4HUXA

Crystal structure of h2db-h155a-np
Total Genus 63
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
63
sequence length
276
structure length
273
Chain Sequence
GPHSMRYFETAVSRPGLEEPRYISVGYVDNKEFVRFDSDAENPRYEPRAPWMEQEGPEYWERETQKAKGQEQWFRVSLRNLLGYYNQSAGGSHTLQQMSGCDLGSDWRLLRGYLQFAYEGRDYIALNEDLKTWTAADMAAQITRRKWEQSGAAEAYKAYLEGECVEWLHRYLKNGNATLLRTDSPKAHVTHHPRSKGEVTLRCWALGFYPADITLTWQLNGEELTQDMELVETRPAGDGTFQKWASVVVPLQNYTCRVYHEGLPEPLTLRWEP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords H-2 class I histocompatibility antigen, D-B alpha chain
publication title Preemptive priming readily overcomes structure-based mechanisms of virus escape.
pubmed doi rcsb
source organism Mus musculus
molecule tags Immune system
total genus 63
structure length 273
sequence length 276
ec nomenclature
pdb deposition date 2012-11-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00129 MHC_I Class I Histocompatibility antigen, domains alpha 1 and 2
A PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4huxA02
3.30.500.10 Alpha Beta 2-Layer Sandwich Murine Class I Major Histocompatibility Complex, H2-DB; Chain A, domain 1 MHC class I-like antigen recognition-like 4huxA01
1DQMH 4HX1A 4O5LL 3QDMB 4R0LC 1Q0XL 1OAUL 5DLMH 3E6HA 3SPVA 5BCAA 5FA3B 5EU5B 1KSRA 2FB4L 1XF2B 2OI9B 2VXSH 5SWSD 1IE5A 1I3RB 1AI1H 5KS9E 5T3ZL 1Y18A 3HZKA 4RMTA 4OLYH 4EDXA 2JK5A 2IEPA 1K6QL 3BUYA 4OSUH 4Y4HD 4WV1B 1K3IA 1AGDB 3LSOB 4M6OH 1QPXA 3KPOA 1U8JB 3EUUA 1HXMB 5I1GL 1KXVC 3HRPA 1EJOL 3NA9L 3RWJB 1ZVSB 4LU5L 4MVBC 3WBDA 3RBSA 4RQQA 2NYYD 3HE7B 5B4MD 2ZSVA 3HPLB 1LK2A 4P5KB 2O61A 1FVCB 3O3EB 4QRPA 4DKEH 3MOAL 1KT2B 4M1CC 1MHEB 5E2TH 3DX9B 2ITCA 3DVGB 5IJVB 4CW1A 4M5ZL 1N0XH 2PTVA 3BKYL 1EJ6A 5HHVL 1E4JA 1YJDC 1N64H 2DI9A 2Y72A 3RU8L 1U95B 4PLKC 2RCSH 1U91B 3PF2A 1NUFA 1PSKL 2IAMC 4JM4L 1YUHB 4Z7UB 4W6YB 1JNJA 2R15A 2XG5A 1I8KB 2EYRA 2LU7A 5GS0C 3N1GC 1H3WM 3ARGA 2ZKHH 1M7DA 3BKMH 1ZXQA 3S96A 3X14A 4M43H 1J05B 1NDMB 3LOWA 3H0TB 4XXDA 1I85C 5E8OA 3SDCB 4QRUA 2A6DA 3VXQA 4OB5H 1YEHH 3KXFD 4UT6H 3U9UA 2AJUL 3BQUA 4NUJA 4S1SH 1AQKL 3RZWA 3VXMD 5KW9H 2PCPB 5EIVA 3SO5A 3PGCA 3QIUD 1EHLH 1T7XA 4X7TA 3VGDA 1JTPA 2H41A 3MRBB 2YD1A 3QQ9C 5KVGL 3FQUA 4F9PA 1MUJB 1O7SA 4A6YH 2VDOL 3EO1A 3L95A 2GY5A 3ZE0E 3M07A 2AEIT 1OSZB 1A6UL 4OF3A 5A2JH 3DUSB 1T7YA 3PGDA 2Y5TB 4BFEA 2V2WB 1WVZA 3QPQD 3ARWA 5ICZA 1F4WH 2JCCB 4M93B 5L2KD 3SGJC 5LAXB 2P8LA 5D6DC 3HE6D 4LSTH 2IG2H 4PGDA 5ILTH 1ONQB 3SE4A 2QR0A 4LPXA 4RBPK 4UNVA 3QH3A 1S5IH 2JJSC 5BS0E 4AIXA 2XZAH 5HYSB 2HFFB 3CD4A 4LASL 4WWKC 1I1YA 4JZJB 4PJ9C 2VL5B 5C86A 4E41D 3FQRA 1KCRL 5C0JB 5E6IA 5DQ9B 4XPBL 1WBZA 2PUQT 3TWCH 4FG6C 3UTTE 2APBA 5D1QC 1RJZA 2Z35B 1RZJL 5D7JB 2BVEA 2VWEC 1A14L 1T66D 4N8PA 1CR9H 3AXLB 1KFAH 2W91A 1MFAL 1MNUL 4LSSH 4PRPA 4ISVA 2NY5C 3STZA 1H3VA 1SHMA 2P8PB 3ARBB 5DJDB 4NQSB 2YUVA 3MJ8A 2H3NA 1G9MH 4DTGL 3QEQB 4D3CL 1TENA 1CL7L 4S10A 3WXWL 2VZOA 4KJPD 4PLNC 5JOFB 1TTUA 3GSOB 4YFLI 5F7HA 3W0WB 1F6FB 1I7TB 1IAII 2VNCA 4K7PY 1KLUA 5D9SB 2FX7H 4YHZL 2G75B 1AXTH 5C70A 4JQXA 4WU7A 3ZL4L 4HS6B 1FNLA 4P2RE 4M1DH 4F7CA 1FLRH 1G1YA 1T5XB 1VGEH 1W0YT 5D1XD 2R4RL 2YS4A 5FDYA 2X10A 1J1XL 1EBPA 4K8RH 1NKRA 1YMHA 1AIFB 4RFNB 1NEZB 5D96C 1JHTA 3M45A 5IB5A 5J57B 3L3KA 4ZS6D 5IHLB 5M94B 2DF3A 5HHMD 1KACB 2DBJA 5I73C 4MAUH 5C3LD 5DJZB 4OQ1A 2DD8L 2ZPKL 4K7FA 4UDUA 1ZGLM 4Z77B 1K4DB 1UZ6F 3HTLX 1CLOH 4HKXB 43C9A 2X4RB 4DUXA 3U83A 1UWXK 3RWFB 3SDYH 4FQXB 4RGMB 3LQAC 1QRNE 1LP9B 1ZT4A 3BSZL 2H9GB 1W72A 2FBJL 5C09A 2WBJC 3FCTB 3J7HA 3VFTA 1YC7A 2NY2D 5FYKL 5B38B 2VIRA 2IPTL 4PB9L 1UWGH 5FO7B 2FX8L 3V9FA 5JW4Q 4WIQA 4WHYH 5SWSE 2DQHH 2DDQL 3OKLA 2FNBA 4KDTA 1YEEL 4U7SA 3GKZA 1W0VA 4AEEA 1TQBB 5TF0A 1KXTB 5D5ME 2F5AH 1MLBA 3IGAA 4PJ7F 3CZJA 1J0HA 2BC4A 4CAGA 1I8MA 5A2LH 2E7LC 3BVNB 1ADQA 3RAJH 4HS8H 1MJ7H 1I7UB 2UWEB 1RZKH 2AXFA 3TVMB 1CG9B 1PEZA 1HOCB 1PYWA 4F9LA 4HUWA 4OZIF 1F00I 1XGPA 3PWUB 3OAYK 1GIGL 1I9JL 3ARZA 4WHCA 3SCMC 2IC2A 3ZYZA 5IQ7H 3TPKA 4KK8D 2BY3A 4NPYA 5ENWB 4Q0XH 1L6ZA 1LEKA 4PJ7A 3O9WA 2E3VA 3MBED 1FNEA 4OLXL 1DEEA 5GRVK 3O8XC 3RY4A 4C4KO 2CJUL 1SVCP 1JPGA 3TA3A 3UO1L 4RDQF 3TJHC 4H1LH 4OZIA 5IEKB 3D9AH 2JIXD 2F5BL 5D7IE 3RFZC 3OXSB 3UAJC 1YPZF 1YQVH 3QAZC 3ZDZE 4PJIF 3RL1B 3R1GH 5HVHC 4K23L 1NANH 5HGDA 3C2AH 4LAQH 3TJEL 5HI4D 1SYVA 3TO2B 4L3EA 1TITA 1QFUL 3KXFE 1KTDA 5T1DL 2XTLA 4NKDA 1BFVH 5ALBL 3RGVD 3VXME 5CSZA 4QT5A 3QJHA 4M3KB 1Q72H 2DLHA 3CZFB 1KN2L 4W81A 1SMOA 3WKNA 3GGWB 2H32H 3BI9X 4Q9CA 5KANI 4F2MA 4JFDE 5DK2B 4PJIA 1DLFL 1DL7H 1HIMH 3AM8C 4OI8A 2GUOB 5DVOA 3GRWA 1U8HB 1WIUA 5I1EL 3BJ91 5HYJD 5F6IC 4HLJA 2DMBA 1RUKL 4LLYB 4ETQB 1SJHB 2DB8A 4MWFA 1BZ9B 4OKDA 2BRQA 4HZLA 2NY1D 5L2KE 1A1MA 3KLSA 5HHPB 1I9RH 1V7ML 4PV9B 2R1XA 4KH2A 3HMXH 5GGVY 1NGQL 4JM2C 5ESAA 5C6TL 1AKJB 1UCBH 1V05A 4IRSD 4HXAL 5C9KA 5IKCA 1KJVB 2Y6SC 1FNSL 4E41E 5I17A 2RIKA 2VO5A 1JHLH 3JV6B 1HWHB 5EIIB 1YEIL 3TIEA 1D9KC 4UINH 2EDHA 4NHCH 4U6HA 2YRZA 3F12A 1SEBA 3IDUA 3T08A 2HH0H 1A0QH 1MFDH 5EN2B 4LMQI 3VI4F 1P7KA 4NWTH 3B5GA 5I8KL 1FZOA 5C0AA 5ICYA 5FHBH 2GTWA 4J4PD 1BZQK 3FO2B 2PO6B 4ZDHB 2ED8A 4MXQA 3WEXA 5DRXA 3H9SA 3AB0B 4U1NA 1FVDB 2DL9A 1YJDL 1YEJL 2V5RA 1X4XA 4U1KB 4ZXBD 3LEXB 1S7UB 3TFKA 1MFNA 1E4WH 2VISB 3Q48A 2V17H 2G5BB 5FGRA 4R7NA 5I1LA 3IU4L 5CP3A 3N1PC 5L88L 2XPGB 1YEFL 4LQFL 1JV5A 2CDEA 4WTXA 1QLRA 4P46A 3B43A 3VG9C 5GS0L 4XCFL 2YA2A 4LKXA 1YN7B 4WUUA 4OZHE 5GGUB 2VLKB 5EOTA 1S9YA 2PN5A 5ISZB 2D7TH 3HRZA 3MGOB 4CL7A 3IETB 2VR4A 3MLTB 5ERWA 2VLRD 2GJZB 1LO4L 5KSVB 1HSBB 3FRUB 3TZVB 2G2RB 3QJFB 2KL6A 3P2TA 1G6RA 3MGAA 3O2DA 3QNXA 5KSAD 5D6CB 1YDPA 1Y0LB 1TZHA 1TETL 1U92B 3T2NH 2J8HA 3O6LL 3ZE1F 4OF5A 2A6JA 4NBXB 5EWIH 2K7QA 3LS5L 1C5CH 3U30B 3VGFA 1FZJB 5J3HD 3GNMH 1KIQA 2YKLL 1J0ZA 1DBJH 2NTSP 1XIWA 4KRLB 4IMKC 4X0KB 2I5YL 1S7TB 2HJKA 3INUH 3TN0B 4DJMA 1U8IB 3NAAL 3T0BA 4LF3A 3T65A 2DIJA 2X09A 3AAZA 1EVUA 1KPRA 4ZSOE 1YEGL 4UQ2B 3CDYA 1MCHA 5HGBA 2F58H 2ARWA 5B3NA 4KAQL 2P7TB 4PD4K 3EGSA 4G6FB 1FSKB 5D8JH 5K33A 2A0LC 1BBJA 5BQ7A 1DVFC 1HNFA 1MJJB 2EE2A 3V5DA 4EUPH 3S88L 1BOGA 3UXFA 1NCAL 1TZGH 5KS9B 2CUMA 4PLOB 1RZGA 3U7WH 4FQ2L 4XRCA 2EEBA 3T8XA 1NFDF 1M1SA 3UBXG 2VUYA 4BK5A 1NC2D 2NY5L 1DR9A 1TCRB 3O4LB 1JGEB 5JXEC 5LWYH 4OF0A 4GMSL 4YHNA 1CTOA 2OR9L 4P5TB 3CFEB 1QR4A 4NQED 5K93A 3MFFA 5FF6A 5JHDA 1B6DA 1ZGLP 3JZ7A 1N7MH 4XMKH 1ORSA 4L3CB 5I1JH 3WE6A 5DHYA 4MX7A 4X7DC 4MXVF 4CDGC 4Y19A 2AK1H 4NN6C 1A7OH 1CBVH 3V6FB 1SEQL 4MQXD 1NFDA 2FR4A 1RUPH 4J3TA 4NQVA 4JRYA 5DI8A 4TSAL 35C8H 5JW4M 5D71L 1I7RA 3G04A 4UIKL 4YBLB 1IAOB 1XZ0B 5CJXA 4NOBA 1OSPL 1F90L 1JZ3A 4Q9BA 4H8WC 4XBGA 5FV2A 1JMXA 1D5ZA 4KKBD 4XBPB 5DUBB 3T0EE 5FGCB 1A7QH 4KVCH 5MEPB 2CQVA 3KPLB 5IHUH 4HUXA 2ORBL 4GRLD 5DZOA 4YHYB 4BH7A 5TE7L 1MJ8L 3VWKC 4FXGB 2BSTB 4HK3N 1EMTL 1LE9A 3JWOH 3QQ3B 3LHPL 5E1AB 4JKPH 4X4ZA 2O93L 5I6XC 3LQAL 2FECL 3FO0L 3ZT5A 2A9NL 2P5WD 3AVEA 3LRHA 5HYJE 5SV3A 3QWRA 3P40A 1EEQA 1Z2KA 1JWUA 2B0SH 4I5BA 5E2VH 5FM4A 2D2OA 3K7UA 4G43A 3BRDA 2W1NA 3NGBB 3PIQA 1ETZA 2E7MA 4A6YB 2N7BA 4X99A 3RDTB 5FCUH 2Q3AA 3CDFA 1H15B 3T4AB 5GRWA 2VXQL 2QQKH 4XWGL 4PJ8A 2QBWA 3H3BC 4NO0A 2DKUA 1T0MB 5CZVL 5BS0B 1R5VA 4PJFE 1DQQB 3SKMA 3VFPA 4JZNA 4E9LA 1MWAL 2YA1A 3HZYA 1MPAL 1M7IB 3I50L 3HAEA 1P69B 1R3HA 5DSCB 4IIQB 3KYMB 3UTTB 1PG7W 5J11B 2OR8A 4DFIA 3VRLF 1OW0C 3MLYH 3ZLQC 4YHOL 5LGHH 4KC3B 4U6XA 3P0YL 1FZMA 4OBRA 5GGSA 1B4JH 1Y6KR 5BV7L 2VL4A 3MRNA 1BZ7B 2C4FU 4L8SB 1MRFH 4X6BB 4RCAA 3X3FL 3QWOB 1BREA 4F57H 1XFPA 4L8CB 2BMKA 3CH8A 1HZHL 1FHGA 2J88L 3E2HB 1KELH 3MV8A 3K80A 3QXDA 3MRCA 3S3SA 5DFVD 4U05A 1CLYL 2CLVA 4N5UA 1AE6L 2RJMA 4Z8FH 3ZKMD 3NN8A 5L7XH 1L8JA 4P2RB 4DWHA 2EYTB 4LLVA 1PGRB 2VLRE 4HMCA 5HHQB 3FHQA 4KI5D 3PWPD 4ODUA 4CADB 1N59B 2VQUA 3DWTA 4P23A 5CEZL 4EOWH 2JKXA 1XGUA 4HWBL 4EIZC 4K3JL 5I1KL 1OAKL 1B0RB 4M5YH 4NBZB 5JDSA 5FIEA 4ZO7A 3TO4A 3OAUL 1V7NL 1PQZB 1YEDB 4DVRH 1T03L 4ZD3H 2AXGA 1LK3H 2I07A 2WWMD 1GC1C 3O6KL 3PWNB 2AS5M 1R0AH 4FNLL 1MRDH 5TGBA 3DLQR 2P24A 3HG1E 4HJGB 1MCSA 4J23A 4M1GL 1WBXB 1P4LB 2ZSWB 4WHTB 4FQJH 1TJIL 2J8OA 1GAFH 5TFSH 5I8OH 3WO3B 2NX5D 3GM8A 1QSFA 3WLWD 3VDAA 4F7EB 4KU1A 3N85L 3RWCA 4LFHG 1XF4A 2GITA 4JY6A 5SWSB 5HI5C 4FOMA 3DHJA 4TOYL 3CSBA 4OTXH 2J7LA 4MA8H 4QRTA 1N5AB 4HUUA 4LLUB 4K9EH 1LEIA 3BD3A 3VWJA 4BJLA 4Y4HB 4PPTA 5D5MB 2X70B 2NMSA 4U1JA 3WUWG 3LMJH 1K8IA 3CFIC 1NFIA 5I76A 1N6UA 4X6EA 2HP4A 4G3YL 4S2SA 1HQ4B 4Z18A 5D7LA 1MFEL 3IU3B 4HZAA 4NQEE 5C0BE 4JRXA 1SBSL 2HFGL 1AO7E 3KJ6H 1XCQA 3VXUD 4PUBL 4P9MH 4XAWL 2A1WL 3OKDA 4BSWA 2GEEA 5HHNA 2R0ZH 1P7QA 2W9LA 5JIHA 5HVWA 4JFHE 4HAGA 3HMWH 2SEBA 4JLRA 3VXOB 5IBTL 1D6VH 3BJLA 4XNUL 2BNRE 2UYLB 3THMH 2Y07H 5FUOH 3DYOA 4GG6B 5IB2B 4MNHA 4GMTH 5MEQB 4Q2ZB 3DURB 1NJ9A 2XA8L 5TF1L 5DXWA 3EDEA 3WS3B 4KKLC 1OPGH 3U36B 5D7IB 2FWOA 3OKKB 3GFUA 3CSGA 4PDCE 5C07D 3NOIA 3VG0L 2DJSA 4M6NH 5C71A 5DMYA 1UEMA 1HINL 4XNMB 3FB8B 3QIWC 4XNZC 4TVPD 2FJHA 2CDFB 2ZOLA 4JDTH 3W9EA 3B2UC 3KXFB 1F3RB 1KTLA 2WY3A 2IADB 3MZTA 3VXNB 1JWMA 3HA0A 5E8NB 3BRGC 3VXMB 4D8PA 3MMEB 2NY6D 5DK0B 5GGRY 5DEFB 5FUZL 3HPJA 3QIUB 4UTAH 1QFWM 2P5WE 1BBDL 3CC5A 3MUZ1 4ZYKB 3C60C 2CKBH 4JQVC 3JTSB 2H32B 4HIIB 4M6AA 2HMID 3B9KC 3CMOL 3DX7A 1IEAB 4E5XB 2ZJSL 3U4BL 3IFOA 3ECBB 5EO0A 1T22B 4B0MM 3BW9A 2EDXA 5D1ZC 5L2KB 2YZ8A 3VH8B 1X6LA 3HE6B 3RWIA 3WFCH 3FZUD 4FFVD 4Z5RB 2WIIA 4IS6B 4H88L 2XIDA 2GIYA 1CGXA 2HYMA 5DRWA 2MCPL 4PR5A 4PTTB 4E41B 1RJYB 12E8H 3I9GH 4LPYA 1VHPA 4L8DB 1GGIL 4C57C 1KULA 2AJYH 4TULL 1NCCL 3D3VA 2XY2A 2HTLD 3MRLB 4Q6IC 5C0GA 1XH3B 3L3IA 1IC1A 4FZEH 4IJ3B 1IT9L 2MTPA 2DLEA 4MDIA 4I4WA 3IJSB 5JOPD 4G8FA 1MH5B 3GJFB 4EI5D 4XWOC 5C0EB 1QR1B 3A6CL 2MNUA 4F7TA 3CMGA 3HZMA 3OSKA 4UBDC 3QUXD 2H1PL 4GXVL 4EDWH 1N6QH 1A6AA 3QZWB 5TDPB 4LQ1A 3UYOD 3QP3A 3QDMA 2ADGA 4URTB 4GAFB 4QGTA 5EC2A 4U1MA 2X9WA 2EE3A 5EORH 3LIZH 4H8WL 1VPOH 2JF1A 1D5BB 3HUJA 2XFXB 5EU5A 1PX4A 2YWZA 2CMRH 3AU1B 1NUNB 4OV5B 3C9NB 1I3RA 3B8YA 4OZHB 1CL7I 3T4YB 5D1XB 3NIFF 3RGHA 5D2NE 3PWPE 4WV1A 1AGDA 4JO2L 1E6JL 5JXAL 3QXUA 2A73B 2C1OB 2G60H 1TPXB 4AY0A 4MB5A 4FQLL 4KV5F 1FVEB 4N8VB 2FD6H 3WXVH 3RWJA 1T1WA 1ZVSA 5HHMB 3ULVC 1FGNH 4Z7QF 3HE7A 3MLWH 4P5KA 1FVCA 1UJ3A 1C5DA 4Z7UF 4YWGL 2GT9B 4S1DC 4XCEB 3BPNB 5FYLL 4M61B 4YFLF 3KPRD 2VXTL 2CRIA 1JL8A 1J1PH 5EU4A 4LPTA 3SOBL 5T1LA 4TRPL 1BQLL 3U0PB 4KK5D 3UJIH 5AWNH 5KJRH 1U3ZA 1A21A 1UB6B 4U6VH 4HPYH 4X4YB 2NY2B 2X1PA 4HEME 4HSQA 1IQWL 1U91A 1NEUA 3OX8B 2NX5E 3EJJX 4ZSOB 4OF7A 2FLRT 4ALAL 1G1CA 2XQBH 2IF7A 3H9HB 4XNYH 4Z7UA 2P4AB 1RUQH 1I8KA 4TQEH 5LXGH 2YK1H 2BVUA 5FO9B 3UP1A 1I9IL 3LS4L 3JVGA 1FCCA 2MMXA 2VSCA 4PRHE 3MOBH 2CRZA 1J05A 1NDMA 2W0LA 3H0TA 1B0GB 1WF5A 4PRIA 5A3IC 4NKQB 1MAML 2HFEB 2VDML 1T4KA 2IAND 2DKSA 3OR7A 1A6PA 4GG8A 3GO1L 4JPIB 4D94A 1DN2A 2YD2A 2PCPA 5DVKA 2JCCF 4HFUL 2AKRB 1WZMA 2MPAH 5F72S 5CEXB 4Z7WE 5GGSY 1WT5C 2FLBT 3GUTB 3SDXE 3LDBC 3KNBB 1MUJA 3GZKA 5HTSA 3MRMB 4FTVE 4K7PX 3EYOA 5FO8A 3MODH 3Q5TA 4F80A 4EVNB 5SX5H 5T3ZD 1OSZA 3TPUA 5I9QB 1NFKA 2YR3A 3DUSA 2Y5TA 1WC7B 3MBEB 2ICWI 3GI9L 2HN7A 4PYHA 4K7PL 1UXWA 2JCCA 5LAXA 2WUCL 3LKSB 1KPUA 1AJ7L 4K3EL 1T2JA 1ONQA 1VSCA 1M4KA 3JBG7 5DD0H 2JIXB 3MBXH 3QUKB 1L6XA 2V7NA 3ULUL 1IGCL 5HYSA 2HFFA 4H5SB 3IVKB 5KSUB 4TVPH 4FN0A 4JZJA 2VL5A 4ZOAA 5C0JA 4XPTH 2BFVL 1ZHLB 4KJQC 2OK0L 3TYFA 2KH2B 3BP5B 1UACH 4NO3B 5CJQL 4TVPE 1OARL 1JNLH 2Z35A 3LEYL 3N9GH 5DWUH 3GM0A 3K8KA 1AP2A 3RGVB 1EO8L 5CBEB 4JPKH 1TVHB 1T1XB 2NNAA 1OQOA 2ZUQB 3AXLA 3NFSL 2OJEA 1FBIH 4TUKL 3ARFD 2P8PA 3ARBA 4WY7H 2RAMA 3T1FB 4KJWC 5FYJU 3PGFL 2FH6A 4HV8A 4LPCA 2ZNXA 2OX5A 1CD1B 4ZUUB 1BWMA 3G5YB 4P2OC 4LRNH 1P1ZA 5HYJB 1Q9KA 3GSOA 1B9ZA 1KEGL 3QT2A 3MRHB 5I1IL 4FP8L 1I7TA 1KTKE 5D9SA 4D9RE 4X9BA 5IEHA 4GW4B 1H5BA 2QSTA 2NY1B 4KROD 3V0AC 3T2PA 4K2UH 5LGKA 4QF1B 4ZPTA 5EUOF 4JANA 3EYVB 3MLUL 1REIA 1D5XB 4PGZA 3KPQB 3VFVA 1FQ9C 4IRSB 1FRGH 3FKUS 1AIFA 1JPSH 3HC3L 2C3XA 3CX2A 4WI5A 5ECJE 3Q6GL 4OFYA 4PJFB 4I9WE 4ZOBA 4PGCB 1VGKA 3V4PH 4Z77A 4IRJD 1BOYA 3LZFL 4I48B 3S37X 5EUOA 1WAAE 5FXCH 4B53A 1CXKA 2ED7A 5JOPE 1OGAD 5F6HJ 4PLJD 3WKMH 2YPVL 3VD4A 3QHZL 4F9LC 4OI9A 4FQXA 3O45B 2DTSA 3C5JB 4BKLB 4GBXD 2H8PA 2R39A 3S37L 2ARJQ 2H9GA 4JKWA 4ZXBB 1BWWA 3FCTA 4POYA 3MACH 2CXKA 3O9WC 1AR1D 4K71B 4MD0B 4YJZL 1U0QA 3CXHK 4H0IA 1L9MA 3D25B 3OF6D 5ACZA 4N5EC 3TA3C 5F9DC 5D7KD 5FO7A 2UWEF 4LBEA 2I25N 3BKCH 2UUDK 3FMGH 4PJ5D 5EUKB 3CK0L 1UM4H 2NY3D 3S4SG 3FT3A 4U0RB 3WFEL 2QADC 3LEVL 3PJSA 3QHFH 5IQ9B 3AMLA 1DQLH 1IARB 2QQLH 2VLRB 1A5FH 4XP6L 1K5NB 3CVHL 2UWEA 5KSAB 2VJXA 2Z91A 4NGHL 2XZCL 1HKFA 3TVMA 4R26H 2DBLH 1BJ1J 5CGYC 1J5OH 4DN4L 3OAZK 1EFQA 3VGBA 1IC7H 2YPLA 1KB5L 1S5HB 5MHSD 3WIIH 4LCWA 2IQ9H 4XVSL 4I77H 5CKAA 4X4XA 3MRQB 5B8CB 3W81A 2YD9A 4HIEA 4MD4B 3WN5A 3W2DL 3DIFB 1F3DH 1ZOXA 4OD3H 3CGTA 1HYSC 5LQBL 4S0TD 3VE0B 3FN0L 1N4XH 4JFED 4OIBA 5IOPB 2YD7A 1VDGA 3PP3H 5GGVL 2PYED 1D5IH 1NMAL 3NACL 5AZEH 1NMBH 5EZOL 1LO3L 2IANE 4O5LH 3EZ8A 1Q0XH 3S3PA 1OAUH 4LCYB 4M6ML 3NBNA 3QXWA 3O41B 1HDMA 4P9HL 3GSVB 1S7XB 1FGVL 5FYKD 2XOTA 4NJ9L 1NC2B 4CDHA 4O2FB 1H3PL 5DK2A 4I2XA 1FO0A 1CE6B 4FQHA 3DMMD 1Q94B 5T3ZH 2YRPA 4FFYL 4P2QD 5IW1B 2GUOA 1K6QH 2EDOA 2OMNA 2CLZB 5GS1C 3SY0B 5T3ZE 4ETQA 1VENA 3TFKC 5CLWA 4WI6A 1RURL 5L8JB 1EJOH 3NA9H 4LU5H 1RIUH 3QRGH 5HHPA 4MNGE 5C2UB 3SGKA 2FEEI 3SDDC 4P4KC 1AR2A 1LD9B 4O2CB 1WWAX 2Q87A 1AKJA 2OL3H 3BKYH 1S7QA 4IOFD 4FZ8H 4ODXB 4PV8B 5D4QA 5HHVH 2C5DC 3W9DB 1TMCB 2VZ1A 3JV6A 5EIIA 4O02L 3QIBD 3ULVL 1CVSC 5ABDE 1BVLB 4GRLB 2AQ2A 5EN2A 4RIRA 3KYOB 1PSKH 4JR9L 3MLSL 4L9LB 1PKQA 3G6AA 2MHAB 3BISA 1R5IB 3L3DB 4IIQC 2PO6A 1HKLL 5B39A 1KNOB 2BJMH 1JZ7A 4Y2DA 1BIIB 4NDMA 3EYUL 1S7UA 2P5WB 3MJ6A 2YOCA 2VISA 4HFWB 1XIWC 1IGIL 3DX6B 3WD5L 5F21B 3NIGF 2XPGA 2B8OT 2ZG2A 4MAYD 3EIFA 5T1KD 1HHHB 1X7QA 1KC5L 5FKAA 5MENA 4ORGB 1YN7A 3V5KB 3SE3A 2GFBB 5KVGH 3I3EA 3P9MB 3L7FB 1U8OA 4HG4K 3CH1A 1MY5A 4OCSL 2VDOH 3DOSA 1P2CB 5ISZA 1EK3A 1P4IL 4JHBA 3DO7B 2O5YH 5BOZG 3MLTA 5CGMA 5I8CB 3KPTA 1A6UH 4PRNA 1IKNC 5KSVA 4ERSH 2G2RA 3GSUA 3IAQA 2BVOB 3QJFA 5CD5C 1RJLB 5D6CA 1Y0LA 4WW1A 5DFWH 1U92A 4QXTA 3LVEA 4JDZB 2VXVH 3LKQB 3NPSC 5DDHB 1JZ6A 4PJBE 1U42A 4K8RC 1EXUA 4G6AC 1FZJA 1UZ8B 3CXHJ 4U31A 4LASH 2R29H 3K8MA 1KCRH 3MX0A 4LKCB 3VJ6B 1U8IA 1KPVB 5KS9F 4TPRL 4DEPC 3EJZC 3NMEA 2BNUB 1RZJH 3KJ4B 2D4FA 1KB9K 2JELH 2VLLA 5D7KE 5CMAB 2RFXB 2CH8A 2P7TA 1MNUH 4TUJB 4M03A 1G7LB 2ITDA 1QFWL 1LO0L 3G5ZB 1Z3GL 5IVXB 4V1DA 5DC4B 2O5XH 4GKZB 4H26B 5BO1L 5J7CC 3VFGH 5L0QC 4C59B 4X5WA 4DN3L 1MJJA 1FL6B 3BH9A 4M1CD 3FOLB 2ZCKH 3CCHA 1CL7H 3WXWH 1OWWA 2OTUA 5HJ3B 1RU9L 3GSNA 3U4AA 2MJWA 2HVJB 2Q6WB 4S1QH 3KLHC 5J6GA 32C2A 5IF0A 5D2NB 3PWPB 3LQMA 1UA6L 1N5YL 3O4LA 4H1LG 1JGEA 3B4NA 4HGKC 1QSEA 3OKOA 2IAMD 3CFEA 2R4RH 2ZP0T 1RIHL 3HAEG 5GS0D 2QSQA 1QYGL 1T21B 1MLCB 4XVJH 4NKIH 3PDGA 2EO1A 5MHSE 43CAA 4WI2A 3A67L 5BXFB 1UEYA 3HB3C 4HDIB 1MF2L 5HGGS 2FO4B 1HXYA 1VKXB 4NRZB 2YRLA 3FAXA 2HA1A 5FB8A 3H3PH 3RL2B 2ZPKH 5J12B 4EQ2A 1MCOL 8FABB 1J86A 4P2CG 1LEGB 3KYKL 1N6VA 1IAOA 3TT1L 3E0GA 3AC0A 1G7HA 4JFEE 4C56D 1A4KA 3MCLH 2V9QA 4OIAA 1MCRA 2NX5B 3QQ9D 2PYEE 1DBBL 4NKOB 3UYRL 1SJXA 4NQDD 5L6YL 5C0RL 2PXYC 3BSZH 4NT6B 2GCYB 2WANA 4Z76B 5MEPA 3V4VL 3KPLA 4JEGB 3RWGB 5FYKH 3MV11 3P9LB 2IPTH 1T2QL 1ADQL 1A6WL 3OV6A 1C1EL 3V0VB 3ZE0F 2A6IB 2XZZA 2FX8H 5FYKE 1IGML 2F54D 2DDQH 1NCNA 4WDIB 5EPMA 3S5LA 1GSMA 4P2QE 4XX1E 3WNOA 3CU7A 1RHHA 1ZA6B 4OBSA 1JGVL 2ID5A 2IMNA 3VXUB 5HI3C 3VFRA 4BQ9A 4Z7WB 4WWKD 1CD0A 4PJ9D 3SDXB 5IB4B 2XWJB 1YYML 4FG6D 3UTPD 4FRWA 4ZAKA 1FYTD 3MA7B 5D1QD 5DRNB 4EZMA 3G9AB 4PJDE 3RDTA 1U9KA 2LV4A 3BIBX 5EOCJ 1A6TA 2QJDA 2D7NA 1E4XI 5E56A 1WZLA 4Z9KB 1DBKH 4E0RA 1RK0B 4ODTH 5E00B 3PG2A 1UM5L 5BS0A 3VGEA 3ILQC 4NCC1 2ICES 1MELA 4OLXH 3AGVA 3SN6N 2CJUH 3LQZB 4CJ1A 5C07B 2VXSL 1SJEB 1JTTA 3PL6A 4ONHB 3UO1H 4I18B 1AI1L 4DFHA 4NC2B 5IK3B 2PW1B 5DSCA 3KYMA 3ELAT 4XNQA 4HKJA 4OSUL 4LNRB 1OTSC 4BZYA 2Q7NA 4ZNEE 2Q86B 3NCJL 2KPNA 1IVLA 1WIOA 2NY6B 3TO4C 1A1OB 1EUTA 4KI1A 3F7PC 2YPKB 1RJCA 1ZLVK 3GRWL 3K3QA 5F9JB 4JREB 2X1WL 3LKNB 5GRZA 4OLVH 1IKFL 1BD2D 5AEAA 2EC9U 4X6BA 1XMWA 3P4MA 4LLAA 3LB6C 5T1DH 4HG4J 4UU9B 2Z92A 5BJTB 3RY6A 4L8CA 5E2TL 4KJPC 1KN2H 4MLSA 2J6EA 3E2HA 1V3MA 1BP3B 4JFQB 3U4EA 4EEEA 1N64L 5T5NF 2YBRA 5E5RB 5LVEA 1G7IB 3E8UL 1NGXB 4G7VL 3MNVB 4P2RA 2EYTA 4P3DA 1RUKH 1F6LL 3RRQA 5HHQA 5C9JA 4HMEA 4DGYL 2W65A 2WBJD 3WS6C 2CIIB 4CADA 4D0BB 3VXSD 2RBLA 3BKML 3VWJC 5DR5H 4GKNA 1B0RA 4KTYA 2DMCA 3KPSA 4HAFA 3NZ8B 4NQXB 2ZUWA 5FM5O 1NGQH 5C6TH 1T5WA 4UT6L 4HXAH 5CZXC 1FNSH 4EUPG 1IAIM 1F11B 4EI5B 5DURD 1EHLL 3GSXB 2EIEA 2HG5B 2IPKB 2BSSB 1GOGA 3QUXB 2ENYA 1I8LA 4YE4L 1P6FA 1FFNB 2ZSWA 3KGRA 3PQYA 2NY7H 4OF6A 3BP4B 4U0QB 4WHTA 4PP2A 4ZTPL 4P3CH 5D5MF 2YD5A 2FHBA 1XF3A 2ATKA 4EBQL 3MLPA 2L7JA 1PJ9A 1Z9LA 2EC8A 1KCVL 5IFJB 4UOW0 1YJDH 1YNTB 4L8BB 3GHBH 5SWSA 3SCMD 1Q1JL 4PG2A 4LSTL 3IU4H 5ILTL 4LLUA 1YEFH 2B5IC 3RP1A 3MGTB 3O8XD 4NIKB 1G6RL 2B1AL 4CKVX 3CFJA 2XZAL 5GS0H 4XCFH 5E9DD 2DIAA 1HQ4A 3TJHD 5HYQB 3MJ7A 4YDLB 3IU3A 5H94B 3REWB 3UEZA 5F9WB 1UVQA 4GG6F 3UAJD 2V5TA 4OCWL 2HLAA 2BSRB 1MCNA 1XCTB 2YWYA 4XC1L 3SHSA 1MFCH 4OFVA 1LO4H 4XB7A 5D7IF 3VA2C 3KPRB 3OL2A 3UMTA 2DM7A 5T3XH 3SE9L 1CR9L 4CRPA 4EN3A 2X4NA 5F89B 3H7LA 3N06B 4KK8C 3C6LA 5CIPH 1TETH 5I9QC 1KJ3H 2UYLA 3Q3GB 3O6LH 3LS5H 4OM1H 5CEZD 4C56E 4GG6A 2V2TA 2VTFA 1N3NB 1TNMA 4G9FD 1I7ZB 1Q9WA 1ND0A 4YQXL 4NQDE 5CFHA 1KCGC 2I5YH 1WBYB 1OTTC 3FO9B 1Y6NR 2WP3T 4JY5L 1ZK9A 3S9DB 3U1SL 4M1DL 3VGAC 2W38A 1FLRL 4L4TD 1VGEL 4XNMA 3FB8A 2HRLA 2V9RA 3DV4A 3VA6A 2CDFA 3T0EC 3KXFA 5HI4C 2P5ED 4YHLL 5FK9B 2IADA 4KAQH 2IANB 5ANMB 2F54E 1XGRB 3MMEA 3G5VA 5DK0A 5DEFA 5J56B 1X5JA 3QIUA 1T1ZB 2X44D 3REVA 1HHGA 3N1FC 4YUEL 5FUCE 5KSBB 3KVQA 2Y6SD 1NCAH 4ZYKA 2BXYA 1CS6A 4X7SL 1T04B 1CFVH 4FQ2H 3B6SA 4HIIA 3UTPE 2PKDA 3JWOC 4N9GA 1FYTE 4LCUA 4KY1L 3CDGB 4POUB 3DYPA 5I30H 3SDYL 2AV7A 3MA9H 4LEOB 5JZ7D 4PGEB 4GMSH 2OR9H 1T22A 3QUYA 2EC9T 1Z0NA 3VH8A 4MNGB 5SWQB 3HE6A 5CCKL 2Y23A 1KCUH 4ODBD 1UWGL 2GSGB 2C7UB 2Y06L 1VFMA 1KYOJ 1R24A 3EDKA 1FFOA 1A1NB 1RAMA 1U58B 2M2DA 2DQHL 4LLQB 1RJYA 4PTTA 4E41A 1IM3B 4ZFFB 4TSAH 4L8DA 5AUMB 4C83B 4NQTA 4UIKH 4XCCL 2OXGA 3IJHA 2A83B 3MRLA 4APQC 1OSPH 1F90H 1NCBL 3F7YA 4Z7VE 2B7DT 3OWEA 5H37G 4BH8B 3P11L 1MH5A 3GJFA 4M7JL 1QR1A 1FN4A 3ARFB 3SKOB 5CSGA 2B20A 1MJ7L 2R0KH 1BD2E 4J4PC 1KIPB 5EBMA 3UJJH 1E28B 4OZHF 2ORBH 4WW2C 4PJEA 2X4UB 3HLAB 5TE7H 5BW7C 5TDPA 4XCYA 4ZOEA 4ZXBC 5IMKA 4CNIB 2JTDA 3LHPH 4C4KT 1PEWA 4YHPA 3LPFA 3GJFK 4OLZL 2ENSA 2XFXA 2D7OA 3MREB 4R4BB 3LQAH 3FO0H 4KROB 2A9NH 1AGCB 2HVKA 3RPIB 3C9NA 5IVZA 4PJAB 2FL5A 2ICWA 3CLFL 3T4YA 3LD8B 4JJ5B 5HPOA 4MNQD 3QUZC 5TDNB 3ZZ1A 5E0QA 2NTFA 3JUYA 1ZSDA 1AC0A 2W0FB 3D9AL 4PJCE 3JVGC 1ZHNA 5F88A 3H7BB 3VXSE 1FVEA 3RX8A 1FFRA 3KWWA 4NO2B 3R8QA 3BD4A 4FFWC 5HHMA 1MHHA 2VXQH 2YUWA 5I8EA 3QCVH 4IRJB 5DJ2B 2F74A 2GT9A 4XCEA 5GJTL 3SE8H 5JA8B 3BZEB 1E0OB 4M61A 2A0LD 1DVFD 4QNPE 1OGAB 5CZVH 4PJBB 2VDKL 1Q72L 3ZHLA 5F3HB 5BZDB 1F4HA 1HCFX 4XH2B 5CUSH 1QBLL 4GBXB 2CK0H 2XY1A 1MPAH 4G8EB 1DL7L 1UB6A 3I50H 4WJ5A 2NY4C 3ILPA 2E7LE 4NNYB 3RPKA 3OX8A 1F6AA 1HSAB 3H9HA 5AYQA 5JXED 4ODWB 4YHOH 4KTEL 3F5WA 1ES0B 3D48R 3HI1B 5EU3B 4DQOL 4GAYB 1QBAA 5H2BB 5BV7H 3MLVL 4PJ5B 4RGNB 3LPWA 5CJ5A 5MEOA 4V2CB 2V6HA 4NQCD 2NY3B 3X3FH 4LHUA 4TNVF 1B0GA 5JPMA 3O3DB 4QRRD 5CHNA 1BX2B 5F97E 1ZHBB 1UCBL 1HZHH 3C8KB 3IDNA 4JPIA 5E9DE 3QCTH 4LCCC 1JHLL 3EFFB 4YPGA 3RNKB 1AE6H 4UINL 4I3RL 2P8MB 3V5HA 4NHCL 1OAYL 1A0QL 3BHBA 4ZMAT 1IAKB 1JGDB 4NWTL 3O2VH 1X9QA 3MRMA 3QFJD 5FHBL 2YD4A 2OZ4A 5FV1L 4EVNA 3CAFA 2APVA 1GRWA 5CEZH 2JJUA 4HJ0C 4LSQH 4HWBH 1Q9LB 1WC7A 3IS1X 4UB0H 3MBEA 5I1KH 4PJXE 2WLZA 3VWKD 3TNMB 1IQDA 2BHUA 5CEZE 2EE9A 3LKSA 2QHRL 3IDGB 5KANG 4NHUA 3UDWA 5HY9B 1AD0B 5JORB 1EFXA 4ELKA 1V7NH 4G9FE 4TNVK 1H5BC 1DUZB 1F4AA 1DUYB 2JIXA 1T03H 2J5LB 4DKFL 3QUKA 4JFEB 1Z5LA 4H5SA 3O6KH 3A0OA 4FNLH 3UTQB 2PYEB 3MCG1 5FYLD 4AZ8A 1ZHLA 4M1GH 3BP5A 1D5MB 4OT1L 1TVBB 4L4TE 2CRYA 1CGSL 3NCYP 2P5EE 3CSYA 3F7VB 5EZIL 1RPQA 4ZQKB 3B3IA 3PE9A 3VCLB 5IBUG 3RGVA 1K8DB 2C4XA 5CBEA 3BZ4A 5AD0B 1G7QA 1T1XA 4ODHL 3N85H 4WI9A 1P9MC 3T1FA 4H25B 4FS0A 4TOYH 3DMMB 1YC8A 4B41A 5DUPL 4P2QB 4ZUUA 2XKSA 4L1HA 4ZUVB 5EWIL 5C8JA 3MRHA 1VFUA 4PJHE 4JAMB 2DLFH 4PJFF 4NNXB 4G3YH 2FH8A 4GW4A 1CICA 4YBHA 1MFEH 1OD7A 2CLRB 3O3BB 4HLZH 4JB9L 1SBSH 2HFGH 3FQWB 3FN9A 3EYVA 2GJ6A 2X4TB 4XAWH 1HHIA 1D5XA 3IT8D 1AY1H 3TV3H 2CXGA 3LV3B 4IRSA 1NMCC 1V3JA 3AY4A 3I6KB 4MS8D 3BPLB 3L3GB 3RTQC 4X6CB 3OG6B 5D8JL 1JPTH 5IBTH 1BGXL 1I1AA 4XNUH 2GTZB 3SDAA 2OTWA 3QIBB 3L5XL 2Q20A 3WFDL 2HRPL 2NQCA 1MCPH 1TZGL 4I48A 3U7WL 4BZ2L 3S8WA 1MIMH 5FM8A 1FJ1A 1U3HA 5TF1H 2K9UA 2I27N 3OGCB 3O45A 2BCKA 5JIPA 3C5JA 4YGAB 5DD6A 2BOCB 4U1HA 2XKNB 5LWYL 1HHJA 3ULUD 4LVOB 5F8QC 4L4VD 4CMHC 1K2DA 3WO4C 2Y7QB 3CIQA 1N7ML 3OQ3B 4XMKL 5I1JL 4MAYB 5T1KB 4YXKL 5E2UH 4N0YL 2AK1L 2X5PA 3KJ4C 4KPHH 2AEQH 3MJ9A 5FUZH 2OSLB 3WN5C 9CGTA 2XYCA 1CBVL 4PREA 1J0JA 1BBDH 4W70A 4KZDH 1IGYB 2VLMD 3DSFL 4MNQE 1FC2D 1QP1A 4NQUA 1ZANL 4MJ4A 3KYNB 4J3WA 5IQ9A 5I66B 4RWYH 3SGDH 3CMOH 3QG6A 1QD0A 2VLRA 3BKJH 1PAMA 3KPMB 3MRFB 4LGSB 3U4BH 4CMMB 4LSDA 1JZ2A 5I1HH 3DGGB 4R0LB 2EDKA 3HNVH 2HJLB 1DCLA 5IHUL 5DJYB 1PY9A 2X1XR 1M7XA 1GGBL 4NYLA 4H88H 1AGBB 4PG9B 4QY8B 3SGEI 3ZMRA 3D18A 3JWOL 5HI5D 5LCVL 3QB7C 2XWBB 5ICXA 5B39G 1BQUA 1GGIH 3MRQA 3QO0A 5B8CA 1X4YA 1D7FA 1A7PL 4MD4A 3DBXB 5FECB 1F97A 2WWMC 1O7VA 3VFWB 4YDJA 3DIFA 2PTTB 2AJSL 1CIDA 3DTXA 1IT9H 2B0SL 4XHQA 1KIRA 2DWDB 5EG6C 3KDMB 2XWTB 5CLTA 3A6CH 3RVWD 1DLHA 2CIKB 2QEJA 2VR9A 3IXAB 5FCUL 3WLWC 4AT6B 1X5LA 1P7HL 4IEFB 4QRRE 1HK6A 1AD9B 2IALB 2J1KA 3VFSB 3H6JA 2WINB 1INQB 2VZSA 4XVTL 2BRRL 1H0DA 4LFHD 2W9EH 4LSRL 4ELME 4Q7DA 5FGBA 1IBGH 1CE6A 2IAMB 1CF8L 3QFJE 1OP3H 3VI3E 5E99L 2MQCA 2CLZA 2DQDH 3C5ZC 3CX5K 2Q76B 4Y2DC 1MCFA 3Q6FB 4P0DA 5JXAH 5DJ0A 5J1AB 3L5JA 1WCBA 1C16B 4FQLH 1T3FB 1XT5A 3CSPA 5DO2C 1AHWC 3QIWD 1VADA 3B2UD 4OZ4B 5C0CA 3DX8B 4MHHI 3QDGA 2AK4D 4YWGH 1OOAA 1LD9A 1IAIL 4C56B 3SE3C 3DARA 1JYVA 5CIPB 2BSED 3SOBH 4AM0A 1BQLH 4PV8A 3C60D 1OP5H 4NQDB 3OR6A 2H2SC 4XMPL 5F1IB 3IYLW 1BVLA 4JO4L 3VRIB 4V2BA 1IQWH 3B9KD 2DJUA 1KG0A 3KYOA 4JG0H 4OKVA 4DVBB 4ALAH 3WJJA 1RZ7H 4L9LA 2R2BB 1R5IA 3A6BL 3ZDXF 3U2SB 5D1ZD 2F54B 4G42B 3PWLA 5F9OL 1I9IH 5IM7B 4QHKI 1BIIA 1BEYL 3FHAA 2NY6C 2VOTA 4QHNB 3RWEB 2VN4A 3DX6A 1MAMH 4JFOB 4WWKB 3OXRB 4PJ9B 2VDMH 3FB6B 3GO1H 1HHHA 1XR8B 4DVRL 2Q7YB 5J9PA 1CU4H 4DK3A 1LK3L 3X17A 1FYTB 2NW2B 5D1QB 4ORGA 5IIEB 1R0AL 5EZJB 2E27L 2A74B 5K9KB 2AJXL 1WUNT 5A40E 3U79A 2BNQB 3JTTB 4XWOD 3DO7A 4AL8H 4QRPD 2HLFD 3QWQB 4YPJA 1T6WA 2FSEA 4UBDD 3KHOA 5EO1B 5DYOB 3GI9H 3PXJA 4LRIA 5J4MA 1RJLA 1ZHKB 2WUCH 3T3MF 4Y5YC 1CWVA 3VFMA 3T77A 4CVUA 1AJ7H 3MFGB 4JDZA 4OZGE 5DQDL 3LKQA 1UKSA 4RZCB 1BQHG 3T2QA 3UC0H 3W11D 2KZWA 3ULUH 2JLLA 5IVXF 1IGCH 2FGWH 4B7IA 3LMJL 4Z7VB 1UZ8A 1JF1B 2BHYA 1K3ZA 3ORJA 4XCNB 2NLJB 2PF6A 3ULUE 1KPVA 3ARGD 3QISA 3S5LG 5CJQH 3VXTB 4TNWF 1BD2B 3KJ6L 3LEYH 2BNUA 3EO0B 5D96B 4UIMB 4KI5F 3BDYH 5BVPL 5C0ND 1EO8H 1SYSB 3QUXC 3I84A 2R0ZL 2Z4QB 3ULVD 3HMWL 4JKMA 4TUJA 1G7LA 5K59E 2R2HB 5IVXA 1JP5A 1EGJA 2MSPA 4GKZA 3VRJB 2VLME 3PGFH 4S1DD 3TBSB 1D6VL 2VQTA 3O0RH 4WTZG 3FOLA 3MUGB 1HILB 3THML 1GH7A 4WO4C 5FUOL 5HJ3A 1KEGH 2VDLH 5EZLB 5I1IH 3ZKNC 2HVJA 4GMTL 2Q6WA 4NM8H 3QUMA 1A9BB 5D2NA 4PJCB 4X6DB 2WBJB 5I1AB 5DC9B 4Y5XA 2D7MA 2VZVA 4ETYA 5TH2A 4FMFA 5A2KH 1CLZL 3VXSB 4BYHA 3MLUH 4M6NL 1OB1A 1T21A 2BVPA 4JDTL 3OMZA 2V7HA 1IGTA 4NZJA 5BXFA 3FT2A 4NRXB 4HDIA 3Q6GH 2FO4A 5DURB 4NRZA 1AGEB 3EOBA 4GJTB 4LIQL 5FKPB 4HIJA 2VDQH 3QNZA 4J3XA 3RL2A 2LU3A 8FABA 3LZFH 2LQRA 1LEGA 1Q8MA 2CKBL 4ZAKC 2VE6B 3LPGA 3NCFB 4RSVA 1NGWA 1MWAB 2W60A 5E8PB 2YPVH 1BMGA 4KKCC 4NFBA 5BRZA 2XT1B 3S37H 4NT6A 3SCMB 4ZUTB 3SDXF 1T80A 3MV7E 2CR3A 3P9LA 1WTLA 3WFCL 1H9VA 4P4RA 1XGQA 4NN5C 1G9NC 3V0VA 5BV7B 2A6IA 3O8XB 6FABH 3U6RB 3Q0HA 3FFCE 5E9DB 4PYGA 12E8L 3CK0H 2WQRA 4LK4A 4WFED 1KBGH 3VXUA 1A4JB 3WFEH 4JZOA 1GOHA 1YMMD 3LEVH 3QAZB 1YY8B 4RA0C 1PKOA 2XWJA 1DDHB 5MERB 5HVHB 1U8KB 1P5VA 4KJQD 4XP6H 5I75C 3CVHH 3UPRB 1EBAA 5F7NC 4C58B 5INCB 4NGHH 3EFDL 3RY6C 4Z7NF 2AK4E 4JQIL 1HE7A 4PJXB 4OUUB 5BOPA 5GS2H 1N6QL 4R7DB 5SWZA 3DXAA 3FRPA 1H8OA 5F7MC 4G9FB 1RK0A 4KJWD 4Q58C 3LIZL 5E00A 3LY6A 3MNZB 4WNQB 4XVSH 1HWGB 2C3WA 5C0FB 1KF9B 5C07A 1CGYA 4KRNA 4U3HA 5F6IB 1JYXA 2ZWLT 2FCBA 4ONHA 3W2DH 5I19L 2UVEA 5SX5K 1GGYA 1TJHL 4L4TB 1CD8A 5LQBH 4YO0B 2P5EB 4LNRA 2AJ3A 3UTSA 3C8DA 1FO0L 4XZUA 3K2MC 5GGVH 2Q3ZA 3QXAB 1IL1B 2DQJH 1NMAH 2FDBP 3TBVA 3LKNA 3WJLA 1LO3H 1VEOA 2H26A 2QLVB 4N8CL 4S1RH 4M6MH 5BJTA 1D9KB 5IBLC 4P9HH 1IGJA 1I8LC 1J88A 1FGVH 4NJ9H 4PJHB 5HPMA 4I0PA 4JFQA 2X42A 4OLUL 1H3PH 3UJIL 3GK8H 2P49B 1P4BH 4OCLC 4FFYH 1G7IA 4U6VL 4QRPE 1A6ZB 3KAAA 1FFQA 3EDJA 2XQBL 3HC0B 1RUQL 1IZJA 1XGTA 1RURH 2CIIA 4TQEL 2WBWB 4D0BA 3O9WD 2EEDA 4RNRB 2X4QA 3PABB 3MOBL 4N5ED 3TA3D 2BOBA 4M62L 3NZ8A 3VG9B 1RHFA 4MDJB 1IAMA 3OJVC 4BFGA 1NUGA 1P53A 2MWCA 1F11A 3LKOB 4EI5A 1MVUA 5I1DA 2IFFL 1CFBA 3GSXA 1LE5A 2QADD 2HG5A 2IPKA 4O02H 3C5SA 5T33L 3ULVH 2EYSA 1LWRA 3IDIB 1IFHL 2LAGB 4EXKA 4YIQA 3BP4A 4QKXB 1KV3A 1BM3L 4GBXC 3MLSH 4EN3C 5J6HA 2CK2A 3ULVE 4XPHH 5IMMB 1RK1B 3GB7B 1HKLH 5KTEH 3L5WB 5CGYD 1UADC 3ES6B 5IFJA 3DRTB 3GMMB 1R3LA 1YNTA 2BY2A 3F58L 1Y6MR 3JWDC 3WSQL 4L8BA 4FFEX 4RBPH 3BIKB 3BN9D 1G6VK 3BPOC 5B22A 1IGIH 3FQNA 3U7AA 4Y16A 3GSWA 3TP4A 2Z8WC 4ODVL 5DD0L 4QWWC 4ZFZB 1NGPH 3ARVA 4R3SA 4LEXL 4OCMC 3RKPA 4TVPL 4LP5A 4B7LA 3WHXB 2VKXA 5HYQA 4XPTL 2UZIL 1QTYT 2DQGH 4L4JA 2YMXH 2UY7A 5EU6A 1P4IH 2FIKB 3N9GL 1ACZA 4WWID 4TUOB 2VR5A 5ADPL 1DVFB 4YK4C 5IMOB 4PTUA 3KPRA 4JPKL 1VFBB 3WL9B 4YX2H 1FBIL 4OAWB 1LO5B 1QQDB 1RZFL 4XI5C 5DJXB 3RVUC 1OL0A 5BVJB 2JJTC 1FNGB 2R9HD 1QBML 3IRPX 1KIUA 3HCVA 1N3NA 1J9CT 1IMHC 3QUYC 2R1YA 5DZLA 1WBYA 1J18A 3TBYA 3FO9A 1WFOA 5KSBF 4P59L 1XF5B 3H9SD 3GSNL 4K2UL 3P73A 4LLMB 4NQCB 4O51B 7FABL 4CN1A 2UY6A 3TFKD 4NN6B 3MRDA 1NAMA 4QRRB 3DVIA 3RWHB 1WCQA 3MRIB 5FK9A 2APTA 4UT9H 5ANMA 5JNYB 1FRGL 1QFWH 1LO0H 1XGRA 2GK0B 1SMAA 1JPSL 3LN4B 4P46D 3VFUA 3QQ4B 5GPRA 3SDDD 2ICEB 1T1ZA 4P4KD 4DN3H 4ELMB 5KSBA 3V4PL 1RULL 3JUZA 5IB1A 1A9EB 1T04A 3QFJB 2BVQB 1PX3A 1INEL 5E8DL 3WKML 3I02B 1RSFA 3CDGA 1A02N 4U1LB 1N5YH 3UBXB 4LEOA 4PGEA 4Y5VA 1YQ2A 2VXUL 3VWKB 2AEPH 4BSVB 4DGVL 3VFOA 1QYGH 1BVKB 4GKOA 5T1MA 5A43C 1JZ8A 3A67H 5HGHA 5I6XB 1W72H 1EVTC 4OJFL 1MF2H 3BZFB 4ONGH 3BKCL 3FMGL 1A1NA 1U58A 1XIWD 5M95B 4LLQA 1IM3A 5EH1A 5JPNA 1ZVYA 5C09E 4FFZH 3D69A 1MCOH 3W39A 4IOFC 4R9HA 2A83A 1I8IA 3P30L 4LHUG 3BGAA 4QOKA 3QIBC 2X4OB 3CUPA 3BWAA 4OGZA 3BOVA 1DQLL 3H42L 4QO1A 1DBBH 3WFHB 1RZ8A 3ARFA 3K1KC 5L6YH 5C0RH 3LKRA 4PJAF 4RFOL 1K4CB 1KIPA 3OAYH 3V4VH 3T0WA 3ZHKA 1NGZA 4R26L 1LDPH 2XNAB 1F58L 2X4UA 2M8XA 3HLAA 4KMQA 1D6EA 1ADQH 1A6WH 2GYSA 3GMRB 3IFPB 5CD5D 1IC7L 2JB6B 3WIIL 4NJAL 3VDCA 1UM6H 2Y25A 2IQ9L 3BP6B 5FCSH 2LU4A 1AGCA 1JGVH 3O6ML 3L3HB 5E5MA 4EJ1C 4PJAA 3OGOE 2E9BA 1PG7X 1JE6A 4JJ5A 2X4PB 2GY7B 5TDNA 4PJBF 3VMNA 1R5WB 4HBCL 1G9NL 3NABL 5HVFB 2Q8BH 2A6KA 3EJZD 2E9JA 4Y19D 1VCAA 1D5IL 4X5LA 3DROB 3UZVB 1NMBL 1QRND 4JRYD 5KAQF 4X5XB 4TTDC 5D72L 5DJ2A 1UH3A 4OZIE 1JIBA 4QTHA 3PWJA 4OZFA 1OGAA 1UM5H 4G9DB 5GZOC 5BZDA 3JXAA 2FRGP 5F3HA 3UZQA 4XH2A 4YDVA 2F8OA 4QRSB 3L6FA 3MYJB 1RVFH 4G8EA 3RUGE 3KLHD 3EOTH 2ZOKA 3G08B 1KJMB 2J6EL 4L4VB 5CBAB 1OHQA 3KPPB 4KWUA 3GIVB 5ESQA 4J3VA 4U33A 3NCJH 4WEBL 1JF5A 1ES0A 3HI1A 5DQJA 3P0VL 3GRWH 5EU3A 4GAYA 4PJ5A 2D9QB 1RIUL 4MCYB 4PJIE 3QRGL 4ONFL 5GRJL 1IKFH 3ZO0A 2F9BT 3L9RB 4RMSA 4CVZB 2QKIA 5CP7B 3HB3D 3ZKQD 2M1KA 1N0LA 1WICA 4JFXA 1MQ8A 4LSUL 1BX2A 3QWRD 1CVRA 1ZHBA 1TJGH 3FQTB 1GZPA 3C8KA 1HI6B 4GT7A 2OL3L 2GSIB 4FZ8L 3I75A 4BZ1L 4BELD 3BDXA 1S8DB 3E8UH 4G7VH 1KENL 2FGZA 5KN5A 4NKMB 4MYWB 3DRQB 1WZ1L 4PJ8D 4DGIL 4G8IB 3NPZB 4DGYH 2LTQC 1SY6A 2PXYD 4HW6A 2DICA 3RHWF 5I15L 4FXLA 3HR5B 5FYJH 1E6OL 3KR3H 3DV6B 4XTRC 2BJML 2V2XB 5EFIA 4MA3B 1T7WA 1XR9B 5FYJE 1JMZA 3ESVF 5F6HI 1UKTA 2VDPL 1PZ5B 4X4MA 4WU5B 1AD0A 2CRMA 2NW3B 1CICC 5SX4H 1DUZA 4K07A 3EYFB 1JWSA 3M17A 4EI6A 4HWEL 3ROOA 5HXMA 4Y4FA 4HIHB 3TF7A 5HI3D 3H9SE 3UTQA 5F7UA 1MCIA 4NP4H 5CP3H 1F3DJ 4JN2B 4YE4H 4JFDD 2W59A 1D5MA 2PYFB 1TVBA 1HH6B 1DQTA 4ZTPH 4Z7OF 5FOBB 5A1AA 3F7VA 4PRDA 3VI4E 4MB4A 4EBQH 2O5YL 1I1AC 1EAPB 3SDAC 2VQ1B 3RNQB 5AD0A 2GHWB 1KCVH 1MCBA 1HH9A 1OWRM 3RHWK 2AW2A 4ERSL 3IJYA 3MV8D 4OM0L 1NDGA 5IG7B 1MAJA 4H25A 4WUUE 4YHKH 5DC0A 3ZE2F 3DMMA 1Q1JH 1U3HC 2DJ4A 4XC3L 3HZVB 4GSDL 4P2QA 1GZQA 2Z93B 3ILQD 3D0VB 2VXVL 3HHRB 5DA4A 2XN9A 3BZDA 1G6RH 2B1AH 4X6CF 3O2DH 4MD5B 4JAMA 4N0RA 3WUWB 5FUCC 4E42A 3U46A 2R29L 3MRJB 4HKZB 2EICA 4XNZB 3QIWB 2ICCA 3O3BA 2CLRA 3JWDL 5LJYH 4I8DA 1OTSD 2YZ1A 4ZODA 4OCWH 2X4TA 2AK4B 3CVHB 4GS7C 4HCRA 4XC1H 3SKJH 1UFUA 4ONOA 3TO4D 4FABH 2JELL 4OQTA 1ZA3A 3SE9H 4LSPH 1X5XA 3I6KA 2CR6A 5H8DA 2O5ZL 5E7FA 4X6CA 3GIZH 3C60B 3FO1A 2AJZB 3U48A 2O5XL 3LB6D 3VFGL 4OFDA 1HHKB 1KB5B 4GRWF 4UTBH 2ZCKL 5J0BA 3B9KB 1T2XA 4HUMB 3MLRH 3ZE1E 4KQ4L 5IV2B 4S1QL 4YQXH 4MSWA 5T5FL 3CPLA 3FT4B 4KZEL 2EH8H 5D1ZB 1HQRB 3NFNA 4HULB 3OGCA 1A3LH 4JY5H 1BLNA 2BOCA 3U1SH 1B90A 2XKNA 1CFSB 4H0HB 1JK8A 2ESVA 2WP3O 3O11A 3QPXH 3HZKB 2Y7QA 3ARDA 4HWZB 4YHLH 4XVJL 4NKIL 2JK5B 2W07A 1WTGT 3VWJD 3BUYB 5A16B 1J8HA 2V5YA 4NCC2 1IJ9A 4MA1C 2BX5A 3KPOB 5ITFB 4Q6IB 1JRHI 5HDOA 1GCFA 1OT1A 3H3PL 3KLAB 4YUEH 5D7LD 1CK0L 1IGYA 1T89A 5CZXD 3V52H 3VMOA 4X7SH 5BZWA 2ZSVB 3RJQB 3I6GA 5TDOA 3O4OC 4QRPB 4JN1L 4XVUC 4JGJA 3MCLL 5I66A 4KY1H 4Y19E 1TTFA 4DZBB 1P7QD 1Q38A 3LRSA 3D39A 3KPMA 3MRFA 4CW1B 1NFDE 1U8PB 4CMMA 3U9PL 4JRYE 3PHQA 1T83A 5GQBA 2XZQL 5JMOC 1A6VL 3NA4A 4ZO6A 5DJYA 5CCKH 1BIHA 5KVDL 3QO1A 4BQCA 5FGBC 1AGBA 4PG9A 4QY8A 3V4UL 2Y06H 2ZUXA 3U82B 4MXVE 1MY7A 2EYRB 4RMWA 2VDNH 2XWBA 4D2NA 2EIZB 5DK3A 5F7DA 2EDEA 1M7DB 2XRAL 3MRRB 3GEWB 1VFOA 4XCCH 5DD5L 3VFWA 4NC1E 3X14B 4F3FB 1NCBH 4UV4L 2PTTA 3OHXB 3QEHA 1ZMYA 4QRUB 4XB8A 3VXQB 3P11H 3ZKXC 3B2VH 3KDMA 3U9UB 4MVBA 3MROB 4M7JH 5JQ6L 4NUJB 4DK6A 5IHBA 4ZFOA 4KVNL 4XXCC 3SJVA 1YA5A 4MMZC 4AT6A 1BFTA 1CXHA 4L9DA 2VC2L 4HT1H 3JTCA 4P5MB 4HGMA 3BIAX 1AD9A 1DBKL 4KUZL 1FAKT 4QHLB 4HIXL 3EO1B 2WINA 2HJFB 3L95B 3KS0H 4ODTL 4OLZH 4NC0B 4HK0B 4Y2OA 5BV7C 4DOHE 1GGCL 4O9HL 1YNLL 4FQIL 4UI2A 1G7MB 3CLFH 4OFKA 4GQ9L 5ICZB 2BP3A 1QA9A 3V6OA 1OTTD 4HK3J 2J8UF 1CDGA 1U8NA 1ERNA 1P84J 2YUXA 1J11A 3W5MA 3TT3H 3HAEH 4M7LH 1I85A 1MRCL 4R4NC 3P4OB 3EW3B 5JLZA 2YEZA 3T0ED 1J87A 4OZ4A 5AAWA 4OLVL 1ZLUK 3O3AA 3ZYIA 2CPCA 5GJTH 1RJZB 4UNTA 3BX7C 2VDKH 3EOAA 2D7PA 1ZEAH 2DQFB 2J8UA 3LH2L 3LDBB 1QBLH 1YPZA 4L29A 4YEEA 5IW6A 3BFOA 3STZB 5E5UB 5ETUA 5CJOH 1U41A 3K4ZA 4OCNC 5F1IA 3VRIA 2GJJA 1CGTA 1LNUA 25C8L 2AGJL 3IKCB 1QVOA 1ED3B 4HLZG 5DVMA 5IMLA 3EOYG 4KTEH 3ULSB 3MV8E 3VRLE 4JE4B 2AXHA 1OF2B 3SGJA 4DQOH 4G42A 1KLUB 5D6DA 4BA8A 3PV6A 3MLVH 1ROWA 5EC1B 4DZ8A 1Z9SA 3TNNB 5DR5L 4FQQA 2JJSA 4GKSA 2OZ4L 5DHVA 1YMMB 3E1F1 4XP4H 1D3CA 4JFOA 4WWKA 4F7PB 3OXRA 1A7BA 3FB6A 1I3GH 1C7SA 1SM3H 3VXPA 4RAVA 1G7PB 1GL4B 1YMHB 3G6JF 3UTZB 1NBYA 4FQCH 4X6FB 4GQPH 4I3RH 5EZJA 5DTFB 4APQD 2A74A 3K74B 5JR1H 1TIUA 1OAYH 1YNKH 5FA4B 3QG7L 2YXFA 2NY7L 2BNQA 5JZ7C 4P3CL 1CGWA 4K7FB 4UDUB 3QRFM 2EH7H 4Z7VF 2FYYA 3VXRD 4HS3B 1F5WA 5EO1A 3X12A 5DYOA 5T1LD 5CD3A 4P2OB 2ED9A 3G6JA 5IVNA 3GHBL 4AENA 1ZHKA 5IW3A 2QHRH 5DS8B 2IPUG 4Y5XC 4RZCA 1I4FA 4RRPG 3RA7L 1GGUA 1TNNA 3BO8A 4DKFH 2VIRB 1NAKL 3O3UN 4Z7VA 5IROC 1JF1A 4X80L 4R8WL 3IB4A 1W0WB 3AS2A 4XCNA 5FDWB 1NCTA 2NLJA 3MLXL 3QUZD 4M8QB 3BEVB 4OT1H 1BD2A 3AS0A 1CGSH 1CGUA 1M6OB 1UB5B 5EZIH 3EO0A 4UIMA 4KRPC 4PRID 4PJCF 4X6DF 2X1QA 5K9OB 1CLCA 1MFCL 4FFWD 4ODHH 5F7YC 4XGZA 4W4NA 4JO3L 5T3XL 1MLBB 2A2QT 3GMOA 1I8MB 3NZHL 5D7LE 1OAQL 3S35X 1MREH 3G5XB 1LO2H 2EDLA 4JRXE 5DUPH 1KJ3L 1EPFA 3WMSA 2AXFB 3PUCA 1U93B 2C26A 1PYWB 4HUWB 4OM1L 3H3KA 4TN9A 5EZLA 2HT2C 3FRPG 3BT2H 4QNPF 3S35L 1FG9C 1A9BA 1MJUL 4PJCA 5I74B 4X6DA 3U0TA 2NY4D 3NIDF 4DCQA 3RZCC 4JB9H 3O9WB 1FNEB 3OZ9H 4LVNC 5JUEH 3HG1D 1MFBL 1JPGB 3TA3B 1U36A 3OJDB 1IGFL 1J12A 1H3XA 4OZIB 5EO9A 4OIIL 3GSQA 1BGXH 5EBLA 4WFFD 5FKPA 2QADB 5EULV 5K9JH 3R4DA 3L5XH 4HUVA 3WFDH 2DRUA 2HRPH 5HDBF 4JHZA 3WLBB 2KUTA 3RUGB 3F6LA 1OQXA 2K7PA 3GMLA 3QEGL 3HS0B 3MJ9L 4BZ2H 1CFVL 2D7QA 1MWAA 1ORQA 2B4CH 5KG9A 4NKDB 3OTTA 2F15A 5I30L 3MA9L 5HGAB 3A6OA 3EBAA 4JFPB 4KMTH 4OGAD 4F2MB 2NR6C 5C0BD 1JPFB 2FEEL 4ZUTA 2B39A 2JJVA 1NGYB 1AO7D 3P0GB 5IFHL 4HH9B 4HJ0D 3TYGL 4YXKH 2Z8VC 3O8XA 1KCUL 4K94H 4N0YH 3U6RA 2CGRH 4JFHD 5J89A 4UOW1 2YSSB 3F65A 3ZSSA 1BFOB 3TJHA 4HZLB 3VD7A 2DKMA 3DSFH 5CS7A 3MOQA 3GSRB 4PY8I 1A1MB 1VEPA 3S4SB 4F58H 2BNRD 1ZANH 1TVDA 4WI8A 1DDHA 5MERA 4R96B 1G7JA 1S9XA 5JTWA 5I17B 1DZBA 2R0KL 5KZCD 1VB9A 5INCA 3UJJL 3TIEB 3WNPA 3QI9C 4U6HB 4AMKH 1Q0YL 1SEBB 3D3VE 4AEFA 5F1NB 4R7DA 4I0PC 1GGBH 1A64A 1FG2A 4OD2A 1FZOB 4KGJA 1QRKA 2GTWB 1MOEA 3MNZA 3GI8L 4PY7A 5HHOA 5LCVH 3FAWA 4ZG1A 3FOMA 3AM8A 5HBBA 2R0LL 4WNQA 4JM2F 2XQYG 2FZ3B 1EV2E 4Y4KC 2R0WH 5DRXB 5GS1B 2EIBA 3H9SB 1A7PH 1DN0A 3QQNA 1Z0MA 4ZTOH 1CFTB 4N0UA 2AJSH 2XXCB 3QR2A 4HXBL 2QQQA 5I1LB 4P57A 2Z31C 3MV01 3VFNA 1L9NA 4N0FA 1JV5B 2CDEB 1WITA 5GSVA 1CXEA 1LDSA 4PRAA 3HUJE 5CSBA 5JHLL 2NXZC 3SDDB 2FJGB 4JO1H 4P4KB 2NXYC 5F44A 4M7ZB 4LKXB 4JM2A 1V8HA 4J12A 4HEPG 4RAUA 3QCVL 4JFZL 3LN5B 3RTQD 2P43B 4LHQB 5EOTB 3SE8L 4Z0BL 3R06A 4QXUL 4QTIL 4MJ6A 1D9KA 3WIFB 4XVTH 4LSVL 2ILLA 2BRRH 2C3GA 1X3DA 5ERWB 2J4WL 1ZLWK 4LSRH 3H9YA 5CUSL 4F33B 1HYRC 1NH6A 2CK0L 3D0LA 3MPCA 3QDJA 5DJCA 1CF8H 1G6RB 3QNXB 1JPST 1YDPB 4H0GA 5E99H 1KJ2A 3VGGA 1JNNL 1A6ZA 3HI5H 4J8RB 2PW2A 2A6JB 3VXRE 3NIFE 4RGOL 3HC0A 3UYPA 2YPLD 5GGRB 1WFUA 4OD1L 4PRBA 5C6WH 1XIWB 2FJFA 1IC5L 4LCWD 1XF1A 2HJKB 4RNRA 4MS8C 3QFDA 1BPVA 3T65B 2I9LB 5D70H 2VLJA 3QDHA 4YDKH 2J3SA 1DBAH 3PDOB 1KPRB 4Z7QE 3AFLA 1IAIH 4MDJA 2VITA 5IWLC 5HGBB 2DLIA 1LVEA 3LKOA 3QCTL 5ID0B 3EGSB 3GHEL 4XMPH 1F02I 5H37H 3PHOB 3PXHA 3MRPB 4U4BA 5DVNA 5BQ7B 4JO4H 4PRIE 3O2VL 4YHIA 1BOGB 3ULUC 5IMMA 1RZGB 3GB7A 4JCMA 3A6BH 2GAZB 4PS4H 3L5WA 5F9OH 4KHTH 3T8XB 4LSQL 3GMMA 4UB0L 3NPSB 1BEYH 1L7IL 1X6NA 4K3DL 1EAJA 1MCEA 5D2LE 2Q8AH 4YHNB 4IMKA 3OKEA 5FF6B 3D2UD 2H2PC 1F4XH 4ZFZA 3QA3B 3TPUE 3WE6B 4MX7B 1MI5A 4DEPB 3S34L 5CAYB 4Y19B 2E27H 1FE8L 3WHXA 1URLA 2AJXH 4YR6A 1NFDB 1QRNB 2JCCE 5CJBA 4U1GC 3O6FC 4JRYB 4LPUA 4N1CA 3LKPB 2FIKA 3BESR 5JW5B 3NTCL 3CFDB 5L0QB 1DVFA 1LQSR 5IMOA 4C55A 2QV2A 4WFFE 4NRYB 4YFEA 2QSCH 4OAWA 3VMPA 4B5EA 1NC4A 4KHXH 3BWUC 5DJXA 4PRHD 5DQDH 2AI0L 1F8TL 3GMQB 1FNGA 4RMRA 3E3QA 1KN4H 4JFFA 4Y5VC 4OGXL 5JXEA 4LL9A 1YN6B 5JO5A 2DLFL 1LE9B 5C0IA 4XNXH 3FTGA 1I75A 1GPOH 1JGLL 2ADFL 4D0DB 3C5ZD 1XF5A 4Y2DD 3D5OF 1E4XL 4NQCA 5CEYA 3VI3F 3RVWC 3QUML 4QXGH 1PDKA 5BVPH 3TV3L 1AY1L 3VDBA 2DWEA 3RWHA 5DO2D 2N1KA 3MRIA 4FTVD 4HKBB 4UV7H 1JWUB 4I5BB 2GK0A 5J06A 3CU1A 3ISWA 3L3JB 3MRKA 3PIQB 4WFGD 1FC1A 2ICEA 1JPTL 4NSKB 1AXIB 3I6LD 5MEND 4NM4L 4BK4A 4DOHB 1TTGA 1MCPL 1A9EA 5C0DB 4LDLB 4UOJA 4PJ8B 2BVQA 4MJ5B 2PXYB 1M05B 1MIML 2H2SD 4UNUA 4LOUC 4OZFG 5FYKU 4U1LA 1CLZH 2WV3A 2Y1VA 1NBZA 4H1LB 4GLRI 2VABA 3VFPB 4JZNB 3QCUL 1BJMA 1BVKA 5EUOE 2VH5L 3HAEB 1QSZA 1R3HB 2UUDH 4KDVA 4K55A 5KAQG 2DM3A 3RJDA 1I1FB 5C08A 5B3JE 5E2UL 3BZFA 4FHBD 4KPHL 1OP3K 2AEQL 4HQQH 3OBAA 4LIQH 2ZG3A 5GGSB 4KZDL 4JFDB 3DI2B 1ZS8B 3MRNB 1G9EA 3SKUD 2PNDA 4LIQE 4G8GA 1UQSA 3ROLB 5GGTA 5JOEA 1S7SA 1C08B 4RWYL 3BKJL 3WFHA 3RY5A 3AREC 1XEDA 2BMKB 3H2WA 3MV8B 3OAZH 4D9RD 3QXDB 4RAHA 4V1DD 5I1HL 2CLVB 4JDVB 3HNVL 2XNAA 3J8F7 4HF5H 3NN8B 1DEDA 1VEMA 3GMRA 1TXKA 3RVVC 3WIHA 2JB6A 2VAAA 3GMNA 3BP6A 2UWEE 3BH8B 4I9WD 4LDEB 1QSED 3IDYC 1OW0A 3QULB 1JNHB 3OPZL 3S6CA 2H6PB 2X4PA 4MMXC 5JDSB 3TO4B 1CDYA 4LMQE 2W9DH 2YPLE 4M02A 3TH4T 4P9HC 5E4EC 3V7MA 3BGFB 1PFCA 5MI0B 2VB5A 4LCWE 2HLFC 2AXGB 3EFDH 4JQIH 4W4OA 2P24B 4X5XA 1CFQB 4W68A 3F62A 3ARUA 3RVTD 2MOVA 5FA3A 4WRLA 5GS3A 3S98A 3BYYA 1XF2A 3W11C 4CGTA 4WO4D 2W9EL 3C2SA 2OI9A 3RWCB 4QRSA 2DQTL 3ZKND 1IBGL 2HKFL 2E6PA 1XF4B 3I2CL 3MYJA 5I19H 2GITB 3V7AE 1TJHH 1QEWB 3G08A 4L4VA 3V2AR 3ARGC 3KPPA 3GIVA 2DQDL 1ZT7B 4HUUB 3LSOA 3V8OA 3VWJB 1FO0H 1U8JA 1HXMA 5BMFH 4U1JB 5C0NC 5L2JB 1K8IB 3MRGB 5CILL 5I76B 4X6EB 1I1CA 4I2XE 3MQIA 1CQYA 1DE4B 4S2SB 3WV0A 3BQUC 2OS7A 5D7LB 3RVXD 4A2MA 4ZPVB 3L9RA 3HPLA 2IQAB 4N8CH 4Y4FC 2YHGA 3O3EA 5CP7A 3TF7C 1WWWX 4GUPB 5L9DH 1KT2A 4MZ3A 1MHEA 4QLRA 1AGFB 3DX9A 3OKDB 3DVGA 4BSWB 5HHNB 3CDCA 5IJVA 3ESUF 1P7QB 1I3UA 2GSIA 4F9PC 2SEBB 1EEYB 2N4IA 4OLUH 4ZAKD 1CXLA 1PD6A 1S8DA 1QZ1A 3R8BB 1U95A 3EJYC 4KKCD 2KDGA 4JG0L 2NPLX 3DRQA 4OUOA 1YUHA 4G8IA 1RZ7L 2PTUA 4MNHB 2JB5L 1EHAA 2ARJB 3HR5A 4NO5B 1V3LA 3NCMA 4WGWB 15C8L 3QNYB 4N68A 3DV6A 3SE4C 1PW3A 2R69L 3NCBB 2F19L 4MA3A 2B5IB 1ZKAA 3SDCA 3PL6D 1NCWL 4M62H 1PZ5A 2AJVL 1JBJA 4WU5A 2P45B 4NNPH 5E6IC 1PKQE 2ZOLB 5AYUH 1KTLB 2A77H 4EUPB 1JWMB 2OMBA 1CU4L 5EBWB 2IFFH 3CLEL 5T33H 3MRBA 3AS1A 3HPJB 1IFHH 2PYFA 1MQKH 1HH6A 1BM3H 3CC5B 4WI7A 2VDRH 2ADIB 3LN9A 4AL8L 2VQ1A 4MHHG 5DRZB 3RNQA 4WFGE 2D3VA 3CFBB 3I6LE 5MENE 2V2WA 3DX7B 3F58H 3WSQH 5IG7A 3M8OH 1FDLH 3U0WL 1I1RA 3IFOB 5CKGA 8CGTA 3HZVA 1FPTH 1N8ZB 4JQXC 5ISZE 3V6ZB 4ODVH 2DTML 3UC0L 3RWIB 4JPVL 2CD0A 4RMVA 2QL1A 3C09C 4X7EC 2WIIB 2FGWL 2X7LB 4FA8A 2R2EB 4LEXH 2MQ0A 5DEGB 4OGYH 3VGAB 5EB9A 3IFNL 3STBA 2WIMA 2RB8A 5DRWB 3RKDC 1P6AB 4HKZA 2UZIH 5DQ9A 3QIWA 3ARDC 3T0EB 1S9VB 4YFDB 1Z6JT 1X5KA 3KPSD 1F2QA 4Y1AD 3BDYL 5D7JA 4ACPA 5ADPH 3L3IB 3TH2T 3W82A 1A2YB 1X5GA 4JVPA 1T89C 3LCYA 5EBGA 4GAGL 4MDIB 2QQNL 5DJDA 4G8FB 4YZFE 1RZFH 4NQSA 1NAML 2A9ML 1HHKA 2C3VB 3O0RL 5KOMC 3CVIL 1KB5A 3QEQA 4I1NB 4F7TB 2ZUSA 5IBLD 2E7HA 3V6BR 5JOFA 3B9KA 1QBMH 3PQYD 2VDLL 1A6AB 3W0WA 1LILA 4NM8L 1T83C 2ADGB 3FT4A 2EDBA 5DD1L 5EC2B 2G75A 1HQRA 4U1MB 5D1ZA 4V1DE 2DOCA 2NCMA 4P59H 4HS6A 3GSNH 3HUJB 3FONB 5EU7E 4HPOH 7FABH 1CFSA 1BVZA 1T5XA 4R90H 3B5TA 3JWNC 2ZUVA 3B9AA 4HWZA 4KDTC 2X9XA 4KXZI 5A16A 3BAEH 1NEZA 2D03H 3EYSH 1LP9F 1ODAA 5ITFA 3O4LE 4Q6IA 1QSEE 3IS0X 4APQB 2VDQL 1VA9A 5DJZA 3KLAA 1T1WB 1RULH 5HSFA 1K4DA 1WJ3A 3S3JA 5E2WL 1ZTXH 4HKXA 2DQUL 1UJ3B 4PBVC 1C5DB 1INEH 5E8DH 5E08L 4RDQG 2X4RA 4DZBA 3VXRB 3RWFA 4WW2B 1JI1A 5EU4B 1U8PA 2Y4SA 5T1LB 2VXUH 4EN3D 1LP9A 4JVUA 5I74C 4DGVH 3C6LD 2EEAA 2I60H 2HT4C 4U7KA 5B38A 3ULVF 5CINL 5IB3B 3JV5A 4J3UA 4I3SH 5ADOL 4OJFH 6FABL 5AZ2L 5C3TA 3MUHL 4L5FH 3MTRA 1OAXL 1JZ5A 5FGCE 2EIZA 3QUZB 3V6OC 5JIIA 3MRRA 4QWWD 1DP0A 1KBGL 3P30H 1WWBX 4F3FA 1GVIA 3OHXA 3JSSA 2B1HL 1CDIA 4PRIB 3H42H 2ZUYA 1T4KB 4YNYB 3MROA 3OR7B 4GG8B 3BVNA 4RFOH 1I7UA 3RIAF 4JKKA 1CG9A 1HOCA 1F58H 4P5MA 4JVWA 4OF8A 3PWUA 5J13C 4CBPA 5D2LB 3BN9C 1T0NB 4QHLA 5C2BH 3EYOB 4G6KL 2HJFA 5FO8B 1NCUA 5ENWA 4NJAH 4XI5D 1NLDH 2NY4B 1CI5A 4HK0A 3RVUD 3TPUB 1MCCA 3O6MH 4RFEB 3HG1B 1G7MA 2HN7B 1I9EA 1JI2A 3QUYD 1UXWB 1JZ4A 2I26N 4G6MH 1KPUB 4DW2L 5IEKA 1ZLVH 4HBCH 4D9QD 1G9NH 3GBLA 4MA7L 2WQ8A 3NABH 3OXSA 5EOQL 2DLGA 1ACYH 1GHFL 3OJMB 2DQCL 2V7NB 1PG7H 3RL1A 3VD9A 5IHZB 1G84A 2DQJL 3ZDYF 4POZC 3P4OA 1J1OH 2JE8A 3RIAK 2D31B 4NWUL 3TO2A 2WWKO 1OD9A 5I0DA 3TYFB 3T0XA 5D72H 4XPFL 1U2CA 4M4RA 2EIDA 4S1RL 4LCCB 5F7LB 3KHQA 1RFDL 1AP2B 3CZFA 2DQFA 2R9HC 1WT5A 3GGWA 2NNAB 2ERJC 2E7CA 2OJEB 2EXWD 5AG9A 3GK8L 1P4BL 4YC2C 1HNGA 5C0BB 4NQEB 5GSRB 4MXQC 2J6EH 1U8HA 4HV8B 2DAVA 1AO7B 3X11B 1H3TA 1RMFL 3L7EB 4HD9A 3IKCA 4WCYH 4LLYA 1ED3A 1P1ZB 1Q9KB 1KCKA 1SJHA 4WEBH 3QDAA 3ULSA 1BZ9A 1U6AL 2Y36L 3P0VH 1OF2A 5IVOA 5EC1A 1XGYL 3BMVA 4ONFH 5GRJH 5IEHB 3TNNA 1YEKH 2DM4A 1H5BB 5TQ0L 2DLTA 1QKZL 4P46C 1SY6L 4TTGA 2BNRB 4PV9A 4ZPTB 4JANB 1YMMA 3MCKB 4M7ZC 4LSUH 3M1BB 5EA0L 4F7PA 1KJVA 2BXZA 1UG9A 3VFVB 2X6MA 4IDJL 1G7PA 4HH8A 3UTZA 4BZ1H 4GLRH 4X6FA 4ZO9A 3ZHDA 5KZCB 5DTFA 1KENH 4JGMA 4WTWA 3KPSE 1WGOA 5FA4A 1OAZL 4Y1AE 1VGKB 4JRWA 5FHAH 1WZ1H 4X9GA 4DGIH 4LCIL 3UPCA 5EUOB 4XPHL 5I15H 3ARYA 1UCTA 3FO2A 4ZDHA 1E6OH 3DNKA 5KTEL 4MQ7B 4HS3A 1FVDA 3BRFA 3C6SB 4P2OA 2AABL 4IBLT 4U1KA 3LEXA 5C92A 2H8PB 2VDPH 3PQYE 1F3JB 5DS8A 2G5BA 2E5EA 5F1SA 1NBQA 4HWEH 1H8SA 3TBTB 2GW5A 5ACZB 1NGPL 4JHWL 5EIQA 4YAQB 1U3JA 4Y88A 1W0WA 2CKBB 3UROR 5FDWA 1U3YA 4LBEB 1ITCA 4LVHC 4R97C 4M8QA 3BEVA 2DQGL 4M00A 5D93C 5GGUA 1NMCB 2YMXL 1K85A 3T3PF 2VLKA 1M6OA 1TDQA 1UB5A 4JFYB 1FIEA 2DL2A 3FT3B 5I18L 3RTQB 4LHUD 3VGHA 3MGOA 2NY0C 2GI7A 3PJSB 3IETA 1FL3B 5IBUB 2GKIA 5K9OA 5KOVC 2GJZA 2XTJC 5JW3L 3K81A 1HSBA 5DJ8B 4HC1A 4YX2L 5JDJA 1JFQL 3FRUA 4UDTB 4OM0H 2XV6B 2CSPA 3TZVA 5IT2L 4TTDD 4HCRL 3Q2CA 3G5XA 1RUMH 1MCQA 4XC3H 4GSDH 1JHKL 4OQTL 2Z91B 5GZOD 1U93A 3TCLB 1S7VB 1WK0A 4U1IB 3RX5A 2YPLB 4X0KA 1LQVA 1S7TA 3TN0A 4CMHB 1I3VA 3WO4B 3JWDH 4LCWB 3RUGF 2APFA 4X4XB 4N5EA 4UQ2A 2BERA 4HIEB 3WN5B 3OJDA 4GG6E 2WNGA 3T0AA 1EFXD 4M48L 4UT9L 2O5ZH 4LARL 3WNMA 4JY4B 5CJXC 2ZUTA 1CD9B 2OBGA 3WLBA 1QPPA 5KS9A 3RUGA 2VERN 4OCRH 3HS0A 4HJJH 4KQ4H 2D0HA 5T5FH 4KZEH 4YHMH 3SBWA 4R2GC 1HDMB 4NC1C 1TCRA 4DKDC 5HGAA 4JFPA 1VACB 2X89A 2AEPL 2HT3C 4P5TA 4Z0XB 1JPFA 4I2XB 1FO0B 4FQHB 1NGYA 4HH9A 4G5ZH 3D2UB 4L3CA 4UAOC 4XTRD 5C7XL 4N1HB 1N2RB 1W72L 5E94B 2YSSA 4ONGL 1B0WA 3V6FA 3D87B 1BFOA 4Z78B 1CICD 1NL0H 1CK0H 1YYLL 4FFZL 3GSRA 3S4SA 5T3XD 1XZ0A 2GJ6D 4LAJH 4D9QE 3K1DA 4H20H 4JN1H 4R96A 1ITBB 1EEZB 4U3CA 5I2IB 4QCIB 4NZTH 4PJ8C 1SBBA 4XBPA 1A3QA 1A7NL 5DUBA 1S7QB 3U9PH 3MXVL 2R8SH 4LGRB 5CGTA 2EKSB 1I1AD 2XZQH 1A6VH 3SDAD 1LDPL 4UILH 4PRHB 5F1NA 3GJFH 5KVDH 4FXGA 4RIRB 2BSTA 1W8OA 4JHAH 3V4UH 2E8YA 5GRVL 4ZFOL 3QQ3A 2HAZA