4ZUWA

Crystal structure of equine mhc i(eqca-n*00601) in complexed with equine infectious anaemia virus (eiav) derived peptide gag-gw12
Total Genus 73
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
73
sequence length
274
structure length
274
Chain Sequence
GSHSMRYFYTAVSRPGRGEPRFIAVGYVDDTQFVRFDSDAASPRMEPRAPWVEQEGPEYWERETRNMKEATQNFRVGLNTLHGYYNQSEAGSHTLQRMYGCDVGPDGRLLRGYRQDAYDGADYIALNEDLRSWTAADAAAQITRRKREEAGVAEQCRNYLEGTCVEWLLRYLENGNETLQRADAPKTHVTHHPISDHEVTLRCWALGFYPEEISLSWQRDGEDVTQDTEFVETRPAGDRTFQKWAAVVVPSGEEQRYTCHVQHEGLAEPVTLRW
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural Illumination of Equine MHC Class I Molecules Highlights Unconventional Epitope Presentation Manner That Is Evolved in Equine Leukocyte Antigen Alleles
pubmed doi rcsb
source organism Equus caballus
molecule tags Immune system
molecule keywords Classical MHC class I antigen
total genus 73
structure length 274
sequence length 274
ec nomenclature
pdb deposition date 2015-05-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00129 MHC_I Class I Histocompatibility antigen, domains alpha 1 and 2
A PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4zuwA02
3.30.500.10 Alpha Beta 2-Layer Sandwich Murine Class I Major Histocompatibility Complex, H2-DB; Chain A, domain 1 MHC class I-like antigen recognition-like 4zuwA01
4P2OC 3ZE0F 1DQJA 5J11B 3QG7H 3RX7A 4Y5XC 4PJBA 4HPYH 3TFKD 1D7FA 1NC4A 4MLIA 4O4YL 2HWZL 4V1DB 4YUEL 3W9EB 5F8RC 3GHBL 1AC6A 2VZ3A 5JXEC 4MNQE 3QNYB 3QZWG 2OTWA 1YMMD 3VWJA 4MA7L 4L4VB 2VDQH 1VACA 4IHOA 2OTPA 3DURA 3MC0A 4YPJA 3SDXA 3WKNA 4KK9C 5LCVH 1AXSA 3Q0HA 4M5ZH 3GJFH 3MROA 4MCYB 4WHYH 2D0HA 4O00A 1HKFA 3O2WH 3OR6B 4WENB 4LLQA 1HIML 1R3KB 1S9YA 5L0QB 1O7SA 2DQHH 3LN5B 3L5HA 2YA2A 3NBNA 2H32B 4EVNA 4JREB 3OTTA 3NTCL 3JV0A 3FTGA 1ZTXL 1IBGL 1AO7A 1K8IA 4IRJD 2EC9T 1P4BL 1IGTA 3DV6B 1IM3B 4CADB 4HWNA 1XZ0A 4K94H 1VADB 3T1WA 4G6FB 1N59B 2GTWA 4MDJA 4ONHA 2FD6H 1ITBB 4GUPB 3RBSA 1ZANL 3GMQA 3RDTD 2V17L 1U6AH 2YOCA 2QKIB 1NGXA 3VI3E 5JPMA 3MLTA 1SJHB 3X12A 2CGRH 2R0WH 3RQ3A 3OKKB 1JPSH 3FONB 4K9EL 5H2BA 1LK2A 1U8PA 2VR4A 4LCWA 2QQLH 3GSUA 4RMRA 5HXMA 1VFOA 3CFDB 1ORSB 3RVTD 1YUHB 1CICC 2EDHA 1RFDL 4OKVB 4JVWA 4OKDA 4PREB 1MCOL 3RWDA 4LVHB 1DQLH 4KHXL 4JANB 4OB5H 1T03L 4S0SD 1HI6B 1RK0A 3QAZB 4XI5C 2R56L 3ARYA 1CVSC 1YEFL 4U1MA 1CIUA 1SJEA 2W9DH 4OZFB 2HH0L 2XZZA 3EJYD 2ZSWA 4P5TA 3T1FB 5KOVC 5CBEB 3U0TA 5CJBA 2A77L 3MRQA 5E99L 3IDJA 2EYTA 1DP0A 1YEHH 2IAMB 3VFRA 2VISA 3OKLB 1U8NA 1XGRA 5IWLC 1OD7A 3RDTC 1X5XA 1PG7X 4OI8A 4Y2OA 3QO0A 2X4NA 2OSLA 1LDSA 2QL1A 1KJMA 3F7YA 1T3FB 5E7BA 2HVJB 3O3EA 4PJEE 5FM5O 4MNGE 3AXLB 5DFVC 2X4OB 1LQVA 3PL6C 1CD9B 5T1KB 4LSRH 1ZGLA 1QVOB 1A47A 4P5MA 3IAGC 4OLUL 2I07A 4QEGA 1CD1B 1K8IB 5EPMB 4FFVC 3U46A 4M3JA 3HAEB 5HDBE 4PJBF 3KPOA 4KVNH 3EO9L 3LDBC 4GKNB 4M62H 5FUZL 2P49B 4ODVL 4P59H 4GUPA 5L6YL 3ES6B 4QRSB 1DBKL 4MSWA 3VFMA 4PTTA 3TPUA 1T4KB 5C86A 5CMAA 1SYVA 3RL1B 3BEVB 5IHBA 2NX5D 5ETUA 1F00I 5MEPB 5FKAA 2WUBL 3IGAA 3FT3A 1FZKA 1TTGA 3X3FL 1A14L 2VDOL 1MCLA 3DTXB 3BD3A 3T0EB 5GS0L 3BP5A 4XT1C 2ARJB 3EAKA 4UV7H 5GISH 4AENB 3N9GL 2F8VA 2FJHA 1K3IA 1DSFL 4NQDD 4XWGL 5DGQA 5ISZD 4PRAB 1RJLB 4BH7B 4DUVA 4U31A 3BIBX 2L7UA 2OI9A 2PYED 4OZFA 1CG9A 3B2UC 3MNZA 2IAMD 1V3JA 4UBDC 3WV0A 5GGUB 1UCTA 5CJXC 3SPVB 4EIZC 5D7LE 1T1XB 2OJZL 2ZNWA 2B4CL 2ORBL 5L2KE 4N68A 5C08D 4LGSB 5F9JB 4HWBA 3GO1H 1TFHA 4MS8A 2LE9A 1KCUL 3DMMC 3MYZA 1DBAL 4TN9A 5E0QA 5IBLC 1T3FA 1AJ7H 1INEH 3M17A 2HVJA 3O3EB 3VXSD 3WNKA 1AXIB 4YH6A 4PPTA 4I3GA 3ARRA 1RV6X 3K8MA 1KC5H 3B6SB 3MRNA 4MVBA 8FABB 1XCTB 3TNMA 1IQWL 3QUYC 2GQHA 3B4NA 2V2TA 3VJ6B 4ZOCA 4D9RD 5SWSD 5FO8A 5ISZE 2ICCA 5C6TL 4U1GC 3UTTD 5HHME 5FCUH 3D39E 4ZDHA 5GGRA 4LHUB 1FDLL 3HI1B 3UZQA 4XPTL 4ZAKD 3JWDC 4UTAH 3DVGB 1CGUA 4N8VG 1AR1D 5C09D 2OYPA 3VDCA 5JZ7C 2NXYD 3HAEH 3TPUB 1BREA 1HHKA 2UVFA 4DUXA 1XF4A 3QEGL 4L29B 2OP4H 4F15B 1A1OB 5EZOL 1DLFL 4NBZB 1YEKH 5BS0E 5IK3B 1R5VA 3V6FA 3RAJL 1C5CL 3JVGC 3L3HA 4LVEA 4LHQB 2CIIA 1E27B 3KPMA 2HA1A 5IVXA 4ENED 5JOPD 5LBSH 1S7SB 4NFCA 2VH5L 4MQTB 2HN7B 1U8KA 5DJZA 5INCB 4DK3A 4LLDA 3D2UD 3NFNB 5FYKD 4Y4FD 3TYFA 4U7MA 3C5ZA 1A7NL 3RU8H 3TWCH 3S4SG 3I2CL 1HYSD 1VFBB 1IFHL 2F53E 4PR5A 4L8DA 4O5LH 4FTVE 3TIEA 1FQ9C 5E2WL 4XVJL 1ZLWK 3HZYB 4YFLF 1FCGA 4RRPG 5EBWA 5J1AA 1MPAL 2CK0H 5IJVB 3EO1B 4NOBA 3HMXA 5CP7B 3RDTA 1C5DA 5DVOA 5ERWA 1CDYA 2IBBA 1OOAA 3ARFC 2W0KA 1GOHA 5DR5L 1S7WB 4NUJB 1FJ1B 3LD8C 5D7KD 1IGFL 4EN3B 1H3PH 5CZVH 3L3GA 2BNRD 4JHWL 1RU9L 3FN3A 5KAQG 5EB9A 2ZOLB 5GGRB 1JI1A 3GMRA 2NZIA 1A1MB 5HHQB 2BVPA 4G8FB 2O5ZL 4RZCB 5LCVL 3DVNA 3C60C 4DAGL 2HFEA 1JCKA 1CYGA 1OPGL 3F65A 3MCKB 1NL0L 3KYKH 2FH8A 2B5IC 2DTMH 1J8HE 5IMOA 4HEME 5FHBH 4OQ1A 5AZ2L 3SGEI 3OKEB 1CXLA 1X5HA 2Q3AA 1CDUA 3IS0X 5EO1B 1KPVB 1YMHB 3AU1B 2R8SL 3HG1A 4UMGA 1UB5B 3BH8A 3HA0A 5DJ0B 1BZ7A 4RMTA 5AAWA 2LVEA 2VC2H 2PO6A 5FUOH 1AKJB 5L9DL 2FBOJ 1W0WA 2ZUXA 2FJFB 2X05A 5IB2B 3IFOA 1Q0YH 4HWBH 3FT2A 3MX0A 5EDXA 5L88L 4D0CA 5D7LA 1CFTA 2XXCB 3BPLC 4ZUSB 5DJZB 5INCA 4PGZA 4XBPB 1FZOB 4IMLA 3SKUD 1OTSC 3KPLB 4NZTH 2IALA 4K07A 2D3VA 3EYUH 3FQNA 4YK4C 2E3VA 4PP2B 4YE4H 5HVHC 2J4WH 3J8F7 4XH2B 3GBMH 2EDDA 2FL5A 2N4IA 3TFKA 2WBJD 2FBJH 5CBAB 4JFHD 2FYYA 3G04B 1MFEL 2YPKA 3NZ8A 1T7YA 5DEGB 3AS2A 1ROWA 2VQTA 2BOCA 2HKFL 2BY3A 4WI3A 1U95A 3K2UH 4G5ZH 5F1IB 3TJEH 5KG9B 1ACYL 5C0AA 5C7XH 1SHMA 1E6JL 4R7DB 4F9PC 2DQHL 4JR9L 5KJRH 1I9JL 1N0XH 4S0UC 2PN5A 3VFGH 1IGIL 2WUCH 4JREC 5FECA 1CGTA 2DM3A 4XPAL 5E9DE 3UXFA 5DS8B 3I3BA 4G8FA 2NW3A 3QNXA 3DVNB 4L4TA 4D2NA 4ISVA 3OB0K 3S97C 3MXWL 5F1SA 3ZHLA 2EKJA 2V2WB 4RGMB 1FN4A 2OK0H 1T1WB 3G6JA 4OIBA 5D93C 4X4YB 3ZE1F 3MBED 5E6ID 5GPRA 5GHWH 4WWKA 2AJUL 4G3YL 2BC4B 2VDKL 2P7TB 3V5HA 2Z31D 1PYWA 4L8BA 4N0YL 3V0WL 4R8WH 4JFEA 5CHNA 5IB2A 3P4LA 4ODXB 1CU4L 5I1CH 4EI6A 1CD8A 1UJ3C 4X7CC 1G9ML 4M6MH 2F53A 4OZHE 1UADC 3UJTH 1FZOA 3NFPB 3B9AA 4X0KA 1QQDA 3FHQA 3LMJL 2VUOA 4FHBD 1FIGL 1TETL 4OSUH 5FYJD 4LVOC 4KHTH 2X42A 3NFSL 3KXFA 3BZFA 2CLRA 3U4BH 3WFHB 3QDHA 1MI5A 1JRHH 3B2UD 3MJ7B 2OZ4L 1LHZA 2NX5B 3T04D 3DUSB 1NCAH 5AYUL 1UFUA 5EFIB 5I74C 4L4VE 2BOCB 1QFWL 4MA3A 4XRCB 3MV11 1MWAL 5DJ6A 1NDGB 4KDWA 3MLRL 3TBVA 5EBGA 4ZXBC 1H8SA 2DYPD 5HYJB 1ZANH 3PL6B 3FOLB 3QHZH 1G9NL 1DFBH 2VMFA 3VRLF 4Y5YC 1MFDL 1FV1A 4PFEA 4U0RC 5DQJA 2YK1H 3LKQA 1NFDB 2IF7A 4RAVA 2BVOB 5MP6H 1QFHA 4KKAC 1CS6A 1U42A 2NY2B 3HE6A 4ISVB 5I1IL 3HG1E 2Y36H 1NANI 3HI6H 1AP2B 3MGOA 3VCLB 3WFBL 3LIZH 1Q1JH 3DSFH 4UUJA 5FHBL 3WFEL 5IKCB 2XT1B 1UKTA 1MAJA 1Z9MA 5HDBF 1I1CA 3D18B 3ECBB 5D2LF 2A38A 1BECA 3GUTA 2IWGA 3TN0D 1X6NA 4P9MH 2IG2L 5F7EL 2PO6C 2XA3A 4LSTH 5EU4A 2UYLA 3S37X 3UTPD 4C4KT 3C8KA 1MOEA 3QI9D 2ADGB 4FN0A 4LNRA 5IM7A 2PKDA 3KS0H 3HNVL 1MREH 5AAMA 1OARH 5DJDA 2FIKA 2J6EH 3VDBA 2ZJSL 1L7TH 4XNZB 3UCRA 4XC1L 1KEMH 1QG3A 2EH7H 3GB7B 3KPSA 3P9LB 4KJYB 5E24E 4FFYL 3I75A 1NSNL 5DSCA 1JMXA 1MSPA 1HOCB 1AI1L 3C60A 4K7FA 3C5SA 2AXGB 1DEEA 1FFQA 5TDPA 4HJJL 1G6RH 5D5MF 5JOFA 1FYTA 4M7LH 5I1DB 1B3JA 4RGMC 1M05A 4X9FA 5EOTA 2X6MA 3IDNA 1BFVH 4PGBA 3O2DH 1B2WH 1BQUA 1RULH 5HYQA 1ES0B 3BGMB 1XF3A 2NMSA 3IB4A 2HG5B 4FQ2L 3HRZA 3DYOA 4Y2DD 5DQJB 1VB9A 5GS1B 2XWTA 5HGBA 4IS6B 2VC2L 3BQUC 4KV5F 3RWFB 3HE6B 4R4BA 3G5ZA 2EIDA 1UZ6E 3BZ4B 4C55A 3WIIL 2W9EL 3EJYC 1I9IH 2E7LC 5BXFB 4N5ED 2DTML 2VQUA 3ZE2E 1MCBA 4X8JA 3SE8L 4Y4FB 1AGBB 4LEXH 4M7LT 5E00B 4XC3H 1EPFA 3ECBA 3CDYA 4N1EA 5B38A 5F7WC 1T2QH 3EYSH 4RAUA 3KPQA 3LQAC 4PRHD 2E7HA 3ULUL 5IB4B 2B4CC 3S9DB 3ARGD 4U33A 3TJHA 1JGDA 4HW6A 4Y16D 2X9XA 4RMQA 3O2VH 1I1AA 4JAMB 3C8KB 5DA4A 4ZXBB 5K93A 1DBBH 2CXKA 5BQ7B 4OFYD 4K2UH 5C0RH 3H3BC 3DOSA 4OUUB 1AGEA 5DQ9A 3PWUB 4JN2A 4Y1AA 1CFVL 1J8HB 1ZK9A 4LLWA 4UDTB 5KW9H 5DZLA 4YXLL 2YN5A 3HUJE 3BWAB 4QOKB 4PJFA 5JO5A 4MXVE 4AQ1B 3AUVA 2VO5A 4GS7C 4NKOB 4YNYA 3T2NL 4MX7B 2AJVH 1T1YA 4MZ2A 3FQXA 2CDEB 4K3DL 1NANH 2EYRA 3VD4A 2JK5A 4JFHE 1R3HA 3V6ZB 4XNXH 5F7YC 4UQ2B 1OLLA 2GT9A 2NY5C 1QSEA 4NT6A 4G9DB 4F7MA 5HGAA 4NPYB 1T2XA 5I9QC 5HD8C 4R97C 2PW2A 1YPZE 3IAQA 4HX1A 1KXQE 1QA9B 1QLRA 2BDNL 3BZ4A 5T3XL 1RURH 3NGBB 4PRID 3RI5K 1YN7B 4ZPTB 1BWMA 4JM2D 4HCRL 3SE4C 3PWVB 4JQIH 1F3JA 4MWFB 4XMKL 3V7AG 2NZ9C 2CJUL 4JQXC 3U9UA 2J5LC 3BUTA 1GGBH 2YUWA 1JGVH 2DQEH 4Z9KB 5A2LH 4AK1A 2P43B 4EOWH 5I1HL 3TO2A 5FK9A 1WBXB 2J6EA 4F33A 5K9OA 3CXDL 1LD9B 2DJSA 2R9HC 3U4AA 1UM6H 5C3TA 2VUYA 3TZVB 2JCCB 1K8DA 2X1WL 4M93B 3FO2B 2A74B 4RDQG 1LILA 1N3NB 3QXTA 1KACB 3QWRD 2C1PA 2VXTH 4V1DE 2BOBB 4RWHA 2XN9E 3QISA 4DTGL 1WITA 3IKCA 2A9ML 1NC2D 3Q5OA 4JZNB 2VR9A 4KQ3H 1K85A 4MJ5A 4LLWB 1RZKC 2VLKA 5HDQL 5FCUL 4H20L 3GRWH 4RQQB 3WFDL 3QUZA 2MQ0A 1AD0A 4WEBH 4J8RB 3RUGF 3EYQD 1MI5D 3SCMB 3AS0A 5BZDB 3HMWL 1VESA 2CDEA 2AV1B 1B90A 1Q1JL 4X6CA 1AJ7L 4HWUA 2EYRB 3VXSE 3BKJH 2NLJA 1MFCH 2P5EE 4F3FA 2FATH 2XA8L 2QHRL 1T7WA 4UT9H 2UVEA 5D1ZC 1QSEB 4NT6B 4M7ZC 4RA0C 3HMXH 4NPYA 5CUSL 4N8CH 3QPQD 1GGIL 1LMKA 4N9OB 2V5TA 1JF1B 3IXAB 1LO5B 3WE6B 4GAFB 4BZ2L 4TULL 2HTKC 4IIQB 3UDWC 1VFMA 5IBUB 4QKXB 1Z5LB 1QLFA 5C0CE 1M7IA 1YA5A 1PD6A 1Q94A 3U9UB 3GMMA 5AG8A 1NMAL 2B8OT 5E6IB 5ACMA 2KZWA 5TE6L 3WYRA 4P5KB 3W0WB 3MOBL 2H2SD 2HLAB 3QWOA 5INDA 3WUWA 4GLRI 4QHKI 3FQRB 1LD9A 4P23D 1CFVH 1YN6A 3HG1D 3VXPB 5FUCE 1DLFH 3JTSA 1BIIA 2B0SH 2KDGA 3RWJB 1JRHL 1B4JL 3VG9C 1KB5L 3QJFB 4LSVH 3IDXH 3OKNB 3T4AA 3WLWC 4H8WC 4O02H 2VDRL 2D7TH 1CXHA 4XP9L 4Y1AE 5JHLH 1UWXH 4L9LB 1RIUH 3HAEG 4M7LL 4Z7QF 3VXTA 4CNIA 3MSPA 3ZMRA 5DMGC 4EBQH 4LL9A 1DBML 4APQA 1CLYL 1D3CA 5DD0H 3UBXA 1NEZG 1MVFA 2RFXB 3PG2A 2W9LA 2KH2B 5JIHA 5ITBL 35C8H 1YEHL 1M7DB 4MNHB 2VDQL 3MRIA 4XP5L 3W39B 1FC2D 3KYNB 4XP6L 1YYLL 2EEBA 2MPAH 4OCYL 3OKMA 2VITA 2YZ1A 3N1MC 1X4ZA 4NC1C 5SX4I 1P6AB 3RIFF 2EDTA 3P11H 4HIJB 5SX5H 5JLZB 5DK0B 1NCCH 3IFNH 4WTXA 4JFDE 1JGVL 4N0CC 3KYAA 3MR9A 1HWHB 1CLOH 4DN4H 3BKCH 5TGBA 4HF5L 8CGTA 5DD3L 4JFEE 1ZOXA 2QR0A 1FVCA 2WP3T 3OAZK 3O3UN 4JHAH 2W65B 5JQ6L 4JKWA 3P40A 2D9CA 4OLEA 1JHTB 1I1YA 4G80B 3O3AA 4G6JH 4PJ5D 2Y36L 3HI6L 1S7RB 2PTVA 2DQDL 2E6JA 3BP4A 3TT3L 3ULSB 4G6AD 3KR3H 2UZIL 2H9GB 1ETZA 4OZFH 2HLAA 1WZMA 4PGEB 5FO9A 2P8PB 4O2EA 1C8PA 3ZYJA 5ICZB 2DWEA 4IBLT 3RTQC 4V1DA 2HP4A 2VDOH 1MHEB 5D7SL 4MJIB 1YY9D 2JB5L 4FQXA 2Z4QA 1AKJD 4NC2B 1S7XB 3LPGA 1I1AC 4HBCL 2ZCKL 5GGRY 1TZGH 4QF1A 5A16A 1AXSB 4O2CA 4P2CG 3ZE0E 2X70B 3NN8B 4E41A 3RNKA 5L6YH 4JRYA 1UENA 1VENA 4YXKH 1NCDL 1HXYA 2IQAB 2XRAH 5E4EC 5EIIB 1MVUB 5IVXF 2GJ6A 4GW4B 4XCEB 3WFCL 1Y0LB 3RVVC 5IIEA 4ALAH 3ILQC 1I7TA 2ID5A 2R9HD 1PAMA 4HC1A 3U4BL 3FTGB 1SYSB 2BNUB 2VDKH 3IU4H 1XR8A 3MRIB 1I9EA 4KKLD 3VFTB 3W39A 2XIDA 5DD1L 4OT1L 4YX2H 2C7UA 2VITB 3OHXA 2ERJC 5KVDL 5C0CB 4G7VH 2IANE 4E42B 5LWYH 4ONHB 5CLWA 3UAJC 2AI0L 4LIQE 4NQVB 3BZDA 4JB9H 5DK0A 2YWZA 1XF2A 1KYOJ 1I3RB 3GSRA 4OCLC 3ARFD 5E2TH 3WN5B 5HJ3A 2HFFB 2BNRE 4WVRA 2VLRE 1FL3B 3FQUB 5F96L 1U8PB 2CLVA 1JWUA 3GHBH 1Q9OA 4YC2B 3UTQB 3MLVH 1BF8A 3JV6A 1KXTB 2EE2A 4JDTL 3WIIH 4UIMA 3ULUC 3JUZA 2DF3A 5JHLL 3O3AB 1OAKH 3ZKQD 1ZHBA 1QFWH 4MQ7B 3TC9A 2PXYC 3HR5A 4GJTB 5ILTH 1ZLUK 4G9FE 4LNVA 2OCFD 3OV6A 3THMH 3O9WD 4N0FA 4XCNB 1MHEA 1UJTA 1I1RA 4NZDA 2ZCLH 1L6ZA 1SMOA 1CLCA 3ULVF 4AL8L 5F1KC 4BUGA 1RD6A 2DI9A 4GBXB 4OJFH 2VB5A 4I8DA 4O2CB 4Z7OF 1TZGL 4AMKL 2YPVL 1MAML 4LOUD 3ARFA 3VDAA 3QIUB 3OR7A 4HK0A 3P77A 4G43B 3ZDZE 4GW5A 4LPTA 1HKLL 3K4DA 1CCZA 5DVKA 1WIUA 1MY5A 2C1OB 3LSOB 5C07A 1IGYA 1JYWA 1OF2B 3U7WL 3HN3A 3OXSB 4KHTL 5HGDB 1F13A 1WTGT 1XR8B 4LPYA 3QHTC 2IFFH 4EXPX 3A6CL 2X40A 3HAEA 1YEKL 4XAWL 3P73B 1RZ8B 2CR6A 5K33A 5A2FA 3SQOH 5CJOL 5D72L 5DRXA 4ELKA 1D6VH 3BO8A 2FO1A 1CU4H 3NACL 2WLZA 4TPRH 3V6BR 1QRNE 5JUEL 1I3RA 3QHFH 1KTKE 3WN5A 5HHOB 3X17A 1BD2A 4LEOA 4CMMB 1XH3B 2AJUH 4G3YH 4E41D 2ZSVA 4Y5YB 4GH7B 3LPFA 2RCSH 1Q9OB 1JI2A 1OAXH 3FOMA 2N1KA 4HBCH 1A6PA 2VXTL 2HKFH 1FFRA 2AXJA 4U7KA 2AQ3A 4QRRD 3MV9E 1MLCA 4NQCB 1F90L 2NXZD 2LTQC 4F7TB 1NC4B 3FHAA 1KELL 3MMEB 4MNGB 3QO1A 5E8OB 1AHWC 3OKOB 1G9NH 3F7QA 3L3IA 5D6DA 4U1KA 1BBDL 5T1LB 4DFHA 3ME0A 5CZVL 4BFIB 2OJZH 3L3KB 2C3WA 3FN0H 2ZCKH 1L8JA 4ZUTA 4MCYA 1MCDA 1J1PH 1K4CB 1YPZB 3ZE2F 2Z93A 4PJ5A 1EMTH 3DVIA 4K71B 3O4LA 1R3KA 3VGHA 1C08A 5MI0B 3TNNB 5FOJA 5T1DH 2ILLA 4W4OC 2ZUUA 1GC1C 4QRPD 2OTUA 1LP9F 3MRKA 1E0OB 1KLUA 1UWGH 2JLLA 3QULB 1FAKT 3HZVB 4KVCH 1IFHH 4G42A 4PLKC 5IEHB 4LKCA 4WV1B 5DT1L 1FSKB 1U0QA 3MLWL 5FOBB 5E2UL 3MRFB 2R2HB 1JFMA 5JXEA 3BN9C 3RPKA 3L7FB 4DKAA 4BQCA 1T20B 1X3DA 1FORL 2EDWA 5EZJA 2EZ0D 1RJCA 1L9NA 1SM3L 4FQJH 5D1XC 3U7AA 3MLTB 3LS5H 3O8XB 5GJSH 1XH3A 4Y88A 1P1ZB 2QHRH 4YHIA 5H2BB 1DUZB 5KN5A 2YPLD 5ADPL 1C7SA 5F89A 1XGQA 4LU5H 4LK4A 4ORGA 5EC1A 1GC1H 2EDBA 4OCYH 3P4OB 3DO7B 1ZA3B 3L3HB 5AWNL 1LO2L 2VOTA 2DL2A 3EYFB 1UA6H 3ARBA 4N5EA 3KPMB 5ALBH 5IVXB 1S7SA 3NIFF 3MV7D 1U8KB 1PQZA 1UT9A 4NKMA 1IAIH 3NFNA 1B4RA 3PWNA 4UINL 3IVKB 3F12B 1UH2A 1GGUA 5JHDA 4I4WA 4XNZC 3OGCB 1JPFB 4KK5D 4NHUE 1I9RH 3NIGF 2IAMA 1X5KA 4S0TD 3JTTB 3WIFA 4H1LG 5KSBF 4K8RH 2J8UA 1JN6A 1IE5A 1RMFH 3OG6B 1MRFL 1OTTC 4LSVL 2EO1A 2VXVH 2AEPL 3QIWD 1C08B 4HH8A 3TNNA 3B9DA 3RDTB 4LCWE 1L9MA 3K1KC 2UZIH 3RI5F 3UBXI 3GSQA 4Z7QE 1FVDB 3IAPA 1MFCL 1BOGA 5DYOA 1BIHA 3BUYB 5ITFA 1KGCD 2AK4A 1MELA 2AV7A 4JLRA 1FSKC 2QQLL 3KPOB 3HE6C 1A1MA 5FM8A 1QFOA 4NKDB 4EDWL 4FQXD 2X41A 4BH8A 3L7EA 4EKXA 1G6RL 5EZJB 5I71C 4YBHA 4GG6F 3KGRA 2HJFB 5LXGL 5IW1A 1ONQB 1SYVB 3RL1A 3CFCH 1RIVL 1EEYA 5DDHB 4LLYA 2NY1B 3FT3B 3QUYB 3DIFB 1DBJL 3PABA 3MUGA 1P53A 2IAND 3X3FH 3IFLH 1KIRA 3HKFA 3IRZA 1ADQA 1F11B 1A9EB 5HYJE 3RVTC 4WDIA 1OAXL 4FXKB 1SEQL 1QFPA 4Y5VB 4NIKB 4UNVA 3ABZA 2J88H 4GSDL 4BH7A 4PS4H 3NIFE 1A6WH 4LQFL 5DD0L 4NHUB 2X4RA 3SE3A 1HXMA 2AGJL 4Z18A 4P2OD 3ZYOA 1GGBL 2Q76B 1IGFH 2PXYD 4S2SA 2NY4B 3VRJA 5EU3A 4CDHA 1IC5L 2BVTA 1BQHA 3NPZB 2OL3B 2R1YB 1E4XI 3B9VA 4X4XA 3HC0A 5I73B 4NSKB 1AGCA 1I4FB 3GI8H 3S37L 2AW2A 1F4AA 4NBXB 3FZUC 2VDNH 5I1IH 3VGDA 4XHJD 3HB3C 5BV7H 4WJ5B 5SX4H 2BHZA 3ZT6A 3O8XC 1DL7H 8FABA 2B2XL 1HH9B 1J5OL 4NM8L 4WTZG 1DDHB 1DVFA 1H3WM 2Y6SD 3IDMA 4P2YA 1MFAH 2CO7B 4ETQA 5TH2B 3DGGA 3QIBC 5E2UH 2EYSB 4NKDA 3DVGA 4NO3B 2BNQA 3R0NA 3L7EB 3T0VA 3OKDA 1UEMA 5EOQL 5B3JE 5C3LD 1X5ZA 5KSBA 3D0LA 7FABL 2YEZB 2VYRE 4X5LA 2WP3O 3BGFC 3QB7C 5E2JA 2CRIA 5DDHA 4OZIF 2R1WB 5HPOA 3U0WL 2NY6D 2WUBH 2J6EL 3MYJB 4WUKH 3V6FB 1JTOA 1PSKL 5AUMA 1OCWL 1MIEH 4WTZA 5FA4A 1VDGA 3FT4A 4NWUL 3GFUA 2DLTA 4UTAL 1F8TH 5CEXA 5JIPA 3MRPB 1X7QA 2DD8L 1KENH 1NGYA 2JE8A 4WCYH 3SDCA 5B3JF 1J05A 4OD1L 2O61B 1OAUL 4KJWD 2V5SA 2VXUH 3OR6A 4ODWB 4CN4A 3MLXH 1S9YB 1VFBA 4U1SB 3DVFA 2PYFA 2JELH 4NQXA 1KLGB 2NX5A 4TQEH 1TCRB 2R2BA 3PDOB 5GIRB 3LEVL 5IB1B 1VERA 1CZ8H 5IJVA 4ENEC 4PJGA 4QHUB 1VEMA 5FV2A 2CRYA 2DJUA 4KRPB 1XZ0B 3TBVB 3WNMA 4OQTA 4TVPE 4X6EB 3VFVB 3SE3C 1NGZB 3PP3H 1NC2A 2GSIB 5DMJB 3QEQA 1CK0L 5J8OA 1AFVL 1G0YR 1CE1H 1CFNB 3V5KB 3MLWH 4OQTL 1CT8B 3JWOH 4MMXC 1LK2B 5C8JA 1XFPA 1MQKL 5HYSA 3GMNB 2IBGA 5EC2B 3FMGL 3OKDB 3BW9B 5ICYA 5JZ7D 3EJZD 4LLUB 1AP2A 3MGOB 2FGWH 3ZKSD 1KB5B 3ESVF 1B9ZA 4Z7WA 3EHBC 2ZOKA 1QUNA 3IXTB 5J1SC 3WLBB 3IFPA 5ESVA 2R4RH 3TCLA 1B2WL 1RULL 1J11A 3QHZL 3PGDB 3NH7L 4N8PA 4WW2C 4MD0B 4G7YH 3WS3A 4HV8A 3BMVA 1A9BA 1KG0A 5CBEA 1DUYB 4UU9A 2MCPH 3WLWD 4Y4KC 4LBEB 3VG9B 1QEWA 4QY8B 6FABL 3HPLA 3GSVB 4NNXB 3RJQB 3U30B 5F6IB 4NC1E 4NZRL 5MENE 1U3HA 4MQXD 1J05B 4NO5A 4QCIB 1OGTB 2AERT 4YK4B 3QP3A 4FTVD 3RY6C 3LKRB 5D93B 1TZHA 1TVDA 5AEAA 5HGHA 4QTIH 4JO2L 3ZYZA 2WLYA 3V9FA 5KVEL 4HS6A 4YHOL 3K0WA 1OSZB 4OD3H 5T5FH 5MP6L 5EPMA 3MJ9A 3QUMA 4KU1A 3D6GA 3PV6A 1FNSL 3TV3H 4NM4H 3D39B 4KPHL 3G5XA 4AH2B 1T0NB 5KG9A 2XPGB 4PB9L 4TPRL 1KJ3H 3B9KB 4ZO6A 1UM4H 1Y18A 3QQ9D 1S8DB 4NO2A 5J13B 3EUUA 4WI6A 2ZWLT 3WFEH 5KJRL 3VGAC 4APQC 1CI5A 1M6OA 4ZUWB 3KLSA 1MJ7L 3L5IA 2X4PA 4HDIB 4GG6B 2NW3B 1T80A 3IDGA 1OCWH 4U6HB 1J88A 3ILPB 5TF1L 4ZOBA 1R3LA 4FG6C 1TJIH 3ZKXC 3DNKA 4X9IA 3BXNB 5E2VH 2BSRA 3VH8B 3TBWA 3CSBA 4ZO7A 1KGCE 1Q0XL 3CXHJ 2F19H 1FVEA 5CILL 2NNAA 3KR3L 4JM2F 5C71A 3BGAA 2YUZA 2CO6B 3PGDA 5JA8B 3IU3B 3BZEA 4GXUN 1B0RA 4Y5XA 5B38B 3VD9A 1MCIA 1SMAA 4PBXA 4ZUVA 4LARL 2AXFA 1KPUB 5DD3H 3CMOH 3SPVA 4FFYH 1T1XA 5T3ZD 1NCAL 4N8VB 3NGBC 3LQAH 3S36L 3U36A 1UJ3B 4JPIA 4PJ5E 4YGVB 1OGTA 5BV7L 1PKOA 1TJHH 2Y7QB 4PJ8D 4OAWB 1LK3L 4YE4L 5BJTA 3PWUA 3D85A 3HFML 4JG1H 4OV6F 4WY7L 1KJ2B 1CICD 1TQBB 1XCTA 4HC1L 3MCLL 5IMMA 2VE6B 3PP4H 1ZVYA 3WDHA 2YPLB 5EFIA 1LNUA 1P7HL 4HF5H 3SKJL 4KC3B 4L1HA 5TFSH 3H3PH 2O26U 4LAQH 5DJ6B 2R29L 4JFQB 1EHLL 2IADB 2FDBP 4JPKH 2V6HA 4OLYH 1UXSB 2A9NL 1YEIH 1JGEA 1U3HC 3GDBA 3M07A 3NA9H 5JW4N 2PXYA 4P2QB 5IT2H 3I02B 1ADQH 1RZGA 3FOLA 4LASH 3X14B 1INDL 1MH5A 2YSSB 3PJSB 4CVXB 2PTTB 4OIAA 4HSQA 4WUUE 1T04A 2XWBA 3VGBA 3LRSB 4IDLA 1QA9A 1QLRB 2LV4A 5HVWA 1EFQA 5IQ7H 2EDQA 4NCDA 1DQDL 4WO4D 1WCBA 1R5VB 2J12B 2VLME 2BVQB 5GZND 4BK5A 4PJEF 4NZRH 2A6DA 1KENL 5C08B 4ZYKA 1MJ8H 1HSAB 1RUMH 2YZ8A 5DJYB 1ZLUH 2RIKA 5C0JB 3IS1X 3S96A 5F88B 1TVHA 2F74B 2GK0A 3N85L 3SY0B 5ENWA 1MJUH 1B0RB 3WXVH 4LLDB 4Q58C 2CLZB 5HHVH 2ICWJ 2WWKO 4PJDB 4MXVF 1NLDL 3C5ZB 2JCCA 4FQ1H 1KPUA 2GFBA 2QSTA 3GGWB 4KK6C 4PRNA 4YAQB 5J12C 4FMKA 4S11A 2OZ4H 3QDMA 5F44A 1WBZB 1N3NA 1JWSA 1S7QB 5I16B 1LO0L 2BOBA 3HZYA 4XAKD 3GSXA 3BAEL 2GW5A 1J87A 4AEIL 3QIUD 1EGJA 3QJHA 5HHMD 2GY7B 4HXAL 3D39D 2J3SA 5F6HI 2YD9A 3O6FD 2XKNA 3TFKC 3GSNH 5DVNA 5I18H 4N9GA 1QBML 5C0IA 4CMHC 1U92B 5I1KL 1GVIA 1CE6B 5IHUL 3VA2C 4JN1L 5BO1H 2HFEB 4H0GA 5JHDD 4FNLH 5DUPL 4F7PB 2VZSA 4K8RD 3MREB 3RKDD 1XIWD 3QDJB 4U1NA 1A0QL 1T04B 4LVNC 4QRRB 4JRYD 3VU2A 3IYLW 1DE4B 2F5AH 3O0RH 3EOTL 1NGQH 4PJ8A 4H20H 1WCBB 2HRPL 3HCVB 5B3NA 1K2DA 4D9LH 1Q38A 1ZLVH 1A7BA 3TBSA 3EJZC 2A9NH 3HI5L 2J88L 1J7VR 4LIQL 5E6IA 1EGJH 2FECL 3CVHB 4Y4FA 2A9MH 3N1GC 5EOCJ 3SY0A 4LCCB 2YXMA 1IQWH 5E08L 1A1NB 1IAKB 3WDIA 5JW5A 1LDPL 3F6LA 3VFSB 4DKDC 2GUOA 4WHTA 2X7LA 5FYKL 2YC1B 1BQSA 3T4AB 4XVJH 1PG7L 5JXAL 1I8MB 3LZFH 1SEBA 2QQNL 1EJ6A 1MCOH 32C2A 5IW3A 1RFDH 3E3QC 1D5XA 2NY0C 3KYMB 4KXZH 3UC0H 3CD4A 3NIDE 5EWIL 3CFEB 2XG4A 1BQLL 1U95B 3I6KB 3EOYG 3LOWA 4R7NA 3OKYA 4NQSA 3SN6N 1CDGA 3RTQB 4FA8A 1U8HB 1V5JA 3JBG7 4UQ3B 1FFOB 5IFHL 5GQBA 4RFNC 2FWOA 2FLRT 5FECB 1TIUA 1YMMA 2K9UA 5GSRB 3SGKC 1AI1H 3ZO0A 4XPTH 3OKMB 4P3CH 1MWAB 5C0IB 5I1AA 4OZIE 2R4SH 1J8HD 4D9LL 4ZSOB 4WI2A 4I0KA 4AEEA 2I26N 1Q0XH 5A2IH 2LAAA 4WU7A 3MRBA 3WNPA 2X1OA 2V9QA 3MRDB 1T0MB 4GMSL 5CGYD 1KC5L 3RA7L 2RAMA 1Z9LA 1URLA 3TVMA 4G9DA 3H9SB 1QSVA 3G6JB 2OI9C 4FQIL 1CQYA 4LU5L 3MR9B 3DROB 4M1DH 4I3RL 5LVEA 3ROOA 4E0RA 2P7TA 5F7EH 3SDYL 3V5HB 2DB8A 4UI2A 2VQ1A 2AJXL 1FO0L 4JFFD 5CJ5A 5I8EB 1YZZA 1PBYA 3WL9A 4XGZB 3UYOD 4GOSA 2APVA 4MJ6B 2A83B 2P47B 3PDGA 4PJ9D 5FK9B 1S7VB 4C4KO 2Z91A 4C54A 3P3YA 5DRWB 4MJIA 3JTCA 3V4UL 4OGZA 4U3HA 4POYA 4KH2A 1EEZA 4X9HA 3WFHA 4OM1L 3O8XD 5CJQH 3ZTNH 2NTFA 5KSAA 1QD0A 4C59B 3R06B 3QSKB 4RWYL 1LE9A 1J18A 4XNUL 5K9KA 2WMPA 3MBEC 5FF6B 43CAB 4UNTA 4MAUL 4PJHE 4RGOH 4E5XA 3BISA 5AD0B 4GW4A 1BQLH 3G5VB 2Y5EA 4NQSB 1VKXB 2W9DL 1QSED 2IBZX 2V17H 3HFMH 1SYSA 2BNUA 3T08A 3VXRE 4PJEB 4I18B 4PJ7F 1CFSA 3RAJH 1FV1B 4HHAA 2XQYK 4J8RA 2R2EB 3QUZD 2EXYD 3AROA 3G6JF 4JDVA 3ZZ1A 2EDXA 4HIXH 4I2XA 5GS0C 3FO9B 1I1FB 4WU7B 1B88A 3BDYL 4N0CD 1MF2L 1OY3B 3H9SA 2FSEB 1YDPA 3ROLB 5HJ3B 2IQ9H 1RQ5A 3DBXB 5FB8B 1EAJA 1RHFA 2UUDH 3G5YA 5F7UA 3NOIA 4GQ9L 1RY7B 2MTPA 3MV8A 2YRPA 3AFLA 1D5MB 3PDDA 3U7YL 1NMCB 5GGQH 1RVFL 3D3VB 5IVZA 1A6ZB 1ZHLB 4JJ5A 4OLXH 4P5KA 4Y16A 2AI0H 2IPTL 1P9MA 2P45B 3PQYB 4MCZA 4I5BB 3H9HA 1BAFH 2HKHH 3GNMH 4HT1H 4I48B 5D2NC 3HNSL 4KGLA 2B1AH 3FCTB 1WJ3A 1WSST 4JRXD 3RGVD 2VLJB 2Y06H 1Y6MR 3TV3L 2OM5A 4KQ4H 3VXTB 3S88H 3VD3A 1AD9A 5SWQA 5C0DB 5ECJE 3DSFL 4EVNB 3IDNB 1EO7A 3LSOA 1AHWB 1CFQB 5C0FA 1M7DA 2VXSH 4KK5C 2MQ3A 4KRPD 5GS2H 2IPKA 4XX1G 4JDZB 4Y19A 5M7QA 3DX7A 3U79A 4CADA 1C16A 3RZWA 4ODUB 4J1UA 3RWFA 3CU1A 1I1FA 5KBNC 5EZIH 4U4BA 1EVUA 4HIJA 4MJID 2NY5H 4U6VL 1HZHL 3MOAL 3MBEA 4NKIH 1WWWX 1T5XA 1SJHA 3BSZH 3DBXA 4CMMA 4M48H 4GXVL 2Q87A 3IJHA 4PBVC 1U8OA 5ISZA 3LEXA 4DGIH 1MFAL 1GL4B 1ND0B 2ESVE 3CFDA 3SGJC 5GZOD 3LHPH 2PUQT 3S4SB 1YQ2A 3UEZA 1N7ML 2VLLB 3ARBC 1OL0A 2ZKHH 2CRMA 3FMGH 4U1LA 3BP4B 4NQEE 4JRYE 1II4E 2H9GA 5FGBA 3H42H 4LHJB 2NY6B 4MD4B 4X7TA 5I8CB 3QO1B 5E8OA 3MV7E 1IM9B 3CU7A 5SWZA 5IMLB 1CL7H 1CK0H 5T1LA 1KPRB 1L7IL 2ZG1A 5JMOC 1PY9A 2Z4QB 3O9WA 5F96H 5GGVL 1FFPB 4ODTL 4WFGD 1SJXA 3HHRB 1J8HA 3OAYK 4PG2C 3WJLC 3H3PL 4LAQL 3SDAA 4KMTL 4BA8A 5I0ZA 3O41A 5D7JA 4JRYB 6FABH 5CWSB 4Y4HB 5IVXE 4J3UA 3KDMA 1J0ZA 2VDPL 1MRCH 5SWQB 5EIIA 1OHQA 3QNZB 5C0DA 2X4OA 2GJ6B 1UWEL 3MODL 1NPUA 4WI4A 3P4MB 3IJYB 2FCBA 1CFQA 2I07B 4G42B 2DS4A 1A3RL 3IF1B 5IHZB 4GAJH 4PLNC 4LLVA 2HT3D 4PJFE 5FV1L 4QT5B 5HI4C 1CF8H 4JHZA 5I8OH 5L2JA 1CICA 2YPVH 3FRPA 1N2RB 4HH9B 2DIJA 2R1XA 4IEFB 1MY7A 3L5XH 2EC8A 5FYJH 3VFOA 4K8RC 4OGYL 3EO0B 4NKIL 4BQBA 2UWEF 4K3GA 5IROC 3GMOB 4HWZA 1ZS8A 1BFSA 3MRHA 3L6FA 4H1LH 3LQZB 4LFHG 4JM2B 3DO7A 3U30C 1ZHBB 1MQKH 3ARBB 3T0XA 2A6KA 3R8BB 4P57B 4WFFE 2VDNL 5CINH 1I7ZB 1NH6A 5SWSB 2IH3B 3BE1H 5DC0A 1JUFA 2YBRB 4RDQF 4NKQB 3K74B 2UUDK 4OCXL 5IFJA 5JW3H 3DRTB 4PG9A 35C8L 1QP1A 1I9RL 4K3EL 1VPOH 2I24N 3STLA 4FFWC 2MFNA 3MTRA 3S5LG 5FUOL 5IBTL 3CXHK 4DKEH 5HHNB 3W9DA 1S7TB 3QUML 1WWAX 3FO0H 5CCKH 4GSDH 1CLZH 4JPWL 1GXEA 2UWEE 1WFTA 4MHHG 1BBJA 4G43A 4HK0B 3PXJA 4RBPH 3WIHH 1RIUL 3SCMA 2WY3A 1MF2H 3B83A 4P2OA 4ZD3H 3D0VB 4GLRH 3RA7H 2AV1A 5C2BH 1DVFC 3AREB 4NN6C 2AK4B 1A5FL 1ZEAL 4BFGA 2HLFC 3BN9D 1F6AA 1IZKA 3REWA 5GZNC 2H2PD 5TQ0L 5J89A 1XGUA 1RUQL 3UYRL 2V7HB 2CRZA 4Y4HD 5BVJA 1FO0B 2B1HH 4Z0BH 1JE6A 1PKQB 1EXUB 2BSSB 1K3ZA 3NCYS 1FORH 2XFXA 5AZEH 2ED7A 3VFOB 3VXRD 2OLDA 3K2UL 1IVLA 4OLVL 1X5YA 1XMWA 5GZOC 4YXHL 2CIKB 2M26A 1V3MA 5DHYB 4TSBL 4GT7A 3U82B 1S9XA 2VRAA 4ZQKA 3L6FB 3MXVL 1YNTA 2ADIB 3BQUB 1XGTB 4P23B 4EUPB 2C26A 3W5NA 4ZPVB 3HC3L 1ZHNB 3GI9L 1ED3B 4L4TE 1CGWA 3VWJB 3MLUH 1F42A 3CSGA 5JQ6H 4NQCA 4FP8H 4XVTH 5D4QA 1EMTL 1RJZB 2WV3A 5SWSA 4K3DH 3TO4D 5K59E 1F58H 3TYFB 4OLVH 5C0EB 4J2XA 3QUKA 5IFJB 4JY6B 1NBQA 2E7MA 3PNWB 2FEDD 1W72H 4Z8FH 2RFXA 5HDQH 2F15A 1MCNA 1T83A 4NSKA 1AGCB 1I4FA 4ZFGL 4YHNB 5LGHL 4FRWA 2NR6D 2Z93B 4PJ5B 4OZIA 4PJDF 1AO7B 2AEPH 2FR4B 1BJ1H 4RIRA 5DJAA 4KDTC 5FDWA 5HHMA 4WWID 5EU5A 3P4NB 4I3SL 4OGXL 4MDJB 5F8QC 3QULA 4KROD 1JRHI 4NN7B 4X5XA 5H37H 3PGFH 3FN9A 2ARJQ 3T2OA 4JGUA 4XX1E 4LCUA 1OVZA 4LCWB 1S78C 4U2YA 1QPXA 2XTJB 5ALBL 2QADB 2XQYG 2KQNA 4XP9H 5KSBB 3NACH 1YUHA 2OQJB 3QUXB 4ZSOE 3OXRB 1FLRH 4EUPH 4BQ8A 4B7LA 2EDKA 2APWA 2X4UA 1JHTA 1I1YB 4S1QH 4X7SL 1TMCB 1JV5B 5C0GA 4PV9A 1KB9K 5DUPH 2WBJB 1JNLH 4I0PD 2X5PA 1YEFH 3QEUB 5JHDE 2GSGB 3CFIC 2VLKD 1RK0B 1BZ7B 1NUFA 5B4MD 1P4LB 3LN9A 4ORGB 5EC1B 2ADIA 3BQUA 1SJEB 3HTLX 5FO9B 1C12A 4P5TB 4QGTA 4W6WB 3T1FA 2F8XC 2FJFA 3EGSB 1NEUA 4ZPVA 3WFZA 4KJQD 3SJVA 2H26A 3P0VH 4KY1L 1FG2A 4XBPA 3AAZB 3BOVA 4Y2DA 3TBYA 3S35L 1RZKL 2VH5H 1IGCL 5AZEL 4I13B 4E41B 3U9PL 3SO3C 4PP2A 1EGJL 3N85H 4PUBL 4ODWA 1HXYB 2IQAA 4X9BA 2NY1C 2HVKA 3O81A 3G6DL 4TRPL 5IR1A 2DQUL 2Z31B 1IAMA 3BWUC 1BF2A 1JN6B 4NQED 1YNKL 1ZT7B 2EH7L 4YHNA 4GRWF 4MAYD 5IP4A 3SKNB 4QRPE 5EU6D 4IIQC 1UCBH 4I0PC 1FNLA 4LDEB 4KUZH 1CXIA 3MO1B 3FB6B 2DI7A 1E28A 1OAKL 4PJCF 5EU7E 5EIQA 4RFOL 4OV5A 3P4NA 1CQKA 3AY4C 3QCVH 3KNBA 4YEFA 4NQVA 1U9KA 2GSIA 2K7QA 3KLHD 4Y4KD 1A6AB 3C09B 1F4XL 5DS8A 2ICWA 4P23C 3N50A 3VGGA 4CAGA 3T09A 3TZVC 1CT8A 3RL2B 3ULUE 2X2YA 4XXCC 5DURB 4RBPK 1PEZA 1KN4H 2DQTH 1PGRB 3UP1A 5A40E 1E4KC 5BS0A 2KPNA 2YPLE 4UIMB 2X4UB 4OCSL 3REVA 3U48A 2X89D 2HT2C 1LQSR 5F70A 3QUYA 1I75A 4RMUA 2A73A 3PABB 1BLNA 2BC4A 4PRHB 3ETBF 3C08L 5B8CC 1F11A 1ZT4A 4Y1AD 1C12B 1WV7T 4EN3C 5D7KE 4U6TA 1X9QA 3WS3B 1U3JA 4K3EH 1WICA 4YDIH 4XCNA 4HQQL 4D0DB 3DX6A 3ZKXB 1A4KB 3C2AH 1IGMH 3ZE1E 3IKKA 1FG2B 4F57H 4AMKH 4YWGH 4FP8L 1I9IL 3QBTB 4HAFA 3K3QA 3MLRH 1AQDB 3VWKC 3ARFB 3ZTJH 4F7EA 5EU3B 2NY4C 1PZ5B 4PJXE 1FZMB 5SV3A 1MI5B 5I19H 3MRNB 4FQPA 5D1QA 1OAYH 1ZT7A 3VJ6A 4HS6B 5D1ZA 3OXSA 3DGCR 3SKNA 3SDDD 5EOCL 1AGFB 5T3XE 4LHUA 3MUZ1 1E28B 1CGYA 4HFWB 3STBA 3L5XL 5HYJA 2XXMB 3MLYH 3QH3A 5EBLB 2N7BA 5GGSY 4HPOH 1ZLSL 1H5BB 1KELH 1HHKB 3C09C 1M6OB 1NMBL 4DGYL 1SVCP 1HHIB 3LEYL 2XV6B 4N0YH 3ILPA 5E6ZA 4MA7H 4XNYH 3PWPE 3TZVD 4WO4A 3VFNA 5A3IC 3VCLA 4G7VL 3WIHL 4RAHA 3O2VL 5DFTA 1CR9H 5GGTL 2F54A 4Z78B 1P7QD 1E27A 3UO1H 2ZUVA 1J1XL 3BIAX 3MV7A 4MMZC 4ZFFA 4Y5XB 4U1MB 4LSPH 4XC3L 3CZFB 5FA4B 4UT6L 1TDQA 1U8QA 5DURD 6CGTA 3L3IB 3VI4E 4U1KB 4N1CA 5FHAH 4CJ0A 1JNJA 4NNPH 4IOFD 1W0VA 5DO2D 1DZBA 2D03H 4BFIA 5T3ZE 2VISB 3OKLA 1L0QA 3SQOL 4N5UA 4NDMB 4LNRB 3R1GL 1A64A 4ZUTB 2NY1D 4EXKA 1JNHA 1K4CA 2R23B 1A4JA 4P4RB 3D85D 3DX9B 2R0ZL 5DC9B 4JZJA 4KUCF 2VZ1A 4NP4H 3IDYB 4G6KH 1JPGB 1A3LL 1KLUB 2B0SL 4PLJD 1QVOA 3QCTH 2W92A 4P5MB 4QHLB 1NUDA 1EV2E 5D2NB 5D9SB 5IEHA 4LARH 5I30L 1VGKA 1DEEB 4JKPH 1ORQB 5L2KB 3ARGB 3FN0L 3SDAD 1V7MH 5IV2A 5JOFB 2IADA 3MRFA 5TPWL 5JQHC 3SGDH 3G9VA 3KG5A 5I8KH 1ES0A 3BGMA 1VHPA 1WTLA 2G9HA 4QXUL 4O9HL 4AM0B 4YHYB 4OCRL 1MH5B 3JV4A 5BRZA 5BVPH 4GRMA 2EC9U 1UGNA 1EVTC 2PTTA 3NPSB 5F72S 3LH2L 1H9VA 2AJYL 3C5ZD 3J7HA 4F9LA 5EO1A 3NTCH 1KT2B 5DJ0A 4HJGA 5TF1H 1XGQB 4HKXB 1BFTA 1MLBA 2FLBT 4MDIB 4I9WE 5DUBA 3P30H 4Z78A 3GMLA 3CIQA 3RVXD 5C0JA 5ESVB 1TVHB 3TCLB 1JZ7A 4PRAA 1TPXB 3QAZC 2VXUL 1CFTB 3MRMA 3VA6A 1NUGA 4NKMB 5A1AA 3CZFA 4PJDA 1NMBH 1BEYH 4L8SC 1D6EA 1ODAA 1RU9H 3MCLH 1FZJA 4YUEH 4FABL 4OCNC 2EIEA 3LEVH 2EH8L 2FL5B 1OD9A 3RVXC 1BP3B 2ZG3A 1I1AB 3VWJC 4MA1C 1JGLH 4NO5B 2MKWA 1T0PB 5DEGA 1A4JB 4LHUG 3QIWC 4NQDB 1CD0A 1EO5A 4UTBH 4OZGE 4ZFOL 3PIQB 4GMSH 4PGDB 4JRWA 4XZUB 2NQCA 3CLEL 1SY6H 4QXTA 5HGHB 1JPGA 5GXBB 3GSQB 4UDTA 4DGYH 4L3AA 4RGNC 4M7KL 2RBLA 15C8L 1UM6L 4H25B 4YLQT 4Z7WE 4ZFOA 3T3PE 1XF5A 2MCPL 5ITFB 4ZDHB 4MXQA 5E5RB 4OFVA 4RMWA 2ZZUT 3T0WA 4LVHC 3ARPA 3FQXB 3B9KA 3S35H 3QZWB 1Y18B 4DQOH 2F19L 4BH8B 5C9JA 2G9HB 4PGCB 1Q8MA 4X80L 1R3JB 5CEZL 4UILL 2LTQB 1MCFA 4NP4L 4RX4D 3EIFA 5HGAB 2LVCA 1EEYB 1C7TA 4QRTA 1KT2A 2JIXB 3VXMD 4PJ8B 2PW1B 5FYKH 1RUKL 1KIRB 4Q6IC 4UIKL 4JHAL 5JW4R 5FYLH 5DUBB 4OLWL 4H0HB 4NC0B 1KCRL 5DRZB 5CHNB 3QDJD 4Y5VA 4MAUH 1G6VK 4IOSD 4UB0L 1T2JA 4M9PA 3VE0A 3IDYC 3PL6D 5D5ME 3QDGE 4WW2A 3IFNL 3EFDL 5JW5B 5GHWL 4M1CC 4YHMH 3CVIH 4P5TC 4L3EB 2X7LB 2FB4H 2I27N 4N8VA 4PR5B 3IETB 4PP1C 1J0IA 2YD1A 3GMPA 4KUCD 3O6ML 1FH5L 1GIGL 3OJDB 2V2XA 3R8QA 5J1AB 25C8L 3B5HA 2W38A 2Y7QA 3T0BA 3CDCA 4RX4A 1U3ZA 1F45A 3TP4A 2CUMA 3D85B 4YHPB 1RIVH 4WJ5A 4ZTPH 1NAML 2X4TA 4YHML 3I85A 4B0MM 5IMMB 1G7MB 3QDJE 5D1QD 1N0LA 2LU4A 4JHWH 3F58L 4L5FH 3T0EC 3L3GB 4X6DA 4M1DL 2VNCA 1PFCA 1Z2KA 4A6YL 1V3LA 4QYOA 5IEKA 1RZFH 2BVPB 2M2DA 1QBLH 3O3BB 4ZFZA 3LVEA 3SDAC 4HCRH 5ADOH 3BN3B 1RZGB 4LSUL 3S6CA 2FGWL 4FQQB 5C9KA 3KWWB 2YEZA 3PJSA 4XVSL 4HUXA 1IKNA 4KDVA 3OKEA 4P4KB 4KKBD 3SOBL 1JGUH 1GGCL 2O93L 1GAFH 5JPNB 5MEOB 5J1TC 3QXAB 4X7DC 2PW1A 3QG6B 3QDME 4EDWH 1B0WA 2A6DB 1QBLL 4GS7B 5E5MA 1W0WB 4ELME 3GUTB 1HSAA 5DJYA 4HWBL 1IEAB 3CSYB 5DRZA 3TH4T 4RWYH 2DQJL 3FT2B 5FYLD 4HAGA 5CEXB 4PJ7A 3WNLA 3DRQA 3DMMB 2A83A 4ZUSA 5INDB 2A6IA 2IMNA 1NCCL 3PWPD 3ZTJG 1GH7A 2IALB 4ZTPL 1KJVB 2DWDA 5ACZA 3HE7B 4CRPA 2BXZA 2BJMH 1A5FH 4L3EA 3EOTH 3S98A 4XH2A 5MERA 3KJ4B 1I85A 2E9BA 2X10A 1IT9L 4OIIH 2MPAL 4PP1D 3NA4A 5ALCH 4PDCE 3G6AA 4JRXE 3MJ9L 3QFJA 1LWRA 1LE9B 4AEFA 1FGNH 5BO1L 4WCYL 1OAZH 3L3OB 5IHUH 4MS8C 4QHUA 4LASL 1FYTB 3F8UB 4K3JH 4I0CC 3HPJB 5B39A 4HGKC 5J4MA 3PGFL 5JTWA 4JKLA 4NQEA 1BJ1J 1U2HA 4MNHA 2M8XA 4I18A 3GSNL 3C6LC 1TVBB 4HMCA 5AWNH 1RUPL 2WIIA 2DDQL 1Q9WA 5ESAA 3I50L 1YEJH 2X44D 5CINL 3CC5B 1M4KA 3SHSA 2E9WA 4WUUD 4OB5L 4B5EA 3CFCL 3NCJL 2V2WA 4TUKH 2VDLH 1FNHA 3V8CA 3KHQA 1FL6B 3EYOB 4EOWL 2ZOKB 5I1HH 4F9LC 4M3KB 4P4KA 5C07E 3WO4B 1FHGA 4XNXL 2VLJD 4KMQA 3RU8L 5DTFA 5F7LB 4PJXB 4DEPC 3F6IA 3HCVA 3B2VH 1RMFL 1JTTA 2QR0B 5DJ2A 5E8PB 3P2TA 3TBSB 5E1HB 4JFEB 4FQHA 5T3XH 3MLUL 2V7NB 5D2NE 2NCMA 3D5OF 1JGDB 3GSVA 4NNXA 5KSAD 3ALPA 3D3VD 4JAMA 1EHAA 4P46C 4PGEA 2ZCHH 3VGFA 2J8HA 5ICZA 3TIDB 2NY3C 2DWEB 1KJVA 2DWDB 1MNUL 3DLQR 1A3LH 4U7SA 4FQ2H 1LE5A 1LDPH 4OLUH 3FCTA 4XAKE 4Y1AB 5I0DA 1KYOK 2WBKA 4OM0L 1YEEH 1T22B 5F3BB 2H6PA 3M8OH 3BWAA 4QOKA 3DUSA 3LN4B 4TVPD 3R1GH 1F5WA 4J3XA 4HJJH 1HHHA 2NY0B 4FXGB 5IESL 4XRCA 1AD9B 3QUMB 4MAYC 3ZHKA 4GW1B 5DMYA 5CJ8A 1W72B 3D39A 1UM4L 2D0GA 4M02A 5CP3A 1VCAA 4YHKL 3QHFL 5HHOE 4XC1H 1RZJH 1IKFH 5CZXD 2Q20A 1WAAA 1FAIL 3PP4L 1JYNA 2WIIB 1NFDA 3N1PC 4MGXA 4NRXB 3TN0A 4IDJL 5KVDH 4HX1B 3V7MA 3GO1L 3MRBB 2VWEC 4V1DD 5I1KH 4XBEH 4H8WH 2PCPB 4OF5A 4F8TA 1FVEB 4LEXL 3VFUB 5BVPL 1U8OB 2D4DA 5DTFB 3UBXG 1YYMH 5CSBA 2NXYB 4ZO8A 4XPGL 3T2PA 1IGIH 4PJ7E 3D18A 5C09B 5K9OB 3JWDH 5B21A 3LV3A 3SQBA 1UEYA 4AY0A 3QQ4B 3QRGH 4X4ZA 4MQ7A 1G9MC 4M9OA 3O11B 1KSRA 3NCMA 4XGZA 1H15B 5GRVL 4RRPA 4A6YB 1H0DA 1DANU 1YNLH 4GRLB 1WEJL 4H5SB 1S7VA 3ARUA 2EXYC 5D7IB 5DEZA 4QRUB 4JFFB 1ZMYA 3W81A 5SWZB 4G6KL 5IMLA 2P5ED 3MV8D 1L7TL 2CKBL 4BK4A 1X4YA 1ERNA 1LE5B 3BD4A 1EA9C 3P0YL 4ZMAT 2NW2B 4IOIA 2VLKB 4J6RH 5DSCB 4PJHB 5I2IB 4I0PB 5IW6A 3VRIB 2FZ3B 3DV4A 2AXGA 2NYYC 5GS3A 3P77B 5DHXB 2B5IB 4G6FD 5L88H 5I6XB 3ARDC 5E9DB 3HZKA 1NDMB 1SY6L 3SGDI 1NFKA 2UY7A 2F53D 3WKMH 3WMSA 5KVFH 5CAYB 2MMXA 1TETH 4OSUL 2FJGA 5JDSB 1S9KC 1XIWA 1NGPH 4TQEL 3WJJC 2RB8A 3EOAA 1OAQH 2JB6A 4LSTL 2NTSP 2VZUA 2NR6C 2XACC 2VJXA 2BVQA 1IEHA 5KSVA 3RWIA 4Z7NE 2RHEA 1H8OA 3QFDB 1YDPB 5EUOB 1BD2B 1KCGC 3A6OA 1Q94B 4K23L 3VXUA 4QNPE 3MCG1 1ZS8B 2OXGA 1HN1A 1N4XL 5D7IF 1GZPA 4Z7UE 3KS0J 4XAWH 2X4SA 2ZUSA 4X6BB 3OB8A 2G2RB 3BT2L 3JTSB 5I74B 5IGXH 4FQXC 4MB4A 4S1SL 2A6KB 5DLMH 3Q3GA 1T21B 2EDEA 1BJMA 4WFFD 1I7ZA 1A7PL 3PQYA 4XVUC 2IH3A 1HNFA 1UKSA 1NBZB 3PWLB 1CXKA 3VWJD 4DZ8B 3UX9B 1JHKL 3O2DL 3B9EA 1I9JH 1KFAL 4JR9H 1P5VA 3BQUD 3RFZC 4IOIB 5HY9A 3TVMD 2XKNB 3W9DB 2D03L 4I0PA 4JKPL 5JO5B 5IW6B 1JYXA 1YPZA 1G7PB 3C2AL 1IQDA 3OX8A 4TULH 3TBTA 1U8JA 1BBJB 4QO1A 1Q0YL 1TZIB 5E94B 3VXRB 4NZJA 3AM8C 5E9DA 4ZO9A 4IRZH 4JY4B 1J9CT 4OI7A 2Y25A 3AS3A 5DUML 4J3OC 1N5YL 4X8XA 2HJKA 2OMNA 4LP4A 1R3HB 4UT9L 1FIGH 1JL8A 2P4AB 2J4WL 4DCQA 4X98A 5F9OH 1MJ7H 1G0XA 43C9B 1XIWB 1IC4L 2R2HA 4G8GA 3TESA 1WCQA 4J1UB 2JB6B 3CDGA 1KUMA 1PY4A 2EXWC 1KN4L 4P9ML 5TGBB 1T20A 4KKBC 3KPSD 4G8IA 1FO0A 5C0NC 5GGQL 2BSSA 5T5NF 3FRUA 4KZEL 1F2XK 3O8XA 3FFCE 4U49A 2NX5E 4JB9L 4LQFH 2XRAL 5JIKA 4JZJC 4XPBH 4S1DC 5ISZB 3V52L 4F9PA 4KQ3L 1S9XB 2FHBA 4O4YH 3FB5B 2IQ9L 4M6NL 4O2EB 1XGTA 3O9WC 4WNQA 4D94A 2DLIA 4MB3A 3HR6A 2EDLA 3K4AA 4XNYL 4XP6H 2LAGB 1E6OH 1N7MH 1GRWA 4NQDE 1MCRA 4BYHA 2YD8A 4GKSB 1PQZB 2HAZA 1SEBB 3L1OH 4F7CB 2DD8H 3GEWB 4TVPL 4DZ8A 4PP8C 1D5XB 4WHDA 1IARB 3PNWA 1E6JH 2DYPB 1U8IB 1MCWW 2H1PL 3V5DB 4ESKA 3UTZA 1KFAH 5L2KD 5IBUG 5LAXB 3O41B 3V95A 3WBDA 1WGOA 2HT4C 2JB5H 5IMKA 1N6QH 4FZEL 2FWOB 1MPAH 2CK0L 2VWEE 4S1DD 2MOVA 4KMLB 1TZIA 4RIRB 5DJAB 4FFWD 2SEBB 3SDCC 5MHSD 5C0CA 5EU6E 1O5DT 4XBEL 3P4MA 1NUNB 4PTUB 4OLZH 3MOBH 5A3ID 3LMJH 4U3CA 1WIOA 1D5BB 3STZB 3FO1B 2HT4D 4Y7MA 4QXGL 5IROA 4C83A 1AFVH 4L4VD 4LCUB 3ZL4H 3T4YB 1N2RA 1EO8H 2NYYD 5H94B 3JV6B 5IW1B 1UVQA 2OQJA 3QUXA 2YD6A 1VFAB 2H8PA 4XP4H 4YDJA 3GIVB 1QLFB 3NCJH 2XWJA 4UINH 2XQBH 5DQDH 4PV8A 2A1WH 1OWWA 1BAFL 2HKHL 3GMOA 1MCCA 3RUGE 3FB5A 5B8CA 4J4PA 4ONOA 3WUWB 4PJAF 1I7RA 3S34L 5BV7C 4WDIB 1E4WH 4PRIA 2VABA 3JXAA 3ULVH 4BZ1H 3OPZH 1PKQE 4HUUA 5ESQB 2AK1H 2BP3A 1MIMH 2AQ1A 3OKNA 2H26B 4IHOB 3U7YH 5BOPA 1D9KC 4GMTL 1RZIB 4MNQB 1CLZL 4GKSA 1U3HD 4JPWH 3WXWL 2Z92B 4NHUA 3WEXA 3B5GA 5LGKA 4YXKL 4K3JL 2YBRA 1CLYH 2V5MA 1OAZL 3MRCA 5K9QI 4E5XB 4GAYB 3VD7A 1RIHL 3C5ZC 2H32A 4ZUUA 3E2HC 5C08E 3SDDB 5TE7L 1IGYB 4JO1H 3RGVB 3BEWA 3QXDA 1RUKH 2BDNH 4BFEA 4DKFH 1T89C 5IQ9A 5KANG 1RZ8A 5JORA 1LP9A 1RZ7H 3BP7B 4YFEA 3ZKMD 4I2XB 4D9RE 3ARWA 2Z0BA 4BSJA 5ACLA 3O3DA 3KHOA 1A2YB 1S7UB 1QYGL 3REWB 4QWWD 2QKIA 1KXVC 1P69B 3DGGB 3BESR 3VFWB 1QHPA 3BKCL 4NRYB 4JFFE 4BM7A 3O6LL 1IL1A 1QSFE 5DI8B 3C2SA 4TSCL 3OF6D 3ULUD 3VWKD 5CJQL 3ZTNL 1ORSA 1RHHB 2XFXB 1T66D 3FOMB 1CF8L 1S9VA 5I8OL 3A67H 3HUJB 4G80A 3EDFA 1IJ9A 5D7JD 3A6BL 1QNZH 1IMHC 3LB6C 1D5IL 1WIPA 1I7RB 2F8OA 1RIHH 5HHPA 3UJJH 4HUUB 5C92A 4FQLL 1A4KA 1FO0H 4E9LA 2HT2D 4O51A 1KF9B 1RJZA 3W2DL 3PQYD 1DTUA 4M62L 4QF1B 3RGHA 3SDCB 4PS4L 5IUSA 1L0YA 1FGNL 1IAIM 1BHGA 3O4LB 3OZ9H 3TA3B 4P2QD 2WQ8A 4L3CA 4R2GB 4YBQC 3H8NA 5DR5H 2YKLL 4U1SA 1MVUA 3MACH 4JO3L 1CL7L 2B39A 3ZDXF 2XTLA 5T1KA 4P3DA 4AYFA 1I7TB 1VEPA 1TCRA 2R2BB 5GIRA 4PBWD 1IC4H 5D1ZB 2GHWB 4G9FD 5DT1H 3HZVA 2AQ2A 3NIGE 4JO4L 5LGHH 4O2FB 5F3HA 5D7JC 5IQ9B 2C7UB 4M6OH 4Q9CA 3VGEA 1MCHA 4Z7UB 4HGMA 2QEJA 4NFDA 5D96C 4IRZL 4M8QB 5T1DL 1XGPB 4UILH 5TF0A 3BHBB 1VEOA 2GJ6D 5FO7B 3SE8H 4PTTB 4HIHA 3UTSB 1DFBL 5L7XH 1CGVA 4PY8I 4GXUM 1AQKL 2A6JA 4NQCE 4GXVH 2BSTA 4LPVA 2P8LB 3DUHA 3IGAB 4QWWC 5KS9B 3FQUA 3UZVB 3C6LB 3RWGB 2OR9L 3DTXA 1A7RL 1S9WB 2O5XL 3T65A 3T0EA 3BP5B 4HLJA 3GZKA 1EFXD 2QQNH 4LLUA 1BX2B 5I30H 4AENA 5F7HA 1PG7H 1OT2A 5DHVA 2HTKD 1X5GA 1JV5A 4JVPA 3BJLA 5ANMB 4S1QL 4X7SH 2GSGA 5CEZE 4NZUH 3QEGH 5GJTH 3EBAA 2R0KL 3BI9X 1MCPL 2G60L 1DANT 2OI9B 3MRRB 1V8HA 3I3EA 2CGRL 2R0WL 3GJFA 5SV4A 4WUUA 4M6NH 3DECA 2G75A 3EGSA 2YD4A 5GGUA 1KIUA 1JPFA 1RK1B 1REIA 4HWEH 1FDLH 4OF6A 5IBTH 4DKEL 3SDXB 3O6FA 1F4YH 3MROB 4MD5A 4QCIA 2QQQA 4JJHA 4KPHH 5C6PB 5CWSA 3DX9A 4J3WA 3LKRA 5C0RL 3QIUA 4Z77B 1TZHB 5CEYA 4IRJA 5I75C 1QRNA 3WHXB 4S1RH 1UB6B 3HNVH 1QNZL 5SWZE 5GS2D 3VXSB 4NNYA 1BD2E 4U6XA 3MPCA 3P9MB 4QHLA 4UDUA 5BW7C 4P2RD 1P2CA 1ORQA 3H9SD 1I3GL 4JLRB 5LQBL 3JVGA 4EZMA 5I18L 2LQRA 5IB3A 5DRXB 5KANI 4OV5B 3HB3D 1N59A 2GTWB 4LFHD 3BHBA 2YS4A 5IBLD 5D71L 1A6AA 1NCDH 5CGTA 1QSFB 5EG6C 4G9FB 1ONQA 3QQNA 2C3GA 3NCFB 4Z7OE 5F9WB 1X4XA 1GAFL 2DM7A 2XI9A 3S5LB 4AL8H 3GSUB 4C58B 3BPOC 1R24A 5EO9A 2BSRB 5DMKB 1KNOA 5SX5K 1UZ8B 4UBDD 5HPMA 1A9EA 4OF3A 4MDIA 4OKVA 5J9PA 1OT1A 1A7PH 4WWKD 1YECL 4MS8D 2OR7A 1YNLL 5ANMA 4ZS7L 1BLNB 4QXUH 3T3ME 5LGJB 2DQDH 3TT3H 1NAMB 3VWKA 2HN7A 4OGYH 5L8LB 4M00A 2AKRA 4XNQB 2E7CA 2VLRB 5JR1H 3L3JA 3ESUF 4L5FL 2NXYC 4HCRA 2Y6SC 5MENA 2BSED 2IANB 4V2CB 1GZQA 2GTZB 3U36B 4QHNA 3RZCB 1DLHB 5CZKA 2HFGL 1NLBL 5HHNA 3QO0B 1HYRC 2G5BA 2AEQH 3K8KA 4OZ4B 3RTQD 1HQRA 5CEYB 1R5WB 1VA9A 4TUJA 4GKZA 4W4NA 1EZVY 3QDGB 4P2OB 1JZ4A 1CDBA 3ZKND 1QR1B 3QR2A 1XT5A 4URTB 2YPLA 1UACL 2QQKH 1T83C 1MEXL 2DM4A 2ENSA 5FOBA 5TH2A 4TTGA 2GJZA 2R29H 3KPRB 1ZA6A 1FNSH 3V79C 4RZCA 4QNPF 2UWEA 2Y07L 4NO3A 2PXYB 3OAUL 3QH3B 5EBLA 3ES6A 4QRSA 3BDBA 2A2QT 3BE1L 3V6OC 4OF8A 1U8MA 3QCVL 1OB1A 2JJTC 5MEPA 1V7NH 2XWBB 3NH7H 1C1EH 1P1ZA 2FGZA 2R1WA 1B6UA 3U7WH 3L95B 2JIXA 4WO4B 5GRXG 3DETC 2Y23A 1UZ8A 3VI4F 5EULV 5D1QC 1G7LB 1ZA3A 1KBGH 3H9ZA 2FJHB 1IC7L 3LKOB 1K4DA 1OM3L 4MNQD 2IJ0C 2DMKA 1WWCA 5EOQH 2DQIL 4X6DF 3HC4H 1X7QB 5TE6H 4ZFFB 4IJ3C 1ACYH 1H3TA 5LG1A 3TVMC 4LVOB 5FAAA 3U1SL 1FP5A 5JHDB 1AQKH 1BM3L 2X89A 4PRPD 1UQSB 2ITCB 5D2LE 1GZQB 2GTZA 1X6LA 4R8WL 3RZCC 5DMIL 2DI8A 1G9EA 5M94B 1E6OL 1F4WH 4YIQA 2PF6A 3PHSA 3VW3H 3PDOA 2NY2C 4X6FA 5DLML 5KS9F 3MJ8A 4P2RB 2R2CA 2AJZB 1HQRB 3F5WB 3O6FC 5J6HA 1SY6A 4W4OA 1FNGA 4NZTL 3MV8E 3UJIL 1N26A 4OTXL 3F7VA 5AZ2H 4JFDA 3H6JA 3OSKA 2V2TB 2D7PA 5D2NA 3MLXL 1IC5H 4ZODA 3BUYA 1KCSH 4LRNH 4X5XB 1CLOL 1VGKB 2BVUA 5IVOA 3QEQB 4DN4L 4G59A 1I3UA 3GRWL 4POUB 3ULVE 5IV2B 4K3HA 1G7JA 3CK0L 4W81A 5IEKB 3KPRA 3PXHA 4P2QE 2AJXH 4FS0A 1KN2L 4KI1A 2XZAH 3CUPB 3TLRA 3P30L 5H35A 5LWYL 5MEND 4AM0A 1T5WA 1PDKA 5HVGB 3JV4B 4F7PA 4NRZB 3PUCA 3RX5A 3VMOA 3D2UA 4N0RA 2DLHA 4QOKD 3ARDA 2PTUA 3DUUA 1FBIH 2BCKB 4NQTA 2LABA 3EDEA 4IMKC 5C0GB 4X4YA 2VZVA 1A1OA 4PJDE 3DIFA 5DC4B 3IFLL 3BKYL 5JPNA 3QXAA 1HK6A 1QTYT 5DJCB 5C07D 5C0BB 1QFUL 1K2DB 4WHYG 3MQIA 3V7AE 4Z95L 1YNKH 1WT5A 1G7LA 3QDMD 4ZFGH 5E5MB 2R4SL 4D3CH 4FXKA 1TENA 3GMLB 5DXWA 4K7PH 3GBLA 3IJSA 3MRMB 3AAZA 2CJUH 1SBSH 4G5ZL 1IAKA 1BVZA 2X4RB 1MCPH 2G60H 4H0IA 3P0YH 3VMNA 2LU7A 3SDXF 2DBJA 1MHPH 1J1OL 1DQML 1B4JH 2UY6A 3LKSB 2HVKB 1QACA 4DOHB 1WZ1L 5DGRA 3I3DA 3NCEB 1YC8A 3G6AB 3QEHA 4OM1H 1C5CH 5HYJD 1X44A 1SQ2N 2DQCH 1LO0H 4BSVB 1OWRM 1CDCA 3FQTB 4LCIH 5IJKA 5ID1A 2F58H 4MVBD 4XZUA 4MA1B 1NDGA 4NJAL 3LAFA 3MO1A 4XMPL 1FNGB 2XPGA 3SKMA 4QTHB 2I9LA 2Y5TB 4FZ8L 4DGVL 3Q1SL 1XF5B 3ZHDA 3IDMB 2WNGA 5HHOD 2IMMA 4U1IB 1NCUA 3N0PB 4JM2C 2X4QA 2B1AL 3GMRB 1AGDA 3RVVD 3U2SB 3SDYH 1X5LA 1EEUA 5D6CB 3CVHH 3QZWA 4QRPA 2BNQB 1MRDL 1CR9L 4PGCA 3TM6A 2YD7A 3C9NA 1T5WB 4LOUC 4NRZA 2VLKE 1B0GA 3D0LB 4Q74A 1CGXA 3JWOC 2IPTH 3EJJX 4XCFH 4K2UL 5BS0B 3TVMB 3DXAD 5D6DC 3RNQB 2ICWI 1A0QH 5IKCA 1C5BH 1YMHA 3AU1A 1P7QA 4K7PY 4HZLA 2VN7A 2NY4D 1CWVA 3ROOB 4E0RB 1HHJB 5ADPH 2E7LE 3CVIL 3MV9A 5DJ2B 5E8PA 2WINA 4HWEL 3NABH 4P3CL 3MNVA 3F62A 3KPPA 4FQHB 2NPLX 4KKAD 2I5YH 1EHLH 1IGCH 4YZFF 4LSQL 3VG0L 2JJSC 1BVKB 4LRIA 2ADGA 5D2LB 5F6HJ 4YGVA 4PJIA 4NGHH 1MCKA 1VFUA 5TDNA 5HYIA 1MHCB 1MNUH 2X9YA 1Z6JT 5BJTB 2PYFB 3T77A 4JG0H 4WHCA 1KJ2A 3GBML 2EEDA 1H8NA 2V2XB 5JXAH 3N9GH 2ORBH 3R06A 4X4ME 2W1NA 1EUTA 3NZ8B 4KAQH 4P46D 4K7FB 5FF6A 4NN5B 4CVUA 4F57L 1RZKH 2EKSB 2ITDB 2JJWA 2GITB 3VG0H 2I9LB 4X6EA 3HLAB 1ZWIB 1SBSL 2WBJC 3VFVA 2NY7H 2FX8H 4P2QA 1NGZA 1I8KA 3WUZA 4XXDA 3LD8B 3F58H 1JGUL 1GGCH 4QRQB 1CDJA 4OGAD 2X4QB 3RZCD 5GRZA 4NRXA 4IS6A 1HHIA 4JDVB 1M71A 2ATPA 4EIGB 1OQXA 4JO4H 2AS5M 5C8JB 1KIPB 2XKUA 1P4BH 3GI8L 3S37H 3ZSTA 3C9NB 1A6VL 1A22B 4JQXA 2O5YH 3HMWH 3GIZL 1NC4D 3TH2T 1N8ZB 5DWUH 2Q8BL 5K59F 2FSEA 3GM8A 3ROLA 5FB8A 2F54B 4OGAC 4FNLL 3VFUA 3WLBA 4LCCC 4YHKH 3V8OA 3G5YB 3OMZA 4YJZL 1HHJA 3I6GB 5I1EH 1RJYA 2XOTA 5TQ0H 1D5MA 3K80A 3CK0H 4KMTH 4RAUB 3ZT7A 3NMEA 1EO8L 3O11A 4X5WB 3M8OL 4Y5VC 1QEWB 3HPLB 4HGWB 1JWSB 3CPLA 3PHQB 4LMQI 1IAOB 1OTUC 2F53B 4G8GE 1L4IA 3U4EA 4NDMA 1NJ9B 4K55A 1QRKA 3PGCB 2CUIA 3UJIH 4M61B 3VXQA 3A6BH 1HHGA 1YEDB 2R56H 4P4RA 5F9OL 4KVCL 5GGVY 1BGXL 3BKML 3IDUA 5EUKB 4XPFH 2ZUWA 3RGVC 4OFIA 4U0QB 5K9JL 4PJHA 3SDDC 4TSCH 2VAJA 2D7QA 5D9SA 3S3SA 3CFJA 5GRUH 5F71A 1OW0A 1BJ8A 1K5NB 1PLGH 4PJXF 4DQOL 4PRPE 5D8JL 2YWYA 1MAMH 3G5XB 3HPJA 4PRDB 5EWIH 2DLFH 5B38G 4OD2B 1KOAA 5GGSA 5DZNA 4AEIH 1I8KB 2JK5B 1JZ2A 4BELD 4LKXA 1BBDH 2C4FT 5F1NA 2FJGB 4HLZG 2GYSA 3RP1A 4U1NB 1A8JH 5ESAB 3QCTL 4F7MB 1OGAE 4GG6A 4XHJC 3ZDYF 2JTDA 4J3VA 4NYLA 1R3LB 3WUWG 2EDOA 3D69B 3BVNB 3MRGA 4R96B 5I76A 1BVLB 2C4FU 5I1JL 3MBEB 4L3EE 1A7OL 5EORL 4OZHF 3RWIB 4FTVB 4DOHE 1YJDC 2GJJA 2H2SC 1NKRA 1INDH 4Z6AT 3VXUB 2DICA 5D70H 4YDVA 3ULUF 2AXHA 3I6GA 3BZEB 5KW9L 4M7KH 3BIKB 4FMFA 1FPTL 2G2RA 3V0VB 4I18C 2VLLA 2AXFB 3T2QA 2GUOB 4U1LB 3X3GL 3B3IB 1J8KA 3BYYA 3W0WD 5HI3D 5TE4H 2UYLB 4HGWA 2H3NB 1GIGH 1IAOA 2C1PB 1WFOA 2DIBA 2P5WB 5FUCC 3PGCA 5IM7B 3LKNB 5I8CA 1A21A 4P0DA 1DBAH 5DJXB 1BZ9B 2QLVB 5CEZD 1RSFA 2AABH 4XPBL 3O4LD 3CFEA 7CGTA 5ID0A 5FGRA 2X1QA 4R2GC 5FM4A 3LH2H 4UOW1 1INQA 3RPIA 2ZP0T 3LEYH 1T66C 3VXOB 3KVQA 1EEQA 5D7JB 4Q0XL 3KLAA 1G7PA 1KTRL 3TBTB 2OR8A 5TDPB 4KTEL 3QQ3A 1W72A 2Y1VA 3BPNC 1IC1A 5BZDA 3MLYL 5FYJL 1TJGL 3X13B 4R2GD 3DHMA 4OD2A 5GGSB 3Q5YA 5D96B 3OG4B 4L1DA 3U0PA 4Q9QH 4CW1B 5T1MA 2NLJB 1R3JA 4KJWC 2BNRB 2R4RL 1RUAL 2X1PA 4OBRA 3RUGB 1V05A 3K2MC 2FECI 5DA0B 3BD5A 4OUOA 3C87A 4I9WD 3LRSA 3CDGB 3DROA 5T33H 1A6UL 4AT6B 2IFGA 4ZYKB 5C08A 4PJHF 4P59L 1HIMH 5GSVA 1HZHH 1UM5H 1JK8B 5F88A 4JFXA 4MAYA 4MA8H 2YD5A 4Z7VF 4MJ4A 2F54D 4JM4L 3VE0B 3UROR 3ZLQC 2EE9A 2NY3D 4Z5RA 3WSQH 1F97A 4XB7A 3QWOB 5FGCB 3I9GH 3LQZA 5HGGS 2GAZB 1ZEAH 1QFUH 4U0RB 4ODTH 1EFXB 3KPQB 5EIVA 4HULB 3QIBA 1YJDL 1MEXH 1TJIL 1I3GH 1J0KA 2VERN 1D5ZA 3MUY1 3LPWA 3RVWC 4BKLA 4ZXBA 4OCSH 3H42L 4JFFA 4M6ML 3E8UL 3RHWK 4KROC 5K9KB 5FGCE 3VGAB 1S5HA 43CAA 4APQB 4K23H 1ZVHA 2DYPA 5D5MA 3WKML 5AD0A 3CLFH 4N0CA 4YHPA 3STLB 3OJVC 5ITBH 4LDLB 5JDJA 1ZLVK 3I9GL 5DK2A 1KCSL 1JF6A 4RA3A 5E99H 1R6VA 3HNSH 2FZ3A 1X5IA 3DV4B 4GQ9H 4BUHA 3ERYA 3SE9H 3WD5L 1F8TL 1HE7A 3TJHC 2R0LL 1EX0A 3BPNB 1T1YB 2C5DC 5EORH 2Q8BH 1TJHL 2NY5L 2Z35B 3O4OC 5DWUL 3FO9A 1LO3H 5GJTL 4L8CA 3V6ZA 5LKNA 4J23A 3U0WH 4KRLB 4FQQA 5JDSA 4JCMA 3NZHH 3QDJA 1HDMA 3M45A 1MFDH 1D9KD 2DLGA 5F9DC 5I19L 4XPAH 5MEQB 4M03A 2V7HA 4TOYH 1J0HA 5HD8D 3QIBD 3QG6A 5BW7A 4XPHL 3D1MC 3OB0H 4WRLA 3KXFE 4WW1B 1JZ6A 3CFKA 3LKPB 3QFDA 5EUOA 1IEAA 2VKWA 1MFBH 3CSYA 5D71H 2RGSA 5D1XA 4Y16B 3DRQB 1PZUB 3DXAA 4TSAL 1F6FB 1YNTB 2BERA 5J11C 2CD0A 4DN3H 1W2KT 1GZPB 3HMXL 4P23A 1FE8L 2MHAB 4PRIB 3H9HB 4EUPA 1XF1A 4L8SA 4A2MA 2EE3A 5ACZB 2C4XA 3WDJA 5ESQA 5HI5C 5I1LB 3F7RA 4FQXB 5IWLA 1ZHKB 2XN9B 3QRGL 4XXCA 3TPKA 4JDTH 4PG2A 3WJLA 4RMVA 4PLOB 3I50H 1G9MH 3WEXB 2EDRA 3PWLA 5HTSA 4DVBA 3FRPG 4OLXL 5C0EA 1R5IA 2DKSA 4LSQH 3VH8G 3T0ED 2X9WA 1S5HB 2VL5B 3L3OA 1DN0B 5HI5D 1Q9KB 4O58L 2W59A 3V4VL 4ZNEA 1HILA 4D9QE 4RGNE 4HKBB 1L7IH 4DZBB 1AHWA 4F2MB 1U8HA 2HLFD 5C0FB 3AB0C 1T1ZA 1IQDB 3OX8B 2PR4H 4EDXA 2PETA 1NGQL 1AD0B 2BZDA 3QFJE 5HI4D 5JIIA 3PWJB 3OHXB 5JA9A 1Q9WB 3MJ9H 5FGBC 4W6XB 3KYOB 2D7TL 4R6UA 4UOW0 2IPUK 4ODUA 1OGAB 1OPGH 4NZUL 4X6CB 2HJKB 4JGMA 3AGVA 4F3FB 1WZKA 2C3XA 3CCHB 2J8UE 1GOFA 4HBQA 4RGNB 3ISWA 3GSRB 3WSQL 4YPGA 1HDMB 4JM4H 4H1LB 1ZLSH 2DQUH 3RHWF 2WUCL 1TQBC 3MGAA 1KCVH 3IJHB 3H7LA 4OF0A 3DJ9A 1Q9LA 5TPWH 2Q1EA 1QHOA 3FRUB 4WW1A 3OXRA 2YUXA 3OBAA 1Y6KR 5EZIL 4ZS7H 5CD3A 3GSOA 5I66B 2AK4E 1I1AD 4F80A 1YQVH 5FYJU 3UC0L 1T6WA 1LEGB 4GBXD 2QBWA 2Z91B 3IT8D 1EK3A 4JG0L 3QNYA 1WZ1H 2AEWA 3O9WB 3QDAA 2LFGA 4O51B 2VTFA 4Y2DB 2MSPA 4JZOA 4L9LA 4RSVA 2Q3ZA 4LSSH 3LN4A 2EDYA 3O4OB 1JYVA 3RVWD 1HHHB 4NFBA 4U1HA 1KTLA 3UBXB 5IR1B 1DL7L 4Q7DA 2Z31A 4PJBE 3G5VA 3BKMH 4U1JA 1NGWA 4WV1C 5LAXA 1IILE 4HT1L 4X6CF 3E3QE 3GHEH 5HGDA 2ZG2A 4HUWA 4JFOB 4ODSL 2JELL 2AK1L 1IM3A 1P6FA 4P2RE 3SDXE 1VADA 4JCLA 3TN0B 3KYOA 2E27H 2O5YL 3QUXC 5L2JB 2K1MA 3KNBB 1XGPA 1HINL 4L4TD 1INEL 2L7JA 4LIQH