4HUXA

Crystal structure of h2db-h155a-np
Total Genus 63
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
63
sequence length
276
structure length
273
Chain Sequence
b'GPHSMRYFETAVSRPGLEEPRYISVGYVDNKEFVRFDSDAENPRYEPRAPWMEQEGPEYWERETQKAKGQEQWFRVSLRNLLGYYNQSAGGSHTLQQMSGCDLGSDWRLLRGYLQFAYEGRDYIALNEDLKTWTAADMAAQITRRKWEQSGAAEAYKAYLEGECVEWLHRYLKNGNATLLRTDSPKAHVTHHPRSKGEVTLRCWALGFYPADITLTWQLNGEELTQDMELVETRPAGDGTFQKWASVVVPLQNYTCRVYHEGLPEPLTLRWEP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords H-2 class I histocompatibility antigen, D-B alpha chain
publication title Preemptive priming readily overcomes structure-based mechanisms of virus escape.
pubmed doi rcsb
source organism Mus musculus
molecule tags Immune system
total genus 63
structure length 273
sequence length 276
ec nomenclature
pdb deposition date 2012-11-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00129 MHC_I Class I Histocompatibility antigen, domains alpha 1 and 2
A PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4huxA02
3.30.500.10 Alpha Beta 2-Layer Sandwich Murine Class I Major Histocompatibility Complex, H2-DB; Chain A, domain 1 MHC class I-like antigen recognition-like 4huxA01
3C8HA 4P46A 1UWXH 1EVUA 5JIIA 3MLSH 1XZ0B 5J06A 1J8HD 4ETQA 5BRZB 3PQYE 1LEKB 3ZE0F 1HHHA 3TBWB 5B38A 1IFHH 3IFOA 4WFHD 3RNKA 1F00I 3G5XA 1YY9C 2DLIA 3NCBB 1T7XA 2VISA 1XGPB 4GSDL 3TPKA 3WKML 1R3HB 3LPGA 5C0AD 3VCLA 1ZKAA 3OKMB 5MHSE 4GKOA 1A9BA 3EO9L 5ISZE 2PXYA 3M17B 1FAIL 2YUXA 1ZVSB 1KLUA 3T0WA 3WXWH 3QCVL 2E8ZA 3KPSE 4XP9L 2VUYA 5KOVC 1WZLA 1K4DB 3SPVB 4YDKH 2B2XL 4Z7NE 3B2VL 4U6YA 3O9WD 4PGEA 1HHJA 3EJZC 4PJIB 4RGOH 1SYSA 4LLQB 5EU4B 1IKNC 1YEIL 4YX2H 3WSQL 3VXPB 3RI5F 2MHAB 2DQEH 5F6IC 1FLTX 1CFBA 2BNRA 1CDGA 4OLXH 4DOHE 4CUCA 4OBRA 2ILLA 1BFTA 1MQKH 4NHUE 3D9AH 4BQCA 1CDJA 5D6CA 3SO3B 3C5SA 1IGMH 4OD3L 4I9WD 2KPNA 4WVRA 2QADD 5I75C 3QUYC 5E2VH 1A6ZB 3VFMB 3SEPA 5L88L 1XGTB 3H9SB 2UYLA 2XTJB 1ZA3B 1Z5LA 3GHBH 3IDMA 2IFFL 4AK1A 5ID0A 1KPVB 5HHOE 3DARA 1C12A 4PY7B 4FQJL 5C0IA 4L8DA 4QRTA 4PJCF 4ZODA 3CIQA 2B39A 2ADJB 4XNQB 5HGHB 4Q7DA 4AM0A 3MNZA 4Y16C 3OKNB 1CU4H 1G0DA 4UT6L 1JN6B 4U1SA 5DJAA 1JGUL 3D18B 4BZ1H 3MRRA 3IS0X 3CSBA 2FEDC 4X9HA 1J1XL 3V95A 4N8PA 4GBXA 4XB8A 2VE6A 4M02A 1I75A 1MEXH 3PDDA 3NA4A 5IJKA 3MRLA 2LQRA 4J3WA 3OG6B 5A3IC 5HYFA 4G3YH 5T1KA 4ONGH 4NCDA 3QDJE 2DTMH 4HWBA 5D1ZC 4S1SL 2QEJA 2GW5A 2CLVB 1F45A 4PP2B 5I1IL 3L9RA 1W72L 3H42H 4Q9RL 5ITBH 1I85C 3MACH 3WLWD 1NUNB 1MREL 4ZUUB 3REVA 1W0VA 3G08A 2EEAA 4LHJB 5GXBB 1KT2B 1EO8H 1XF5B 4PJHE 3C60B 3JXAA 3FO1B 4KQ3H 1RUKL 1MLCB 4X5LA 4Y1AA 1KTKE 4FA8A 5CP3H 4WU5A 1BFOB 3OAYH 2RCSH 4XVUC 5D9SB 1ODAA 2XN9A 4JM2C 3RA7L 2GSIB 1WC7A 1S5IH 2VDML 2EDDA 1BVKB 4N0YL 3MBED 3VXRA 1Q0YH 1H3UA 3B6SA 3O2DL 4PR5A 3JV6B 3OPZL 4Z7WA 3D3VD 4MVBD 1WZ1L 2VDQH 4XWGL 2JK5A 1LDPH 1UYWL 5F1NA 4HWUA 3V9FA 3FOLB 5T3ZL 3R8QA 4ZNEE 4HFUL 1ZS8A 1LD9A 1IQWH 4Z8FH 4G9FB 4RSVA 4DGVH 1ZLVH 4C56A 1CFQB 4WO4A 2D3VA 4JHZA 3RWDB 2J1KA 4IRZL 3LSOA 5E8EB 1ZHKA 3EYQD 2EIEA 4JKKA 2AEQL 4JFDE 4P4RA 2RR3A 1MUJA 4QRPB 4K3HA 4BSJA 2HVKB 2R56L 4JY5L 2P5WE 3OHXA 4AEFA 4JQVA 4V1DE 1WCQA 3F5WB 4WTZG 2DQTH 3HZKB 5IFAL 5BS0B 4D8PA 4HQQL 1AO7A 5DJ0A 4D9LH 3U2SB 4KI5E 1F4YL 4LFHD 1KCVH 1X5ZA 2A74B 1WAAF 1G9MC 3C5JA 3W9EA 1E6JH 2GJ6B 1AQKH 2NNAB 4XXCC 5J12B 3EBAA 3V5DB 4RGND 3F7QA 4R4FL 1U91A 4KJPD 4WEBH 3QCUH 4P2QB 3KS0J 5F1OB 4F7PB 1YMME 1RUMH 3HLAA 1L7TL 4GRLA 4AEHH 5IKCB 4NQCA 4ZDHB 5JXAH 1CR9L 4MWFA 5DWUL 2H1PL 2FO1A 4P2RA 4JZNA 1P7QB 5BZWA 1YEKH 1U3JA 2NY4B 1BZ7B 3EHBD 2HLFC 3DO3A 2AXJA 2JIXD 5DD3L 3AS1A 4NC1C 2J8OA 2YPVL 3QPQC 3HC0A 1FJ1A 3CH1A 4GRWB 3ARUA 4ETYA 5CCKH 3IDYB 5C0ND 1NGXA 3O6FB 3GRWL 5JORA 2VXVH 1JPSH 4KTEH 3QNXA 4FTVB 4L8SA 1SEBA 1INEH 5IM7A 1S78C 1U8OA 1S7XB 3V6FA 1ZOXA 1N0XL 3DXAE 1DBBL 4X83A 2CIKB 1MVUB 2R1YA 4WW1B 2ADGA 5EO9B 2X4SB 3L3HA 3ARGB 4PRPD 1BP3B 2AJYL 5CD5C 4JPIA 1FL6B 4RMQA 4WFEE 4A6YH 4IRSB 2XY1A 2R9HD 4HULB 4M6MH 2BSRA 5FGBA 3MLTB 1V3JA 1U8KB 3SO3C 2VDOH 4LFHG 4P0DA 4P46D 1KGCD 4F15C 3VFRB 2CKBL 4JE4B 2Q8BL 4L4JA 1BGXH 4LHQB 5T1LD 3CDCA 3DV6B 3HUJE 2Y6SD 4XP6L 2IAMB 4FQCH 2BC4A 4AMKH 3U46A 2P45B 4K94H 3HE6D 4PJ8A 1QVOA 3HG1E 2OZ4H 1IGYB 1XCQA 1V5JA 5TQ2H 3RL2A 5JXEA 2AI0H 4GG6F 3IDNA 2NY3C 2W65B 5D7LD 4MCZB 4XPTH 4PYGA 5LCVH 4MNGA 4HXBH 4UILL 2UZYB 3V4VL 2PXYD 3IRZA 1W72B 2NX5A 5ERWB 2ORBH 4LRNL 3QIUB 1JWUB 3OAUL 4MQXC 4U1MB 4C83B 2H2SD 3IKCA 3SGDI 4PGZA 4KDWA 4IM8A 2YSSA 1HINL 1ZHBA 1CFVL 1S9VA 2EDFA 4JFZL 4U6XA 1OAKH 3GMOA 4PIRF 1ZA6B 5ILTL 15C8L 1ZHNA 4EN3A 2RB8A 2IFGA 1CLOL 2HG5A 5HYJE 5DRNA 1CXHA 4QO1A 5C6WH 4RCAA 1XIWB 5GGTL 2QSQA 1P4IL 4DK6A 1QFWI 4XMKH 2JJUA 1RUAL 3B8SA 3A67L 1AE6H 4NN7B 4KJWC 4LPUA 4S0TD 3WHXB 4D3CH 1D9KA 4XI5D 2ITDA 5JDSB 4IOFC 1V3LA 3QUXD 1FVEA 1WBZA 4YBLB 3CVHL 3WFEL 1NUGA 3S8WA 2NY5C 5CEZH 1B88A 1CFTA 4U7MA 5E8NA 1AQDA 5ADPH 4K3JL 4OV5A 2DQIL 4X98A 4JFPA 4F33A 1HHGB 2BXZA 5M7QA 4LSQH 3MNVB 3RBSA 4KV5E 1ES0A 3MJ9A 3MOAL 2YBRB 2VMFA 2PO6A 1LP9B 4Y5XB 2ZCLL 3RWJB 2AJZB 4Y4KA 5DZNA 1YQ2A 4GBXD 3GSRA 3UPRA 1MFEL 3TWCH 4HV8B 5IP4A 1RAMA 5T1KD 1EO7A 3WD5H 2QQKH 3FOMB 5DR5L 5D93C 4Z7NF 4HF5L 4QEGA 1I7UA 3JTCA 2BVOB 3LQAL 5ESVA 4HIEB 4CNIB 2NY2B 1G7MB 4FXKB 3BUYB 4OCRH 1VFOA 3QI9D 4NQEE 1MI5E 3MRBB 4U1IA 4Y1AD 4JO3H 3G5VB 3OB0H 1QYGH 2I9LA 4HLZG 1K9TA 5J8OA 1LEGB 2DI7A 1Z0MA 5DGRA 3TNNB 5AZ2L 5KAQF 3CZJA 1UKQA 2CLRB 5J12C 5IG7B 4DGYL 1U8NA 2YKLL 3S37H 3TPUB 4B7LA 4EXPX 2IGFH 4ZUSA 4MJIB 2OP4H 3L5XL 4CW1B 3NPZB 1JYNA 3HR5A 3QIBA 1S7SA 4OZHE 1FIGL 1P2CB 3BH9A 1RZGB 3D69A 1ND0A 1OSPH 4LEOB 2VWEE 3GSXB 5TDPB 2NY4C 4C56D 3N1FC 2CRIA 4NZJA 1RJLB 2BOBA 4WO4D 5FOBA 3N85H 2DM7A 3GMLB 1JIBA 3W9DA 1JPST 2X09A 3IDYC 4RFNB 1EFQA 1F4HA 4NKDB 4DN3H 1MCWW 2CDGA 1YYLL 2VLKA 4ZFZA 3GJFB 2DIBA 3PJSB 4H5SA 4JPWH 5LGJB 3P73B 1VFAB 1L0QA 2CKBB 5IEHB 4BH7A 3CGTA 3T09A 2JJWA 4WGWB 3VXQB 4RA3A 2NW3A 5GGQL 4YR6B 4KGLA 1DBML 3P9MA 3ARGC 4GXUN 3UJIL 1J5OL 1WWBX 3OTTA 5GRUH 2XA3A 4IRSC 5CINH 3BO8B 1Q72H 1T3FA 1XH3B 1NJ9A 2QTEA 3O3EA 4Z0BH 3B2UD 5MEPA 5DURD 2FX9L 4G80A 5IF0B 2W9EL 2E27L 3DX7A 4FQLH 2KL6A 4MD5B 4GRLD 3QIWD 4CRPA 4NQCD 4KY1H 1DBKL 4LASH 2IAMC 1IL1A 4HWZB 1FCCA 4P2RD 3IGAA 5CSZB 1QKZL 1BF2A 2IWGA 2RFXB 3BUTA 1PBYA 4HJGA 4KKCD 4R26L 5CKAA 3GMRA 3WDHA 1VGKB 2DYPB 2BVTA 1I8KB 3JBG7 4UINL 5E03A 2YA2A 4M7LL 3NCEB 4TQEL 1ZGLP 2FATL 4JM4H 4MS8D 4Z7VB 5IMLB 1T4KB 4Y8AA 3RVUD 5DQDL 4PJ9B 2P7TB 3QIUC 3SDCB 1EFXB 5JR1L 3L6FB 3QWOA 4ONHB 4I48B 1C1EL 4NM4L 4F7CA 1NCWH 4MLIA 1UZ8A 4WV1B 1BVLB 4HGKC 2X1QA 4LLAA 2ENYA 1QOKA 3SQOH 1WAAA 2V5MA 4MCYB 4NKMA 3INUH 1A6WL 2XKSA 4OF5A 2YEZA 4LDOB 1IC4H 1QQDA 1QBLH 3C8KB 1JTOA 3CVHB 2BY1A 3DVGA 1JGDA 4X9FA 4UQ2A 4ODVL 1XGYH 1EJOH 3ZDZE 1EMTH 2AS5M 2AAVA 4LBEA 3MRQA 2NXZD 1GGCL 4BYHA 4OUUB 4GMSL 4HUVA 3RTQB 4NN7C 3O6KH 4P2OB 4TUOA 4WY7L 1NBYB 5D4QA 3MV11 3QPXL 1VENA 4S0UC 5H2BA 3WE6B 1H0DA 3UBXA 5HHMA 4OCSL 1J0KA 2CRMA 3HC4H 4KQ4L 3MLVH 3FHQA 3QEUA 3UXFA 5JXED 3DNKA 3P9LB 3ARBB 4KKNA 3C6SB 4OUOA 3UTZB 4Z77B 8CGTA 3HPLA 1UWGL 1WF5A 1CDIA 1U8IB 3ZYOA 1XR8A 1WJ3A 2NX5D 4UB0H 2UZXB 1PFCA 4I0PA 3C09B 4E41E 4N1HB 4GMTL 4KTDH 4K2UH 3T3PE 3S88L 1MIMH 4IIQB 4K9EL 5I1EH 2BOCA 2YRZA 3GSWA 3ILPA 1BIIA 1E28A 3FO0L 2YA1A 4ZS6D 5D7IB 3W0WA 1NEUA 3BAEL 3CFDB 4Q58C 4ISVA 5I2IB 3BWUC 5EDXA 3NBNA 3SN6N 2ZJSH 1N2RA 1U93A 4EN3D 2XPGB 5TH2A 3RGVB 1U8PA 5HHQB 3SDXB 2IANA 5AZEH 3RUGE 5F21B 3CCHA 5INCA 3WXVH 2AV1A 3MJGX 1NMAH 3KJ6L 4J4PD 2NY2C 3MODL 3FB7A 2VH5H 3WNKA 4I8DA 4Y5YA 5ETUB 2VDPL 2N4IA 4ALAL 1RIVH 1I3VA 2ATPA 4WCYL 1KSRA 3EFFB 1D9KD 5GS0H 4DJMA 1MFCH 1SVCP 5CEZD 5CBAA 1ACYL 5A16A 1IVLA 3FFCE 3LKNB 3HUJF 2W60B 4WRLA 3NCJL 1BF8A 1TCRB 1U8MA 5C0CA 1OTUD 3HCVB 4XTRC 1EHLL 4OGXL 3T8XB 3OWEA 5GRJH 1NFDB 4R96B 1KJVB 4MNHA 5CGTA 5ALBH 2YD7A 1J0YA 5E8PA 5FYJL 3TO2A 1OF2B 3KLAA 4G8GA 3STBA 2ADIA 1WFTA 3VRIA 3CUPA 2NZIA 2PO6D 1O0VA 3MRGA 1FVCB 3BN9D 3CVIH 5C0FB 1HXMA 3MUJA 5CHNB 3EO1A 4TUKH 4GAGL 2QV2A 1OT2A 2BMKA 4F7MB 3VFSA 4JKMA 2QQLL 4AG4L 4LARL 1WFNA 4HD9A 1A7PH 4XBGA 2ZKHL 1ROWA 3MXVH 4KVCH 1AC0A 3GM0A 2HFFA 4YXLH 2UZIL 4WI2A 3VXUE 1G6RH 2Y23A 1QLFA 1DQML 3O0RH 5DMGD 5CZKA 1JPTL 5CILH 1LO3H 5E6IB 2GJZB 4OT1H 4YPJA 2PTTB 4NZUH 1RHHA 3K0WA 4H8WL 5DEGB 3MRPA 3PQYA 2IQ9L 2Z31A 5C92A 4KK5D 2VC2L 3QSKB 1RIHH 3GIZL 4AIZB 4DGIH 3QIBD 4G5ZL 3DUSA 3GGWA 2OSLB 3IDXH 1G7IA 1WWCA 5DVOA 3KYAA 5I15H 1JZ3A 1F11A 2XQYG 1F58L 4QRRE 1OGAB 2F54D 1CGXA 1FRGH 1S7UA 2VAAA 5ISZA 5IGXH 1F6AB 3FT4A 2J8UB 2NYYC 2OTWB 3QRGL 3ZE1F 5KSUA 5GGVL 2EE3A 3KPSA 2VDNL 5E9DE 3ZT6A 1CE6B 4MA1B 3I6LD 2A38A 4I3SL 2R0LL 3SDCC 4DFHA 5EPMA 4EDWH 2NTFB 2EKSB 3P4OA 1MAML 3BSZL 5EUKB 2OJEB 1S7RA 1G9EA 5CUSH 4JG1H 4WV1C 3BDYH 4NZRL 3TT1H 1FNFA 4LVHB 4X7CC 4NWTH 3ZZ1A 4FQ2H 5HDQH 4X4XA 4XCCH 4NHUA 5C09E 4UIMB 5HGGS 3CSPA 5A2FA 4XNYH 3AMLA 2DWDA 3CXHJ 5MEND 1H3TA 4QNPF 2EDEA 1QSFB 2CIIB 5C7XH 2WUCH 3QEQA 5HHOA 5GS2H 3RTQC 3NACH 3IFPA 3D5OF 1N6VA 1UACH 2FX8H 4ZFGH 1B0RB 3ZTJG 4NUGH 3BZ4B 2FH6A 2GTZA 4H25A 4KMTL 5KW9H 1D5IL 4QHKJ 1YEDB 5EBMB 3WLBB 2N7AA 3AU1A 3EUUA 3EYFB 5DQ9B 4OZHF 3OKKA 1K5NA 4YXKL 2NY1D 3ARBC 5I0ZA 2WIIA 2OI9B 2LTQB 3EOAA 3SO5A 3UTQA 1A4JA 5DUML 5I73B 2GKIA 3GO1H 3F7VA 3R0NA 3T0EA 3LQAC 1WIPA 1CF8L 2IADB 3G6JE 4K8RC 1AD0B 1TVBA 1JHKH 3C09C 1MCBA 3FRUB 3QDJA 4IIQC 4DWHA 2LABA 2CJUL 1AXSB 3QJHA 3RDTA 4NNPH 1OAYH 4FN0A 2AXFA 1VGEH 3DHMA 3TZVA 2E7MA 4HS3B 1HXYA 2Z92B 4LCCC 4LVEA 4IMLA 3RGVC 5C2BH 4PJHA 1N59A 4HUMB 4ODHL 3HMXA 4XMLH 1FL5A 1KEGL 1J86A 4HH9B 2JB5L 3DWTA 4L3CA 2X41A 2ZOLB 4OCMC 4QHUA 5I8CA 1T2QH 3IVKA 5E8OB 2X70A 2GSGA 2SEBA 3SDDC 1XGUA 2D7PA 2DN7A 4JB9L 3BGFB 4M1CC 1LQSR 1CYGA 2ICCA 4JPVL 1T89A 5D2LE 3S36H 5IT2H 1IEAB 4OCYH 4K3DH 4R2GD 1E4XL 3HC3L 1HH9A 5FHAL 4KVNH 2IMNA 3WUZA 2H6PB 4HJ0D 4NKQB 3VW3L 4Y5VC 1EAPB 3UJTH 4OAWB 4ZNEA 3FB8A 2HJKB 1CDBA 3KLDA 4YDJB 5I74B 2X4UA 2VZTA 1AD9A 3U79A 3TBSB 1PY4A 4YQXL 5JUEL 5AG8A 4PLKD 4YAQB 3N1QC 5CZVH 2W0KA 3VG9B 2ZUTA 1YA5A 3BEVA 3KYOA 4GRWF 4JFDA 5I1KH 4JDVA 4K07A 5B22A 5FYLL 1J1PH 2NLJA 3S4SG 1I8MB 5IVXA 1H5BA 4MMZC 3STLB 1S7TB 4LNRA 3W0WD 1E4KC 2BVUA 4YIQA 2CDEB 4L4TB 4V1DA 4KUCD 5C08D 1DQJA 2Y4SA 1D6EB 5KVDL 3VXNB 2C26A 3V6OC 4BM7A 1FNEA 4FFZL 5ID1A 5BVPL 2IAND 2R1WB 1KIRA 4JPKH 1DLHB 5ANMB 1IZJA 4ZQKB 2DDQL 4HIJA 2ENSA 4HPYH 4LLWB 1FC1A 1FZKA 3LY6A 3Q0HA 3RPIA 3CC5A 5EU6E 2DIJA 5DRWA 1R3KB 2EZ0D 4GXVH 3MCG1 3QUML 4LQFH 2GITB 1DVFA 5DZLA 4Y4FC 4E42A 1D5MA 3DV4A 5JDJA 2EEBA 3U82B 5IBUG 3VA2C 5GS0D 5E6IC 4U3HA 1DL7H 2XIDA 1PJ9A 5D8JL 2BRRL 5IFHL 3P40A 4L5FL 3L5WA 2ZNWA 1RZKL 3OKDA 1KTLA 3W81A 5B8CA 2Y9RT 5IIEA 5FK9B 3SE4C 4MSWA 5C0CD 5GRYA 3F7PC 2BSED 5ADOH 5SWQB 1MJJB 1NLBH 1LO4L 5T1MB 3M1BB 2VRAA 1DQQA 5B3JE 5FDWB 5T5NG 4JRXB 3WN5A 2HTLD 4KRPB 2B1HH 3L7FB 5D2NB 5HYSA 4G8GD 3X3GH 2DQGL 1QTYT 4HCRA 1WLHA 2VLRD 5KVFL 3HNTH 1JFQL 4AENA 2B5IB 3NGBB 4PTUB 1T04A 2DMKA 3MRKA 3DGGB 3T1FB 4ODWA 3S35X 4YXHH 4I18A 3QG7L 1FH5H 4WNQB 4MA1C 1ADQL 1FV1B 5D7JA 2Y1VA 1U8QA 1CL7L 1UM5L 2V2TB 2DKSA 1BJ1J 3RIAK 4GW1B 3WJJA 4FOMA 3MZGB 1CFNA 2H2PC 1FL3A 1G9MH 1IGIH 2XKNA 3E1F1 4GQ9H 3U0PA 5IV2A 1G84A 3O3DB 4QHMB 5TDNB 3OKYA 2DQJL 1GAFH 2D7OA 4P48A 4PJFE 4ZTOL 3B9KC 4LPCA 4DVBA 4WI7A 2P24A 2HFEA 1R24B 3MRNB 4YGAB 3C6LC 3PQYD 2X4OA 4PJDA 3VXTB 3U9PH 5I8EB 3HZMA 4M61A 1N5AB 1EH9A 3HG1A 2GUOB 3TC9A 5FUOH 3GMQA 3EYOA 4L9LA 4PUBH 1UWEH 5MHSD 4MA3A 1MQ8A 4K9EC 4J6RH 2M8XA 1KXQE 3ARDB 5GRZA 4DKDC 4XVJH 5ICZA 5ISZD 3MFGB 4L3EE 5LAXB 1HEZB 2F53D 1FNGA 2X4RA 3W11D 5FHBL 4PRDB 1RULH 2OI9C 5IQ7L 2LTQC 1A7RL 2R8SH 5BVJB 1HQ4B 3KPSD 4Z5RA 1LP9F 5I73C 3W5MA 5DFTA 2ATKB 1I1RA 1ZLUH 4D0DB 3LS5L 1JHLL 3QDMB 4XPAH 1T5WB 3WEXB 3P4MA 3MQIA 4DW2L 3MYJB 1P7KA 1FYTE 5HYJA 5DJ8A 1D5ZB 4FQQA 2O61B 4CVZA 1GGBH 3BIKB 4XBEH 1INDH 4FABL 3VD4A 1QRKA 1ZT7B 1BEYH 4GAYB 4WI6A 4XP1L 5HGAB 4LCIH 4WI3A 2E9WA 4LDLB 2DAVA 4DKFH 1BAFH 3G04A 1UCBH 1XF1A 3IFLH 3T2NH 4JO1H 2WSKA 3W39A 1JYXA 2F19L 2JE8A 2ZSVB 5SWSB 7FABH 3D87B 5GS2D 4EUPA 1HNFA 2DM2A 3BGFC 4LLDB 4ELKB 4JFYA 4N8VB 4JRYE 2B1AH 4NQVB 5HHOD 3LMJH 3GIVB 2C3HA 3F8UB 2A6DA 4H1LA 3VG0L 5IW6B 4JFQB 5IHUH 2CMRL 1QHOA 1Q9LB 3D1MC 3F7YB 1TETL 2LU7A 3Q48A 2XA8L 1BD2B 5HVFB 3RGHA 2X05A 3CXDL 4YZFF 4APQB 5KTEL 4U6HA 1ZANH 1BIHA 2VLJB 1QG3A 5FUCE 5EU5B 1KCUH 2AGJL 1HDMB 4LSSH 3I50L 4JY4B 2E5EA 3NFPB 2FGWL 4H88L 3VMOA 2VN7A 4XPBH 1NMBH 2X2YA 4DZ8A 1QFWH 5I66B 4PS4L 1Q9WB 4PRHE 3VG9C 3QUKB 1N7ML 1NDMB 5BW7A 4UNUA 1XGRB 3QUMB 1D5XB 1EBPA 1GC1L 4DFIA 2OQJA 5I17A 3QDJD 5JIKA 2NY6B 4G8FA 2AJUH 5E08L 3Q6FB 1JZ2A 1DE4A 2Y07H 12E8L 3NFSH 4XT1C 2FZ3B 3TZVD 3WIFA 1NCAL 2ARJB 2HJLB 3QXAA 1YYMH 5E5UB 4H8WC 3UP1A 3GI8L 1D5BB 4NQEA 5ELIA 1MI5A 3QG6A 4OFDA 1IEBA 4BZ2L 5DMIL 3BKYH 4JAMB 4OF6A 5EU3B 5T3XL 4DUVA 1T03L 3RVXC 1MHPH 4GKSA 1G1CA 5DJCB 3PWPA 3GK8H 2NY5H 1XF3A 4R7DA 2FLBT 4PB9L 1OAUL 1KJ3L 3AUVA 4NC2B 2IBZY 1QLRA 3HZYB 3T2PA 1FG2A 3AROA 1TQBB 5IEKB 5CP3A 2EH8H 1MCPL 3UYRL 3WFBL 1CICB 3QZWA 3FQWB 1MCIA 1FZOA 5IVZA 4OI8A 2EYSA 1PYWA 3QO1A 4K7PH 4NUJA 1BOGB 4K23L 4KRPC 3CLFL 4O51A 3PWNA 3R06B 4TNWK 2DF3A 1CGSH 1ERNA 4ELME 2DQFA 3EZ8A 1C5BH 4JFDD 5D1QA 2B5IC 1SY6H 32C2B 3NGBC 4Z7VF 3RWGA 2DM3A 2OJZL 1RJYB 2P5WD 3G6JF 1DEEA 1NCNA 4HFWB 3LN4B 1IT9L 2MPAH 4V1DD 2AJSL 5JZ7C 1F4AA 1AHWA 4LCWE 4MQSB 5LXGL 3FT2B 4QOKB 5CIPH 4LLMB 5GGRB 4KI5D 1U92A 1FN4B 5HDBF 3C2SA 5DUBA 2XICA 4MDIA 2Z35B 2V7NA 5JQ6L 3AB0B 4GSDH 4UOW1 4PJ7B 2AEIT 1VPOL 3H0TB 3WKMH 1DVFD 4E5XA 3G5YB 2H8PA 1TVHA 3HAEB 4R4ND 4KJQD 2F8XC 4JHAL 1X6NA 4O00A 1YMMD 4UDUA 1BZ9A 3EO9H 4M7ZB 4LSUL 1WT5A 1TCMA 1FAIH 1ETZA 5D2LF 3WUWG 1IC7L 3QCVH 3V5HB 5F7DA 3RP1A 1RZFL 1QA9A 1N5YL 5J9PB 4AJ0A 4HLJA 3EJYC 1NAMA 1JGEB 2B2XH 5J6HB 3BP5A 1WWWX 1OP3K 1HILA 4JY6B 1YEIH 3WSQH 1QBML 1I1FA 1NEZA 4PREA 1AI1L 4P4KB 3IXAA 5ITFB 4GUPB 4Z76B 2UVFA 3LEXA 3NTCL 5HHNA 3ARDC 4GRWH 3O6LL 2P8MB 5EO1B 3ES6B 4UV4H 3RWHA 1NGZA 3NVQA 2R2EA 4NNYA 1Y6MR 4DN4L 5I8KL 1WV7T 4NRZB 3DRTA 3SBWA 2OBGA 2XG5A 4XCFH 3DXAD 5D7JD 1U58A 2YRPA 1D6VH 2IF7A 4X5XB 4OD2A 4DAGL 5DHVA 2MQ0A 4NKIL 3E3QC 2J2ZA 2V2WA 2IFFH 5JW4R 1XAUA 4WFED 2J6EL 1G7PA 4FQJH 3VFOA 1IAKB 3G5ZA 3NCYS 3WS3A 4ACPA 5HGBB 2HT4C 2UWEB 1MWAL 2NY0B 2I9TB 1KIUA 1MCNA 5FF6B 25C8L 1PG7W 1TIUA 5EBWB 1AR2A 5SWZB 5DO2C 1DSFL 3PWUB 5D1XB 4UT6H 3RPKA 2QKIA 2ZCKL 5IHLB 2F8OA 1WGOA 1TTUA 4N0CA 3QQ4A 4HC1L 4PG9B 3IJHB 2HFGL 4FQXB 1A21A 1P4BL 3ARTA 4XP5H 3HG1D 1J1XH 3VRJA 1E27A 5CJQL 2DQUH 1ZK9A 1OLZA 1CLYL 1MJ8L 3IFNH 4FZ8H 4NO0D 1A22B 4G6KL 4LPXA 4NGHL 4DVRL 3BZFA 1RK0A 3OJDA 1FG9C 1OAQL 4X7DC 1Q0XL 2ED9A 4O2EB 4S1SH 3KPRB 5LVEA 4APQC 5C0GA 5I1IH 4Q9RH 1F3DJ 3VXSB 5I19H 4E41A 5GIRB 4NQDE 3HZVA 3Q5TA 3TO4A 2HLAA 4PRAA 4QRQA 1RUKH 3LRSB 3GSUB 5C0BE 2Q7YA 4F7EA 4I5BA 4JKWA 3FONA 2PYEB 4F58L 3RA7H 5FKAA 4XRCA 3MO1B 2QSTA 4N0YH 1A14H 4LLYB 2NY6C 3N1MC 5HYJD 3RUGA 3O2DH 1J8HB 3UTSA 2BVQB 1JBJA 1Q8MA 3NCCB 3OPZH 4QHKI 3VGHA 4R4BA 3K46A 5KS9A 4XH2B 2ZPKH 4ODUA 4JO2H 1JGLH 3KPQB 1M7IA 3LKSA 4MJ4A 2R69L 1WZ1H 3IU4L 3RAJH 3VFPB 1UYWH 4G9DB 1RZKC 1G7QB 4YNYA 5J3HD 4ORZC 1I7TB 5EZLA 3N9GH 2N1KA 1WIOA 3BMWA 5T3ZH 1R5VA 1P4LB 4HFUH 5E2TL 5E4IA 5C0AB 5JOPE 3RKDC 4LSRL 3LN9A 1UA6L 4QXGL 3V0VB 4QT5A 4CBPA 2W9LA 3FFCA 4IRZH 5J1AB 4K71C 1NUDA 1IRAY 1DZBA 1V8HA 2AEQH 5IK3A 2D7TL 1A6AA 2VR9A 2WWMC 4KAQL 4MA7H 1N4XL 4JY5H 3X11A 2EYRA 3D85D 1A7NL 3O41A 4EOWL 2V17L 1P84J 4PGDA 1CICC 4MHHI 2EDXA 3EYVA 4NO3A 3VGBA 5IFAH 2Z8WC 4HQQH 4QHNB 4PJBB 4X4YB 3JTTA 1F4YH 2CRYA 4PRIE 1VKXB 4NNXA 1V7ML 1EHAA 2Q3ZA 3BPOB 1Y18B 3TNMB 4KFZC 2JJTA 2QADB 3KPNA 3O6ML 4D0BB 3M45A 4UNTA 3L3GA 3RIFF 1QSEE 1FGVH 5CFHA 4EI5A 5F96L 4IRJD 3ZKMC 3VXUA 4NQED 1CR9H 1MI5D 3CDGB 2Z4QB 2H1PH 3VWKA 1MFBH 3IDIB 5JHDE 4HUWB 5C1MB 4KUZL 1X5LA 3HI1B 2ZUSA 5L2KE 4YHPA 1ZGLA 3AB0C 2LU3A 2XWJB 5FO9B 1A2YA 4ENED 1SJHA 5DD3H 3KPPB 3FQTA 3WNLA 5EUOB 3QYCA 3U30C 1A7OL 3WNNA 4JFEB 3JV4A 3WFZA 4M7ZC 4ZYKB 2G75B 4JREC 3GRWH 4NRYA 3ULVE 1R3LB 4EUPG 4CDGC 1QEWA 2ZUWA 1X5IA 5T33L 3V8OA 5I1AA 1XF2A 1DBBH 1OB1B 4QCIA 1Q9OA 4KKBC 1WK0A 4TTDD 2PUQT 5E9DA 3VD7A 4F9LC 2Q6WA 4YDKL 4S0SD 4M9PA 1SHMA 2ZNXA 3G6AB 1MWAB 5EZOH 4U1JA 3GJFH 3NAAH 3AFLA 2E8YA 3LKRA 4ZO9A 2W0FB 4Z7UE 4JANA 2DQEL 4OF3A 3LKQA 5FKPA 2Q8BH 2C7UB 3I85A 3PABA 3L95A 3MBEB 4XP6H 2VXQL 5KSAA 4KDTC 5DVLA 4U3CA 1U6AL 3RVWC 3D9AL 4JVWA 2D0HA 2HJFB 2G5BA 4G8EB 3OR6A 1EBAA 4WUUE 3D3VB 5I1GL 1A1OB 1YUHB 3MXWL 3RVTC 2CDFB 3IF1B 3PL6A 5K59E 4Q6IA 2NY0C 1VHPA 2IALA 3H3KA 2V7HA 4UILH 3L3IA 4C59B 4ESKA 5IMMB 4WI4A 5D1XC 3QB7C 2XG4A 2EDRA 2UY6A 1X5XA 4EDXA 1BQUA 3RZCD 1IQDA 2VZSA 4FQXC 5MP6H 3CH8A 3MLWL 3U4EB 2PW1B 3RI5K 1HINH 4W4OC 4JJ5B 1CU4L 2YD8A 5ILTH 3NA9L 15C8H 1GC1C 1CIUA 2P4AB 4HIIB 4BZ1L 4RWHA 2Y7QA 1CLOH 1QP1A 4P2QE 4JFOA 5GGTH 4RRPA 4HK3J 2KKQA 3QZWG 4RQQB 4WUKH 1RUAH 5IWLA 3A67H 4PJAB 3N06B 4RGNB 4HWBL 4P3CL 1J12A 4ZO6A 5EC1A 1EO8L 5A2LH 2P48B 2HT3C 3LCYA 1VEOA 4MA8L 2RJMA 1B2WL 1FP5A 2YUZA 2RCSL 1QO3B 4J3OC 3OXSA 1K85A 4I77L 4R97B 4UQ3B 1RK1B 1Q0YL 2EIZB 1JUFB 4MB3A 3NZHL 1A4KA 4NJAL 4OLVH 2JIXB 1CXIA 3VJ6A 4N0CD 3MOAH 4GG8B 2P8LA 4ZSOB 3S6CA 4LNVA 4NQTA 3TYFB 4NO2B 3FQXB 1RJZB 2JTDA 1MFEH 4O2CB 1U42A 5F88A 3P0VL 4M9OA 4CN1A 1OARL 5DR5H 2R15A 4HF5H 5FGCE 3EO0B 4J8RB 5CZXD 1M05B 1WIUA 3SCMD 3D0LB 3LQAH 4OLUL 4YE4L 3LPWA 2LU4A 4E41D 4YEFA 1HOCA 4L29B 3VFWB 3TO4D 4QTIL 4PRPB 4KU1A 4IHOA 1YQVH 4CU6A 2DMCA 1AKJA 4KWUA 1F2QA 1KENL 1DQLL 1S9KC 4UDTB 5D5MB 1UXSA 3WIHA 1MRCH 2AABH 3PWVB 5AZ2H 2VZOA 3CPLB 3BPOC 3FQUB 5EULV 5F9JA 4P46B 2GK0A 4U2YA 4DGYH 3SKNA 2D0FA 3ZKQD 4L8BA 3V4UL 5T1LB 4HZLA 1ACZA 4POZD 4Q9CA 2DBLH 3REWA 3IFOB 5EU6A 3RNKB 1CT8B 2C1OA 2ZSWA 1UJ3A 1C16A 3HE6B 2GTWB 5LGHH 1DEDA 1WEJL 4XCYA 4JN2B 3VFNA 4HEPG 4P23C 2DL2A 3U7YH 1I7RB 3MR9B 3GBNL 3LV3B 1JE6A 3G6DL 5D7LB 3GB7A 2VL5A 3ZDXF 5I9QB 2M26A 2R4RL 4UTAL 5JXAL 3FFCD 2ICEB 2PXYB 4OI7A 3SKMA 2VSCA 3GFUA 3QNZA 1OTTD 4OF8A 4KROD 5C0DB 1YEGH 4ODXA 4P3DA 3ZKSD 2CUMA 3LVEA 1YYLH 4U7SA 1TZHA 4JZJA 3CFIC 5SX5K 4U6YB 4PGEB 1SYSB 5E7FA 5EH1A 4YHIA 1I1YB 5GSRA 3UYOD 1RZ8B 1BQHA 4PTTA 2XRAL 5CMAA 1H9VA 1JPSL 5GGQH 2FLRT 1FNSL 1GGYA 5E1HB 3UJIH 1VFMA 1TTFA 1OAXL 3AS0A 4FQ1L 5D6CB 2AJ3A 3C5SB 3EAKA 3S7GA 4PBVC 1WISA 4H0IA 2VZUA 4WHDA 1RV6X 2EDYA 2FX9H 4G7YL 4MXQA 4X99B 2W9EH 1IJ9A 4JQXA 2UYLB 3D0VB 2E27H 1MHEA 2W38A 3P0GB 5ID0B 1DBKH 4F7TA 3QUXB 4HUUA 2GQHA 4LPTA 3VWKD 3LHPL 5EZIL 4PJFA 3X3FH 4X5WA 4FNLL 1CWVA 5C0IB 4L8DB 4QRTB 4AT6B 3T0VA 1QKZH 4MVBC 4BK4A 4R26H 4AM0B 1A1NB 4XZUB 5EOCL 2WBJA 1YPZE 4AMKL 1B0GA 3V79C 4M7LH 4TQEH 3U9UA 4XGZA 2M2DA 4ORGA 2FATH 3MRRB 4RZCA 2OZ4L 2CQVA 3OJVC 3OL2A 3MGTA 4V3EB 5DJ6A 4MD4A 3MROB 3AREB 4YHNA 2X6MA 3MV8E 7CGTA 3VH8A 1C1EH 4NM4H 4GBXB 3EYQC 4QRRD 3MRLB 5DZOA 4OSUH 4XCNA 5LCVL 2C1PB 1JNHA 5T1KB 4L3EA 3HE7D 4HBQA 3S96A 1UFUA 5TE4H 1OP5K 1KCKA 3L9RB 4EBQL 5E9DD 1CGYA 4NQUA 3G08B 3WFDL 4MGXA 1S7QB 3QI9B 4S1DD 4Y1AB 4NWUH 4HKXA 5GGUA 2E9JA 4ODVH 1B6UA 3OX8A 5E2JA 5F44A 1FYTA 1JYVA 1JYWA 1GGCH 4GMSH 5CJBA 3PWLA 4X7SH 4YBQC 4BFIA 4N0UE 4OM0H 5C09D 3B6SB 4Z7OF 4R6UA 2F74A 4OZGF 4OCSH 4PJGE 3OR7B 1AE6L 3DURA 5FGRA 5F1NB 3I84A 4J3SA 4D3CL 3OG4B 1UWGH 1ZS8B 4EVNA 1LD9B 5FB8A 1KACB 1DBJL 3FZUD 2Y36L 2FJHB 2WBKA 3DVNA 4WO4B 1VERA 3HFMH 2BSSA 5CEZL 4NFDA 3LEVH 5DHXB 3S88H 1ZHKB 4K9EH 1L0YA 4M1GL 4P4RB 1MUJB 3ULVF 1VEMA 3FO0H 5IVNA 1PZ5B 5JLZA 3BAEH 2ZUXA 5E1AA 3NFNA 3SJVE 4LSQL 1EGJL 3IDJB 3VFGH 4D9RE 3MNWB 3U0WL 4LLUA 4WEMB 1RZIB 2OS7A 4M8QA 5DTFA 1MCRA 3FCTA 1JPGA 3J7HA 5F3HA 1CLCA 1W0WB 3KJ6H 4PRHA 4D8PB 3H3BC 5DJ0B 2BP3A 3IB4A 3PV7A 2FL5A 3MODH 3NIGF 1YY8A 3C5JB 4ZOAA 3V5KB 5C0EB 2VDPH 3MRHA 3QULA 4ALAH 4ZUTB 1RIUH 1T1WB 4WCYH 1NKOA 5F3BA 3CX2A 3BYYA 1U91B 4X7FC 3ZHLA 3PGCA 4OCRL 5DURB 2N56A 4P46C 5GRVK 2G9HA 2AK4E 1ACYH 2JELL 3DSNA 3GSNA 3K7UA 3NCJH 3QIWB 2Y6SC 3TV3L 1QYGL 4NQCB 2J88H 2GFBA 4OGXH 1IKNA 3HE6C 2H9GA 4JZNB 4P2RB 5DXWA 3E8UL 4U05A 1MLBA 3IDUA 5DA4A 1YJDL 2DM4A 4RGMB 2ZUVA 2QQNL 4YO0A 5K59F 2PR4H 3T77A 3ZHDA 2EECA 1FJ1B 3CH1B 3H7BA 4YFLI 4WW2F 1FNLA 1UG9A 3RY6A 2CKNA 3TN0D 1TTGA 2A6JA 1TZGL 3QNXB 3RJQB 4L8SB 2ZUQB 4GAGH 1OSPL 4UT9H 2YOCA 3ZSTA 1U8OB 2H2SC 5D6DC 2YPLE 3V6FB 4AG4H 1K6QL 4H26A 4X6FB 4X6CA 2ZKHH 4N1CA 2HP4A 4ODSH 1K3IA 1A7BA 2ADGB 5E5MB 4ELMA 2XFXB 3C2AL 3L3HB 2X4PA 3EOTL 2W91A 4YWGH 4DN3L 3I6KA 2EE2A 5L8JB 5GPRA 4IMKC 1ORQB 5FA3A 4Y16A 4RRPG 2BSRB 1JPTH 3U4BL 1YDPB 2D7MA 1NC2A 2B20A 3HRZB 3DYPA 5CSBA 4LCWA 4LEXH 2BZDA 2QQQA 2MQ3A 3PV6A 4OFVA 2D0GA 2NXZB 1MH5B 4PGCA 2X7LA 2L4OA 4AL8L 2BC4B 3P0YH 1MHHB 5EU6D 3GIZH 3DUUA 4XI5C 1M7XA 4G5ZH 1A9EA 1WICA 4FXGA 2GAZA 4FFYH 1QVOB 5GRUL 2J3SA 3QUXC 4CVWA 3MUGA 3RL2B 2UWEF 4P2CG 5D1ZA 4Z18A 1UM4L 4Z0BL 1F58H 3LN5A 4FFVD 5D7IE 5IQ9A 2VZ3A 1QFUH 4QKXB 2E6PA 4QWWC 5D71L 4FQLL 1S9XB 4PV9A 4MNGB 3QRGH 2EDNA 4LASL 4M7LT 3SDXE 1KG0A 2NX5B 4H0GA 3FO9A 5D72L 2ARJQ 2VDNH 1ITCA 1X4XA 4PV8A 3HRPA 2CH8A 4Y2DD 5I16A 3MRMA 4JM2A 3IKCB 3VMPA 4HK3N 5A2JH 3K1KC 3AREC 5SX4I 1CVSC 4GBXC 1MAMH 3QQ9C 4U6XB 5IJKC 1AGFA 5DD0L 2KQMA 4EN3B 4NBXB 2BNRE 1X5JA 5EU7C 3H2WA 4OCXH 4XPGH 2HG5B 5DRNB 1UCTA 1TNMA 3FN9A 1CG9A 3OQ3B 2ITCA 3H9HA 1WITA 3MRIA 2BNQA 4JDZA 3ULUE 3QI9C 1UQSB 2WP3T 1NFDE 4KH2A 4UUJA 3T0BA 2E7CA 4DEPB 4MXQD 4X9IA 2XTLA 1JZ5A 1KTDA 2FX7H 5H94A 1JTPA 3O3UN 3TIDA 2APWA 5IB3A 4PJXE 3EOYG 1QBLL 1AIFA 3VXME 3BWAB 1CN4A 4LU5L 1CXFA 1JMZA 4KMTH 1D5IH 1UXWA 3RWFB 1T80A 1EMTL 5E8NB 4AH2A 2ICES 4OV5B 1ZLSL 4X98B 3V6OE 2WBJD 1T21A 2DL9A 5DUMH 5B4MD 3HC4L 3KPLB 2JKXA 2PO6B 1BX2A 2Q1EA 1F42A 4WO4C 4XXCA 5IBLD 4GOSA 1S8DB 4MMXC 3UPRB 1HH6A 3KPOA 3GMMA 5IJVA 2CJUH 5GGSY 1MF2H 2DWEB 5BO1L 1CE1L 2YD3A 4L3ED 4OFIA 1MCHA 4PFEA 3CLEL 4UAOB 5BRZA 3OGOE 1LEKA 2W92A 5KN5B 4NQDA 4JQVC 4ODHH 1DBAL 5KSBE 2JB5H 4QRSA 1XGPA 3QXDA 4KK8C 2Y5EA 4C58B 4U1IB 3LQZA 4XB7A 1WWAX 2XN9E 2ZJSL 4JB9H 3U48A 2WW8A 1FYTD 2Y06H 4JPVH 3VXRE 3DI3B 3ZHKA 1U8NB 3M17A 1E4XH 1NMAL 3HC3H 4ZUSB 1ZVSA 2YC1A 3B2UC 3UZQA 3VW3H 3MSPA 4WWKB 1ORSB 1IILE 3HR5B 3QIBB 1RIVL 2GHWB 3QIWC 3V6ZB 4J3XA 4PJIA 2FEEL 1P9MC 3UPAA 1B4RA 5ECJE 3VI3F 2MHAA 5GS0L 4JRYD 4RGMC 2F54B 1GJIA 1GSMA 1R5IA 5DEFA 5EUOF 2BOBB 5AYUH 2FBJL 3KYNB 5FOBB 3P77A 1Q38A 1GOGA 2HT2C 5FYLH 3VFVA 4M43H 5DJZA 1ZLWK 3W9DB 5I1HL 4MS8C 5I18L 5ALBL 3RVUC 1IAMA 4I3RL 1A6ZA 3LKOA 4M6OL 5K93A 4I2XB 4H5SB 4PBWD 2P46B 3H9SA 5KVDH 3BYTA 1KCLA 4FFZH 1DQDL 2IEPA 1ZA3A 1GPOL 3F12A 1KPVA 1I4FA 5DD6B 1AO7E 2WUBL 2DDQH 3CVIL 4PRHD 4PRIA 2JCCE 1BBDL 3MJ7B 4LSVL 2WV3A 2X9WA 5MERB 3VWJD 3QUMH 5CJXA 1U41A 2VUOA 2ADJA 5HGHA 3C87A 3QHZH 1PSKH 4MJ5A 5MENB 3EW3B 1QSEA 1T3FB 1NJ9B 3QWRD 4G7VL 4MZ2A 5D8JH 2YN5A 3O3EB 2BRRH 5IFHH 5DVNA 3RIAF 4C4KO 3D18A 4G80B 4IOSD 3MUY1 4L5FH 4YXLL 3MLUL 3ZKNC 1G6RL 5JHDA 4K94C 3L1OL 2ID5A 3TIEA 5CILL 4YGVB 1LO4H 5L2KA 4PJGF 3IGAB 4TTGA 3BP6B 1SYVA 3CDFA 2HYMA 2BHUA 1OY3B 5JXEC 1ZAGA 2EC9T 2CLVA 5CEYB 2NY1B 3GMRB 3L3OA 2E7LC 5GRVL 1KF9B 3PDGA 5KVFH 1F3JA 3M07A 4RA0C 4ZUUA 3S4SB 5C0RL 4DGIL 1NMCB 3TA3C 3TFKA 1KT2A 1XF5A 2D9QB 4WHYH 3QG7H 1MLCA 3VGGA 3ULVH 2AP2A 4G6FD 3DIFB 5FA4B 3QWOB 1BFOA 4MLSA 5D9SA 4XVTL 1FRGL 4CADB 1WFOA 4F7CB 3LB6D 2GSIA 1UM5H 1NGPH 1UZ8B 3CSYA 5CJ8A 2ERJB 4Q6YA 5FYJE 3MRCB 4ZS6C 2PNDA 3CDYA 5ACLA 3WDJA 4NKMB 4EN3C 2EDTA 2YEZB 4LCYA 3P11L 3T2QA 2AEPL 2DQJH 2HKHL 5FYKE 5J13B 3M8OH 5IBUB 1MCLA 4EDWL 3FOLA 1J0IA 3DVGB 1JGDB 4J4PC 4Z7UA 1NC2D 5GZNC 4JG1L 3BDYL 4LCWD 2FEDD 1CFQA 4NWTL 2YN3A 4XCCL 1U3HC 4DEPC 4F2MB 4OI9A 4R2GB 3NIFE 4WUUA 5E8EA 5BV7H 4XBPB 1NC4D 5AG9A 3MFFA 4HGWA 3QEUB 3EGSB 2HVKA 5MEQA 1S9YB 3GSOB 4F8QA 3HAEH 1MELA 3HB3D 2W59A 1MFDL 4X6BB 4X7TB 4L4TE 2RGSA 3L3JA 3AY4C 5FHBH 5DMKA 1XR8B 2DIAA 5IQ7H 5BS0A 1A7RH 1I7ZA 5ANME 2EO1A 3U2SA 5FAAA 1RUPL 4W6YB 3DHJA 2A74A 4FQHB 1MCDA 5J7CC 4KZEL 4JM2D 3BN9C 2NNAA 2BOCB 5ENWB 4N5UA 1JHLH 2EIBA 1E28B 4L3AA 3QFJE 4DW2H 2V5TA 1BFVL 3HKFA 5C08B 1N2RB 4P2QA 4F7PA 2WZPD 3HNSL 2IANB 3Q5YA 4UAOC 4FABH 4LPYA 3CCHB 5INCB 2AV1B 2J8HA 3LOWA 1BBJA 3SDAB 3KPMB 1P7QA 3L7EB 2X89A 3ABZA 4Y5YB 1TDQA 2IPUG 1OAYL 1H3PL 1BZ7A 2G60L 3QDGE 3KAAA 4R7NB 5C2BL 2VTFA 4YK4B 3VG0H 4YFLF 4M93B 2X4NA 2QLVB 4ZPVA 5CBAB 4GG6B 1DCLA 1I1AD 1T2QL 1T22A 3B83A 1TETH 1U8MB 4KK5C 2XA8H 5C0CB 5HDLA 5GISL 1JRHI 1I3RB 4LPWA 4WWKC 1S7XA 2D03H 3AM8C 3IRPX 5C0JA 4TULL 2C3WA 5KTEH 3MX0A 3S36L 2QJDA 3SGKC 4NRXB 5E8PB 1GZQA 3TO2B 3I50H 4JRWA 4WW1A 3KLAB 2X9XA 1BWMA 2HMID 2ADIB 2FGWH 3CAFA 1HYRC 3LKPB 3ARGA 1M6OA 2VLRB 5ESQA 1IAOB 3CUPB 4MAYA 1WBXB 3L5JA 3MRGB 4IRSA 1N7MH 1NGQL 3MLTA 1KB5H 4BQ6A 2FCBA 1GC1H 1U8KA 4ZO7A 3EO1B 4J23A 4IDJL 2V2XA 3BFOA 4OFPA 3VFSB 3VFRA 12E8H 3EDJA 4W6XB 3DV6A 3JUYA 4XBGB 4GJTB 2IAMA 3VFTA 1NCAH 4NQDD 4TNWF 3GI8H 4AYFA 1G6RB 4I0CC 5C0BD 4BZ2H 5DMIH 3BPLB 2XZAH 1QLFB 1EAJA 5T3XH 2HLFD 1T03H 3EDFA 1P6AB 4RMSA 3TT3H 1DFBH 4MCZA 4NSKA 3S37X 2Z8VC 4JPKL 1RHHB 3T3ME 1W72A 3PQYB 5JPMA 1NGWA 3QIUA 1WBYA 4PB9H 1OAUH 1KJ3H 4ZXBD 4GXVL 4LQFL 4C83A 4I1NB 1QBAA 4YDIL 5CS7A 3GGWB 4FG6C 2A73A 3ZYJA 1A6UL 1II4E 5FXCH 4F80A 3UYRH 3WFBH 3ELAT 5JOPD 4MJ6A 1F11B 1MRDL 2XYCA 4UZGA 1B6DA 1L6XA 4K23H 1CXEA 1S7UB 2VAAB 5CD5D 5ISZB 3CLFH 5IMKA 2JJVA 2NY1C 2F53B 1RZJL 2MKWA 3KPSB 1NMCC 4G42A 4X0KA 5FV2A 1I9IH 4GAJL 2VLKE 3LRHA 5IOPA 1IT9H 4NZDA 1HCFX 5CAYB 2AJSH 5EPMB 4KXZI 3P4OB 3ESVF 1S7RB 1AGDB 3O3AA 2C3XA 2R39A 2H32H 5JDSA 4DOHB 5LXGH 2ERJC 4ZFOA 1FH5L 4PRID 4X4XB 3WBDA 4NHUB 3MMEB 2OMNA 2GEEA 5JQ6H 1S3KL 2NY3D 3PP3K 4IS6A 2DWDB 1VPOH 1BD2E 5J13C 3BJLA 4XP4L 1YN7A 3ZDYF 5DJDA 1HHGA 3QWQB 1QSED 2LFGA 4JHAH 4LAQH 3MNVA 1IGIL 3C5ZC 4LSUH 3U36A 4HAFA 4MQXD 1JZ4A 5HHOB 2AKRA 3QXWA 1SM3H 2VNCA 4OCNC 3RWJA 1NGYA 5JHDD 1IC7H 1GAFL 4R2GC 1N5YH 4NOBA 4MJ2A 3BH8A 4Z7WF 4H25B 1YEEL 3NIDE 5L2KD 4HJ0C 3K3QA 3AU1B 2EDLA 4XVSL 3I75A 4IBLT 2WLYA 5JNYA 3FOMA 1QBMH 5L6YL 1K5NB 1YPZA 1AI1H 2F58H 1C5CL 3NTCH 3MBXH 3QRFM 2WIIB 3BP4B 4CNIA 3O6LH 4GS7B 4FXKA 2P47B 3BUYA 4HX1A 5L7XL 1AGEB 2OR9H 3UTQB 3TFKD 3ULVD 3F6IA 3LD8B 4PUBL 5F7HA 1MHCA 3MV8A 1UWEL 3MRBA 4PLJC 2IMMA 2XOTA 2BCKB 5I8KH 5J0BA 1TVBB 4J6RL 3UBXI 1LEGA 4XVJL 3QDJB 1FFNB 5IB2A 4ZAKD 5FFLA 2R23A 1ULVA 4NKIH 4IOFD 2R8SL 3JWDL 3BZDA 1QSZA 2AXFB 4MJIA 3TZVB 4X9BA 1KCSL 1JNNL 1HXYB 2J6EH 3HPJA 4PJHB 1PX4A 1N59B 1FL5B 2QHRL 2GT9A 2DI8A 1MWAH 4UT7L 3TVMD 5HYQA 3TJHC 1RZGA 2ICWJ 1MCFA 3SDAC 2X70B 25C8H 4LEOA 2I27N 2SEBB 5TDPA 1XGUB 1DSFH 4Y5YC 4OBSA 2ZCKH 2DS4A 1GGBL 4N0UA 4X6DE 1MCEA 1RJLA 3Q6GL 3WUWB 1TNNA 1INDL 2EDQA 5GS0C 3EYSL 2HFGH 5HHME 4YFDB 4WUUD 1G7LB 1HH9B 4YK4C 5CJQH 5E2UL 4M93C 1CLYH 1MJ8H 3IFLL 3T2NL 4JO1L 4QXUH 2VKXA 4G6KH 1ONQB 4NGHH 2R0KH 3PJSA 2EYTA 1EUUA 1U9KA 1QR4A 3FB8B 1IGJB 3P73A 1OAQH 1QRNE 5KBNC 2B1AL 2CKBA 3LMJL 1N64L 2FEEI 1AD9B 1FO0A 2X4UB 4GW5A 1M71B 3N1PC 2FECI 5IHUL 3VXQA 2HTLC 2YMXH 3MLXH 5EWIL 4YR6A 3WO4C 3KYOB 3BEVB 5TDOA 4JFDB 4JVUA 2HAZA 3DX8A 2NLJB 1I9EA 4PJ7E 4F58H 1H5BB 3SJVA 2P5WB 3ZMRA 5HVGB 4LNRB 3BKML 4N5ED 4V1DB 4P2QD 5KSVB 1REIA 2MMXA 1FNEB 1QFWL 3T08A 4MD5A 4TVPE 4WGVB 1IKFL 2R69H 3IU4H 5HDOA 3DMMA 3RPIB 1YMHB 4YHKL 2X89D 1MCSA 4P5KA 4PBXA 2AJUL 3BPLC 2PTVA 4P3WA 5E2TH 2Y07L 4E42B 3CFBB 3DV4B 4P49A 2DYPA 5C07E 1UA6H 2DKUA 4S1QH 4QXGH 4M5YH 1EPFA 1YYML 1YMMB 2C5DC 1CIDA 5GGTA 4ZPTA 3K8MA 1S7VB 5IMLA 2FJGB 5IIEB 3SDCA 2WK2A 4OQTA 2D7TH 3E6FA 5C8JA 4RAUA 4I48A 3NIFF 1N4XH 4WV1A 1Y0LB 1A7NH 5CJOL 3WN5B 3MTRA 1PLGL 2XKUA 3ARGD 3MV7E 1NBQA 2Q8AL 4MAYD 3C8KA 3MRKB 2IPKA 3CVHA 4IRSD 3W11C 4ODWB 5DDHB 4I18B 4P59L 4B41A 1V7MH 5K33A 5L8KB 5EZJA 5F9DC 2YPLA 4FP8L 4K7PL 3DXAB 5D7JB 3UROR 4QGTA 1U8QB 3RX5A 3RTQA 3B8YA 1NBYA 2AEWA 2IAMD 1C5BL 5F96H 3DX6A 3R0MA 4S11A 3RBGA 3WE6A 1FL3B 1UKSA 3I02A 1KC5L 2R2BA 3K4ZA 4KUZH 3CFEA 3P9LA 2MPAL 3ARBA 4LIQE 4DVBB 2OM5A 3DO7B 2P24B 3FB6A 3UTZA 2EE6A 5J1TC 1XCTB 1BLNB 1U8IA 3HUJB 1A7OH 5FO7A 1OTSD 3VXSE 5C9JA 4Q2ZB 3QIUD 2UY7A 3HZMB 1PQZA 3HG1B 3STZA 4FFEX 1IAII 1JF5A 4IIQA 4F9PC 3EYOB 3U0TA 4NO5A 5T33H 3ARSA 4NO0B 5D7IA 5E0QA 4MA3B 3CFDA 5I2IA 5BXFB 4LCCA 5E4EB 2XPGA 5ICZB 5HHQA 3SDXA 3AS2A 1M7DB 1J8HE 4JKLA 4NPYA 4GS7C 1FFOA 5JW5B 1FORL 4Z5RB 3SDDA 3KNBA 3LD8C 5ETUA 2RBLA 4JLRA 3IS1X 4RFEA 1U8HB 3EFFA 2OCFD 1T1XA 4JQIL 3FFDB 3RY5A 2VXQH 4UV4L 4FQQB 4Y5VA 4CVZB 1U6AH 2K9UA 1UENA 2MTPA 3LKNA 4HLZH 1TCRA 3TZVC 5I1GH 1MY7A 3MXWH 4XCFL 3DTXB 4I0KA 1O7SA 2D9CA 3G04B 1NFDA 1NCBH 1D6VL 1OW0C 4R96A 1KJVA 3DROB 3GBMH 3W39B 1OF2A 3QEQE 1A6VH 2FDBP 4KJYB 4PJXA 4EUPB 3SQBA 3VXMA 4JFYB 1FVCA 1I9RL 1HI6A 4PJBE 3T3MF 2W1NA 1IC5L 5SX4H 3MLWH 3RWEA 3RNQB 5KZCD 3V6OA 2EDOA 1MOEA 3NA9H 5GS1A 3D85B 1NCTA 4XP5L 3WNPA 2ZG1A 2C4XA 2DQUL 3T0EE 3IFNL 4DZ8B 4M8VA 1AR1D 4FZ8L 3MV8D 4Y4FA 2BHYA 2L7UA 4FXLA 1OP3H 1NCCH 3BPCA 1JJUA 5E6IA 3H6JA 2OQJB 2PTTA 5I17B 4X9GA 4LMQI 4G8FB 5C3TA 4HWBH 1JV5B 3QH3A 4P3CH 5I19L 1GOHA 4OIBA 3THMH 1DE4B 5SV3A 1X3DA 4CMHB 3SE4A 3WIFB 5CJ5A 4JFEE 5KSBA 4MA8H 4XAWL 3QXAB 4HKZA 4IRJB 1B2WH 4ZUVB 4NQEB 3GZKA 1MI5B 3QG6B 2OSLA 4KI5C 1IEBB 4X80H 1VA9A 2VXSL 3VXOA 4C4KT 1MAJA 4P9HH 4I77H 3KYMA 4P5TD 1A14L 2FIKA 2X1WL 1OGAA 1T0PB 4GKSB 4DCQB 3NZHH 4NJAH 1F6AA 5IB5B 5C6TL 2J8UA 4NN6B 1FFRA 4LGPB 2ZPKL 4JO2L 1JGLL 3FAXA 3MREB 4KJQC 3RAJL 4K7FA 4OZHB 5KJRH 1CE6A 4NN5C 3W5NA 3N9GL 4LMQE 1RZJC 3E6HA 4KKLD 1FYHB 1FG2B 1DN2A 3BW9B 4J1UA 3P0VH 5ESAB 1EEZB 3ALXA 2XQBH 2NTFA 3ARXA 1OARH 5DYOB 4YDLB 8FABB 2OJEA 5KVMC 5E8DL 3QZWB 4OZIE 5IVZB 1PYWB 4NUJB 4OLUH 4YE4H 4OD1L 4O51B 2OTUB 3U83A 4QTIH 2BK8A 1YNLL 3B9KA 2DQFB 3F65A 1MIEL 1NQBA 4MA7L 1KENH 5IVXE 1DQLH 3OAZK 3C6LA 4I18C 3SJVD 2DJSA 1NL0L 3V0AC 1A8JH 1DEEB 4D9RD 1NCDH 1KEMH 5D7JC 5CIPB 3V4UH 1AHWB 2CLZB 1OPGH 5I1LA 2JCCA 3WL9B 1U92B 1JHTA 1HKFA 1DDHA 2JJSA 3DMMD 1WEJH 3PGDB 1YEDA 3SE3C 1EUTA 2HRPH 4MYWB 3ZKXB 1OVZA 5DQ9A 3BIBX 3GBNH 4PGBB 4GQPH 1XR9B 3ORJA 2H8PB 1FGVL 1TVHB 4G8IA 2CO7B 4U2ZA 3G6DH 1Z0NA 1ZT4B 2OI9A 1SMOA 2AK4D 4QYOB 1BZ9B 2R4RH 2C3GA 3JUZA 4OLEA 4UTAH 1QFHA 1JMXA 1MFBL 3VDBA 2A6IB 1B4JL 1ETZB 1UADC 1AD0A 2BVEA 3SDCD 3PHQA 3N0PB 1UB5B 5T5NF 3RZCB 2H41A 1OQXA 1QA9B 1YC7A 1GXEA 4CU7A 3FRUA 1U3YA 4P2YA 2MNUA 3BP5B 4PJAE 1AXSA 1X4ZA 1GCFA 3K1DA 4K55A 4MB4A 4JFFB 5HJ3B 4PREB 2XRAH 2Z92A 5E4EC 5HHNB 1C7TA 3UEZA 1LVEA 1FNSH 4HSQA 1T7ZA 2ZOLA 4O2FB 1NGZB 1OAXH 4FQ1H 2R2EB 4NNYB 4JO4L 2VN4A 1NBZB 2YPLD 3MV9E 5I1CH 4CN4A 3RIFK 2M1KA 1U58B 3S97C 3CZFA 1GZPA 1B90A 4G7YH 5DHVB 3NABH 2HH0L 1BOYA 4KUCF 2V2WB 1KLGA 1R0AH 5IB1B 4ZSOE 5HI5C 3LHPH 2EICA 5EZIH 5EZOL 5TE7L 2FJFA 5FYKH 3NAAL 4FNLH 1E6OL 4M5ZL 3ECBA 5J3HC 3P4NA 3HHRB 5EOCH 3ILQC 4PJDE 1S9WB 3EZJB 3JV0A 2XTJC 4K8RD 3QAZB 2D31B 2O93L 3VRJB 1Q94B 1E27B 3A0OA 1VESA 4LRIC 1T83C 1YN6A 3OKEA 4ODTL 2LAAA 5DC9B 5D5ME 2RQ8A 4L4TA 4TRPL 1XMWA 3OJDB 2Y5TA 1D6EA 1H15B 4GT7A 3BQUB 2R1WA 4CL7A 3ME0A 1DLHA 5ANMA 2VLME 3SCMB 4EBQH 4ZQKA 5EOTA 2X5PA 5MP6L 3IU3A 4E41B 1LMKA 3WFDH 3TO4B 4LP4A 1R3KA 1AXTL 2HLAB 4PRAB 3SDDD 4MXVF 1X7QB 4I5BB 1PKQE 3QFJA 3OGCA 3FKUS 4XRCB 2BNRD 4LSPH 3P3YA 3RUGB 1CVRA 2GIYA 5DK2A 4WUKL 4CMHC 1QR1A 4R4BB 4ODUB 3C60C 1M7IB 3ULUD 5SWQA 4IRJC 5T1MA 3M1BA 1ZMYA 4CKVX 5FDWA 5EZLB 4JRXA 3MCLH 1R5VB 2X9YA 3QDGA 3FHAA 1DBJH 3LIZL 5TPWL 2Y36H 3VXMD 4ENEC 4QT5B 4MNQE 4PTUA 4NN6C 3FFCB 3DGGA 3T1FA 1T0NA 4IOIB 5B38G 4KROB 4M1GH 3NH7H 1LK2B 4TOYH 5IK3B 3CFCL 1FV1A 4BSWB 4MX7A 5IROA 5E2WH 1SMAA 2VLLA 4OLVL 4TUJB 1EGJH 3X11B 4UBDD 3O4LE 3O41B 4GW1A 2VWEC 4YDLC 3U0WH 4PGDB 1GH7A 1A64A 6FABL 3EYVB 3MJ9H 3OSKA 2DQHL 4QHMA 5TDNA 4GKZB 3JTTB 2OTPA 2IPUK 4Y4FD 4TTDC 5D7KE 4OFKA 1CLZL 3OKOB 4PRNA 1LNUA 1Q9KA 3CFJA 1R24A 5DK0B 4LPVA 3U6RA 3VGFA 1CXLA 3L3GB 3VXTA 2I07A 5I8EA 4HUKB 1YQVL 2JELH 1KPUB 3TV3H 1X4YA 3S3SA 1HSAB 5TQ0H 3VWKB 2DOCA 1MRCL 1ZTXH 2AABL 2XN9D 3E8UH 1YJDH 3WIHL 3ZKXC 2OL3A 3VXRD 4RMRA 2QQNH 1SJHB 3PWPE 3ZTJH 5FO8A 5LAXA 1HEZA 3FQTB 2DBLL 3T0XA 5JA8B 3UMTA 5LGHL 1HQ4A 4R8WH 3JV4B 3P2TA 3K8KA 5JPNB 4NRYB 1JVKA 3TBTB 3GUTA 1TZGH 4CGTA 3U7YL 1QEWB 4D0DA 3EDKA 4L4VB 3RZCC 3SDYL 1VACA 4WFGE 4QRRB 1K6QH 5CD3A 1XF2B 5JMOC 1AY1H 5E6ZA 5DSCA 1D5ZA 3HE7B 2O61A 1UGNA 4QCIB 1Q9OB 3SKOA 3BIKA 5E24E 1ZT1B 5DD1L 3BP7A 2I5YL 2ESVE 3C2AH 1ZT7A 1YEGL 4GAYA 5HGAA 3MRDB 3B9KD 3EOTH 3O6FC 4LVNB 5E9DB 2Q6WB 2RHEA 5C6PB 3C6LD 1TMCA 3U4BH 3O45A 5K9OA 3LKRB 3V2AR 2NW2B 3NOIA 2ZSVA 5SWSA 3SBWC 5I1DA 4JANB 3PNWA 3LKQB 4LLDA 4N8VA 4NQVA 1AO7D 2PYFB 3PABB 4GKNA 2YHGA 2GCYA 3GIVA 5BOZG 5IW6A 5A43C 5F8QC 4AL8H 2YD5A 2O5XL 5C09B 1JI1A 1Q9LA 1BECA 1MCCA 2G5BB 4D2NA 4PJHF 2Z8RA 1BD2A 3ARPA 5HVWA 2YZ8A 5DRZA 1N6UA 1JI2A 5CGYC 1UM4H 4APQA 2D4DA 1XF4B 3S34L 1GRWA 1H8NA 1TJGH 2IALB 5EU5A 3DRQA 5D71H 4JY4A 3RKPA 3HA0A 3NFPA 1ZXQA 1AP2B 3F62A 5D72H 1I3GL 2DLTA 3X3FL 4R3SA 3BHBB 1NDMA 1LHZA 1IQDB 1XGRA 1J1OL 1MCQA 2ZWLT 4LGSB 3GNMH 4PD4J 5HY9A 2ZG3A 3MJ6A 4JHWH 5DF0A 2JF1A 5DD0H 2FZ3A 5BOPA 2HJLA 4NHCL 4ERSL 4PG2C 3BQUC 1D5BA 4JFOB 5CZXC 3SCMC 3B9DA 3G6JB 5JTWA 4JAMA 1QFPA 1ED3A 4OSUL 5EU3A 5SX5H 2R4SL 4JG0H 5FOJA 4XWOD 4ZS7H 5IVXF 5FYJD 5DJCA 5M94B 5TE4L 4W4NA 4DKEH 1PG7H 1PAMA 1T5XB 1XIWC 5FYKD 4LU5H 4NKOA 4KI5F 3PG2A 4NWUL 3IAGC 4QXTB 4FS0A 5IEKA 1OM3L 3QQNA 1KV3A 1ADQA 4XCEB 1CICA 1ZLSH 1I8IB 4X6DA 4X7SL 4X7EC 4HMEA 1BOGA 3B9AA 1KXTB 3CXHK 4OM0L 4QXWA 5D2LB 1A4KB 4EZMA 4PJ8D 4RFOH 3VJ6B 1RPQA 3FT3B 4YBLC 1MRFH 3DETD 3TN0B 1OTTC 2BERA 4N1EA 1QFWM 1QRNA 1BM3H 4HFWA 4L4TD 5F88B 1CE1H 3WO3B 5BO1H 1ZHLB 3VE0A 2WWKT 5J1SC 3CLEH 1FSKB 3CK0H 3HFML 1GGIL 4QOKA 4LLMA 3LEVL 4LKXB 3VA6A 4NM8H 4RNRA 2R0WL 4Y5XC 1DBAH 1HOCB 2Z35A 5IFJB 4IHOB 1HIML 3RVXD 5GHWL 4PJ7A 3B4NA 3H0TA 2ZOKB 3G5YA 4LLVA 2NTSP 3QFJD 5GJTL 1YECH 1Z2KA 1UXSB 3VFGL 4PP1D 1X5YA 4N8CH 2A77L 5F9JB 1OP5H 2GK0B 1S7WA 3UTSE 3SKNB 4M6NL 4MQTB 5DHYB 5KS9E 1YNKL 3I6GA 5FIEA 4HZLB 4Y2OA 2OMBA 5EU6B 5GGVY 2C1OB 1C5DB 5J9PA 1JGEA 3H8NA 4XCYB 1RIUL 3VWKC 1A1MB 3KXFB 4JY6A 5C07A 3QDGD 2GY7B 4HKJA 5ITFA 2J12B 4F9LA 3GB7B 2VL5B 4BH8B 2FBJH 1VDGA 3E2HB 4PJDF 2J88L 2Z91B 4PJEE 3FO2B 3GSNL 3D39B 3QNZB 1JF1A 3WFCL 1F02I 2VQ1B 1CGVA 3VD9A 5I1HH 2H3NA 5IB4B 4NRZA 2OX5A 5I18H 4Y2DB 4I3RH 3WFHB 1TZHB 4JZJB 1Z3GL 4M6OH 2PR4L 5IW3A 4KDTA 3ZE0E 4MB5A 1NUFA 2JLLA 4OCWH 1DQDH 4YHIB 1GPOH 2AW2A 3MV7A 2BDNL 5GSRB 3TESA 3T4AA 1G7JA 2WUBH 4PTTB 1F4XL 4Y4KD 5IESL 5CMAB 3HE7C 1JL8A 4U1GB 2Q20A 1BBDH 2NXYD 5LKNA 4LSVH 5HGBA 4RFNC 4UT9L 4B5EA 4KKAD 4M7KL 5T5FH 1MJUH 5FF6A 1A02N 2AJ3B 5EBWA 3TGXA 4ODSL 4G7VH 4BFGA 4GW4A 3FTGA 1ZVHA 2A0LC 2MKLC 5HYEA 3AXLA 2Q76A 1NBVL 3IJHA 3MLUH 4FQXA 2XWBA 4YWGL 1MHEB 1JF6A 5M95B 3L1OH 4W4OA 1A0QL 4PJFB 2XZZA 3QEGH 1V7NH 3ARVA 1VFBA 2VOTA 4LEXL 4LIQH 4O2EA 3CX5K 4UNVA 1SJEB 3ULSA 3VXSA 2WBJB 3P0YL 4HKBB 1B0GB 5C0RH 5GIRA 5K9JH 4FFYL 4OIIL 4ORGB 5ICYB 1X9QA 1FDLL 4Y4HA 2X4QA 3LRSA 1EEUA 3MGTB 2DB8A 2VO5A 3B3IB 5DJ6B 5DJYB 4YHNB 3K2UH 1G7HA 5JHLH 4XVTH 4QHLB 1QFUL 1ZEAH 1DP0A 1OAZH 1YEFL 4EKXA 3MO1A 1KOAA 4H20H 4XCNB 5F89B 3L3KA 1K8DA 3ARFB 1X5FA 4L3EB 4HT1H 2X4TB 1J8HA 4HWNA 5KG9A 3S96B 1XT5A 1NPUA 4KV5F 3BT2L 4CVXA 3L3DB 4PJCE 3P11H 1U95B 2AEPH 2HKHH 4PJ9C 4G9DA 1G7QA 2VLKD 3WV0A 4F3FA 4NP4H 2FSEA 3MGOA 5DO2D 1P4LA 3T04D 5GGUB 5C0AA 2V9TA 1JZ6A 4OCXL 1FYTB 4ONFL 4XPGL 3PWLB 4BFIB 3SKUD 5BMFL 1QBBA 3QUZA 3P30L 4U33A 3PWJA 1BD2D 4HXAL 3DURB 3WHE0 1MFDH 3GKWL 1TJIH 2AJVL 4M62H 2FX7L 1YC8A 3T0DA 1RUQL 1Y6NR 4EVNB 4P2OC 5FB8B 4JRYB 5IR1B 3VFUB 1L0XA 4X4YA 3PHSA 3GDBA 4PJBA 4U0QB 3TEUA 1H8SA 1RUPH 3DVNB 4ZFFA 4KZEH 1DUYA 1Y18A 1A7QH 2AK1L 2E3VA 5EFIB 3TN0C 4D0BA 5JLZB 1BFVH 5LWYH 2APFA 2FO4B 3CMOH 3NFNB 4D0CA 1LE9B 3HNSH 3QCTL 5J11B 4M8QB 1FLRH 2Z93A 1FSKC 1J11A 5EC2A 5TE6L 1JPGB 2Z4QA 4WIQA 4PRHB 1T7VA 1LO2H 3IDIA 4P23A 4HUWA 3OKLA 3V4PL 1IM9A 3VWJB 4NZTL 3BZEB 1MF2L 2FL5B 4GRMA 1YY8B 4JZOA 3RKDD 5F72S 3SE9H 3MRHB 3QULB 2XWJA 1H3PH 3H9ZA 4JN1H 5FO9A 1CTNA 2G60H 3KLSA 3BPNB 3OJ2C 2VDRH 4JFEA 3PGCB 4ZYKA 1N3NA 1RI8A 2K3TA 2YUVA 2G9HB 4DQOH 1J05B 2WWMD 3HMXH 3GSNB 1R3LA 5GISH 2GFBB 1HCVA 4WTZA 4TULH 3QO0B 2Y06L 5FCSH 1MLBB 4G6AC 4GXUM 2PKDA 1OB1A 3GMPA 4YO0B 1T20B 2RAMA 1DN0B 2E9IA 5HHMD 4FFVC 3T77B 3WJLC 2J6EA 4TSCH 1CDCA 4R90L 3E2HC 1BMGA 2FYYA 4YDVB 4CMMA 4F57L 1NGQH 1WCBB 3U4AA 2A83A 1CGTA 3G6AA 2A6JB 1HZHL 3WNMA 4G6FB 4IDJH 1QRND 4L1HA 4OZFA 5IHZA 2DRUA 3VGEA 5I71B 4Y2DC 2VAJA 1CFSA 4OZIA 1AGCB 2VIRB 2C7UA 4H26B 1SBSH 5AYUL 3T0AA 4HC1A 4I0PD 3SOBL 5FYKU 5GGRY 2HJFA 4ELMB 5JOEA 4M43L 4TN9A 5I8OH 4MAUL 2X4PB 3D3VA 4EQ3A 2EE9A 4U1GC 4X6EB 5DMJB 3I6KB 4NT6B 4XHQA 3A6OA 2CK0L 1LK3H 1OP9A 2VYRE 1NC2B 2R29L 2VITB 5HGDA 1OGTB 1T0MA 4LCWB 3IAQA 2P5EE 1INQA 4TVPD 2EDBA 3PV6B 1FVDA 2LVCA 3MLYL 3CX5J 4MXQC 2P44B 3AVEA 1NC4B 4FXGB 2H45A 4YDIH 3U4EA 4QRUB 1KB9J 1PSKL 3QHZL 1A6UH 1U8JB 3MUGB 4Q97A 5C07D 3ZDZF 1MRDH 4U1NA 5HPOA 4M1DL 4HIIA 4LL9A 5IQ9B 9CGTA 1FZMA 4EIZC 4HH8A 4YHOH 2O5YL 1RZJH 2QBWA 1AC6A 1KG0B 1K2DA 1UVQB 1FBIH 4HWEL 3Q1SH 5B4MC 2NR6D 4PV8B 3BMVA 4GAJH 3UBXG 3O8XB 4PJAA 3KDMB 5IBLC 4PDCE 1KN2L 1EHNA 2YPKA 4NQXA 3RVWD 4HCRH 3MV7D 3LQMA 4JKPH 3RRQA 3ARFC 3TCLB 3X12A 4WWID 3F58L 3Q3GB 5DQJA 5F7KC 3ULVL 5L9DL 2YS4A 5JIPA 1ZLWH 1CG9B 1S3KH 4YHZL 2ITCB 1CD9B 2P8PB 3H9HB 3O3BA 3MV9A 3T3PF 3VI4E 1L7IL 5EORH 4BQ8A 4JDZB 3LEYL 1NGPL 4XP4H 5I1JH 1RK1A 1A3RL 2EIZA 1JUFA 1CBVL 1FPTL 2JIXA 5L2JB 5TGBA 4GG8A 4LVHC 5H94B 1QSVA 4ZSOA 3TIDB 1Y6KR 3RUGF 3M8OL 1AIFB 3T4YB 3HI5L 1I9JL 1CGWA 1DR9A 1I1AB 5KS9F 1DUZB 1YEEH 2X1PA 3D2UA 4HK0B 5F6HJ 2A2QT 4XVSH 4HHAB 5L6YH 1W2KT 2Z31D 4JDTH 4J8RA 1C5CH 1RVFL 1M05A 3SGEI 3VXSD 1M4KA 5BV7L 5L7XH 4JJHA 2Q3AA 4PRPA 1IM3A 4Y4HD 1C8PA 4C54A 3BRFA 3OMZA 5DUPH 5D5MA 1NFIA 1HH6B 3KPOB 3GMMB 4JFXA 3CPLA 5IJVB 2QR0B 2HT3D 5TFSL 3B5HA 3JWDH 5T1LA 4NFBA 2IQAB 1NDGA 5FUCC 3TM6A 1KCSH 2MFNA 4FQPA 5H35B 1JNNH 1CT8A 4NQDB 1BQSA 4WU7A 3HE6A 3QJFA 5J11C 1UT9A 2GTWA 1H3XA 2NPLX 2QHRH 4R0LB 5C0BB 4QRSB 2IBGA 3QXDB 4JN2A 4UT7H 1PKQA 5F7WC 5DMYA 5T1DL 3LQZB 5HPMB 1I7RA 4Y0GA 3MR9A 5JIHA 3LV3A 3VWJC 2VABB 4O9HL 4FHBD 1P5UA 4RMUA 5D7LA 1MCOH 4JR9L 5A2KH 3Q6GH 3DX9B 3QQ3B 4S2SA 2YD4A 3BEWA 5TF1L 4DUWA 3BPNC 2ICEA 3EYSH 3QUZD 4OLWH 2F53E 2YC1B 5C0DA 3UDWA 2XACC 5E2UH 4PB0H 2AQ2A 4ZXBB 5D6DA 2CSPA 3C9NA 3QEQD 4XAKE 1K3ZA 2XZQL 1N64H 1HWGB 1I1YA 5C86A 4EUPH 3SGDH 1RZ8A 4MNQA 4D9QE 1R5IB 5DEFB 2QHLA 5EWIH 4H1LH 1N6QH 4IMKA 4OZ4A 3P77B 2D03L 4FQIL 1KIPB 2KBGA 3QXUA 5DJZB 3VFVB 4A2MA 5CP7B 4PRBB 3RY6C 2I26N 4YUEH 4F15B 3A6BL 4KZDL 1CI5A 4QF1B 3O4LA 3LKOB 1IGCL 5I74C 1N8ZB 3BKMH 2PW2A 4X99A 5I71C 1ZE3C 3NN8B 2F15A 3LB6C 3D0VA 4I3GA 3T0ED 4D94A 3F12B 1IKFH 1I4FB 3QUXA 3V7MA 1IGFL 3IT8D 1F6LL 4L9DA 1QLEL 1CTOA 4P23D 1KB5L 4PRIB 3H9YA 1IM9D 4YHKH 4AT6A 3FN0L 1PVHA 2NY3B 3RDTD 5EN2B 3D25A 1A1NA 4O02L 2F5AL 4MJ5B 2EXYC 4XZUA 5GS3A 4OZGB 1P1ZA 2EH7L 1QSEB 1O5DT 4OTXH 5FCUL 4JFED 1PEZA 4HS6B 4OJFH 1MCJA 3TH2T 3HNVL 4W68A 2NZ9C 4OQ1A 4KRLB 2XZAL 3CMGA 4Y19E 3MROA 5JHDB 3AREA 2APXA 5F7LB 3TIEB 2I24N 3TT3L 1DFBL 3UTTE 2OR8A 5L2KB 1KBGL 4E0RB 1SYVB 2C1PA 5CJOH 2K7PA 2ICWA 1PLGH 4RDQG 3L3OB 3HB3C 2DLHA 1R3IL 2Q8AH 1F3JB 5F1IB 5MI0B 3I2CH 4DZBA 3BDBA 1S7QA 2WIMA 3QI9A 1QNZH 4P59H 3BRGC 1H3GA 3QHTC 5H37G 1AGBB 1WQVT 2DQCL 4FP8H 1A3QA 1Z9MA 5CBEB 5F7FA 43C9B 3O8XC 5INDB 4X6CE 1RU9L 4ZAKB 5D2NC 2YD6A 3CSYB 5GJSL 1IGTB 2PCPA 4HG4J 2ESVA 4PJ5E 2J7LA 2VXUH 3X13B 1I9IL 1KC5H 1P84K 4LCYB 3OR7A 4MQ7A 3U1SH 5B39A 3GSVB 4MXWH 3RVVC 3TVMB 4Z7UB 3DSFL 3GM8A 1RSFA 1K8IA 4LCUB 2FWOB 2FJHA 1L6ZA 3ISWA 4XMPL 5BV7B 1KJ2L 4ZFOL 4WUUB 3ROLA 2W9DH 3MFFB 4HGWB 1P53A 1R5WB 1KN4H 1PZ5A 1I1AC 4YLQT 3JTSA 5HTSA 3KPTA 5D93B 5MEQB 4LAQL 5E00B 3IDJA 4WW2B 3MNWA 4YHLH 1RZIA 4CJ1A 3L3JB 1NAKH 1SM3L 3EFDL 5DMKB 1W0WA 3RWIB 1I7ZB 2HMIC 1ZVYA 1FORH 3MCKB 2FB4H 3V5KA 4PGJA 5C0EA 1NAMH 4W81A 2HN7A 4ZUTA 1T1WA 4MDJB 4YBQD 2F58L 3MBXL 4JQIH 4Z78A 1PD6A 2OR9L 3F7RA 3MA9H 4OZFG 1JPFB 5HI3D 3QIWA 4G43A 2COQA 4HUXB 4RISL 4LKCA 4WJ5A 2BNQE 5HSFA 3MV9D 1P9MA 1BBJB 4R0LC 1RFDL 4M03A 3QR2A 4RIRA 2BJML 1HYSC 5J4MA 4HIXH 5DHVH 3OXRB 3GMNA 4CAGA 4JFHE 3ZYIA 1GHFL 4O5LL 1I9RH 4YHML 4MS8A 2X4NB 4BKLB 2AQ3A 3PP3H 1IC5H 4ZPVB 3V7AE 5AUMB 4RAVA 4XHJD 1T22B 5CEXA 3D2UD 4ZXBC 3EYUH 2EDWA 3HS0B 2Z8SA 2G2RA 5C0JB 1KCRH 3RHWK 4X6FA 3JWOL 1A3LL 1GL4B 1HSBA 4UV7L 1GZQB 5JMRA 3IETA 5E5MA 2XFXA 4N9GB 4A6YA 1M6OB 2OXGA 4P57A 5ESQB 4MAYB 4QXUL 5E99L 1KB5B 1ORQA 2R0KL 4OF7A 4DTGH 1IZKA 1VADB 1YDPA 3UTPE 5FGSA 3SGJC 3HRZA 5B3JF 2NMSA 1J0ZA 2V2XB 5DFVD 5FGCB 1EHXA 2R1XA 2YMXL 5BRZE 2VLMD 3MLXL 1FO0L 1J7VR 1R3JA 1MH5A 3VFTB 5HYSG 1MHHA 1M1SA 4XAWH 2OZ4A 3KLHC 4M48L 3ARQA 3I3DA 4OLZL 5JW3L 1LO5B 2VXSH 4WTWA 4NC1E 3V6BR 5DJ2B 2YXMA 1EEYA 2A6KA 2E7LA 5CLWA 3VI4F 5CJXC 1WTLA 2YD1A 3GI9H 1PW3A 4NSKB 2WP3O 3MA7A 1S9XA 5C6TH 3TA3A 5I76B 1ZSDB 4BSVB 1RHFA 1CDYA 5DC4B 1L4IA 4POYA 5JPMB 1NGWB 4Y7MA 5GRXG 4U6VL 1WBYB 3RWCA 43CAB 5ACZB 4NDMA 3AS3A 4PJFF 4PJIE 2I60L 2A73B 2C3VA 4S1QL 1JZ7A 4M5YL 5E8DH 3TF7C 3IJYA 4MJ6B 1HHKA 1T1YB 5L8LB 2XXCB 3V52H 2G5RA 4MNQD 2XNAB 4O58L 1CK0L 4OD1H 3MUZ1 5IMKB 4PJEA 2XZCL 1KNOA 4QY8A 1YNLH 4HJJL 1MIEH 4J4PA 4OQTL 3ULVC 4G42B 5MI0C 3TFKC 2ZP0T 3PDOA 1TQBC 4X0KB 1HN1A 3O9WB 1UQSA 2GI7A 3L5IA 1NL0H 1KPRA 3O4LD 3GHEL 3O81A 5IOPB 3H9SE 1U3HA 1EXUB 1G9NL 2H32B 2XTJE 4XNUL 1QUNA 3GSQA 3JVGC 3O3AB 4ZAKC 5CLTA 4TNVK 1XGQA 3BWAA 3CFKB 1KJ2B 5D7KD 4ZFOB 3RWFA 3TBYA 1UB6A 3BISA 4IS6B 1U2HA 4QWWD 4XX1E 3AY4A 3B5GA 5DS8B 1YN7B 5L0QB 1OOAA 1EGJA 3TVMC 5DJDB 2R2CA 3ZE1E 2W0LA 3DGCR 2GJJA 5F8RC 4ZD3L 2APVA 3KVQA 2AXGA 3ZTNL 3KPLA 3SE8H 3ROOA 3U36B 3DBXA 4NQSA 2AKRB 4U1LA 1HK6A 4ZOCA 1B4JH 4XXDA 5BV7C 1NGYB 3BVNA 3ARED 3SKJL 1JWMA 1S8DA 3TYGL 3BH8B 1Z9OA 3QQ9D 3HR6A 2DWEA 3T1WA 5ICXB 3LZFH 3PWPD 3I75B 4JGMA 5KZCB 1OSZB 2FHBA 5JNYB 2FHCA 5MEOB 2OK0L 1YPZB 3QNYA 1JK8B