4HUXA

Crystal structure of h2db-h155a-np
Total Genus 63
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
63
sequence length
276
structure length
273
Chain Sequence
GPHSMRYFETAVSRPGLEEPRYISVGYVDNKEFVRFDSDAENPRYEPRAPWMEQEGPEYWERETQKAKGQEQWFRVSLRNLLGYYNQSAGGSHTLQQMSGCDLGSDWRLLRGYLQFAYEGRDYIALNEDLKTWTAADMAAQITRRKWEQSGAAEAYKAYLEGECVEWLHRYLKNGNATLLRTDSPKAHVTHHPRSKGEVTLRCWALGFYPADITLTWQLNGEELTQDMELVETRPAGDGTFQKWASVVVPLQNYTCRVYHEGLPEPLTLRWEP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords H-2 class I histocompatibility antigen, D-B alpha chain
publication title Preemptive priming readily overcomes structure-based mechanisms of virus escape.
pubmed doi rcsb
source organism Mus musculus
molecule tags Immune system
total genus 63
structure length 273
sequence length 276
ec nomenclature
pdb deposition date 2012-11-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00129 MHC_I Class I Histocompatibility antigen, domains alpha 1 and 2
A PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4huxA02
3.30.500.10 Alpha Beta 2-Layer Sandwich Murine Class I Major Histocompatibility Complex, H2-DB; Chain A, domain 1 MHC class I-like antigen recognition-like 4huxA01
4NZTH 4G3YL 2W60A 3O41B 5J0BA 2HVJA 2HTLD 3RWHB 2VUOA 4YHIB 2F53B 5C9JB 8FABB 2RCSH 3BPCA 2FH6A 3MBXL 2NX5B 3P73A 4NFBA 2JJWA 1IGTB 3KNBB 4GW5B 3L1OL 4Z8FH 4Z6AT 4UTAH 1DEEA 1HOCA 4AMKL 3LRGA 2IQ9H 4PRHB 3RIFK 1IEBA 3RTQD 4HWZB 4ELMF 3CXHJ 5JZ7D 1MCOH 3N50A 3QBTB 3VDCA 3AVEA 4KXZI 3AROA 3ZDZF 3BVNB 1KBGL 1CGUA 2HKFL 4WWID 3UO1H 3DGGB 4L1DA 1LEIA 4WO4D 5CZXD 5EUOE 4XAWH 4HSQA 5B4MC 1D9KC 5I66A 4DUXA 5DK0B 5C0DB 2ZCHL 1LO2L 5C0JA 2XPGB 1OD9A 2HVKB 1R0AH 3DXAD 4ZAKC 2J4WH 1V7NH 2F53E 5JHDB 1IFHH 5D2NB 1N6QH 1ED3B 3TYGL 2BNRA 2ZPKL 3DVNA 4RA0C 4Q58C 1LQVA 1RV6X 4W4NA 4PRHE 3PGCA 4TQEL 4ZSOA 1GIGH 2H8PA 1II4E 1DDHA 1YEIL 1MQ8A 1QFWI 2HJLB 4BK5A 4XBEL 3PL6B 5HD8D 3DV6A 1ETZA 5EOQL 4GLRI 4G8GD 4KRMB 3VRJB 5TDOB 4WW2F 2WUBH 1L9NA 5A16B 4HZLB 4OF0A 4ONOA 4Y4HA 2AJ3A 3D9AL 4FP8L 1MHEB 1EXUA 2VQ1B 5L8KB 2APFA 2ADIA 2VDNH 1TJIL 2GFBB 3B2UD 1XF3A 3MRPA 5I75B 5JHDE 3ALXA 2A9NL 2ZSVB 3KPSA 1T1WB 4PJGB 4RX4D 3S3SA 2FH8A 5HVHC 4X6EA 5JDJA 2DQFA 4YNYA 1R3JA 3P9MA 1HIML 2NR6D 5GRJL 4K94C 2HMIC 3ARTA 2Y6SC 3EKCA 5HHPB 4CW1A 4XCFL 4ETQB 4J1UB 1J8HE 4AEIL 3RPIB 3CSBA 2WANA 4P2QE 3BRFA 1KEGH 4AH2A 1QFPA 1KV3A 2A73B 3GMLB 4XPTL 3WN5A 4CAGA 3MUZ1 4QCIB 2DWDA 1I3GL 3ZMRA 1RVFL 1ZLSL 4PGEA 5DK2A 3KLAA 3PV7A 1FH5H 1KGCE 3I75A 1NKOA 5GS3A 3K4AA 4PJGE 4AEHL 2QQKL 1RIHH 3T09A 3D69A 3JV6B 3UAJC 4OIIH 3BIKB 1T3FB 3FT2B 3HE7B 3I50H 1BWMA 4K3DH 5C7XH 4YE4H 3S35L 1IL1B 1HQRB 2WBJA 2WW8A 4Z7NE 3WJJA 5I71B 4HPYL 4KPHH 1UADC 4G6ML 1DQLL 3VFGL 5C0AD 1F90H 4R90H 2NZIA 2P45B 4DVRH 1P7HL 3GKWL 4AJ0A 5FCUL 3QEGH 5FGCB 2BRRL 5FYLL 5DMGC 4TNVK 4KROB 3ZE1E 4YUEL 5GS2D 4IHOA 2YWYA 3NA4A 4GRWB 1VACB 3OZ9L 3KYKH 3WFHA 2V5TA 4WY7H 2O5ZH 5KG9B 4LLMB 3RVVD 1PBYA 4XPFL 3B5HA 3WFBH 4HKJA 2E7LC 4JREC 3PWNA 1MRFH 2AI0L 4FFZL 5B8CC 2NMSA 2YBRB 3MGTB 5EZOH 2AJVL 4H1LH 5C0CD 1INQB 1J1XL 3Q5YA 5DF0A 2DQEL 1URLA 1MELA 2YD3A 3L7FB 4NIKB 1E4XI 4MJ6B 1MJJB 3RQ3A 5CLTA 4WTXA 3DETD 1QLEL 3HI1A 5EIIB 5FGCE 1G7HB 4JFQA 4JDVB 3MLSH 3W39A 3C60A 4QYOB 4LCCC 4NQVA 3F7RA 3HAEB 4DGVL 4I9WD 2LU3A 3DJ9A 4GRWE 5TF0A 2IH3A 5HVFB 1ZGLB 2Y5EA 5C8JB 2IAMA 4KWUA 1KLUA 4XPBH 4G6AD 4I0CC 4OKVB 1MCCA 1MPAL 1NBZB 4BUHA 4HWBL 3VI3E 4U1KB 3WJLA 3BQUC 3TJHC 3LKNB 2FHCA 3IYLW 1NDMA 2VKWA 1W0VB 1KB5A 1FCCA 5FDYA 3LN9A 5CZVH 1KG0B 1W0YT 1BQSA 2XKUA 1QBMH 2RQ8A 4JFFD 1Q0YL 4OQTA 4OBRA 2D31A 1ZHLA 4Y5VB 4A6YB 3GB7A 1RZJH 2CLVA 5EU3A 1LO5A 4KKNA 1MJ8L 1QBAA 6CGTA 5GHWH 1SBBA 3T2QA 4RRPG 4W4OA 5IFAL 1S7TA 2LABA 2NTFA 3QUMH 1AC0A 4E41B 2G60L 5I16B 4LSRL 4OM0H 3GBLA 4BZ2H 2H6PA 4UTBH 4PB0H 2BOBA 1J7VR 1BD2B 1HSBA 3LQMA 4LIQH 3RWFA 4PFEA 5IVXB 4OQTH 3KPMB 1OAZL 3VXOA 4Z78A 1A6TA 1H0DB 3HC3H 2ZJSH 2VDQL 4I0PA 3O6KH 1WFOA 4ONGL 4TN9A 5D71H 4M7LL 5L2KE 2RBLA 5FO9A 4CDGC 5DA0B 1UKSA 1QA9B 1Q9KA 4GBXA 5L6YH 4O00A 5HYJE 1QRNA 1FGVL 3TZVB 1CGXA 4EOWH 3IVKB 3WFCH 3TBWB 4EI5A 5MERA 1CLYL 4PRPA 1BOYA 4Y1AB 3V0VB 4E41E 1SBSH 1ZTXL 4XXCC 3MLWL 4LBEA 1BM3L 1CZ8H 5E2UL 2Y25A 5IVXE 3GNML 1CFVH 4F15C 3RJDA 4L9DA 3K3QA 1QSEB 1G7IB 1ZT1A 4U3CA 3DUHA 4W70A 5EORH 3HG1B 1YZZA 2B4CH 3QH3A 1EO8H 4APQA 3HZMB 4Z76B 4XNZC 5KBNC 1QNZH 3PL6C 3IRZA 3A6OA 1ZGLP 4IRSA 4PGBB 5HYSG 5I1IL 1X4ZA 4O9HH 1D5ZA 2WWKO 2D03H 3MRNB 4ZNEE 1MCPL 4Y1AE 4LPCA 1OSPL 2LTQB 3QUKB 3EFFB 5H8DA 4RFEA 4U7KA 3QIWD 1XIWB 1FZJB 4EBQH 3IDMA 3S6CA 3TN0B 1I8KB 1V3JA 4I77L 4WI3A 4P23C 1QSEE 5CP3H 3GMMB 2P8LA 2YD9A 4XC1H 3GO1L 3HG1E 4MX7A 4ODVH 5E03A 2CUHA 3MRMB 4NHCL 1CL7I 1RZ7H 4M6ML 4PRIB 5GSRA 3PWPA 3OAYH 3RUGF 4DN3L 4NUGH 4OCXH 5C92A 3T65B 35C8H 5EIVA 3ERYA 1RJZA 1IQWH 1U3HA 4NKDA 5ELIA 5CJXC 4UDUB 1FP5A 4MD5B 1EH9A 1UKQA 1ACYH 3LQAH 2X70A 3BN9C 4JM4L 5I17A 3KPNA 4JHWH 1TJHH 5DVNA 4JFDB 3CDFA 4E0RB 2VR9A 1MLBB 4H5SB 4QGYA 3HE7C 3WE6B 1AD0B 5DJAA 2COQA 1FZMA 2X40A 1DQTA 1K8IB 1AD9B 4KJPC 4LFHD 1JUFB 4G59A 5I8OH 4XP4H 3OKLB 1YYLH 1Z9OA 4XX1E 4P4RB 3LS5L 2E27L 4LHUA 5D9SA 3X12A 2BVOA 1C5BH 2ADGA 2I07B 3DX9B 3PWVB 4HIXH 3WLBB 1U8HB 4HXAL 2EE3A 3TIEB 3WCYA 2VLRD 2CO6B 4JFDE 2HFGH 4Z7WF 1U8KA 4JB9H 1FJ1B 2YUWA 4M48L 3TT1H 2VR5A 4CJ1A 4MDJB 2C3WA 1PG7H 5AUMB 1A6UH 4M6NH 4PJBB 1S5IL 4PDCE 4YDIL 1CS6A 3MGOA 4K3EL 1V05A 2OQJB 3UYRL 4YEFA 5IT2L 2ZKHH 1S7QA 4HBQA 4V1DD 4YEEA 2HWZL 2VISB 4MLSA 2X4QB 1UVQA 3SGJC 2AK1H 4MXQC 4NRZB 4HKBA 3ILQC 4GAGH 5JOPE 1LK2B 3SKMA 4HJ0C 4F33A 2DD8H 4N8VG 1YEJL 3BP6B 3WIIH 1KC5L 1S5HA 4PGDA 3IKKA 3EJYC 3C87A 4RGOH 5ISZA 4NQCA 1VDGA 4X4ZA 1ZGLM 3GJFK 1IZKA 3FB6B 1XFPA 2Z31A 4U6XA 4D0DA 3BP5B 3INUH 3SE8H 3O6ML 1DFBH 5IVZB 5DJXB 4Q0XH 4HD9A 1UWGH 1HKFA 1EGJH 4PJBE 1BVZA 3FONA 2OR9H 2P49B 3BP4B 3IXAB 1YC8A 3C8HA 4CJ0A 1A4JB 4QRPA 3SE3C 5DQJA 5FEBA 1WISA 3H7BB 1TCMA 3CJJA 3V52H 2P1YA 1DVFD 2QHLA 3C6SB 2X9XA 3MOQA 3DUUB 5E00A 5ADOL 5C0FA 5KSBB 4Y5VC 1JTOA 5DK3A 1FIGH 1BZ7B 2APWA 3E6FA 1T04B 4MJIE 2HJFB 3TESA 1WWCA 1B4JH 5DUBA 3SN6N 5E24E 1RUAH 5D70L 2WAHA 4Z77A 4PG2A 1NCNA 1U95B 1A4KB 4CRPA 1GYAA 3L3KB 1K6QH 2FJHB 3B9KD 1QLFA 4FXKA 1NC2B 5DGRA 1CDGA 3PDOB 1K4DA 5HVWA 2ZUWA 5IM7A 1HHGB 3KYAA 5F3BB 3HRZA 4S11A 4JAMA 3E2HC 2NY0C 4JDZB 3F7YB 2XQYG 2OMNA 4P0DA 1YQVL 3GSUB 5KSBE 1S9XA 4ALAL 3CDYA 4Q9QH 4WW1B 4YZFE 4K3GA 5FYJL 3IFLH 3TT3L 1Q9LA 2B20A 3LV3A 5I76B 4KK6D 3GSWB 5IW6B 3DSFH 1HILA 3HE6B 4G7YH 1GGYA 1RK1B 4XVJL 1SJHA 5DD1L 5F21B 1QFOA 4PJHB 4WEMB 4PGCB 1LD9B 2GCYB 1OTTD 1I1CA 2ZCKH 4MSWB 1TETH 2YD5A 3MV7B 3C5SA 3G04A 2EIZB 3IU3A 1QTYT 5FF6B 2XNAA 32C2A 4HKXA 3UPRB 5CBAB 2X1XR 2P8PB 4UT6L 3D2UA 2R9HC 5DJZB 4LPXA 4C59B 2BVPA 5D72H 1N5AA 2WWMC 4M93C 4BELD 2JIXD 1AGFB 3KS0J 1JWMA 3ROLB 3S3JA 3UTOA 3SDXF 4YO0A 1WAAF 1Z3GH 1IEAB 3F7QA 4U7SA 4HJGB 5KVDL 3FT4B 4ZYKA 5GISH 4JN1L 3D0LA 5I8EB 2LTQC 2VAAB 3EYQC 4U2YA 1HK6A 4UDTB 3JUYA 3M17B 4OCNC 3IFNH 4NNYB 1G7LB 4MD0B 5AZ2L 5HBBA 5E56A 2QBWA 4E9LA 4JFED 4PJ8B 5K9QG 1FL3A 1ZSDB 1T5WB 1ZHKA 1DBJH 5T1LA 4N0CC 2C3HA 4QTIL 1V7MH 5BS0D 2QR0B 5D1ZA 3DI2B 3T4YA 4X6DF 3RUGA 3VGEA 3MJGX 2NPLX 2HT3D 2VDOL 4HEPG 3WO4C 4J7RA 1G7MB 1OTUD 2IPUK 3TO4D 5IHBA 1G84A 3ILPA 1I7RB 4KTEH 3TBYA 3T2NL 1NAMA 5TQ0H 1BFVH 2NZ9D 2R29L 4YHLH 3U1SL 3V6ZB 2HKHH 4JFXA 5BJTB 2FYYA 5HYFA 2YPVL 1MHHB 4NM8H 1CE1H 2C5DC 3VXQB 1FO0A 3MRJB 4M00A 4NQSB 2UWEF 4LRNH 3DX6A 4HS6A 5JOFB 3NIDE 1KCGC 2N7BA 4LSSL 4MCZB 3L3DA 3PP4L 2VXVL 4XMKH 2RHEA 1CXFA 4LGRB 2PW2A 4L29A 3SO3B 4HIJA 1AGEA 1P9MA 3IDGA 3QIBB 5LGKA 1D6VH 1QKZL 3SBWC 1KIQB 4OLUH 1L6XA 5HHMB 4Y8DC 4XPGL 3GI8H 1FO0H 1BJ1H 3D0VA 4JLRB 4O51B 2DKMA 1SMOA 4FQQB 2D4FA 4AEEA 5IVNA 3SPVB 4YHPA 4PJAB 1XCTA 3K80A 4MHHI 3MRQB 4Z95L 3FL7A 4Z7WA 4ODWB 4KKCC 1NCWL 2DQCL 1YYMH 1LE5B 1LEKB 2R0ZL 4IRJC 3UJJH 1F4XH 1MFEH 5AYUL 1XF5B 3VH8B 2B2XL 4V3DB 5T1DL 3F6LA 5T3XD 3FFCA 4HUWB 5F9OL 2ITCB 4OUOA 1DQQB 1MFAH 4OZIF 2MWCA 3DMMA 2Q86A 2EH8L 4LKCA 4LEXH 5ICYA 5C0EB 5KSAA 4JG0H 4PJFB 3WFDL 3KGRA 4DKEH 1D5MA 1P7QD 5CWSA 5JW5A 4WU7A 2W9DH 1KTLB 3LD8B 5DQDL 2Z4QA 3AREA 4PJAE 4Y16A 5ENWB 4ELKA 3QXWA 1QRND 1IGFL 5F9JA 5SWZB 3RZCD 3P11H 3DVIA 2V7HA 3U9UA 2FGZA 1NLBH 5C08D 2DM4A 1HZHH 2YMXH 4PRPD 1GGTA 1CWVA 2IAND 5FXCH 3VD7A 3HZKB 4QHLA 5DJCA 3NCMA 4M4RA 5ITFA 3QDMA 3MLZH 5C09A 1WEJL 3QPQC 4PJFE 3IFOB 3STLA 4PRAA 2DQGL 4OLVL 3RGVB 3OHXA 1X5YA 3QDGB 3I9GH 2IADB 5DDHA 5IB5A 5MEOA 3QHZL 1W72A 5ACZB 4XXDB 4WFFE 4MXVE 2YS4A 4J8RB 4UT9L 4U6YA 1CIDA 2GTZB 1YDPB 3MROB 5F7UA 4NSKB 5SWZE 2FGWH 4KH2A 4YQXH 2HRLA 2DI7A 1NJ9A 2F5BL 4NUJA 2BFVH 2EYRB 4LLUA 1T1YA 4XCEB 4V3EB 4G3YH 5C0BB 5E99L 5FYKL 3BHBB 3WDIA 4HUUA 2A74A 2AK4D 2M8XA 3MLVH 3MBXH 5BW7A 5GGTL 4YH6A 1I1YA 3JTSA 1P7KA 4HGWB 3L1OH 2XWJB 1JHKL 3KDMB 1KCLA 4AMKH 4YDJA 4J12A 5B3JE 3ZYJA 3HCVB 4BFBD 3PWPD 3D3VB 3SKUD 1P84J 2W9EL 3H3PL 3OKKB 3EYOB 4ZFOL 1KBGH 4JZNA 2HKFH 1ZKAA 4KMLB 1HHIB 3SJVA 3HE6C 3I3EA 4PJ5B 1X5XA 1JF1B 3E6HB 3T0AA 1M05A 5E8PA 3VFVB 1UCTA 1B0GA 5C0BE 1HYSD 1R3LA 2ZCHH 1LO2H 4RMSA 4OZGF 4DAGL 2NY5L 4H8WL 3K2MC 5IKCA 4IJ3C 4RAVB 3MLPA 3R0MA 1UJ3B 1N5YH 2NY3D 2ZPKH 1V3KA 1TZHA 3I84A 5FGBA 5GRWA 3O3BA 3VXRD 3D3VE 2RJMA 3UTTA 3QEHB 4IRZL 2CKNA 1YEIH 3ZT6A 1V3LA 4MDIA 1WK0A 5C71A 4XBEH 3B2VH 3HLAA 3FQRA 5EOQH 2ID5A 2ED8A 4WNQA 3CAFA 2UYLB 1CG9B 4PJ5E 4HLZG 4YHYB 4FQHA 2IMMA 5F89A 3MRKA 2ICES 3D9AH 4FP8H 4XZUA 3MYJB 5IJVA 2LU7A 3SDAC 4HULB 4XTRD 1TJIH 3MXVL 2GJ6B 2Z8WC 1TTUA 1CXLA 1X7QA 2FIKB 4NN5C 1J8KA 4CNIA 2WV3A 3FQUB 4N5EA 3C9NB 1A5FL 4UBDD 3TVMD 4GMTL 5DD5L 4Y88A 1HIMH 5DURD 5D4QA 1R3IL 5AG8A 4X6DA 1S7RB 4F7CB 1T21B 4O2CA 5M95B 1U92B 5HHOD 4XCFH 3GSNL 3TPUA 1KJ2L 3CZFA 1NGPL 4L4TD 3EYSH 5E6IA 4AEIH 3NCFB 3QUYB 4RSVA 3RWJB 4X7FC 3SCMA 4AQ1B 5ITBH 4PJEF 2PYFA 5HHQB 4XPTH 2R0KL 5IVOA 1I3GH 4YPGB 4J3VA 4PB9L 4MMZC 2ZG1A 1RVFH 1ZLSH 1BX2B 5F1KC 2J3SA 4NQCD 4WWKD 4KK9C 3VDBA 4NWUL 1S9WB 1YJDL 3VCLB 3T1FB 3MOBL 4AEHH 2QQKH 2MQ3A 3BD4A 1XF2A 3BZEB 3OXSA 4D0CB 4ZPTB 3SO3C 1T20B 5CIPA 3V6FB 5HGAB 3S35H 3BX7C 1KFAL 4LKXA 3S96B 3MRLB 4HPYH 2N7AA 1DQLH 3VFGH 3O2WL 3G5VA 1UM6L 5EUOF 3VXMD 4X99A 4OUUB 4NOFA 2VLJD 1PSKL 3ZHKA 3GKWH 4XCYA 1RURL 5FCUH 3VFPB 2BRRH 5FYLH 3PHQA 5BXFB 2AV1A 4OLYL 1T2XA 3EW3B 3IJHA 3ALPA 3QISA 2K7PA 5DFTA 5BV7B 1YQ2A 4KDWA 5A40E 1JYNA 2J5LB 5C2BH 3EHBD 2GJZB 3OZ9H 1OGTA 5FIEA 4F2MB 4OZHB 3B8YA 5DRNB 4R4BB 4OGZA 1FFNA 3FO2A 4XPFH 1S9YB 4XNUL 5IG7A 4OZIA 1YA5A 4BH8B 2AI0H 4L9LB 4OFKA 3V5DA 4AM0A 2AJVH 3OGCA 1KPUA 3TWCH 1J1XH 1RUQL 1D9KA 4XHQA 1KPRA 3LD8C 1OCWL 1G7QA 3V6OA 1OF2A 1QLEH 4WTWA 1WZMA 2MJWA 1F2QA 1T22A 1CDHA 4P9HC 4DVBA 3AXLB 4ZAKA 3CNKA 4DGVH 1S7VB 5FA3B 2VZ1A 2V5SA 1UEMA 3S5LA 3RWCA 3UZVB 1X5GA 4ZUWA 4ZDHA 3EO9L 4NP4L 4OZHE 1WV7T 4L4VE 4QRRB 2PYEE 3AAZA 1EAPA 2NW3B 1ZLWH 3WD5L 4OCMC 4LSPL 4G9FB 2F74A 2JB6B 3Q3GB 3RGVC 3D2UD 1QEWB 3LH2L 1CD1B 4X7TB 4QHNA 25C8L 2X4UB 1TNNA 4ZTOL 2CLZA 3ARUA 2J8OA 1JK8A 1ZT7B 3BEVA 1S9VA 4H25A 2NY6B 3UMTA 4RWYL 1R5VB 1YN7B 5EU7E 2YOCA 1Q0YH 5KZCD 1JPST 1FZKB 3HMWL 3KLSA 1MJ8H 3BD3A 4ODBD 5DTFA 5KSUB 4Q9BA 5IFAH 1RJYB 4M8QB 2YPKA 2EDHA 1KIRA 1Y18B 5D7LB 4G9FE 2VXUL 3B4NA 2IG2L 1FNSL 4NRYA 3RHWK 2R15A 4KJWD 1PYWB 5IEHA 4KK8C 1OAZH 5IEKA 1DANT 2VDQH 3MYZA 3PV6A 4ONGH 5GGRA 3VFUA 5D7JB 3C09B 3ZLQC 5IROC 3LN5A 4JY4B 2ZUQC 3V8OA 3CC5B 4X6CE 1XZ0B 1A2YB 1FGVH 4OZGA 1X44A 3RWDA 4JGMA 3UROR 1SYVA 1AQDA 1CLYH 1KN2L 3CSGA 4MAUL 3VFRA 4NNXA 1ZTXH 4K8RC 1UWEL 1UJ3C 3MLWH 1EUUA 4M5ZH 1BM3H 3OPZL 1WT5A 2BC4B 1P4IL 5E2UH 1MJ7L 3GNMH 4HH8A 4J4PC 2J6EA 1AFVL 3O8XC 2PXYB 1X5FA 2X4NB 2XRAL 2C7UB 4HIEA 2XN9D 3V7AG 1WBXB 1MCWM 4NKMB 4OGAD 3K2UL 1KYOK 3SDCC 4KKAD 4PJDB 1OGAE 2R1WB 3CFIC 1GAFL 3LKSB 4YHYC 5IMLB 3NA9L 3RTQB 5I1IH 5MEPB 4F7PB 5I8CA 3ARDD 3VXSB 2E7LA 1MCPH 2J6EH 2EDBA 1OSPH 4LU5L 3HNVL 3C8KA 4FRWA 3VD9A 3GBNL 1E4WL 1VFBB 5B8CA 4ZUTA 1MCSA 2CPCA 4HHAB 3FN3A 2JB5H 5FM4A 3OKYA 2YRZA 2ZWLT 1N26A 4EEEA 5A3IC 4QWWC 3QUZA 5IF0B 3GO1H 5LBSL 3UTZB 5T5NF 1BP3B 1A6WL 5KSAD 4NHCH 3A67H 2CIIA 4LCCA 4M6MH 3IDJA 1NFDB 1T7YA 3QUYC 4DN3H 4PJDE 3GEWB 3LRSA 4R4NC 4N1HB 5FV1L 1I1RA 1C5CL 2UZYB 2ZOLB 3ZDXE 1HCVA 4HFWA 1J0IA 4G8GB 3QG6A 4R97B 4JM4H 4JKWA 3BW9B 3QXVA 4O2EB 1CLZH 4CVXA 1GGUA 4PTUA 4Q9CA 3O4LD 4BZ1H 3BQUA 3TJHA 4X7CC 3VXPB 3DXAE 5C09D 3HPJA 4MQTB 3OAYK 1SJXA 3SGDH 5KS9E 1BFOB 3ZKXB 3I85A 4LGSB 5ILTH 3MNVB 1NFDE 4H26A 5HYEA 2OJZL 4ZNCD 2XKSA 3MREB 3OB0H 3MV11 5ID0B 3AS1A 5EUOA 4Y19D 3LS5H 2E27H 4HV8B 4WDIA 3O41A 12E8L 5D7KD 1EZVX 5KOMC 3RVWD 2DM7A 4HXAH 3GMRB 4G8GE 5C9JA 3KPOA 5BV7C 4EQ2A 1NUDA 3KNBA 1TQBB 2AAVA 4GW5A 4YXKH 4U1GB 3EDJA 4M48H 2FR4A 5JR1L 3LKOA 3MGAA 4HWZA 4B5EA 1KTDA 5CGYD 1ITCA 1S5IH 4UIMB 4L9LC 1CYGA 1ZWIA 4YDIH 1DBAL 2LV4A 4K3EH 2XACC 1CXEA 4DTGL 2GIYA 5JUEH 3BVNA 5IT2H 3TCLA 3T4AB 1EHLL 5I73B 1WIPA 5F3HA 2NY2B 1ADQA 2ZG3A 5FM8A 4N1EA 5HTSA 2ICEA 1RZKC 2ITDB 5DK0A 5C0DA 2BSRB 4HCRA 3ETBF 2HVKA 5E1AB 1YEJH 1CD9B 5IFJA 4BFIB 1KC5H 3OJ2C 5EU7C 5C0AB 2X4RB 3SJVD 1I9RL 5IB1A 1OL0A 4KI5D 1AKJA 1XH3A 4P59L 4UZGA 2XOTA 3BDXA 3D48R 4G6KL 4X6FA 4MQXC 3KVQA 3O6MH 2ATPB 4WFGD 4X8JA 4YDLB 4FFVD 4I4WB 1F4WL 4QHMA 1YEHL 3IAQA 5J57B 3PL6A 4Y4KA 1VEOA 1J8HA 5DD0L 2G9HB 4P2QA 5FECA 1HNGA 5FHAL 5A16A 1A6VH 4F9LC 3SE9H 3UTTD 5CBEB 1MHEA 4ONFH 3UJIL 2NY6C 2VQ1A 1OAYL 4X4XB 1FPTH 4L3AA 5C0AE 3F7PC 1RFDL 2ZSVA 4PJGA 3F7VB 5HPMB 3DROB 5E4EB 2GEEA 5K9KA 1WIUA 1N0LA 4P23A 1I3UA 3GMOB 3DTXA 4PUBL 1A14L 3GRWA 5HHPA 4JFHE 5D70H 3ZE0E 3RPIA 1RK0B 5JO5B 2SEBB 2ZUXA 5IESL 2A73A 4FS0A 1J11A 2XXMB 3GMLA 4PJ7B 4F37F 4R7NA 5CJXA 4UQ3A 1U2HA 3MV9D 4I3GA 3C09C 5C0CE 3REVB 1ZLVH 2MNUA 3ZKNC 4ZOBA 1JMZA 5D6CB 1IM9D 2BNQD 5J6HA 1EMTL 1YQVH 5FB8B 2VABB 4ALAH 2FO4A 4GH7B 1EDQA 1QSFD 1DN0B 4AYFA 4IMLA 3TT3H 1SQ2N 4N0RA 4G80B 3BIKA 3FT2A 3UTSD 4XVJH 2YKLL 2WLYA 2FHBA 5DD1H 5IBLD 3EDKA 3PHOA 4LOUC 4I9WE 1IL1A 3FB8B 3BYYA 2FWOB 1A02N 5FYLD 2HTLC 3NCEB 4N8CH 5FKPB 2D0GA 4YK4B 4I2XB 5I1DA 1N0XL 3JV5A 4FZ8L 4G43B 1MCQA 2WIIA 4AIXA 4KAQL 2V2TA 1BVLB 1Z2KA 3ESVF 5FKAA 3RTQC 5JZ7C 2CKBB 1NGXA 1BBDH 1BLNB 2D7TL 3CMOL 1NAKL 5KVDH 4LLMA 2FCBA 4JFFE 3PDDA 4R4FH 5DVMA 2CDEB 4WO4C 5CZXC 3A0OA 4X6BA 2EDLA 2YBRA 1YN6A 3L7FA 1QD0A 3JWDC 3SGJA 4M6AA 1UCBL 3U4BH 4MJ6A 1MJJA 4I2XE 4MXQA 3O11B 3IKCB 4QTIH 1ZS8B 5ADPL 5EIIA 1G7HA 43CAB 3CCHB 3EDFA 4AQOA 4QYOA 5JPNB 5E2JA 4AK1A 2VDOH 5B4MD 2RB8A 3NBNA 4XMPH 3T2NH 2A6JA 2ZSWB 1ZGLA 1OSZA 4HWNA 4KDTC 2XG5A 1EZVY 2X1PA 3LKPB 3VFOB 2R29H 3L5IA 3U1SH 1WSST 3BYTA 4R97C 3IGAB 1BQHB 3IETB 1UC6A 2YPVH 4OKVA 1NBZA 3QJFA 3CFCL 3CX5K 2X4SB 5H94B 3MMEB 2QQLH 3GSXB 3SE3A 4X5WA 2VH5L 2D2OA 1ZHBA 3B2UC 5E9DD 3PP4H 1PKQB 1E6JL 2VXVH 2FJGB 4K9EL 3ZKXC 1F42A 5L2KA 3QIWB 3DBXA 4LCIL 2WWKT 1DUYB 4WHYG 4M03A 3RWIB 2O61B 5DJ6A 4WI5A 4NO5B 4Y5VA 1NLDL 4NBXB 1OTSD 1U8NA 2NR6C 2ED7A 4YZFF 5HYJA 4ZO7A 5GS1B 4NQTA 1TVHA 4G5ZL 4XPGH 2R56L 4JO2L 2XKNB 5J1TC 1C16A 4UUJB 4E41A 3F5WA 1DUZB 3OXRB 4MQ7A 1FN4A 2H2SD 3C6LD 4PRBA 5I16A 1L4IA 1RZ8A 3NGBB 3VDAA 4Z95H 4B53A 1TQBC 1L7TL 2XFXB 1NCWH 1BZQK 1IBGL 1ZA6A 4FMKA 4TRPL 5IVXA 4U1GC 1YEGL 4JCMA 3KPMA 4JPWL 2R0ZH 3BP7B 3I6GA 4NQDD 2CK2A 2B2XH 4L3EB 4EUPB 4QRUB 5IGXL 3ULUL 1KCUL 5F9OH 3E2HA 4RZCB 5EO1A 1JTPA 1GC1L 1ZE3C 2GAZB 2Q6WB 1KULA 1QA9A 3KLHD 2VE6B 1D5XA 3WFDH 4NFCA 1VESA 2EDEA 3IVKA 5AG9A 2NXZB 3TBWA 3DPBA 4ZNEA 3VXUD 5DLMH 2UVFA 5DQDH 1G7JA 2H1PL 1A9EA 3O3EB 5CCKL 1CGTA 1ULVA 1LK3L 3S5LG 4HX1B 3EGSB 1NSNL 4J3XA 2DLGA 2VLRB 4MHHG 3P77B 3HG1A 4JVWA 5I1JL 1EJ6A 4YFLI 4MLIA 1GSMA 5EBWB 2PETA 3HZMA 4Z76A 4X98B 4PJIF 1HNFA 4J23A 3FN9A 2W60B 2WZPD 1WEJH 2HVJB 4BSVA 1A6ZB 4QY8A 4RQQA 3RVVC 5DEGA 1NEZA 5TH2A 2DQGH 1CDBA 1CD8A 1VGKA 2P48B 5F97E 2R8SH 3P73B 3EOAB 4RGND 3QHZH 4V1DB 4UT9H 3EFFA 5DHYA 2VQTA 3P4LA 4TVPE 3SHSA 1IEBB 4XMLH 1X4YA 3IAGC 3DETC 3ZDYE 4JFOA 4XT1C 1QOKA 3OV6A 4QRQA 4ODSL 2F5BH 5HHVL 3M8OL 3P4NB 4N0CA 2VLRE 3KS0H 4RMWA 1JGVL 3HI6L 3QG7L 3MRMA 4OF7A 4FQXD 3AGVA 5I66B 1HH9A 3CGTA 4M7LT 4RGMB 4JANA 1AHWC 4OKDA 1DBKL 1F11B 1T0NB 4OD2A 2APXA 2GQHA 3T65A 1PG7W 3L5WB 3QUZD 2KPNA 1LEGA 5EU4A 1RMFH 1JHKH 4G6AC 4YFLF 1OM3H 4MD5A 2YD1A 4V1DE 1ZLUH 5FV2A 2BNRB 2W9EH 3H3PH 4FFEX 3U82B 3PGCB 3X17A 2YPLD 5DD6A 3NCCB 4XCCL 3S37X 2VDKL 1DDHB 4K55A 1MLBA 4H5SA 3U7WL 3O4OB 1AD0A 1DVFB 1TZGL 3DV6B 4MXWL 1ETZB 1K8IA 1VERA 1Q9OB 4WHCA 2NY5H 4ZO6A 1L0YA 3S4SA 3VRLE 4H8WH 5J13B 3OKLA 4Y4HB 4NZDA 2C3GA 1KIPA 3SBWA 3IRPX 1EXUB 3VD3A 4P4RA 3MLXH 1XF3B 2Y23A 5MI0B 3RPKA 2I07A 4LQFL 3PWVA 2G5BB 5B22A 1U8HA 5EC2A 3TIEA 2DQFB 4YNYB 4KZEL 3B9KB 1TFHA 1R3JB 1G1YA 2PCPA 3P9MB 4FFWD 1ZMYA 5I1EL 1QG3A 4OI9A 1FJ1A 3RA7H 2Z92A 4HAFA 4IRJA 2DJ4A 1IM3B 3V6BR 4LNRA 4D9LL 1T2QL 1KTRL 2ZNWA 3NH7L 4HMEA 4AH2B 1IKNC 4ZO8A 5I8KL 4ORGA 2QSCL 2GSIA 3OR6A 3WDJA 3IDUA 2V2WB 3MXVH 4PGEB 2VISA 1HHKA 1T6WA 5C07D 3RIFF 1U3YA 4NRZA 3I75B 1A5FH 4GMTH 5DD5H 3DV4A 3CH1A 3GSRA 3D69B 5C0RL 4CL7A 1R3IH 2EYSA 5AZEL 4MXVF 2OZ4A 3QYCA 1KJ2H 3LS4L 5TF1L 3FB6A 2R0KH 1NGQL 2NQCA 4MJIA 1NC4D 4PB9H 4MA3A 1Q38A 5KN5B 3AS0A 3GUTA 3IT8D 4NWUH 1JGLL 1YJDH 2D7NA 1QP1A 2HTKD 3G6JE 3MOBH 3QXAB 3EOYG 3DIFB 5K93A 4R2GD 3QIWC 5B3JF 4Y4KD 1J8HD 5JW3L 3GMQB 4JFEB 1KFAH 4X83A 3UTQA 5KSBA 4HKJB 3EO1B 3PWNB 5GS1C 4OCRH 5CUSL 2FD6H 5DHVA 5F6IB 3O2WH 5BS0B 3RVXD 1UM6H 3RNQB 1T04A 3VFSA 2AXFA 2HJFA 2QQQA 4M5YL 5HI4D 3OKDB 4UIKL 3NMEA 2P4AB 1RURH 3QUXD 3NGBC 4YHNA 1G9NL 4OLYH 5GZND 5FO8B 4PG9B 1CDYA 3HI1B 1G6RA 4IS6A 2E8YA 1U95A 4JFQB 2JJVA 3UDWC 3W39B 2FJHA 2EH7L 3C60B 4NKIL 2X10A 4NQVB 3MJ8A 5F7EL 1JRHI 5LQBL 3IXTA 3S7GA 2X42A 1HHGA 1K2DB 5DHVH 1HEZA 2X89A 2IH3B 3NZHL 4MJ4A 3D39D 4JFEE 4JQVC 4XNUH 2YUXA 4YIQA 3F7YA 4KV5F 3LKQA 3D87B 3VFTB 2BHZA 3N9GL 2BY0A 1KLUB 1RAMA 3IDIA 1NDGA 5BS0E 1RUQH 4HFUH 3TH4T 1KTKE 2UY6A 3OJVC 3TO2A 2GCYA 4GAJH 5IB2A 2FECL 1NDMB 1UGNA 5F9AC 2BDNL 1KB5B 1FORL 1MREH 4NRXA 5FF6A 4A6YL 5H2BA 4ZS7H 2P8PA 3EO9H 2D4DA 3NTCL 2D31B 4NP4H 2XZQL 3GB7B 1LO5B 4PJIA 5BRZD 4Y4FC 2VXSH 3WD5H 1G6VK 1AGFA 1B90A 5K33A 5GXBB 3ROLA 2NTFB 5LXGL 3ARQA 1IEAA 2NXYD 3LH2H 1HSBB 25C8H 3LVEA 5DMJB 3RWFB 3RI5K 2VAAA 4X7DC 3WL9A 1H3PH 4ZTOH 3R4DA 2B1HL 5JIIA 4EKXA 1G7LA 4MD0A 3SDAA 1A6TB 4Z78B 4RWYH 1JI2A 1I1AA 5JMRA 4M7JL 1U36A 3Q6FA 2I60L 4JY5L 4LIQE 1T5WA 1PZ5B 5FO9B 4ZOEA 3TA3A 2VJXA 4GBXB 5TDNA 3FFDA 1QRNB 1MLCA 2VWEE 1A6AB 3RZCB 4RGMC 4U2ZA 4EI5B 3CSPA 5C08B 4PRPB 2VXUH 1FNSH 2DKUA 3JUZA 5T3XE 4HJ0D 2FSEB 1OVZA 3O2VL 4WI2A 5EC1A 4ZTPL 5DEZA 3MUGB 4ELME 3V9FA 4PYGA 1ZT1B 1N59A 3MRJA 1K9TA 1AI1L 3ZDZE 1QQDB 3O4OC 1DVFC 4UV4H 4WFHD 1SEQL 1IGYA 4MCZA 3IJYA 4IRSB 3MR9A 1NFIA 4WW2B 3GSVA 3VJ6A 1KN2H 1R5IB 2FATL 2WNGA 1G0YR 3KYOA 4MAUH 1D5ZB 4WIQA 4XB8A 5J13C 1NFKA 3OQ3B 1UWEH 5C08E 4QHUB 1KIQA 3VGHA 2IANE 1T80A 3OPZH 5MI0C 1P4IH 1A21A 1BWWA 4JLRA 1AFVH 4O51A 3RDTA 3IDMB 2YRLA 2I26N 2XRAH 2W07A 3B9KC 4LGPB 4PJAA 3I3DA 4HWEL 3MRQA 3WS6C 2P8LB 3K2UH 4YFEA 3FO9A 4ODWA 4MX7B 1GAFH 5DEFB 5GSRB 3NA9H 4HXBL 3PWPB 2E6PA 4KVCL 3UYOD 3VH8A 2GSGB 2BNUA 3V8CA 1A1NA 4HUWA 3JWOL 3BFOA 1F58L 4LCWD 1U3HB 4NKDB 1DQQA 4KUZL 4LU5H 1M4KA 3FB7B 3HNVH 4KK6C 5HHNA 3GBNH 1FAKT 5FA4A 2PTTB 4PJFA 2AEIT 4LMQE 5AYQA 3C5JB 1AR1D 3MBED 3KPNB 3UEZA 4BQ9A 1OTTC 5I74B 2LAGB 4H0IA 2AK4E 4LPTA 4XBGB 1H3WM 2HLFD 5EFIB 4I8DA 4JRYD 1CXIA 3HAEG 5DJAB 1I1FA 1FZMB 4NCC1 5SWZA 2IH1A 2NY3B 5BO1L 1U6AL 5F8RC 4K7PX 3HB3D 5DHXB 3CDCA 3VXRB 1CIUA 1AC6A 4HJJH 5CHNA 1C5CH 2XQYK 1MWAA 1FRGL 1BGXL 2DLFL 4LHUB 1GGBL 3X12B 2ADGB 1F3RB 1NPUA 4P9HH 3IFOA 3RGVA 4XVTH 5TFSL 5J8OA 2E9JA 1OARL 5ACZA 1U8KB 3HNTL 3T0XA 5JMOC 4HT1H 1EFXA 2GTZA 5TGBB 2J8HA 2VSDA 2OJZH 2XZAL 3BIBX 4NJAH 4NSKA 4X7EC 5FUCE 2WQRA 5IQ7L 2ORBH 5FYKD 1W2KT 1CTNA 4F57H 2R2HA 3LDBC 3MGOB 3VXRE 4X6CF 5DURB 2E9WA 4GUPA 1S7QB 1OW0C 1HN1A 1DLFL 2HT3C 5HHOB 1OTUC 1UVQB 12E8H 2R39A 3TO4C 3ULUF 1F5WA 4L4TB 4WI6A 3BHBA 4HKBB 4LPUA 3SKMB 1EBAA 1NGYA 4XWGL 2NZ9C 2X7LB 2IBZX 1S5HB 5DMIL 2BMKA 2XWJA 4NQCB 4WWKB 1IAIL 3HCVA 4X9GA 4CBPA 2F15A 4MZ2A 5JR1H 1F4HA 4GW4B 2ZUSA 3D3VA 4FMFA 3NIFE 4U6XB 1IZJA 2AP2A 2DYPA 4D0DB 3OKKA 4UOW1 3EYOA 2MFNA 1DBAH 5IROA 4DTGH 1YUHA 1A7OL 4FABH 3ZE2F 3PHSA 3HTLX 1EHLH 3FRPA 3X13B 1HHIA 3FONB 3G5XA 5EU5A 1JF1A 2MKWA 1MHCB 3IJSA 3V79C 4HKZB 5HHOE 4HC1L 1FGNL 3GFUA 3GSOA 4PS4L 4L4TE 5DQJB 3FTGB 1GCFA 4MJ5A 3GMPB 1U8JA 2Q8AL 4OFYD 1UJ3A 3MODH 1PFCA 4Z0BL 4PY8I 1I9RH 3ZTJH 5CEZL 3OWEA 1NCCL 4NQCE 5E00B 5C0FB 4P59H 4NQEA 1VEMA 4G6KH 3WNLA 3O8XA 3BXNA 2VWEC 3NPSB 4L8DA 2P43B 3E6FB 4LASL 3W2DH 2H26B 5DD0H 3SDCA 5DUBB 5FCSH 2F54D 2HYMA 4IIQC 4GRMA 2PO6D 5JOPD 2JCCE 1CG9A 1NEZG 3P30L 4K8RH 4Q7DA 1LQSR 3EYVA 4Z77B 4U1LA 4HS8L 1SEBA 1C5DA 1YNKL 3TC9A 5IJKC 5DS8B 1QLFB 4FXKB 3ZDXF 3AY4C 3UJIH 1OAYH 5D5MF 5IM7B 3HRZB 3VXME 1RFDH 5SWSA 2VLJE 4WTZA 5HVGB 3FQUA 3VG9B 3QXTA 1S9XB 3BGAA 5IK3A 2NY4D 4ZFFA 4QKXB 4GKNB 4D9RD 5IIEB 3RZCC 4F7CA 3LV3B 2B4CC 4PUBH 1GOGA 5KS9F 1SJHB 1Z0NA 2BVYA 3QUYA 4XX1G 2B7DT 4KUCF 4TTGA 4EZMA 3V4PL 3IU3B 5GQBA 2ENSA 4RDQF 1ORSB 32C2B 4HKXB 2DI8A 4B7LA 3D2UB 5ECJE 3AC0A 1EMTH 3T1FA 4DUWA 3TBTA 4Y8AA 3BZEA 1GGCL 5CINH 4ZPTA 4D0CA 4WW2C 1JWMB 3T77B 1T20A 2YKLH 4NJ9L 4JPIA 3ULVL 5KW9L 4YO0B 1A8JH 1PKOA 5KZCB 3QZWA 3S4SG 3EDDA 4QOKD 1L8JA 5AWNL 3AS3A 4ZYKB 4PP8C 1GZQB 3B9DA 4X7SL 5I1CL 1G9MC 3SKJH 1FNEA 3QDJD 3HC0A 4OUUA 4M62L 4GQ9H 3U6RB 1N0XH 2P44B 4FZ8H 1PLGL 1FL3B 3CLEH 4JKMA 3VFPA 3LQAC 1FZOA 5IMMB 5BXFA 1RZFL 5IBUG 4KAQH 3RZWA 4NNPL 4K7PY 1JP5A 1MFDL 5J11B 3RUGB 4CN6A 3LB6D 3CMOH 5GGSY 4L4VA 1NAKH 5DRNA 2PYEA 4R4BA 3ILPB 1Z5LA 1S9YA 3TBYB 4NKQB 4Z9KB 1NAMB 3I6LD 3EYUH 4Y0GA 2VC2L 3ALWA 4L9LA 3PWUB 3P9WB 5F72S 1HYSC 2FYYB 1NCTA 4RFNB 5I74C 4RMVA 1UCBH 1KCRL 1EVTC 2X89D 2W0FA 1FO0B 1HDMA 5GJTL 3AB0B 4JPKL 5ADPH 3BI9X 3DX6B 4HS6B 2Q20A 1KENL 2X41A 5FUOL 3L3DB 1EBPA 4JZOB 5FUCC 2NY3C 2I27N 5GPRA 2VXTH 4L29B 5FA3A 5T1KD 4ZMAT 4ZFZB 3QT2A 4HIJB 3IDGB 4XAKD 3PWJA 4MA7L 2L7UA 2CUMA 2XN9B 4NT6A 1SVZA 5CKAA 1OY3B 2X4OA 3BD5A 3BPLC 3D0VB 3FQWB 3LPWA 1YPZF 3BUYB 2IBZY 4QHKI 1JPGB 4WUKH 4YBLB 4EJ1C 1JWSA 3CFCH 1I3RB 2Y4SA 3Q3GA 3VU2A 1DQDL 4YHPB 4S1DD 4OLXL 1QEWA 2EDRA 4CDHA 4Z7WB 5H37G 1ZVHA 2VH5H 4XTRC 3EJZD 1E0OB 1E6JH 2VL5A 4POYA 2H3NA 4K9EH 4OT1H 1KCVL 1R5VA 4AL8L 1YN7A 4LCIH 1MI5D 4UBDC 3TVMC 3O2DA 4EVNA 4H88L 4YHOL 1FZKA 4KMTL 1NLDH 2NY1B 4X6CA 1UQSB 3EIFA 2XN9E 1VFAA 4G5ZH 4LKCB 2R56H 4JO2H 3ROOA 5ICYB 4OF5A 5KSAB 3MNZB 1K4CA 5D2LF 3SDAD 1D5MB 1RJYA 1I1AD 5CWSB 4ODTL 5JW5B 4WU7B 1Y18A 5DC9B 1GZPA 4PP2B 4URTB 3GM0A 4FQCL 2Z4QB 3MRGA 3AREB 4PYHA 3TA3D 1L7TH 3WFZA 2ESVD 1IBGH 4WWKC 1CGWA 4ELKB 1YEGH 4JPWH 3O2DH 4Z7WE 4NGHL 4JHAL 4V2CB 5EH1A 4QT5A 3CFDA 3STBA 2GUOA 2XTJD 2V7HB 5IGXH 3ULUH 1KCUH 1MNUL 1P5UA 3CVHL 1GC1H 1FFOA 1EJOL 2PF6A 4QHLB 4P99A 1OGAA 3DECA 1RUKL 3QDMB 5C0NC 5C09B 1KPVA 4WEBH 3G6DL 1QPXA 4KU1A 3STLB 1MF2L 4PRAB 3OHXB 2Z93A 1FC2D 2HN7B 5DDHB 1PY9A 2DQDH 3TYFB 2A6DA 2H1PH 4R3SB 4L3CB 4Y19B 5CCKH 1AO7D 3MNWA 1LK3H 4U6YB 3WO3B 3PNWB 1NSNH 1Z9SA 2C7UA 3NPSC 3TV3L 3TFKD 4GG6F 1YMHA 3EHBC 4LLUB 5ACLA 1T1YB 3O4LE 1KSRA 1AXSA 5ALBL 4PJDA 1LWRA 1S8DB 3DNKA 2R1WA 3LKSA 5C09E 3RTQA 4OZFA 3RDTD 3BWAB 2A74B 3JTSB 1P7KB 2YEZB 4FFYL 1JPFB 4XPAH 1DJSA 4WO4A 5LCVL 1MRCL 2VYRE 4Y19E 1VGEL 4L8CA 3VG9C 4C56D 4PJ9A 2M26A 1FFQA 5D7KE 1UB6A 2WSKA 3DXAA 5IF0A 4OZFH 3LEXB 4DGYH 3SJVB 3QG7H 5KS9A 5L8LB 1K8DB 4M4PA 1M05B 3VMPA 2R69L 1B0GB 1R3LB 3RNKA 4ERSH 3E8UL 3NN8A 1DBKH 3SGEI 2IBGA 1RSFA 5IKCB 3CZJA 5KAQF 2HLAA 2ZOLA 3GJFA 3BZFA 5F9DC 3JWDH 4KK5D 5DMKA 4LPVA 4G8GA 1B0RA 1TZHB 3BO8B 2E6JA 2B0SH 3CX5J 3MJ6A 3UTTB 2NYYD 4XCCH 2VDKH 2EEAA 3VXPA 4DZ8A 1N3NA 3HLAB 1TZGH 4MXWH 3FQRB 3IAPA 4G8IA 3SJVE 1BFOA 3WKNA 3DI3B 1FYTD 2EDXA 3MNVA 5F89B 4YHML 4KHXL 4KI5E 3MRKB 3MREA 3N1FC 4XZUB 1A7BA 5IJVB 4KZDH 4WFGE 2LVCA 1DSFL 3BEWA 3OBAA 3DX8A 4HV8A 3W0WD 1NMCB 1T1XA 3DO3A 3MJ9L 1X7QB 1C08B 4CNIB 1MHPL 3GMRA 5BZWB 3U9PL 3I2CL 4KZEH 4KJWC 3P0VL 3QDHA 3O3UN 3UTTE 1AGCA 4X6DB 3I02A 1UKTA 1VEPA 3MV9B 3SDXE 3VH8G 1WAAE 4PBVC 4OGXL 4UT7L 3SCMB 4D9LH 4JO1L 1T2QH 2BNQB 5TE7L 4OD3H 5DRXA 3NH7H 1SJVA 5I8KH 4UIMA 1QSFB 2QSCH 1BJ8A 3B6SA 1BBJA 4KK8D 4FA8A 1RUML 2PR4L 1JJUA 4J6RL 2UWEB 3WMSA 2IPTL 3RX7A 1UYWL 2DLIA 5E1AA 2WBKA 1XF2B 4DKFL 5C0RH 2Y07H 3OXSB 5AZEH 4H20L 5C0AA 2X4RA 1MCNA 3LS4H 4X6DE 5TF1H 1MUJA 4LKXB 3MV9E 3R8BB 1H3UA 1A22B 3K74B 4NZRL 4OGAC 2ADJB 3DX7B 4LPWA 3TJEH 2BNQE 1WITA 5DVOA 4KKAC 4P5TD 4K8RD 3G5VB 1QSFE 4YBLC 2J8UF 2OM5A 4JDTL 1U91A 4P4KD 5DVLA 1IEHA 5K9JL 2JJUA 4XPHH 5LGJB 3UTSE 1JGLH 4XCYB 1CGSH 3VWJD 2G9HA 2Q76A 3QA3A 3ARDC 4NQED 5C1MB 3PHQB 2AV1B 1Y0LA 4MNGB 4PY8J 3O8XD 4XVUD 3IJHB 2UWEE 2GK2A 1WFTA 3SDDA 5C2UB 3TF7C 3QXDA 4LSQL 5C0CA 3UJTL 1NMBL 4X4XA 1IAOB 1OGTB 5JW3H 5FYLE 2XT1B 3OKMA 3O3AB 3QO0B 3F7VA 5IG7B 2M1KA 4OZIB 5D6DA 5CUSH 3PIQA 2DL2A 3V5DB 1N4XH 3OGCB 2ZZUT 1KPUB 1MFBL 3ZSSA 3GMOA 1I9JL 2BXYA 3GKZA 1RJLB 2DWEA 4JN2A 5SWSD 1MOEA 1G9NH 1G7QB 1OF2B 5EUKA 5DZOA 1AHWA 1T22B 4HK0A 1EK3A 2DQIL 2SEBA 1FG9C 4DVBB 2EH7H 4MNGE 4ZAKB 5F7EH 4W68A 4YJZL 5GIRB 2MCPL 3WUWB 2UZIL 4NQXB 2AV7A 1WZ1L 2P24B 4Q2ZA 3NZHH 4ZUWB 4ZDHB 4N0YL 1JFMA 4HUMB 4OB5L 3U0TA 1NBQA 3AAZB 1EAPB 2KQMA 3N9GH 2G5RA 1XF1A 4AIZB 1JGEA 4G80A 1OAUL 4U1MB 3GSQA 1PD6A 2F74B 1O7VA 5IB4B 2DLEA 2AEPL 1JNHB 4JFFA 3CXDL 4QHNB 5IHZB 3WNMA 2IFFL 3FB8A 3V6OE 1RHHA 2BDNH 3F6IA 5DRZA 1FORH 5BMFL 3P0YL 2CLZB 5EU6D 1X5AA 1JK8B 1S9VB 4H25B 3RVWC 2W91A 3TH3T 4I2XA 4NPYA 4HIIB 1JMXA 1X6LA 2XZQH 4G43A 3LIZL 3S88L 4JRXD 3FZUD 5CGTA 4OF8A 4F58L 4YDVA 5E9DE 3S37L 5LXGH 1KIRB 2VZTA 5CGYC 2EDDA 1MEXL 4PJHF 5BW7C 4NRYB 1CK0H 4K3JL 2CDEA 1IKNA 2B1HH 4LARL 4MVBD 3MRBB 5IEKB 1P84K 3PV6B 2E7HA 3VFUB 3QWRA 1P2CA 4WTZG 4IDJL 5CSGA 2I60H 4JY5H 3G6JF 3LN5B 4ZO9A 1KXTB 3VXUB 2XZZA 3O11A 3IKCA 3HFML 3ZTNL 43CAA 2A1WL 4LQ1A 5JPNA 3C5ZD 4PV9A 5E94A 3RP1A 4KI5C 4OZGB 3RWDB 4KVNL 2FEEL 4NQDE 5T3ZH 3VFRB 4FFVC 5DFWH 4NNXB 1RU9L 2EE2A 2ZSWA 1T66D 4WU5B 4UNTA 3ULVF 1FNGA 3IF1B 5E2WL 5FGBC 3GGWB 1T2JA 4U1NB 2X4SA 5L9DL 5H94A 2VAJA 5LWYL 1W8NA 3MMEA 5EOCJ 2VITB 3GSXA 3H42H 1AI1H 4RGNB 3VXUE 4DW2L 1SEQH 4S2SB 2GK0A 2AABL 2OP4L 1CFTB 4F8QA 3QIWA 1HINL 2A0LD 2FATH 4OZGE 5I8CB 3T04D 3RWIA 3O6FD 2H45A 5IMOB 2O61A 4QHKJ 4NO5A 2C3XA 2Z35B 4JREB 1CFBA 5GS1A 1MAML 2XKNA 3C8KB 4Y5YC 1I8IA 1F13A 5B8CB 2MCG1 4FQXB 3VGAB 4ZUTB 4J3TA 4YAQB 3FHQA 4OFIA 1JI1A 4HWEH 2IQAA 3QUZB 4Q9RL 2XFXA 4KKBD 3UDWA 3ULUD 2QTEA 4CVWA 4RGNE 4Z0XA 4LCCB 3IDJB 1TTFA 4HXBH 3G5YB 4P46D 2YK1L 4KVCH 4PJEB 5D93B 3RHWF 3LRSB 4EUPA 4QRUA 4Z7UE 2YPLB 4GKOA 4FTVD 3ZT5A 3JWOH 4TUKL 2VDRL 4JQVA 2GAZA 4KUZH 4S1RL 5IBLC 4HFWB 1PZUB 3QG6B 2EDQA 4JO3L 1BF2A 3BGMA 1J9CT 4BKLA 4IOFD 5EULV 2VLKD 4PTUB 3BQUB 3DYMA 1TNMA 2LFGA 3O3EA 3HPJB 3B9AA 3KR3L 4OCSH 1AQKL 1U6AH 3EGSA 4LVHB 1K5NB 1VKXA 2AKRA 5EBLA 2NX5D 4B0MM 4PJEE 4QRTB 3P77A 4ZPVB 2YPLE 1H5BC 5EUOB 1FRGH 4JY6B 2J8UA 2DLFH 5CD5D 1GGBH 4OAWB 4Y4FA 3SDYL 3GIVA 4WDIB 1NANH 1FBIL 2VMFA 1XEDA 1A6ZA 4TVPH 1KELL 2BY3A 1TIUA 3KPOB 2BK8A 2EZ0D 1UB5A 4I18C 2BSSA 5TFSH 3EOAA 1OARH 2Q3ZA 4V1DA 5ERWA 3HNTH 1WZLA 5C07B 2NCMA 5EBMA 2FR4B 3LKOB 1INEH 2XZAH 1FE8L 3PABB 4OTXL 5IQ7H 5BVPL 1KTDB 1QLRA 1JBJA 3RWEA 1ZWIB 3P4NA 1KT2B 1J1PL 3GZKA 4LMQI 3TCLB 1NKRA 1DLFH 5F3HB 4L8SC 2ICEB 3X14A 1I9IL 3V6OC 1QFUL 4G9DA 4PJ9D 1F11A 1T0NA 2I9TA 5IFJB 3L5WA 4XVSH 5DMIH 2R2CA 1IAIH 2PTVA 5IB1B 2APVA 2HFEB 5F7NC 5DJYA 5C07E 1AKJB 4IMKC 4KUCD 2XG4A 1XH3B 3U7YH 4F15B 4X6FB 4OM1L 1U41A 3AUVA 4X8JB 4QHMB 2CXGA 1FNHA 4XNZB 1DVFA 2QQNL 4Y4KB 1J8HB 2GI7A 1Q9OA 3L6FA 4DN4L 4P2QB 5FECB 4DWHA 2HT2D 4PS4H 3S34L 5I15L 1OTSC 3AM8C 4U4BA 2OBGA 3MUY1 2B1AL 4DGIH 1I7TB 3L5JA 1TLKA 4K7FB 1OPGL 5I30L 1HYRC 4Z0BH 1ODAA 1KEMH 5CEZH 5B39B 2A6IA 2P5EA 2H2SC 3C6LC 3QUXB 4XNYL 3KHOA 1UH4A 1JZ8A 1KOAA 2G5BA 5CILL 2MQCA 4DFIA 5EOCL 3JTCA 5K9KB 1FNLA 2DKSA 3B9KA 2Z0BA 5DGQA 3NFPB 1KLFA 4P23B 1DP0A 3WS6A 2YUVA 1C7TA 1YECH 3DTXB 3WXVL 5DJDA 4OFVA 1F4YL 3ZYZA 1IM3A 4FQLH 1YNKH 2DMCA 1QR1B 3P40A 3KLHC 3OJDA 1U8LB 3AU1B 2FX9L 3D25A 5JA9A 4R7NB 4PLKD 4UQ3B 2V2WA 1F97A 3BH8B 3G6JA 4HBCL 5J6HB 3QIUD 2FO4B 4O4YL 1NGWB 1AXTL 2RGSA 4FG6D 4IMLB 4NO0D 4JEGB 2ATKB 5HJ3B 1WWBX 2X1QA 3PHOB 1IC4L 5KTEL 4NQUA 3N85H 3QR2A 4LP4A 4KMQA 2IPKB 4P2RA 4X4ME 3WEXA 2IWGA 4KROD 1XGPB 3V4PH 3D39E 4KQ4L 2OTPA 5BRZB 2FO1A 1WT5C 3V4UL 5ID1A 2JIXA 2X4PA 4ZUVA 3N06B 1CFSB 5KN5A 1JHLL 5I1DB 5M94B 3BKYL 4ZG1A 5EZJB 4H1LA 3HMXL 5I1KL 4U6TA 3MZTA 2WIIB 3W9EA 3QXAA 4RGNC 3STZA 2CKBL 2W0PA 4BM7A 2V2TB 3MXWL 5IW3A 3DIFA 3SQBA 4JFHD 3WIFB 5HHXL 3T3MF 5FKAB 3ULVH 5KW9H 1J86A 1NGXB 4MD4B 3GMQA 4JFEA 1A7QL 3NIFF 1CDIA 4Z7QF 6FABL 2VB5A 3BH9B 4C4KT 3EO1A 2X6MA 5I1CH 2N1KA 3BKJH 5IQ9A 4JPVL 1DLHA 4K7PL 3SDDD 4MB3A 5BS0A 3BUTA 4FQXC 4X6BB 3RNQA 3VGAC 1YN6B 5DJ2A 5BRZE 4M62H 1OW0A 1CFNA 3OKDA 4DQOL 2CDFB 1PLGH 3TO4A 4FQIL 4ZUUA 4JJHA 4IOIA 3GHEL 3Q1SL 1RZFH 3H9HB 2J12B 3QUZC 5FK9A 3T0WA 5FO8A 4PG9A 4NNPH 4FQPA 1H3GA 3KJ6L 1JYVA 3QRFM 2EXYD 1JYXA 5D93C 5DZLA 4JR9L 1K2DA 3ARFD 1HE7A 3OR7B 2A6JB 1OSZB 5D8JH 4FQJL 3VFTA 2AJXL 3V2AR 2GT9A 2EDFA 4CUCA 1TDQA 3BT2L 4N8PA 1B0WA 2F9BT 2JCCF 3QJFB 2VZ3A 2AGJL 7FABH 1RY7B 1X9QA 5GJTH 4JPKH 5F7DB 1KENH 4X5WB 5FUOH 3QUMA 2ZUTA 1ZHBB 3DLQR 4KTYA 1EERB 4FQ1L 1CI5A 4YBQD 4EQ3A 5L2KB 4LVHC 3DBXB 5ALCH 4AEFA 4S0UC 4ZFGL 2EE6A 4MA7H 5IP4A 4HWUA 5DJ6B 3BDYL 3T0EA 1VFOA 4FFWC 1U8NB 1JCKA 5HYJB 2QKIA 1TVHB 1DN2A 4MS8D 2IEPA 2Q3AA 4OLWH 4RFOL 4WFHE 1C16B 2DMKA 3F5WB 4IIQA 1DQDH 1U58A 1XGYL 5F70A 5MEQA 4MQ7B 1FN4B 1P6FA 4OLXH 4PRBB 3BMVA 1RZ8B 1XMWA 3RAJL 1ZA6B 5IJKA 15C8L 3QQ9D 5D7IF 3AY4A 2Y36L 1WZKA 3I6GB 4ELMA 3VW3L 1KCVH 4AL8H 1P7QA 4UU9B 2X4TB 5F88A 3V0AC 1EV2E 1G0XA 4H88H 3E2HB 4YHOH 1PZ5A 2NY0B 4XP1L 5EO1B 3OX8A 4O58H 3KWWB 5T3ZD 1D5XB 5T3XH 1RZIB 2ICWI 1A6AA 1J5OL 3RZCA 1EX0A 4ODTH 1EHAA 3QWRD 1AGBA 1OAQL 1MCEA 4GW1A 5C08A 3ZKMD 4Z7VF 3NACH 4LHQB 2IANA 4FQCH 2BERA 4CU8A 1G7JB 3PUCA 4ENED 3A6CH 5L2JB 2BX5A 2FSEA 1A9EB 4YGAB 4LCWE 3MC0A 1FFPB 4NGHH 4JHAH 4F3FA 4X80L 2EKSB 4YXHL 1HHHB 5DC4B 1LO4L 3PWLA 2HTKC 3MUGA 5TDPA 1MNUH 3KPRA 3ISWA 3CVHH 1PJ9A 2R4SL 1EJOH 3RFZC 4HUXA 5J56B 4R2GC 1QQDA 1YY9D 2IJ0C 3LQZA 4YDKL 4Y4KC 5LJYH 1NBVL 3N1PC 4M93B 3L7EA 1RHFA 1R5WA 1VFMA 2QV2A 1XIWD 3G6DH 4JRYE 3HZYB 4QY8B 4RQQB 4WW2A 5CP3A 5DQ9A 5DEGB 4BSVB 3TN0D 1NEZB 1MF2H 1JGUL 1R5IA 5TH2B 2XY2A 1VGKB 3K8LA 3IB4A 4O5LH 1V7NL 5LGHH 1AGDA 4QHUA 3B5TA 3RVXC 2OJEA 3QHTC 4JRWA 4GG8A 5HI4C 5BOPA 3K81A 5DHYB 4PRID 1BIIB 4J2XA 3QUXC 2GYSA 4BSWA 5GZNC 2KH2B 1MVUB 2AK4A 2JK5A 2AXGA 4JFOB 3TV3H 5J6GB 3QO1B 4QRQB 5GGVY 1MCHA 1TQCB 2DDQH 3LEYL 5FOJA 3B8SA 5ICZB 5ALBH 5EB9A 2XTLA 3LAFA 2Q7YA 4ZFOB 5DEFA 4ISVA 1HH9B 3K4ZA 4JFPB 4B50A 2K1MA 4JANB 3W9DA 3WO4B 1G9MH 2GSGA 4OD2B 1UT9A 1N7MH 4FFYH 1LEGB 5EU4B 1D3CA 5FYKE 3FB7A 4U1SA 1QO3A 2WIMA 1MRCH 5LCVH 2ARJA 5JW4M 2PTTA 1VGEH 3C5JA 4EDXA 1JVKA 1ZA3A 3BISA 4ODXB 5DD6B 1KXQE 4GQPH 2OTUA 4XBGA 5EFIA 5KVFL 3BZDA 1WVZA 2R69H 4HZAA 3E8UH 4PJCF 3S4SB 2FX7L 4GAFB 3VXRA 4Y89A 1DANU 2H32H 4AT6B 1NCBL 1A3LL 1KIPB 3DVFA 4TVPD 1BQHG 1U9KA 2F54B 1ZEAL 1FG2B 2NXYC 3LPGA 1JPTL 4R0LB 2YSSA 2PN5A 1UA6H 5EC2B 4S10A 5IBUB 2PCPB 5GSVB 2VLMD 9CGTA 3HUJF 3I50L 4Y4FD 5B3NA 5C7XL 1GHFH 4HIHB 2Z92B 4YBHA 4IRJB 1NGZB 5TGBA 2DQHH 2W59A 4LNRB 4YHMH 1KLGB 3TVMA 2VNCA 4ORGB 3V95A 2GSIB 3OR6B 1DSFH 3NPZB 5KVGL 4R90L 1HHKB 5HHOA 4CU6A 1TVBB 4L4TA 3QEGL 2F54E 4PJXF 1EGJA 4G8FA 1OQOA 3KHQA 3DV4B 1I8MB 3CH1B 5I0DA 3GSRB 2H9GA 2X7LA 5E0QA 2FX8L 4YWGL 2EYSB 5T5FL 3OKOA 3H9ZA 4WWKA 2BY2A 4U3HA 5C3LD 1PW3A 5CMAB 4D8PA 1WCBB 3BJ91 3T0BA 4OGXH 4JVUA 4GW4A 4C83B 4JO1H 2B39A 5TE7H 4EUPG 2JTDA 3L3IA 4G42B 3OJMB 3SKOA 4MJIB 1MCWW 1IGJB 3QFJD 5EDXA 3BRGC 4MA3B 3X13A 2JCCA 4QEGA 4D9RE 1RUMH 3GMNA 3GUTB 2PR4H 1MHCA 1F2XK 4HKZA 4J6RH 4P5KB 5BVJA 4LFHG 4QRSA 3FTGA 3GMPA 5CEZD 4DKFH 3EUUA 1KCSL 2W92A 1NQBA 4MMXC 4H20H 2DS4A 2QL1A 3VXMA 2MPAH 2VLJA 4LP5A 3V0WL 3A6BL 2XY1A 4XRCB 3UTQB 4J3UA 4NZRH 5HDLA 1NC2D 3B5GA 5DHVB 5E8OA 3VFSB 2AXFB 2C1OB 4JQXA 4JDTH 2H26A 1HKLH 1VPOH 5K9JH 1WUNT 3X11B 2V17L 1IAMA 2P5ED 3IU4L 5J9PB 4YHNB 1FL6A 4DZBB 1JPSH 1G6RB 2L4OA 4IS6B 4QOKE 2X9WA 4M6OL 4HEME 5DS8A 2ICCA 1IQDA 4LSQH 3MJ8B 1B9ZA 4OCWL 3UJTH 3IXTB 1AR1C 1NMBH 1GRWA 3MBEC 1QBML 3QDJE 1HEZB 3WHE0 3LPFA 4YIQB 1RZJL 1T1ZB 3FO0L 4ZQKB 3MV7D 3LKQB 4GRLD 3MACL 3WHXA 5KANI 2HLFC 4IBLT 5KJRH 1F6AB 3PJSB 1MCIA 4GKNA 1EA9C 4PLJD 5IIEA 1I9JH 1AJ7L 3FCTB 3IDIB 2H41A 4HUKB 1NDGB 3BWUC 3HB3C 1KB5L 2FHFA 5BZDA 4UTBL 4LVOB 4KI5F 3TO2B 2IF7A 5IB2B 1MCFA 1N64L 3PXJA 4NRXB 2VLLA 4IJ3B 3I6LE 2UZIH 5H2BB 1ORSA 2IC2A 2ZJSL 3ME0A 1WZ1H 5ETUA 4N0YH 1CT8B 3T3PE 4P2RD 4OB5H 3PQYA 3ULVD 4PJIB 3MA9H 3P4MB 1OAUH 2IALA 2JJTA 3T77A 2VQUA 4PJ8D 3WFCL 1MI5B 2AEPH 3CXDH 1EEYA 3S98A 5CEYB 2G75B 4XAKE 1CDJA 1GZQA 4C58B 4XNXL 2A9ML 1CXKA 3P0YH 3WL9B 3F58L 3SDAB 4LAJH 2ICWA 1I1AB 3U6RA 1TJGL 4XB7A 5JHLL 2YXFA 3Q6FB 1U93A 4NN5B 3LIZH 5IMMA 1EO8L 3H2WA 1ZVSA 2CLRA 5GGRY 1TQCC 3TA3B 1F6FB 2ESVB 4M9PA 5TDNB 3FFDB 3EOTL 1MLCB 4PJIE 3FRUA 3U30B 4R8WL 3S37H 3T8XA 1JGDA 1MEXH 3FAXA 4OIAA 1MI5E 4ZUSA 3DUSB 4K3JH 1UEYA 4TUOA 5GRVL 3IDYC 2JF1A 2NY5C 1FVCA 1H8SA 1VHPA 1R3HA 4H8WC 4NM4L 1MIEH 3PWUA 4LARH 3R8QA 2CSPA 4KI1A 4AY0A 5EC1B 4KC3B 3MCKA 4IDJH 3QIBD 1N59B 2VDML 3ZYIA 3HFMH 1EO7A 3ZTNH 5HHMD 2KZWA 2WINA 1B2WL 1AO7B 4ODVL 2A1WH 1IGYB 3ZKQD 1XCQB 2BVQA 2ESVE 4HUVA 3IJYB 4JZOA 3WUZA 3MR9B 1NFIB 4KVNH 1GOHA 3GSVB 4ZFZA 3VJ6B 2B5IB 3CIQA 4JO4H 4J3SA 3KYOB 5C0IA 5EN2A 2WBWB 2XTJE 1RU9H 4F9PA 5JXAH 2GJJA 2XN9A 4L5FL 4U0QB 4MA1C 5JXED 2PO6C 4LLAA 4R0LC 3FQWA 1SY6L 3BUYA 2DQTL 4TPRL 1JPGA 1TVDA 5E2WH 3RDTB 1MY7A 1I3RA 3V5KA 5L9DH 2EC9T 4H1LG 5CP7A 5LWYH 3T0ED 1TZIB 3ARDA 1I8LC 4DW2H 3FKUS 4QNPE 3FO9B 1XGUA 2AABH 2OP4H 3QJHB 1AO7E 2XWTA 3TF7A 3MRHA 4KKLD 1OT2A 1HINH 1QFWL 3MLYL 2ED9A 4DKAA 4ZD3L 2BNUB 4XP4L 1A1NB 1U8QB 2NY4C 3BESR 4RMQA 3RWGA 3RI5F 2O93L 1ROWA 4OIBA 1S9KC 1UQSA 3UTPD 4OF6A 5HHNB 4FQ2L 5FA4B 1C5BL 3MNZA 1I85C 2OK0L 4LSDA 1QVOA 3TBVB 4I3SL 4TULL 3SKNA 4HK3J 1KN4L 2OL3L 4PP2A 4UAOB 5CZKA 5F7YC 3QWOB 5TJWK 2VIRB 1YJDC 4NDMA 4Q9RH 5IHLB 2EIEA 4A2LA 2HFGL 1I1FB 1C8PA 2IH1B 2YK1H 1PG7L 4LRIC 2UY7A 3QB7C 3UZQA 3QDGD 4TUKH 1OAKL 3U36A 5CHNB 4C56E 4N90D 2VDRH 3CFBA 3O4LA 2MHAB 1MWAB 4S1RH 3LCYA 1IMHC 1IGML 2D7OA 3DRQB 4LVNB 1MY5A 5DC0A 4JM2F 4JO3H 5INDA 4D0BA 3VXTB 1FYTB 5K59E 4JFZL 2DD8L 2AVGA 3KPRD 1S7UA 3HI5L 2HN7A 3B43A 3ECBA 3PGFH 3TYFA 2PKDA 4R3SA 4L3CA 4Y19A 1IE5A 2P42B 1QSZA 1LMKA 5DUPL 3W0WB 3KR3H 1S7WB 2JJSA 3TBSB 1AQKH 1A64A 1EFXB 3PNWA 1VCAA 3EZ8A 4NZUL 5FUZH 3VG0L 1UWGL 2R2HB 3H0TB 4U33A 4QXTB 4DFHA 3KLDA 3GM8A 3I6KA 3H9YA 4GUPB 5IWLC 2FBJL 4YC2B 3LB6C 3SDYH 2IBBA 1S8DA 1FBIH 4ETYA 4LLWB 5IV2A 4U1IB 1UXWA 3BWAA 1KELH 4XCNA 3WDHA 2R2BA 1NGYB 5IB3B 1FYTE 2QSVA 4M3KB 2YEZA 3NIGF 4MZ3A 2CD0A 2BMKB 4N9OB 1JPFA 1LVEA 3FHAA 4ZOAA 5EOTA 1H3TA 4PD4K 1GVIA 1BIHA 3W0WE 1FE8H 4OTXH 3O9WD 5BVPH 2DYPB 4M7ZC 3VWKD 4NBZB 4L8BA 2M2DA 4YGVA 1YUHB 2ZUQB 2OXGA 1J1PH 3LEXA 1U8IB 3G5XB 3MCG1 1K8DA 5EU5B 2W1NA 3IJSB 4YHZL 4IDLA 1QFUH 4LVOC 3GSOB 5MHSD 4MJ5B 4PR5A 1K6QL 1U8JB 2C9AA 3HR6A 2XWBB 1E4XL 1P4LB 3MLRL 5E2TL 2A6KB 1T7WA 5LG1A 2HRPL 3CSYB 4P4KB 3TYGH 4NKOA 2LQRA 4S1DC 4N68A 3VWJB 4NQEB 2WY3A 3BO8A 4OM1H 3O8XB 3BXNB 4KV5E 3EJZC 4TQEH 3SGDI 4L8DB 3V5HB 4L4JA 2QQNH 2GJ6D 3SDXA 3SDCB 1WAAA 4P2OA 3QQ4A 5C3TA 4GRMB 1NUFA 1YEEL 4DN4H 3EYVB 3S34H 4FZEL 4U1LB 5I15H 4XP9L 4Z7UF 1SEBB 1C5DB 3QAZC 4HK3N 4BK4A 2B1AH 5CSBA 2BOCA 5F7WC 5I1AA 1OPGH 5I30H 5C9KA 1IT9L 2DQUL 1I1AC 3SO5A 4Y5YA 1Q0XL 2A9NH 4XNYH 2YHGA 5SWSB 1C08A 2W65A 5I1GL 43C9A 3OSKA 5CILH 3RVTD 3TA3C 1U3ZA 5BZWA 5D72L 4G8EA 1ND0A 4NQEE 4Q97A 5IK3B 1NCUA 2C3VA 4ZFFB 5GRJH 3DO7A 3U30C 4OCYL 1W0WB 1S3KL 2XTJC 3MV9A 3QEUB 3WXVH 5CD3A 1KJMB 1F4YH 4M1GL 1IM9A 2BNQA 5GISL 2CR6A 2P5WA 3KPPA 3MLTA 1BQUA 3RL1B 4DK3A 3RKDD 3U0WL 1QSFA 2DTSA 2HJKB 4MNQD 4GS7B 2YD6A 3UTSA 3EYFB 2GY7B 4P3DB 5INCA 3D5OF 4L1HA 2UWEA 3WS3A 2I5YL 2YD7A 5SWSE 3TBTB 5DUML 2AJZB 5EU6B 4EI6B 4ERSL 2B5IC 5C0ND 4JPIB 1IC4H 5KTEH 2VZSA 3QZWB 2ARJQ 4KTEL 3TFKC 2ADJA 3DX7A 4KQ4H 4JRXB 4G6MH 1BFVL 1OWRM 1O0VA 3P4OA 1FNEB 4TSAL 5ESAA 3V4UH 5JLZB 4Y2OA 1H5BA 2KQNA 4LHUG 1KCKA 2CDGB 3HC0B 1JHLH 3RDTC 3DGCR 1S7XA 3BKYH 5F1IB 3U83A 3OG6B 3RIAF 5LGJA 3ARBA 1FZOB 3HMXH 5I1KH 4GSDL 4MNGA 5DA4A 5GJSL 4DEPC 1DQJB 3MRRB 5GGSA 3MXWH 4YUEH 1MCKA 1M71A 4XMKL 4I18A 5HHXH 1NAML 5EU6E 2DMBA 1IAOA 1A7QH 2Z91A 4L4VB 2PYEB 6FABH 3O3AA 1D6VL 1Z5LB 2K3TA 3QO0A 5GZOD 1KNOA 3D85D 4JPVH 3VFNB 4K7PH 4FFZH 2UV3A 3GI8L 1FO0L 4JRXE 1MJUL 4U1HB 2DQEH 1RJLA 2LVEA 2ZCLL 1VFUA 4L8SA 4UAOC 1FSKB 4K3HA 4GMSL 3GHEH 3Q1SH 2W0FB 4QRRD 1HDMB 5LVEA 4HWBA 1CFQA 5I1LB 4KK5C 1YYML 5JORA 5GIRA 1RULL 3WUWA 4NQXA 3L9RB 4X4YB 4JR9H 2P24A 3PWJB 3VMOA 2QSTA 3MFGB 1CE6A 3U46A 2NYYC 1CL7L 2E7BA 4IMKA 4NT6B 4FQJH 1MFAL 4HLJA 1FVEA 3MO1A 2X4OB 4LVNC 5E9DA 1F3DJ 4AIZA 4M3JA 4U1MA 1MPAH 4BZYA 1JWSB 2BP3A 4HWBH 4YHKL 2AGJH 2DTML 5IB4A 5JDSA 4CMHC 1JNHA 3O6FB 3VD4A 4RMRA 4N8VA 3PQYD 5IHZA 3AM8A 4FQ1H 4P5MA 2VL5B 1MIML 2H3NB 4WUUD 1WF5A 2ARWA 2EO1A 3REWB 4BSJA 5E5UB 4ZFGH 5D7LD 4J3WA 3P9LB 2YMXL 4HIIA 3ZKSD 3BDYH 3C6LA 4EVNB 4X6CB 5GS0L 1IC1A 3P2TA 5E5MA 1VFAB 4YC2C 3ROOB 4D94A 4RFOH 2KKQA 1K4CB 2D7PA 2NTSP 4NQDA 1XF4A 5D7JD 2H2PD 2DL9A 3B9VA 1CQKA 2G60H 4CU7A 1GZPB 4LSRH 3I9GL 3WIHL 3MRGB 3ESUF 1SJEB 2Y72A 3RAJH 4BUGA 1F6LL 1HSAA 3MRBA 3OG4B 4PBXA 3VW3H 2L0DA 4QT5B 3CFDB 2GUOB 3DVGA 5FDWA 4M7LH 1U3JA 4NO2A 3ARZA 4YQXL 2VLKB 3VXUA 4XP1H 1FFOB 3RVUD 1OGAB 2PTUA 5BQ7B 2CJUL 1KPVB 2I9LB 1J5OH 2AW2A 3ULUE 4G6FD 2PXYD 1BF8A 1OAQH 1W72L 1A1OA 3OKNA 3VRIA 5CJ8A 3MLVL 1DL7L 2Z93B 1HI6B 4P5TC 2ZNXA 4PRNA 2A6DB 4FTVE 4PRDB 4WU5A 5LKNA 4P4KC 3MNWB 1X5KA 4Y5XB 4X80H 1UXSB 2MKLC 5HDBF 4YXHH 3VWJC 4LCUA 3IF1A 2J1KA 1LO4H 1C12A 3WKML 5FOBB 5IBTL 4QTHA 4XVUC 3GGWA 4U1NA 5DO2D 4EIGB 2R4SH 3VXSD 1H15B 1YMHB 3AS2A 3MLUL 1I75A 2VITA 4PY7B 5B38A 2VLKE 3QI9D 4GKZB 3ZE2E 4YDKH 2OR8A 2C4XA 3RBSA 5C70A 1J10A 1NBVH 4S2SA 1AXSB 5SX4H 1ZXQA 4Z7UA 1CFTA 4OZFB 1JGUH 1EEZB 5IMOA 2YD8A 5GGVL 2NX5E 2Z35A 5D5MB 1N5YL 3UCRA 2L7JA 4WO4B 4BJLA 4HMDA 1E27B 4FQXA 4HUNB 4WVRA 4L8CB 1RZGB 3BZ4A 3LKRA 3DHJA 4PJ9B 4EIZC 1U8PA 4NHUB 4YAQA 1UB6B 5D1QD 4I77H 4LEOB 4RISL 3DXAB 4JHZA 1B6UA 3LEYH 4O2FB 3RY6A 3B2VL 2YN3A 1RIUL 4PREA 5KS9B 3G5YA 5DI8A 3RNKB 3NN8B 4PJEA 1ZHNA 3R1GL 4K2UL 2YPLA 4GS7C 3WSQL 2HLAB 3MV8D 2HG5B 3GJFB 3BZFB 5D5ME 5DMKB 1JE6A 1QYGL 4U6HB 5D2NE 3ZO0A 1B0RB 2GHWB 5IUSA 4Y2DA 4M43L 4U05A 4NHUE 4TOYL 4DZ8B 3UZEA 1N3NB 3OMZA 5KVFH 4G8IB 5FYJU 3EYSL 1LE9A 5ITBL 1K5NA 4N9GA 2FX7H 4P9ML 1T03L 2QADC 3NABL 3FZUC 5F7FA 1NCBH 4DJMA 4QRTA 1A3LH 2EECA 4ZPVA 3L95B 3ARSA 4JY6A 3BEWB 3DX8B 5E8DL 4OAWA 1ZEAH 1T1XB 1E4JA 1JPTH 4XI5D 5DSCA 5DR5L 1BEYL 4MVBC 2IGFL 4KJQD 1AGCB 2NY2D 3I02B 1YC7A 4PTTA 3ARGD 3TIDB 5C07A 2Y5TA 4TUJA 1INDL 1U42A 2QLVB 4R9HA 4A2MA 2CXKA 3PABA 2X2YA 5DRXB 1V5JA 3QIUB 1XAUA 4WGVB 1RIVL 5E8NB 1WC7B 3UYRH 3FOMB 2V5RA 3FB5A 5T33L 3IDNA 5KVGH 1KT2A 3C5ZC 3B6SB 1KB9J 4NO0B 5IHUL 1PAMA 1BBJB 2HWZH 5JTWA 5C0GA 3T2OA 1CCZA 3VGGA 1FSKC 4OF3A 3BN3B 2XQBL 4QGTA 1T66C 3U48A 5FM5M 1NC4A 2FX8H 4YWGH 1GJIA 5C2BL 5T5FH 3RL2B 3HPLB 1K3ZA 4XWOD 2HFEA 1MUJB 3LZFL 4B41A 4K9EC 3MCLL 3QHFL 5GGUA 3TCXA 1IJ9A 1T0PB 2A83A 4MCYA 3B9EA 3TWCL 1YPZB 4WENB 1KUMA 2A0LC 1U91B 4UV7L 3BE1L 3O6FC 2Q76B 1KACB 3QA3B 1Y0LB 1P6AB 4Q74A 1KCSH 3VFWA 3SDDB 1I7TA 2VDPL 2DJUA 3Q2CA 1X5HA 1FDLL 3QXDB 4K7FA 5C0CB 1CLCA 4WI8A 4RWHA 4P2OD 3QCVL 3V0WH 3L3GB 5GRUL 3A6BH 5ADOH 5B39A 1RUPL 3QUXA 3OKMB 5F7MC 4WGWB 2HFFA 4ZS6D 4DK6A 5EZIL 1U2CA 3JXAA 4KKBC 2NLJB 3MOAL 3ULUC 3NFPA 3PIQB 5D2LB 2CRYA 1GC1C 4P46C 2YRPA 3GJEB 1YPZE 2DWEB 2V17H 3IU4H 3ARFB 4JN2B 4X4MA 3D39A 1ES0A 3RX8A 5EUKB 1QR1A 1AHWB 3VFMA 4HK0B 1YMMD 4M6OH 3CDGA 1U8LA 3AU1A 4OCWH 2WLZA 4HDIB 1HHJB 1JNLL 3BH8A 2AV7B 2DF3A 2AERT 1TITA 4JKKA 4KGJA 3EZJB 4Q2ZB 4IOFC 4LF3A 3FO0H 2P5WD 5MEND 3MACH 1A7PL 3U0TB 4MA8L 1NGWA 1PQZA 3QQ3B 5FYJH 1JGEB 1HCFX 1AJ7H 2ATKA 4OI7A 1UENA 3GSQB 5D2LE 5HJ3A 1KB5H 2Z8SA 4JFFB 2P46B 4CADA 3H9SD 2IPKA 3OKEA 4UQ2A 1XGPA 5CD5C 1RHHB 4Y5XC 5DRZB 1F8TL 3C2SA 1N64H 5BRZA 4EN3D 2WMPA 4ORZC 1BFTA 1CFSA 4XH2A 4ZXBD 4NPYB 2FZ3B 4UT6H 4GG6B 5EZJA 3AMKA 2EZ0C 4K94L 4BH7A 1H3VA 3QQNA 3QWQB 5F44A 5ESVA 4I3RL 1CN4A 1DEDA 3KJ4B 3WIFA 4YDVB 2Y06L 1P1ZB 1OP5K 1ZAGA 3FN0L 3K8MA 4MD4A 3L3JA 3ARBD 4CKVX 1M7IA 1M7DB 3BH9A 4JN1H 1KJ3L 1OHQA 5KANG 4XNXH 5D2NC 1BD2E 2A9MH 3KYNB 4M5ZL 3LN4A 2BVUA 3QRGL 3F58H 3GIZL 5AZ2H 1TJGH 5JHLH 4PJ9C 1P2CB 3JTTA 2CDFA 4JQIL 4NYLB 1MRDL 2G2RA 3H9HA 4GG6E 4HQQL 3AFLA 3EOTH 5DJ0A 4R8WH 4PV9B 5E94B 1T83C 1WFUA 4HF5L 3FJTA 3OR7A 4YLQT 5FYKU 3O0RL 2A77L 5FO7A 2J6EL 3EO0B 2KL6A 4NM4H 5I75C 1VADA 1FNGB 5F7KC 5T3ZE 3HNSL 2JB5L 2HT2C 4R96A 3BPNB 2EIDA 2VDMH 1MCJA 4HH9B 5F7DA 1SY6A 4HLZH 4LLQA 1ZT4A 1B2WH 2EKJA 4LSSH 4P57A 1I9EA 2GK0B 3A67L 3MUHL 4KXZH 4JM2D 2IMNA 3PE9A 4R7DB 3V7MA 5DFVC 3UBXB 3WNNA 1CICA 4L5FH 2YUZA 3QNXA 3ARVA 1QKZH 4JFYB 4KTDL 3QFDA 4U31A 1I8IB 4MWFA 5TE4L 1SY6H 3R06B 2DQTH 4TPRH 3DRTB 1ZVYA 4XP5L 3IFPB 4L3ED 1DBML 4MNHA 1CLZL 5SWQB 1VA9A 3NCYP 3NFNB 3KG5A 3T2PA 4BZ1L 2APTA 4LCWA 2IQAB 5HXMA 3ZZ1A 4PLKC 5SV4A 2DQCH 3O81A 4XGZB 2D3VA 2OL3A 3K4DA 4JJ5B 3W11D 4Z0XB 4W6XB 5AYUH 5ILTL 1QFWH 4RAUA 2NXZD 4PRIE 3MBEA 3MLYH 2YD4A 5T1DH 2WK2A 4UU9A 5I71C 2EIBA 2X4TA 3QIUC 1D5BA 4C57C 4ZD3H 3RY4A 2PUQT 5CJBA 4GLRH 3T3PF 4FG6C 2OCFD 4E5XA 1JTTA 4RMUA 3HHRB 3KWWA 2EH8H 4FQ2H 4JRYA 2BSED 2OK0H 1RZIA 4Z5RA 4I3SH 4TULH 3GBML 3BGMB 4QXWA 1TCRA 4BKLB 1JNNL 4KROC 1KN4H 1MH5A 2OL3H 2V7NB 4FXGB 3JVGC