4ZUWA

Crystal structure of equine mhc i(eqca-n*00601) in complexed with equine infectious anaemia virus (eiav) derived peptide gag-gw12
Total Genus 73
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
73
sequence length
274
structure length
274
Chain Sequence
b'GSHSMRYFYTAVSRPGRGEPRFIAVGYVDDTQFVRFDSDAASPRMEPRAPWVEQEGPEYWERETRNMKEATQNFRVGLNTLHGYYNQSEAGSHTLQRMYGCDVGPDGRLLRGYRQDAYDGADYIALNEDLRSWTAADAAAQITRRKREEAGVAEQCRNYLEGTCVEWLLRYLENGNETLQRADAPKTHVTHHPISDHEVTLRCWALGFYPEEISLSWQRDGEDVTQDTEFVETRPAGDRTFQKWAAVVVPSGEEQRYTCHVQHEGLAEPVTLRW'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Classical MHC class I antigen
publication title Structural Illumination of Equine MHC Class I Molecules Highlights Unconventional Epitope Presentation Manner That Is Evolved in Equine Leukocyte Antigen Alleles
pubmed doi rcsb
source organism Equus caballus
molecule tags Immune system
total genus 73
structure length 274
sequence length 274
ec nomenclature
pdb deposition date 2015-05-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00129 MHC_I Class I Histocompatibility antigen, domains alpha 1 and 2
A PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4zuwA02
3.30.500.10 Alpha Beta 2-Layer Sandwich Murine Class I Major Histocompatibility Complex, H2-DB; Chain A, domain 1 MHC class I-like antigen recognition-like 4zuwA01
4RFOL 4WI9A 5FM4A 5D6CA 4NYLA 1D5MA 5HHVL 4FQXD 5HYSG 3QUZA 2D9QB 2XNAB 3TV3H 5IEHB 5FCSH 2A1WH 4NNXB 4P9HC 3SDXA 2IQAB 4XWGL 4GRWH 3GJFA 2GJZA 1MCPH 4GRLB 2PO6B 1CXKA 2YSSB 1QFUL 3IT8D 1U41A 5D5MB 1FYTA 1SM3H 3AM8A 2VXVL 4OKVA 5GRVL 5DRZB 2VSDA 5I1DA 2X9XA 4JY5L 4HFWA 3W11C 3WUWB 3EFFB 2DIJA 1BX2A 3QI9C 4MNGB 2YD7A 3CD4A 4UDUB 1BBJA 4PLJC 1EUTA 3ZYZA 3LV3B 5B4MC 1HQRB 1GPOH 4P2CG 2DQHH 1CCZA 4N9GA 1RZKL 2OQJB 35C8H 1MFBL 2FATL 4CN6A 3RDTD 3TH4T 4OCRH 4HEPG 1FVEA 3ARFA 1ZT7A 3JZ7A 5SV3A 4AEEA 3OSKA 1Q9KB 5EU4A 3GSWB 1J8KA 1KEGH 3N85L 4ZNCD 2QJDA 5J06A 2AXHA 4GQ9H 2IADB 4P57B 2DQCL 1IGJB 4WW1A 5KS9E 1LE9A 2X5PA 4G42B 1IGFH 1WBYB 1YYML 2Z8RA 3K0WA 4OJFL 3QDMD 5TDOA 4NOBA 2V5SA 1KC5H 4KQ4H 3AM8C 2J8UB 3MRBA 4M9PA 4Y2OA 5HHXL 3LEYH 4Y1AA 4GXVL 3O4OB 3FQRA 4MGXA 2BXYA 1RZKC 2Y07H 4DKFL 4UOW0 1GSMA 4YX2H 1MCCA 4KHXH 3KJ6L 2VDKL 5JW5B 2E9IA 4KROB 5KG9B 3I50H 3HG1D 3QG6A 4HKJB 3GI9L 3O4LE 4RZCA 5IB4B 2BSED 3IDNA 1VACA 5CSBA 1AXIB 4I3RH 5ADOL 1HNFA 3VXME 4PRAB 4DTGH 5ITBL 3ARFC 4LK4A 5DK0A 3DX9B 3INUL 1IGMH 3JTSA 3NPSC 2R4SH 5D7JC 4N9OB 5J12B 2H6PA 2FSEB 3HUJE 1YDPA 4I3SH 1II4E 2XPGB 2Z4QB 3SKUD 4PBXA 3L3GA 1W8OA 1VFAA 4YJZL 2OS7A 2H26B 5TDPB 2VC2L 1A7OH 3CMOH 5IUSA 3VI3E 1LDPL 5EZLA 2BXZA 1B4JH 2ENYA 4FQLL 2QQLH 1XF1A 3NH7H 1UKQA 5I76A 2R2BA 2DQIL 5C3TA 1OPGH 4HSQA 1YQVH 5EBGA 3AS3A 3GMMA 4M8QA 3WNMA 5HYJE 5JTWA 4L5FH 2GFBA 3ZE1E 2AEPH 1MHHB 4HPOH 4PBWD 4UT9L 2F58H 1RI8A 4WWID 3ILQD 5C07D 2AJZB 4W6WB 4J4PA 2D7TH 4U1GC 4YBLC 2PCPB 3QEUB 4ELKB 4LLWA 4MB4A 1OD9A 5B39A 5HDQL 2AK4E 5K9QG 3WUWG 2VLKB 4F7PA 2DQEL 1W72B 4JG0L 3A67H 3PL6A 5HVHC 2HFFA 4U6TA 5DLML 4POYA 3MZGB 4YZFE 5C0CA 4HBQA 4YXHL 2HTLD 3PNWA 3T0XA 2BNQE 3X12B 2GJJA 2R2HA 2YKLH 3L3IA 4OLXH 5I8KH 4UBDC 1MLCA 2AEQH 5TF1L 2AKRA 1LK2A 5IVZA 4N0CD 2F8XC 4HUWB 4HH9A 3BP6B 5SWZE 2DQFA 1WLHA 3QISA 1QBLL 3L3DA 4ODHL 5J89A 5DMKA 1IFHL 1YY8B 4YDLB 4HIXL 1JZ4A 1YMMB 1H0DB 3C08L 1DL7H 1ZE3C 2DLHA 3U9UA 1I8IB 1E0OB 4Y4KC 1IGTA 3QNXA 1ZOXA 5FUOL 2Q8BH 5CP7A 1ND0B 4HBCL 3NA9L 2R1WA 2FX9L 4XPHL 4JHWL 5F7YC 5C0EB 3HC0A 1NGXA 2E8ZA 1H5BB 4E41E 3MMEA 3FT4B 3LEVL 1IGYA 2EDXA 5T3XH 3UC0H 3IYLW 2YUZA 3D2UD 3KPRE 4GW4A 2Z9TA 1X5LA 4H25A 5EO0A 4X6CA 3BPCB 1HHKB 1DQLL 5HHNB 3WSQH 2BZDA 4PJAB 4V1DE 4LU5L 4W4NA 5HGBA 2VITA 1MOEA 3U7WL 4MQ7B 1P7KA 4PP1D 4HK3N 1U8OA 4JFZL 1PG7L 5GJTL 5KSVB 1VB9A 3GSNH 4KK5D 5CSZB 5DHVB 4M43H 4X6DA 2NY2D 2ZOKA 5JPMB 3NABL 5IVOA 1A7NH 3ERYA 1QFWL 3DRTA 3EO1A 3MRIA 5CGTA 5C2BH 4G8IB 1G9EA 1N26A 1A1OA 3MFGB 3WKNA 1I75A 2G60H 1I3GH 4TPRH 3A6CH 2CGRL 2R0KL 3MLPA 1N64L 4RBPH 1KPVB 2CLRA 4OCSL 3JBG7 5DUBA 2RAMA 4O2EB 3I6GB 3BP5B 3U4BL 1R3JA 3OKNA 5DJ8A 4S1QH 2OBGA 5I2IA 1CE6A 4NUGH 3D0VA 3KGRA 2BVPB 5D7LA 1C08B 4LKXA 4WDIA 3Q1SH 4NKQB 1Z9OA 3HPJA 3ULSA 3BAEH 3L3JA 3MV7D 4XVTL 2VDOL 3JWDL 3VFRA 3B83A 4WGVB 4K94L 4H0IA 5JDSB 4Z6AT 4HXAH 1MIML 3WS3A 1NUFA 2DQUH 1ZHLA 4WU7B 3VFTA 2X40A 4U7KA 3TIDB 5DC9B 2HKFH 1NQBA 4OLYL 1RZGB 3KJ4B 1NEZA 1Y18B 5L2KB 1Y6NR 1NCWH 1UKSA 5IIEA 1NC2B 4JM2C 1CFVH 3HMXA 4KJPC 1J05A 1NAKL 4JRXE 2CKBA 5KS9F 3JWDC 1RU9H 3ZSTA 4M1GL 5DF0A 5DJDB 1QR1B 1ADQA 2YD9A 4K94C 1ZGLM 2CIIB 1DN2A 1MJJB 1S7UA 5IMOB 2P8MA 1FG9C 3DX6B 2X70B 3MBEA 2A2QT 3BN9C 2JJTC 4MA8H 2CKBL 3TCLB 3ZKND 1QQDA 3C8KA 4NHCL 1IM9A 3GRWL 1BVKB 3HS0B 4GW5B 5E8NA 4LSTL 3HNSL 3O3BA 2EIZB 3L5IA 5BXFA 5IMMB 4JQIH 4MDIB 2X4TA 3VFVA 4PRPA 1ZHNB 5IVXA 1P84J 1UT9A 3IB4A 3QEQA 1WBZA 4H5SB 1JF6A 1N4XL 3D18B 5ACLA 2AV7B 5F7FA 2IMNA 3O6FA 4Y4HB 2JK5B 3OJ2C 4PJ5E 3H3BC 3MROA 3N9GL 2DYPB 5JW4M 1DQTA 2XTJC 3MRGB 5A1AA 4ZS7H 5K9JH 4LPCA 3B9AA 5E6IB 5BMFH 3SQOH 3GMOB 2ILLA 3HUJF 3OG4B 3BUTA 5I0DA 5C86A 4JN1H 3CXDL 3NZHH 2BERA 1KJVA 3S3PA 3VI3F 3MBEC 15C8L 1YECH 4XZUB 5CKGA 1CDHA 3HPLB 4OZIA 4ZUSA 3MNWA 3OJVC 1P7QB 2VLRA 1CFNA 3RX7A 1FPTL 1P84K 5E70A 3RHWK 1KCUH 1D5ZA 3GMPA 3O45A 1BLNA 3F7PC 1SHMA 3FN0H 4JFQA 4JRYD 3MGAA 5DXWA 1BPVA 2XRAL 4IIQC 3ZE1F 1XH3B 1YEJL 5T5NG 4XVSH 2CUIA 3K2MC 1IARB 2AJSH 3QHFH 3NIDE 4QOKB 3AXLA 1MFAH 5IFJB 1FGVL 3HI1B 4OIIL 5MEOA 1X4ZA 4XWOC 1KG0A 3DBXA 4GS7B 4HS8L 1S78D 4X98A 1S5HA 4EDWL 4ZFZB 1CFTB 3PHQA 4CN4A 3FRUA 1EHXA 4YZFF 3SCMD 5DFVC 1KB5H 1OL0A 2OL3B 4YHOH 1R5IA 1Q0XL 4NC0B 1ZT4B 1BZQK 4OQ1A 1MAKA 2PR4H 2R0ZL 3SDXE 5IW1B 2GT9B 2BOCA 1JGDB 1G0XA 1EFXB 4IOIB 4D0BB 2XYCA 4K7PX 3GBML 3CFIC 3UTSD 5E8OB 1FYTE 4HHAB 1KPUA 5AZ2H 5BZDB 5I74B 1KIQA 4EI5B 3NFSH 4BK5A 4K7PH 2JIXD 3ZDYE 4TSAL 5EN2A 4DZ8B 4HKZA 5EIVA 3VGBA 4FNLL 1FO0A 4NCDA 3GDBA 4KKCD 5L8LB 1QRNA 2C1OA 5GISL 1QNZH 1JIBA 3SDAA 1JI2A 1T2XA 1TPXC 1UB6A 4RGNB 5A3IC 3BVNA 1J1OL 4S1RH 3DX7B 5ETUA 1L7IH 5TGBB 3QHZH 5M95B 4JPKH 5I1CL 3BKYL 4ZO7A 3WD5H 2AI0H 4MAUL 1PG7W 1XT5A 4BZ2H 4NO5B 2NXYC 3O2WL 3IGAB 2H2PD 1PLGL 3HE6A 1BOGB 2XZCH 2A9NL 1EEZA 2ZUQC 5ICYB 4JHZA 1M1SA 4EN3C 3MFFB 2E7HA 2RBLA 4Y1AE 2PXYC 4XTRD 1WAAA 1N6UA 4LDLB 3LKQA 2MKLC 4KFZC 5D93B 4OF7A 4X6FB 4G7YL 4K3JL 1KEML 4NHUB 2AEIT 1WWCA 3MYJB 2FO4B 2DLFL 4XBEL 1AKJB 4PUBL 3O4LD 1MFEL 4XPAH 5E5RB 2XACC 4O02H 12E8L 4N0YL 4XNUL 3SPVB 1SMOA 3H3PH 5TJWK 3Q0HA 2XKNA 2NY6C 1S9YA 4PGCA 5J56B 2DWDB 4PJ9B 4HS3B 4OLUL 1S5IL 1RVFH 2H8PA 1YEKH 3PWJA 4JZOB 2BNUA 3HE6C 1LNUA 4U3HA 4JKMA 4NZRL 4XCCH 5C7XH 1TQBB 1T4KB 1UG9A 1JHKL 3BH9A 4P23D 3V6ZB 5CEZL 2O5YH 3B6SB 4GBXC 5EIIA 2BVQB 3FB8A 3MRKB 2X4QB 3OJMB 1BEYL 1BWMA 1ZA6B 3D1MC 2BOBA 1QSEB 5T1LA 3WFEH 4JREB 3DVGA 5C6PB 4NKDB 4D9RE 4UOJA 1QP1A 3NIGE 3SOBH 4JHAH 2IC2A 4JFEB 4C59B 2XN9D 3LS4L 3FQWA 5F97E 3W9EA 3OGCA 2ZPKH 4P4KD 2NPLX 5E94B 1CBVL 5HGHA 3VFGL 5IQ9B 3ILPA 4J3UA 4KMTL 5IW3A 3OKEA 4HIEB 3ZE0F 2L0DA 3DUHA 1A5FL 2VIRB 4MNQD 1UCTA 3ARDD 3MV9B 4HFUL 3B2UC 5IK3A 3VXTB 3OAUL 2BNQD 5TPWL 1UWEL 4ZD3H 4LCIH 5GZND 4WJ5A 3H0TA 1UA6L 3AREB 2DS4A 1W72H 4M48H 2AQ2A 3N1PC 4HUXA 1BD2D 4QHNB 4YXLL 4R3SA 3QNZB 3QO1B 4NT6B 1CK0L 4BSVA 3KPMB 1ITBB 1MCWM 2YD2A 4KK6D 1NMCB 1NCBH 1RK0A 5FB8B 4HKXA 1F2QA 2LABA 5EWIL 1MUJA 3CUPA 2ESVB 4X99B 5T1KB 2OP4H 4R8WL 4OFDA 1KLGA 1KOAA 1WZLA 2J88H 4OD1L 3HTLX 1TQCB 5EB9A 3ZL4H 3R06A 2GTZA 3D9AH 2EECA 3QA3B 4Z5RB 4X6CE 4MMXC 5DJYB 4U6VH 1RFDL 5D2LB 3TO4D 1X5YA 2CUMA 3G5VA 3KPSA 2L7UA 4V1DD 3T1FA 1KIPA 3MOQA 2APXA 3WLBB 2GQHA 3NIDF 4M5YH 3ME0A 4WCYH 4X6DE 1FAKT 3ARYA 1G6VK 1H3GA 1T1YA 5T33H 4MCYA 2GITA 3MSPA 5GXBB 4OF3A 2OCFD 3MJ8B 4DZBB 3DMMB 4C55A 3T0DA 1L0YA 4IOSD 5KVMC 4KK8C 5FHAH 4JKPL 5A2KH 4R7DB 4F15C 5SWQB 1R3KA 3QDAA 3H42H 5DHVH 4PS4H 1CFSA 1FCCA 4K23L 3KR3L 1LEKA 4I0CC 1I1FA 1K6QL 3S37X 3QCUL 2C7UB 1LP9A 4HC1H 3HLAB 1IAIH 2ZOLA 4KKAD 5DWUH 1WZ1H 5JORA 3TFKD 5GGSB 1LEIB 2AJ3B 5HD8D 2EYTA 2VISB 3S37H 2ZCLL 5D7LE 3P0VL 5JW3L 1E4KA 2IGFH 1OB1B 1GIGH 3ZDYF 1GGUA 4QXTA 5DUMH 1XZ0A 2VKWA 4FQ2L 4PRHB 5CBEB 3OKDA 3MLTB 2WWKO 2O26U 2J1KA 4ODTH 4KKLC 1U2CA 5C9JA 5I1IL 1C12A 4RX4D 3VFSB 3HA0A 1I9RH 1NGYA 4QCIB 4YDIL 4ONGL 4YHML 2LU7A 1XGRB 4HGWB 1FIGL 3BKJL 3QBTB 5CD5C 4OBRA 2XTJE 1YEDB 4ZQKA 4JRXD 1HEZB 3LS5L 1DVFD 1OARH 3UCRA 4RA3A 3GMQA 3Q6GL 2UWEB 3QUKB 3EFDL 5FYKU 5ID0B 5B39G 4OZHA 2X1QA 4MVBA 1KXQE 1MJUH 2G9HA 4KVCH 3MQIA 1XF5B 3VGAC 1ZWIA 1J8HA 1UZ8B 4RMTA 4DK6A 4P5MB 3GM0A 3K3QA 1INEL 3OKKB 2R1YB 1BZ7B 1JMXA 4P5KB 1HWHB 1XCQB 3ARBA 4PRPE 5IVXE 3QUYA 4FQXB 2WIMA 3QEQE 4LQFH 2P43B 2DMKA 2WBJA 1V7ML 2R23B 2ZJSL 2PW2B 2MKWA 3T0ED 5D1XC 2Y6SC 3H3KA 1HOCA 1P4LB 1L9MA 1AGFB 1DEEA 1V3MA 5L88H 1MCOL 5B38G 5CEXA 4UT6H 1PZ5B 1QYGL 3NAAH 4MJ5A 5C8JB 1B0WA 1D5XB 1DBAL 5D6DC 3P9MA 4OZIE 3H7LA 1BF8A 5A43C 4LLAA 1FL6A 2ZCKH 1F6AA 1Z0MA 4OZ4A 3QAZC 4JCLA 5K93A 3IDJA 2DTSA 4RMUA 4NWTL 2F5BH 5DJ2B 1CIDA 4LSRL 1UJTA 4ONHA 4E0RA 4X4XA 43C9A 4ZTOL 2VXSH 4F7CB 1VSCA 3NIGF 1NCCL 4WHYH 3RDTB 3ARBC 1FGNH 4CN1A 5KSAA 4PV8A 1SYVA 4HUKB 1U92A 1HCVA 4JVWA 3G5YA 3QI9D 3OHXA 4HAFA 1RD6A 1N0XH 5FECA 3LB6C 2VB5A 3MLZL 4PLJD 2DL9A 3A6OA 3QDMB 4K2UL 5B4MD 1UXSA 3UAJC 2DDQH 3IDIB 3VW3L 5EOCJ 2XV6B 5MENB 3KLSA 4MQTB 4OM0H 3WMSA 1TVHA 3CGTA 5INCA 4CDGC 1K3IA 3QQNA 3CLFL 3KPLB 3TA3A 1HK6A 4XH2B 3BPOB 2B2XL 3DYPA 1NLDL 3HG1B 3PGFL 5BO1L 1VFBB 3GSXA 4M62L 5HHOD 4QXUH 3EHBC 1FYTD 2ITDA 2OL3H 5KSAC 1O5DT 1ZK9A 3P3YA 5TDNA 1DP0A 3ZLQC 4ZUTA 4M1DL 3QXAA 1CTNA 4LSQH 2IPTH 3WN5A 1QRNE 3TBYA 4MCZA 2APBA 4P4RA 3L7EA 5IEKB 2A6JA 3UBXI 2ARJB 5EU6D 2M1KA 3CFCL 4X6CF 5IMLB 1I7RA 3ARFD 3RNQA 4NKOA 3FT3B 1JHLL 1YEGL 5D7JD 3ET9F 3PWVA 4FXGA 2VDLH 1RK1A 3I3BA 1MQ8A 4U1IA 3MZTA 4X6DF 1H8SA 4I4WA 2OI9C 3PWUB 1BFVH 3MGOB 2AABL 5F9WB 1WAAE 3H9SA 3I9GH 5DJAA 4Y1AD 3RWIB 3IDYB 1JK8A 2YPKA 3KLAB 1T1XB 2GTWA 2NY4C 5SX4I 1HI6B 3WN5C 4ZS6C 1KCRH 1S7VA 1I8KB 3PP3K 5CSGA 1JPGA 1MI5D 3SKNA 4YAQA 2V17L 2HFGH 4GKSB 3K8MA 1JRHI 4HWBA 3IF1B 2VR9A 4PB9H 4JDZA 1OP5K 3SGKC 4PJIA 2V2WA 32C2B 4DN4H 2NLJA 4MLSA 3FONA 4LVHB 5F7EH 4R96A 3ZE2E 1OWRM 1EGJL 4UOW1 4PGDA 2X4OA 4HWBL 2H1PL 1OHQA 4RGMB 4TRPH 4KI1A 2BHYA 2IH3A 4L4TA 3HR6A 4AJ0A 2D3VA 5FKAA 4JPWL 4YNYB 4UBDD 3PV6A 1T6VN 4YHPB 4KQ3L 5E4EB 4FZEH 1IAIM 3TBVA 5I1JH 4EUPB 3NCYS 3DRQA 4LPXA 3VFWA 5I8CA 4CADA 1F00I 3E0GA 1AXSA 3D2UB 3B8YA 1JFQL 1P7HL 1OQOA 4KRNA 2P5WB 1PSKH 1P53A 1ZHKA 5EU7C 1C7TA 1VFUA 2YPVL 4R4BB 5FF6A 1K8IB 1MCEA 4LCYA 4Y4KD 3VFMA 3SDDA 3BZ4B 4GAFB 4NQXB 2NY2B 3NFPA 3RWHA 1TZIA 3P2TA 4RAVB 1A9EA 2IJ0C 1S7WB 5C0CD 1DQQA 1SYSA 1G9ML 3MRRA 1FFPB 2NNAA 2PF6A 4LCUA 3EYSL 1DDHA 4LASH 4OF0A 3RPKA 1BIHA 4LFHD 1JGUL 2CR3A 3G5XB 2F74B 1NEUA 5CEYA 1EMTH 1OSPH 3L5WB 1L6XA 3I6KB 1I8MB 3FT2A 4ELMF 3AAZA 4Q9BA 4AIZA 4XRCA 5FOJA 3TVMC 2PETA 5EFIA 4Z7VF 4X6EB 2YA1A 2OJZH 2P4AB 4TVSa 3SDDC 1WEJH 1K4DB 4OZIF 3ZYJA 5I1EH 1G9MC 3EO0B 2UYLA 2ADFL 4X80H 3P40A 2AJUL 4KVNH 3VGHA 3RPIB 1EO5A 2V2TA 4HWZB 4FQQB 3C5SA 1RZJL 3KPSE 1QSZA 5AAMA 3RUGA 1G7LA 1WIOA 4I48B 3ROOA 1AQKL 1IQDA 3N0PB 4BH7A 1UEYA 5I18L 4KDVA 3QFJA 3SDCC 5IB2A 4K8RH 4MD4B 4PTUB 1AGDA 3RWGB 3P30L 1C5DA 1LO2H 3WS6A 5CJQH 2G5BA 1WVZA 2FECI 2WSKA 1RZJC 5CWSA 4X4YB 5L8KB 2AW2A 3BWAA 4UQ2A 5D70L 1LP9E 4JM2D 3FQUB 2FGWL 4KJPD 4G8EB 5DHYA 3CVIL 2DBLH 4AL8L 4YWGL 1NGQL 2HRPH 2D31A 1H3TA 3FB7B 4R7NA 1QKZH 3BN9D 5IHZA 1EBAA 1R5VA 2Q6WA 3OL2A 1FE8H 3S7GA 2DKUA 3WFDL 2BSTA 5I1AA 1ZSDB 4P5TA 3J7HA 1T1WA 1KV3A 5C0GA 3WS6C 3T4AA 2JE8A 3BEWB 5I0ZA 2MTPA 4LARH 4TSCH 4KTDH 3OAZK 5HDOA 2ARJQ 3MCG1 1GZQA 4I13B 3U48A 3GO1L 2XTJD 4TUKL 3C8HA 4JRYB 1CDYA 2BFVH 3OR6B 1BQLH 2EE3A 4OD2A 5D7IA 1FL5B 5FGBA 3EOTH 3GMLB 4KI5C 3DXAD 5LAXA 4WFHD 4C4KT 4OZHE 3MBED 1WAAF 2NW2B 1MEXL 4GKNB 1J8HE 4NO0A 4QRPE 1N5AB 2CJUL 2NTFB 2RJMA 3FAXA 3L5XL 4JFYB 3VMNA 4MDJB 8FABA 1BVLA 1FLRH 2IPKA 2XKSA 4ENEC 1T22A 1NCUA 4P5TC 3E6HB 1L7TL 1SY6H 4PB0H 3S5LA 3SCMB 3VFUA 1JWUA 1PJ9A 4DCQB 1DN0B 1MCRA 4ERSL 3PDDA 2ED9A 3LQZA 3O6LL 3MRJB 2A77L 1FVCA 3RWCB 3ZE2F 1C8PA 4K9EL 4XWOD 3UTSB 2EIDA 1FAIL 1REIA 1NLBH 5DQDH 3HI6L 5H94A 3F5WA 3MXVL 3P77A 1U8IB 3W2DL 4ETQA 4J7RA 1NCTA 1VGKB 4PLKC 4J23A 4B5EA 3NFNA 2VLRD 4I1NB 1H15B 4MJIA 4OD3L 5DVOA 5EU5A 3RWDA 5F7DA 1QEWA 3MOBH 1U93A 3HC4H 1RUKH 4IMLB 1HQ4B 4K9EC 1AC0A 1SEBA 2JELL 2Z35A 4LLUA 2HLAB 2R0LL 5FAAA 5IQ7L 5FM5M 4LSVL 5DS8A 5E00A 3GHEH 4OQTA 3BT2H 2R1XB 3CIQA 4PRBB 3VWJA 3QPQC 3D69A 4RFEB 3QXVA 3HC3L 3L1OH 2DMBA 5JOEA 3K4DA 2I60H 1A7PH 3TNMB 1ZVSA 3MLXL 3U30C 5A3ID 2WINA 1MFCL 1SQ2N 5F3HA 5B8CB 1KTDB 1T83A 5IMKB 2GEEA 1A1MA 2H9GB 1OQXA 3MACL 2M2DA 2DQTL 4UNUA 5IBTH 1IC7H 3IFNL 1WWWX 2NXYD 2AJYH 4N0RA 1HXYA 3I85A 4ODUA 3O4LB 1A3RL 4IS6A 3RY5A 2V5MA 2HJLB 1TJHL 3RVUC 1RUAH 3SJVA 3A6BL 4EN3D 4MX7B 2J6EH 3HI5H 2QBWA 1KJ2A 2PXYD 2GCYB 2IFFH 1CICA 2VNCA 4S1DC 3IJSB 3OB0K 2YA0A 5I75C 4MXWL 3VWJC 1JYXA 3DVNB 4I2XA 5KOVC 1CF8H 4H26B 5DMGC 4MD5A 5EC1B 1A6WH 2VR4A 4P23B 4OLZL 1F3JB 5JQ6L 1T2JA 1QUNA 4NQSA 3MPCA 3HE7A 2IG2L 3ALPA 3W39B 3L9RA 1W0VA 1T83C 4UQ3A 4EOWL 5C9KA 2NY6D 3CH1B 2VXQH 3OZ9H 1KT2A 1R3IL 4S0UC 1TITA 5DYOB 5BV7B 3N06B 2CLVA 5IG7B 3FZUC 2XN9B 3QJFB 4ALAH 1U3YA 2P7TB 4M7JH 5FDYA 1VPOH 4PG9B 3AU1B 4KZEL 4KTEL 1CL7H 3H9SE 4GBXD 3FFDA 4LLMA 1YYLL 4YPJA 2E27H 3MO1B 3ULVL 1CICC 4KY1H 2R2EA 1TIUA 3WKMH 4MNQB 2O5XL 5HDBE 4U1KA 3I75B 4GG6B 3O9WA 3ARDB 5I1HL 1LP9F 1ZLWK 5DD5H 5ICZA 4KKNA 1UQSA 3MR9A 5EU7E 3MCKB 2BNQB 5HVFB 1UWGL 2AJXH 4PJIE 5JDJA 1KCKA 4M9OA 5AWNH 4M7LL 2OZ4L 4GAYB 5CEZD 3OTTA 4FP8H 1G7QB 1IGIL 1BD2B 1QFWI 1HSAB 1JPTL 2EDTA 5D1ZC 1R3LA 5DR5H 1FRGL 5T3ZE 1OAZL 4WW2B 2MQ0A 4ZXBC 1KF9B 4EDXA 3Q5OA 1T3FB 3TGXA 1QHPA 2Y36L 4W70A 4ODVH 3PJSB 4A6YA 3B2UD 1J12A 1BJ1J 3VG9B 5CCKL 5C08D 3B2VH 3KPPA 3VE0B 1E6OL 5AUMB 4RDQF 3BZEB 4EI6B 5GRVK 2FLBT 1SBBA 1DBKH 1LEGB 1Z5LA 3O9WC 5BVJB 3GBNH 1AO7D 1AIFB 2Y1VA 3WIFB 2X4SB 3QEGH 3VJ6B 2BDNL 3TO4B 2I07A 1JZ3A 5DGRA 4XP5L 3MOAH 4BM7A 1RURH 3IAQA 2BRRH 4EUPH 3U2SA 4KRPC 4OZHF 3DNKA 5D72L 1S9WB 2JB5L 1IZKA 4XC1H 5FUZL 5LXGH 1A6VH 5C0DA 1UXWA 2FD6L 3LN4A 3D85A 3BO8A 2ZNXA 2VLJD 4CDHA 3GUTB 1WFNA 5DQJB 4PRIA 4RFNB 4DOHB 3LKRA 2X4NA 2BHUA 4H0HB 1T66C 4WY7L 1M7DA 1G7JA 3BGMA 3R4DA 3NCYP 1AQDA 3MRPB 5GHWL 4O51B 4FTVD 4CVXA 5C0RH 4H1LA 3EYQC 1AD0A 1DLFH 5FO7B 5LJYH 3CVHA 4HPYH 1FJ1B 1SJHA 3PWPA 1CFBA 1IC4L 5ERWA 1HN1A 3OXSA 4X6BA 1DJSA 4U49A 5CIPA 5I1GL 4PRNA 4KK8D 5FYKE 2I9LB 1U8JA 1IJ9A 3W5NA 4R2GC 4XAKE 2AK1H 1OAUH 1C16A 5GS1B 5LGJB 3MRNA 4KMQA 5FCUH 2LE9A 4HUVA 4OZFB 1JGVH 1GVIA 1S9XA 4H0GA 3M1BB 2NW3B 1H3VA 3JWNC 4R4NC 2X89A 2Q76A 4OUUB 3RUGE 1CLYH 1IL1A 3C2SA 1S7TB 4RAUB 5EU3B 2A74B 4YQXL 4UV7H 3QFJE 2P8PB 1RUPH 2RIKA 1GJIA 4JAMA 4CKVX 4E5XB 1PYWA 2QKIA 2W9EH 1AR2A 5DEFA 1WC7B 4KKLD 3U36A 3X3FL 4PPTA 2FHBA 1GAFL 3EJZC 4XNYL 1OGTB 4P9ML 3ZTJG 2I26N 3MCLL 4G9DB 4WIQA 3RZCC 1FNGB 4IOFC 4MWFA 4W6XB 2E9WA 2FIKA 2HVJA 1KIUA 4ZFOA 1MCSA 4OGXH 3ZKXC 5E6ZA 5CD5D 4N8VB 3RKDC 4XCYB 1VA9A 1X5XA 3L3HB 4OLEA 4OV5B 4GG8A 1SJEB 6FABH 4ZFOL 5BRZA 2AJVH 5IJVA 2OTUB 1RHHA 5GGQH 4YGAB 4P59H 3FL7A 1LK3L 1LO4L 4OBSA 1WBXB 2HJKB 5EBMA 3L3KB 3T0EB 5EOCH 1VEMA 1I1YB 4M5ZH 2D2OA 3LD8B 5C0NC 1CU4L 2B4CH 1IM3A 3IDGA 1E28A 2ADJA 3FOMB 4TQEH 4B0MM 4OGYH 3W0WD 1HDMA 3J8F7 1WWBX 5DJ6A 3U0TB 5KZCD 3SE8H 3HAEG 4UUJA 5FYJU 3VRJA 4F33A 3VFNA 5D1XD 3TNNA 2Y6SD 1UACL 4WFFD 4WENB 5T1MA 1IGCH 2PYFB 4K7FA 3HRZA 1YNKL 1J1PH 4WFGD 4N8CH 5TE7H 3ARWA 5D7IE 2DRUA 4LLVA 4AMKL 5JPNA 2O61A 4HWUA 1ACYH 3OPZL 4DN3L 5E2TL 4ZPVA 2KQNA 1EHLL 4KTYA 4PYGA 1CGWA 3U0PA 3QT2A 3QI9B 3PP3H 4NM8H 4G80A 3WNPA 4LHUB 2EKSA 1G6RL 5HDBF 5EZJA 2ZP0T 1XMWA 4QGTA 1MREH 5ADPH 2XZAL 1OP5H 4LEOB 3HMWL 2D03H 3ARBD 4QRSA 3S35L 4OTXH 5ISZA 5ILTH 3HFMH 5IF0B 4I5BB 4JPIA 4Y4FC 2D0GA 2BNRD 1GC1H 3RBSA 4PJIF 3TC9A 1RUQL 4JFOB 1X4XA 3LSOB 1D6EA 1NGPH 3WE6A 3CFEB 3D0LA 1J0YA 4FZ8H 4XMPL 4NQDA 3TF7A 3EGSA 1HINL 4CBPA 3LB6D 4EIGB 5HHOB 1XR8B 3UAJD 2DTMH 1FN4A 1MFDH 4JFXB 1KPRA 5LQBH 4G9FD 5J57B 4HFWB 2DQDL 3SGDH 1MCHA 3KYNA 5JO5B 4NNPL 1LQVA 5TQ2H 3GHBL 4JY6A 2ATKA 4MJIE 4M3KB 2MSPA 1N6QL 1P1ZB 2CRIA 3C5JA 4QRQA 5C3LD 2DKMA 4N8VG 1MHCA 1A1NB 4APQA 5F88B 1NCAH 5EU6B 2AQ3A 3EHBD 1ZT7B 1MNUL 1FZJA 5KSAD 5EU4B 1XGPB 4YEFA 2VDPH 2HVKA 1IKFL 2DBJA 1QA9A 3NPSB 5D7JB 2FH6A 2V9RA 3MJ6A 3TF7C 1FZMB 2GAZB 1CG9A 4Z78A 5GSRB 1T03L 3O8XB 1GZPB 5A16A 1F4YL 1R24A 5CILH 2W91A 3IU4L 1LE5A 4CUCA 4KJYB 2YRLA 1N6VA 4L29B 2GSGB 1INDH 3CDFA 4YXKH 3ALXA 2CUHA 2JF1A 3BPLC 4X7TA 4Q6YA 1AGBB 1XF4A 3VWKC 3CLEH 1MI5B 3P11H 3IDNB 4F57H 3FHAA 1HH6A 3ETBF 5KW9H 3SJVE 4EQ2A 4JJ5A 4PJEB 1TJIH 1MY7A 5HY9A 5TQ0H 4U1GB 4G8GD 4YBQC 3TCXA 3EDFA 4ZG1A 1F58L 5K9OB 4I2XE 2JCCB 2NY4D 4LPTA 2Z93B 2WIIB 3GBLA 4NQCD 2J4WH 4OZGB 4ZS6D 4DGYH 5GQBA 1VDGA 1VFAB 4RGOH 5HVHB 3PWLA 4CVWA 4EKXA 2EYSA 1ZT1B 1TVBB 3ISWA 5CZVL 4LHUG 5BW7A 5EZLB 3SE9H 3O81A 3OF6A 1IBGL 3ARGA 3LHPH 9CGTA 3U7YH 4TOYL 2N7BA 4E9LA 3RUGF 3QWRA 3VU2A 3TLRA 1A3LH 1A7QH 4TYUA 3HZKA 4M8QB 4LBEA 2AAVA 4MAYB 3TZVC 4NNYB 3KS0J 2FX7H 3DO7B 3V5HA 3T3ME 1RMFH 4AIOA 4YDKL 2JB6B 2X7LA 3E8UH 4Y4KB 4MQXC 2VE6A 4C56A 3LKNA 3GK8L 5BV7H 3QH3A 1JZ2A 2DWEA 4JGMA 5DK2B 2HFFB 1U91B 4XP6L 4Y88A 4IHOA 5GIRB 5C0CB 3V8CA 4MB5A 3PNWB 4X0KA 1JVKA 4Q9CA 3RL1A 3RWFA 4LLQA 4PJGA 5IVZB 4QRRA 1GGCH 1QSFD 3BIAX 4I0PC 3T8XA 2XTLA 3TBTB 3MBXH 1EXUB 2EC8A 3DGGA 4OCNC 5DZNA 1G7IA 1NDMB 2A9ML 1KCLA 4QY8B 4U1MB 4LEXH 3PV7A 3MRCA 5KAQF 5DT1L 4L4TD 2XWTA 1RZFH 2KUTA 2D7MA 3QXDA 1RZ7L 2XG5A 4UDTB 5GSVB 4PIRF 5AZEH 4KUZL 2EDOA 5CP7B 1TZHA 2RHEA 3RGVA 2OTWB 4OSUL 4AEIL 4WVRA 1NL0L 3HC0B 4NSKB 1U8PB 1BHGA 3GSQA 1FBIL 1U2HA 2FHFA 5HGAB 5HYQB 3HKFA 3KLHC 4PY8I 3VXRA 2DI7A 3MUY1 3HZMB 3L7FB 5I8OH 3FTGB 5D7IF 4DVBA 4PLNC 1NH6A 4CU6A 4YR6A 3TVMD 5SX4H 1ONQA 2QHRL 4GMSL 5HHMA 2VZ3A 1I1AC 1E6JL 1B6UA 2VZUA 3DECA 3SDDD 3QDJA 2XQBL 1FG2A 1RJLB 3BD5A 5CBAA 3DURA 3QPXH 1JRHH 4N1CA 2Z31C 4K3GA 4DGVL 4LLDB 3VXSA 4Y8AA 4PRIE 7FABH 5ANMA 3VXPB 1A1OB 3WFCL 1NSNH 4F3FB 1NAMA 3EZJB 3RGVC 2F8OA 2IBZX 1DFBH 5B21A 2BP3A 4JM2B 3UROR 1KGCE 2FGZA 3FN3A 5D7SH 4S1SL 5ALCL 4YHKL 1MCJA 3DJ9A 3SDCD 2QSVA 2NY0C 2F53B 3ABZA 1R3JB 4FQPA 4XP9L 5JZ7C 1HKLL 3PWPE 3D0VB 4RMWA 2GHWB 1T20B 3MV8A 4ODWB 5EOTA 3IXTB 1C7SA 2HLFC 1GHFH 5J13C 1I7UA 3HPJB 4U33A 2H32A 1JNJA 3IS0X 4YEEA 2J2ZA 1CGYA 2IAND 3DVIA 5FYKD 4CMMA 1UM4H 5IV2A 1DANT 1U8QA 5CLWA 5INDA 1BGXL 4KXZI 4KGLA 3VFTB 4ORZC 2LU4A 1M05B 2CK0L 3QIUA 5F1SA 4Q2ZB 1RJZB 2ICEA 4BFIA 2IPUK 3M8OH 5DD1L 3UPRA 1M71A 4WGWB 5EORL 1NEZB 3B9KC 5TE4H 1NDGB 1QOKA 1WGOA 5DZLA 2XTJB 4PJDA 3V0WH 2E9JA 1S3KL 3QFJD 4Z8FL 4ZYKB 3BHBA 4I0KA 4U0QB 2CKBB 5EZIH 2MPAL 4KPHL 1T0NA 4JANB 4OZFH 4TN9A 4YHLL 2NY7L 3WJJA 3SGEI 2UZXB 1F4XL 3DXAB 1IAOA 2P8MB 3MBEB 3EYVA 3SO3C 5E1AA 1QRKA 2E6QA 5DD3L 4PTTA 2VXTL 2IQ9L 4BQ6A 4MZ3A 4UIMA 5GS0L 5BRZE 2FB4L 3P9LB 1VKXA 3VFOA 5JHDA 3QIUC 4IIQB 3WHXA 3REWB 3KHQA 4X8XA 3UTPD 3OB0H 4HF5H 5I15H 1ZEAH 1I7ZA 1RULL 4KI5D 4DK3A 1ZHBA 2GJ6A 4UINL 4FXKA 1Q8MA 3WJLA 2RFXB 4XNMB 5F6HI 4M7KH 1F90H 2G2RB 4OFYA 2VAAA 4PG2A 4ELMB 4HIHB 1JZ8A 4Z7VB 1QBBA 4P5TD 3QQ3A 1NBZA 5H2BA 5ABDE 1WTLA 3SKMA 1RAMA 4HV8A 3VGFA 4J8RB 2DLEA 1PW3A 3UTZA 5ENWB 2VLRB 1MRCH 2DM2A 4JVPA 1CFNB 2JJSA 2VQUA 4KHTL 2WUCL 2ZKHH 4NJ9L 2NX5A 2OJEB 4JFQB 1ZANH 1M7IB 1P9MC 1YPZA 4GRMB 1NBYB 2EEBA 4HDIA 1UCBL 4JVUA 3T3MF 2EICA 3LH2L 4P9HH 3SEPA 4XAWH 4QTHB 4PJFB 1ETZA 4BUGA 4PLKD 5MEOB 2EO1A 1P4BH 1S7SA 3D3VA 5KANG 3R0MA 1KG0B 3DBXB 5HHQA 4ONFH 1BBDL 3C9NA 1ZLWH 4PG2C 3ZHKA 3CXHJ 3TIEB 5C6TL 2P5EA 4R4FH 1EH9A 4NGHL 1TPXB 5J6HB 3V5DB 3FRUB 2E7MA 1D5IH 5A2JH 4PY8J 5ISZE 1KJ3L 3QRFM 3CH8A 4HZLA 2DI8A 3C6LC 2DIAA 4RFOH 3CZFA 4V3DB 1U8LA 1IAMA 2YMXL 4H1LG 4YHZL 5D1QA 2NXYB 4NQDE 3RWEB 3KYOB 4PGZA 4TSBL 1W0WB 2ITCA 4XWGH 3QPQD 5HSFA 2ZUQB 4EN3B 3MNVA 1QFUH 1KIQB 1UM6L 2PXYB 1JGLL 4M6OL 1X5ZA 1N3NA 3PWNB 2VXVH 3CXHK 4JFHE 4M00A 4JY5H 4U1NA 5F44A 2VLME 5CGYC 4LGRB 4MJID 3TBSB 5HYIA 2J8OA 3THML 1X7QB 3UJJL 2C3GA 1FH5L 4TUJB 2VABA 1HHGA 1U3HC 2NY3C 1RZKH 1TCMA 2EH8L 2J5LB 3MX0A 3X3GL 1BREA 2AVGA 4YFDB 1MFBH 2FATH 2NY6B 4N0FA 2FYYB 1KLUA 5BOZG 5DJCA 5EBWB 2EYRA 2DLTA 4M61A 5D1QC 5FM8A 1BJ1H 2M26A 3LDBC 4S1DD 4U1LB 4ORGA 4H20L 1UJ3A 4Q7DA 4XB8A 4Z0XA 3VWJD 3N85H 4UAOB 5EA0L 1I3RB 4NQEA 4WEMB 3QXUA 3BSZL 3WIIL 5DMGD 2YHGA 5IB3A 5EUKB 1YYMH 4KJWC 4OJFH 4GBXB 1WZMA 2DLIA 3K46A 5ESVB 2XICA 2ATPB 3LKQB 4OB5L 1MJ8L 4LF3A 5HHXH 4GXVH 3TEUA 3WNKA 5JMOC 1V8HA 4YHYB 3GSRB 2P42B 3OKOB 5FA4B 1JPFA 4YLQT 3BWUC 1MHEB 3ULUE 2D0FA 3KJ6H 2VDKH 3LN5A 3GI9H 4OM1L 2Q7YA 1DBBL 1UB5B 3IDXL 3SJVD 5BVPL 5ADOH 1XGTA 3EYOA 3ARTA 5ITBH 1EEUA 1HKFA 1CICD 3KYAA 4RISL 4LRIA 4DTGL 4NQUA 1UJ3C 5I9QC 5DSCA 4AG4L 3INUH 1AP2A 3T04D 1J0JA 4O2FB 5IM7A 5C0AB 5IOPA 3UO1H 1EO8L 1LILA 5FK9B 2CO7B 5C08B 1OAYL 4CGTA 2VC2H 4P2OC 1LDPH 2ZSVB 4G8FB 5F1NB 2XZQL 3CSYA 4FQLH 2QSTA 2LQRA 2DQIH 4N5EA 1L4IA 5D1ZD 5F6HJ 3ULVD 1AO7B 2BX5A 3FQWB 3PDOB 4ZXBD 1H3PL 3DETC 3DV4A 3OGCB 1LQSR 1CXLA 4HLZH 1XIWA 4XNQA 2COQA 2UZYB 4C56E 3PXJA 2IFGA 1MCIA 4F7EA 4UT9H 3S8WA 1QLRB 3WFBL 4LRIC 1IC1A 1S7XA 2XKUA 2DQJL 5HDQH 5AD0B 2VLJB 3O9WD 2HKHL 3VRIA 2DQEH 4JG0H 4X8JB 3FO2B 2BSRA 4GW1B 5DLMH 3T4YA 4NC2B 1G9NL 3LZFL 4PJGE 2E7LA 1DCLA 4YXHH 4QRRE 1XFPA 3MNZB 3GB7A 3NVQA 3FFCD 5TF1H 4FTVB 4KRPD 4ZPTB 5LWYL 4YDVA 1QBLH 4ODHH 1P4IL 5FFLA 1IFHH 1IAKA 1GCFA 3LMJL 1ORSB 1XAUA 1I9IL 4HIXH 5IR1A 1QO3B 1N2RB 1UEMA 3C08H 4TVPE 1P2CB 5T5FL 4Q58C 1HHJA 1DL7L 1T89A 4F15B 2VO5A 1A6AA 5FUOH 3LRGA 1T66D 1YEEL 1G9NC 3L6FB 1GGIL 1EK3A 4F9PC 2GK0A 4HBCH 3NA9H 4XPHH 2FX9H 3MRQB 4JHWH 5IKCB 1I4FA 2IWGA 3EYQD 3VXRE 4DUXA 2CLZA 4XPGL 5FA3B 2FJHA 2VDNL 3LEVH 4RQQB 5ITFA 3OKMA 4DVRL 5HHME 4DEPC 2MQCA 4YUEL 3HZYA 1DQLH 1KIPB 3QDJE 4LU5H 1PG7X 5FO9B 3MJ7A 3U82B 3GSNA 4L3EA 4WUUD 3TYFB 3U7WH 5H37H 3LKOA 4R2GD 4JFZH 1PG7H 2AP2A 5GJTH 3VXSE 1B6DA 4JN2A 4YO0A 2R8SH 4GUPB 5MHSE 5ANME 4PRID 4L8DA 1QFWH 4R4ND 1T89C 1PY9A 2XI9A 2C3XA 5FYJE 1FQ9C 3VA2C 3DI3B 3RVVC 2CGRH 2R0KH 3V4PL 1ZXQA 2ZOLB 5GGTL 1KGCD 1N64H 3S96A 3E1F1 4OCSH 2CDGB 4U6YA 3UTTA 3U4BH 3MV8E 4FHBD 3EJZD 3PWPD 1YNTA 1W8NA 5I8EA 3TPUA 2ZNWA 1NFIB 3RZCD 2BSSA 4IOFD 2EDHA 3DX8A 3PHSA 1RIVL 3B5GA 2R56L 2UVFA 1S9KC 3RKDD 3W0WB 4XVTH 4N0UB 2YRPA 4Z95L 3JWDH 3NGBC 4K94H 4IM8A 1A4KB 5KZCB 3LKSA 2BVUA 3CSBA 4LCCC 3BQUD 3U9PL 3HR5A 4U0RB 5L9DL 2HT4C 4XXDA 1MWAL 4U1JB 2X89D 4MYWB 4BSWB 5D1XB 4C54A 2A38A 4PJDE 4ZDHB 3PE9A 5C0ND 5HYSA 4OLYH 4QGYA 2EDEA 2EEDA 1EAJA 1INQB 3O11A 5F3BA 5CHNA 4QYOA 4V2BA 2HP4A 4N90D 1NAKH 3ARZA 3FB5A 3E3QA 2EC9U 3KLDA 3AGVA 4MA3A 4P2QA 4TTGA 2DLGA 3IETB 4M1GH 1T21A 3RTQA 3IJYB 3TT1H 4FFVC 4DUWA 5A2IH 3H9HB 3QAZB 5CJ8A 3RJQB 2CKBH 2X4PA 4NHCH 3CDYA 1BZ9A 3GRWH 4QXWA 2X4RB 1EAPB 1R5WA 5TH2A 3ZKMC 2Z8WC 4LSTH 3HNSH 5BRZD 2AXFB 3ARBB 3V6FA 1PKOA 5CJBA 2BNRB 3B3IA 3SN6N 3V4UL 3DV6B 4Y19A 2GJ6E 3OGOE 4WI6A 2X1WL 1UFUA 1HOCB 1N4XH 1G84A 3N9GH 4BK4A 5CEXB 3IFLL 1KCVL 5F71A 4XVUC 4G9FB 5SWSA 3ZTNH 1OSZA 3P9MB 1FVDA 2YEZB 3RTQC 4HWEL 3CXDH 1FL6B 1MRFL 3K74B 4OZ4B 4Y4FD 5EUOA 3ZHLA 5CJOL 15C8H 4U6XA 3K4ZA 3QCVL 4L8SC 2FDBP 3IAGC 2YPLA 4ONHB 4X4XB 2NX5E 1R3HB 2Q7NA 1JHTB 1YPZE 1FPTH 5FYLL 5FOBA 4WWKA 3NCEB 4OFPA 4CJ0A 2E5EA 5KSUA 3NTCL 5E03A 4RCAA 5EDXA 2XRAH 4XX1E 1H8NA 1YEJH 3FN0L 3IU3A 2ARWA 4M6NL 4NQVB 5T1DL 3D3VE 3G6AB 4YPGA 2DJUA 1QACA 1KN2L 5FECB 1TZGL 1IC5L 3DOSA 4EBQL 2XOTA 4XBGB 4F2MA 1FGVH 4OIIH 2C26A 5C0JB 4HWNA 4CVUA 1WT5A 4HS8H 4YHNA 1KB5A 3IKCA 3Q2CA 3BYTA 4L9LA 4HJJL 4EDWH 5ISZD 3KS0H 4PJGF 4QF1A 4GRWE 3VG0L 4GLRH 1Q0XH 3MRFA 5FIEA 1F5WA 2R0ZH 1CFQA 5C0BD 5FGRA 3GSXB 4WWKC 2OI9B 2ITDB 5DI8A 2XNAA 3GBMH 1YEFL 4LSUL 5IEHA 4NNXA 1WWAX 2IQAA 2W0LA 3V0VB 4G8GB 5AZ2L 4JFHD 4NQCB 1GYAA 3F6IA 3MLYL 3NFSL 5D5MA 1GOFA 3C09C 3TBYB 1O7SA 1NC4B 4FNLH 3VWKD 4Q9RL 3TM6A 1KJMA 3VDCA 5DRZA 5FM5O 5J1AB 5GISH 1CQKA 5JOPE 3WUWA 3EFFA 4JG1L 4L9LC 3M17B 4AQ1B 4MNGA 1I7RB 3QUML 2GIYA 2ZUSA 4UDUA 3UDWA 3LV3A 3Q5YA 1HQRA 2VLLB 4YBQD 1P6FA 1FZOA 5I1CH 3BKYH 4R90L 4NQEE 4OFVA 3PWVB 2OQJA 4MAUH 4U1IB 3O2WH 1VESA 4I4WB 1PLGH 3RY6C 4JO2L 2V7HB 5J9PA 5E8PB 1YJDH 3SDYH 5E2UL 3GSWA 2A9NH 3Q48A 1VADB 3VRLF 1AHWA 4GOSA 4P57A 2NZ9D 4IRJC 1IGJA 2GTWB 2WY3A 2CXKA 1WBYA 2IAMB 4OLWL 4MB3A 5HJ3B 2P47B 3SKNB 4YAQB 4G7YH 4K3JH 1KEMH 4AM0B 2EE9A 2I9TB 1KNOB 3JWOL 2AV1A 5FXCH 3TZVD 2DLFH 4XBEH 4PUBH 1MFEH 1QSFB 3ALWA 4MQXD 4XNUH 12E8H 1S9VB 4N0YH 2NLJB 4ZUVA 2P45B 3FONB 3UDWC 1NKOA 4FFZL 1A6TA 5JW5A 4R96B 5KG9A 4HKJA 3ZYIA 5IB4A 4X5LA 3H3PL 2VQ1B 1S5IH 4OLUH 1UYWL 3DHMA 1J5OH 3FO1A 1U95B 1QFWM 4L4TB 4NBYB 3H7BB 5E99L 5IB5B 3BD3A 4NZRH 4OT1L 3DX9A 1JHKH 4NZTL 1AHWC 5CEZH 3JWOC 3DHJA 2D7PA 2FSEA 3S34L 3BIBX 4I0PD 1BEYH 2Z4QA 2V2XB 1MVUB 3DRQB 2J8HA 3FQTB 4NOFA 4CADB 4PJDF 2V9TA 2EDLA 3V95A 3GIVB 1CD1B 2IBBA 3JUYA 1JWSA 2DM3A 3O6ML 5E6YA 3TVMB 1J9CT 5FF6B 4NUJB 5GGRY 1A7RL 3SDDB 4KV5E 3VD7A 1CWVA 1CBVH 4MJ6A 4U2ZA 4IMKC 4Z7NE 3VFGH 4DFHA 4KMTH 3VXUE 1MHHA 3RWHB 4K3DL 3KLHD 1A5FH 4ZFFB 3CZJA 4JFDD 2L7JA 2MJWA 2AJZA 1X44A 1WITA 3Q6FB 3BMVA 4ZOAA 2E7LE 2PCPA 3QEUA 1CTOA 4HFUH 4ELKA 3MTRA 4MHHI 3OAUH 3O2VL 3VD3A 1I1AD 5TPWH 2BCKB 1UWEH 5C0IB 2VLKA 1W72A 1Z0NA 5JW4R 5E7FA 4ZMAT 3SDCB 1N8ZB 4L1HA 3IRZA 1MSPA 1UA6H 3AMLA 1Z2KA 3X12A 4M7LT 3FT2B 2Z31D 4YXLH 5DDHB 4AIZB 2FBJL 4XRCB 4M48L 4X5WB 5SX5H 2W0PA 3EDEA 5GRWA 3BP6A 3FRPG 4GSDL 1CK0H 3ZDXE 3PIQA 1YY8A 1XR9A 2WNGA 2IANB 5IFHH 2V9QA 4PJHB 5EWIH 1YMMA 1H0DA 2UYLB 3BGFB 1T04B 4Q6IA 4LAQL 5T3XE 2WLZA 5FO8B 4R8WH 2R29L 1I8IA 2NY0D 1HZHL 5JZ7D 4OD1H 3I6LE 3BDBA 4ISVB 3C5SB 1YPZF 4M1CC 2KBGA 1DQDL 5FGCE 1ND0A 5BOPA 1CZ8L 2D9CA 5HHMD 5C0EA 1FDLL 1RFDH 4MXQC 2HLFD 4A2MA 1UH2A 5JXAL 1IQDB 1H5BA 3GZKA 3FT4A 3V7MA 4ZAKC 4L3EE 3OBAA 3QDJD 3QFJB 5M94B 2DN7A 1K2DA 5IB2B 5F21B 1F4WL 1AGDB 1J0KA 5HHNA 4PJAA 1VGEL 5LBSL 2DF3A 4MQ7A 3MV11 1CN4A 2EXWC 4Z7UB 4OI7A 5KSVA 1YY9C 1U8NB 5DHVA 1NUDA 3D6GA 5JPMA 3B9KD 1U0QA 4JKPH 4Q6IC 3S6CA 2E9BA 5F1OB 1X6NA 4K23H 3FN9A 3KR3H 3CX2A 2CDFB 4FQHB 4G8IA 1BFOB 1K6QH 4U05A 2V7NB 3UTTE 2Q1EA 2QQKL 3QCUH 4OGAC 4PS4L 4BKLB 2B1AL 3TPUE 3FKUS 2HA1A 3EKCA 4XCNB 2ZCLH 3NZ8A 4OLVL 4NN5C 4HUUB 1KPVA 1H5BC 5IHZB 3OJDB 4OCXL 1CYGA 3P0VH 1HWGB 4O2EA 2IH1A 4Y5YA 3BP4B 2Y25A 4FQ2H 4HJGB 2IGFL 2Q86B 3WLWC 2Y7QB 2LFGA 3QSKB 1IILE 1T1WB 5I1IH 4LNRB 4QLRA 3QIUD 3B8SA 2LVEA 4HQQL 4YDIH 3Q5TA 1BMGA 3BUYB 4OIAA 4ONGH 4YHMH 1UC6A 3U46B 2YD5A 4Y0GA 1FIGH 5IHUL 3BKJH 4NCC2 3KWWB 5CD3B 4BFGA 2BJML 3RVWC 3DYOA 4OD2B 2ERJB 2AXGA 3E3QE 3TIDA 1V3JA 3RRQA 4NPYB 4P2QE 1VFMA 5EO9B 3LS5H 1RZGA 1Y18A 6CGTA 1NC2A 3Q6GH 1FFOB 4ODXB 1I8LC 3EFDH 2BVOB 5I71C 1CGVA 3CFBB 4D9QE 4Y5YC 1F4AA 5DJDA 1QR1A 2ZG3A 3IRPX 2CIIA 1MJJA 2J12B 3S5LB 3VFUB 3DX6A 2X70A 1INEH 5JHDD 1JWUB 4PGJA 3TCLA 1NUNB 5DD0L 4Y19E 1BVKA 3HS0A 4GW5A 4M4RA 2FL5B 4JCMA 1V7MH 2ZJSH 2EIZA 4KXZH 3FQXB 3CDCA 1FVCB 3G5ZB 4JO3L 1EPFA 4ZOEA 3SY0B 5J0BA 4I18A 3DIFA 3LRSB 2WUBL 2N4IA 1ZHNA 2ICCA 3QJHB 5H94B 5SWSE 1MCOH 2AV7A 2YBRA 1QYGH 3P77B 3S4SB 4Y4HA 2JK5A 3BW9B 4ETQB 2DYPA 5FYLE 4UT6L 3F62A 1K5NB 3C6LD 5EUOE 4LVOC 2QR0B 1DBAH 5C1MB 1T6WA 5E6IA 3G9VA 4BQ9A 1JF1B 4H8WL 3GMOA 2W60B 4HXBL 5EU5B 2YPLE 4LCWB 4NWTH 2G5RA 3REVB 2ZCKL 2VL5B 2BY1A 4LSRH 1ZLUH 4XZUA 4ZTOH 3HPLA 1NCCH 3ZKSD 1P7QA 5J6GB 3OKLB 1R0AL 4QEGA 5I75B 4KV5F 2X4UB 5F93C 3EO9L 4I18C 5HGDB 5CGYD 3QDGD 1Y6KR 4Z7NF 3X13B 1E4JA 4U3XA 1B88A 1XH3A 2P5ED 2I25N 4H8WC 3MLZH 4AT6B 2C5DC 2Y4SA 1YN7A 4K2UH 2WINB 3PP4L 2F15A 5HGGS 3ZHDA 4QOKA 2FEEL 5TFSL 3VW3H 1U3HD 2NY3D 1DBML 5IFJA 3HI1A 4JQVA 1H8OA 3UYRL 4WNQB 5IB1B 5E6IC 1D5BB 4ZO9A 4NBZB 5DVMA 4L3CB 5D1QD 3CLFH 4YBHA 4ZFZA 1CFTA 4C57C 4YGVA 5D2NB 3T65B 2B2XH 1NLDH 2OL3A 1T0MB 3QHTC 3ECBB 3PGFH 5GRYA 5BO1H 1ZT4A 4KJWD 4M62H 4QRTA 5IW1A 2GT9A 3GKWL 3VCLA 1EFXA 1CICB 4Y5XC 3ZDXF 3IXAA 4D0BA 4HCRL 2W38A 5DJZB 4M1DH 5D5ME 2EZ0C 3CNKA 5E8OA 1FV1A 4HHAA 1NJ9B 4ZODA 3WHE0 4X9BA 3R0NA 3JV5A 3BDXA 5DTFA 4NQSB 1YNLL 3QNYB 4R9HA 4DZ8A 1PX3A 4MNGE 3L9RB 1W0VB 5MERB 1J0ZA 1ZA3B 3CFCH 4XNXL 1KT2B 4P0DA 3NCMA 4LGPB 2P8LA 5D1ZB 4Z0BL 2D7NA 4JPVL 1JHLH 4ZXBB 2XWBB 1YEGH 3DX7A 1CT8A 4JZJB 1XF3B 2OTPA 4YK4C 3PGDB 2VDLL 2AABH 3F7VB 4TTDC 3RA7L 4P2OD 4D8PB 2PYEB 3IGAA 4N68A 5GRUL 2FWOB 5LCVL 4WEBL 1BOGA 3MJ9A 3QFDB 5ICYA 4FRWA 2YUXA 4JFPB 3O9WB 2PTTB 2WV3A 3MFFA 5I30L 5E1HB 1UQSB 3MR9B 3TP4A 5E0QA 3DETD 2V17H 5DEGB 2HT3C 5GRJL 2KQMA 3L3OA 3MJ9L 4X6FA 3FFCB 1FORL 5F9JB 1DUYB 3QUZC 4NHUA 4KRPB 3MYJA 1OTTC 2FO4A 1BAFL 4PGBA 4R97B 4L3AA 3QIBA 4RGNC 1AKJA 5C0FB 4N5UA 4FQCL 4IJ3B 1EGJH 4I9WE 2H1PH 3UZEA 3PGCB 4U1SB 1RPQA 4HIIB 2DWDA 2Z0BA 4PJ9A 4HS3A 5DJ0B 4JPWH 3R8QA 1NBVL 1PKQB 4RIRB 4KQ3H 3AMKA 4XPBL 1Z5LB 3V6ZA 3UYPA 3B6SA 2BVQA 3MRKA 5I1JL 2X4QA 4PREB 1Q94B 1JFQH 1ZA6A 1QSEA 4LLYB 4NKDA 1HHHB 2YPVH 3V6OA 1PSKL 1LO3L 4WUUB 4Y7MA 4JFEA 5DVNA 4KK9C 3X11B 3QIBC 4NP4L 5D7KE 4PD4J 1UWXH 2OK0L 3MRMB 3LN4B 5EOQL 5E94A 1RZIB 5DUPL 4WEUD 2FRGP 4JO4L 2ZUVA 4NRZB 3T09A 4PJ9C 1RIHL 4HIEA 3NACL 3WXWL 4ZFGL 1G9MH 2VLKE 1MPAL 4UILL 3EYSH 3V4VH 1C5BL 1JGUH 3OR7B 3CFDB 5FDWB 3BE1L 5JOFA 1JMZA 3BI9X 3D87B 3VXTA 1G7HA 1KXVC 3FO0L 5H35B 5DJXB 3RZCB 4YE4L 1T5WB 4PD4K 4FQIL 3AREA 4UV4L 5CIPB 4RWYL 3NPZB 4I77L 3EOYG 3V6OC 3ZKXB 4QHNA 1YMME 1K9TA 5EUOF 3SBWA 3WCYA 3VXNB 4NT6A 2QLVB 1K85A 3KPMA 3RVVD 5DEZA 5FB8A 2ICWA 2BMKA 2ADFH 3BQUB 2AJUH 1HNGA 2ESVA 1XF2B 4X80L 2XY1A 4X99A 5T1KA 1RZJH 1MCKA 2W0FA 2VN7A 3LQMA 3MLUL 4L3ED 2X41A 4JAMB 1AQKH 3QA3A 4Z5RA 4OI8A 5I18H 3LEXA 4PJAE 2NR6C 5D2LA 4XP1L 4UTBL 3JVGA 5E2JA 3T3PE 4POZC 3P30H 3DI2B 1JNLL 2F5AL 5ESQB 3SKOA 5B38A 5F89B 5JR1L 5MI0C 2HT4D 5JXEA 2DI9A 4J4PC 4LNVA 3MLWL 3U4AA 3MJ8A 4ZUWB 4DZBA 5BRZB 3DMMA 4OCLC 3VXOB 5IJVB 3PL6C 5D70H 2ZUXA 2FGWH 1DTUA 2CIKA 4D9LL 3CVIH 1C5CL 4R7DA 5SWQA 5EBMB 4AL8H 4YWGH 1NGQH 1VCAA 2XQYG 1TQCC 1TTGA 2C7UA 4FFVD 3HLAA 5FGSA 1MF2L 3MLRL 5GGSA 1LEIA 3DVFA 4NIKB 5D5MF 4MD0B 1PZUB 1TETL 4ACPA 2FJFB 1OAQL 3ZKMD 1IEBB 3JVGC 3WFDH 4POUB 2AQ1A 2R9HC 4XPTH 3MLSL 4PRHA 1AGEA 1WCQA 4Y4FB 4D3CL 5JXEC 1T0PB 3MLTA 4D94A 4MSWB 5HI3C 2UZIL 1AE6L 4OAWB 4CVZB 3HRZB 3VFSA 4QCIA 4K07A 3GO1H 1XGRA 5BQ7B 1F11B 4TUKH 4HGWA 1ACZA 2F8VA 4H88L 1G6RB 5L2KE 4UU9B 1MJ7L 3GJEB 1BQLL 3RTQD 1YEDA 4MMZC 4BYHA 3VH8B 1AY1L 3DUSB 5BS0D 1IQWL 3OMZA 1MEXH 1XCTA 4WO4B 1HEZA 5EO1A 1EFQA 5GRZA 4D9QD 5KJRL 1UGNA 3JV4A 2CJUH 3KXFA 1SY6A 3F58L 2UWEA 3QUKA 3L5XH 5ID0A 5I73B 4AEFA 4WFED 1CGUA 3HZVB 1L7TH 3BKCL 3WNNA 1UZ8A 4Y19D 2EH7L 2QSCL 3JV6B 4P5MA 4ERSH 1LHZA 3OKKA 3O6LH 5C0BB 1HYSC 2R1YA 1G7PB 1BZ7A 4O5LH 3EGSB 4P5KA 1XCQA 2A77H 1A4JB 1MQKL 2ZG1A 4WUKL 1OGAA 2EE2A 2R23A 4K9EH 2PW2A 1FAIH 3D39A 3CU7A 5SWSD 2C3VB 3HI6H 3KYNB 3V5KB 1P4LA 3MXVH 5FYLD 3BPLB 3EJYC 2VZTA 2H2SC 3HMXL 3SKJL 1RUML 3W2DH 3IJHA 1EJOL 3C5JB 1IKNA 4HT1L 3VWKB 1ADQL 4OD3H 5C8JA 1MHCB 1AI1L 1BQSA 1D5XA 5KVGL 5DGQA 5L0QC 2UUDK 2XWJB 4WWKD 3FJTA 5DMYA 1YEIL 1RJCA 4LKCB 2G75B 4MA1B 1A2YB 3MOBL 5DJ2A 3G6JB 1CGXA 1TXKA 2JELH 1XGYL 3KNBB 2R0LH 4AENB 5IQ7H 3BZFB 4LSVH 4F7CA 2W9DL 1RY7B 4NN7C 3CK0L 1LE5B 3BOVA 3UJTL 3HC3H 3UTOA 4F7TB 2NY1B 4QOKE 2I5YL 1A9BB 1ZS8B 3ESVF 1IVLA 3MLXH 1WCBB 4XCEB 3TWCL 1MFCH 1FNSL 4MNHB 3QDMA 2A6KB 2A83B 1HILA 2BRQA 4ZO6A 2HH0L 1XF4B 4LRNL 3IDIA 3A0OA 5MENA 2XA3A 2DQTH 3TZVB 1YC8A 3IFNH 5D8JL 2J6EA 1JNNL 1ORQB 1A3RH 3GKZA 1E4XL 1TJHH 2IALB 2HFEB 2W9LA 4XH2A 3A6BH 4IRJD 3O6FC 5L2JB 4DQOL 1VFBA 1WQVT 2J6EL 1NGZB 4J3WA 2R69L 3S3SA 4MXWH 4XVJL 3VH8G 5FKPA 5E24E 2D0HA 1DSFL 1UENA 2YWZA 4OLZH 1GXEA 1OCWL 1QZ1A 2IG2H 2MWCA 2JKXA 4I0PB 1AFVL 5K59E 3GNML 5IT2L 4EOWH 3TT3L 2ZUYA 4RGNE 1JL8A 1R3IH 5IEKA 1ES0B 1A6UL 2ARJA 2WP3T 3V5HB 4PJAF 3WFZA 1OVZA 5HVWA 3FT3A 2VE6B 4OIBA 4KZEH 4KTEH 4E42B 5MEQA 3T3PF 3LKNB 3ROLB 1YYLH 2X42A 3FOLA 3QH3B 4KJQC 3P73B 3ULVH 4JM4L 3PWUA 5F9OL 3WIHA 5I17B 1CS6A 2BVYA 2O5XH 4FFYL 1JGEB 4NWUL 3VMPA 4WV1A 4JFDB 4QKXB 1HH9B 3RWIA 5I1HH 4AH2B 4P3CL 3KLAA 2QV2A 4PJ8A 2YC1B 4DAGL 4LLQB 1T1XA 1U8KB 1I1AB 3WIHL 1HI6A 3T8XB 4NHUE 1UWGH 2WQ8A 1FO0L 3BP7A 1I8KA 3U1SL 3UX9B 5FV1L 1WICA 4M7LH 4ODBD 3DGGB 5T5NF 2OZ4H 3H8NA 2Z31B 3IF1A 1IGIH 1JPTH 1FRGH 4N0CA 1DQML 1OAZH 2OSLB 2N7AA 4TULL 3IFOB 2Y36H 1NFDA 5DR5L 2ED7A 4G6JL 3UTQB 5KVDL 3B9DA 5CCKH 4PJ7B 3ZYOA 5ECJE 2R4RL 4WHYG 4X7EC 1E6OH 4R0LB 3V0AC 2C1PB 1J11A 2O93L 3W5MA 4WV1C 3QIWB 5EULV 4GT7A 3SDAC 5GGUA 3AY4A 1QSEE 4K3HA 1JWMB 4YR6B 4PJ8C 5LG1A 5HHMB 4PP2A 4EUPA 2R2CA 4XP4L 2BDNH 3VXMD 4WHTB 3V6OE 4XP5H 4JFEE 3DURB 3D2UA 5B3JE 3MYZA 2P5WA 5D72H 1BFSA 2JB5H 1G7MB 4JFFB 5FUZH 1E27A 4R4BA 5CP3A 1X5GA 2K9UA 1T80A 1NMBL 2FD6H 4M1CD 3BZ4A 4NFBA 1RIUL 4C4KO 4NQXA 2VSCA 3Q3GB 3T2QA 3B9KB 4MXQD 2VLKD 1MLBB 4RAVA 4ZAKD 4HJ0C 4WY7H 3NBNA 1S7WA 5GHWH 4TNWF 1VERA 1FFPA 3AY4C 1CGSH 1KB9K 3RAJH 5HYJD 3G5XA 1G0DA 3VA6A 2F74A 3SO3B 2NY5L 2EXWD 4WTZG 1IC4H 3BH8B 1JNHB 3R8BB 1JJUA 1YY9D 3L5WA 4Q0XL 4CMMB 5A2FA 3IVKB 1I8MA 1AH1A 2C3WA 4M7ZB 2B1HL 2AK4D 2HJFB 3QIUB 4JQXA 5I1LB 5CIPH 2ESVE 4OGAD 3UPRB 1HYRC 1M71B 1YUHB 3STLA 3EO0A 2AGJL 5DK3A 1JGVL 5TE6L 4WU5B 3PXHA 2NY5C 3GMRB 4YQXH 5SWZD 4G6KL 3RPIA 4HWZA 4FQQA 1I85A 5D2LE 3WLWD 1V3KA 3LKPB 4KC3B 4O4YL 5K9KB 3GGWB 3X3FH 3BPNC 4I48A 1K4CB 1GAFH 3EYVB 4XNYH 5I66B 1CIUA 4P9MH 4PV9B 3MCLH 4WI3A 2A6IB 1Q9OB 5IGXL 4PTUA 1M4KA 4G3YL 3BN3B 3RWGA 3LY6A 1OF2B 3NOIA 4PJBB 3B9EA 5F70A 5E9DB 1VKXB 3F7YB 2X2YA 5JHDB 3RVWD 4E41D 3B9VA 3DROB 1I7ZB 4IRSD 3KPRD 4X4YA 2AJVL 1LK3H 1LO4H 4U4BA 3FQUA 4G8EA 5E8DL 3IFPB 1CU4H 3MLVL 3BXNB 2X09A 1I85C 3FAWA 2LTQC 3HHRB 2PTVA 1ZLVK 3FB7A 1RSFA 4CU7A 4PRHE 1VENA 4QHLA 3C6LB 4NO3B 4XMLL 3MA7B 2CR6A 4ZSOB 2BC4A 1CR9L 2XFXB 1JUFA 2HMID 2WLYA 1ZSDA 2OR8A 3SDXF 4OCYL 3V7AG 3BISA 3TN0A 1YPZB 1UH4A 2C4FT 1YNKH 3EJJX 3BEWA 3HNVL 5J4MA 4AMKH 3OPZH 4DN3H 1Q9WB 5E2TH 1EHLH 4JRYA 3OR6A 3QDGB 3C5ZA 1FL5A 4PJCB 3KXFE 2P5EB 2UWEE 1G6RH 3W9DB 4Z7WB 3S35X 4NM8L 1EVUA 1U3HB 2NW2A 2NY3B 2XZAH 4HZLB 4GKNA 2YD6A 1N0LA 3F7RA 5K9QI 3HMWH 3E6FB 3CZFB 2NTFA 3S35H 1J1XL 3E2HB 2ZCHL 1G1YA 3JTTB 5D1QB 4JFYA 5LVEA 4GQPH 3LDBB 4MDJA 3T2OA 3SHSA 4BH8A 1RUQH 2YK1L 1FCGA 3GIZL 2DM7A 4PP8C 3SCMA 1F3DJ 1F8TL 3ESUF 3KPNB 4XMPH 3TN0C 4DCQA 1DN0A 1OGAE 5EH1A 1HINH 3D39E 3MUGB 1CDCA 5DFTA 1NMAL 4PY7B 1TNMA 4HGMA 1S7RB 4JKKA 4JDVA 3RWCA 1E4KC 3RY4A 2DQDH 4JY4B 3UTSA 4PJXB 4RBPK 4M3JA 3C5ZC 4NNPH 3GHBH 1T2QL 4QRPA 1RJYA 4Z76B 1N6QH 3RI5F 3HN3A 3VDBA 5TQ2L 3RL2B 1HHGB 1U8IA 3SE4A 1VGKA 1OTSC 2VDMH 3WEXB 5DJCB 3OX8B 1MNUH 1FNEB 1EEYB 4L8CB 2SEBA 2Z91B 3U79A 1IKFH 5I9QB 3SCMC 4PJ5D 2EZ0D 5B3JF 4IMLA 4ETYA 1HQ4A 1T03H 1WFUA 4AYFA 1F4YH 4F9LA 3IU4H 4P2OB 1S7QA 5DRWB 4B50A 4LF3B 2R1XA 1U6AL 4PRBA 4OF6A 5IHLB 4IBLT 4RFEA 1XGQB 3QDME 5DVLA 5IESL 4FQ1L 4MVBC 3CDGB 3T2NL 3ARVA 4P49A 4URTB 3TNMA 5MENE 2QADC 3MXWL 5HPMB 5B8CA 3K1KC 2VDRL 1FLTX 1KTDA 3SE4C 1Z6JT 5ICXB 3TO2B 4DKDC 2Q7YB 2W65A 2W0KA 2H9GA 3QUYC 3EYOB 1KTLB 2WBJC 5A40E 1EFXD 3O3EA 4TTDD 5KW9L 3DUUB 3FCTB 3W11D 3DSFL 5EC2B 4M6ML 3HCVA 2HJLA 1F58H 3BRDA 4MX7A 5J1SC 2GCYA 1N5YL 3LRHA 4F9LC 2Q8AL 5CZVH 2HT3D 2RCSL 4XBPB 1IBGH 3CSYB 4ZTPL 4H26A 3QUZD 1Z3GL 2UV3A 1OTTD 4TOYH 3P4MA 1F3JA 1GRWA 3U0WH 4RGND 2Y72A 5FUCC 5ID1B 5B8CC 3W39A 3WHE1 1HIML 5D2LF 5LKNA 3DARA 4O00A 2Y5TB 5DYOA 4YDKH 4R26L 3QCTL 4NKMB 5IG7A 2XN9A 3QJFA 4DGIL 4M6AA 3FO9A 3V6BR 2P7TA 3MODL 3GK8H 4PG9A 3AU1A 2B5IB 3VRIB 3QWOB 1B0RB 2BSRB 3K2UL 4XP6H 4QHUB 4DEPB 4GMTL 4MNQA 2DD8H 4UTAL 3I75A 5E2VL 3MREA 4GG6A 4YDVB 1EJ6A 4CW1A 3TA3C 4KK9D 3VD4A 3QIBD 5J7CC 1DEDA 1IAKB 4S2SB 1QLEL 1ZTXL 4CMHB 3L95A 2A9MH 1NFDE 5FHBL 5DT1H 1V05A 4GAYA 4PJ9D 1G7QA 1BD2A 5C07B 1HSAA 4DUVA 1RZ7H 5JW4N 4WW2A 4KUZH 1QHOA 3C6SB 1X5JA 1T3FA 4OSUH 4AEIH 1NL0H 2VWEC 2LV4A 3PJSA 1C1EL 1CDIA 1FBIH 4QXGH 3UJIL 1U8HB 3VE0A 4PGEB 4AK1A 5AUMA 1EZVY 1BIIB 2BY3A 3BEVB 3BZEA 3T08A 3EDJA 3K8LA 2QHRH 4GMSH 3PG2A 4DW2L 1LEGA 1E6JH 4O58L 5BVJA 3F12B 2P5WE 4XCFL 1AIFA 3LKOB 5CUSL 3NGBB 3UP1A 3WIFA 2X4SA 4BA8A 3TO4A 4JN2B 4YO0B 4J6RL 3QEHB 1IEAB 2UWEF 3QPXL 4DGVH 5DFWH 1KUMA 4LCCB 4NC1E 1ZLSL 4D0CB 1S9WA 3WFCH 4NRYB 4WW2C 1T7VA 5T3ZL 1N59B 3HAEA 2UY7A 5EZOL 3RNKB 4KDWA 4L8BB 43CAB 1NSNL 3GUTA 3GSVA 5DQJA 4D9RD 4HUMB 3VG9C 3D48R 5ALCH 4S1SH 4YHKH 2NR6D 4J3VA 4XP9H 2Y9RT 1HKLH 5L7XL 4NJAL 3MRPA 4POZD 2BSSB 4O51A 3RIAF 2ZSWA 3BIKA 1Q1JL 4UZGA 5GJSL 3TFKA 1OY3B 2VXUL 1LVEA 4J4PD 5ESAB 1I9JL 1MWAB 1FJ1A 2UUDH 1ED3B 1LO5B 4K3EL 1HHIB 3PL6D 1FC2D 1BGXH 2I9LA 2CK0H 1GGBL 2GI7A 5MEPB 3MUJA 5IVXF 1U8MB 1H9VA 5T1KD 1FFNA 5DD1H 4RX4A 3MRDB 3I2CL 5LGJA 5EORH 2R39A 4OFIA 5CHNB 1KTKE 3VGGA 1S3KH 4Z8FH 1M6OB 3M1BA 2NW3A 2MPAH 4KPHH 4OUUA 4YHLH 4YDJB 4RAUA 3MRLA 1F6FB 5EU3A 1CVSC 1KIRB 2R9HD 2P8PA 4UMGA 3FMGL 3M07A 2XY2A 2GSIA 3ZKQD 3MV01 3JSSA 4E5XA 3MV7B 5BS0B 5JXED 2KDGA 5HI3D 1WC7A 5DD3H 1A0QL 4L8SB 2OR7A 4R6UA 4BQBA 5CGMA 1OGTA 2VXTH 3U6RB 1QSVA 4BJLA 1MAML 4G9DA 4LSPL 4U31A 5DRNB 5IHBA 2IQ9H 1FNGA 1KBGL 3R1GL 5GS0H 2FB4H 3B5TA 2QQQA 2OR9L 3B3IB 5FYKL 4N8VA 1TJGL 3G08B 1YN6A 2Z92A 1RULH 3L3HA 1QR4A 4OV5A 3F7QA 1SJEA 2YR3A 5AYUL 4UINH 2FEEI 2Q20A 4F58L 4Z9KB 1HSBB 1WBXA 3L3KA 5SWSB 3T0EA 1NKRA 1I1YA 3FOMA 1TMCB 2KZ1B 4OCMC 2MCPL 4U6XB 4L1DA 1PVHA 1JV5B 3ZT7A 4KWUA 4IDJL 1HYSD 5DA4A 3U0TA 5DVKA 1KN4L 4KHTH 1IRAY 4WWKB 5FOBB 4EUPG 4NJ9H 4JLRB 1FZKB 1P5VA 4C58B 4HS6B 5KSUB 4UB0L 2OX5A 1UCBH 3GSOB 5D7LD 2PYFA 2JTDA 4JRYE 3EJYD 3LH2H 2H2SD 1U3ZA 1PQZA 4F2MB 1FNAA 2APFA 4UIKL 2NZIA 3VXQA 3S36L 3KXFD 1BBDH 4YHNB 1TVDA 5C6TH 1JZ6A 4U2YA 5F7LB 4NGHH 1OOAA 3QI9A 1OLZA 4QHKI 5HHPB 4UNVA 3ES6B 4BQCA 2E7CA 1KJ3H 4LHUA 3MRFB 4GXUM 3WFHB 1CFQB 2YMXH 4YIQB 4YHZH 2VUYA 3NN8B 4LEOA 4FABL 4J3OC 5IF0A 4TSBH 4I5BA 5DI8B 1WK0A 1OGAD 4NRXB 4LOUC 3QULB 1XGUB 4JFOA 3LSOA 2FX8L 2E6JA 3D39D 2CD0A 3L5HA 5IVNA 1NFDF 3CPLA 1UM6H 3CFEA 4IRJB 3CAFA 1JGLH 4M6OH 1DQJB 4Z77B 3EYUL 3UTSE 2YN5A 5ACZA 4XNZC 5F9DC 3QUMB 5HHOA 1XR8A 1IM9D 3LPWA 1KJMB 3KVQA 4JFXA 2UY6A 3P0YL 1QFPA 3PHOB 3THMH 3UJJH 3VFPB 1FH5H 1B0GB 1K8DB 4JKLA 5JO5A 4W68A 2KL6A 2VRAA 3V79C 4PRPD 1P1ZA 2EH8H 4MLIA 3X3GH 3QEQD 3S9DB 1FZOB 3O6FD 5FEBA 1A1NA 5F88A 5EU6A 1CE1H 4H20H 5J9PB 5EA0H 5I16A 1URLA 3NCJL 1XGPA 1PEZA 3WIIH 3BSZH 1BQHB 1OAXL 5FGBC 2AS5M 1AHWB 5F6IC 3VGEA 2JIXB 2P48B 5D7JA 1FZMA 2GAZA 5DFVD 5GSRA 3O8XA 4OB5H 1MJ8H 2W59A 1GZPA 1A7BA 3O41B 5HBBA 4GAGL 2X10A 1EHAA 4KJYA 1GL4B 5FUCE 5MEND 4L29A 2AV1B 2GSGA 3M45A 2ORBL 4EXKA 4TNVF 1F97A 1P5UA 1U58B 4GKZB 1X3DA 1AGBA 3QRGL 4ZUVB 4OM1H 5GPRA 1DBBH 1I1CA 3IDXH 5BVPH 1A6TB 1LGVA 1MI5A 1I3UA 2GUOB 4KJQD 3KPQA 3BD4A 3B43A 4RISH 3FO1B 4M03A 3WYRA 5KS9B 4PJEA 3KYKL 4AG4H 4JEGB 2FR4B 1NGWB 4G6AC 4J1UB 3UZVB 2NMSA 2A0LC 3OAYK 5F1KC 4OQTL 3W81A 1E4WL 3GSUB 5K9OA 1EO8H 2JCCA 2Z93A 1OAYH 2F54A 2WIIA 3O8XC 5HYEA 4OZGA 4P2RA 3EOAB 5KBNC 1QBML 3UO1L 2XZQH 1ZT1A 2FNBA 1TVBA 4X7FC 3CFJB 4TNWK 2YN3A 1OLLA 2YD3A 3O3DB 1JWSB 1BP3B 2A6DA 1NUGA 1AGCB 1H3PH 2CO6B 3RX8A 3VXMB 1VFOA 1S8DB 4NZUL 3ZT6A 4MJ6B 1LD9B 2XN9E 2CDEA 1BJ8A 4MAYA 5I1KL 4NNYA 3WFBH 3DO7A 2VWEE 1SBSL 2MFNA 3HUJB 2JB6A 3TJEL 4Y4KA 1QRND 2DQJH 1KJ2L 4KZDL 1HXMB 3SDAD 1EDQA 4CRPA 2ICWI 3P4OB 4LL9A 2HKHH 4RNRB 4PJ8D 2P24B 4MNQE 4WI4A 1BF2A 1OT1A 1G9NH 3LZFH 5DK2A 4GG6E 4QHMA 4XGZB 5CS7A 4ZAKB 4G7VL 3DGCR 1U91A 1D6VL 5GIRA 1CLOL 1NCDL 3O0RH 3QWQB 5F9AC 1ZLVH 5LWYH 5IFAL 3ZMRA 1LO0L 1D9KA 3HE6D 1P4IH 2KH2B 4XHJC 1GOGA 5HYJB 3LMJH 2ZUWA 4NO2B 5C09A 1RZ8B 3PIQB 1I9IH 4P4KB 3TBTA 1BD2E 1XR9B 1EXUA 4RRPG 4QHKJ 5T5FH 1WZKA 2JJVA 1BQHG 1NDMA 4MAYC 4QY8A 4U1MA 4Q6IB 4XMKL 3JV0A 5GZOC 1YEEH 4HJ0D 2AK4B 1GGIH 2HTKC 2LAGB 4UDTA 5GSVA 3UBXB 2VMFA 4PRDB 1MFNA 3HE7C 4K71C 2OTWA 3KYMB 2A73B 4XPGH 1MIEL 2VDNH 4M93C 4ZUUB 1Q9LA 4NSKA 4NN5B 1O0VA 4DVRH 1U8PA 5HYQA 5HGAA 1WFOA 4YUEH 1K2DB 5DQ9B 5SWZB 4M02A 1H3UA 3HZMA 2B0SL 2P5WD 3L7FA 3FTGA 1MH5B 2VERN 1D9KC 2HWZL 5F72S 1PD6A 4HUNB 4Q74A 1RJLA 4LPUA 2R8SL 1CLZL 3OXRA 4PFEA 4LLDA 5T1LD 1VEOA 4DOHE 4U6HB 2PTUA 3GJFK 4A6YL 3VXPA 4E41B 3ARPA 3ARSA 3V4PH 4F3FA 1QLFB 5GGTH 3QZWB 4D0DB 3L5JA 4IRSB 3KPRB 3MRHB 4YHIB 3PABB 3RWJB 3NZ8B 1KELL 4F7MA 3FB6B 4YC2C 4JM2A 4V1DB 5J11C 5I71B 4QT5A 1DBJL 2IH1B 3BKML 2F53A 3QQ4B 4XT1C 4Y5YB 1DE4B 1RIVH 4JDTL 5KTEL 2R56H 2BY0A 4IEFB 1T20A 2R0WL 2DKSA 4ODWA 4Z95H 4BZ1L 2EXYC 3IXTA 5DRXA 2B39A 1F3DH 5F1IB 2JJTA 2VDQL 1OP3K 3U9PH 5L9DH 1MWAH 5JHLL 1G0YR 1JP5A 1M05A 4EXPX 2YUWA 4Q2ZA 1RJZA 5GGRB 2AXGB 4MJ4A 5J8OA 5ALBL 4HIJB 5KSBA 1DANU 1WUNT 3VI4E 1NDGA 1QVOA 4NM4L 4LVOB 4ZYKA 3TBWB 1AR1C 1X5KA 3CVHL 1KCSL 4JANA 3GRWA 4P48A 1WIPA 3DXAA 1J18A 3RI5K 2N56A 3TT1L 2L4OA 4LVNC 4LSDA 1MCQA 2LAAA 3ZE0E 1MHPL 2YD1A 4OF8A 4U1HA 2ADIB 2Y06L 5E2WL 4L4VA 3UBXG 1JCKA 4LHQB 1J0HA 3KPSD 3V4UH 5EBLB 4X9GA 1SEQL 1SJXA 1KFAL 3P9LA 4I18B 1BQUA 3DIFB 2D7OA 2C3HA 4IIQA 4JR9L 3REWA 1Q0YL 1SJVA 1B9ZA 3S88L 1AC6A 4JRXB 3T0EE 1DVFB 3KHOA 2YBRB 3IFLH 4X7CC 1KCVH 4AEHL 4GH7B 2RFXA 4XNMA 4G43B 4P46A 2ADGB 5F96L 5IBLC 5HDLA 2ICWJ 3D25B 3TPKA 1YEHL 4M4PA 2G2RA 5D9SB 4HWEH 3UMTA 4ELMA 4NDMA 3EBAA 4HIHA 1MRFH 4ZOCA 3ZTNL 4KAQL 5CJOH 1E4XI 4Z7VA 2Z8VC 1LWRA 3V52L 4JGUA 3QCVH 2XT1B 3TN0D 4J8RA 5CJXA 2CKNA 5FYLH 5ENWA 1FIEA 2B7DT 3X14B 4LPYA 4Y5XB 3QZWG 3NTCH 1SVZA 1A6PA 2OJEA 3QO0B 5JUEL 1FL3B 4PJ5B 1M7IA 1I7TB 4GRMA 3C5ZD 1NBYA 4M6NH 5T1DH 3MGTB 1KN2H 1TZGH 1IC5H 4EBQH 5BJTB 1YN7B 5L6YL 1TTFA 4RWHA 4QTHA 4JB9L 4PJFA 4HX1B 1OTSD 4P46C 4EVNB 1FHGA 3KDMB 3FQNB 4HJJH 5AYQA 1A22B 1X6LA 3TIEA 4HMCA 5DD6B 4GG6F 4QRUB 4JZNB 5J6HA 3V5DA 3VG0H 5LGHL 4YGVB 2H45A 3LQAL 4MS8A 2CRYA 1Y0LA 5CJXC 4YK4B 1A6ZB 1T1ZB 2E8YA 4QRTB 2EO9A 1CL7I 3VCLB 5CMAB 4LSUH 1YEFH 1IT9L 3IXAB 3RWEA 3TH3T 3CCHB 3KYOA 4X5XB 1W0WA 4CNIB 3H6JA 5HHOE 4WW2F 4MVBD 3EOBB 1FV1B 4NFCA 4XB7A 1J8HD 4EN3A 4OCWL 4QRPD 3MLYH 2PXYA 2QADD 5DTFB 4O9HL 2P44B 4KKBC 3RP1A 4Q9RH 3PWNA 1TCRA 4QWWC 3TESA