1W0VA

Crystal structure of hla-b*2705 complexed with the self-peptide tis from egf-response factor 1
Total Genus 76
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
76
sequence length
276
structure length
276
Chain Sequence
GSHSMRYFHTSVSRPGRGEPRFITVGYVDDTLFVRFDSDAASPREEPRAPWIEQEGPEYWDRETQICKAKAQTDREDLRTLLRYYNQSEAGSHTLQNMYGCDVGPDGRLLRGYHQDAYDGKDYIALNEDLSSWTAADTAAQITQRKWEAARVAEQLRAYLEGECVEWLRRYLENGKETLQRADPPKTHVTHHPISDHEATLRCWALGFYPAEITLTWQRDGEDQTQDTELVETRPAGDRTFQKWAAVVVPSGEEQRYTCHVQHEGLPKPLTLRWEP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system
molecule keywords HLA CLASS I HISTOCOMPATIBILITY ANTIGEN
publication title Thermodynamic and Structural Equivalence of Two Hla-B27 Subtypes Complexed with a Self-Peptide
pubmed doi rcsb
source organism Homo sapiens
total genus 76
structure length 276
sequence length 276
ec nomenclature
pdb deposition date 2004-06-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00129 MHC_I Class I Histocompatibility antigen, domains alpha 1 and 2
A PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1w0vA02
3.30.500.10 Alpha Beta 2-Layer Sandwich Murine Class I Major Histocompatibility Complex, H2-DB; Chain A, domain 1 MHC class I-like antigen recognition-like 1w0vA01
4U1IA 2VDKH 1Y6KR 1LILA 4XGZA 1Z9SA 2EE6A 5T5NG 3BSZL 2QQNL 4XCNB 4QY8A 4AEHL 1I7ZB 2GFBA 3ET9F 5GSRB 4G9FD 3BEVA 5DMKB 2JJWA 4U6VL 4E41A 3HZKB 3P11L 2YPVL 3NABL 1MHHA 1CD1B 4CNIB 3SPVB 3NIGE 4I2XE 5BS0A 1A9EB 3GBLA 4PG2C 3QIBD 5J9PA 2OXGA 1A0QH 1MLBA 3ZKXB 1QRNB 2EDLA 2VO5A 4XPTL 3TO4C 1LO4L 3CMOH 4P23D 3CAFA 4K94L 4LEOB 3VFSA 1B2WH 1V7ML 5HHOA 1XGPB 3WFHB 2NX5B 4WHYH 1QBML 2HLFC 1V3KA 3FT2A 5DI8B 1DQMH 1BD2A 5BO1L 4LSPL 3MA9H 3L5JA 2B1HH 1TJHH 3EIFA 3NCEB 3L3GA 1D9KB 5J7CC 4M02A 1I1AC 5CLWA 3MR9A 4M7ZB 1LNUA 3C9NA 4NQDD 3KPNB 1PDKA 4YK4C 4GXUN 1UYWH 4HX1A 5DMGD 3GMRB 4U1MB 1DQLL 2Q6WA 2XXMB 4M6OH 3SJVB 2VXTL 1UKSA 4PBXA 1R3KA 1QFOA 4HV8A 2NYYD 4XCYB 4IDJL 5JW4N 4ZFFA 4F7MB 1ES0B 3MRCB 2EYTA 2A77L 4ZUTA 5IMOA 5HHME 4M4PA 1GGIH 4MQSB 3ISWA 3FOLB 2CIKB 5D1ZB 5SWZD 3T77B 1OAYL 2IAMA 5I1JH 5EOQH 1Q9WB 4A6YH 4PUBH 3FFCB 1KXQE 2I5YH 5D71L 2F54A 4QWWC 2IG2H 1GJIA 4N0UB 3GUTB 5JDSA 3EO1B 3O2WL 3F8UB 4YHNB 5GGUA 3WJLC 3BP6B 4U0QB 3U2SA 4JKMA 4CL7A 1CLYL 2BX5A 3K80A 3MROA 2YA1A 5GISH 1AFVH 4QHNA 4LHJB 4WO4D 1QACA 3UJTL 4PLKD 3H9SD 1NPUA 5E9DB 4U31A 5EBLA 5DEFA 3ULUL 1KEMH 3L7FA 1F6AA 3UZVB 4KJYB 1F8TL 2OTWA 1LP9E 4JY6A 4OFIA 3ARFB 5DURD 1ZGLA 1QFWH 4JREC 4S11A 5A2KH 2XKUA 1HWGB 1A7NL 4GBXC 3V0WL 1NFIB 5DZLA 3VXOA 1U3YA 4L5FH 2VUYA 4U7SA 1T5WB 4B7LA 4EUPH 3AY4C 5JHDB 5MHSE 2Y7QB 4ORGB 5F9JA 5HGHB 1I1YA 1N3NB 4JFDB 4FQ2L 1I8KB 4ACPA 2V5MA 4IOIB 5EBWA 1YEHL 5EFIA 5MENB 1VACA 43CAB 1OAZH 4HWBA 5D1XD 1S7VB 2E9BA 2DLGA 5IVZA 3IFOB 4LASH 1MCPL 2WBJD 3WDIA 4WGVB 1T4KB 2Y07H 2YR3A 2G75B 4JZJA 2QL1A 2YN5A 3QAZC 2FJFB 3EYUL 4J4PC 4ZO7A 4Y16D 1PSKH 4RZCB 1UXWB 2A74B 5MEPB 2K7PA 2HA1A 3ILQD 5FGCB 5T5NF 5L6YL 4XNMB 5J6HA 4PRIA 4H8WC 2NW2A 2Q7YA 2Z9TA 3QUZD 3ARUA 3TH3T 5IVNA 2R15A 3SO5A 3S4SA 4YBQC 1H15A 3C2SA 4Y19E 3VXMA 3WHE1 2X09A 1RZJH 4PRDB 2QQLL 1FDLH 1Q1JH 4P2RA 3OJVC 2YBRA 3TO4B 4JDTH 1FFOA 3VXPB 1TFHA 5DD0H 4UDTA 4IJ3C 1JJUA 3O4LE 2XZCL 3QEQD 3C8DA 1I9IL 3MTRA 4GAFB 1A5FL 3RNKA 5DJCA 3EOAA 3VFGL 2BSSA 1FFQA 5C0GB 3UBXB 1QUNA 1C1EH 1U8MB 4ODHL 5DO2C 3VJ6B 2HFEA 3K46A 4TUJA 3TJEH 4Z95H 3SE9L 1CL7I 1U58A 1MCSA 3VMOA 4TPRL 1I1AB 1J0YA 4OI9A 4RRPA 2BCKA 1S9WB 5FYLD 1OW0A 3VMPA 5FGBC 1MCOL 4Q9BA 4X7TB 3RGHA 3T2OA 3QDJE 5E8NA 3HCVA 4HH8A 4JFOA 1CFQA 1ITBB 2SEBB 1RI8A 3IU4L 3HMXA 5KOMC 3VFVA 1AO7E 1G9ML 2VH5H 3FQTB 3D9AH 3LRHA 5JXED 1RZFH 2V2WB 3V52L 3U4BL 4QTIL 4K3EL 1F97A 3NFSL 3I3BA 1BFVL 1JWUB 4GXUM 5EH1A 2J4WH 2JJUA 1TMCB 3EYSH 1OAKH 4H1LG 1EXUB 3ULVC 1DL7L 5MI0C 1ZWIB 1Y18B 3U6RA 4LDLB 4X4XB 3MLXL 4FQCL 4V3EB 2DMBA 1G0YR 3WFZA 5T1MA 4R26H 5AAMA 4V2CB 5HPMA 2BOCA 2ZSVB 2AV7A 3FOMB 2C7UB 5LJYH 5BRZE 3QPQD 5J1SC 5IT2L 4JB9H 2PNDA 4G8FA 2BVOA 1J5OH 4KKBD 3HAEG 3N85L 2JTDA 4XNYL 4BH7B 1K8IA 1N0LA 1II4E 4JHAL 1CS6A 4NGHH 3LEYH 1C12B 4YJZL 1DLHA 3SDYH 3T65A 4M5ZL 3EOBB 5DEZA 3PWPD 1Q0YH 4UNUA 3RIAK 2GUOA 3QFJA 4V1DB 2VISB 2C1PB 2VXVH 5C0DA 1G1CA 3WKNA 5FKAA 4OZHB 1XH3B 4HKZA 2DB8A 4RAVB 4YHOH 4GBXB 4MS8D 5ICYA 1JTPA 4F7EB 3QXWA 2AI0H 2R9HD 4YUEH 4X4MA 4KRPD 5KTEH 2DLHA 2ARJB 1QQDA 2DI9A 5DDHB 3VA6A 3O45A 4PRHD 1P4LB 4KUCD 1RHHA 5D4QA 2AXFA 2H2SD 1N4XH 5J3HD 3TNMB 1GSMA 1OP5H 3NPSC 4CU8A 3E8UH 4D9RD 3V6FA 3UJJH 1FSKC 5T3XL 2VLKE 4N0YH 4N0CD 5E4EC 2MMXA 4PGCA 1MCFA 1QSEA 3MLSL 1OPGH 2BDNH 4OT1L 4HKJA 2UZYB 3QAZB 5ISZE 5KW9L 1KB5B 3LN4A 3O9WD 5F96H 5C0CB 3VD3A 1KEGH 1RPQA 5TE4H 4ZSOA 4OGYH 1WIPA 2R1WA 5EZLB 4LVEA 3BD4A 5D7SH 3T0XA 2OX5A 1B3JA 1OD7A 4XP1L 3UTSD 4D8PA 1DE4B 2C3HA 5DJ6B 1QSFA 4JRXB 5HY9B 4GW4B 4E42A 4ODWB 3SQOL 1X4YA 4CVZA 3LQAL 4WFFE 4G8GE 4YZFE 3IFNL 4PJ5A 2YSSB 4NO2A 1AKJA 3GKWL 1CCZA 2IPKA 4JLRA 5HSFA 1U3HA 4X6CA 3CFIC 5JIKA 5C0BE 4Z7VA 1T2XA 4M7LL 4BFEA 3PGFH 4LPXA 1SJHA 3AS0A 3ARGC 4QGYA 5FA4B 1T1WA 2NLJA 2UV3A 2NTFA 4PJCB 1OGAD 3TWCL 4UAOC 4DWHA 4JQIL 1ONQB 3QUMA 3C08H 2W9DH 4FXKA 4GRLB 7CGTA 2OTUA 3D39D 3EJJX 1E4XI 4MX7B 3F6IA 2DTML 3V0VA 3AROA 4NFDA 4NKDA 4L8DA 1I7TA 3IRPX 4K8RH 2Z8VC 3RWDB 2Y06L 1KACB 5TE6L 1JN6A 1IM3A 1Q8MA 2YUWA 1UWGL 3G5ZA 3FL7A 4PJ8C 5MI0B 4L9DA 2AEQL 4QEGA 1KN2H 1JNLL 1LGVA 4N8CL 4N9GB 4WCYH 3RWCA 3ETBF 2LU7A 5D5MA 2A9MH 2E9JA 1E28B 1U8JA 3K1DA 5EU7C 1IQWH 2IGFL 1TQCC 3FB6B 3RPIA 1JHTA 4JFYA 1R5IB 1JNHA 3ZKNC 4LLUB 3UTPE 1IKFH 1MJ8L 1JRHI 2Y9RT 3BH9B 5D7LA 5KOVC 1RUPH 2FBOJ 3E6FA 1BX2A 2MHAB 3NVQA 5I8OH 3V4VL 4BZYA 4MZ2A 1FNAA 1KN4L 4C57C 5SWSD 2OR7A 4IIQA 3TT1H 1CDGA 5CZXC 4NQSB 3BXNB 1NDGB 4DTGH 3WIHH 2VLMD 1CG9A 1AGEB 1T0NA 3EW3B 4GAJL 1WAAE 1U95B 1FJ1A 3W9DA 3LMJL 4AZ8A 4OCSL 4JHBA 3WIIH 2GJJA 2ZOLB 2IQAA 4QRPE 5AUMA 4CRPA 3WYRA 1ZHBB 1CT8B 3T4YA 1WICA 5FKPA 1PGRB 4ZFZB 3NPSB 3UAJC 2FHBA 2X7LA 4KMTH 1MAKA 3CSBA 4L9LA 3CLFL 1FSKB 1BGXL 3LS5H 4I5BB 5E4EB 4HPYH 4DVRL 3R06B 4MJIE 3GHBL 4U2ZA 2O5ZH 1QRNE 1WBYA 3BQUD 5HHMD 5B3NA 2CDEA 5E2WH 4B0MM 3RI5F 4PV9B 3TA3A 5IROA 4LCWD 2OI9C 2Z31D 2XNAB 4L8SC 5E6IC 5KZCD 4J1UB 2F5AL 2YD9A 2NX5E 1WEJH 3PHOA 4PGEB 3VXUD 4JFFB 2VLJD 2Q3AA 2Y5TA 2YC1A 3EJYD 3VXNB 4KZEL 2XOTA 5EO9A 2I9TA 5B3JE 3KNBB 3P4MA 2CUMA 5JOFB 3T0EA 1ZEAH 1IGCH 3KJ4C 4M8QA 2W0LA 1PX3A 4YXHL 4M00A 1LWRA 4CADA 1DBKL 3DTXB 3QXDB 3NTCH 5HHXH 2R29L 3CU1A 3EYVA 1HHHB 3RTQD 4LQFH 3AXLB 1YN6B 2CQVA 3SJVE 3TO2B 1GOGA 5FOJA 4Y1AA 3EJZC 4ZS6D 5GGRA 4JKPL 5ACMA 3IDNB 4IRJC 3SHSA 1S7SB 3LHPL 1MI5B 3ARGB 2XFXB 3O8XA 2YPKB 1YMHB 4NQTA 4UAOB 5ELIA 4HKBB 5IMMB 4NM8L 1I4FB 5LQBH 3X13B 3GMNB 1BJ8A 4K55A 4KAQH 5F1OB 3FFCE 2A9NL 4WFEE 3BH8A 4X6DB 1SBSH 3NFNB 5INDB 2K9UA 4O2EB 1NBVL 4N0UE 1ORQA 2A0LD 2X1PA 5MHSD 3ARXA 2OMBA 3TFKA 4FRWA 1N59A 1FZJA 2B2XL 4Q0XH 3WUWB 4CMHC 5BVPL 2FNBA 3ZTJG 4WGWB 4XT1C 1ZSDB 3QPXL 4PJ8B 1RZKC 2EDBA 5IQ9A 1TNMA 4JRYA 2VDNH 1NAML 5IB1B 1J05B 4NFCA 1XIWD 5BOZG 4XVSH 4I3GA 4G6AC 4HIJB 4DAGH 5B38G 1DEEB 3P9MA 3WE6A 4GRWE 1TQCB 4YO0B 1JMXA 4G9DA 2XYCA 3MBXH 3HUJF 3I6GA 3U7YL 1TQBC 3ARDC 4Y5VA 5GGTH 5ANME 1G7JA 3U4EA 4K7PL 4MSWA 1H8OA 3I6KB 5KVGH 3VI4E 2FRGP 5IBLD 2NZIA 4XI5C 3PV6A 3QDGB 2HJLA 3JV6A 4BUGA 3QCVH 3PWJA 4TSCH 1XF3A 5I18H 3PHQB 1N0XH 4PJEB 5JHDE 1RUAL 3V6ZB 4MXQA 1WC7A 4OZFA 5T3ZH 1HNGA 3U7AA 3P4OB 3EZ8A 1DDHA 1S7QA 2DD8H 5IVXA 5L2KB 4YDLC 4MVBC 4JFDE 4NCC1 2G9HA 3I9GL 3WS3B 5ALCH 5MENE 4MB4A 4GXVH 1BIIA 1NCCH 3OF6D 5CZVH 3RNQA 2I9LB 3OPZH 1KB5H 4TNWK 4Y4FB 5EOCH 3QWRD 3OSKA 2HG5B 3RGVA 4H8WH 2IJ0C 3L3JB 4XXDA 4TNVK 1F4YL 5DRWA 1AC6A 3FTGB 2XQYK 2AVGA 3HC4L 5DS8A 5K59E 3QDJD 3S5LB 3WD5L 5FGCE 4G43B 2VITA 1W8NA 1MFCL 2DLTA 4P2QE 1YY8A 1JPGB 1ZXQA 5JZ7C 5KSBA 4BZ2L 1ZVSA 2APWA 4JN2B 3D0LA 2OI9B 1RIVL 4UV7H 3QUYC 5E6IB 3VWJC 3GJFB 1PEWA 3VXTA 5JW4R 3PIQB 2R2BA 4ELMA 4LSDA 2XPGB 1S8DB 1DVFD 4RMUA 4NKQB 2ZCHH 2JELL 5IQ7H 2H26A 3WIFA 4MD0A 3ALWA 2AJSL 3KJ4B 5C0ND 2C1OA 3RZCD 4MDIB 1SHMA 4YAQB 2DYPD 5CFHA 1J86A 1K4DB 2Q76B 3QHFH 4NHUB 3E2HA 2VXUH 3MLUL 3UTTB 3KS0J 1K4CB 4XMLL 3VCLB 1HKLH 4P2OB 4NOBA 1XR8A 3HRZB 4G8EB 4U6XA 4GAYB 3ARRA 4F9PA 1KGCD 3MGOB 1DP0A 3FQRA 1TJIH 5KVDH 3SY0B 3ULVH 2EC9U 4H25B 3FMGH 1UCBL 2X05A 1D5ZB 1EUUA 1ZLSH 3WXVH 2O93L 3MLVH 3NIDF 1FGVH 2IEPA 3O2VH 2OZ4A 4DK3A 2D2OA 4OLUH 4N5UA 2IF7A 4Z7UA 3BKYH 3H3KA 2J8OA 1BFSA 5E2UH 3BP5B 3MUGA 4ERSL 4CGTA 3U0WL 1YYLH 4CMHB 1FL6B 4JDZA 3WFBL 4BQBA 3ZHLA 5CSBA 2W0FA 2Q87A 5FK9A 4QRQB 4FQQA 2Q1EA 5DGQA 2VLKD 3QNXA 2NNAB 3SCMD 1IAII 1INDL 3WS6A 25C8L 1F11B 1Q0XH 1U91B 5IF0B 5FM5M 1Z6JT 4X9HA 1TQBB 3ARDB 1NSNL 4V1DE 1EBPA 5L7XH 1NGXB 1UQSA 4IMLA 1IAOB 1KBGL 4F7TB 2GIYA 1N2RB 3KPQB 4MA8H 3T09A 5GS1A 4H20H 5I1GL 1V8HA 1R3JB 4L1HA 1A7OL 1KTRL 1ADQH 2EDFA 32C2B 3VD7A 4LIQL 4IS6B 1ZA3B 4YBHA 4AIOA 1ZS8B 4WFFD 4G8GD 4HWBL 4XZUA 3QCUL 2G60H 2JCCF 4YDLB 1XGYH 2PXYA 4X7SH 4WWKC 3LV3A 2DQTL 5E94B 3S96A 3MRLA 3PWVB 2WINB 4Y4KA 5T3ZE 3X14A 3MRKA 2CXGA 4HFWB 4PJAF 3E6HB 2DLFL 3VRJA 2HT2D 3DX9B 1Q94B 4NPYA 5JNYB 5EORL 2GYSA 2EE9A 1A6VL 3IJHA 4YNYA 1JGUH 3MLWL 4WRLA 1N5YH 1GIGH 3MRHB 3S3SA 2BSRB 4D9QD 1AGFA 1GYAA 4BM7A 3JWDC 3BGMB 3STZB 4I18C 4ZO8A 1RU9L 1FPTL 3QO1A 1M1SA 4JJ5A 2BVPA 1EEYA 5I66A 1MIML 4N0RA 1R5VA 4Y5XC 3JTCA 1LK2A 3MO1A 2I60H 1OSPH 5I1KL 4XX1G 5IBTL 4X83A 3QUYB 3PWUB 3VWJB 1P69B 1ULVA 1BZ7B 3C5ZD 1CTOA 3DHMA 2FD6H 3MRRA 4IHOB 4GKZA 1TTGA 3C6LA 1FZOB 4MJ5A 4WUKH 4PJXB 3F7QA 3RAJL 3JZ7A 2CDFA 1TIUA 2ZKHH 1KCRH 3BPNB 4WW1B 3BGAA 1GZQB 3WNNA 2HT4C 4LF3A 5TDNB 1C5CL 2X4OA 1RIHL 3BZFA 2LV4A 4WJ5B 3O6LH 4PJCE 3GSQA 3OG4B 3HMXL 1ZHLB 3PABA 1OCWL 3CFCH 3RVTD 1CL7H 5IB4B 1NFDF 3RWFA 5IOPB 4PV8B 4Q7DA 1HWHB 1JGEB 1PZ5B 3IETA 3GSWB 1KPVA 2B1AL 2IADB 3DX8B 4JFEB 2MOVA 3TYFA 5I8CB 1AXSB 5JXAL 1GGTA 4RFEB 2DICA 3V95A 5D9SA 1JPTH 3MNVB 1KIQB 1IGTA 4HCRH 3B9KC 4RA3A 4D0BA 3ULVE 5ICZB 3I2CH 4JEGB 3W39B 3JWOH 2VXQH 3ARVA 1WIOA 3L9RB 4HLJA 3IDMA 1CXKA 2DQCL 1J87A 2AJYL 2GY5A 1HSAA 1NC2B 1VEPA 4QHMB 5IKCA 4OQTA 1P2CA 4M6ML 3H9HB 2QQNH 3TBSB 4AEHH 3CFJA 1BPVA 1A7BA 4JPKL 3X3FL 1DJSA 3WDJA 1A47A 3QZWA 4BKLA 1M7DB 1S7UA 1MH5A 4JJHA 2YPVH 1EAPA 1G7HA 1I3UA 3CXHJ 5F72S 5FEBA 2GK0B 2AK4B 2DL9A 2N7BA 4I77H 4O9HH 3FQWA 4P46C 2UUDK 1QVOB 3VD4A 3BT2L 5I1LA 4G7YH 3QFDB 3N1QC 2NX5D 5K9KA 2X9WA 2CO7B 4KI5D 3O6FA 2FIKA 2OSLA 4HZLA 3B9VA 4IBLT 5ALBL 4AIZB 1YDPB 2YWZA 1HOCA 4XPTH 3V7AE 1OAUL 3I85A 5DR5L 3MCKB 4YIQB 1E27B 1GXEA 4K94H 1H0DB 1V7MH 4JY5L 5JMRA 2XWTB 4X9GA 3S37L 2IANB 3S88H 3LKPB 1SEQH 4LSPH 3GHEL 2PTTB 5LCVL 4F9LC 4WWKB 4UTAL 4QRRA 1E4WL 2F58H 3IDUA 3SJVD 3GIVA 4QXUL 4NKOA 4OCWL 4XWGL 5CEZE 3D25A 3WL9A 3MV9B 3A6CL 5DHYB 5D7JA 4H5SA 4RMWA 3QSKB 5C0IA 5C07D 2BNQA 3GJFH 5I8EA 3ZE0F 4MNQA 2D4DA 5D1ZD 1XCTA 3QXAB 5DJZB 1YEDB 1HKFA 1F90H 2LAAA 4KJPD 2KH2B 4OUUA 3MRJB 1JGVL 3ILPA 4X7EC 4XPFH 4IDJH 4I18B 3FFCD 3C60C 4JFFE 2E7LA 1S9VB 4NC0B 2J8UF 3F7RA 5CJQL 4RNRA 1F2QA 4ZODA 4Y5XB 4N5EC 1E4KC 4NJAH 4GAGL 1DQDH 4GQPH 1MUJB 4DVBB 5EO0B 4K8RD 1T5XA 3W0WB 3V7MA 3PWNA 1LEGA 4YQXL 3RUGE 5D71H 5DZOA 5D96C 5CP3H 2GJZB 4PIRF 5F89A 4WY7H 5E9DD 3IJYA 3GBNH 1LVEA 4PJIA 4YXKL 4UT6H 2GT9A 4FTVE 4B5EA 4XAKD 5IK3B 1KLGA 3QUML 1MI5E 1TVHA 2BMKB 2PYEA 3UJTH 5EZIL 5TF0A 1OGTB 1G1YA 3ARFD 4X0KA 3L3DB 5E24E 3Q3GA 2DWDB 4ODTH 1S7RA 2VDLL 4JVPA 4X6DE 3IAQA 3LKSA 3V5DB 4GKNB 5ICXB 3TZVC 3TJHA 1XF5A 2CRMA 1RZKH 3GSRA 2A83A 3WEXB 1JPFB 3GI9H 1HI6A 4OLYH 4YC2C 4PB9H 4GRMB 1PLGL 1E4XH 4NNPL 3B9KB 4WFHD 3ARSA 3V0WH 4NRZB 5MEND 1EEZA 1Z9OA 4F7CB 1I3RA 3HE7A 3A0OA 5L2JB 2I24N 4ORZC 4KV5F 2G5BA 2X5PA 4R0LA 3EFFB 4NHCH 4OKVA 1Z3GH 5EU4A 4F7PA 1R5WB 3RHWF 1OOAA 1NMCB 1HZHL 2E8YA 1RY7B 3T2QA 5EU7E 1DZBA 1XZ0B 3D69A 1NC4B 2ZUYA 5H8DA 5BW7C 1VHPA 3TJHC 4R96A 4HLZH 1CR9L 3Q5YA 4PRNB 1IEBB 4HGWB 3RIFK 5C8JA 4XVTL 2GTWB 3SKJL 2FWOB 2R8SL 2PR4L 2YD8A 3QISA 3VRLF 5I15L 3JV4B 4M43L 3SE4A 5IB2A 3QDGE 2W60B 1X5ZA 4UNVA 5HYQB 4P46B 3TO4D 5T33H 4ZUSA 2XN9B 5L6YH 4PJEE 4R0LC 2AJVL 5ITFA 1CFVL 5FDYA 1UM4L 1HDMB 1IL1B 1JWMB 1U92A 2HLFD 2YMXL 3GO1L 4HK3J 3SE3C 4OV5A 4Z7NF 3D0VB 4MJ6A 4N1CA 3QDAA 4Z78A 1AD0A 5D6DC 2Z92A 1IC1A 2NQCA 3BE1L 4PJ7F 2APTA 2D7MA 4EVNB 3DUUA 4NKIL 2BSED 2ZG2A 8CGTA 4WU5B 2VJXA 3MXWH 4KDTA 1NJ9B 3GZKA 1HEZB 3QIUB 2P5EB 1NUFA 3FB5B 1U93B 3MLPA 1MWAB 3I84A 1F4AA 1FRGL 3KWWB 4CJ0A 2YWYA 4OD2A 2V2XA 3Q6GL 3TPUA 2WANA 2J6EH 4O2FB 2RFXB 3T3PF 3LIZH 5DEGA 3MRNB 4JPWH 5BJTA 4KTEL 2X4TB 1FVCA 4Z7QF 1UXSB 3IU4H 3HS0B 3AUVA 3G5VB 3C60B 4YXLH 1G9MH 4AL8L 1F4XL 4QWWD 3F7VA 3CZFB 4QTIH 1KLUB 3A67L 3V6OE 2APVA 4NNXB 3QXUA 1NKRA 2PW1B 3VDBA 1S9YA 5HVWA 3QUKB 2FL5A 1NLDL 4WENB 1N6QH 4TSBH 2NMSA 3WNLA 1DL7H 1MPAH 1XF1A 2H41A 5J4MA 1FN4A 1KB9K 4NHUE 4Z9KB 2EECA 3MLXH 5D96B 2HFFB 1DEDA 3B3IB 3VG9B 3UTTE 2APBA 1YNLL 1BQLL 2BNRA 1MLCB 3QYCA 3MNWA 3OAUL 2H8PB 2LFGA 3QRGH 1AHWA 1HHGB 3OX8B 2VB5A 2XV6B 3BWUC 4ZAKA 1ZLUK 5IT2H 3RVVC 4U7MA 4C58B 5F7HA 1GAFH 2JJVA 4KMQA 5C0EB 3MODH 4YPJA 4EI5A 2AK1L 4KGJA 4ZQKB 2C3WA 1R3HB 2FEEL 4LEXH 1NAMB 5DUBA 4GBXD 5AZ2L 3QWOA 4E0RA 1SVZA 1DBAL 4LLWA 3OG6B 1RURH 3QEHB 3TZVB 1JZ3A 2ADIA 4G6FB 2KZ1B 2ZSWA 1KCSH 4YC2B 4U1SB 1KPUB 3MRDB 3HG1B 1MCEA 3MNZA 4UIMB 4TVPL 2A2QT 2W65B 1VB9A 2BY1A 4Q2ZA 4QHKI 5BCAA 5T3ZD 1CWVA 4YFDB 3VXSB 1YPZA 3QXTA 4EI5C 3ROLB 5MEOA 4HMCA 4HGMA 4W6YB 4J4PD 5C0CD 4JO2H 1NGPH 4NRYB 4UQ2A 5IB3A 3L95B 3Q0HA 2NY7L 1X5AA 3HPJB 3ES6B 4XC1H 4EI6A 1SYVA 5T3XH 2XKNB 3BIBX 1FG2B 1I75A 3TT3H 4DZBA 5EUOA 3G04A 1ZTXL 4WHYG 4JRXD 4ZPVA 1VADA 2CK0L 1M4KA 5D8JH 3CSYA 1Q9OB 1YA5A 2ED9A 4LHUA 4R90L 4LU5L 5F3HB 1FL5B 3ZE1F 1K8DB 3KYOB 1WV7T 5ACLA 5C0AB 3TBWA 3W9EB 4M6NH 3BKJH 5E5MB 1B9ZA 1LEKB 1I8LC 1GPOL 2EDOA 5DO2D 1UWEL 1I7RA 1J0KA 4FG6C 4G6JL 5FUOH 3TIEA 1P7QA 3HMWL 3DUSA 2E7MA 4MCYB 1P5VA 2LU4A 1FO0L 4TQEH 3WHE0 1ZK9A 4AH2B 2ZUSA 4DFHA 1HN1A 5AZEL 1KNOB 3RJDA 2V5SA 3LPFA 4XBEL 1OF2B 5BV7C 4GUPA 4FQIH 1RFDH 4RISL 2V6HA 3MZGB 4UB0L 2CPCA 5GS2D 3MV11 4DKFL 2H2PC 2ATKA 2CJUL 3EYFA 5FF6B 5JO5A 4OAWA 4B50A 2BVQA 2IALA 3SN6N 4HIHA 3N50A 3C8KB 3UEZA 2FHCA 1TDQA 2YPLB 2Q6WB 3HLAA 4I0PA 2F5BH 4YHZH 4OLZH 4LLQA 1R3IL 3MRIA 4XTRC 2VN4A 3U46B 1YMMA 4ODXA 3ULVD 4C56B 2EXWC 4GSDH 3BDYL 4PJXE 4ZUTB 4G8IA 1H3PL 2Y06H 1NGQL 3O3BA 1P7KB 1CE1L 2PF6A 1JV5B 3QR2A 3KPOA 1HCFX 4LMQI 2XQBH 3FQUA 4KKLC 2AEQH 2HKHL 4N8CH 3OKEA 5LAXA 4O2CA 5E03A 4MDJB 5C09B 3HE6A 4GJTB 4NZDA 2VQ1A 1EDQA 4P59H 4G6KL 4MB5A 4JM2A 5B4MC 1FIEA 3MBEA 4EDWH 1MAJA 2E3VA 4NT6A 2HFTA 5DUPH 5L88H 3BPLC 2OZ4L 5C70A 5FO8B 4HJJH 2YD4A 3PP3K 3O41B 4HUVA 1RK0A 2UWEE 4GH7B 1AP2A 3QH3A 4FMKA 2X4RB 4MWFB 4ZPTA 1YEFH 5B8CA 1ETZB 3V8CA 3V4VH 4MQ7B 3JBG7 4M6AA 4NKMB 4QHLB 4NNYA 5IM7B 1QLRB 1A64A 4LVOC 5DMIH 4Z76B 4LAJH 3OKOB 2VAAB 4CN6A 5C9KA 1X6NA 2NPLX 3OKNB 3TBVB 3NCJL 1CTNA 1CN4A 3LS4H 4PY7B 9CGTA 5FXCH 1NKOA 1GGBL 2NY0C 2ZJSL 5B8CC 3VD5A 3LH2H 2AK4E 5CGMA 4TVSa 4W68A 1AH1A 4UV4L 3MRGB 1T0PB 3CLFH 3BPOC 1BGXH 4H1LB 5DSCA 3WMSA 4M1CC 1IKNC 4L3EA 3CUPA 3B2UC 1IAIH 4RWYL 5LKNA 2EEBA 3GHBH 4G7VH 4W4NA 3T1FA 5T3XE 5C0JA 4U6YA 4HC1A 4BSWA 3F5WA 4ZXBA 2PW2A 3FO2A 1HHJB 1AXTH 3HHRB 3JTTA 1ND0A 4DEPC 3OJDB 1RIUH 2WIMA 2XKSA 2FJHA 1J11A 2IANE 1P1ZA 2BRQA 1MWAH 4OB5H 4HT1H 3X12B 2YOCA 1RJYB 4BUHA 5IHLB 4KZEH 3HAEB 3VXMB 4K7FB 1Z0MA 1XGTB 1BHGA 1UZ8B 3ZDZE 4ZFOL 4QOKA 4X6BA 1U3ZA 5H35A 2DN7A 1WTGT 3TP4A 3MV9E 1FVDB 2P8LB 2B8OT 4XCFL 3FQNB 2YEZA 4JPIA 3RNKB 3ARGD 1MI5D 2FBJL 4PJFA 4MAYA 2AP2A 3T2NH 3MV7B 1KJVB 4M3JA 3U82B 3MRBB 2V9TA 3BRDA 4HEME 3QI9A 3VFUB 4PRPB 1E4JA 4OD3H 5ETUB 2V17L 3P30H 4PY8J 1IEHA 3TVMC 1XMWA 1K5NA 2GJ6E 4P4KC 2D7OA 4Y4HA 3FO1A 1DLFL 1AGBB 5L8JB 3AS3A 3NACL 5E8NB 1Q38A 1CFNA 3W0WE 3O3AA 4X98A 3UO1L 3V4PL 2A9NH 3HZMB 4PJ8D 5JA8B 1A6TB 2ZG3A 3BKCL 2CR3A 1MJ7L 3NZ8B 4UI2A 4WNQA 1OTTC 4NJ9L 1T22B 1TVBA 5BVPH 4JPVL 5D7IA 3HNVL 2R0WH 2ITCA 5D2NB 2JJSA 5GRUL 1T3FA 4NQXA 3ZKND 1NAMH 2IQ9L 2YZ1A 4QXWA 2Y5EA 4LBEA 5E2TH 5JDJA 2GW5A 1T1ZA 4A2MA 4QF1A 4S10A 3P4LA 3QDGD 3P0GB 2ICEB 1T21A 3U7YH 1TZHA 4S2SA 3BPLB 3H3PL 3MV8A 1XF2B 5CZXD 1LDPH 4K7PH 2EKSB 3KLSA 2YN3A 5L2KD 3V5KB 3RY6A 5AD0A 2H9GA 1JZ5A 1QR1A 4F58H 4OIBA 2C3VA 3O3DA 1K3IA 4LCYB 4YHPB 1HXMB 4ODSL 2ZUTA 4F15B 1RUAH 4OQTL 4GW5B 1C5DB 5D7LD 5H94A 4LVOB 2XIDA 3WUZA 3WHXA 4OLXH 5GSVB 4WWID 3BW9A 5FKAB 3VXQA 1IT9L 3UAJD 5JLZA 2HJKB 3CXDL 3OAZK 5IV2A 5TF1H 3CFKA 1TJGH 1B0GA 2H32A 4MCZB 3PNWA 3WFDH 1LE5A 4F3FA 3FN0L 1DQJB 3FB7A 3RY6C 2ZOKA 3MXVL 1J8KA 4EXPX 2C9AA 3HC4H 2XN9E 4NUGL 2R4RL 3HUJB 4LAQL 3B6SB 2FYYB 4G9FA 4Y88A 1IBGL 5E6ID 3LQZA 2CRIA 3GSOA 4OF8A 3QEUA 3VU2A 5BMFH 3BI9X 3DJ9A 4KHXL 4BZ2H 5A1AA 4JFZH 5SV3A 3NN8B 5FFLA 5GHWH 3FT4A 1MFBH 1J8HE 1RIVH 4DEPB 2DQEH 4JFPA 1F5WA 4OI8A 3QIBA 5DD5L 1EEUA 2VAJA 1HQRA 1DBBH 1JHKL 2NY3C 2QSVA 3O11B 1C08B 1UZ6E 2BZDA 2P5EE 3HZVB 5SV4A 5IFJB 3ZT7A 3I50H 5GRYA 3OKLB 3EJZD 4P23A 3BAEL 3GIZL 4IRJD 4MGXA 4JO3L 4ZNEA 3FAXA 1EGJA 2IPKB 5I2IB 5I1AA 4I0CC 5IHZB 3RVUC 1CLZH 5DVLA 1JYNA 1NUDA 3TVMB 1U8PB 4NC1C 5TH2A 2UZXB 2VERN 1WZ1L 4P4KB 3SDDC 3UZQA 1N8ZA 5A2JH 4JR9H 3AU1A 4HF5L 4XCCL 1UCBH 1BVLB 2P8MB 3UROR 4RMVA 3S36X 3SKOB 1V5JA 1FL3A 2Y23A 3GGWA 4PBVC 2HLAB 2NW3A 5E00B 4ZO6A 1S5HB 3G6DL 3LAFA 5JPNA 1I7TB 1U8QA 3SKNB 5FB8B 1L0YA 1YN7A 5HHVL 3DMMA 4G6AD 3REWA 1WWAX 5CP7B 3LN5A 1ZT1A 2ADGA 2BFVL 4ERSH 5CBEB 4X5WB 4PP2B 4RAUA 2A73B 1CFTB 3RI5K 3IKCA 3ECBA 2AXHA 3ARDD 4OF0A 5FECA 5FM8A 5GJTH 4G3YH 3VE0A 1YEEH 4BK4A 1MFAL 5JUEL 25C8H 3CDCA 2P5WA 2F8VA 1LO0L 1RUKH 1U6AH 2FSEA 3BUYA 3GRWL 4XI5D 4Z7WA 3L6FB 4JRYD 5T1KD 5DWUH 4KKCC 4RGNC 3DMMC 3RWHB 4WO4A 1MRFL 3PXJA 1MFNA 3GSNB 3H9SA 3GSUA 1P6AB 1WAAF 5E4IA 1TNNA 5DRNB 4D9LL 4MVBD 5HYSG 5HI5C 7FABL 5ACZA 4CMMB 1VGKA 3FHAA 4LPWA 4LKCB 2NXZC 4CW1B 1BQHG 4R8WH 3TIDA 4H1LH 4HWBH 2QSCH 3QCUH 3CC5A 2IH1A 3DX6B 5I8KL 3MFFB 1IC5L 3VFPA 1QFWM 3EYOB 1S7TB 4WIQA 2DQTH 2Q7NA 3DV6B 4HS8H 1JFMA 2OTPA 3FJTA 4LRNH 3VGGA 3BX7C 5F1NB 4NRXB 2CH8A 4UT9H 1S9XA 3NIFF 4NQED 1JZ2A 5K9OA 5JZ7D 1B4JH 3BZ4B 1QA9A 5EORH 4BSVA 5LWYH 3G5YB 4TRPL 2W0PA 1VEMA 3HAEH 5FO7A 1ZLWK 5D1XA 3QUYD 3VWJD 2WBJA 4ZTPH 4QRTB 4PR5A 5HYIA 3O2DA 4NWTL 3MJ8B 4GG8B 1MY5A 5B38B 3SKMA 5AWNH 4HS6A 1MREH 2VLRB 5I73C 5M95B 4Y16A 4HUWA 5GRZA 4TUOA 5I1KH 5C92A 5IBTH 2L4OA 4N8VA 3MCLL 1FNLA 1SY6A 1YNKL 5HJ3A 1NLBL 2NY3B 2YC1B 1BD2E 2JCCB 3RAJH 3FHQA 5EN2B 4WV1A 1M6OB 1TZIA 3BZEB 5DFVC 4N0FA 1UACH 2Z8SA 3G6JA 1U8LA 1J1OL 4JDVA 3QEQA 1ACYL 4BZ1H 3VGFA 4PJAB 3N1GC 4I48A 5DA0B 5EOCJ 1GOHA 4JFED 1T66C 1HCVA 3HMXH 5IHUL 1MY7A 5BQ7A 2BRRL 4ZUWB 4TTDC 1BREA 4I3RH 1AY1L 1OCWH 4DOHB 3BN9C 2ZCKL 4XPGH 3ARBC 1A1OB 4TUKL 5GZNC 1J0ZA 3BVNA 3H7BA 4HUXA 4C56E 1TTUA 1J9CT 1RK1A 3SDDB 4ZMAT 1I85C 5JXAH 5SX4I 3EO0A 3PXHA 4HIEB 4HPOL 4G80A 3ROOB 1L7TH 3O6ML 4QXTB 1R24A 4L4JA 2EH8L 5DVMA 4J3OC 5D2LF 1EZVX 4YR6B 1NC2D 4KQ4L 4LSQL 2OK0L 1BMGA 1HYRC 3FN9A 5IHBA 1G0XA 2V2TA 3KYMA 1OTUC 1WFTA 5JXEA 1JZ7A 4L4VB 2P8PA 1S3KL 4P5MB 4LRIA 5GJSL 1N64H 3OB0H 4K3JL 1Z2KA 3OXSA 1BOGA 1VESA 2V5YA 4R4BB 4X5XB 1E6JL 2BSTA 4GMTH 4GRWF 3K7UA 4M6MH 5IMLB 1D5XA 3FRUA 5DUML 4EOWH 1E6OL 4JPKH 1WQVT 1QOKA 4MQTB 3ULSA 5GGVY 2W9EH 2XTJE 1NFDB 5GRXG 3FCTA 4XH2B 3FN3A 5DQDL 3K2UL 5ENWA 3LZFL 4MA3B 4P9HL 3RA7L 1EZVY 2HP4A 3I6GB 3BKML 4RGNB 5B39A 1UM6L 1X5LA 4PGDA 4UU9B 5KVEH 1JUFA 2IAND 2Z4QB 5FGSA 2OMNA 5ALBH 5IW1A 4OZIF 4RGOL 4WWKD 5ESAA 2FLBT 4JQVA 1FYTB 1EHLL 5DR5H 4J8RB 3DECA 3PWPA 2NXZB 2AABH 1KXVC 4JY5H 1FH5H 3V0AC 2DIJA 3LDBC 4LSRL 4PJDF 1I9RL 1YEGL 2OQJB 3VFMA 3GHEH 4CVXA 5LCVH 4QXGL 5GS0L 4MS8A 2OLDA 1GHFH 1E4WH 3V4UL 5EBMB 1H3GA 4Z77B 4QXUH 1ZANL 1FZKB 1BIIB 3GI8H 1TLKA 2BVYA 4XWGH 5FYJL 1AD9A 3H2WA 4M61B 2GKIA 1OL0A 4PRHA 4AEIH 1IC4L 3T4AA 4PJBF 2V7HA 1FO0B 5F3BB 2CXKA 3GM8A 4UDUA 4D3CH 1VEOA 1PQZB 2WM0A 1T89C 4LCUB 4IOSD 2CRYA 5DD3L 4N0CA 5E08H 2VITB 4HWEL 1MELA 4KC3B 4NO3A 5DC4B 3VXME 5E6YA 2YK1L 4Q9QL 1OP3K 4K9EC 5I73B 5FUCC 3O9WA 3BJLA 3NGBC 4K3HA 2FX8H 1W72B 3AMKA 3D1MC 4H26A 3D0LB 3N9GH 4DQOL 2HT4D 4DN4H 1OTSC 3DIFB 4FQXC 5EPMA 3WNPA 1P4IH 3AB0C 5C6PB 5TGBB 4YQXH 4AG4L 4OM0H 4PYGA 2KDGA 4DKEH 2IFFH 1T7YA 4PG9B 3UTSA 4CU6A 3MV7E 5HPOA 1EO8H 2FHFA 2NZ9C 4LSTL 3ESUF 5K93A 4YH6A 3DUHA 5DRZB 3UTZA 1KV3A 1X5GA 4PRPE 4YXKH 4J3XA 4XRCA 1MHCB 5F88B 5DQ9B 2WIIB 1DSFL 4XPHH 4D0CB 3MACL 1BQUA 1NBZB 1U8IA 2UY7A 1ZAGA 3QXVA 3RWIB 3ARBB 1MVUA 2VDOL 1PG7L 3B9KD 2Z93B 4ISVB 1ERNA 5EC2A 3JTSB 4JANA 4U6XB 3CFDB 2BOBA 2J8UB 4AT6B 1OGAA 3OV6A 3H9YA 1HIML 4M9PA 1FVEA 1KTDA 2F53D 5ADPL 1I7UB 3D39A 3ZTNL 3FKUS 1H5BA 1RUQH 1RULH 1YZZA 4XNUH 5D2NE 1NC4D 4PRBA 5CBAB 2B20A 2YZ8A 4B41A 4NDMA 4XP5L 2FR4A 4L3AA 1YC7A 2H3NB 2J88L 2PTUA 3D18B 5DQJA 1BECA 5DJ8B 4XB7A 3HC0B 1YEIL 3ZL4L 1FAIL 4JHWH 1HZHH 1QR4A 2A6JB 3GSNH 5F6HJ 5A2IH 2EDDA 1FNSL 1KT2A 1K6QH 3C6SA 4P46D 1I9EA 5F6IC 2XN9D 3WKML 1BFOB 5GRVL 1CR9H 3M17A 1G7QB 1NGYB 4KK8C 3ZKSD 4OLWL 4UUJA 3KGRA 1SYSA 4PTTB 5KJRH 2PR4H 2VUOA 1IQDA 4FHBD 4OFYD 4M43H 1EO7A 3TH4T 4RQQA 3TV3L 5IR1A 5MP6L 3KXFB 4DW2L 1KCUH 2EYSB 4MA7H 5IEKA 4WEBL 4UT7L 3BUTA 2YMXH 3IFLL 4HBCH 5DJ2B 4OLVH 2HFGL 5C0RH 4L29A 2P5ED 4BQ6A 3U0TA 2NY6C 1DN0A 3BE1H 5TDOA 3JWNC 3CPLA 5SWSA 3H7LA 1KIPB 1EMTL 3LDBB 4XHJC 3T08A 3ZTJH 3LSOA 4EQ2A 2NY2C 3RWEA 5IEHA 4TYUA 3U0PA 1YYMH 4M5YL 1T1YB 4OD1L 4ALAL 4HC1L 3CCHA 3C60D 4X9BA 5T1DL 1OARL 1QSEE 1QG3A 3NZHH 3DRQB 3VH8A 5IB5A 1X5KA 3IDXL 4ZFOB 3ZMRA 3VRJB 3DRTA 4N5ED 1IGJA 2ADFH 2XZAL 4Z8FL 4YNYB 2VQUA 4KTEH 3BP4B 3I75B 1DUZB 4BFGA 4H0GA 3L3OA 1ZVHA 4AL8H 4WHTB 1F4XH 3CK0L 4JJ5B 4ZDHB 3QB7C 4R4FL 3BQUA 5HHMA 4OSUH 1QSFE 2PYFB 3NGBB 1YY9D 2X4UA 3QDMB 3OKMA 3KPSB 4DGIH 2X9YA 5DYOB 4PJ7B 1CBVH 4LCWA 2Z31A 3QNZA 2EH7L 4FQXB 4F8QA 1OB1A 2LAGB 3VXUA 2CKBA 5GIRB 3T0WA 3K8KA 1AR1D 4OBRA 1K2DA 3C6LB 4PJ5E 3QULA 1FNGA 1KCVL 5C6TL 5J13C 2XTLA 1DUYA 1IGFL 1YNLH 1A1MA 1BQLH 4YHMH 5LXGH 5IG7B 4Z5RB 2EIZA 2DF3A 2CRZA 1T0MB 4KDWA 4J3WA 2FGZA 4LF3B 3NCYS 5DJ0B 1OP9A 1CK0H 3RTQA 3TZVD 1ZHKA 1RJZA 4YGVA 1F3JA 5IESH 3FO9A 5TDPB 2PCPA 4Y5YC 2Q8AL 3VMNA 3HG1D 1WGOA 3QIWC 3EDEA 5AZ2H 3KG5A 2DLEA 3TBYB 1PY4A 4OCNC 5CCKL 1JK8A 3IFPB 1LP9A 3TCXA 4MA1C 5EU5A 3LOWA 3VXSD 2VMFA 1F45A 5EIIB 3MOAL 2CLZA 1IGTB 1P5UA 2X70B 1GCFA 1Y0LB 4P3CL 4D0BB 3TJHD 3WV0A 3JSSA 2CK2A 3VFNB 5DFWH 2VDQL 5DT1H 1M05A 3GMLB 1LD9A 1QBLL 4NN5C 2FX7L 4J3SA 1LK3L 1P2CB 5KSVA 5F6IB 1CGTA 3P73A 5SX5K 5I1HL 5C0AD 2DMCA 1XIWA 4JE4B 2PO6B 1ZHNB 4LMQE 1FFPA 3P9WB 4AM0A 3NIDE 1CQKA 1G7HB 1UH2A 5I16A 5J11C 2H6PB 2D0GA 3IXTA 3WSQH 3N0PB 4WW2F 3W2DH 1PZUB 2R0LL 5ESQA 5JR1L 4MMZC 4DKDC 5I1LB 4LPTA 3VD9A 2XA8L 5E2VL 5JQ6H 4BQ8A 2DQGL 4FZ8L 1MCJA 5J0BA 3SGDI 4JQXA 4GT7A 1UWEH 1CDUA 2BNUA 3HMWH 1VDGA 1HHKB 2YD2A 4WU7B 2MSPA 4XPAL 3LKQB 1FO0H 4AK1A 5EZJB 3O4LA 5E99L 3IJSA 4Q9CA 4PD4J 5AZEH 3CH1A 4RBPK 3X3GH 5JW5B 3QQ4B 4UINL 2IPUG 1R6VA 1VSCA 2YPLD 4I2XB 5D7KE 5KVFL 4XP4H 1MNUL 3OGCA 3MLZL 4UB0H 4KRMB 1ZGLM 1XGRB 3OF6A 2AGJL 4P2YA 5DJXB 4ZG1A 1D5MB 2AV1A 1HILA 4DKFH 2VL5A 2CJUH 4KH2A 3U36B 1CXEA 1MIEL 3QWRA 1W72H 1X7QB 2CO6B 4C56D 1SJXA 4OZGA 3AVEA 2VLRE 3G08B 1OQXA 3WLBB 4TULL 3QDJA 1R3IH 1ZT7A 1AI1H 4M62L 3U48A 4L8CA 4P3DA 4PJHF 1Z5LA 1U36A 2FZ3B 3RUGF 2R2EB 5KS9A 3EGSA 1AO7A 5JORA 3P0VH 1G7LB 1WK0A 2CLVA 2JCCE 5C09D 1NMBH 4KUZL 1KSRA 4APQC 1H3PH 3IAGC 3C2AH 4OZ4A 3GB7B 1CE1H 2FJGB 1JF1A 2VR5A 3QQ3A 1X6LA 1EGJL 1LQSR 1TPXC 2DMKA 1QHOA 3ARWA 2BP3A 3OKDA 2Y6SC 1DVFA 3SOBH 4C55A 3RVVD 5J13B 1M71A 3P0YL 1KG0B 4G42A 4FOMA 5E1AB 4A6YA 1MAMH 4DOHE 2ED7A 2X1XR 5GGVH 3KPTA 2QKIB 5D93C 5E8PB 2GAZB 3DV4A 5J6GA 2GTZB 3RZCA 1NEZG 1W0WA 2DYPA 1VFAA 1D6EA 3MLRL 1OT2A 1A6ZA 1T80A 5SX5H 4X4YA 5I76B 4L8BA 3QHZL 2VKXA 3MC0A 4LKXB 1UM5L 5KN5B 4Y5YB 1VFUA 2EXYC 4YHIB 3X11A 1MF2H 4MAUH 5DK2B 5CINL 3QIWB 3BP7B 5CHNA 1WBXA 1QNZL 3V5HB 5IFAH 5C2BH 4OCXL 4L4VE 1X4ZA 4HWZB 4RGMC 4MA1B 1LMKA 4FQPA 4EI5D 2FO4A 1G9NL 1PW3A 3WXWH 2IBBA 1NGZA 5JW4Q 4J23A 5EOTA 1WCBA 1J0HA 3BEWB 2ADJB 3QO0B 1B88A 2GITA 3OHXA 2YXFA 4KVCL 2C4FU 2VWEE 2XRAL 4Q6IA 3RP1A 1NFDE 2ZJSH 4O51A 4NN5B 4EUPA 5FCUH 4PJEF 5HYJB 4GMSH 2R69L 1CXLA 2IH3B 3KLHC 4RGNE 3RX7A 2VLKA 2AKRA 2F19H 3SCMA 2C26A 1PD6A 5J11B 3ARTA 4FQ1H 4FG6D 3R1GH 1FYTE 3F7YA 1A22B 5JOPE 3CXHK 5C0FB 4IMKC 3J8F7 3IS1X 4M4RA 4NO5B 3MV01 1KIUA 3BESR 3PGCA 5CJXC 3LD8C 4R2GD 5ESVA 1QLEL 5IVXE 3TM6A 1UFUA 1CZ8L 3INUL 3DETC 4YHKL 4Z78B 1UJTA 5FHBH 2HH0H 5HHPA 2H2PD 1CI5A 4XCFH 1A1NB 4LQ1A 1T2QL 5GPRA 3QT2A 1EJ6A 2X4SA 1JPST 4P48A 4G8GA 3SDAB 2GSIB 1UA6L 3B5TA 3NCCB 5HHNA 2AJ3A 4NUJA 5J8OA 3UPRA 1KJ2L 3ABZA 3QQNA 5LVEA 1YECL 4YHLH 3SDCC 3O2DL 5CMAB 4MQXC 2LE9A 4XTRD 3A6OA 3WJJC 5BZDB 4YDJA 3BHBA 2EXWD 2D9QB 5EU3A 1N6VA 2X42A 3SDXF 3UYOD 1N5AB 2P7TA 1S7XB 4NZRL 1SY6L 1VKXB 5KSBE 3QNYB 1DLFH 1MJJA 2DWEA 1HH9B 3NACH 4KI1A 3MA7A 3N1FC 5ERWA 3IGAA 3V4PH 2FGWH 1FNFA 3BKCH 3DURB 5FOBB 2WW8A 4I0PD 4APQB 3EUUA 4NJ9H 2Y1VA 5B4MD 3MRMB 1P7HL 2JB6A 1MHEB 1TPXB 3MUJA 2JJTA 3C5ZA 5IBUG 1YNTA 4Y7MA 2IQ9H 5FO9B 4P2CG 2EYRB 1JWSA 1O7SA 1PKQB 1KB9J 1EHNA 4NFBA 4I3SH 5GGSB 4GW1B 3S6CA 5FYLL 5D93B 1QO3A 1V3MA 3PL6C 5EU6B 1L0QA 3TNNB 2DQFB 2J8UE 4LCCA 5LGJB 3ULUF 4NZUH 4ONHB 4R4NC 3SE8H 3HKFA 1P9MA 1X5FA 4DGVH 4AY0A 5EA0H 3IDGB 2MKWA 3HR5A 1VGEL 3NAAH 1OSZB 1LO5A 3MBED 3WDHA 1FE8L 3BWAB 1I1RA 2AJXL 5E2JA 4ODSH 1FZMA 1EFQA 5E56A 1NGWA 2D3VA 4RGMB 4Z7UE 5SX4H 3KPMB 3CVIH 4BFBD 3CH8A 1VFBB 2YA0A 4U7KA 3HR6A 3RL1A 2FX9L 2NY0D 5FA3B 1QRKA 4P5KA 1IT9H 5F9AC 3CXDH 4KTDL 1R0AH 5BRZB 4R6UA 4XCNA 1I7ZA 2V7NB 4WVRA 3DX7B 4M1CD 5GSRA 3B43A 3B2UD 3FN0H 5DMKA 1G6RB 15C8L 3HZKA 5T1LB 3CVHL 1CLOL 5DD6B 4L4TD 4G6MH 4F57H 1CD1A 4CNIA 3SPVA 1C5BL 3KXFE 1N7ML 4S0SD 4EI6B 1IBGH 3DARA 1A9EA 4GQ9H 2QSQA 4K3DH 4M7KL 5K33A 3KHQA 2ZUXA 3WNKA 4JAMB 1QRNA 3C5JB 2WWKT 3CSYB 1L8JA 1MCKA 1JF5A 2WLYA 1T83A 4QO1A 4HJ0C 4LEOA 1XGPA 3WFHA 2NX5A 3ZYZA 4G5ZH 2UVEA 3MLYL 1NCWL 3CFBB 5DI8A 1J0IA 3LD8B 2I07A 3F58L 1VPOL 1S7WB 3EBAA 4IRZL 3IDIB 1NBYB 1D9KA 4NC2B 2EO1A 4PTUB 3TVMD 1BZ9B 2N1KA 4JO3H 5F7KC 3W5MA 1VERA 3VRLE 3KPNA 4P4KD 5ISZB 2FH8A 3GMRA 2BVEA 4ETYA 4X6FB 4U1MA 1ZLVK 4F2MB 3P4NB 4M1GH 3SJVA 3SDCB 4OFPA 3U9PH 2W59A 4E5XB 3ZDYE 3IVKB 3RWGB 3S34L 4XCYA 4U2YA 3CDGB 4F7MA 2EC8A 5D1QB 1ES0A 4BH8B 3MRCA 4CN1A 4Z7NE 2R1YB 1C8PA 4XCCH 1OTTD 2CIKA 5D1ZA 3QDME 1D9KC 3T77A 1QYGL 1IZKA 4PJ7E 4CKVX 4YDVB 5F9OL 5EZOH 1Q9WA 4ONGL 3MRIB 5FIEA 1A4JB 1YMMB 3FFCA 5DD1L 1OM3H 4FQJH 5ILTH 4O02H 4N0UA 5HHVH 2Q8BL 3GUTA 2HT3C 2CIIB 2BFVH 1LO3H 3EO1A 5C0BB 4YHNA 5IJVB 3BP6A 3RVWC 3MMEB 1G7IB 4YEFA 1A3LL 1INQB 1IGYB 3UTOA 4KVNH 3HE6B 2DJ4A 3T3PE 2UWEF 5E9DA 4X5LA 5JUEH 1UH4A 1OY3B 1W0YT 1LO0H 3GRWH 3OMZA 1D3CA 1KELH 4KK6C 1LO2H 3PL6B 1WWCA 4HEPG 4KJYA 1FC2D 3TGXA 1NL0L 3CSGA 5HGBB 5ID0A 4PGZA 5CWSB 4GLRI 3ARFA 8FABB 3Q48A 3DVNB 3NFPB 7FABH 1QFPA 1NFIA 5EUKB 3U1SL 3V8OA 4WFGE 3PHSA 2XWJA 4J6RH 3HNTH 1T5WA 1JHLH 2AEPL 5JHDA 4ODUA 4NNYB 3KPLB 1A14H 4FMFA 5BXFA 1HINH 2Y7QA 4ORGA 1QEWB 5HGHA 1N3NA 5D7KD 1I8KA 5I1IL 3GBML 4IOIA 5MENA 43CAA 1S7VA 3IFOA 3WIHA 1JPSL 1HE7A 2KUTA 1T4KA 3QA3B 1YJDL 2G75A 1NDMB 3VGDA 2BY3A 1Y6NR 1OHQA 2FJFA 2VLRD 1RVFL 2ZUQC 1CE6B 2YD5A 1OAQH 4RZCA 1UXWA 2A74A 4O58H 2RR3A 4PYHA 2Q86A 1ZLVH 5MEPA 1J1XH 4XNMA 5TE7L 4Y2DC 4PG2A 2DLIA 2AJUL 4F37K 3CUPB 1F3DH 1UEMA 4FFZL 4NWTH 2NY3D 4PRDA 4Q9RH 4KQ3L 1JGLL 3ZDZF 4U6YB 3TO4A 3PP4L 4ZXBB 1X5JA 1U2HA 2PW2B 3VXPA 4QRPB 1KJ3L 3THMH 3DO3A 2BHZA 1NLBH 1B0RB 3FRPA 5K9JL 2DM3A 5C0GA 3VXRB 3VWKC 2DQUL 3UBXA 1NAKL 1OD9A 1U8MA 4YE4L 3VJ6A 1X5XA 2V5RA 3RVUD 1I1AA 1UADC 5LGHH 2DQHH 4MJIB 1WT5C 4YEEA 2R2HB 4P5TC 3SDDD 1S9WA 3ZDXE 3M8OH 4XCEB 3BO8B 1L6ZA 4X7TA 2ZCKH 5AAWA 3ZE1E 3CDYA 2SEBA 3CNKA 2CR6A 4LP4A 3FQTA 4OM1L 2CUIA 4YPGB 5B21A 5EWIL 4L4VD 2V2WA 4HPOH 3IAPA 4CVUA 5CD5C 3O6MH 2HWZL 2CKBL 1RZ8B 4KQ4H 4LLVB 1J18A 4LLYB 1C16B 3GK8L 2NXYC 1TMCA 2A1WL 5HXMA 3GMOB 1EXUA 1G6VK 1ZWIA 1Y18A 3QHTC 4X4XA 4PJGF 3WN5C 3QJFB 4ZOAA 5HGAB 4PGBB 4NO0B 1ODAA 5TQ0L 3WJLA 4MXWL 2VOTA 3GMQB 1AC0A 2ZSVA 1Q72H 4LCIL 4KKCD 3WFCH 2C7UA 3GNMH 4IRSC 1IAKB 1T3FB 3DMMD 2PYEE 3RU8L 1QTYT 1T7VA 4UBDC 4MLSA 2CLRA 1VA9A 4GG6F 4BH7A 3B4NA 1MVFA 4LBEB 4EDXB 4KZDH 4POZC 3K2UH 3LZFH 4ETQB 1C12A 1NCDH 2J3SA 4R7DB 4XC3L 5HI5D 3EOBA 1J1PH 2YD7A 1RJLB 2O61A 2NXZD 1GC1C 5JOPD 4ZUVB 4V1DA 5IIEB 4PLKC 2VISA 2P5WD 2C1PA 3MV8B 5D2LB 1AIFB 4OZHA 1XH3A 3I02B 2DKSA 1G6RH 3WNOA 4RAVA 4GBXA 5TPWL 3UC0H 4M7LT 3LKNB 4F7EA 5GGTA 3F65A 2M8XA 2ARJA 2AXGB 3AY4A 5DDHA 3OXRB 1BEYL 4RFOH 4FXGB 1P4LA 4MNHB 1I9RH 1YEGH 4KI5F 5FYJU 3TN0B 3GDBA 3H0TB 4GRWB 3TNMA 4CU7A 5HYJE 1F4WL 5MERA 5J06A 5ANMB 3KVQA 1EERB 1IC4H 1T1XB 4OFDA 1EJOL 4Q6YA 1A7RL 1C7TA 4RFNB 1ACZA 1RQ5A 2HRPL 4J4PA 1KB5A 5ITBH 5C0CA 2E7CA 2ZUQB 3MOBH 3HFMH 4KMLB 5E5RB 4QRUB 1D5IL 2QHRL 2ITDB 4Y2DB 5EZLA 1K3ZA 4HWEH 1YQVH 1AQDB 1A6UL 1UZ6F 3C09B 1A0QL 2YK1H 1DE4A 5DJ6A 4OZIB 4JRXA 2I27N 4QTHA 5F1IB 5HY9A 2DKUA 5HBBA 5DFVD 5KG9B 4GW4A 3CMOL 4ODWA 5A2LH 1FGNL 1F02I 4HSQA 1FFRA 1B2WL 2DAVA 4LDOB 4AG4H 4PJDB 1T66D 3VWKB 3SGDH 1DQML 3VFRB 2YSSA 5I30L 3MA9L 3KJ6H 1BVZA 4TTDD 3ORJA 3UPCA 3BN9D 1TJHL 5HYSB 3ARBD 5GZND 1DSFH 4P2QB 1BQHB 1Z9MA 2ZZUT 1UVQB 4P5TB 3MJ6A 3HI1B 4PJBB 5FA4A 3LKOB 5C2UB 4PJCA 5FGBA 1HXYB 3FB8B 1IGMH 4M6OL 4GRLA 4EBQH 3OJ2C 1A7PH 4MX7A 5DHVB 3FONB 5C9JB 4RIRB 4W70A 5JQHC 1UJ3C 2ATPB 4NQDB 1OP5K 4ELKA 4U49A 1EUTA 1N8ZB 3RWDA 4LP5A 1GGIL 2MTPA 1L7IL 1HIMH 5EULV 5ADPH 2NXYB 3GGWB 5I1JL 5D6CB 1JE6A 4RX4A 2FATH 4YGAB 4XP5H 2I5YL 2WNGA 2J88H 4N9GA 2IG2L 1PKQE 3WN5B 4GRLC 5SWZB 2ENSA 3D2UB 3REVA 4DUVA 2VE6B 1E28A 4DCQB 5EU6E 3FB6A 2MFNA 4IRSB 4ONOA 1R5IA 3QG7H 1AFVL 4LLUA 1W8OA 3X17A 5MEQB 2LVCA 2VC2H 3BH9A 4OGAC 2NY5C 1MHPH 2HKFL 4D0DB 2APXA 2R23B 3W11C 2MHAA 1KEML 2IBGA 4NBZB 4WEBH 1XR9A 4UT7H 1JNNL 5DVKA 1U8NB 4QKXB 4NQSA 3BXNA 1NDGA 2LTQC 5INCB 1QFWL 1AGEA 2HFGH 2BC4B 3SBWC 4OIIH 3SGKC 1U95A 2DQDH 3HTLX 4HJGB 1IFHH 1MFDH 4L5FL 3S4SG 4AIXA 5I19H 2ZOLA 3V9FA 1EMTH 1YPZE 5I1EL 1CT8A 4YWGL 1ADQA 4ZFZA 1R3LB 3PQYB 3VFPB 4ALAH 4JM4H 1OAZL 3SGEI 2CGRH 4I5BA 4LASL 1CGXA 2Y07L 3R06A 5DJYB 4PP8C 2H2SC 2D7NA 5FYJE 2XZAH 3QDMD 2DBLH 4WW2C 1JYVA 3KPSD 1PSKL 4PV9A 4RRPG 1RJCA 1PYWB 3PUCA 4FQXD 4J1UA 2HVKB 2WZPD 1KJ2B 3QUXC 4BELD 4JFFA 3VXNA 1IAIM 5CIPB 2NZ9D 1RZJL 5CEYB 3KNBA 1EO5A 5C6WH 3EO9H 1Q1JL 3K74B 4XBGB 5JOFA 2E7BA 4JDTL 4UIKH 5DD0L 4KK5C 3PDOA 3VFOB 3DTXA 1P84K 3QUZB 1SMOA 2VZSA 3QXDA 1FBIH 4ONFH 4PREB 1HHHA 4JZNB 2VZ3A 2X89A 1KCVH 5C6TH 3ZKQD 1CDIA 3AXLA 1YN6A 2ZG1A 1BF2A 3TO2A 3TJEL 1FIGH 2B4CC 1X4XA 4QHKJ 2OCFD 4NZTH 1S7SA 5J89A 1MI5A 3ARGA 3MRPB 1U42A 2XFXA 2YPKA 1YMHA 2X4PB 5GRWA 2JIXB 5HVHC 4HKBA 1HH6B 5CJ5A 3N1MC 4LLMB 1BLNB 4N90E 5IMMA 5F7UA 4XAWH 1I4FA 4JFQB 4M1DL 3X13A 3GMNA 3T0AA 4NP4H 2JKXA 1YMME 5FDWB 2ESVB 3I3DA 4XBPB 1UJ3B 4X6DA 3DGGB 1G7MB 3NFNA 2VH5L 3D9AL 5INDA 4O2EA 1RZFL 1JL8A 4U6TA 6FABH 4JFHD 2VDML 3MOAH 3MRQB 1EVUA 3UDWC 3V2AR 3B8SA 3WUWA 4KROC 2J4WL 1ZSDA 4PJ8A 4FQLH 1DBJL 4P4RB 1I1FB 1JVKA 4KK8D 4ZD3L 5IB1A 1J05A 1Y6MR 2CMRL 4HCRA 1FFNB 4HIJA 2VDQH 2CDGB 1DEEA 5E8EB 4F33B 3OXSB 1JF6A 4UQ3B 1QBLH 2FX7H 1INEH 4DK6A 3UJIH 2BJMH 4YO0A 5FAAA 3VGEA 3O3EB 5I1HH 1EFXB 2BHYA 4OCRH 4JB9L 4KJQD 3DWTA 3LKRA 5I1CH 2H1PL 1J5OL 3HI6H 4RDQG 1MCQA 1GRWA 3MYZA 4P9MH 3I6KA 4HIXL 2VABB 3FCTB 3QDGA 1VCAA 4XMKH 3MJ7B 3SDYL 2NY6D 1A6WH 5E5UB 2J5LC 2J8HA 3CVHB 4GRWH 1Q0YL 2HN7B 3PHQA 4UZGA 3TYGH 4O4YH 1S5IH 2RGSA 4OQ1A 3V6ZA 4DFIA 4XHJD 3D5OF 3TLRA 1JUFB 2DQGH 2LTQB 3L5XH 3JWOC 2YHGA 3MUHL 3P4OA 4HFUL 4I0KA 4WUUB 5L2KA 2NY2D 5J12C 3WS3A 4DJMA 4BFIA 4YHOL 1FCCA 3UTQB 2I9LA 5DVOA 2QLVB 3VFTB 4ZOEA 4YUEL 5KTEL 4FNLH 4Y4FA 3I6LE 2WY3A 5DC0A 4WI8A 4X80H 3Q6FB 3L3JA 2VNCA 1ZA6A 4CVXB 4HKXB 1N4XL 1MCHA 1QFUH 1MNUH 2OM5A 3FTGA 5FHAH 3E8UL 3UX9B 3S5LA 5CEXA 1G7PA 4G43A 4N0YL 3N06B 1JPGA 1OPGL 4O5LH 2P45B 4MLIA 4NN6C 4ZYKB 4WW2B 5F96L 3PWLB 3Q2CA 1KEGL 4JN2A 4JO4H 1PEZA 4Y4FC 5F9WB 2OI9A 2IC2A 4L8SA 5E6IA 4OGYL 3GJFA 3E3QE 4G59A 3QUXB 3PIQA 2ICWI 1UH3A 5M94B 3LPWA 4KHTH 1TCRB 2XPGA 3VXRE 1S8DA 4K94C 2M2DA 3PG2A 2VXSH 1EEQA 2D7TH 3BYYA 1QLFA 5K9QG 2MJWA 4MDIA 4YAQA 2GEEA 3NIFE 1K4DA 2Q76A 5DHVH 4NHUA 4XB8A 4X8JB 3UTTA 1K4CA 2ZCLH 3VCLA 1C7SA 2ARJQ 4P2OA 3QIWD 4IRJA 1BQSA 3HRZA 5CP3A 4G8EA 1WFUA 4GAYA 5CD3B 2MPAH 3MGOA 2BK8A 1CD9B 3SY0A 3V6OC 5HVHB 1XF4A 4H25A 1D5ZA 1I8IB 1JYWA 2RHEA 2W9DL 3LEXB 4MNGA 4PJHB 4ODBD 4PB0H 3RUGB 5EC2B 4TNWF 5A16B 2EE2A 4K8RL 2MCPL 3BP5A 4HK0B 3SGJC 2WLZA 2NTSP 4P2OC 1G9NH 3U79A 4FTVB 2A6DB 2GSGB 4KROB 1FL6A 3BFOA 1ROWA 5D7IE 1GGCL 4PFEA 2WUBL 5HYJD 3GMPB 3UYPA 4QRQA 4Z0XB 4C54A 5FCSH 1J10A 2I26N 3KLAB 1PFCA 1KN2L 2NNAA 3KYKH 4KVCH 4WCYL 2OL3B 1NMAL 2LABA 1GC1H 4IEFB 4I4WB 1IRAY 4TOYL 4B53A 1F11A 3BOVA 2A9ML 3EOTL 4P57B 1BVKB 1U91A 3JUYA 2AJZB 5IF0A 2R69H 1JP5A 3ARDA 3ULUC 4XVUD 1NFKA 1XCQB 1NGXA 1IKFL 1OLZA 1KFAL 3MV8E 1IAOA 1BBJB 5D2LE 4LDEB 1BBDH 4F7TA 4JG1H 2LQRA 2DTSA 5AEAA 1N2RA 3KPQA 1RUPL 1RZIB 5FUZH 3S3PA 5IR1B 2DM4A 1R3JA 5T1KA 2OJZH 5FYKU 2X4NB 2J5LB 3Q1SL 4X9FA 32C2A 1MQKL 2W9LA 4GLRH 3ZYIA 5TQ2H 2W91A 4IS6A 2YRZA 3DNKA 1ZA3A 2P4AB 3OQ3B 1ZS8A 3WLWD 3OWEA 4QRSB 5FYKH 4RDQF 4DTGL 2Z8RA 3WIHL 1QLEH 4PP1C 4MVBA 5J12B 1IEAB 4ESKA 2Y4SA 4YHKH 1DQQB 4L29B 2R4SL 1NBQA 3PWVA 2WINA 1BOYA 5TDOB 3B2VL 1HYSC 4POYA 5CGTA 3WIIL 4HFWA 2D03H 2P42B 4Y19D 2VZTA 4NQVB 3E6HA 5D70H 2EDJA 3DX9A 1Q94A 5JNYA 1KJ2H 3P3YA 1Q9LB 3AREC 4KMTL 2WWMD 3O4LD 3MRHA 2BSRA 4WHDA 5CIPH 4EN3C 4U1JB 5HHQB 3BGMA 2G2RB 3STZA 2HJFB 4HPYL 1KIRB 1NANI 4NQEA 1SY6H 4OZIE 4NN6B 4APQD 2YKLH 5DJAB 3RVXC 2IWGA 5I1DB 3QUYA 2EIEA 3PWUA 3VWJA 4JO1L 1U8OB 1BZ7A 1WEJL 1JGDB 2J6EA 4HHAB 4PJDE 5DK0B 2WP3T 2Y6SD 4IHOA 1CYGA 1FZOA 4PJXA 2KKQA 4X6CF 2RAMA 4Z7VF 1T04B 4WW1A 1ZEAL 1GZQA 2HMIC 5GRJH 1BM3L 1AO7D 3ZT5A 5EU6D 5TDNA 4PJBE 1KJMB 2VLJB 4WJ5A 3NTCL 4U1HB 4OGXH 5HHXL 2WQRA 4LQFL 1ZHLA 5HTSA 4JRWA 1A3RH 2EXYD 1D6VH 2UYLA 5IB4A 5IOPA 4PV8A 3NH7H 1NCTA 1JGEA 3TPKA 5C0NC 1KUMA 3L3KB 1D5BB 3DXAB 4NQDE 2IADA 3DX8A 4JFEA 3SDXB 2HTKC 5I8CA 1AXSA 5F8QC 43C9B 3BPNC 1G9MC 4RFEA 1RZ7H 4PLNC 3MNVA 1KIQA 2B7DT 4CDHA 4LLDB 3S35H 2JK5B 1BFTA 5BRZD 3LEVH 4KAQL 3EDFA 5ICZA 2HRLA 2AS5M 3W39A 3IXAB 1SBSL 3UYRL 1UB6B 3FQXB 3L9RA 4LSUH 5H2BB 5SWZE 5T1LD 5D5MF 4HS3B 3NA9H 3T8XB 1NC2A 1CVRA 4QHMA 5JW3H 1XGUB 35C8L 4Q0XL 1LE9B 1BJMA 3DROB 3H9HA 1KYOK 3QJHB 5DGRA 3AS2A 3TBSA 3JVGC 2NY5H 3NCMA 3KLHD 4XNZC 3IRZA 4YFLF 4OZFG 2VDNL 3VGBA 1QFHA 2IPTL 1JZ8A 4LARL 1B0WA 1M7DA 4XVSL 4DAGL 3CVHH 1CLOH 3GKZA 3ZHDA 2XXCB 4QHUB 2GK0A 3VDAA 1C5BH 4HUNB 5HGDA 5DRXB 4Z7OF 3MBXL 2ZUVA 1P4BL 4XMPH 3QFDA 2XT1B 4OJFH 1FLRL 3KPRB 5GGTL 1MOEA 5CJOH 3LCYA 4XP6L 2W38A 4OIAA 5EG6C 2ORBH 4RCAA 1AJ7L 3KYAA 4AIZA 4WTZA 5EO1B 5KVGL 5IW6B 1CGVA 2R0ZH 3EDJA 3DETD 4BQCA 5C08B 2BXZA 3MCKA 3QCVL 4YIQA 1E27A 1NEZB 2P24B 2X4QB 2DBJA 1H0DA 5I18L 1N0XL 2XWTA 3MLYH 1NCWH 1U8KB 2IANA 3L3IB 3LKPA 5ISZD 2FO1A 4NSKB 5T3ZL 4L1DA 1J88A 2PTTA 3F58H 3PQYE 4IRZH 3RX5A 4WWKA 3UCRA 3TBTB 3SDCD 5ALCL 4MQXD 4LFHG 5FYKE 4L3CB 2VLLB 5F7YC 3OTTA 4HQQL 2NR6C 3MV9A 4JY4A 5EOCL 5DHYA 5I17B 3HNSH 1A3QA 4ZOCA 2VZOA 4H8WL 4S1RL 3T0BA 3AREB 3QXAA 3K81A 5DJZA 1YEDA 3HZYA 3OGCB 2XZQH 1MEXH 4N90D 5E0QA 2DM2A 3MRJA 4EN3B 3FFDB 5IGXH 5IMKB 1HSBB 3IDJA 3MJ9H 4I18A 4XNQB 3ZT6A 2FEDC 5CEZH 1S9VA 4XXCA 2E5EA 1TVDA 1AE6L 5JPMB 4LNRB 4DZ8B 3QBTB 1MRCL 4Y5XA 4K23H 3VRIB 1L9NA 1MUJA 1NEUA 5C0BD 4DVBA 4OGZA 5EO0A 5F9OH 4GKSB 1XGQB 1NCAH 4UMGA 4UV7L 4YDIH 1A2YB 3AM8C 5T5FL 5DD1H 2B4CH 5CUSL 1I3VA 2GJZA 3LQAC 5GGQH 3BGFC 4NQCB 3G6JE 3PL6D 3QEQE 5F8RC 4XXCC 5IK3A 3DSFH 5GS3A 4HDIB 2X1WL 2BMKA 1DVFB 1CGSL 3QHFL 5F71A 2VXUL 2Q20A 1OGTA 5AYUH 2ICWB 3L3DA 5D72L 2VR9A 3WFEL 3GJEB 1Q9KB 1HKLL 4R9HA 2F8OA 2DWDA 2ESVE 3V6BR 2R56H 3MGTB 1VFAB 3V5DA 4GKNA 4Q74A 5F7EH 5ICXA 1RZGB 3MYJB 3WEXA 1TJIL 5KVDL 3ULVL 3FMGL 1JPFA 3F12B 4GRMA 5DMJB 4ZUUB 1ZLSL 3WXVL 1YUHB 1FGVL 3B9KA 3DPBA 1A21A 2OL3H 1JCKA 4NRZA 3GJFK 3O2VL 3U9UB 4F7CA 4RMSA 3O0RH 3EFDH 3UTPD 2O5YH 3OR6B 5L8LB 5L2JA 5CZKA 2EIBA 3BKYL 3I6LD 2ENYA 3EFFA 5E2UL 2RCSH 1R5WA 3BIAX 2F53A 3GEWB 4LSVH 1RSFA 1A4KB 2IPUK 1XZ0A 2XICA 1QKZL 1NC4A 4U1NB 1ED3B 4XNZB 4PRNA 1IEBA 4HGWA 1JPSH 3KDMB 5HYEA 2GTWA 2XWBB 2FWOA 2UWEB 3JV4A 3RDTC 2JE8A 2W60A 1Q0XL 5HYQA 4P46A 4JZOB 2XN9A 1KPRB 4QRPD 2KZWA 4HJ0D 1AGDB 4HIIA 5IBUB 5L7XL 1HDMA 1IL1A 1JWMA 3FO0L 3VXRD 1NMCC 4OFYA 4WUUE 3D0VA 4Z0BL 5IVXF 3BSZH 4HGKC 3L3HB 3PP4H 3STLB 4PJ9C 3PWPE 2RBLA 2X6MA 4U6VH 1ADQL 3P11H 4EVNA 4MJID 4QCIB 3NABH 1QRND 4WU5A 2X10A 1NAKH 2X1QA 1ZT4B 2G60L 2Z91B 3TCLB 4F9LA 1XGYL 1HEZA 4X7SL 2P5EA 1FV1B 3FB5A 1MWAA 3G6AB 3GSXB 3DBXB 1IM9B 5TJWK 2XY2A 3M1BB 2WP3O 3KWWA 4JFXB 5SWQB 5KSBF 1LO4H 5HHNB 5CGYC 1D9KD 1SJEB 4O2FA 4PD4K 4D9RE 2OR9L 1JGUL 3G5XB 4X99B 4EXKA 5I75C 3MRNA 3SGEH 1GIGL 1QBMH 1UXSA 3HS0A 1CFSB 4X9IA 3OZ9L 3G5VA 4ELMF 3C60A 5BO1H 3T2PA 1UGNA 4YDJB 4R7NB 3QIUC 3CZFA 5AYQA 4N5EA 1KLUA 1E4KA 1UWXH 2ZUUA 5LGKA 4NNXA 2I60L 4NO0D 1OSPL 2PW1A 3P9LA 2A1WH 3RVWD 5BVJB 5ECJE 2O26U 4N68A 1DQLH 3KLDA 2FD6L 2HFFA 3P77B 2VXTH 3B3IA 5ID1B 2HVJA 3CSPA 3BGFB 4S1DC 1MLCA 2E6JA 1MCIA 2H8PA 2ZKHL 4MXWH 1RV6X 4KK6D 1HHGA 4WFED 3OKKB 3OX8A 1CICC 4LCIH 2GJ6B 2A77H 3PGDB 4X6EB 4HUUB 4MD4B 3RU8H 1OAYH 3IT8D 4XWOC 3O6LL 4C4KT 3G9AB 3H42L 4AENB 2VR4A 4OFKA 5C0EA 3CFCL 1FCGA 3AAZB 4ZQKA 4PJHE 1R3HA 4OTXL 1I8MA 1NAMA 5HDBF 3RRQA 3QZWG 4Z7UF 3FT3B 3QEHA 4FFVD 3TZVA 3VG9C 3GMMB 3O2WH 1F2XK 1OGAE 2GQHA 5FM4A 4U1SA 4NWUL 1KPUA 1JPTL 1CLYH 3D39E 3MRDA 3HG1A 5HD8C 4HCRL 4UIMA 1F58L 1X5IA 2W65A 2W0KA 3IU3B 3I2CL 4PJGB 1FZMB 4PRAB 3HC3L 2VXQL 4BJLA 3VXSA 3ROLA 1WWBX 3ULUH 3F7PC 4P5KB 5HI3C 4NRYA 3L7EB 3L95A 3RL2B 5BW7A 1F8TH 1F4WH 5JHDD 3HPJA 3ES6A 2R1XB 3MREB 2B39A 4Y2DD 2XKNA 3HPLB 5C1MB 2JLLA 1FG2A 2VYRE 4GG6B 5DXWA 1EJOH 1A7RH 1A7NH 4K7PX 4JFDD 5KSAC 2HRPH 1WUNT 3RDTB 3VG0L 2A6IB 3OR7B 1Q9OA 4O9HL 4I77L 1D5IH 1MCBA 2QHRH 5F3HA 1FL5A 1K8DA 3KYOA 5C0AA 3W9EA 1FLTX 1M7IB 1FNHA 4G7YL 5E5MA 3RBSA 1IMHC 1A6UH 1A9BB 3SE3A 1N26A 1LEKA 3VWKD 4FQ2H 2JB5L 1A6AB 1YEHH 5D6DA 1MCPH 4PJ9B 4MCYA 2EDNA 1W2KT 5EC1B 3WO3B 1FGNH 3L5WB 1AGCB 4P2QD 4AH2A 5SWSE 1U2CA 2GCYB 2Y36L 3MLTB 2AQ1A 4P5TD 3EYUH 1KNOA 4AMKL 3S88L 1SEQL 2VLME 1CU4L 2GI7A 2I07B 5I30H 1MCDA 1OF2A 2EDEA 4JKKA 2F58L 4K7PY 4U6HB 3ZDYF 3AGVA 1LEIB 5JIHA 5FF6A 1SEBB 2QQLH 3L5HA 3C8KA 1IAMA 2YPLA 5F7DB 3VFWB 5CD5D 1EAJA 1WBZB 3JUZA 1J8HB 1H9VA 1I1AD 2XZCH 4Y2OA 4O00A 1F90L 1I9IH 1MCLA 5I75B 1A5FH 2NXYD 5CSZB 3VFGH 3ZSSA 3U46A 5E1HB 4XPFL 2QEJA 4C56A 3GSVB 3DVGB 4ODHH 5C07B 1F3DJ 2OP4L 4RMQA 3SE9H 2F74B 1T20B 4H88L 1L7IH 1B90A 4TPRH 2F8XC 3D2UD 4NJAL 1WF5A 5JHLL 1P7KA 1DQDL 3QRFM 4LCWE 2C4FT 1JV5A 2WUCL 2OJEB 1KF9B 3BD5A 5E8OB 2OS7A 4MMXC 3VXUE 4IRSD 2VLJE 3VA2C 1MCOH 1LHZA 2Z35B 4UBDD 4MDJA 5C09A 5J1AB 4WY7L 1EHXA 3C5SB 2BY0A 4POZD 3GBNL 4UT6L 1CICB 4HMEA 2QJDA 4KGLA 2X44D 3DXAE 5BZWB 3U4BH 3V52H 3BPCB 3SDXE 5M7QA 4K3EH 3NFSH 3K4AA 1EX0A 1BFVH 5FO8A 2NY4C 2IAMC 3D3VB 3O41A 3T0DA 3OL2A 2EEDA 4FQHB 4U1KB 2HKFH 2X4RA 1YEKL 3AMLA 4MWFA 3CFEA 5EBGA 3ZO0A 4QT5B 4BYHA 1ETZA 4ZTOL 2WBWB 4ODTL 4FQCH 3U4AA 4MQ7A 1HQ4B 4NKMA 4QHLA 4W4OA 1JNNH 1QLRA 5ID0B 5IM7A 1QBBA 1RZKL 1TETL 4LNVA 2YUVA 3MZTA 4Z76A 3OKOA 2VAAA 3GI9L 1JMZA 1UB5B 4OLYL 3DO7B 4PB9L 2QR0B 1DCLA 1E4XL 1KTLA 4S1QL 3PQYD 1BAFL 3DSNA 5DTFB 2VDPL 3OKNA 3TBVA 4V1DD 3RWJB 5FYKD 2XWJB 3N85H 1WCQA 4XNYH 4PY7A 4ODUB 4JHAH 3CJJA 2XTJC 2WAHA 5I1EH 5BXFB 4NHCL 4U1LA 1Z3GL 4YWGH 2P47B 4M5ZH 2HTLC 3KYNB 4UNTA 3MRGA 1W0VB 3LRSB 5DJDB 4MJ2A 4TSAL 4H1LA 4W4OC 3ULUE 4QLRA 3KPRE 2EDQA 4NCDA 1URLA 2VIRB 3D85B 3D6GA 5KSAB 4RMRA 3BIKB 1FNEB 3U7WL 1HHJA 5C08E 1VFMA 3IF1B 5T33L 2Q86B 3OJDA 4HH9B 1JRHL 1CXIA 3X12A 1I8LA 1RJYA 4U1IB 3HAEA 4Q97A 4XGZB 4K7FA 1XGTA 4QY8B 5FV2A 2GFBB 1UZ8A 4DN3L 5F6HI 3BEVB 3ZLQC 4YHYC 5CJ8A 4KY1L 3MLSH 5E8DL 4E41B 4JCLA 4OT1H 4YBQD 1FVDA 2P8LA 3FQNA 1PX4A 4JZJC 3ZDXF 3UP1A 4MHHG 2ED8A 5KW9H 1JBJA 1MHHB 2O5XL 1DBML 3MV7A 1KJVA 2WK2A 3MXWL 3MRBA 2JIXD 1MCWW 3ME0A 1DFBL 3VFUA 5BS0B 4PRPA 5ETUA 4XP1H 5J9PB 2ESVD 2JF1A 1MLBB 4LSSL 4YK4B 4OZGE 2J6EL 3RFZC 1AGBA 3VFSB 3LIZL 4M1DH 1UT9A 3SQOH 5HHOB 3EKCA 3LQAH 4JPWL 3IFNH 5KSUA 1NANH 3HZMA 3FT2B 5KS9E 1BD2B 1A6TA 1LDSA 4YXLL 3GKWH 4C4KO 3NZ8A 5C86A 4GRLD 5K9QI 2VDMH 3L3GB 3QQ9C 1T22A 4PJIF 4M7LH 1JTTA 4NQCE 4QYOA 4KTYA 3MR9B 1LNUB 3C9NB 1UCTA 1N6QL 5D2NA 4TSBL 3TC9A 4HX1B 1DBJH 2J7LA 3TWCH 1MPAL 1OW0C 4JQIH 1EFXD 4ZD3H 2CMRH 3LB6C 1G9EA 1V3LA 5JW4M 4OGAD 5E70A 4FA8A 2DTMH 5I6XC 2FCBA 1R3KB 4RX4D 4HV8B 4NCC2 3QRGL 4ZFFB 3W11D 2ICEA 2EYTB 3HRPA 4JG0L 5IMOB 5DHXB 4I13B 3PJSA 5TE6H 1QP1A 2H1PH 1XF2A 2NY4B 2IAMB 1GAFL 5C7XL 2CLRB 1UWGH 4CDGC 2EKSA 4YFLI 4WUUD 3MODL 4HIXH 1I3GL 4XNXL 1JFQL 3V5KA 5D2NC 4LGSB 4LEXL 2YA2A 1JNLH 4YHPA 4LCYA 3KR3L 2O61B 2F54B 1HXMA 1CIUA 1KGCE 2QTEA 1RURL 5JDSB 1ORSA 1C5DA 3OGOE 4GW5A 5GGUB 5GSVA 3MPCA 4JREB 1KCSL 4HFUH 4LHUG 2L0DA 4P0DA 3U2SB 2IGFH 5JIIA 1U8HA 3MROB 2HJKA 4HK3N 2RQ8A 4QHNB 4D2NA 5EB9A 1MJ8H 4FS0A 4MCZA 3T04D 1DQJA 2XTJB 2L7UA 5EBLB 1M7XA 5DEFB 4HWNA 1F13A 2YUZA 3L7FB 1F6AB 4JO2L 1NGPL 1KN4H 4F15C 3HUJA 3IDYC 2OTWB 2FYYA 3B6SA 4JY6B 5MERB 1IKNA 3O3UN 4XC1L 1H3WM 1REIA 3QUXD 1ZGLB 4GAJH 2UZIL 3TT3L 4L4TA 1RUML 4W81A 3M07A 3LMJH 3VXOB 3NN8A 4PGJA 1FORL 4OCSH 5D8JL 1F6FB 5CEZD 4J3VA 4OV6F 1SVCP 4KK5D 4YDKL 4M6NL 3B5GA 3BKJL 5F9JB 2N7AA 3S37X 1XAUA 3RZWA 1I1YB 3O11A 1C08A 1TXKA 3BJ91 4TTGA 4EJ1C 5EBWB 5EFIB 4QTHB 1VACB 3HZVA 1IILE 3EYQC 5IFJA 5FUOL 5IVZB 3OKLA 4DVRH 4YHYB 1OQOA 2QQKL 4IJ3B 4JFFD 3ALPA 4TQEL 4JZJB 3JWDL 3CGTA 4KKAC 3NCFB 1ZGLP 4FQIL 1RFDL 3BMVA 2YD1A 4PRIB 5I2IA 5IHZA 5J6HB 2F5AH 2ICCA 4HAFA 2NW2B 2Q7YB 1KXTB 3R0MA 2R39A 4LPYA 3TVMA 3S4SB 1H15B