4ZUWA

Crystal structure of equine mhc i(eqca-n*00601) in complexed with equine infectious anaemia virus (eiav) derived peptide gag-gw12
Total Genus 73
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
73
sequence length
274
structure length
274
Chain Sequence
GSHSMRYFYTAVSRPGRGEPRFIAVGYVDDTQFVRFDSDAASPRMEPRAPWVEQEGPEYWERETRNMKEATQNFRVGLNTLHGYYNQSEAGSHTLQRMYGCDVGPDGRLLRGYRQDAYDGADYIALNEDLRSWTAADAAAQITRRKREEAGVAEQCRNYLEGTCVEWLLRYLENGNETLQRADAPKTHVTHHPISDHEVTLRCWALGFYPEEISLSWQRDGEDVTQDTEFVETRPAGDRTFQKWAAVVVPSGEEQRYTCHVQHEGLAEPVTLRW
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Classical MHC class I antigen
publication title Structural Illumination of Equine MHC Class I Molecules Highlights Unconventional Epitope Presentation Manner That Is Evolved in Equine Leukocyte Antigen Alleles
pubmed doi rcsb
source organism Equus caballus
molecule tags Immune system
total genus 73
structure length 274
sequence length 274
ec nomenclature
pdb deposition date 2015-05-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00129 MHC_I Class I Histocompatibility antigen, domains alpha 1 and 2
A PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4zuwA02
3.30.500.10 Alpha Beta 2-Layer Sandwich Murine Class I Major Histocompatibility Complex, H2-DB; Chain A, domain 1 MHC class I-like antigen recognition-like 4zuwA01
3SEPA 1AGBB 2BRQA 1XGYL 4ISVA 1L0XA 1LE5A 5I1LA 4NNPL 1OP3H 4MJ5A 1AGEA 1T2XA 3T8XB 4CVZB 3ZO0A 4KY1L 4IEFB 1T5WA 1ZWIB 5D7SH 2R23A 2IBZY 3MLRL 4IMLA 2YBRB 2R69H 4ZS7H 1N7MH 4QXUH 1CGWA 2YD3A 2H2PC 3GI8L 1FFNA 1ZHNA 4GJTB 1RMFH 2IH1B 5HHQB 4NWUL 4PV9B 4LSSL 2Z8SA 2AXHA 5KVEH 4NQXB 2JELH 3KPNB 2CKBA 3SDDC 3LV3A 2BY3A 4NKQB 3FZUC 4Q74A 4UOW1 2DLFL 2HWZH 4O00A 1N6VA 2FX8L 4NQDD 2BVPA 1W72H 3G04A 3QXDA 1RIUH 2WY3A 4NUJA 3WIHH 5DJDA 4GAGL 1KFAL 1LK3H 3SDCA 3OB8A 4DN4H 3NPZB 2J88H 1XEDA 1JNLL 3GBML 3GZKA 2ZUYA 3QUZC 3R8BB 3QEUA 4ODWA 4RGMB 3D3VA 4QTIL 2FYYA 1P4LB 4QOKA 3CPLA 3HCVB 5E1AB 4L3ED 2DBLH 2DIJA 1WZKA 4G8GA 4GS7B 4YE4L 1AIFB 5DEGA 5DUBB 4U0QB 3T1FA 2BOCA 1KCSH 4WI9A 4FTVB 1T3FB 4JFPB 4C58B 3MCG1 1FZJB 4KK9D 1DVFA 1WWBX 1MWAH 5CJOL 1MFAL 3C5ZD 3MV7D 4BSVB 4NHUE 1C5DB 4EN3A 1EH9A 1A14H 4JKMA 4KU1A 5IJKC 2ESVA 3B5GA 1T1YB 2VXQL 2PCPB 3DTXA 5J11B 3FAXA 4MDIB 5IB1B 1MCLA 1N6UA 3O6FD 2HVJA 4S1DC 1GAFL 2WAHA 3V52L 1NFIB 5D2NC 2PTVA 4JFZH 4MCYA 1BFOB 3QG6A 2YPLB 1JIBA 4LLVA 1J12A 4JM2F 1J86A 5C0CB 3QIUA 2CLVA 4Z8FH 2H45A 3BDYH 5GS0D 3NIFF 3VWKD 4K94L 1EZVY 1K5NB 4D2NA 2EC8A 1IVLA 3HAEA 2FSEB 5D2NE 5DD6B 5DQJA 3HNTH 1XR9A 2IQAA 2X4QB 3GHEH 4OLEA 5I1AA 3LCYA 3VFNA 4ZS6C 3WUZA 4TPRH 3QHFH 1DUYA 5EDXA 3V4PL 3KPRD 2R4RL 1TZGL 1D7FA 5EBWB 4ZYKB 2XZAH 1S7WA 2AKRB 1HK6A 3FFCB 4UDUB 5JNYA 2KPNA 3RVXC 3DYMA 4KK9C 2FD6L 4QHKJ 3HE6A 1FZOA 4XBEL 1Q72H 3VXPB 4F7MB 3V9FA 3BESR 1YC7A 5CFHA 4L3EE 1ZLWK 5L2JB 3LIZL 2R8SL 3O3DA 2NXZC 3NGBB 2LABA 3X3GL 1OTSC 2P5WA 4QRPD 1I3RA 5KSBE 5IV2A 1NANI 3IDMB 1UB5A 1RU9H 4XVJL 1N64H 3SCMB 4NRZA 1TZIA 1G7MB 3HMXA 3MV7E 1EHLH 4HK0A 3VFMB 3A6BH 1MNUH 1AC6A 1IQWL 3VH8A 5F1IA 2ZSVA 5CZVL 3SDAB 4TNWK 5DK0B 3BP5A 4EIZC 5C2BL 5HDOA 3ALXA 3FOMA 2OR9L 5GS0C 1J10A 3QQ3B 1JNHB 4MD5A 1QO3B 3VWKC 4NRYB 4U0RB 1JYXA 5CUSL 4IMKC 4EXPX 1N4XH 5FO8B 3I02B 4HXAH 4IRSD 2E5EA 5I71B 4FABL 2AXFA 1CTNA 1ZV5A 3E6HB 4FFWC 5ALBH 3B9VA 5ENWB 4OF3A 1FH5H 1HSAB 1N0LA 1H0DA 4ZUVA 5K93A 5ANMB 2IANB 3LMJL 3IU3A 3OKLA 4LIQE 3SQOL 3ZT6A 2BNRA 1JZ4A 1MJ7H 5C0EB 1M7DB 1R0AL 2VUYA 1D9KB 2VDNL 1XGYH 4WV1C 2EXYD 2DQDL 5DRWA 3KPRE 3KPPA 4PV8A 4NNPH 5A16A 4ODUA 1LO4L 1H15B 4LHUA 1V7NL 4P3DB 4PJ7B 4HWUA 5EU7C 3MLRH 1GOHA 4G5ZL 2VTFA 3GFUA 2QSCL 5CKAA 2I27N 5IB3B 3GI8H 1D6EB 4LLDA 1TVDA 8CGTA 1CFNA 1Q38A 2VDQL 2YK1L 3MRQB 4NWUH 1HQ4B 4LSSH 2WIIA 5HYFA 3T4AB 4QXGL 3MODL 3U46A 1K8IA 2DDQL 4QRPE 3BISA 1VESA 3J8F7 4K8RL 5HPOA 1M05A 4ZFOL 4F33B 5EORH 2DLFH 4PJCA 3WE6B 1EFXD 5BJTB 4U1LA 2FX8H 2DWDB 4KROB 4LNRB 4XAKD 4AQ1B 1IFHL 4AEIL 1BZ7B 3MFFB 4IRSC 3WJJC 4UIMA 4QRQA 1NMCB 5T5NG 1U58A 4GAGH 1KFAH 3IKCA 5INDA 2FECI 1I1AD 3PWUB 2HFFB 2VB5A 3MRBA 3GBMH 1JNLH 1CD1B 5BCAA 4Z7VB 3NTCH 4J8RA 1VFBB 4QTIH 1JN6A 3DYPA 3W81A 4HUMB 2JTDA 1U93B 1I7TA 3QHTC 5GS2D 1M7IA 2ITCA 4YE4H 3O2DH 3VFSA 4PJIA 5TDNB 2X40A 2B5IB 5INCB 1FNGA 1JMXA 1REIA 5EZLB 1NKRA 3AAZA 4Z7WE 5EO9A 5IK3B 1MFAH 4QRSB 2BCKA 2QQQA 3AU1B 5C92A 5EPMB 2VXQH 2JB6B 3MLUL 3A6OA 3HC4L 1GAFH 4EBQL 4MXQA 3C09B 1BD2A 4K7FB 3FT4B 4JQXC 4Y4KD 3V52H 4YDKL 2A9NH 2A6IA 1U8NB 3W9DA 3PNWA 5F7UA 4CKVX 3H9HB 1RUAL 1ZT7A 3H7BB 4N8CL 5J12B 1RHFA 4NNYB 3U30B 1G7IB 4Y1AD 1I1AC 3MLTB 4MAYA 4YBLC 1S5HA 5D9SB 3ARZA 3O9WB 5IBLC 1U8IA 1NC4D 1DBML 3HPJB 5HHXH 4XAKE 1U8LA 1O5DT 4P2OB 3V4PH 4WW2A 1OTTC 2V2TA 1IAOB 1TZGH 2R4RH 4HJ0C 3VXRA 1A1MA 2EDTA 2ZCLL 4U1KB 4GW1B 4P3WA 2DQGL 2FD6H 3QUMA 4EUPA 4X6CE 1W0VA 4JFDB 3BO8A 4MD4A 4XBEH 3FT2B 4H0HB 4FXGA 3VXTA 2N56A 3ZDZF 1ZA3A 3LIZH 3ARXA 4P0DA 3DX6A 1LE9B 3CVIH 4OSUH 4JGUA 5B38G 3DUSB 1IARB 4I2XE 1T7VA 3MA9L 2OYPA 4DVBB 4Y19A 4ZPTB 3C5JA 4XVJH 4PLJD 1JPFA 3QEQA 5F6HJ 2AVGA 4P2RE 4MLSA 2O5YL 1IQWH 3L3GB 4KJYA 1RUML 1PAMA 3D18B 5CZVH 1U3ZA 5D8JL 2WUBL 1F11B 3GSVB 5C2BH 4N1EA 1UWEL 4MNQB 2AJUL 3BGAA 3PGCA 1J0JA 2OR9H 2BC4A 4M9PA 2IALB 4OQTL 3C60D 1WC7A 1CICC 1JF5A 3BW9B 1WIPA 1LP9F 4Q0XL 3UPAA 4HT1L 4LLUB 5CUSH 3NFPA 3K8MA 3RGVA 5FIEA 1LQSR 1MUJA 3GSOA 1I4FA 4NN5B 5BO1L 5SWZD 5KANI 3RVTD 4OZFA 2GT9A 1AD9B 1FORL 1KLUB 1SY6A 4LARH 4Y1AE 4YDJB 3U36A 1HCVA 4HIHB 3RDTC 2F19L 2VWEC 3LMJH 1KJVA 3SQOH 4D0CA 3LN4A 3RUGF 4UT7L 1S9XA 5HDBE 2C1OB 2Y25A 25C8L 4JG0L 5IQ7L 2JCCA 3G6JE 2CMRL 4ELME 2DQDH 1MCEA 1X5JA 3CU7A 2XNAB 1LO4H 3K4DA 1I85C 1B3JA 1VADB 3ARFC 3IAPA 3VFOA 3MCKA 4JRYB 4G5ZH 3OKYA 2QSCH 5E9DB 4NOFA 3N9GL 4OCSH 4OJFL 4PLJC 4M1DL 1VENA 1FBIH 1YDPA 4J3WA 4GKNA 3CCHA 3BEWB 3S37X 2VDQH 2YK1H 3T0EB 3VGAC 1KTDB 1NEZB 4OLXL 4QXGH 2EDLA 4NT6B 3OXRA 1R3HB 2DDQH 5J1AA 1OAZH 3ZYIA 1ZXQA 5BZWA 3P4OB 4HPOL 4FQ1L 4O2EB 2I9LA 3C60C 4LMQI 2EDHA 3IF1B 4ZTOL 3FQTA 1UB6B 3TH2T 3FN9A 5T1KB 4Y5YC 1IFHH 3MLYL 4AEIH 1UFUA 1YEGL 3QRGL 3K1KC 3RX7A 4G80B 1GGIL 3QJHB 5E6IA 3SJVB 1JZ5A 3FQWA 3WFHB 2DIBA 3QWQB 2OL3B 1CK0L 4AIZA 1A3LL 1URLA 2X4SB 5IVXF 4NPYA 3T65A 5E00A 3PGFL 1F02I 4S0UC 3ARDB 2GSGB 2HJFA 1UZ8B 3MRPA 4P9HC 5SWZE 3CFEA 4X5XA 2OBGA 4HHAB 4RX4A 4U1MB 3K2UL 4KJQD 5J4MA 2JF1A 1LHZA 1IGFL 5FO7B 2CR6A 2NW2A 3ARYA 4BZYA 3W5NA 4K7PL 3LH2L 2PKDA 4GQ9L 3V6BR 4FS0A 1TZHA 4G43B 4U6HA 4DN3L 1X4ZA 2VR9A 2WUCL 4R0LC 4A6YA 1VEOA 3PL6D 3QDGA 3I2CL 4U1HA 5HGAB 1HHKB 5KW9L 5J6HA 3QFJA 4NFCA 1G1YA 5EU4B 5I6XC 3VD4A 3MMEB 1JBJA 4EXKA 3MLUH 3OKEA 2X70B 4EI5D 4HAGA 3BMWA 3HC4H 3VXUA 2HFEA 5IF0B 4YDKH 5E8NB 3F62A 4K7PX 3MLVH 1A7NL 2D7TH 2NY7H 3JWOC 5GJTH 5FB8B 4JM2A 4HEME 1IAIL 4N8CH 1NPUA 4U1NA 2YUVA 5JIIA 4GG6E 3MV9B 5IFJA 1FVEB 5IJVB 1AQKL 1DJSA 4FQPA 4KGJA 4YFDB 4ZO8A 3DVGB 1MAML 1WZMA 5LGJB 3VFGL 5IMLB 2K7PA 3BP4A 3RWHA 1DBMH 2I26N 3MREB 3EYQD 5LGHL 2WBKA 3SE9H 4HS6A 4YPGA 5E8PB 4IBLT 3X11A 4ONHB 2ZCLH 3MROA 5DGRA 4AH2A 3O6ML 4JHWL 5DJ8A 3S35X 3L3HB 3KYOA 4GT7A 2XKNA 1MVUB 1QFWL 3EDJA 2AJVL 3PL6C 5EFIB 1XGPA 3TIEB 5JPNA 4YC2C 2ATPA 4WO4C 1XF2B 4J3UA 3BUYB 3PV6B 4LQFL 1JF6A 3LDBB 3BPLB 5KSAA 5D2LF 4E0RA 2XTLA 2NR6D 3QH3B 3TCLA 3P77B 3VFPB 5ITFA 3P73B 4TTGA 3PP4L 2O5YH 1XZ0B 1RUMH 5K9OA 4IRZL 2WUBH 5DEFA 3F58L 3WXWH 1A7RH 1J0YA 1NDMA 1P2CA 4OQTH 3D25B 3ARTA 3NPSC 1NMBH 4Q0XH 3ME0A 4HT1H 4CAGA 4Z78A 2I60L 5BO1H 4AEHH 5IHLB 1DDHA 3RWIB 3U2SA 5TDPB 3WUWB 3AB0C 4UU9A 1G6RA 4FQHB 1FORH 2UUDH 4M61B 4YIQA 3MBXH 4XX1E 2EYRB 3QQ4B 5C08A 3KLDA 1PYWA 2A1WL 2F19H 4LLAA 4ZFOB 1OB1A 3A0OA 1YMMD 4ESKA 4PRIE 2QSQA 4UT7H 4QCIB 4IJ3C 5IW6B 25C8H 3EYUH 4JG0H 5IQ7H 4R2GB 2CMRH 5EB9A 4F15B 5HVWA 3SGEH 5DRZA 1FZKA 2MJWA 4XMPL 2LTQC 5B8CB 3MNZA 4YX2L 5FM5M 5AWNL 5IFAL 4QRTA 3N9GH 4OJFH 4M1DH 4MX7A 5DFVC 4JY4A 4QHUB 4PJXF 4D0DA 1E4WH 4WTWA 2EECA 3PIQB 3FO1B 4H26B 4MB4A 3TBSB 5EIIA 4OLXH 3DURB 3GSRA 3QO0A 1MHEB 2NX5D 1Z3GL 2EKSB 1BOYA 4K2UL 3U6RB 4HPOH 4FQ1H 2VLRD 4M4RA 1BGXL 1KGCE 4ZTOH 2X1QA 3Q1SL 3KPLA 5KTEL 5E5MB 3TNNA 3O45B 4ZUSA 2CKBL 4DTGL 3QRGH 1CLYL 3D69A 3MRJA 1GGIH 1TENA 5FKAA 4Q9RL 4HV8B 1K2DB 2A74B 3RNKB 3CD4A 3PWPD 1CK0H 3IAGC 5CSZB 3IXTB 1A3LH 2PW1B 4QT5A 3F7YA 4MD0A 4X7TA 3PWNB 1KLGA 3V6ZB 1F3JB 4P5MA 3CU1A 4EDXB 5KSVB 3P9LB 5E94B 3QA3B 3HE7B 2Z31B 1ZHLB 1JFQL 3K2UH 2DQIL 3JV6B 4L4TD 3UPRB 3MV8A 1YA5A 2ZUQB 4K7PH 2OQJA 3LH2H 4GQ9H 4P46D 3BGFC 5ILTH 2VIRB 1G1CA 5IQ9B 1YMME 4LVNB 3I2CH 3QIWB 1QNZL 5ICXA 4PGBB 5KW9H 2OI9A 4LIQL 5KZCB 2QR0B 4WFHD 4QWWD 1I9JH 4XP1H 4LPXA 3CFIC 1MRCL 1QA9A 3WLBA 3QDAA 4F3FA 2FJHB 3Q3GA 2VLLB 3CUPA 4EDWL 5DJ6A 3RX5A 2WMPA 4O51B 2RHEA 2VLJA 5D1QB 4F58L 4FFYL 4GRWE 2B7DT 5C0DA 4BUGA 4LRNL 4YR6A 1A7NH 3UYPA 3MRHA 1CT8A 5FM4A 1CGXA 1IAIH 3B9KA 3ESVF 2NX5E 5FYLL 3LPGA 2FGZA 3G5XB 2A83B 2N4IA 4XPFL 4GRLD 2ZWLT 5T3ZD 1IE5A 5DHVH 3GMQB 2VLRE 1MAMH 1GOFA 5TFSL 3VFGH 1JPSL 1T0MB 5D1XD 2D7PA 2AJ3A 1SVCP 3VFVB 3ZT5A 4I3SL 5HVHB 5C71A 2F53D 4MSWA 5LGHH 2VXVL 1OSZA 3TCXA 1WLHA 4DOHE 1XF5A 3O6MH 4JHWH 5I1EL 4I0CC 3FCTB 4M9OA 2FBOJ 1C16A 3QNYB 4OKDA 5IBTH 4NKMB 4P46C 1QFWH 3EYFA 2J5LC 1BZ9A 2AJVH 1KIPA 3JTSB 4HUKB 4CMMA 4KQ3L 4BELD 1INQB 3WDJA 5DVKA 2VNCA 2C3XA 3DRTB 1OT2A 4LDEB 5E99L 1OP3K 1NFDA 5JHDB 4N8PA 1P4IL 2W0KA 4QWWC 3ULVL 3VFWA 1LWRA 3WYRA 4WEMB 4DFHA 2VR5A 3WS6A 2QBWA 1MIEL 3A67L 3RVUC 4DKDC 1IAKA 5E08L 1LK2A 4ZQKB 2NXYC 2HLAA 3W5MA 4QXTB 3PP4H 2VITA 5C0AB 1G84A 2UWEB 1VGKA 4P48A 4IRZH 4JZOA 1PKQE 1JRHI 4WFHE 1BP3B 3F58H 5F6IC 2DJUA 5FGCB 1YEEL 2GI7A 5A3IC 3MGOB 4GRLC 3BGMA 3HS0B 1I7ZA 2E6QA 3GNML 4WWKB 4LKXA 5JZ7C 2NW3A 2I60H 32C2A 5SWSB 5FYJD 4TUJB 5F7HA 1FL5A 1NMAL 3PUCA 4Q6IB 5DEZA 2IJ0C 1FAIL 3GRWA 3VXMD 5T3ZE 4G59A 3H42L 1T1XA 2A1WH 3RUGA 5HYQA 4I77L 4YO0A 3QUYB 4ZPVA 5AG9A 1EO5A 1NCNA 2R2BA 3P3YA 4KXZH 5FA3B 2F53E 4J7RA 1NAMA 4KMTH 3MJ9A 4RQQB 3LEXB 1OGAA 4G6FB 5CD5D 2V7HB 4NQSA 5GGUB 1AE6L 5IHZA 2ZUVA 4XMPH 3UX9B 4YUEL 1C7TA 2JIXD 4YX2H 4XCYB 4G3YH 1II4E 4OCNC 5AWNH 4HBQA 3IDNA 5JOFA 3DVNB 3O3AA 2PXYD 5IMKB 4KRPD 1H8SA 2R2HA 3KGRA 1LO5A 1Z3GH 2FZ3A 5F89B 2EE9A 4ORGA 4K2UH 1CGUA 3I84A 3RPKA 2Q7YB 1I1YA 1BGXH 3IRZA 1G7HA 2CO7B 5DMGC 4LGPB 4JFFB 4WFFD 3Q1SH 5EU6B 5DK2B 5KTEH 2NYYC 4NDMB 4XWGL 2CKBH 5FAAA 4DTGH 2EDJA 3MRKB 3SE3A 2VDOH 1CLYH 3G6AA 3LRGA 1ZT1A 2DM4A 4N90D 3SKOA 2BY1A 3AFLA 4LCUB 5D6CA 4Q9RH 4UAOC 3UO1H 5IVXA 4TN9A 2C3WA 2PW2A 3VDBA 4U6VL 5FUOL 1AQDA 2RB8A 4H1LA 1KTLB 5DHYB 2KKQA 1HOCB 1PKOA 3QI9A 5DUPL 5FYJE 5I8KL 4M3JA 2R0WL 3TM6A 1JFQH 1N59B 3VD9A 2DQIH 5CD5C 3GIVB 3JTTA 1MLBA 3VXME 1QACA 3QULB 2SEBB 4JAMA 1X5GA 3OAYH 5DS8B 2AXGB 2R1XB 5GS0H 2PXYC 1RZ7H 1QNZH 4KRPC 4CADA 2NQCA 4JN2A 4LIQH 5DWUL 4LMQE 3H9SD 1A4JB 3IETA 1MRCH 3ILPA 5KVFL 1R3KB 2H6PA 1AJ7L 1JUFA 3MLWL 3QIBD 5J13C 2CIKB 2GK0A 4TRPL 3ARUA 1WFUA 1EXUA 2PO6A 4LRIA 1KJ2A 4IIQA 1NGZA 4MQTB 4P4KA 4FFYH 1YEDA 1KIRB 1G7QA 4IOIA 4LRNH 4WI2A 2YZ1A 1YUHA 3OKKB 5HJ3A 1IL1A 1GJIA 3ZKMD 1I3VA 3O0RL 2BP3A 4AY0A 3MR9B 3BWUC 1CYGA 1IKNA 1MLCA 3MV01 3V6OA 4AT6B 4XPFH 3I6GB 4HJGA 1EGJA 4XVSL 1WBYA 1FV1A 4X8JA 3EW3B 1DQDL 5TFSH 1JPSH 2ZSWA 4HX1B 4OTXH 4WFFE 5F7LB 3HA0A 3NZHL 3T0VA 4I3SH 3TIDB 1LEIA 5E6YA 4OLWL 4KI5F 1P5UA 2BNUB 3H0TA 4KUCD 4NHUB 3TFKD 5I1EH 4N90E 1FCGA 5ADOL 1L0QA 4HUUB 1O7SA 1J5OL 2C4XA 3EFFA 2DMBA 4N0CD 2OR8A 5IEKB 2J6EA 1T7ZA 4PGEB 4PGZA 1B4JL 3IDGB 2CK0L 3WIFA 1MSPA 4LCWA 4WGVB 5E99H 1PFCA 1P4IH 4NQTA 4CN4A 5DD1L 3H2WA 4XRCB 1NDGB 1JV5A 2ICES 4KDWA 1MIEH 3A67H 1NJ9B 1T22B 3RNQB 5E08H 2UYLA 4ZO9A 3G5VB 4CW1A 3RWCB 3ULUD 4L8DA 2NY0C 2CRIA 1U8MB 4W68A 3ZKMC 5DMIH 3ECBB 1MRDL 4M7ZC 4XBPA 5EWIL 3C87A 3H9SE 3ARBD 3ARGC 4QRUB 4P9HL 2YOCA 1NGXB 1BJ8A 1YEEH 3MRCA 4LSUL 4I5BA 4RNRA 5FUZL 4N8VG 3GNMH 5IVOA 3S5LA 3PGDB 5IB2B 2R2CA 4U1GB 4WGWB 2Z93B 3TBYA 4MA3A 1F6LL 2WIMA 4X6EA 1NGWB 4YAQB 1V3JA 1S9WA 3F65A 1LGVA 5E6ZA 4JFEA 1L9MA 3QUKB 1NMAH 2X7LB 3FQUA 5KVDL 1IMHC 4H25B 4TSBH 5DMYA 1FAIH 3TFKC 1JE6A 4L3EB 3H42H 2DM2A 1BX2A 2AJZB 3DV4A 4M5YL 3HI1A 2X1WL 4YXHL 1JFMA 2AGJL 3AY4C 4WFED 3BPCB 5C1MB 4N0CC 5KSBB 5C70A 4UINL 5IKCA 3RZWA 1AE6H 2XFXA 3C5ZB 3MV7B 1NUNB 3D0LA 4FOMA 4M93C 3X13A 4YUEH 5FKPB 1A7BA 5M7QA 2YC1B 4DZBA 4P5TD 1IEAB 5BW7C 3SGDI 1GYAA 2X9YA 3N0PB 3MYJB 3SGJC 1BVLB 1H3WM 5C6WH 5CEXB 3EAKA 1QSFA 2MSPA 4HG4K 2P48B 2ZJSL 3ULUC 1BQHG 1KB5B 3SE4C 3MJ8B 3ARBC 4UQ3A 5I9QC 4Y5XC 4X98A 5GS2H 3VE0A 1ES0A 1MFCH 4APQA 3EJZD 4EI6A 2Y6SD 2Q3AA 2HRPL 4HLZH 4S11A 4TUOA 1RZ8A 4RRPA 1EJOL 4D0BA 1C12A 1FYHB 4E9LA 3EOBA 3VWKB 3ULUE 4G8EA 5D7JA 1HN1A 3RL2A 1L7IL 5B39B 4PJ5D 1JCKA 3K0WA 2DMCA 4NM8L 2R4SL 1JGDB 5E8DH 2HFTA 3F7PC 5DZOA 3KPRB 4HGMA 4U6VH 4RFOL 5BZDB 5FUOH 5GGTH 3VU2A 3GSNL 1Q0YH 3NA9L 1SEQL 2OP4L 3SDCD 5DUPH 5I8KH 2R0WH 2WANA 1MHHA 5DRNA 3NFNA 1YMHA 3UXFA 5JO5A 3LPWA 4UOJA 4X6DF 4QOKD 1EHAA 1ZTXL 4G8GD 2EXWD 2ZKHL 4P5TC 1MEXH 2FWOB 3IDJA 4WFEE 1LNUA 2B1HL 4QRPB 1E28B 1F13A 1U3JA 2V2WA 1JZ3A 5CWSA 4ELKB 1OW0C 5DWUH 4N5EA 2BVQA 2QKIB 3CMOL 4JANB 1R6VA 5D71L 5KVFH 2M1KA 2QHRH 5IR1B 1AJ7H 1LILA 3MLWH 3E3QC 1RJCA 2ESVD 4J4PA 1KENL 1ZEAL 4FQLH 3FFDA 2Q8BL 3WS3A 1J0ZA 5LWYL 4PJBA 2K1MA 2NZIA 4RBPH 4NN7C 1NBZB 3CDGB 3O0RH 3CSBA 4KRMB 3SGKC 4Z7QE 3BMVA 1FSKC 1U92A 1QR1B 2GUOB 3CH1A 3ZHLA 3E3QE 4XVSH 5ERWA 4QF1A 4GAYB 1NCDL 4IRSB 1DQDH 2Z35B 4NSKA 2AJXH 3IGAA 4V2BA 3NZHH 5IVZB 1AP2A 1WFOA 1OLLA 3IDXL 4U6XB 4OLWH 4Z7WB 2BY2A 4PJ5E 2QV2A 4HKZB 4OFPA 2H26A 2Y4SA 3CSYA 3K8LA 4OD2B 5ADOH 4NN6C 4DZ8B 2EXWC 5KVGH 3W2DL 1J5OH 3MJ7A 5EZJB 2WLZA 1B4JH 2D2OA 3HZYB 4R96B 3GGWB 2FGWL 4JO2H 1DZBA 3EIFA 5HVGB 4PBXA 3GJFH 1XF1A 4L4JA 4QOKE 4C4KT 3G9AB 5D7KD 3U0TA 4LSQL 2HRLA 4G8GE 5JW4R 5CBEB 3QCUL 3IFNL 5L7XL 2UZYB 2OXGA 2Z4QB 3BX7C 3D2UD 5FYKL 1H8OA 3PDGA 1WTGT 4B50A 4I3GA 3R4DA 3WNLA 3KPSD 3GM0A 1XCTA 2P44B 4OGAD 5HGHA 1TCRB 3WNMA 1EFXB 5EWIH 2NY5C 4P9HH 5CMAB 1M7XA 3L3IB 3LKQB 5HI5C 4XGZA 4LSUH 4JZNB 1UADC 3BWAB 2ESVE 2H8PA 3CXDL 5DF0A 5FUZH 4W70A 1SHMA 1K4CA 3RY6C 3KLAA 1I1AB 2HFGH 4HIIA 4PJGA 1PG7W 1EEQA 4X6CB 3FB5A 2XWJA 1KEMH 1WBZA 2R1YA 5KVDH 5FHBL 3V95A 3UTPD 2AERT 4BQ6A 1XGTB 4PY8I 2VDPL 1DE4B 4XHJC 1UQSB 1C1EL 1RJYB 4M5YH 4CN1A 2W1NA 3TA3C 4AJ0A 4YXHH 2AGJH 2XG5A 1S7SB 5DC4B 2O61A 1ORQA 4HGWB 2ICEB 3EO1B 4UINH 3MACH 4UV7L 2C3VB 4ONFH 4YLQT 1CF8L 3QZWB 3BEVB 5C07A 4P2QD 1ZHKA 1PSKL 2FJGA 3FB7A 1BFVL 1C7SA 5CD3B 5MEOA 2V17L 2EEDA 2ZJSH 5I76A 1RZIB 4Y4KB 2Z91A 3B3IA 1A6PA 4CVUA 3G08B 1HI6A 3VRJB 1LO3L 4DCQA 1T5XA 2EIZA 2DIAA 4AMKL 1EJOH 5IB4B 3O6KL 4Y1AB 1CI5A 3KPSE 4AM0B 5FGSA 3O8XC 2ZPKL 1NC4B 4D9RE 2YWZA 4L9LC 3NIGF 4FZ8L 5BVJA 4NM8H 2R4SH 3FO9B 4R7NB 3FQXB 3G6JB 3QO1A 4TNVF 4ELMB 5E5RB 4LF3B 4GKZA 5GPRA 3ET9F 4RFOH 2WBJA 4J1UB 4JPWL 5T1MB 3RTQA 3IS0X 3MBEA 2XOTA 3MFGB 5AAMA 3BRFA 4Y5VC 3GSNH 4OLZL 1SEQH 3AXLB 2OP4H 5L9DL 6FABL 4ZNEE 1KCUL 3D48R 1SJEA 1E4KC 2CUIA 4Z5RB 3UBXI 1ZTXH 3BFOA 3JWNC 5CCKL 2ZKHH 3ROOB 1S7UB 2XWBB 1CGYA 2IF7A 4MYWB 1CU4H 4N0YH 1IC5H 4PJ7F 3CMOH 1E27B 5D71H 3KXFD 3D9AL 3VGAB 2LU4A 1ZT4B 4XCFL 1HEZB 1ZEAH 4P2QE 5BQ7A 5E24E 1SEBB 4LEOB 2Q8BH 1T2JA 1HWGB 5LWYH 4G8IB 5HI3D 1R3LB 3BKYL 2IBBA 4MXQD 2CDGB 3C60B 3FOLB 5HPMA 1KXVC 1R5IB 3WN5B 5JQHC 3REVB 4PRPA 3HZVB 4L29B 2RR3A 3LKSB 4Y5YB 5SWZB 3VRIA 3GSWB 1NCDH 4NRXA 4HIEA 4F7EB 4IDJH 4R7DA 2JB5H 1YECL 3E2HC 3VGEA 1CDJA 1GIGL 4PJCE 1DEEB 5D6DC 1FJ1B 3L3OA 3I6LD 1VGEL 1FGVL 5IUSA 5H37G 1XGUB 2CIIA 3W2DH 3VXRD 3JVGC 4KKCD 3RPIB 4BUHA 5F9OH 3RWGA 1IEHA 2NTFA 1PJ9A 1WAAE 3D85D 1ZVSA 1QRND 3U7YH 4P23C 2Y72A 1AGFA 1LD9B 5HY9A 4KRNA 5FYJL 3TBVA 4P57B 4Z0XA 5I6XB 2P5EA 4MCZB 4S1RL 3L7EA 5LVEA 4LNVA 1BEYL 3QCUH 1MCFA 3IFNH 1HILB 4ODBD 3G5YA 5L7XH 1CFQB 3UTZA 4PJIE 4LSRL 4GG6B 4XNMB 4P49A 5DJZB 5F70A 2IBZX 3H9YA 4Y19D 1ZHBA 3BPNB 3VA2C 2R1WA 3QEQD 4PP1D 5C0BA 3WJLC 3KXFE 3C2SA 1I8IB 1LEGA 3TBTB 1R3JA 1JTOA 4XHQA 3OXSA 5TGBB 5AUMA 3T77B 5CJBA 5GZND 2YUZA 2QSVA 1IEBB 1F4AA 1P84K 5ID0B 1KCGC 4LLYA 1T0NB 5ID1A 4P2YA 2GJ6A 2JJTA 3ZTJG 3UTQB 5FHBH 4M00A 1MFDL 1Z5LB 2EDQA 4RCAA 1JPGB 1JI1A 2VDPH 5GZOD 4L1HA 1FO0H 1C1EH 3ZHKA 3KHQA 4WCYL 3NN8A 1I8KA 3GMRA 5HGBB 4KKCC 3NCBB 3U9PH 1LDSA 2X1OA 3GRWL 2FX7L 4F7PB 4UV7H 3PL6B 4JKKA 1Q9KB 1RZGA 4P5KB 4YC2B 4OCYH 2WBWB 4XPAL 5F3BB 2FEEL 4L3CA 5HDQL 3VXRE 1EERB 1PSKH 2V7NA 1BFVH 1KPVB 5IM7A 3DX7B 2V17H 4OIAA 1IM9A 1QQDA 4GAFB 1F6FB 1NCAL 1QRNE 3W9EA 3KLSA 5ACLA 3IAQA 4L9DA 3K2MC 4KI5C 4PP1C 3T0AA 1LO3H 5KBNC 3ELAT 2OSLB 4D8PB 3EOAB 1GXEA 2D7OA 1U8KA 2AV7B 1KIQA 3F6LA 4I9WD 4TULH 2NNAB 1HH6A 4AMKH 2VISB 4WI4A 3O6KH 4Y0GA 4RMTA 4Y19E 1RZKC 3HG1A 4M43H 5H94B 2BNQA 2DQTH 4PJHA 1JYNA 2ZPKH 4PRIB 3QEQE 4LLQB 4KI5E 2FIKA 4FZ8H 4HWEH 2XWTB 4K3EH 1FZMA 1JWSB 1O0VA 3AB0B 1YN6A 2IWGA 3HAEG 3BZEB 2VLKA 4JLRB 5E6ID 2H9GB 1S7TB 1EZVX 2DWEA 1HHIB 2BVOA 4OLZH 4NNXA 6FABH 1P4BL 1KCUH 1G7LB 4U1SB 3EHBD 3L5WB 4GRMA 4QHMB 4ZO7A 4G6KL 1PQZA 4YH6A 1GGBL 3MYZA 1Q1JL 1AGBA 1J87A 5CCKH 4RX4D 5AZ2L 1ITCA 1QVOA 5DJ2A 3EYVB 2LTQB 1S5IL 4JO4L 3RY5A 5T3ZH 3TT3L 4K3JL 3T8XA 3TBWB 1H3VA 1U3HC 1ZWIA 3PXJA 3QDGD 2YBRA 4XC3L 3D9AH 2E6JA 4HXBL 3BJ91 4XCFH 2IPKB 4JFYB 4F37K 1A5FL 2IH1A 5JQ6L 3BKYH 2DN7A 5HI4C 3KPNA 3VH8G 1CDUA 3VXUD 1MJ8L 4LPUA 3LRHA 3V5DA 5E70A 4XMKH 5F7MC 5GRZA 2QSTA 3MNVA 4X5WB 3GKWL 1U42A 4NM4H 4ZMAT 1X5HA 1A7QL 1OCWL 2NY3C 4MQSB 4DGYL 1ZGLB 4DKFL 1GSMA 3ZKNC 1BAFL 4I9WE 4DUWA 2V5RA 2MPAL 3KPQB 2KL6A 4YNYB 1EGJL 3PWVB 1YMMB 4YHNB 3WSQL 3EHBC 4XC1L 4ZO6A 4NC1C 3U1SL 2J4WL 3FONA 1FGVH 3JV5A 1Q0XL 1OPGL 2EYTA 1C5CL 3HCVA 5E1AA 3PP3K 4LLMB 4YHZH 2KZWA 4JZJB 3DX9A 1AIFA 5DUBA 1X9QA 3BGFB 4MDJB 1MCJA 4FTVA 1T3FA 3V5HA 4JFPA 4UT6H 3MRMA 4GRWB 3QWRA 4LHUG 4LVOC 2NTSP 4NC1E 4OUUB 2VL4A 5FYJH 3ZDXF 3U4AA 1XGQB 4S1RH 2J6EL 5KJRL 4K3GA 2X05A 1FO0B 2A73A 4O5LH 2NX5B 4LSRH 4HIJB 1AFVL 4LCCA 2PCPA 5KSAD 2XTJC 4BZ2L 5IWLA 4MDIA 2VLRB 3DROA 4Q6YA 4KDTC 1QSEE 1CXIA 3CVHL 3KPMA 5E56A 1UJ3A 4NO3B 3UJIL 3FB8B 4I0PD 3Q5TA 1SYVB 5T1LD 4OFIA 4DOHB 2YPLA 4HLJA 3G5ZB 1ETZB 3QT2A 1KNOB 4O58L 5C0CA 3PWPB 2GFBA 3B6SB 4C55A 3CNKA 1VCAA 5BV7C 1K5NA 4Z18A 2LAAA 1CFBA 2HA1A 4UI2A 1MFDH 4NGHL 2C4FT 2FSEA 4WJ5B 4X6DE 5HYEA 4PR5B 2X4QA 4WCYH 1BJMA 4L4TB 3AS2A 3ZMRA 1AI1L 4K3DL 4PUBL 3K1DA 5EBMB 5IOPA 5C08D 2HT3D 4ZYKA 2FX7H 3DVIA 3OJDB 4P46B 2AKRA 3FFCA 2BDNL 3MA7A 4UDUA 5DYOA 4G7VL 2DICA 3LKPB 5J9PB 3DI3B 1B4RA 3KWWB 2Y7QB 3OAYK 4XPAH 3VXPA 5J6GB 1P5VA 4F7MA 2K7QA 1S7RB 1Y18B 1PKQB 1PZ5A 5HDQH 3OR6B 5L2JA 5C9JA 5HDLA 4HUNB 5D7LA 3IFPB 4PRNB 1BQHB 4CVWA 4CDGC 2LU7A 4OFDA 4POUB 4IRJC 2ZCHL 1JGEB 1W0WB 2F5BL 5F1NB 3IDMA 1A9BB 3JWDL 2E3VA 4I0PC 4FP8L 3CLEL 3H7LA 3UROR 2G9HB 1VACB 4JO3L 3HC3L 3SDAA 3OF6A 5DK0A 4GRLB 1V3KA 4GS7C 2D31A 5CEYB 3QQ3A 1JNHA 4KVNL 2EDYA 1QO3A 2C3HA 4BSWA 3DVFA 4NRYA 5FDWA 1HXYB 3MUZ1 1QR4A 2F53B 5JXEC 2VABA 4ENED 3I6KB 3MRFA 2Y23A 2GKIA 5IHUH 5CZKA 4J3SA 3PHOB 5FO8A 3I02A 4WHYG 3TJHD 5JOPD 1H5BA 3Q5YA 3E6HA 2HT3C 1P4BH 3S97C 5JA9A 1D5XB 1C08B 5ANMA 4G6KH 1GGBH 2F74B 2VXTL 4H1LH 5FYKU 2NY5L 4EUPG 1M7DA 4MXVF 1D9KA 1ZOXA 1V05A 3DRQB 4YHOL 5EO0B 1S5IH 4JO4H 4NJAL 3TT3H 2WINB 4K3JH 5C08E 3WIHA 1F2XK 1H15A 1T20B 1J05B 3FRUB 2B39A 1X44A 4X80L 5CP3H 3DV6B 2D0HA 4HXBH 4OUOA 4BZ1L 5IB3A 1RIVH 5C86A 4L8CB 4XP4L 3IU4L 1WZ1L 1TITA 3M17B 3MRQA 1JRHL 5JQ6H 1AC0A 4JGJA 5F7DB 1A1NB 3SO3C 1B0GA 2JK5A 3FO2A 1UKSA 3LVEA 4BJLA 3WE6A 2NY2D 3KPOA 3FHQA 1MCHA 3GKWH 4L4VA 2DWDA 3B9KD 1A7QH 4ENEC 1OCWH 4DGYH 3VG9B 5MERA 1BAFH 2BHZA 3C8KB 3MFFA 4UAOB 3VXMB 2P43B 2ERJC 3TJHC 4HUXB 2IADA 3GSXA 1GGUA 4OZFG 2NY1D 3R0NA 3PWUA 1RULL 1IM3A 2ZZUT 4JPIB 5LG1A 3WSQH 2VLMD 4ODTL 4OBRA 4XC1H 5E2WL 3VFRA 2BJMH 4MMXC 3U1SH 3TF7A 2J4WH 4U2YA 4Z7VA 4JDVB 1Q0XH 1OPGH 1VFBA 4GBXA 1YEJH 4TVPD 2WP3O 1C5CH 1KIUA 1U93A 3SCMC 4OKVB 3B4NA 5JOPE 3D5OF 1IC1A 1XFPA 4IOFD 2JIXB 4WNQB 5JTWA 4MNGE 1KACB 1KJMB 3VW3L 3CSPA 1CN4A 2PXYB 3DETC 1FNLA 4KRPB 5EZLA 1D5BA 2I07B 1Y6NR 1JNJA 2UV3A 2F5AL 4QRSA 5KJRH 3S8WA 1CG9A 1ZVHA 4KKLD 1IGJB 2P46B 1JGVL 5DJCB 3AU1A 4U0RC 1IKFL 5CEZD 3RJDA 4PRHA 4W4OC 5EPMA 5J13B 2JB6A 4BZ2H 4BFGA 1EUUA 1L6XA 2CLRB 3CVHH 5BXFA 3FT4A 3E6FB 3UJIH 5DURD 2NY2C 1N8ZA 4JRWA 5CIPH 4MB5A 4QNPF 4WHTB 2GTWB 5D4QA 2P1YA 3FMGL 3H9HA 4WU5B 4O58H 2GITA 4PJAA 3ARRA 3KR3L 4NNYA 3UAJD 1G7IA 2P8LB 3BPOB 2NY1C 3EOTL 4ODVL 1MOEA 3O9WA 3RHWF 4XP9L 3M8OL 4NGHH 2ADFL 4N68A 5JDJA 1KB9J 1X5XA 4V1DA 4Z95L 5JPMB 1JF1B 3HPJA 4UDTB 1H3TA 1AI1H 4P2OA 4K3DH 3GI9H 4PUBH 3ZT7A 1UM5L 4U1KA 2BDNH 4P59L 5HBBA 2I9TA 1OSPL 2VLME 1CXHA 3OTTA 4JFDA 4PLKD 3FT2A 1G7JA 1OGAD 3HZKB 1BPVA 3AREA 5DI8B 3F7VB 3H9SB 3GSUA 2UZIL 4KKLC 3B83A 1FLRL 2EZ0C 3S3SA 4KROC 3DUSA 4EEEA 4IS6B 2ZCHH 4AENB 4NCC2 4ZPTA 2G5RA 1F4XL 1PW3A 4QHLA 3JV4B 3JWDH 4M7ZB 3TYFB 1NFDE 3H9ZA 3ARGB 4FP8H 3CLEH 5C0RL 3L3GA 5E5UB 4JO3H 3D18A 1EK3A 4KJWC 5CEZE 2UWEF 2GCYB 3L1OL 2IAMA 1F11A 4HS3A 1RJZB 2EDOA 4NYLA 3UAJC 2J8UE 4KVNH 4UILL 5CZXC 2CLZB 2LAGB 3BW9A 4G9DB 3NZ8B 4X4XB 1FHGA 4LLUA 1YYML 4KZDL 1TVBB 2YEZB 4J2XA 4QEGA 1GZPB 2VL5B 2VAAB 2ZUTA 4C56D 3N1FC 4BH8A 5FYJU 1KLUA 1TTGA 1HQRA 4YDJA 2VQ1B 4AZ8A 3RWFB 3R8QA 4KUZL 3GMMB 3MOAL 3QI9D 4PLKC 2NY5H 4OIBA 5EZOL 3C09C 3NA4A 5DJAB 4M7LL 2E7MA 4M93B 4YHOH 3T0BA 3MLZL 1QBAA 5JW3L 1EA9C 1NGPL 1KPUA 2ENSA 3GJFK 4JRYA 5J12C 1KYOJ 4GKSB 2MHAB 2E7LA 4XB8A 1F97A 1E4XL 3U30C 4BZ1H 2P7TA 3QDMA 2HJLB 5ELIA 4XP4H 3IU4H 1PLGL 1WZ1H 3ARBB 3MSPA 4GQPH 5I9QB 4ZFZA 2ZUUA 1JRHH 1NEZA 4J3VA 1ND0B 3BZFB 4PJDB 3O2DA 4N0FA 3RKDD 2PO6D 3HRZB 1A6UL 4LSVH 5J56B 4O2EA 1JP5A 3OB0K 2IH3B 2X09A 5DXWA 1UB6A 4LPCA 3LKNA 5GRUL 3REWB 1FP5A 2YS4A 3MRGA 1WFTA 3MNWA 4X5LA 1TVHB 3MLSL 4KK5D 3BQUD 2XI9A 2OM5A 4U1JB 1J1XL 2XY2A 4HKBB 5T5NF 3S96B 3VMNA 3QXWA 4OZIF 1MFNA 1VFAA 1RULH 2KDGA 3CZFB 4ODTH 1DSFL 4NC0B 2C1PB 3L5XL 3DBXB 3VMPA 3ARDA 1ZLSL 4G6AD 2GSGA 1UZ8A 3V0AC 3UDWA 4U1MA 1IAIM 3BKML 4C56E 4I18A 1LE5B 4P5TB 5C0JB 3VW3H 4JVPA 4NFDA 5FO7A 4KKBD 4MJ5B 1AGEB 3QJFB 2GEEA 3E8UL 1RZKL 2AJSH 2R0KH 1NCBL 2R23B 4PYHA 2F5AH 4LCWD 1F45A 4JN1H 2E7CA 5L88L 1JGVH 5EU4A 1IKFH 1FFNB 1BQSA 2Y06L 4X6BA 1IILE 4GO6B 4OZHA 3RKDC 2PO6C 2AV1B 3T3ME 2YHGA 5IF0A 1QFWM 4NN7B 4UUJB 4HUVB 43CAB 4XP6L 4M6NL 1FSKB 4OFYD 4PJ5B 4K07A 3H3KA 3FMGH 4FQXD 5FB8A 2BVPB 3QXDB 2HMID 1Q9LB 3JUYA 5JMRA 1FVCB 3KR3H 4KK5C 4NUJB 3BQUC 3MV9A 1FVEA 5BS0D 1OM3L 3RZCC 3HR5A 1T83A 3EOTH 4O2FB 4ODVH 4OQ1A 5DJDB 5GHWL 4XP9H 5LGJA 5IMLA 3SDCB 2ADFH 1PG7L 4PGCA 4Z95H 4JY5H 4DAGL 1C5BH 3EJYC 3VFUB 3MV11 4FRWA 3QEUB 4ODWB 2JLLA 3AROA 2KQNA 4QOKB 3CPLB 4OFVA 3KJ4C 1UM5H 5E8PA 5C0FB 2IMNA 5IBUG 5DA4A 4NN6B 4G8GB 1QP1A 3T0EC 5DEGB 3IB4A 4P59H 4KKBC 1OSPH 1Q9WB 4HSQA 5CLTA 1K3ZA 3SKUD 3WHXB 2EIDA 2Q1EA 5H2BB 5EFIA 1EMTL 4M1CC 3L95A 3TIEA 3DXAD 3WKMH 5AG8A 2UZIH 1X5AA 4ODXB 1FLRH 1T66C 1XF2A 3O2VL 2ZOKA 5D1ZD 4OF8A 3BUYA 3RVWD 4K23L 3PV6A 2ESVB 1OWRM 3DNKA 2C5DC 1IAMA 4GUPA 5JOEA 3JTCA 2HVJB 1F4XH 3QH3A 3P77A 3VFPA 4LCWE 4PTUB 1T2QL 4YBQD 1W8NA 1JK8A 2FEDD 5C0RH 2NCMA 5DJ0B 3VRLE 1T1WA 4MCYB 4FQXC 2HMIC 3L1OH 4APQD 4LLVB 3B2VL 1TIUA 4BFIB 1QSZA 4LFHD 4UILH 2CLVB 4WU7A 2ED9A 5DUMH 1BVKB 2HH0L 4P9ML 1YYMH 2C26A 3OZ9L 1F3RB 3TLRA 3IDUA 1XR9B 5I2IA 3RWIA 5I1AB 1HYSC 5TDPA 4BH7B 2W9DL 5I15L 2HKHL 4FQHA 1DUYB 4IOSD 5BS0E 4G42A 3CFDA 2HKFL 4KUZH 4ZFOA 3BIAX 3MOAH 4FQCL 4LCYA 3ZDXE 1A6TB 1WUNT 1FZOB 4QCIA 2MQ3A 4F9PC 5IW6A 1ITBB 1FVDA 3BYYA 4M7LH 3BZDA 3MLZH 1ZAGA 3S3JA 5D1ZC 1UH2A 1NGPH 4BQ8A 2NZ9C 5DR5H 5B8CA 2YD2A 2Z8VC 1MY5A 3D2UB 4DUXA 4ORZC 4OZ4A 5BV7L 4DKAA 1IC7L 1UB5B 3KPSB 4N5ED 4MWFB 4D3CL 1PLGH 3DXAE 1TNMA 7FABL 3PIQA 4NBZB 5HYJA 4HK0B 5EBGA 4H26A 3TBSA 3X14B 3DURA 1MHEA 5F1IB 3GKZA 2ZSVB 3QPXL 4H8WC 5HHMD 2EKSA 4ODSL 1A6UH 3HUJA 1B88A 5F1OB 3O3EA 5GRUH 1FYTA 3O45A 4L9LB 3THMH 5F88A 3T2QA 1J1XH 1NC2D 2AXFB 3BAEH 4HV8A 3RNKA 1G0YR 3OGOE 1S7QB 1DSFH 5CSZA 3UMTA 1WITA 1U36A 4ZUVB 3LDBC 3MQIA 3PWNA 5F44A 5GJSH 3V6ZA 4F80A 2R0LL 2VZ3A 3LKRA 3OKLB 1ZLSH 1YN7B 3PWJB 5E94A 5KSVA 1DLHA 4QY8A 3QA3A 3HE7A 2Z31A 1IJ9A 5IMOB 1ZHLA 3BKMH 4RZCA 3JV0A 5ECJE 3JV6A 5DRWB 5HXMA 4P2QB 4YHLH 2PTTA 4ODUB 5TE7H 2OLDA 2W60A 3SGDH 3E8UH 5GGSA 1RZKH 2VIRA 2WSKA 1NCBH 5IROC 5IQ9A 5EA0L 3BIKB 2VZVA 4FQIL 1Z0MA 3OHXA 1IGML 4QRRA 3S36L 5L88H 3RP1A 2Y06H 4LLDB 3IS1X 1D5MB 3DLQR 1F8TL 3PV7A 3ZL4L 1EPFA 4NZRL 2WIIB 3U46B 1K8IB 5I16B 1CGVA 2VLLA 2OK0L 4WY7L 4TOYL 2YN5A 1M05B 3PDOB 5EU3B 1Q9OB 3MRNA 3GBNL 4PJCB 4XP6H 4M6NH 3D39A 4ZAKD 2E6PA 3R06B 3I75A 5IW1A 4JCMA 1NLBL 1VDGA 4ZXBA 3S7GA 4AL8L 3S36X 5E7FA 2WWKT 2OTUB 5HHME 1OM3H 1RUQL 4QRQB 4F15C 5LXGL 1U58B 3GMQA 5KS9A 4PJBE 4H5SB 1T0MA 1K85A 1PG7H 2ZP0T 4KGLA 4YXLL 3H6JA 3VFVA 4AQOA 3P0GB 1JN6B 1BZQK 1IT9L 4ZODA 1YPZE 3RIFF 4Q9CA 4Z7WF 1M7IB 2DI8A 4R4BB 4ZSOA 1ZKAA 1D5IL 2NY6D 4GH7B 3FCTA 3VFSB 4C83B 4PJIB 4PTTB 2OR7A 1NAKL 1UJTA 3P0VL 4MAUL 4OQTA 5F9AC 1JMZA 3UC0L 2FH8A 2DBJA 3GBLA 5EO9B 2FH6A 2D03H 3ZDYE 1INQA 3RWEB 1BFSA 2BCKB 3DRTA 3QXVA 1MCDA 3KXFB 3O2VH 4HUWB 4AIXA 4K23H 5C07D 3BHBA 3KDMA 3VJ6A 1NUGA 2DKMA 1J88A 4QGYA 4R97C 5D7IA 1W8OA 3GSQB 3FT3B 2WWMD 3MRIB 4ZAKC 4JKPL 2UWEA 3W9DB 4R3SB 1NEUA 1I9IL 3IJHA 1WWWX 2FX9L 1CXLA 1S9VA 5K9KA 1L8JA 3NCYP 1QBML 1ZT7B 4Q97A 3B2VH 3V5KA 2AW2A 4PBVC 2AEQL 4KHTL 2BFVL 3MGOA 5AZEL 3BT2H 4FQ2L 5E8EA 2XRAL 2HH0H 4TUKL 3C6LD 2ZUQC 2YRLA 3EGSA 4WWKA 4P9MH 3VA6A 3OZ9H 3WO3B 1JJUA 3NCCB 3NACL 15C8H 5SWSA 3EYSL 3QIWC 2I5YL 4X6CF 2W9DH 5I15H 2HKHH 2XZQH 4Q6IA 4WW2B 2V2TB 2WBJD 3RTQD 3VXRB 2NY6C 3NFSL 1A2YA 4HBCL 4PJGE 2BZDA 4FQCH 4YHPB 3QUMB 4HZLA 3D85B 1AR1D 3WFEL 2EO1A 1W0VB 4Y4HD 3BO8B 4MD4B 1QRNB 5FA3A 2DF3A 1FG9C 5D1QC 2V7HA 2B4CL 4QTHB 4POZC 1Y6KR 4JREC 3SDXE 4H0IA 3IJSA 4MVBA 4XCYA 5TH2B 1CDCA 2FJFB 1K8DB 5SX5H 5BV7H 1IC7H 4Y19B 4D3CH 3C5JB 2E7HA 5HGDA 1SQ2N 1JPFB 3QEQB 7FABH 3VXOA 5JORA 1U91A 4QNPE 4JVUA 5IMMA 4KJYB 2X4NB 5HVHC 3QPXH 5F89A 4HDIA 2J88L 5C07E 5F7WC 4ODSH 3DMMA 3ZYJA 3O3UN 4ERSL 3ZHDA 1FDLL 3PGCB 5I1HL 2FLBT 3WFCL 2BC4B 4FFZH 4RISL 5IT2H 1WC7B 5DK2A 2RCSL 3C6LC 4NDMA 3S5LG 2A77H 4LOUC 4PRPD 3NFPB 3W39A 1I4FB 1ADQL 4OZFB 1G7PA 3LY6A 3SPVA 3K8KA 1RK0B 3G6JF 2GY5A 4ELMF 1A14L 1RIHH 2OJZL 5DZLA 5K33A 3U36B 2R0LH 1KTLA 4Y4HC 4E5XB 1Z6JT 2F8XC 3GMLB 5EULV 3QR2A 3HTLX 5BRZA 2JCCB 1B6UA 1N59A 3GIVA 3DO7B 1OTUC 5T5FL 1ODAA 3QULA 3VFOB 3QNXB 4WEUD 1E4JA 5DS8A 5DHVA 5EA0H 4MXWH 4FQIH 1IGMH 3S36H 4MGXA 4OD1L 2DL2A 4GW4B 2Z8RA 1A4JA 1F8TH 3ZL4H 1CL7I 4NZRH 1H3UA 3LOWA 1R3KA 1V8HA 5GRJL 2CIKA 2MNUA 3HNTL 2B2XL 2OK0H 4WY7H 5J1AB 4Q9BA 3SDDA 2I9LB 3GBNH 5A43C 5CLWA 1WQVT 3OKKA 1MHCB 2F15A 3QUYC 5B4MD 4UZGA 4RRPG 1DBBH 3S4SB 1NLBH 3MR9A 4AL8H 1MI5A 2D3VA 3I6GA 4Q2ZA 1Q72L 3EFDH 4HX1A 4U7SA 1OAYL 3U82B 1Y0LB 1FN4B 4TSCL 1ORSA 4AIZB 4YXLH 5EO1A 2GJ6D 1J8HA 3T65B 5E00B 1K3IA 5DC0A 5ITBL 4L5FH 4PRPE 3QUZA 4L8SC 2BNUA 1WFNA 4ZUUA 4PDCE 4X5XB 5EC2A 1HHJA 1RU9L 4NHUA 2QJDA 1X5YA 2BHUA 2YPKA 1F90L 1NAKH 3P0VH 5I66A 1IBGL 2NW2B 4MAUH 4JY6B 4KK8D 1NCUA 2D9CA 1QZ1A 4J3OC 3UC0H 5IEKA 4PGEA 4A6YB 1QSEB 3CDFA 2XT1B 3QDGB 1BM3H 2CDEB 3WL9A 4XRCA 1NDGA 5IJKA 2XV6B 1NJ9A 1T22A 3JXAA 4RGND 3RNQA 3TP4A 1N4XL 4B5EA 2X89A 1IM9D 4HXAL 4WI7A 2HFEB 3VXUB 1VFUA 2P49B 1Q8MA 4GG6F 4W81A 4JFFE 4JKPH 5F7YC 1U8MA 4G7YH 4XXCC 1I9IH 5B4MC 3ECBA 2FX9H 2A6DB 5D2NA 4FFVD 4X6DB 4QRUA 1QBMH 5ETUB 3S6CA 2HLFD 1BIHA 2V5YA 1XH3B 1CDBA 4U33A 4Z7UA 4KHTH 2BFVH 3L9RA 4OZIE 5AZEH 1MJ7L 4FQ2H 1OD9A 3PGDA 5IB2A 2XRAH 4TUKH 3CFJA 5BV7B 1GHFH 3L5HA 4UQ2B 2BNQD 5FCUL 1YY8A 3NACH 3RWHB 5ESAB 2WM0A 3EYSH 4M7KL 4IDLA 1H3GA 2I5YH 3QUKA 1ZMYA 1QD0A 4H25A 4HS6B 4YPGB 3LD8C 2VLKD 4AH2B 5DJ8B 2XQBL 3NFSH 4HBCH 2AJZA 1Z9LA 3V0VA 4KK8C 3WFEH 4FXLA 2GJ6E 5KSBA 3ARPA 2YXMA 1YNLL 1OAUL 2YSSA 1XGPB 2Y5TB 3MXVL 2B4CH 2PF6A 3BP7B 4S2SB 4NQEA 3MV7A 4RAHA 5EORL 4KAQL 2YC1A 4XCCL 4JM4H 1IEAA 1YQVL 3TYGL 4PGJA 1R24B 2ZNWA 1VERA 4RGNC 5KSAB 4LSDA 3MYJA 5LKNA 1X5LA 4S1QL 3ZSSA 4CJ0A 1MCRA 4IRJB 5FGBC 4UV4L 4U4BA 5LJYH 4HWNA 5ITFB 1MVFA 5A2KH 1KSRA 1AHWC 4K71C 3MJ8A 1MCNA 4I0PB 3TNMA 5T1LB 4ALAL 3NTCL 2EDKA 4ERSH 4RGNE 5I1HH 1FDLH 3WFCH 4RISH 1X5FA 2RCSH 2J1KA 3GIZL 3O2DL 3VWKA 5HYSA 2YRPA 2JE8A 5EUOA 1ADQH 3FQRA 5T3XL 5B39A 4IMKA 1FFPA 3TVMD 2MFNA 4PJEE 3TO4D 5CEZH 1G6RB 5B21A 1R5VB 5F97E 2OJZH 5C08B 3P4LA 4B41A 5BZDA 1PYWB 4RFNC 4PS4L 2BNQE 4PJHE 5FO9B 4OLUL 4Q58C 2OL3L 3PWLB 2HJKA 2YA2A 5T5FH 1A3RL 1MJUL 1CXKA 2A9NL 2VLKE 4WV1A 5E8OB 2EIEA 2BSED 3DUUA 3WDHA 5C0GB 3CX5J 3O4LA 2ICWA 3O6LL 4QRPA 4TSAL 4QRTB 4OD1H 1W0YT 4MX7B 1QLFB 4JY4B 5GSVB 4U1GC 2QKIA 1ZLUK 2MCPL 5EIIB 5IR1A 3GSRB 1IGIL 2WZPD 5GRJH 3V79C 3VDCA 3UBXB 2W59A 4GG8A 2B2XH 3STZB 4NQDE 2JJVA 1JTPA 5HHXL 4JFXB 3SO3B 4HGKC 4PRAA 1F42A 4HIXL 3KPLB 3CDGA 1KV3A 4ZUSB 3VXQB 5C3LD 1QR1A 1JWUA 2GUOA 1FQ9C 3TVMC 3MRJB 3TO4C 3VI3E 4GAYA 4IRSA 3WJJA 2ERJB 3C5ZC 4FXKB 5HD8D 1OAYH 4H88H 4ZNCD 3GB7A 4KRLB 4MNGB 4TSCH 1NUFA 4C57C 1XMWA 5CSGA 3F7YB 3CAFA 4MD0B 2DI9A 5DJYB 3CVIL 4OSUL 1KLGB 5ITBH 4QYOB 4U6XA 4P5MB 4Z7WA 5KN5B 1FC1A 3O6FC 5IBUB 5EN2B 5IHBA 1J0HA 3EOYG 1F90H 4JDZB 4OD2A 4NO0A 3ERYA 1IBGH 4H8WL 4DZ8A 1QBLH 4AIOA 4OM1L 5CINL 1D5ZB 3VD3A 4EQ3A 3UZEA 3QAZC 5EZJA 1OARL 3HZYA 4R96A 3GGWA 4GOSA 2EE3A 2IGFL 4DW2L 5L8LB 2PYED 4GRWF 4RAVA 4GW5A 5CBEA 1RZJC 4X7EC 5D7LD 2N7BA 2Z4QA 5JA8B 3CUPB 5ESQB 3BZ4B 2DD8L 1U95B 4JQXA 5K59E 4LARL 1TCRA 1WIOA 1AKJA 1EFXA 1PY4A 2AABL 2NY2B 3P30L 1UJ3C 2FHBA 3WNPA 5CMAA 3MRHB 1CT8B 4NO5B 3IFOB 3B9KB 3L3IA 3LKQA 1QEWA 4JZNA 3QFDB 1PGRB 4K9EL 5HD8C 3WIIL 1MCSA 4MHHG 4KKNA 1I1AA 2PETA 1HSBA 4PBWD 2NY1B 5FCUH 4WDIB 3EDEA 5FUCE 1P7QA 4M7KH 2OTWA 3DI2B 5C9KA 4G8FA 4OCSL 1BJ1J 1DE4A 1XF5B 1UQSA 2XQBH 3SY0B 1FBIL 1RJYA 4HK3N 5CBAB 5H35B 3QQ9D 4I2XA 5IESL 2Y36L 1BVZA 3HHRB 3CFKB 3HMWH 1KIPB 1YNLH 1OAUH 3EO1A 4MNHA 3MXVH 1OAZL 2P4AB 2W65B 5LAXA 1QPPA 1BBDH 1R3IL 1NFDB 4P2RA 4Y16D 3OJMB 4KAQH 3QZWA 3F6IA 4XCCH 3VWJD 3VFWB 1YQVH 2YD9A 3TYGH 3HFML 1IAKB 4S1QH 5CD3A 1LK2B 4UV4H 4WHCA 5GGTA 2J8UB 4HW6A 2G5BB 3STBA 5DURB 1VGKB 5I0ZA 4FMFA 1UWXK 2PYEE 4NUGL 3KLHD 4ALAH 1JHTB 3Q6FA 4Y89A 5MP6L 5TF0A 2KUTA 1DBAH 5IGXL 4MJ6A 5D7LE 4XI5D 3FTGA 3BGMB 5GS1C 1I7ZB 4PJFE 2EXYC 5IB4A 3GIZH 2FIRT 2FB4L 4AM0A 1J1OL 1CICA 4LKXB 4X0KA 32C2B 2APTA 5T3XH 1MCKA 4NJ9H 1NC4A 4L4VD 2P8MA 2VKWA 5I8CB 3FQXA 1MJJA 4ELMA 1MHPH 3P4MA 4LF3A 5AD0B 4J1UA 4PS4H 1JWMA 3RDTA 4OLUH 7CGTA 2OL3H 1I7UB 4U3CA 4PRBB 5IIEA 1L9NA 1A3RH 4GBXD 1OGAB 1MJUH 4HF5H 4Y16C 3BKJL 3LN9A 2X44D 3MLVL 3VWJC 2PR4L 4PJ8D 1I85A 1T04A 2XWBA 5CJQH 5GSRA 3ARFA 4ETYA 2D7TL 2NY7L 5GJTL 3IDNB 3O6LH 1WVZA 4TSAH 3O3AB 1N5AB 2XG4A 4KI1A 3IDYB 1UXWB 2R2HB 1TJHL 4FMKA 2FO1A 4M7LT 2MCPH 3SKNB 1X5ZA 5ISZD 3TZVD 1LO5B 1KN4L 5E2TL 1IGIH 2BHYA 1ZT4A 4PRHD 1HEZA 1BHGA 1SEBA 3FHAA 3SE9L 4XI5C 3I3BA 4NKOA 3BIBX 4HIXH 4X8XA 3C60A 3OBAA 1UM4H 1CIDA 3REVA 1CDYA 3HZVA 3GJFA 4PPTA 4Y5YA 3CLFL 5SWZA 3GSWA 3TV3H 4JFOB 3U9UA 5D6CB 4C56B 4CBPA 4F7EA 4PY7B 4HC1L 2PW2B 4UNUA 1WWAX 5EIVA 4HCRL 1TFHA 3O9WD 2HTLD 2CUHA 4MA1C 4CGTA 1DEEA 4V1DD 4L4VE 1KUMA 1CQYA 1DUZB 4Y4KC 4NZUL 1A1OB 3JTTB 3ALWA 1OF2A 1XGUA 2VERN 4P2OD 4H8WH 3QUXD 3TESA 2HG5A 4PJ8C 4OM1H 5CINH 1N5YH 2FCBA 3RPIA 1OARH 5FECA 1ZLWH 4XT1C 4CADB 1E6JL 4R0LA 3WXWL 1A7RL 4DFIA 2IGFH 4DW2H 1XF3A 2BERA 1YC8A 1ONQA 3ARED 3TZVC 3IETB 5CJ8A 1NMBL 1DBJL 1WT5C 1JUFB 1HILA 4AEHL 2GK0B 2UZXB 2APBA 4QHNB 5DJZA 1CQKA 2DD8H 2EDWA 1DQLL 1EXUB 2PO6B 5E2JA 1KJ2B 1NGZB 4IOIB 5I0DA 3MBXL 4PLNC 2AABH 3MRLB 1YUHB 5HJ3B 3P30H 4GMTL 1RUPL 5ISZE 3S37L 4JQVC 1I8IA 3TBTA 3O81A 3WBDA 1XIWD 3PJSB 3SBWC 2ADGA 2A38A 3RJQB 1A64A 4K9EH 4PRHE 4YZFE 4G9FA 4HJGB 1V5JA 2D7MA 4XCNA 1WBYB 3EYUL 2IAMD 3T77A 3WIIH 1FV1B 1S7XA 3BQUB 4X8JB 3Q5OA 5AEAA 4S10A 1IEBA 2ZSWB 3RZCB 1EIBA 5ID0A 3HN3A 3BKCH 3DHMA 3DJ9A 1T0NA 1CD0A 1PX3A 5C3TA 1FE8L 1LEIB 1I9RL 3UTQA 1Z5LA 1FPTL 1JPGA 3H0TB 3P9MA 3KJ4B 5I8EA 3MRDA 1E4WL 3QUXC 4OZGE 3IDIB 4PJAE 2WLYA 4UBDD 1UCTA 5IESH 2Y36H 4MS8A 3EFFB 2OS7A 2JJSC 1SYSB 2BOBA 3LB6D 3PL6A 3OG6B 4GSDL 2CRYA 4L3AA 4LCWB 4V1DE 1R3IH 4OF5A 4P5KA 1FIGL 1Q94B 1INDL 3STLA 4WO4A 3WN5C 3Q2CA 4O2CB 3HFMH 2ZUWA 2X9WA 2UYLB 3RVTC 3BP6B 4MJID 3RX8A 3GSNA 5I8OL 3OKNA 1I1FA 2NLJA 3EYOA 2B1AL 4HZAA 4PG2C 3QDMD 1ULVA 4NUGH 3OJVC 4EOWL 5MP6H 2PYFB 4FQXB 5HHOA 2OSLA 1XIWC 4D8PA 3EOAA 5AYUH 5IGXH 1QLRA 3MRCB 4HD9A 2HT4D 4Y2DD 4I5BB 3S88L 4RNRB 4QLRA 3OPZL 2YXFA 3FB6A 5BS0B 3S5LB 2FB4H 1TJGH 4NQVB 1PZUB 1J1OH 4LASL 3IYLW 5H94A 4X6EB 5F7EL 4KTDL 4PRIA 4LLQA 1I3UA 3NBNA 5ILTL 1CTOA 1VEPA 3BVNA 1JWSA 4X9IA 1KJ3L 1NBQA 1AD0B 4JLRA 2BSTA 2DM7A 4UBDC 2H9GA 1S7TA 2ADIB 3DV4B 4KUCF 3HI1B 1I9JL 4XP1L 3BN9D 4XVUD 4XPBL 3LB6C 4BA8A 4TTDD 3GUTB 3DXAB 3BKJH 3BPNC 3GK8L 3D0LB 2RQ8A 2YMXH 1S9KC 2PR4H 4JVWA 5D1ZB 2VZ1A 4GXUN 4U1IB 4DZBB 3S35L 1EEYB 2K3TA 1TJHH 5E4EC 3RI5F 1AXSA 1MCPL 4F37F 1KN4H 3H8NA 5E2TH 2CD0A 5E95B 3ULUF 4OV6F 2IPKA 4JFYA 1ES0B 2HT4C 4Y2DC 4APQB 1G0XA 4EI6B 1A6AB 4MJIE 4TUOB 5J06A 1RZ8B 1MQ8A 3OKOA 4KJQC 4D0BB 4PP2A 4PJDF 3VD7A 3MGTB 3Q6GH 4KFZC 3QDME 2IPTL 5IBTL 4U3HA 4RA3A 4XNQB 4B7LA 2YUWA 4XP5L 3CLFH 4XNUL 1J0IA 4HQQL 5GGQL 5DZNA 4HC1H 4X6FA 4HCRH 3ULSB 3KPQA 4YNYA 4EI5C 3BN9C 5DRNB 4G6JL 3NFNB 1YMHB 3B9AA 5C0ND 4NZUH 4TTDC 1I75A 4N9GA 3F5WB 3T0WA 3W0WA 2X4PB 5ACZB 1G0DA 3WO4C 1LNUB 4MDJA 1E6JH 5I1IL 4K94C 5CWSB 2APWA 1KEGL 1CFTA 2BVQB 4RAUA 2EEAA 1A9EB 3GMPA 1XGQA 2PUQT 4DK6A 1DBJH 4FFEX 5SX5K 4X4ZA 5BOZG 1FO0A 4PB9H 4KMQA 4NZTL 3EYQC 3N1PC 4Z7QF 5HHMB 1DQLH 3FFDB 2AP2A 2ADJB 1WEJL 1QFOA 4PJBB 4LU5L 4GMTH 1RUPH 4ZUWA 4ODHL 3EO0B 3S37H 4UIKH 1MCIA 4NO3A 3FB8A 2DLGA 1SYVA 5ERWB 5KVMC 1YPZB 1KLFA 1PBYA 4HEPG 4KMTL 1NC2B 1EJ6A 4OZHE 2H3NB 4R4ND 5EU5B 3B6SA 3ES6A 1FE8H 1TPXC 4G3YL 1I9RH 3QDHA 2FBJL 1AP2B 1PEWA 1FPTH 2NR6C 2GQHA 1DN2A 5C0NC 4PR5A 3X3FL 1B6DA 3HNSL 3CSYB 2ARJA 1KT2A 4K8RD 3OJDA 4P46A 3VGDA 2W91A 1EFQA 4DVRL 2DTML 4LP5A 4GSDH 3LKPA 1DR9A 5J9PA 3BXNB 1FIGH 1INDH 3KWWA 2Y7QA 5J6GA 1S7RA 3BH8B 1EVTC 1XF4A 1Y18A 4I4WA 3OR6A 3UYRL 3C5SB 2VDOL 2GTZB 4OFKA 1RURL 3IFPA 5I8OH 4NCC1 2Q6WB 5A2LH 3AGVA 2B1AH 4R97B 4Y4FD 4Z0BL 4DEPC 1BWMA 3TN0D 1JGEA 3UO1L 1W0WA 1XCTB 5F1NA 5HGHB 1A9BA 2DAVA 4ZAKB 4EOWH 4Y8AA 3FRPA 1U8QA 4BSJA 5HYJD 3O4OB 1I1RA 1KB5L 3S88H 2G9HA 3OPZH 4HK3J 3U7AA 1K4CB 2UY6A 4GRLA 4LGSB 2YD6A 2DQJL 3KLAB 4LASH 1EO8L 2KBGA 4PJGB 3UTTD 5F7EH 4JZJC 4KTDH 3ISWA 1WGOA 2BK8A 2HT2D 3MUJA 2ED8A 1FYTD 2F53A 5GS0L 1RZ7L 1YY9D 3I6KA 4YHKL 1KJ3H 3I9GL 1P9MC 1SBSL 3EJJX 4GXUM 3S3PA 3WLWD 3SDXB 2NY6B 4TVSa 3KNBA 3TH3T 5GGRA 1RZJL 1X5KA 5F7KC 5HHPB 4K8RC 2XKUA 4XPBH 1D5XA 2GY7B 1ZSDB 3PQYD 4OI9A 3GK8H 4NZJA 2RGSA 5ADPL 4JREB 3CIQA 3S35H 3ZSTA 2R2EB 5C07B 5HHNB 2WINA 3NAAL 3HI6L 1YEIH 2FJGB 1MH5A 4Y4FC 5LCVL 3BRGC 3FRUA 1MCPH 3TN0C 3DV6A 4QRRD 2Z91B 3J7HA 4V2CB 4OTXL 3B3IB 1I8MA 4M02A 1JGUL 1GGCH 1OT1A 1AO7A 2KZ1B 1T5XB 1N0XL 5F7DA 2WQRA 3GMOB 3C6LB 2Q76A 2VDMH 2IPTH 2AK4D 3PWPE 3D39D 4JCLA 5ESVA 4N9OB 2HT2C 1OLZA 1U2CA 4XP5H 4XNUH 4M1GH 5HYJE 4ZXBD 2XN9D 1YY9C 1CVRA 4HQQH 5GGQH 3QO1B 3C8KA 3HZMB 3VXMA 3WLWC 4X99B 3HUJE 2WBJB 3RTQB 2R15A 4XZUA 4HUXA 4L4TE 4PJ9D 2ILLA 1LEKA 3DO3A 4Z77B 2ZG1A 5C09A 3UTTE 4TNVK 3LRSA 1B90A 2JKXA 2YR3A 4JPIA 4G6JH 4Y4HB 5SWQA 1KBGH 1SJEB 1FYTE 4E42A 1KG0A 3L3JB 3I50H 4JDVA 4P4RB 1EO7A 2WNGA 1JNNL 5CJXC 2MWCA 3IT8D 5EIQA 3FN3A 4FG6D 4OKVA 5DMIL 4WW1B 4YHIB 4WNQA 1H3PL 3QXTA 5EZIL 1KJMA 5I1IH 1F58L 1WCBB 2PXYA 1INEL 4WFGD 1T89C 1KEGH 1LP9A 3PQYE 1FFRA 5D1XC 1F4WL 1PEZA 2BMKA 4NZTH 1IGJA 2X41A 4YEFA 1ERNA 4H20L 5DJCA 4HMEA 1JHLH 4RMUA 2AEPL 1WEJH 3WKNA 1EAJA 4TSBL 5EOCH 5MEQB 3QDJA 4LU5H 1NEZG 2CLRA 4ODHH 1OQOA 4QRRE 3RL1A 2VZSA 2CRMA 5MENA 2FR4A 2WV3A 3NABL 5I73B 2APFA 1U9KA 1X7QB 4KC3B 4PRPB 1QTYT 3WFDL 4ZXBC 4PJCF 3VRIB 4WHTA 2GTWA 5B3JE 4NRXB 4YFLI 3ZKQD 2ZUXA 4HIEB 2GAZA 4WU5A 1LO0H 4HH8A 5J8OA 3WEXB 4DJMA 4PJ9C 5E4IA 5EOTA 1CIUA 2B20A 2XPGA 2FBJH 2XXMB 2AK4E 3D39E 4E41A 5JPMA 4L8SB 4OBSA 3X3FH 5L2KA 2XN9E 1WAAF 3HNSH 2EC9U 4LAQH 4KPHL 4M7JH 1DQML 4FG6C 4F7CA 2J7LA 1TQCC 1BOGB 5KS9E 3RWGB 4DVRH 2DTMH 1ZVSB 1MFCL 3PABB 4PJIF 1AXTL 2E9WA 5GS3A 4U3XA 3C9NB 2OZ4L 3IJYA 1CLZL 4Z0XB 2VDKL 3F7VA 3H9SA 3L7EB 3UYRH 3TJEL 1PY9A 4ZSOE 4MVBD 3G5YB 4F57H 1CL7L 1RURH 2D0GA 3UTZB 4OZIB 2A9MH 2D4FA 3VG9C 4Z0BH 3AM8C 3IKKA 4IS6A 4WFGE 5E8DL 1Z9MA 2YPVL 1B0RB 3JV4A 2X4OA 5GGTL 3TYFA 4J6RL 1Q0YL 1QYGL 3ARGA 1KB5H 1W2KT 3V6FA 3OXSB 1EEZA 1A4KB 5AUMB 3DMMD 1M1SA 5EOQH 2DQJH 3BOVA 1EO8H 3GJEA 3RIAF 3ARVA 3ZE0E 5D7IE 1IQDA 2GJ6B 2CLZA 4HWBL 1MEXL 4G9DA 5CP3A 3NZ8A 3V8OA 4YHKH 3I9GH 5F9JA 1SBSH 3U48A 2YEZA 3LD8B 3TFKA 2VAAA 3NN8B 3GMRB 1RZJH 2QHRL 4Z6AT 4M8VA 3LZFL 2GJZA 2V2XA 1F3DJ 3AY4A 4WW2F 3RWFA 1M4KA 2VO5A 1UZ6E 4FQLL 4XXDB 4LBEA 3VXSA 3GMMA 4IHOB 4LLWB 2YD4A 4CU8A 4RMWA 1RZGB 5BRZD 5ADPH 1GCFA 2ZOLB 2DTSA 1PVHA 2X5PA 3NAAH 3HI6H 5BW7A 1R5WB 4NKDB 5D5ME 5JW4N 1U6AL 4XBGA 4IM8A 4RGNB 4MZ2A 3SGJA 5LCVH 5KSUB 1IM9B 1QQDB 2DQFB 1K4DB 3LSOB 2XICA 3K4AA 3SE4A 1XGRB 2AJXL 4XAWL 3KAAA 8FABB 3BPOC 3V2AR 2HJLA 1AHWB 1JGUH 4K71B 1U41A 3ARBA 3OJ2C 4Y5XA 5JDSA 4PJEB 1KIQB 1DQJA 1N0XH 2EDXA 2CRZA 3RWJB 1ND0A 3BZFA 3V4UL 3I3EA 3CSGA 1ZA6A 3HRZA 2X42A 5BMFH 3SDDD 3FZUD 5KVGL 2BNQB 4PJHB 5ICYA 1P53A 2FO4A 4JKWA 1A7PL 2R56L 3B8YA 2AJYL 1SJHA 1MI5D 1I8LC 4JFQA 2ICCA 4JO2L 2VLKB 5B38B 1TVHA 1QPXA 3DGCR 3S96A 1J18A 4HKBA 5D2LA 2BVOB 4NNXB 2CH8A 4RFNB 35C8L 3QIBC 1FC2D 1J8HD 1AGDB 3CVHA 5FOBB 3DBXA 3QUZD 1JNNH 2IMMA 1PQZB 5IG7A 3ABZA 5CIPA 2IEPA 1QVOB 4RFEB 5DJ2B 4RGOL 1HH9B 1H3PH 5EZIH 4P5TA 5C0JA 2JCCF 4NQDB 4YHML 1F58H 4RMRA 4Y88A 4JJ5B 1INEH 5D70H 2F58L 2IC2A 3U4EB 3QJFA 5DMKA 3O3BB 1OW0A 4JQIL 1F4WH 4JRXD 2HFGL 5BRZE 4H20H 4BFEA 3LN5A 5I1KL 3E3QA 1KEML 1LQVA 2XA3A 2AEPH 3UYOD 4Z7NF 4YGVB 4F9LC 3JZ7A 3E0GA 4ZOEA 1QKZL 2X89D 2K9UA 4X4YB 2AV1A 4S1DD 3V5DB 3NABH 4UUJA 1BF8A 4HUVA 43CAA 3SGKA 1KCVL 3S98A 4S0SD 4OLVL 3WFDH 3MNVB 3SHSA 43C9A 4PJ5A 1DQQB 1FLTX 1M71A 5GQBA 5K9JL 4J3TA 1Q9LA 3TVMB 3MACL 3VMOA 3NCMA 1DLFH 3TO4B 5FK9B 2R0ZL 4ONFL 1FVCA 1T4KB 3JWOL 4PREA 2L4OA 1UACH 3DX8A 4UTAL 2YRZA 3LEYL 4O2FA 5E1HB 3PHQB 2FL5B 3VFTA 4PJXA 3QWOA 1FL6A 3O6FB 3VFUA 4KPHH 3FONB 1DQMH 1MI5E 5IEHB 3HB3D 5D72L 2EYTB 4ZS6D 5LBSL 5C0FA 1F4HA 1I7RA 2BVUA 3DX9B 2HYMA 4F2MA 1Q9WA 1KB9K 3NOIA 3K81A 3QAZB 3V5HB 2BSSB 3WHXA 1J8HE 1AXTH 2Q3ZA 3RVXD 4CMHC 3UCRA 2OZ4H 3MRMB 3CK0L 1GZQA 5H2BA 1CBVL 1CLZH 1XAUA 2VDKH 3DOSA 4WI8A 2ITDA 4NQED 4ODXA 3U4BL 4HPYL 3TJEH 2A73B 1CL7H 4N0UE 4LCCB 3RA7L 2KH2B 2NXZD 5F3HB 1OTSD 4PJDE 3N85L 4FNLL 2YPVH 1QLEL 3DROB 3L6FB 5F9DC 1KF9B 2RBLA 1WWCA 3KPMB 4PTUA 4JRXE 4J6RH 1JTTA 3N1MC 1QYGH 1UJ3B 3KYMA 2V6HA 5DJ0A 1JZ6A 1FFQA 3QCVL 2WK2A 3D3VD 1CR9H 4XPTL 2VN7A 3RY6A 4BFIA 5IB5B 5F8QC 5CP7A 2GFBB 3OGCB 4HWBH 1MCBA 4HH9A 1BVKA 3K74B 4OCLC 5DJXB 1B9ZA 1CU4L 1DVFD 4N0YL 1IC5L 3VGGA 3HB3C 5KG9B 4Z7UE 4N1CA 4BH7A 3QEGL 4FA8A 5JW4M 3LZFH 4EN3D 3TA3A 5IOPB 4FFWD 1CXFA 2XQYG 3F7QA 5IW3A 3OX8B 3MA7B 5DYOB 3EJZC 1EAPB 2Y6SC 1T03L 1A6TA 3KHOA 5DA0B 1HDMB 2A6KA 4KDVA 5IFHL 1V7MH 3KJ6L 2PYEB 5ACMA 4JPKH 5FYLD 4ETQA 1PZ5B 3OAUL 1U6AH 1NBVL 2QQKL 5C9JB 5D7LB 3D2UA 3O4LD 4PJFB 4F7TA 2RFXB 1NSNL 1IZKA 4IDJL 4XAWH 3KPSA 3QIUD 3T2PA 4MWFA 2VJXA 4UB0H 2JB5L 3HKFA 3NCFB 2XKSA 4NQEE 3SDCC 4XVTL 4PD4J 3X14A 1QFUL 1WBXA 3V4UH 4UTBL 2G60L 1KYOK 3O11A 5GS1B 1JPTH 4KWUA 4ACPA 2D31B 2NY4D 3U0PB 1CDHA 4ZNEA 1A7PH 4BSWB 2VYRE 2W9EL 3O8XA 5FDWB 5F9OL 2R56H 3UZQA 4L9LA 2AJYH 5F6HI 2VABB 3HE6D 3ZE2E 5DRXA 1DN0A 3MRFB 4ZUTA 1DVFC 3U7YL 3ULVD 3B5TA 3VI4E 3D3VE 3U7WL 2RAMA 4M48L 1H5BB 4EN3C 1MCWW 35C8H 4Y5VA 1EX0A 5TQ0L 1S7QA 3KYNB 1ZS8A 4DWHA 2P5WD 5EUOE 1YN7A 3PWJA 1E4KA 5IMOA 4Y16B 2X4TB 3ARSA 4RGOH 1W72B 2EO9A 3VWJB 4M8QB 4NO0D 4YHMH 4P2QA 1EEUA 4PB0L 3UTSA 1BJ1H 3M45A 2V5SA 2F58H 4M6ML 4UNVA 3MO1B 4KY1H 4JQIH 4JE4B 3KYAA 3BIKA 5JMOC 3QIUC 5CHNA 3CC5B 3P4NA 2FECL 5I1KH 5FYLE 1D5MA 1QOKA 4PG9A 4WI5A 3L3DA 4ZFFA 5A2IH 2EC9T 3DGGA 1QKZH 5I16A 1FO0L 1B0GB 2JK5B 3O4LE 5EU7E 1CCZA 3FO2B 4W4NA 4Y7MA 4LHQB 3PDOA 5EU3A 1Q9OA 2NY4C 1KCVH 1AKJD 3U9PL 3KPOB 4OLVH 5SV4A 2W0FB 3R06A 5CJ5A 4L4VB 1MWAB 1XR8A 4C59B 1F2QA 5K9JH 3HE6C 2BNRD 2R0ZH 3ULVC 2RIKA 5EUKA 5MERB 2ZG3A 3JWOH 1P7KA 3L7FB 2OTUA 2DQEL 4UTAH 4OCYL 1YJDC 3LEYH 3E2HA 2IADB 3GSXB 1UXSA 4CDHA 2ATKA 4H5SA 1S9YA 1IM3B 1P7QD 4LHUD 1WAAA 5IBLD 4O4YL 3VFRB 4MA1B 4R9HA 2CKNA 5D6DA 3B8SA 5FA4B 5D72H 4GBXB 4OGAC 5DDHB 3ULVE 2Q86A 5LBSH 4J12A 3GMNB 1OTTD 2F54A 4M62L 2QADD 4R4BA 4HJ0D 4YQXL 4PJ8B 5D7KE 4C83A 3JVGA 5ABDE 4PTTA 4CNIA 5IP4A 1EUTA 4I13B 1XCQB 3CK0H 3MLXL 1D5BB 4TULL 2P5WE 2ZNXA 1CBVH 1MPAL 4P23A 5CJOH 3RWEA 3U4BH 4HPYH 5ISZB 1CG9B 4P2RD 3TZVB 3KXFA 4HUWA 4M43L 5GRYA 1U8JB 2DQTL 3UTOA 3OSKA 3RWDA 4PRHB 3RA7H 4HWEL 1FCCA 4K3EL 4FQQB 3N85H 4FNLH 3ZE1E 1QLEH 1VKXB 1JL8A 4ZDHB 3GSQA 1BBJA 3FT3A 5BXFB 2DLHA 3MRIA 3IVKA 2OMBA 3WJLA 4R3SA 2C7UB 4FQJL 1N8ZB 3MJ6A 1UC6A 3SE8L 2FNBA 3QCVH 1BIIA 4XPTH 2LQRA 3UTPE 3C6SA 1T1ZA 2GITB 2JJWA 3OKDA 4OZGB 4PJAB 1P6AB 4XH2A 1A6ZB 1LVEA 4K94H 3CXHJ 1CICD 5T3ZL 1FNEB 2X4RA 1NKOA 1WZLA 4V1DB 4I48B 2Z92A 1NANH 1TETL 2FDBP 2BNRE 3LKOB 3QEGH 2F8VA 3RHWK 4Z7OE 2J8OA 3L3KA 4DGIL 2A6JA 3QUXB 2QADC 4OCXL 3RDTD 2I9TB 1T03H 3FJTA 4YHPA 3D85A 5L6YL 1QRNA 2CDFA 3IFLL 4PYGA 2APXA 2XQYK 3IXAB 1BD2D 1G7JB 5IFHH 3KJ6H 3AREB 4RIRA 3OAUH 3GSUB 4EVNB 4QTHA 4PRDB 2R8SH 1NBVH 2QQKH 4XMKL 3PHSA 3ARFD 2AI0L 1NFDF 5TH2A 3TPUA 3X3GH 1UCBL 4NM4L 3D0VB 1HE7A 1NSNH 2FJFA 1K8DA 1IGYB 1M6OB 2XACC 4QHLB 3LQZA 4MAYD 3QBTB 4XVTH 1RD6A 3ZYZA 2J8UF 4X9HA 5HTSA 1QFUH 3RRQA 2UUDK 5KAQG 1XIWB 2X4NA 2Z9TA 2CO6B 4UTBH 2G60H 2IAMB 4HS3B 2X9XA 4NYLB 3DPBA 4YHZL 3HPLA 2W9EH 3NCYS 1HHHB 1X5IA 3M1BB 2VRAA 2QL1A 4UT6L 4FABH 3U7WH 4M48H 3QNZA 4BH8B 2BVYA 1RK0A 2VR4A 1UEMA 5TQ0H 1BQUA 1HQRB 1GGYA 1MF2L 2IBGA 1OWWA 2AK1L 4O5LL 4E5XA 5CKGA 5HI3C 2VMFA 1IRAY 3GMLA 3QEHA 1RY7B 4MXQC 1R0AH 2VDNH 2L7JA