4ZUWA

Crystal structure of equine mhc i(eqca-n*00601) in complexed with equine infectious anaemia virus (eiav) derived peptide gag-gw12
Total Genus 73
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
73
sequence length
274
structure length
274
Chain Sequence
GSHSMRYFYTAVSRPGRGEPRFIAVGYVDDTQFVRFDSDAASPRMEPRAPWVEQEGPEYWERETRNMKEATQNFRVGLNTLHGYYNQSEAGSHTLQRMYGCDVGPDGRLLRGYRQDAYDGADYIALNEDLRSWTAADAAAQITRRKREEAGVAEQCRNYLEGTCVEWLLRYLENGNETLQRADAPKTHVTHHPISDHEVTLRCWALGFYPEEISLSWQRDGEDVTQDTEFVETRPAGDRTFQKWAAVVVPSGEEQRYTCHVQHEGLAEPVTLRW
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system
molecule keywords Classical MHC class I antigen
publication title Structural Illumination of Equine MHC Class I Molecules Highlights Unconventional Epitope Presentation Manner That Is Evolved in Equine Leukocyte Antigen Alleles
pubmed doi rcsb
source organism Equus caballus
total genus 73
structure length 274
sequence length 274
ec nomenclature
pdb deposition date 2015-05-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00129 MHC_I Class I Histocompatibility antigen, domains alpha 1 and 2
A PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4zuwA02
3.30.500.10 Alpha Beta 2-Layer Sandwich Murine Class I Major Histocompatibility Complex, H2-DB; Chain A, domain 1 MHC class I-like antigen recognition-like 4zuwA01
3CZJA 1NAML 3O81A 5J13C 3WIHL 2E7MA 1YEEL 2VXVL 3UYRH 3EGSB 3MCKA 4OD1H 3PP4L 4XRCB 1J8HD 2A9NH 2VR4A 4NHUE 1FYTA 1INQB 5D2NE 3TZVA 1OARL 2AJSL 4TSAL 3EO1B 4GRLB 5EBMB 4POZC 4YHZL 3T2NL 3P0GB 4F7EB 4JAMB 2NY7L 3TJHA 4KAQL 5FM4A 4X6DB 4Y19D 3PUCA 3WIFA 3S88H 5EORH 3QCVH 4GW5B 3KDMA 3VXRA 1D9KB 1G7IA 4TRPH 5JXED 1DLFH 3UMTA 5DD5L 4PJIB 1JGLL 1FV1A 3TWCH 3GMOB 4AMKH 3FO2A 2O5XH 4PTTB 4EIGB 4E5XB 1H0DA 3KJ4C 1MH5A 1U93A 2ZCHH 4HGMA 1OPGL 4QGTA 5GGSB 3C08L 1K4CB 5C0GB 4LPCA 1R5WA 4GAFB 2VLKA 3MCG1 4BH7B 3KPRD 4FMFA 1TTGA 2AJXL 3W2DH 5CBEB 4JQVC 1UCBL 1EBAA 4HWUA 2GQHA 2KUTA 5ACZB 4Z78B 4FXKB 1HDMB 2YOCA 4HHAB 3CFKB 2ADFH 3TVMC 3GBMH 3ZZ1A 4YQXL 4RMTA 4YNYB 2I5YL 1AKJD 4ELMB 5IB4B 1EAPB 2LU4A 3VWJA 4YWGL 2QQQA 1K4DA 1HH9A 1FVDB 4CRPA 3PJSA 2Z31C 4S0TD 4QY8B 4CNIA 4K71B 3U36B 1FAIL 2GFBB 2FWOB 3M17A 4WUUB 4PJGE 4TUKH 1I9IH 2UZIH 4QRQA 4S1RH 1KELH 3IGAA 2LU7A 4JVUA 4MHHG 1PEZA 2P8PA 1N4XL 3D0LB 3RWJA 3FQTA 2ZOLB 2WWKT 3RWIA 1JHKL 3FCTB 3EDJA 1PQZA 2NTFB 4LRNL 4AEHH 2XKUA 4K94L 5IBUB 3WFDH 1HSAA 4NHCL 1M7IA 4XBEH 5CEYA 4OI9A 4X4YA 5DHXB 4GS7B 4J3VA 5AUMA 3RNKB 3L5XH 3P4MB 4B0MM 5FKPA 5I1JH 5D9SB 4LSVL 3BD4A 3HR6A 4U1MA 1FBIL 4G8GA 3AS1A 1UYWL 1IAIL 1YC7A 2JK5B 3I02B 1TETH 4KJQC 3VFMB 5F9JB 2EIZA 4YHYC 4QRPB 3H9SE 4M7KL 1KNOB 1KCSH 1FNSL 1IFHH 2R29H 1I9RL 3CVIL 5ID1A 4N1HB 3PHOA 2ERJC 4OD2B 4OUOA 4JPVL 2PYFA 2H2PC 4U6VL 1R3KA 4CKVX 5DGQA 1RULL 1RZ8B 1WBXA 2VDKH 5FYJU 4U2YA 4FA8A 3O2WL 2VISB 4PJ8C 3CVHL 4N8CL 2VAAB 3P30H 5LCVL 1I8KA 3GO1L 4P2RA 3F7VB 1MRFH 3U82B 3GI8H 3WS3A 1V7MH 4OFKA 3E3QE 5HHMA 4WU5B 5HDOA 1FO0L 4RGOH 1KIPB 3BIBX 1EMTH 2FD6H 35C8L 1G9NC 4DK6A 4ORZC 1QRNE 1KSRA 3WD5L 4KHTL 3F58L 1BD2E 1YEJH 3MLXL 1LEGA 3WDIA 4GXUN 1PD6A 3E6FA 4ZO7A 4P4RB 3MRHB 2WZPD 5JHLH 3TA3B 4ELKB 4PJ5B 1WTGT 2GJ6D 5KAQF 4PUBH 1T7XA 5ICZA 2XYCA 3SJVD 4G80B 3NIGE 1FC2D 1A6ZB 4P2QD 3WN5A 4L4VA 1F5WA 5K93A 3OKMA 1NH6A 2AI0L 3MLZH 2PUQT 5JW5A 4POUB 4LRIC 5D7LB 1PG7W 5DUPH 3MRRA 5T1LD 3UJIL 2A77H 3PWLA 4HUWA 4TUOA 5DJ0A 5ETUB 1II4E 5HVHC 3MRGA 4FZEL 3MRKA 1IC5H 1VFBB 1LD9B 4OZ4B 2A74B 1JRHI 5ESVB 3WV0A 5FCSH 5DDHB 4EEEA 5T3ZL 4NQEB 1RZGA 3EYFB 1PX3A 2QKIB 2FIKA 2D7PA 2E8YA 4S1DD 4S1SH 3I9GL 4XPBH 1U8IB 2FEEI 3QZWB 3W9EA 4QNPF 4ZQKA 4L8BA 1BAFL 2CXKA 1N64L 3FTGB 1RIUH 1TTUA 4YFLI 4FOMA 4U1LB 1G7QA 2MOVA 1KN4L 1NSNH 5EUKB 3BP4B 4BSJA 3UPCA 2DYPA 4I77H 4KV5E 4TVPH 3DYPA 5ABDE 5EOCJ 2EKSB 1K8DB 3GJFA 5AYUH 1KCVL 5IW1A 4OLWH 3MODH 3C9NB 1Z0NA 1DFBL 3DVFA 3DRTA 3SE9H 3SKJH 4LCUA 1T3FA 4MAUH 3BKML 4Y4HD 4V3EB 4M02A 5A2IH 3TO4D 1F3JB 1SBSH 3MRMB 5IM7A 1E27A 1G9NL 3MRQB 2OL3B 5BS0B 1YJDC 3UP1A 5EA0H 2B4CH 4QHMA 1Y18B 5ALCL 1YEKL 1IM9D 4G9FD 4J3WA 5CINH 5C0IA 2WWMC 4QT5B 1HINH 3MRBB 2XKNA 5EO0A 4G8IA 3SDCB 3MRFB 1XGRB 2XQBL 3RY6A 3DBXB 4OSUH 2DRUA 1ZA3B 1FSKC 5GSVA 1KPVA 5BRZD 2V5RA 1EZVY 3B2VL 3Q6FA 3P9MA 4NUJB 5J3HD 5CJQL 3CSPA 5L7XL 3SOBL 3HB3C 3GJEA 1XGPA 1S8DB 2BHZA 2J5LC 3CSYA 1H15B 2HJKA 4J4PD 1FGNH 5L2JA 2CSPA 2Z4QB 1ZTXH 5I19L 2RCSL 2R0ZL 2G5BB 4NWUH 3LN5B 5FO9B 3RVWC 4DEPC 4X83A 3CXHK 4EIZC 1KB5B 4WFFE 5IQ7H 1A9BB 1MHPH 4N8VB 3THMH 2FR4A 1MJ8H 3QQ9C 4PJFA 1ZA6A 1EFXB 1ZS8A 2W91A 2BVPB 3NFPB 1F11A 2HVKB 3FB6B 3LEYH 5CEZH 2QHRH 4S0SD 2AERT 1XF5A 1A22B 4APQB 1SMOA 3ULSA 3QEQE 5IWLA 1KTDA 4L3CB 4K3DL 3AXLA 3ZKXB 3BE1L 4QTHA 3OSKA 1D9KD 1W72H 1UA6H 1CXEA 2B0SL 4D9QD 4H25A 4JVWA 5C08B 1X5LA 4MCYA 2OI9B 2IAMA 1N0XH 3GK8H 2R56H 1HI6A 1D5ZA 1I3VA 4WHCA 3KLHC 5DK0A 3PE9A 4P57A 3ZE2F 2GT9A 1AHWA 4HIIB 1YECH 1U8LA 2WBJA 1EERB 3O0RL 4ZDHA 4YZFE 3JUYA 5FGCE 5C0AB 3RVUD 1B4JH 2VXUL 4CVXB 4B5EA 1XF3B 4KWUA 4X4XB 3AGVA 1KG0B 1EGJH 3D3VE 1L6XA 5MEQA 1IQWH 4GG6B 3IYLW 4PG9B 2FL5A 4HC1H 2Y9RT 1XT5A 4MD4A 2P44B 2ZJSH 1MREH 4L9DA 4ZUTB 3RWCB 4NFCA 3UPAA 4ONGL 5L8JB 5LWYH 4L8CA 3W9EB 1S7QA 2P24B 3TCXA 4OKVA 4Z95L 1LEKB 5HGBA 1JN6A 5EO9B 5JOPE 1QR4A 1LWRA 2XACC 3MR9A 5KOMC 2EYTA 2J8OA 1NMCB 1T22B 1GHFH 4UV4L 3IFNL 2F19L 3KHQA 5MP6L 2HTLD 4MQXC 5F9AC 1U41A 2CDFB 4P3CL 3V4UH 3OKKB 4PRHE 3O2VH 2JIXA 2Y7QA 1M71A 2AK1H 2FJHA 1A6UL 2ARJQ 2J8UE 3KXFA 1X44A 3H9ZA 4JO2H 1DBAH 5F1IA 1XZ0B 2C1OA 4MJ6A 2ICWI 1UZ6E 4NN7B 1K8IB 5EBLB 3MBEA 4AIZA 3MC0A 3V95A 4MA7H 1VGKA 1AP2B 3KYMA 1BFSA 4E42B 3WDJA 5KW9H 1WSST 5DYOA 4HT1L 3IFLH 1KBGH 1CI5A 3EDEA 3MOBL 3WL9B 4MVBD 3GMPA 3WIIH 2EYRB 3ZSTA 2CLZB 1IAOA 1NCBH 3RUGB 2DM7A 3EYSL 3EZJB 2D0GA 2FX9H 4QRPD 2P5EA 1Q1JL 2BOBA 5CJOH 2B5IC 4GBXA 1E4WH 1WICA 3V5DB 3MRPA 4RX4A 3VXUE 4MB3A 2BCKA 2BFVH 3MA7A 2HH0H 4YBQD 4MA1B 5KVFL 1GOGA 2WBWB 3DX8A 1F6AB 3J7HA 1T1XB 4R97B 3BUYB 1IC7H 2I27N 1PKQE 3TFKD 3HPLA 5D1ZB 1FDLH 5F96L 1FVEB 2X6MA 3SBWC 1E4XH 1E6OH 3NTCL 5L2KA 1A6AA 1D5IL 5ICXB 1FL6B 1AC6A 2K7PA 4QF1B 3RNQA 4D8PB 3ZYIA 1CR9L 5L9DL 1JGDA 4KDTA 2APFA 3MOAL 3UTOA 3KNBB 1TJHH 3FFDB 1FYTD 3B5HA 4ISVB 2DIJA 4LCYB 2X4RA 4X4ME 3B6SA 4QYOB 1XGUB 4NCDA 5F7DB 3RL2B 3OR7B 3QP3A 3CK0H 3GGWA 1CU4H 2A83A 3TA3D 5ITBL 1L0QA 4JFHE 4XNZC 4PJ5D 1PDKA 5TQ2H 1QD0A 3JVGC 4DFIA 5KOVC 4ZAKB 4OZFH 1A7NL 3UTSB 4K7PH 3VXRD 3Q5OA 4EKXA 3LRHA 4GW4A 1AXSA 5JXEC 3LPGA 3LQMA 5KJRL 1IGCL 5DGRA 3DX7A 4JFFE 4DAGL 3LDBB 5D7LD 4ZXBB 2VN7A 2IFFH 2ZZUT 2BJMH 1EJOL 2HJFA 4MD5A 4WW2C 2AJYH 1JMZA 1KXVC 4P57B 2X70A 4ONOA 1LO0L 1OAKH 1MAJA 3QXAB 4WVRA 4TSCH 4MNGB 4QXTA 4KROB 5FOBB 5IVZA 3BKCL 3KLAB 3V5HA 2R4RH 1N7MH 5J9PA 4NQED 1F02I 3K8MA 2I26N 2BVEA 2C1PA 3UX9B 4P23B 1AQDB 1BVLA 2IBBA 4JO4L 1GGUA 5ALBH 1CFNB 4PJCA 1FGVL 4WTXA 4HBCL 3OKLB 1KT2A 4CN4A 4OCXH 3VWJD 2UY6A 5F93C 4BQ6A 2XFXA 1CBVH 5GGTA 1XF4A 3SKNB 1RUQH 1U8MA 4HGWB 4PP2A 1BFOA 3WKML 3MNVA 3FQWA 1S9WA 3PV6A 4JB9L 4OJFL 2R1YB 1KYOJ 3MFFA 3WDHA 4KGLA 4JZJC 3PP3H 1NMAH 1CT8B 1Z5LA 2IBGA 4OGXL 5T3ZE 1UFUA 2NY5L 2Y36L 4NKOA 4D9LH 5C0BB 4AK1A 4Q9QL 3ARFB 2NQCA 4YR6B 4U3HA 2B1AL 1CFSB 2VDPL 1SMAA 2PCPA 1HHIB 1DQQA 1KLUA 3NCJL 4UDUA 4XPTH 5HY9A 5E4EC 2ITDA 1BQSA 2DD8L 2E9IA 4M6ML 1MFBL 3PQYA 5C0RH 3BEVB 4N90D 3P0YL 4LSTH 4RAVA 5BS0D 4P4KA 3N1PC 3GSOB 3W5MA 5DWUL 7FABH 4PJBB 1F90L 3U7YL 4XNXH 4FQPA 3O2DH 4U0RC 1TIUA 3ABZA 3JWOL 3ZTNH 1AGFA 4DTGH 3VFPA 1IAKA 4LPUA 3T3MF 3NCBB 1DP0A 4U1IA 3FAXA 3JZ7A 2CDGB 4N5UA 1LO5A 4NNYB 2JJVA 1GZQB 1YYLH 3LSOB 3INUL 4H0HB 3OAUL 3JTSB 5DJDB 3U30C 1ED3B 2NW3A 4JO1L 1TTFA 2FSEA 5E6ZA 4DKFH 1CD1B 2YBRA 1F4AA 3QWQB 4O51A 4LEOA 2H8PB 3HUJE 3H9HA 5D7JB 3ARSA 1TFHA 1CXKA 1BQUA 4WGVB 1WWCA 2NNAA 5L2KB 5HHMD 5EN2A 1UJ3C 3WBDA 4HH9B 5C0DB 5I71B 1T0NB 3G6JE 2NXZB 3LIZL 4JFYB 3MRDB 1ACYL 3SO5A 1T2JA 1EFXD 1UH3A 4J7RA 4Y5XC 5JLZB 3GRWH 4AL8L 2FHFA 4HK0A 2X4NB 3BSZH 4FQ1L 4ODXB 1EXUB 2VJXA 1HKLH 1QKZL 1YPZB 2CXGA 4U3XA 5F3BB 2OS7A 4UOJA 1A3RH 3T2OA 1FRGH 1H8NA 4X98B 4WO4A 4M93C 2ZCKL 1YQ2A 4LQFL 3QEGL 4Z0BH 5C08D 2GY5A 4Q0XL 3T04D 1WISA 4C55A 1LO4L 2VZ3A 3LAFA 1JWUB 1ZT4A 1F58L 1R3JB 4NQDA 5ENWB 3KVQA 3BGFC 2XWJA 3MBXL 4HKJA 4OI7A 3OKEA 4ZPTA 4U1GC 1KTRL 5DC4B 5C0AD 3SDXA 5J11C 3MACL 4HPOH 1U8PA 4GUPA 5EOQL 4AM0A 2ZPKH 2FGWL 4OLEA 2YS4A 3DVNA 3Q6GL 1JGUL 4L9LC 5I1IL 3WFBH 2XZAH 4UINL 3LKNB 1T7YA 4C59B 1UWEL 1A14H 3WHE0 2Z9TA 4XTRD 1EA9C 3K2MC 4RIRB 1JFQH 2Q7YB 3B9AA 4JKWA 1B0RA 1KJVA 1OP3H 5EFIB 3ZKSD 5FO7B 3ALPA 1S7RA 4PV9A 3S34H 2DYPD 4YHLH 4HAFA 4E41A 5KS9F 4UNUA 2EDYA 6FABH 1KOAA 4FTVA 2XNAA 4IMKA 4LVOB 1MFEL 1MY7A 5K59F 1U8QB 1ZVYA 2UWEF 4WV1B 3QULB 1G7PA 3EOBA 5GRVL 3O45A 3TCLA 4FXGA 3GB7A 4JR9L 5FCUL 1JPSL 2JELH 3G5ZB 4AJ0A 4F7CA 1FFQA 4I3RH 2J4WH 3TH2T 3MZTA 5B3JF 3MV9E 1N2RB 1JGEB 3CGTA 3L7FB 4Y4HC 3T65A 1NDGB 2BZDA 5BMFH 5SWQB 1FH5L 2V7NB 1NFIB 1ORQA 5C0CA 1CD0A 1UACH 2YPLE 1P84J 3FZUD 1QSFE 3ZO0A 2UYLA 1BZ7A 4NC2B 4MNHA 1FJ1A 1BOGB 4X7CC 3F7PC 4NO5A 4O2EB 1DSFL 4MJ2A 3UTTE 2D31B 4PD4K 4X6CB 3PP4H 5D7IA 3VH8B 4XGZA 1I1YA 4YHPA 4L4TB 1SEBA 2F9BT 3T2NH 4JDTH 1BBDH 4OZIF 5LJYH 3WNMA 1G6RL 3O3UN 2CRMA 4KAQH 4ZOCA 5J3HC 4NGHL 3I75A 1S9VA 2SEBA 1QHOA 2AJ3A 1NBQA 4U6HB 5D1ZD 2D7OA 3TN0A 1GGBH 2VC2H 3KYNB 2E6QA 4IRJA 2XN9B 4WJ5A 1HWHB 2YMXH 4KDVA 4LEXH 4J4PC 4YHIB 2XICA 5HVGB 4C54A 4KY1L 4HJGA 5C0FA 5DD5H 1JGLH 1EHLL 3VXPB 2W38A 3TT3H 3QISA 4PJEA 4PRBA 5IK3B 5CILH 4Y8AA 3G5XB 1FAKT 3KAAA 3FQRB 3C08H 5HDBF 1I7RB 1GC1C 5JQHC 5ESQA 3H7BB 1ZT7A 2AJXH 1TCRB 1Q9WB 3H0TA 5MERA 1UCBH 4QXUL 4L1DA 4ZAKD 1WCQA 3UTSD 4ZUVA 1PEWA 3VRLF 4UT7L 4QHUA 1JNHA 4PRPB 1X4XA 1I75A 1NL0H 1S5HB 4WFGD 4X8JA 3OHXB 3BMWA 4EDXA 5IKCA 4KTEH 5E1AB 4JPIA 4R9HA 2VERN 3AU1A 3SCMA 2YA1A 5CJXC 1Y6NR 1QACA 2X9XA 5IROA 4KROD 4URTB 1AGDB 4PGDB 3ZDXE 5IP4A 5CMAA 5AZEL 2GKIA 4P5TA 4ZPVA 5DQJA 3O9WA 3RVUC 3DLQR 1CG9B 1MCPL 1N4XH 2A73A 1AY1L 2CLVA 2E27H 4P23D 3BP6A 3L3GB 4RQQB 2AJZB 4LFHG 5JPMB 4MHHI 4LRNH 2YZ8A 4K94H 3VJ6A 4MXQA 3S96A 5E70A 4R26H 1D5XA 4HEME 1J8KA 1V05A 4A6YA 1F00I 2IBZX 2ZG1A 5H94B 3VFGL 1J11A 4PBWD 5K9QI 2OR7A 4PJXE 4JO3L 5J1SC 3S5LG 4FQIL 3QIUA 1VENA 1JI2A 4KQ4L 3VXMB 1FBIH 1NFDF 1UYWH 1MCWW 3L95A 4M1CD 1VCAA 3OL2A 2R39A 5IVXA 4BUHA 3QIWB 3IDNB 4OLXH 4ZODA 5C9JA 2HTLC 3ARFD 5KN5A 1MCRA 4FFWD 5F72S 4G6JL 3RJQB 5M95B 4NC0B 2LAGB 4PREB 5JIHA 3CVIH 5DFTA 5D72L 3HC3L 3EOAB 4V1DA 4U6VH 3ALXA 4ZUSA 3LZFL 4EOWL 4NQCA 4L29A 3D18A 1RULH 2YC1B 4WWKB 3O2WH 5D1QB 2E7HA 3CVHH 2VQTA 4N8CH 3WMSA 1CIUA 5BV7B 3JV4A 5LCVH 1NCTA 1FL5A 3GHBL 3IFPB 1RU9H 1YY8A 4R90H 3LKOB 3SQBA 2WNGA 3UTQB 1GC1L 5EBWA 4IHOA 4MVBC 1FO0H 2PW1A 2RBLA 3U9UA 1NQBA 35C8H 4XP9L 5I30L 4QOKB 3WD5H 4KHTH 2G2RB 3MLXH 3RL1B 2OJEA 5D7IB 5DD0L 3T3PF 4DCQB 1KULA 2DQEL 4X5WB 3DSFH 4HZLA 1RUKH 2ESVE 2X1WL 1BX2A 2O5YH 2SEBB 1AQKL 4IEFB 1J8HE 1I3UA 1WVZA 5HYSA 3TFKC 4XCEA 1EPFA 5L2KD 1IILE 3C5ZA 3OJ2C 4JPWH 5F1SA 2V7HA 4O00A 5ESAB 2K9UA 2BSED 4Y19E 2C7UA 1XF1A 4CL7A 4IOIB 4C83A 2AI0H 1VGEL 4KRMB 5JDSA 3BDYH 3U0PB 5HYSG 3UJIH 5E95B 4L8SB 4MZ2A 3PWJA 3DARA 5GSRB 4KMTL 3U46A 2F5AL 5EUOB 4FZEH 5GS0D 1QO3B 4QCIA 1OQXA 3FMGH 4XNYL 4LLWA 4PJ9B 4LP4A 3TA3C 2VH5H 4XVSL 5T3ZH 4PIRF 5IMKB 2H9GB 4DQOL 1A1OB 5C0EB 3DV6A 3I84A 4AYFA 1QR1A 4MLSA 4OB5L 3KPRE 5J6GA 3I9GH 2YD8A 4ODBD 3BKYL 2BSTA 2IADA 4PGBA 1FZMB 5FUOH 1U8OA 4J12A 2JJTC 4PYGA 2OZ4A 1MHEA 3E8UL 4KTYA 4M7LL 4O5LH 3MLRL 1INDH 4KUCD 4YDVA 2PO6B 2VE6A 3IDMB 2Q8BH 25C8H 2XA3A 4L3EA 5IG7B 3MJ8A 3PGFL 1C5DB 3ALWA 1TJIH 3IXTB 4X6BB 4JG0L 4AG4H 4ZS6D 3IJYA 5I74B 4MD0B 3VRIA 1HNFA 4PJAA 3VWJC 5I1GL 3RHWK 4K23L 1GGIL 4E0RA 1E6JH 5FYJD 4JJ5A 2J7LA 1WFTA 4XXCA 4GJTB 5TJWK 4JREC 5E4IA 3TPUE 3CLEL 3HCVB 4Z76B 4AQ1B 1NCDL 3X3GL 3NA4A 2EDDA 2ARJA 1KJ3H 2K7QA 4JFEE 4WTWA 4Y4KA 3GSWA 3AM8C 1M05B 2OCFD 4RMSA 3GJFH 1Z9OA 3ULUL 4MJIB 5DQDL 3KPOA 5I18L 1OAUL 3DUUA 4XXDA 4Z7UE 1NEZA 1I9EA 1JWSB 1MUJA 1A4KB 1J18A 2GSIB 5CJQH 4I4WA 3L5WB 3WE6A 2QADD 3PQYD 4TNVK 1RVFH 4N9OB 3O3DB 4Z7QF 3KYOA 1Q94B 5K9JL 3U4EA 4HMDA 2R0ZH 1NEZG 5F7YC 2GAZA 2R1XB 3BIKB 3MO1B 1PFCA 1T6WA 1AXTH 5K9KB 2IG2H 4NKDA 1TMCB 1OGAA 4XX1G 5FK9B 2FZ3A 4L4TD 3GSNA 5FO8A 3REVB 3IRZA 2WQRA 5FF6A 2A6DA 2R0LH 1KIUA 4XBPA 1I7ZB 2YD1A 3EO9L 3QQNA 4DKDC 5FM8A 1CCZA 4PRNA 1NCCL 1SYVA 5IVOA 5FB8B 2YN3A 4CVZB 1JF6A 1FG9C 3VXQA 5I6XB 5E8NB 3KS0H 1N59A 2B0SH 1Y0LA 5I1EL 4FZ8L 3X11A 1QVOA 3HG1E 4JY4B 2GJ6E 4Y7MA 1ADQA 2DJSA 2R23A 4LGSB 5J1TC 3QUMA 3RVTD 3SJVE 1HSBB 1HHKA 3PXJA 1YA5A 4MGXA 5T3XD 4RWYH 1WBZB 3RGVB 5I75C 3O0RH 3EAKA 5DJXA 4BQ9A 5HYQB 15C8H 1JP5A 2YUVA 4OFPA 5E8DL 1TZHA 3QDMA 5JPNB 3QEUB 2A6JB 5I1CL 4KZEL 4QRRA 1HOCA 4HKXB 1X9QA 3ZKXC 1S9XB 4P3DA 4MXVE 3VE0B 2BVQA 5EU3A 4PRPD 1VADB 5IV2A 4K55A 3LQZB 2W9EL 5C0JB 3OR6A 4UZGA 5IB1B 1IT9H 2X42A 5D5ME 1T03H 1XEDA 2EDWA 4ZD3L 3ZTJG 4D0BA 4JLRA 5CSZB 1VDGA 4LLYA 3B5TA 3BP5A 5LGHL 3BZFA 5C2BL 5KVGL 3O6MH 2R1WB 2PYEB 1TZIB 5I1HH 5ISZB 5IFHL 3TYGL 3MYZA 4KVCH 4HD9A 4P3CH 4N1CA 4XMKL 5F21B 1VEOA 5F9DC 1HH6A 2OL3L 4YX2L 5E6IA 2P49B 1HZHL 3QDAA 3U9PL 3ARBA 5JUEL 4M4PA 5TPWL 1AO7A 3KWWA 5CWSA 1KCLA 5DF0A 3MMEB 4XTRC 3BRGC 5EPMA 4MCZA 4WI9A 3RZCA 4BFIA 4ZFOA 4KPHH 3R0NA 3X17A 5EU6B 4E41D 2QBWA 1H3XA 1NMCC 4KZDL 1YMHB 3QIWD 4X5XA 1UZ8B 3OKNA 3VU2A 1MCBA 3EYSH 5CD3B 3P9LA 4PJ7F 2DWEB 5IQ9B 3I6LD 3QG6B 4U0QB 3DX6A 4G9FE 4EN3B 5LQBL 1DEEB 3TBWB 2Y6SD 5CP3A 4XXDB 3LEVL 3K1KC 4OZGE 4EXPX 4NSKB 1R3LA 1KB5L 3T09A 2UVEA 1FORL 5D1QD 2AAVA 3DWTA 4FFVD 4H26A 3BZ4A 5F96H 4YBHA 5IMOB 1AXIB 3MFGB 2AEPL 5C0CD 2F53B 1HYSD 2ZSWA 4Q9BA 5TH2A 5I66B 3DI2B 3OWEA 4OF5A 1TVHA 4NIKB 3FZUC 1RMFL 3L6FB 4NQUA 2BNUB 4XCYB 1WC7A 3VCLB 5BQ7B 4QOKD 1T89C 5CBAA 4P5MB 2FX8L 4R96B 4HIJB 4XMLH 2R2EB 3DURA 1CGSL 1XIWB 5HHQA 4MA1C 4U1JB 1FNEA 2V9RA 2JB6B 1KIRB 3MGTA 5CS7A 4R97C 5ID0A 3JWNC 1LGVA 5C09B 3RDTB 5AG9A 5IIEA 4IRJD 3DETD 4M5ZL 3UC0L 4HFUL 5D1ZC 1E28A 5F7LB 4PGZA 5FYLD 1ZHKB 1ZHBA 2W0PA 1G7MB 4Z18A 4KK9D 3DECA 2AKRB 4X6DE 3EYVB 5KJRH 1IGCH 4M61B 4RFNB 1QA9A 3GI9L 5F7HA 1GOFA 3P77A 1BVZA 1RJCA 3U0WH 3HE6A 3BKJL 1IKNA 4NC1C 3LN9A 3N85H 2H3NA 1A6VH 4D9QE 5HYJB 1BVKA 5EIVA 3Q0HA 1AIFA 3UYOD 4U31A 2DQGL 5BW7A 3BKCH 2CK2A 5DRWB 1NMBL 3MQIA 5DEGA 3RWHA 1ZHNB 1WLHA 4ZAKC 1INEH 4QRTA 3AFLA 3MUGB 4HUKB 1FGVH 1A6WL 4M00A 4KRPB 4JN1L 5DUML 5F70A 5T1MB 5A40E 4NPYA 2I9LB 1BFVL 3D25A 2IAMC 5CZXD 4LNRB 4P46A 5IFAL 4HKBA 3U4AA 3VXOA 1Z0MA 3WKMH 2VZSA 1RIVL 4ELME 4JB9H 1G7LA 1NUGA 1AHWC 3ZT7A 1CTOA 3VXSB 2NY0D 4M1GL 4OGXH 1S7SA 4KROC 2V2TB 2QJDA 3U0TB 3HC0B 4BK4A 3DYOA 2Y36H 4Q9QH 4WW1B 1AGEB 2BHUA 3UO1H 2VDPH 3B8YA 4P23C 1OHQA 3FRUB 4WUUE 4MXQD 3NCJH 4WNQB 3MV8A 2VIRA 1RD6A 2XZCL 2DD8H 3DYMA 4W6WB 4KC3B 4JPKH 4M6MH 1FZKB 2PXYA 1MFBH 2DQUH 4NRXA 5KSAB 1EJ6A 2FJGA 5J56B 2HA1A 4BZYA 2DQTL 3WJJC 4GFTB 1CL7I 4S2SB 4XC1L 4PGEA 3NCCB 1QLFB 2CLRA 1F90H 2Z93B 5GGTH 2IEPA 2JB5L 1NCWL 2DMBA 5FV1L 5DHVB 4M1CC 1PW3A 4BELD 2DS4A 2RQ8A 5ANMA 4F7PB 3ARFC 1K5NA 3DPBA 4MJID 4FFWC 1CL7H 3D69A 2N7BA 5CLWA 5J6HB 3EOTL 4AENA 3FQUA 4V1DD 3TYFB 4NQCD 2ADIB 1QLEL 4CBPA 3CCHB 4QRPE 3QDGA 1XGTB 5KANG 1L9MA 3A6BH 2WUCL 2EDHA 5JNYB 1OSPL 3VG0H 1YEDA 4TULL 3QHZL 3P11H 1DLHA 2VL5B 3U6RA 3VGGA 4FQLL 1CGXA 3R8QA 4I0CC 4P9HL 4XP5L 1NBVL 1HQRB 1TVBA 4OM1L 1N6QL 3FO0L 4AL8H 1UCTA 1AI1L 4MNQA 3HNVL 3RBGA 1C1EH 5DJAB 3L3KA 5K33A 1MHHA 2BMKA 2BXZA 3HZKA 1FYTE 1U58B 1LNUB 3CMGA 3L1OL 4HG4K 5DD3L 3QEGH 4HW6A 1G0DA 3BWUC 4PJ5E 2O93L 1LO4H 1Q0YH 4KDTC 3IDIA 1AGCA 3LY6A 3L9RA 7CGTA 5I71C 1F58H 2NZ9D 2M1KA 1AR2A 1QFPA 3MBXH 3LKSB 4CADA 1NGQH 3VXRE 2M26A 4R7DA 1UEMA 4RNRA 1ETZB 3CDGB 3RGVD 3QNXB 2QHLA 3REWB 4NZUL 1HQ4A 2CH8A 5L6YL 5D7LE 4Z8FL 2AEQL 5CIPB 1MJ7H 5GS0C 5EWIL 2DIAA 4TPRL 3EFFA 4JFDA 3TT1L 2A6KA 3RWHB 1JGUH 5I1IH 1GRWA 3GMNB 3QUXB 4G6FB 1S5IH 4X9GA 3MRJA 5I0ZA 4LCIL 2GK0A 2X89D 1I3RB 5H35B 3L3IA 4DN4L 4K8RD 3WXWH 4Y5VB 3BWAA 2OJZH 3JWDH 4JVPA 4NQEE 2F8VA 3D25B 3BVNA 1F3DH 4RZCA 2VLRA 2IANB 3HHRB 3H9SB 5HGDA 5I2IB 1PVHA 4JM2A 4NJ9H 1JZ4A 5JW3H 1H3PH 4NN6B 4YGVA 1UXWB 5C2UB 3BPCB 4HLZH 1J1PL 2GITA 2LV4A 2BC4A 2YZ1A 1LK2A 3T4AA 3UJJL 1ONQB 4TOYL 3RI5F 4HUUB 4KQ3H 2Y25A 4Y1AB 4X7DC 4G6AD 3MLYL 2VQUA 1M7DB 3N1MC 4JR9H 5FCUH 2YD6A 2V6HA 1JPSH 1U3JA 4N5ED 4Z7WA 4ZS6C 1TVDA 5E2WL 4HUMB 2IQAA 4MAYA 4Z9KB 5EU6D 1ZLSL 4XNUL 3EYOA 5JZ7C 4EVNA 4Y4KD 1AE6L 4F37K 1RZKH 3CLFH 4N90E 1PKOA 3Q3GA 3UTZB 4F3FB 4PBVC 5ERWA 5BS0E 1CICA 3MREB 4RSVA 1HHHA 2BNQB 3GSUA 5IBLD 4OZHA 4WV1C 1I8MB 1Z3GL 1NGXB 1EO8H 4EN3D 4H1LA 4QHLB 4M5YL 2EO9A 4DVRL 1LDPH 2CKBB 4NJAL 3VFWB 3TNMB 4EDWL 5C6PB 3SDDA 3R06A 3UAJD 3D5OF 2KZWA 4NGHH 2CMRL 3DGCR 3BI9X 4ZNEE 43CAB 3IXAB 2QADC 3IJSA 2DL9A 3QB7C 1YEIL 2APVA 2F53D 4H1LG 3MRLA 4QO1A 3MV7B 5MEPA 3NPSB 4KY1H 1KIQA 3QQ3B 3STBA 5IGXL 1GZPB 1LP9F 5DJ8B 5IMMB 1MCWM 2IPKB 3PDDA 3ZYJA 2FH6A 3WUZA 3LHPL 2Y72A 5HHME 1XIWD 4PLJD 5BOZG 3WNOA 3VWKB 1DDHB 4N9GB 2DM2A 4DW2L 2EZ0D 3W0WA 2GJZB 5C09D 1OB1A 1WZ1H 3RDTD 3VFUA 4LPYA 1OOAA 3FOLB 4YIQB 5INDA 4YJZL 5KG9B 5D96C 4UT7H 1TQBB 1JV5B 4U1NB 1T5WA 2HKHH 2F54A 2J8HA 3MX0A 4G42B 3TNNA 2AEIT 4HS6B 3T8XA 5B8CA 1I4FA 3KLSA 1EEYA 4GKNA 3C6SA 4XHQA 1IZJA 4ZYKA 4OF0A 3RVTC 3PWUA 1YNKH 5HYJD 1RI8A 5C08E 1JNLL 1FG2A 3G5VA 1KXQE 1EK3A 1PX4A 1CGYA 5ILTL 1UKTA 5AZEH 4YC2B 1Q38A 1WZKA 4QEGA 3QHTC 4K9EC 5MEOA 4H5SB 4I2XB 3C87A 4LHJB 1BP3B 1CS6A 4UIMB 4WWID 3PWVB 4WO4C 5C0AE 3MXWH 4KRPD 3BO8B 2ORBL 5IUSA 2OMBA 2CRYA 1DQLL 4GG6E 3VFGH 3E2HA 4UQ3A 2FBJL 4P2YA 5C0ND 4X6FA 4HK3N 1MFAL 3W9DA 1OTUD 2J6EA 1I1AA 3KPNB 4LCCA 3VXSD 5KS9A 5D7SH 5I8OL 3DRQA 5ELIA 1VA9A 4EBQL 1RUPH 3CFBA 4FG6C 3VH8G 5KSBF 5FKAB 4CMMB 3JTTB 4OUUB 1IL1A 1KEGL 4YZFF 1YN6B 1V7NL 4XI5D 5EO1A 5CSGA 2QQLL 2ZUWA 4XCCH 5D72H 3OX8A 4FQHA 1MLBA 1I1RA 1MEXL 2DQIL 5EU4A 1B0GB 3IKCA 2HLFD 3RPIA 1ZVSA 1YDPB 1BF8A 4HUVB 2ATKA 4D2NA 2KQMA 3QXDB 3GHBH 3IJHB 2IQ9L 2WLZA 3WO4B 1MWAA 3QIWC 5CGYD 5A2KH 1MELA 3BEWA 3QEQB 4XP9H 5DEZA 4IMKC 1MI5A 3M45A 4PG2A 2RFXB 2Y1VA 1TNNA 1FNFA 4GKSA 1FCCA 3V2AR 4HXBH 5BXFB 5HHPA 1R3HB 2Q8AH 4U1HA 5DJCA 4OZIA 3OPZH 5HJ3A 5F88A 3PGDA 5LVEA 4Y5YB 5EU7E 1AQKH 1T21A 2Z91B 3MGOB 4GG8B 3VFNA 2J8UF 3EJYD 1UM6L 5D1QC 2NTSP 2W59A 1A7PL 4R4FH 1JYNA 1HCVA 2R2HB 1UZ6F 3EYQD 1HYSC 2F74A 8FABB 4R7NB 3B43A 5IJVB 5F6HI 3HR5B 4XWOC 4PJDA 3V4VL 4EUPB 1BMGA 4LLQB 1VGEH 3AREB 2NW2B 1N3NB 4YK4C 3B9KB 2J12B 3HLAB 1ZVHA 1BQHA 3MLTA 3F12A 4CMHB 4KMTH 3QO1A 4WENB 5T33L 3BH8A 1KJ2B 4P99A 4NC1E 4XVSH 4IRJC 1QSEB 3DETC 4NBZB 3LPWA 5EZJA 3CZFB 1GPOL 1BQHG 2BY2A 4OB5H 2IMMA 3O3BB 1B2WL 2P8MA 2VLJA 1IQDA 4KK9C 2YWZA 5E00B 3UTSE 2VXTH 5E8PB 1Q8MA 3X13B 4BQ8A 1M6OB 3HE7B 2CKNA 3X14B 5DMKB 4M7LH 1CFVL 3O4LA 2JCCB 5I1AB 1IGTB 2IC2A 1JTPA 4WFGE 1DQDH 1UT9A 3E6HB 3QHFL 3STLA 3BOVA 4N0UA 1IC4H 1DBML 1T1ZA 2DJ4A 4IJ3B 1C5BH 2WANA 4WEBL 2NLJA 1WIOA 2BSSB 4NQTA 3QUXD 4G6FD 5E94B 5TGBB 5C6WH 2A0LD 1VFAA 4MNGE 4XP4H 5KTEH 3VMPA 2R2BB 2YA0A 3IDXL 4GXVL 5FHAL 1QBLH 5DK2A 3A6CH 3BN3B 3MRCA 4RMRA 2ZG2A 5I1GH 3VDBA 1JWMB 4Z77B 4P46D 2IAND 4K23H 4ZFFB 1RZIA 5CZXC 3EBAA 2AGJH 3SCMC 5I73C 5IEHB 3VMNA 2OZ4H 3CLEH 4YAQB 4RAHA 2PTTA 5DVMA 3ZYZA 2JJSA 5IROC 3X3GH 1QTYT 4LSPL 1C7SA 3NIDF 4EZMA 1D5BA 3CAFA 1DBKH 1QBBA 3DRQB 3O3EB 3RY5A 2H41A 2NY0C 5DEFA 1G0XA 2W07A 3TF7A 5B38G 1SVZA 5MENA 4NOFA 3LS4L 1WCBA 2UWEB 3W39A 4Y1AD 4XHJD 3ULUH 5BV7L 5DQDH 5I18H 4NO0B 5FA4A 4WDIB 4MXQC 3MV8D 2QEJA 1MFDL 1MJJB 5FM5O 1OP5K 2PXYD 4LCWB 2FECI 2FGZA 4HCRL 4JY5L 1BJ8A 5HHXL 1QNZH 3GMMB 4I5BB 2P5WB 1XH3A 1WK0A 4GSDL 5DMJB 5A16B 3P3YA 4DVBA 3E0GA 3FN0L 2VDLH 3UEZA 2HG5B 5ACLA 4U49A 3I6KB 1G1CA 2IALA 1D5MB 2BNQD 4NQSA 4TNWF 1UKSA 1DN0B 3HMXA 4PJBE 1SHMA 5AEAA 4FQXA 3PWPB 2ZUUA 4UU9B 5F7EL 3SQOL 2MMXA 5FYLL 4GKSB 4LIQL 4QLRA 4AT6A 1OAYL 2O26U 3BP7A 1T0MB 1A8JH 2H32A 4RFEA 1FN4B 2EH8L 1V3MA 2EO1A 4DZBA 3OG6B 5KZCB 1WT5A 2OK0H 2QQNH 4JRYB 1G9MC 3PV7A 3VFOA 2CO7B 4KJYA 3PIQA 4HS3B 2YXMA 2CK0L 3QNYA 1Q0XH 5I1EH 1KC5L 1PG7X 4FZ8H 4IS6A 5DC9B 1F45A 4QXGH 5I17B 4NN5C 3HS0B 2Z31B 3CXDL 4JG1L 5L2KE 1OW0A 4LAQH 3KPPB 4CU7A 2O5ZL 4MNQD 3VWKD 4XPFL 2WINB 5JHDA 1H3UA 3GSNH 2XWTA 4TSBL 1UEYA 3QYCA 5I1CH 3PHQB 4KZEH 3LN4A 1C12B 2H26A 3WFHB 3FRPA 2V2XA 3ES6A 4Q7DA 5JOFA 2P48B 5C3TA 1CTNA 1BLNA 1IEBA 4MX7A 5I6XC 3QCUL 3ET9F 1JPGB 3HUJF 1EV2E 5C3LD 1S7WB 1QFUH 1RK1A 2DLEA 3OKOA 4F7MA 5B39A 3OKDB 2NX5A 4X0KA 4ZD3H 3FRPG 2HAZA 3P4OA 5KSVB 1A7BA 1CFTB 1TZGH 3QUMH 3WEXA 1IEAA 3LKRA 4POYA 3RGVC 4AQOA 4CJ0A 4YHYB 1GIGL 5C2BH 3EYUL 1W0WB 1NDMB 1NANH 5IFHH 2J88L 3TYGH 2G60L 3UROR 12E8L 1XGYH 4JE4B 5B39G 4JFDD 1CLOL 2BSRB 2ZOKA 4UT6L 4HFWB 5DRNA 1CDBA 2DM3A 4YX2H 1HZHH 3CFIC 1KCKA 4PPTA 3U9PH 1CE6B 3VD3A 1ITCA 4HIEB 3ZTJH 4PJ8B 1EH9A 4MQ7B 3O3AA 3BUTA 1A2YB 1TQCB 5IB5A 4K8RC 3P9WB 1BGXH 5JR1L 2Y4SA 3BRFA 5C71A 5IB3A 1OSZA 2XPGA 2R0WL 1WAAF 1MFNA 1GCFA 1NFDB 5T5FH 4D9RD 4KZDH 2R9HD 2F5BL 3DMMB 4ZG1A 4X6EB 5FYJE 4JRXB 3VA6A 5HPMA 2UV3A 4LLUB 2C4FU 4X4ZA 3VFSB 4JQIH 3NN8A 5FFLA 5GGRY 1WV7T 3T08A 4LLMB 3V6OE 3AVEA 4LLAA 1M4KA 2B1HL 3G6JB 3VGFA 1HHJA 1FORH 5KSUA 2VABB 1EBPA 4MAYD 4QRUB 5D2LA 1PY4A 4XXCC 4EI5A 3GMRA 5FUCC 3QFDA 5E5MB 3VDAA 3PQYE 4I3SL 4GRMB 5DTFB 3DX9A 4P59H 4Y4KC 5JW4N 4PJFF 5DHYA 3MLWL 5C7XL 2EE3A 4RISH 1BIIA 4LL9A 1C16A 1CLZH 4EN3C 2X7LB 1UQSA 1I7UB 3AS2A 3BPOB 1CGSH 2AQ1A 4P2OA 3MJ6A 1S7XB 1CF8H 4LLVA 2AK4A 5IR1A 5E08L 3UAJC 2DLTA 1HKFA 1MVUB 4L4TE 2BOCB 2N1KA 1A0QL 4JGMA 5I1DB 2HJLA 2VZVA 5DJYA 4NO2A 3BW9A 1JBJA 5HI5D 4J3TA 2BNRB 2FX7L 2WQ8A 3ARED 4KDWA 4WI2A 4HV8A 3B9KD 3TBYA 1IARB 4IIQA 4Q9RL 1MPAL 4F2MB 3S97C 1XIWC 4PLJC 3VI3E 4EQ3A 4Q6IA 3W0WD 4BZ2L 3VD9A 1KN2L 5BO1H 1REIA 4K8RL 1HEZB 4NCC1 5GISH 5T3XE 5A3ID 2EE2A 3RDTC 2GTZB 3NVQA 1QSED 3T0BA 1JFMA 3PP3K 1RQ5A 4O4YH 4C56A 4ODUB 3NFSL 5DC0A 5CJBA 4LDOB 3ARDA 3OJDB 3HI5H 4OLZH 3GIVA 1JYVA 4JN1H 2KL6A 1RZFL 5DUMH 4DGVL 2ATPB 3Q5TA 4JZNB 1BFVH 2E7LE 3V0VB 4GKZA 4HQQH 1I9JH 4PRPE 5F9OL 2H6PB 2AS5M 3P4OB 3KS0J 1QFWL 2HFEB 3IETA 1FZJB 3ZDZE 3NAAL 1KEMH 3MV9B 5SWSA 3ULVL 2MHAB 1WJ3A 2VDMH 2EH7H 2O61B 3P4LA 1FFOB 4RAUB 3BZDA 3CFJB 4GQ9L 4YXHH 5HHOB 4MWFA 1IAIM 2ICEA 3QA3A 4KRPC 3UZQA 2XZCH 2J5LB 1U92A 5SWZA 1Q9OA 5DMGD 4K7FA 1KYOK 4WIQA 2W65B 1BOYA 2DQTH 4XC1H 3SDAB 5C07B 5IB2A 3DO3A 1WBYB 2XTLA 5BZWA 3BH9A 5E8OA 1FFNA 4P48A 5DVOA 1OTUC 1NCWH 1A7QL 1LE9A 1NC4A 4YPJA 2VITB 5CCKL 2E9JA 3VXME 1PSKH 1FNGB 4MDIA 4PJ7A 5AD0B 3V5KB 4NRYA 4E41E 5EOCL 1ZHLA 4NO0D 1P7KA 4JY6A 1IM3A 4PJHF 5HDQL 5KVEH 3ARBC 4XI5C 4YXKH 1EVTC 3EOTH 5INCA 4GLRI 1XMWA 1TJGH 2Z92B 5IVNA 1QLEH 1W72A 1YQVL 2X1QA 3O6KL 4LCWD 3H42L 3I6LE 3RZCC 2Y06H 2E3VA 2HLFC 2WUCH 1PY9A 3ZKMD 2HRLA 3UPRA 1OSPH 2CJUL 1R24B 2X4QB 4TULH 2P5WD 2WM0A 5KANI 4OGYL 3HC4L 1J12A 1A7RH 4GLRH 4HH8A 4HKZA 3IFOB 4FQLH 4FN0A 4LSQL 3ZMRA 2VDNL 1A6TA 4LSRH 3QIBB 5CGYC 2VLME 4P9HH 3K4DA 1T1YA 3I6GB 1NBVH 3TM6A 5FHBH 2Q1EA 1ND0A 3RAJH 1MHCA 3PWPD 1N6QH 1CVRA 4ZMAT 3D9AL 1EGJA 2VYRE 2WLYA 3HNVH 3D2UB 4HC1A 1Q9KA 2I07A 1LEIA 4YHNA 4ETYA 4QOKE 3DO7A 1NAKH 1T04A 3LQAL 4J2XA 5D7IE 4X9BA 1Q9LA 3IDJB 4JRYD 4W70A 1KJMA 3FO9A 3EJYC 3DGGB 4ERSH 3QQ4B 2CUMA 5DD3H 2DDQH 4OTXH 3EYQC 3O11A 1FLRL 1JGVL 4P9MH 1U3YA 4FMKA 3FT4A 4KK8D 5FYLE 3QG7L 2YA2A 3MLVL 2GUOA 1WUNT 3I2CH 4JFZL 4UB0H 1OP3K 2DQJL 4Z8FH 4I0PB 4CU6A 5EWIH 2P8LB 4NHUA 4TPRH 5D2NA 3SGDI 4X7TB 2DOCA 2YK1L 1RURL 3C09B 3CH1B 4UAOB 4JKPH 5EUOE 2G9HB 3BGMB 4LNVA 2AV1B 5E2TH 1CFQA 2VLJD 4MJ5B 4DN4H 4G5ZL 5MHSD 2A38A 4U6YA 1J05B 3ZE1E 1RV6X 1YMMB 3FB7B 4KJQD 2P47B 1J0ZA 1IKNC 4ZS7L 2FO4B 3GBNH 2PTUA 3FB5B 1YUHB 5IW6A 3LH2L 5H37H 1J1PH 2OQJA 5I1LA 1SYSA 3NFNA 3UJJH 4Y2DA 1FZOB 5BW7C 4TOYH 1U8HB 4QHKI 5FAAA 3UZVB 4ODVL 4JDZA 4QHNA 3QUXC 3Q2CA 2A0LC 3L3HB 1S7VB 5IHZB 2GK2A 4NRZB 5TE6L 4GMSL 4HEPG 1ZLUH 5E2WH 3U1SL 5DT1H 5DMIL 5TDPB 3VFTA 2VOTA 3AY4A 4F33A 1P9MA 4OQTA 4P46C 4RBPK 1BZ9A 4GW1A 1ZLSH 4XNUH 3PG2A 3NACL 1MCJA 4NN6C 5BCAA 1JVKA 2C9AA 3DMMD 4WEUD 4JDVB 1LO3H 1AE6H 3IRPX 5AYQA 4JRXD 1NC4B 1PZ5B 2EDQA 3QWRA 5MEND 1J8HB 5KVDL 3I3EA 3OGOE 1Z3GH 3FO1A 1R0AL 1CXHA 4J1UA 4LGPB 1PLGH 4PJGA 4XHJC 4NDMB 4M5YH 3DIFA 4DVRH 4NJAH 4GAYA 4EDWH 3D0VB 3IU4L 3TIEB 1T20B 3FQNA 1N5AB 3QRGH 3LOWA 1VB9A 3S35H 3V0AC 4DK3A 3OG4B 2CMRH 1WZMA 3KR3L 2VXSL 2PXYC 4HWZB 4MJIE 1P84K 4KI5F 1ORSA 3T4YA 4Y16A 5DJZB 1UXSB 1YEIH 1OAXL 3N9GH 1ZT1A 4V1DE 5IW3A 2ZUSA 1DE4B 4NQCE 1A1MA 3C6LA 1U6AL 3VI4E 5HGHB 1FFPA 4XP1H 4WW2B 1XCTB 2EEBA 2XOTA 4DGYL 4PTUA 3LHPH 3WNNA 2QV2A 5FA3A 3PWNA 2Z8WC 2Z35B 3TP4A 4H1LH 4YHOL 1ZSDA 2RAMA 5JO5A 3NABH 2GHWB 4HIHA 4MA8L 4JZOA 4Z7UF 3LEXA 3QWOB 1MOEA 3SPVB 1IGIL 3K4ZA 1P4LB 3OKYA 1JPTL 1J0KA 4LSUL 3CH8A 3NPSC 4NZJA 3RWGA 3BDBA 2BNRD 5K9OA 1Y6MR 4J8RB 4JZJB 4LPVA 3SDXF 1DQJA 2CDEB 3E3QA 3MUHL 3FONA 1JNLH 4DUWA 2W60B 2HVJA 1NGYA 2EC9U 1IGYB 1JPFA 3VWKC 5JHDD 3QUYB 1QRNA 5ILTH 2GTWB 1WQVT 2AEWA 1BD2A 3IVKB 4PGCA 1FIGL 4G7YL 3SKOA 1WIUA 3VRJA 3LKQB 3MRIA 5DJ2B 3F5WB 4AH2A 1EAJA 3TPUB 2Y23A 3QFJB 2VXQL 2XZQL 3DXAB 3MLUL 3JV0A 3CXHJ 4BH8A 1DUZA 3O2DA 5AG8A 1BBJA 4NT6A 1DQLH 4R0LA 5EC1A 3WLBB 5HPOA 4U0RB 2WP3O 1MCOL 2WWMD 3CFCL 4CJ1A 4Q2ZB 4WI3A 5IESL 4BKLB 4L8DA 5IW6B 4F9LC 2KDGA 5I8OH 1IRAY 1V3JA 4YC2C 1EHXA 4JFXB 2EE6A 4TYUA 5IT2H 1VKXB 2MCG1 2QR0A 3RWEB 5ITFA 1A3LL 4C4KO 5IFJA 5HHOD 2QQLH 1XGQB 3HB3D 3VG9C 2IWGA 5EU5A 3DV4A 5CUSL 3RIFK 3MZGB 4IOFC 5E8EA 4OIIH 1OM3L 2GJJA 4K3EH 2HFGL 2DQIH 1R3IL 1MLCB 5J57B 3GSQA 2C3VB 4FQQB 2EIDA 4JHAL 3FOMA 3V7AE 3SDAD 5C07D 3Q1SL 4Y88A 4LHUB 2A1WL 5T1DH 3EFDL 5TQ0H 3P73A 1QBML 2WUBH 2IQ9H 3V52L 3HPJA 5ADOH 2CKBL 1T83C 1HHGB 3GRWA 2X4OA 2EDTA 2R9HC 2J6EH 2RJMA 4Y5XB 1F3DJ 1G7HB 4ZFZB 4NZTL 3G08B 1AD9B 3P0VL 5EU6E 5FUCE 2N4IA 1KLGB 1PJ9A 1L8JA 4PRIB 4BFEA 1U42A 4OZFB 5E7BA 4I18A 3CFDA 4NKIH 3TBVA 4MS8D 2GJ6B 4D0CB 1MFCL 4RGNC 3ROLA 1UM6H 3VXTB 3F6IA 1A7PH 4P2QB 4MAYC 2VLLB 1MCCA 4H8WC 5AWNL 3KLHD 1RZ7H 4PJEF 3KPMB 1SJEB 4LMQI 1EHNA 3QIBD 1U8KA 1LE5A 1U3HB 1YN7B 1CICC 1CGUA 2F53E 4U1GB 4YO0B 3JXAA 4WGWB 3SE4A 5J11B 2EYSA 2BVOB 3VGBA 3D2UD 3QH3B 3ILPB 4P2OD 3C8KA 4YHKH 5IBTL 4L9LB 3E1F1 4TQEL 1G84A 3S3SA 4PR5B 5CEXB 4Y5YC 2YUWA 3KPLA 4N0CA 3K4AA 4G6KH 1UB6B 1S7TB 4YDJB 1RK0B 3HZYA 3MJ7B 3STZB 5C09E 4OCRH 4UTAL 4ZUWA 3TBSA 5LAXB 2KZ1B 4TVPD 2Q6WB 2AP2A 3GM8A 1K6QL 1VACA 3PF2A 4LLDA 3AREC 3QUZB 3HAEA 2X4UB 4LDLB 3X12B 3PDOA 1CFVH 1MY5A 3PL6A 3B9KC 1P4IL 3LKPB 4JQXA 3TIDB 5DSCB 1ES0A 2V17H 5AZ2H 4GOSA 1MCEA 2Q76B 1RZJH 4HWEL 4IRSB 4X5LA 3WFCL 4I0PD 4HJJH 1DBMH 3ARWA 4NFDA 5FECB 2ZNXA 2IH1B 3TV3L 5HYJE 3HAEG 3RKPA 5A3IC 1CD8A 4OAWB 3H7LA 2HLAB 3ARDD 3ARTA 3KPTA 4XBGB 3IDXH 1M7XA 2W0LA 3GKZA 3QUKA 4GXVH 1P4BH 5FHAH 2IBZY 2HMID 1UM4H 1LVEA 3O41A 2Y5TB 4DOHB 5GRUL 2W9DL 4XAWH 5B8CC 3ARGA 1YMMD 5CLTA 4FHBD 2DQDL 1NAMA 3VXNA 3WIHA 1IM9B 1ZK9A 4G9FB 5IVXF 3FFCB 5ECJE 5DI8A 1R5VB 2FYYA 1C5CH 4LBEB 3NZHL 3EO0A 3C8DA 4UDTA 3B3IB 4G43A 2CQVA 3B4NA 1BJ1H 5SWSD 4PJIF 1FVCA 3R1GL 5BRZB 4NKMB 3QCTL 3VXSE 3GSVA 5BV7H 3NZ8A 5JORB 4ONFL 4H8WL 4TUJA 1MFDH 1XCQA 1WFUA 3D3VA 1MQKH 4XP6H 2DI9A 2WIIA 5LGKA 5DMGC 2HTKD 3E2HC 1KACB 2ZUQC 4EI6B 5HHXH 1F6LL 1YEGH 3FOMB 2MQ0A 5IEKA 4PP1D 4DKEL 5IMLA 2COQA 4C57C 4EUPG 4LCCC 3FN0H 3ZKQD 1NC4D 4YDIH 1IKFL 3L3DB 4ELMF 2PW2B 2XTJB 1JF5A 5CEZD 5DQ9A 3OXRA 3RA7L 2XWBB 2DLHA 5EZIL 2JF1A 3L3JB 3U79A 4CN1A 5JIPA 5C8JA 5I16B 5BJTB 1BM3L 1BQLL 3OXSB 4LIQH 3C60A 1OAYH 4AEIL 1J1XH 3H3PL 5EB9A 2YSSA 4PRHA 5CP7A 1OF2B 1P7QA 2ZKHL 4XCNA 3WHXA 1U8NB 4K2UL 2DQHL 2FNBA 4Z7NF 2J8UA 3TC9A 5DRXA 5E2JA 3ZKMC 1PGRB 3QBTB 5I15L 3MYJA 1JHTA 2B20A 2ZUXA 2CK0H 5L0QC 5DUBA 1H8OA 1P2CA 1KC5H 3GUTA 4HF5L 5GGRB 1LP9B 4RA0C 1KJ2L 3G5YB 5B22A 4JG1H 4XNMA 4CW1B 4JEGB 1P6AB 3HMXH 1RJZA 2F8XC 2CIIA 4HWBL 1KTLA 2A6IA 3GSXA 3P4NA 2AXFA 2VZTA 1LILA 32C2A 1NCNA 2HKFL 2V9TA 4I48A 3S4SG 3H3BC 1XR9A 3VXUA 3SO3B 3QDJA 2H32H 3K7UA 3X3FL 2Q86A 2DLFL 1N8ZB 1YYMH 3QCUH 3HNTL 1PKQA 1CWVA 1I3GL 3ZL4H 5LGJA 3S36H 1AD0B 4L1HA 1OVZA 1V3LA 4P5KB 4AY0A 4JANA 1TCMA 5JIKA 3I50L 4KK8C 4G8FB 5EIIB 3BESR 1KCUH 1L0XA 8CGTA 3QO0B 3ULUF 3WSQL 3QUYD 1GIGH 5GS3A 1X7QA 1RY7B 4PY7B 2BDNH 5H2BA 3RPKA 3AC0A 3WFEH 12E8H 2VDRH 1DUYB 3EZ8A 3U83A 3MTRA 2QQKL 3U7AA 3W11D 4LPWA 2AJUH 3MV11 3ZE2E 1KENH 3RTQA 4U1SB 5LG1A 5SV4A 3QFJD 3DXAD 2DQFB 4PJAF 5GS1B 3CVHA 3AAZA 5D71H 2XZZA 4LK4A 5F6HJ 3OJVC 2VZUA 2HFFB 1RFDL 3VD4A 3T1FA 5I8EA 5JR1H 1FO0A 4K7PX 4JQVA 4KXZH 3V6ZB 2R0WH 2AXGA 3L5IA 3OGCA 4WI8A 4WRLA 3ARQA 1DANU 2X09A 3QJHB 4N0YL 1HCFX 4JFPA 4JFFA 3DUSB 4NO3B 1J87A 4XVJL 3TVMA 2F5BH 2JJWA 2CIKB 2IANE 5IOPB 4BSWB 5KSBB 4JCMA 3MLPA 2FB4H 2XA8L 4KUZL 4Z5RA 5GHWL 3S37H 5GRJL 2F15A 2RR3A 3JV6A 4PLNC 2WIMA 3MROA 3CMOL 2HWZL 4OF7A 3CPLA 1L0YA 1H3WM 2B1HH 1TQCC 3B2UD 5JXAH 5D70H 4Y1AE 1N6UA 5HI3D 4LHUD 1T5XB 5EZOL 3QJFB 4LASL 1RJYB 4DN3H 3MV8E 4ZTOL 3UXFA 3MJ9L 2JJSC 1JTOA 3DMMC 3MRNA 1NGWA 1SQ2N 4XVTL 3V0WH 1ZGLM 2OBGA 3MCKB 4KK6D 5D1XA 4Z0XA 3TF7C 2J1KA 1FYTB 1BEYL 3TZVB 5TE7H 5C7XH 4PRID 3AB0C 2YXFA 1DVFA 2V2WA 2BNQE 3FQXA 2I9TA 4OCWL 3PABA 1ULVA 1J1OL 5E08H 4XWGH 3WIFB 5TDNA 3HNSL 3KDMB 4WHTA 1TPXB 3RVVD 1G7IB 3VXRB 1H3TA 1QP1A 4RMUA 4M9OA 1FV1B 4PB0H 2VSCA 3UCRA 3FO2B 4O58H 1U3HD 1VSCA 5DD1H 4U7KA 1O7SA 1H0DB 5DO2D 5CHNA 1MH5B 1U93B 4FABL 1MCLA 2QLVB 3MV7E 3O8XA 1I1FA 1LMKA 1R5WB 2VLKB 3VW3L 1H5BA 3BPOC 1NEUA 1JNNL 1SJHA 5TE4L 1KN2H 4GT7A 4FNLH 3DVGA 1PYWA 4I13B 2ED7A 1GJIA 1FIEA 4G9DA 4MNQE 4XC3L 1JZ7A 3NFSH 5FDWA 1ZGLP 4MDJA 3VWJB 1HILA 1K4DB 4DGVH 1HH9B 4M62L 5DJ6A 2UUDK 3HUJA 3BT2L 3FT3A 4PS4L 4UQ2A 4Q58C 4CN6A 4JREB 3PJSB 4PD4J 3QUZD 2B2XH 3F7RA 4N0FA 1E0OB 4CNIB 5CJ8A 3G6AA 5F9OH 3M17B 1OW0C 3K46A 4QRQB 3IGAB 1QFWH 2P8PB 4IRSD 4JFOA 5F71A 3RWJB 3FQTB 5D8JL 2Y07H 3RWIB 3NAAH 4V2BA 1PQZB 3ULVH 1OWWA 4WCYL 1P1ZA 2FH8A 1QFOA 2IH3A 2IMNA 1HSAB 1M7IB 5CEYB 1FL3A 4X4YB 2HT3D 2YRPA 5AUMB 3T0WA 2VWEC 3UYRL 5FKPB 4I2XE 3O6FA 4JFDE 4PFEA 3F62A 4U1MB 2X1XR 2XXMB 4G8GB 1UH2A 3CUPA 5LBSH 1CD9B 3CC5A 3FFCD 2Q3ZA 1WAAA 1R5IA 4DFHA 2EIZB 5DA0B 5JTWA 3S88L 1NC2A 5EORL 1HXYA 3QCVL 2JJUA 3WJLC 4TRPL 1DLFL 2I60L 1ERNA 2D7NA 5F1NA 5ID1B 2P7TA 3PHOB 5DD6A 2PYFB 3TWCL 4AMKL 2ITCA 2I24N 1QYGL 1R3KB 4D9RE 5I8CA 2O5XL 2X4PA 2BK8A 4OF3A 1WBXB 1ZANL 2JKXA 2VDQL 3O6KH 1A4JA 1JZ6A 3H42H 1I8KB 1Z2KA 4P2RB 2CJUH 3WS3B 5E6YA 4UUJA 3SDAC 2YD9A 4KRLB 5HHMB 4OGYH 4X99A 4GG6F 5H8DA 4R8WH 3NH7H 5T1KA 1OP5H 1G0YR 1NBZA 2XTJD 4WFHD 2VDNH 4B41A 5JW4Q 5E99H 2WWKO 5D6CA 5I75B 1LEGB 4X80H 3E6FB 4UTBH 3BXNA 4X7SL 1SJXA 2VSDA 3KPSA 4LKCA 4GRWH 3GKWL 2D4DA 3LRSA 3O6LH 3T3ME 1GGTA 3LQAH 2H2SD 4YEEA 5ICZB 2WMPA 4MS8C 5F7UA 4TUKL 3PXHA 1I9IL 2C5DC 1U91A 2UZIL 1KELL 2YUXA 4QGYA 4S1QH 4S1RL 2D9QB 3G6DH 3WN5B 4L4VB 1YC8A 4LF3A 3OKMB 2X9YA 3A6OA 1JGVH 2KPNA 3ILQD 5JW5B 1OT2A 2OTWA 3MRRB 3WFDL 3QIBC 2AVGA 4XBEL 3PWLB 4HUWB 1NBYA 4TUOB 2YPLA 5DJ0B 1QSFA 1A9EA 3L5XL 4MQSB 5DRZA 1KB9K 5J1AA 3MRGB 3IS0X 5I1JL 2ADJA 3MRKB 3DROA 1U8JA 3KPQA 3V8CA 3TJEL 4P2OC 5JW4M 3UTTA 2DQJH 1I7TA 4IM8A 1NLDH 1TITA 1RZGB 1YJDL 2FIKB 4WU7A 3RUGF 1WIPA 2YK1H 1RURH 1FPTH 2NXYD 5DURB 3CNKA 5FDWB 1IAMA 4LKXA 4ZQKB 1F4XL 4L8BB 1I8IA 3QAZC 4MA3A 4BSVA 3N1FC 3W0WE 1SY6L 3ARPA 2XV6B 3RY4A 1X5GA 1DL7L 2IPTL 4G5ZH 5GRVK 1G7QB 1QSEE 1NJ9A 5EBGA 1X5HA 3RHWF 2DYPB 3UBXA 2W0FA 1QLRA 3GMQA 2BVUA 4HUXA 43C9A 4ZS7H 3GJFB 3RIAK 4X9FA 5IW1B 3P30L 3ME0A 1S9YA 1G6VK 1MRFL 4Q6IC 3GI8L 5DFWH 3MUZ1 4I0PC 2JCCE 5E2UH 3DRTB 1XFPA 3UBXG 1QBAA 2J3SA 4LCUB 4RGOL 3C09C 4UAOC 4FQJH 1S7UA 1T3FB 2FD6L 5JDJA 3QNZA 4S11A 1XF2A 3ARDC 1YEJL 3C2AL 2HMIC 4O2CA 2DBLH 5IM7B 4BFBD 5TE6H 2B4CC 1E27B 3CU7A 1KUMA 3O6FB 4KTDL 4NP4L 4Z7OF 3W81A 5ADPH 1AFVL 3F7YA 4QHMB 1QEWA 4TNVF 3BZEA 1KV3A 2VRAA 5E5UB 5JHLL 2PN5A 1T7VA 1RUAH 5E24E 2VKXA 5C0IB 3LS5H 4GMTL 1UH4A 3WLWD 3C5SA 5EZLA 4PUBL 3TO2A 4KVNH 2XKNB 3WCYA 5EO0B 3Q48A 4G8IB 3GSRA 5F89A 1RHHA 3V6FA 1E4XI 5GSVB 5HGAA 1KPVB 2X5PA 5KS9E 4J6RH 3Q6FB 3F6LA 4OCSH 3P9MB 4PJHA 3MLZL 1DCLA 3NCMA 3GJEB 3IU4H 1JZ8A 1XGPB 4FP8L 3D39A 2ZUTA 3FT2A 2A77L 2EDKA 3MXVL 2C4XA 3CSYB 2UWEE 2HJKB 2VXSH 1OD7A 2HTKC 4U6XA 5L2JB 1IC5L 4KJPD 4PP1C 4OQTH 3UDWC 5GQBA 1U6AH 5B3JE 3PNWA 4LCWE 4TVSa 4PJXA 4HPYL 1Z9LA 2FR4B 4S1SL 4HX1A 3T77A 4ZSOA 4ZOBA 3TZVD 4PJFB 1ZA6B 2P5WE 3BD3A 1ZS8B 3N06B 3HZVA 3IDGA 4DGYH 1F11B 4G3YL 4M1DL 1JRHL 4LSSH 1RIUL 2YEZA 3TJHD 1AC0A 2HFTA 1XF5B 3CFEA 3KPSB 3SE3C 3ULSB 4RWHA 4YHOH 1KTDB 1IGFL 3AXLB 1MIMH 1MNUL 1Y6KR 4OIAA 1I85C 4QTHB 3PWPE 2FEEL 4LMQE 3UTPD 4MA8H 4NZDA 3C5JA 5AYUL 4H25B 4MCYB 1NGPH 4M43L 1JPTH 2IAMB 4IMLA 4MSWA 1HI6B 1D5ZB 1EEUA 5DK0B 3SE9L 5BVJA 4M8QA 3SKJL 3G04A 3ARVA 4JRYE 2ZSVA 3DTXA 1X5YA 1AHWB 2GT9B 3DI3B 1U8LB 2UZYB 2WBJB 2VLKD 3BX7C 3VGAC 4ZDHB 4LAJH 1SBSL 5J1AB 4K07A 3HFML 4RFOH 5EA0L 1C08A 5MEQB 4Y4FA 3HI1A 5CINL 2FL5B 4G7YH 1QQDA 4JHWL 4MD4B 3QDJD 1HINL 5HDBE 2ESVA 2CGRL 3IU3A 4L8CB 1WWAX 1ZLVH 1S7QB 4XB8A 3MLUH 1K2DA 2DKUA 4OKVB 4OSUL 1MCSA 2YPKA 4LGRB 5HGBB 1JN6B 1G7JA 1MAMH 1LDSA 4JM2F 4XCFH 5F3HA 3MR9B 2X4TA 3VRLE 1MCOH 2CO6B 3CFCH 2EYTB 3K74B 3JVGA 3VFVA 2OSLA 2VLJE 4Y19A 3OJMB 1QSZA 3QUYC 1FGNL 2OTUA 4ACPA 5HHNA 1ZTXL 2JIXB 2Y7QB 1M71B 4YDLB 2FJHB 5D2NC 3KXFB 3KJ6L 5GRYA 4YUEL 3W11C 5F1IB 5IQ7L 2C1OB 1MHPL 4Z7WF 1NGZA 4MJ6B 2FLRT 4OFVA 4NZRH 5D7KD 1AGBA 4XNQA 3MBEB 4AIZB 3QI9A 5GXBB 4G8EA 4UNVA 3OBAA 3S7GA 1VGKB 3BQUA 4G8GD 4KJWD 2XKSA 5F44A 3KYMB 1I8LA 4R3SA 5DYOB 5CEZL 2QHRL 3KPRA 2LQRA 1EEZA 1YPZF 2YR3A 3GMPB 1IAOB 4JFFD 5JOEA 4NNXA 4MB4A 1KCRL 5F7NC 2P5EB 4C4KT 4OZHF 2BOBB 4ZUUA 1UA6L 2AV7A 4GBXB 2VNCA 1AKJA 4NZTH 3MRPB 2CRZA 2BCKB 4YPGA 3WXVH 1NFDE 3SDYH 1D6EA 3MA7B 2OM5A 3GK8L 3MUJA 3QEHA 3DX8B 4PJHB 1BZQK 4ZTPH 4JRXE 1T4KA 4QRSA 1X4ZA 3NIFF 3L7EA 5MENE 3HPLB 1YECL 3K0WA 4P2RD 1MFCH 3B2UC 2MWCA 1P9MC 1T2XA 1A6AB 5HI3C 2VQ1A 2MQ3A 2VUOA 3RNQB 1JGDB 1JUFA 4ODWA 5AWNH 1WEJH 3EDDA 3SGJA 2DKSA 3M1BA 4Q97A 4M7ZC 1ZWIA 3KYKL 1CK0L 4R4BA 5D1XD 4Y89A 1JF1A 4HX1B 1MREL 4QHKJ 1WZLA 4KK6C 2WAHA 5LWYL 2X4RB 3B6SB 4R6UA 5EC2A 2J2ZA 5T3ZD 4JFEA 2ADGA 3GGWB 5A1AA 1IGJA 2A83B 4XH2A 3EUUA 3PGCA 1DVFD 5GIRA 2D4FA 2ICWA 4LP5A 3L3OA 1QUNA 1JYXA 1GHFL 3T3PE 2DAVA 4MMZC 4Z7UA 4L4VD 5DA4A 1U95A 3RVVC 4GW4B 1AXSB 2EDEA 4HS8L 3DX7B 4P49A 3H8NA 3HKFA 2G75A 3V9FA 1U3HC 2HJFB 4MD5B 4JO2L 3HRPA 4Y8DC 5DO2C 5DMYA 5DS8A 2X70B 5FM5M 3O8XD 1AR1C 3ECBA 4PRAA 1KPUA 1UB5A 4QXTB 5IVZB 4L4JA 3MGAA 2BNRE 4MA7L 3H9YA 3WUWA 2MFNA 3V5HB 5J9PB 4HLZG 2C1PB 5A2JH 4Z7VF 4X9HA 1BVLB 3WIIL 1IE5A 4PJCB 1JNJA 1NCBL 2WW8A 5DURD 2YKLH 1KT2B 1YEHL 1HXMA 5J4MA 3GM0A 4NQXA 5JHDE 4X6CF 1QPPA 3WUWG 2XFXB 5BVPH 5GGVY 2NY1D 1XF4B 1U8MB 4PP2B 1BFOB 2BFVL 3MNVB 3FQWB 5GRUH 1CDCA 1S9WB 3PV6B 2W9DH 3VFRA 5J12B 3MFFB 2VWEE 3QUZC 2DQDH 4O2FA 4LDEB 3RWDA 3E3QC 2DLIA 1Z5LB 4PB9H 2VTFA 3HG1A 3T1WA 3HAEH 3NZHH 4NKOB 3SJVA 1T66C 1E4XL 4IRSC 4WY7H 2R4SH 5ICYA 2X4SA 3MNZA 4HXAH 2KKQA 4OBRA 4PP8C 4NNPH 1G6RA 2XQYK 2PCPB 2Q20A 1KLUB 1DQQB 4UDUB 1ZGLA 5HY9B 3QCTH 2ITDB 2AXHA 1UM5H 2HT3C 2QADB 1T0PB 3PQYB 3O6FD 3C8HA 4JN2A 4NKQB 5T1LA 4RAVB 5TFSL 4P4KB 3QI9B 3CDFA 4R0LC 1MRCH 5HHOE 1UWGH 5HTSA 3D85A 1AGFB 5D5MA 1FNLA 1NC2D 1NAMH 2GCYA 3VFPB 1IAKB 4NYLA 3WIHH 4K7PL 4U1IB 1IKFH 1YEEH 2VXVH 2ID5A 1JK8A 1LO5B 3MNWA 5C07E 1OARH 2AJSH 4TSAH 5EOTA 5EZIH 3HRZA 4YHZH 4RBPH 5GGUA 3FB8A 4KGJA 1D6EB 2NY7H 3ZDZF 2H45A 2NW3B 4NQVA 2FSEB 3K1DA 2YBRB 4TTGA 3RWFA 2EIBA 4O51B 4LEOB 2AJYL 1F2XK 3H9HB 4L5FL 4EUPH 4K2UH 2DQHH 3BYYA 5D96B 3HZMA 5FYKD 2NNAB 4ONHA 1EIBA 4HDIA 5EN2B 1U3ZA 2R4RL 5GRXG 1N7ML 4PJDF 1WFOA 5ALBL 5IF0A 4HF5H 3GMLA 4ORGA 2XTJC 1OPGH 1KJ2H 2M2DA 3K81A 1MF2L 4OCXL 1KPRA 4M8VA 4GAGL 4OD3L 4Y4HA 4HK0B 1CBVL 3TO4A 3KPSD 4HWBH 3BAEL 4JFQA 3DHMA 3ARUA 2E7BA 2NMSA 5JMRA 1IEHA 1A1NA 4WO4B 2H2SC 1NMAL 3O4OB 3BHBA 4YQXH 3F7QA 2V5YA 4DZ8A 2I5YH 3X3FH 4PRDA 2MQCA 4OZGA 1Z9MA 2IAMD 4YWGH 4D9LL 4F7TA 1ZT4B 4UIKL 4NQDB 3ROOA 2XWJB 4HKJB 1YNLL 1HWGB 5HHVL 5TDOA 1NKRA 3IF1A 3ILQC 3T0EA 4U1KA 3OKEB 4ETQA 2WBJD 4PV8A 4ZPTB 2C3GA 1FAIH 2HT4D 3SDXB 3SE4C 3BN9D 3SKMA 1U8PB 4GUPB 4AM0B 4P3WA 1U9KA 4OV5A 4TVPE 7FABL 1JHKH 1RJLA 3DVNB 3S5LA 4OFIA 4ZFGL 3TBTA 1YNTA 1E4KC 1CDUA 2HN7A 1IAII 3ZTNL 3SO3C 4NHCH 4WUKL 4WHDA 4QWWD 3IAQA 2NXYC 1B0RB 1CDYA 4JKMA 4XRCA 1INQA 4LSVH 1KJVB 1YYLL 4GRLA 5EBMA 4F7EA 1B0WA 4JAMA 1S7RB 4PV9B 1IAIH 4CVUA 4DKFL 4E41B 3ARYA 4QTIL 1H8SA 4X6DA 3NCYP 3T0XA 4N0YH 1SM3L 4UBDD 3PL6C 3K3QA 1G1YA 4PYHA 3U48A 4FTVB 2XNAB 9CGTA 2WBKA 4ZNCD 4GW5A 1KFAL 1D9KA 1G7PB 2JIXD 3EOBB 4M7KH 1YMME 4F37F 1FNSH 3O45B 1JYWA 3TCLB 1I9RH 4FXGB 4PJIA 4LSDA 3KXFD 4HZAA 3GB7B 2XA8H 2BHYA 4JPVH 5GHWH 3GMOA 4HG4J 4F7CB 3L5JA 4PTTA 4E5XA 5GS1C 4RDQG 3MBED 5CJXA 5GGSA 1JZ3A 1K4CA 3T65B 5C0GA 4BH7A 2BY1A 5EUOF 3GO1H 1QOKA 1ORQB 2GY7B 4XAKD 5C0CB 1OQOA 5CBEA 3BSZL 1CDIA 1HKLL 3Q5YA 2UYLB 1MCNA 1BZ7B 4ZTOH 5ACZA 4MNHB 4Z78A 4FXKA 3D85B 1FJ1B 1HDMA 3MJ9H 4IDLA 2P5ED 4HHAA 3WLWC 4NO5B 1FRGL 3CFKA 3MJGX 3F58H 4GBXD 4ELMA 4RX4D 4V2CB 4YK4B 5IB4A 1EAPA 4XGZB 1I1YB 4YHPB 5CZVL 3DHJA 1SEBB 5GZOD 3ARRA 3LD8C 1B3JA 1FVDA 4MQTB 3I75B 1S9VB 3D39D 2AJ3B 1KCGC 5CEZE 3TN0B 5TF0A 1QFHA 4IRJB 4PJ7E 4QY8A 3U36A 2GFBA 4WJ5B 3CD4A 4WUUA 1F13A 3HNSH 1XR8A 1JZ5A 4HPOL 3GNML 4ONHB 4HJGB 5C0FB 3D0LA 4KJPC 2ZOLA 5C6TL 3FCTA 3WFBL 4PJEB 2NTFA 4PRBB 2RB8A 1A14L 1JFQL 4YXLL 3RNKA 3TZVC 2FHCA 3P4MA 3VW3H 3IDUA 5D9SA 5ESQB 1ZT7B 3TJHC 5AAMA 4WTZA 3H0TB 5MERB 1QG3A 3C60C 1JNNH 3S34L 5IBUG 2JK5A 2APBA 1N6VA 3I02A 4ZUVB 3VFMA 6FABL 5F9JA 4IRZL 1TPXC 2YRLA 4QHUB 1SBBA 1JNHB 4X8JB 1BAFH 4QRPA 4EDXB 4WTZG 5IKCB 1N64H 1KNOA 3L5HA 4M62H 4WFED 4JPIB 3QDHA 1KN4H 4OD2A 3C2SA 3AU1B 4PBXA 4B53A 3SCMB 5I73B 2NY2C 4LVNC 4I3RL 2J4WL 2D03L 3VI4F 2D0FA 1RZ8A 4F15B 2NY0B 2VISA 5CMAB 4P5TB 4ZPVB 5DQJB 1KCVH 2YD2A 3O9WB 2VAAA 5BMFL 1UENA 2A73B 1DFBH 4K94C 2CLVB 3BP6B 3LRGA 3GIZL 4Y4FD 3EDKA 4WU5A 3VJ6B 3S96B 1DBJL 1KIPA 4YE4L 1D5XB 1NCAL 3BKMH 4A6YB 5FXCH 2YD3A 4UOW1 1G9NH 3QIUB 4P4RA 3CX5K 4JDTL 3MRHA 5JZ7D 1BBDL 3QFJE 5ALCH 1J86A 1YEKH 3DXAE 3L95B 3TA3A 4ELKA 4PJ5A 5IVXB 1GGBL 2VC2L 1BPVA 2QSCL 2XQYG 5C9JB 4G80A 1J88A 5KN5B 2YMXL 4LEXL 2XQBH 1A6ZA 1GGYA 1HE7A 2I60H 3W82A 3B2VH 2JJTA 2AABL 4V1DB 3RTQC 3TT3L 4ZUSB 1QYGH 3ZE0E 4NQCB 4L29B 3D18B 5CILL 5D7LA 2Q7NA 3AROA 3SOBH 5L7XH 1ZANH 4P4KD 3QI9D 3ZHDA 2VDQH 5ETUA 3BQUD 5D2LF 3JV4B 2EXWD 1FL5B 4KJWC 5I19H 1VFBA 1YY8B 2RCSH 1LD9A 4OZ4A 5F8RC 2A74A 5ESVA 5DDHA 5EBWB 4IHOB 4NQEA 2PW1B 3EYFA 2RHEA 2QKIA 4NN5B 5I9QC 3U9UB 2HP4A 4N68A 2DBJA 4KK5D 2OJEB 1NL0L 1U8IA 3QZWA 4TTDD 3FTGA 4KTEL 4HZLB 5CKAA 4X7SH 4U1LA 1BX2B 3GHEL 5EUKA 3GKWH 5GS2H 3BP4A 3RX7A 4K3DH 1IGML 3D48R 5HYSB 3BE1H 3RGHA 2DTML 1JL8A 4XCEB 3QZWG 4KI5D 4DUVA 1FC1A 2JLLA 3OAZK 4PRIE 2EKSA 1K8DA 3EJZD 5C1MB 3AM8A 1ZEAL 3C5ZB 5EG6C 1XR8B 2V7HB 4LVHC 5L88L 3C9NA 2E27L 2C7UB 4C83B 5E9DA 3ISWA 5JDSB 4R26L 5K9QG 1CN4A 4P2QE 4YDKL 5D1XC 4G7VL 4OI8A 4OCNC 5DVLA 3PWJB 1ZLWK 3ULVF 5FUZL 1F3JA 3MRMA 4JFED 3U46B 3MRQA 2OL3A 5GZNC 4BJLA 2VXUH 5BS0A 4QCIB 4LLWB 2C4FT 3TJEH 1X6NA 1DVFC 1Y18A 5GRWA 4WO4D 1NUNB 4GXUM 4KKLD 1YJDH 2A9ML 1VEMA 3DV6B 4QT5A 1QR1B 2OTPA 5J6GB 3MRBA 4OLXL 2X05A 5GPRA 4ONGH 3WN5C 4F9PA 3SDCA 2BSTB 2IADB 3MRFA 4PGBB 1F4XH 1XGRA 4NQDD 1SY6H 1U8OB 3DBXA 4ZNEA 4Z95H 1ZA3A 1DL7H 2IPTH 1MHEB 1SEQL 4NUJA 1LQVA 4EXKA 1ZAGA 1S8DA 3O8XC 4FG6D 4UV4H 3IFNH 2F19H 1H5BC 4YDVB 5MP6H 1V5JA 2VE6B 1ZLUK 1H15A 4M3JA 4L3EB 2E9WA 4OV6F 2Z4QA 1RU9L 3MJ8B 1OCWL 4R90L 1HK6A 2G5BA 3LN5A 5FO9A 3K8KA 1A6UH 3KLDA 4DUXA 1KB5A 3J8F7 4X8XA 1A9BA 1XAUA 4N8VA 3IJYB 3VRIB 4PJAB 3UBXI 1BFTA 3C2AH 1EFXA 2DF3A 2BVPA 4E0RB 4KTDH 4NP4H 3NFPA 2NY1C 1AFVH 1CDJA 4JJ5B 2HVKA 5IJKA 3DSFL 3FB6A 1RUKL 4HT1H 4CU8A 4AZ8A 4APQA 2O5YL 3MOBH 1U0QA 4N8VG 1MIEL 2ARJB 1WTLA 4FTVD 4GMTH 3HG1D 4L3CA 4Y4KB 1S9KC 1T2QL 3GSWB 4DOHE 1L9NA 1Q1JH 4GRWF 1LO2L 4JPWL 4LU5L 5FGSA 5C08A 3FFCE 3KPOB 3AUVA 2OI9A 3DUUB 5GJTL 4TN9A 5KVFH 1NEZB 4GKOA 1MUJB 3NCEB 3BDYL 4I4WB 2YD5A 3WE6B 4FP8H 1C7TA 2C3WA 3KYAA 5DZNA 4HIIA 4KU1A 3MXVH 3O6FC 3BGAA 5BRZE 2NY6B 3KYOB 3S3PA 5C0AA 5I8KL 5CGMA 3NTCH 3U4EB 1J0YA 1D5IH 4CVXA 5L9DH 3FMGL 1CR9H 2GAZB 1XF3A 4X4XA 4XWOD 2VH5L 1KG0A 3D85D 2EEDA 4GG6A 4PG9A 3MOAH 4NKDB 1OGAB 4HPYH 3JBG7 3RWCA 4ZUTA 2FZ3B 3RY6C 3GSNB 5FO8B 2P24A 5FF6B 5FUOL 4G3YH 4M1DH 1NFKA 1JRHH 2A6DB 2Q87A 4XPHL 4XBPB 1LEKA 1C8PA 5ITBH 5EO9A 2XTJE 4WFHE 3TN0D 1A21A 4O5LL 3ZDYE 1IGFH 2ENYA 1MNUH 1INDL 1T22A 1A7NH 1SYVB 4PRNB 3LMJL 4QXWA 2W1NA 2Q8BL 3VXQB 25C8L 2BVTA 2C3HA 3LB6D 2CDFA 1N59B 1Y0LB 4OLYL 3X11B 4DGIL 3OKKA 4M43H 1QVOB 4DAGH 2R23B 1TJIL 3QUMB 5E9DB 1HHKB 2VN4A 1EJOH 4AG4L 1XZ0A 4BK5A 1KF9B 1LO0H 1K8IA 5EBLA 5DJXB 4OM0L 1E6JL 1LP9E 1TZHB 3QDMB 1AP2A 3HN3A 1W8OA 4E42A 3HFMH 4CUCA 5IWLC 4QRRB 1HOCB 2BRRL 4FQCL 3WL9A 4JO4H 2DQCL 4P3DB 3RP1A 1KJ3L 2EYRA 2BVQB 2CLZA 1B6DA 2DIBA 5EU3B 4JHWH 3RUGA 5IV2B 4HBCH 1T89A 3HA0A 2CGRH 3OR6B 1FYHB 3VGHA 3V5DA 2EDJA 3SCMD 4LFHD 3T0ED 4OJFH 4D0BB 4JLRB 3AS3A 4LLYB 3BP5B 1F6AA 2WBJC 1T1XA 3BZFB 3BUYA 4MMXC 4P5TD 1RVFL 2HT4C 5D1ZA 1URLA 3O9WD 2NY5H 1FVEA 3BN9C 3QRFM 2UUDH 5MI0B 1VPOL 2B1AH 1HH6B 5ICXA 1FL6A 4QF1A 4D8PA 5E6IB 3ARBB 4FXLA 4YHML 1AO7B 3UYPA 3KJ6H 3KWWB 4YUEH 1AXTL 5CWSB 4ZO6A 2IG2L 3KNBA 4S0UC 3FFDA 4QWWC 5EPMB 4MCZB 3RZCB 2DM4A 4ISVA 4LCYA 3P0YH 4BFIB 4ZFOB 4GRLD 3QIUD 4QYOA 1XGUA 4MXWL 5F7DA 3OR7A 3RL2A 2EDLA 5DWUH 2R0LL 3U7YH 1NUDA 1MRDL 3JWOH 5E0QA 1DBBL 4X5XB 3OKNB 1CDHA 4ZAKA 4UBDC 1KCRH 2ICES 3UTSA 2LU3A 3P9LB 1UJTA 2HYMA 3SY0A 4F80A 4AIXA 4PJGF 3DX6B 3FN9A 3RX5A 1MCQA 4M4RA 3INUH 3OAUH 4YDLC 5F7KC 4ZXBA 4JO1H 5FYKL 1R3LB 3T0VA 4OF6A 5KSBE 3MBEC 5F6IB 5I1KL 2NY3C 4DWHA 4H26B 4RWYL 4WI6A 2YPVL 3BZ4B 3QXAA 1A6PA 4MNGA 1U36A 2IPUK 2ZSWB 5FOBA 15C8L 5TH2B 3S6CA 3KLAA 1TVHB 2HT2D 1WC7B 4P23A 2D7MA 1AQDA 2BRQA 2VO5A 3LIZH 3KYKH 1CFNA 1ACYH 2YD7A 1CK0H 3DNKA 5CBAB 1X5ZA 4G59A