1MHCA

Model of mhc class i h2-m3 with nonapeptide from rat nd1 refined at 2.3 angstroms resolution
Total Genus 68
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
68
sequence length
276
structure length
276
Chain Sequence
GSHSLRYFHTAVSRPGRGEPQYISVGYVDDVQFQRCDSIEEIPRMEPRAPWMEKERPEYWKELKLKVKNIAQSARANLRTLLRYYNQSEGGSHILQWMVSCEVGPDMRLLGAHYQAAYDGSDYITLNEDLSSWTAVDMVSQITKSRLESAGTAEYFRAYVEGECLELLHRFLRNGKEILQRADPPKAHVAHHPRPKGDVTLRCWALGFYPADITLTWQKDEEDLTQDMELVETRPSGDGTFQKWAAVVVPSGEEQRYTCYVHHEGLTEPLALKWRS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Histocompatibility antigen/peptide
molecule keywords MHC CLASS I ANTIGEN H2-M3
publication title Nonclassical binding of formylated peptide in crystal structure of the MHC class Ib molecule H2-M3
pubmed doi rcsb
source organism Mus musculus
total genus 68
structure length 276
sequence length 276
chains with identical sequence D
ec nomenclature
pdb deposition date 1995-08-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00129 MHC_I Class I Histocompatibility antigen, domains alpha 1 and 2
A PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1mhcA02
3.30.500.10 Alpha Beta 2-Layer Sandwich Murine Class I Major Histocompatibility Complex, H2-DB; Chain A, domain 1 MHC class I-like antigen recognition-like 1mhcA01
5KSUA 3R0NA 5IBLC 3P9MB 2CKBB 3KYOB 2X7LA 3QJFB 4KTDL 5IJKC 4HKXA 3V6FB 2HWZH 4F57L 1JWSB 1WZKA 4OZGA 4K7FA 4O02H 1I85C 3B8SA 3ROOA 5FHAL 3SE9H 3JWOC 3B2VH 3ULUD 3TBWB 1TPXB 2Z91A 5I74B 2WQRA 2OBGA 1H0DB 1B6UA 3WFBL 5CMAB 5K9QI 3MRCA 4EUPB 4HX1B 4WEMB 2VZUA 1XF5A 4GAJH 4UU9B 5C07B 1WBZA 1WFTA 3GJFB 4U1NB 1RV6X 3CDGB 2Z8WC 5CGTA 5D2NA 2FCBA 5DR5L 2X05A 2QSCH 1AD0B 4BQCA 3UXFA 5GRZA 3STLB 1RJLA 1OAYL 2DQDL 5GGUB 2RFXB 3THMH 3VXRE 5JDJA 3R4DA 4FFWC 1G9MH 4HK3J 3W9EA 4R7DB 1YEJL 1A64A 1A0QH 5CIPH 1BM3L 4JM2B 4WW2B 5GJSL 3WFDL 3PJSA 2CXKA 3I3DA 1MLBA 3LIZH 2CJUH 3STBA 4DZ8B 2FATL 3HNVH 1YEIL 4NUGL 4JFYB 3W0WA 2ESVA 1OAZH 4ODSL 4AH2A 1N8ZA 2EC9T 2W9DH 5BXFB 4CMHB 1AGEB 1LNUB 2L7UA 3DHJA 3BRFA 1AGFA 1RJCA 3BP7B 2HN7B 1IKFH 5ESAB 3FB7A 4W4OA 5FO9A 3I6KB 4XB8A 1T1WA 4HPOH 3N9GH 4TNWK 4N0CA 3C5SA 5BOPA 4LEXL 3BH8B 4O2CB 1PEWA 4LAJH 2Q1EA 3WJLA 4AM0A 5CFHA 2A0LD 2FNBA 3Q5OA 2QQLH 1RZ8B 1L7IL 4QTHA 2QL1A 2IJ0C 1QFWH 4J3XA 1OQXA 3K8LA 1NFKA 2XWBB 4XNMB 5E2VH 4FRWA 3F12A 4RZCA 4Y19E 4WHYG 4DQOL 1C5BH 5AUMB 4LPUA 3BD3A 1MREH 5I75C 2BNQD 3BDYH 4JY4A 3UJTL 4UQ3B 1T21B 2Q20A 4OZGE 4NQXB 5KANI 4X4XB 1MCOH 1U8IA 4YAQB 3BE1L 3UYRH 4XGZB 2X4TB 1HCVA 2FBJH 5FKAB 2VMFA 2Y07L 4NO5B 3ULUH 4WFEE 5FOJA 3A6BH 3I9GL 4BFIB 5I18L 2C7UA 3GMOB 2Q6WA 5IMMB 5F7DB 4KHXH 4X4YB 4ODTL 1NGYB 3ARUA 4O4YL 4A6YH 4MA3A 4JREB 4NKIH 2NY1C 5D2NE 3VRJA 1A21A 5D1XB 2W91A 1P4IL 4H1LG 5GISL 4WUUB 2HFEB 2HKFH 4U6XB 3HCVB 5HHXH 5KVMC 1T6WA 3SO5A 1MAMH 4KDVA 4PRBA 4XBEH 1TPXC 5IR1B 2J4WL 3MV01 1A6TA 2JJWA 4XWGL 1R3KB 4XVJH 4BZ2H 1A7NL 2K3TA 2XIDA 4J3VA 1KXQE 3TVMB 4TYUA 1IQWL 1DQLL 3MRBA 5EO0B 4JFFA 2W38A 5EPMB 3WIHL 4P2RD 3WYRA 3ARGB 2NCMA 5L0QC 3W0WE 2ESVE 2VNCA 1JYNA 3N1FC 4HHAB 2BVPB 3FZUC 4OJFL 5JW4N 5FHBH 3MROA 1DCLA 1EBPA 1S9XA 4M6MH 5DS8A 4L4VB 2ARJB 3QCVL 4QNPF 3O6KL 4MGXA 3PV7A 4PBVC 3FN0H 3C2AH 3FB5B 2BK8A 3WN5A 3GB7B 4WW2C 1KPUA 4XPGH 1JF1A 1F4XH 3RQ3A 5KN5B 3QFJD 3JV6A 2VRAA 4QRRD 2EECA 5I17A 4RRPG 3BHBA 1VGEH 3QXDA 3FO2B 5JNYB 5H37G 4XCYA 3OKYA 3VXNB 2BNQA 3WBDA 3WO4B 4PGBA 3CDYA 3TN0B 3A6CH 3GK8H 1JPGA 5IW1A 4I0PD 5F7NC 4G80B 3QNZA 4MXVF 5AG8A 1RZGA 4ETQB 1INEH 3I84A 4YHIA 1Y0LB 4BZ1H 3IDUA 3QIUA 3LKRA 3SDCB 3DGGA 3Q3GB 4LSUH 5C0AD 3VH8G 2QKIB 1NBYB 2ZSVA 5J1AA 4LKXA 2E5EA 2R0ZL 3SCMB 5EBMB 2CRZA 2A83A 1A9BB 3ARBD 3DO7A 3WXWL 3G5YA 1A1NA 5BO1L 1KN2H 1MFCL 5I8KH 4V1DD 1FFRA 4FQ1H 3VWJA 4U6VH 3FONB 4XPFL 3F5WA 4BKLA 3KYKL 5D6CB 1DBBH 3T2QA 2GITB 3QNXB 1HYRC 2EEAA 2JIXA 3IS0X 4OZHA 5C9JB 2NY2B 5ESQA 1GHFH 1EVTC 4H88H 5ADOL 1MH5A 3O6LH 1A4JB 3E8UH 5HHNA 2D0GA 1E4WH 1AC6A 1R3IH 3VXTA 1JN6B 3KPMA 1AR1C 3P4NB 2F5BH 4ZFZA 4NC1C 2W60A 4FQIH 2JE8A 1QVOB 2F8OA 4OTXH 1Z9MA 4IS6B 3NZHH 4FQHB 4GS7B 3PDOB 1NFDB 1N0XH 4XVTH 1UM5H 2JK5A 1ZGLB 2GUOA 4G8IA 1T89C 1TMCB 4NO2B 1G7IB 1Q0YL 1FYTD 3JWOH 2F15A 3SPVB 4G6AD 4JFFE 2P8LB 4K7PL 3QFJA 4NPYB 4QRRA 3NFPA 2VUYA 2IG2L 1JGUH 2IH3A 4OGZA 2AKRB 5I66B 5D1XC 1T6VN 3B3IB 4S1RH 2EH7L 5D6DA 1FAIL 2HLAA 4ZPVB 4I0PA 2B4CC 5CCKH 2X89D 3IFLL 1F4WL 3EOTH 3HRPA 3CDCA 1BJ1H 1A1MB 4YXHH 4J7RA 4P5TD 3TVMC 4RMSA 2Z35A 3T8XA 4WY7H 5T5FL 3ARBA 3ARXA 5GGVL 5T1MB 1L0XA 1ZHKB 3ARGC 3HR6A 2BNQE 5DEGB 4N0UA 1IAIM 5C07D 3GEWB 3O6FA 4F9PC 4LMQE 1E27A 4V1DA 5GS1A 1FNEA 1W72A 3FZUD 4ZYKA 1A6ZA 1I3UA 2HJLA 4XTRD 3O2WL 3P77A 3OF6D 3OKNA 4QRTB 4JM2D 3ULVE 2ZOKB 3RU8L 2E27H 3QQ4B 1UWGL 1GGBH 2XICA 1JP5A 4HWZA 3WO4C 4X9BA 1FGNL 1KTKE 4K3EH 2J5LC 5I73C 3EYFA 1D9KB 3BEWA 2OI9C 5C6PB 1F90L 1W72H 5DHYB 5TE6L 1MI5D 1T80A 4PRDA 4OZHE 1VB9A 3LKPA 1GGCH 3LZFL 5C8JA 1ED3A 1I9JL 1KTDB 1FORL 4RISL 3SCMC 2VE6B 3HZKB 1JPTL 4GXVL 3OKLB 4MSWB 4FP8H 3HC0B 3VW3H 1IM3A 4PJ9A 5F44A 1YN7B 5GGSA 1TZGH 3TM6A 1P4LA 4JO4L 2N7AA 1NCBL 2FO1A 1ORQA 2VDLH 4OD2A 1G0DA 4RFOH 1AP2A 2ICEA 5EOQH 2CO6B 2DTSA 4P5KB 4WV1B 1RURL 2X10A 3U0TB 1YC7A 2CRMA 1OAXL 4HIJA 4I13B 4OKDA 4L8BB 3VG0H 1BP3B 2NY2C 1Y18B 3WDJA 4LDOB 4PLJC 4UT7L 4PJ7A 4U1KB 1FL3B 2R1YB 4LNRA 3T0EB 1T1ZA 1A14L 4P5TA 3QFJE 4G6KH 3MR9A 4QRRE 3LKOA 2DD8H 1MCPH 3T0VA 4LLYA 3VXSA 2RBLA 3G04A 4QHNA 4X7SH 1DUZA 2R1WB 3V52L 2LQRA 3EYQD 3VDAA 5B4MC 3FFDB 1MIML 3JUYA 4MD5A 4PGDA 3HNTH 1IEBA 4G9DB 2VDKL 4ZS7H 1KIUA 1YNKL 3KPTA 4X5WB 1MJ7H 1E4XL 2AV1A 4FFYH 3TF7A 4XCFL 1JWMB 4B53A 4X6BB 4A2LA 2ITCA 1B0RB 4Q74A 4N0UE 1IC5L 1BBJB 4HUVB 4EUPH 1ZEAH 3V5HA 1KIQA 1PLGH 1MNUH 4V1DE 1TVBA 5LJYH 5ETUB 5JPNA 2D7TH 4JAMA 3SHSA 3GJFH 3DGCR 4RAVB 2GT9B 4Y2DD 4WUUD 5T3ZL 4LK4A 1MI5A 4HAGA 3IDJA 1T7WA 3BZEA 3DVNA 1GIGH 4LRNH 4P9HC 2DDQH 3L5IA 5I19H 2VXTL 5D71H 3FRPG 5FK9A 2B0SH 4LSTL 1I1CA 4I9WD 4ZUVB 2HYMA 1N64L 3G6JF 2AI0L 3IRZA 1NANH 4P3DA 1CFVH 4M43L 5J7CC 4MA8L 1CIUA 3C8HA 3KG5A 5DD0H 2F53B 5A1AA 1ACYH 3D1MC 2DYPA 3F62A 3ARSA 4CBPA 1DVFB 3LMJL 3LRSA 3VFSA 1OW0C 2IPTH 4GMSH 4QXGL 4FHBD 2DM4A 2DRUA 5BZWB 1FL5A 2BOBA 4MAUL 2YMXL 1WGOA 3RWCB 5HHOA 1UZ6E 3BPLB 1QRKA 4RMQA 1F00I 3MRKA 3NIGF 2AXFB 4X83A 3FTGB 3Q1SL 5CINH 1PG7W 1HZHL 1D9KC 5JORB 3RPIB 3HZVA 5IQ9B 1PBYA 4HLZH 3TN0D 3QG7L 3VXMD 2XV6B 3WSQH 4MDIA 1QFPA 2J6EA 2WAHA 3MNWA 2XQYG 3VFNB 3GBNL 1OTSD 5J06A 4JPVL 4PJ7E 3SDCD 3R0MA 1BGXH 4I48A 1NGWA 1CF8H 2FX8L 2FLRT 2XKNA 4E41D 3GI9H 3OAUL 4EI5B 2P42B 3SCMD 3L95B 5I1CH 2A6KA 1RUQH 1DP0A 1T0PB 2VR4A 3VXSE 5EC2B 1KEGL 3JTSA 3MV11 1RJYB 4WV1C 1VFOA 2PTTA 3H8NA 3DLQR 2C5DC 5BJTA 5FYLD 3RL1B 2D7MA 1BQLL 2J6EH 3SDDB 2J1KA 4L8DB 1OT1A 4I3SL 4Y2DA 5CZVH 1PY9A 3T0EC 4NHUB 1X44A 1AXSB 3QUKA 4UUJA 3S36X 5DRXB 2OSLB 5CEZH 5FB8B 4FZ8H 3OR6A 4UB0L 3RVVD 5HGDA 5FCSH 5AG9A 4P57B 1S7RB 5FO7A 1EX0A 4JRXD 5J13C 1S5HB 3FJTA 1J1OH 5SWZA 2F74A 2PKDA 2P45B 1MI5E 1F6LL 5E99L 5KVDL 3RDTB 2EIZA 1BAFH 2FEEL 3C2SA 3PGDA 3B2UD 4KZDH 2VABB 5LGHL 4ZO9A 5DQDH 3S8WA 1NPUA 2NTFB 1T0NB 2R23A 4K9EL 2R4SH 1XGRA 1PQZA 1U8HB 4G8EA 4NZJA 1NJ9B 2YS4A 3BKYH 1I1YB 5DD1H 4IDLA 1JGEA 4PRIB 2YPVH 2VERN 3NH7H 1A5FH 3ZDXE 4LQFL 1NLBL 3TZVD 4PJGB 4GMTH 3VXMA 3I50L 3ZLQC 3MCG1 5IWLC 3UAJC 1MWAB 1YEEL 1CBVH 1I3GH 2FYYB 2XY1A 3SE8H 1G1CA 4NQVA 4KQ4H 1MELA 2KDGA 5HHOE 4LLQA 2QR0A 4ETYA 4E41A 4JFPA 4JKKA 4GQ9L 4V3EB 1YEKH 5C0BA 5D7IA 1BFOB 2SEBB 3HE6B 4P48A 1DQQB 1EXUB 5HVFB 2F8XC 2EIBA 5KSAA 3BZFB 2V5SA 4JLRB 1P6AB 4XP4H 4ZO8A 3JXAA 3VD5A 5MP6L 1DVFC 2CLZA 5EORH 2H8PA 4JFDB 4CVZA 2DBJA 2A74B 4ZNCD 4YDKH 5IB1B 1AXIB 4HGWA 1UB5A 5CSGA 4PJIF 3CMOL 5BS0B 4QXUH 3WFEH 3CFKB 3PHOA 2Z8SA 3BPLC 4HIXH 3MLUH 2WINA 3ZYOA 1QSZA 4YXKH 2ATKA 4PGJA 2NR6D 5F7EL 1HYSD 4RA0C 3IXTB 1KLUA 4J3UA 4WU5B 3V4UL 3PP4H 3AB0B 4AEIL 3VFOA 1KELH 4JRXA 4HS6A 1FZJB 4MD0B 4Y89A 5FYLH 4FQXD 2NPLX 5FOBB 1MEXH 1NCUA 5EFIB 4JKWA 4NN7B 1U8NA 3C5ZB 2PXYA 1SHMA 2OX5A 2XFXB 1ZSDB 1QO3B 3FFCB 4HEPG 4S0TD 3OPZL 3CVIH 3ARDD 4I9WE 3OKDA 4CMMA 3I2CL 1QLFA 2OTWB 1K6QH 5SWZE 3MO1B 4NHCL 4CGTA 1UWXK 4OGXH 1CGTA 4IDJH 3IF1A 4TUKH 2NY4D 3SDDC 1J0ZA 3V6OA 1HSBA 4U1LA 3HG1A 1TJGL 1I4FA 4JG1H 1HH9A 3TZVA 2G75B 4QEGA 5IW6B 3CLFH 2IADB 4NRXB 1LO4L 4RIRA 3EBAA 1B4JH 3FRUB 5BW7A 4AIOA 3TBSA 2C1OB 4PJBB 3PHQB 4N8VA 2MCPH 2WBJA 1A2YA 4NP4H 5LCVH 4R90L 3CK0H 3KJ6L 1C16B 5EU4A 3VCLA 1FZOA 2YPKB 1M7IB 3CVHB 3EJYD 4P2CG 3CPLA 1I8LA 3VXME 3GMQA 4JFEA 1OARH 1U0QA 4J3SA 2W9LA 4G42A 3WDIA 3TH2T 3JV5A 1MIEL 4HJGA 4AENA 4D9RE 4Y4KB 1M6OB 3HMXH 1AH1A 3WKML 4E41E 5H94B 3K80A 5JQ6L 5C0BE 2YXMA 5D7IE 4KPHL 5TFSH 4HV8B 3C60B 4G8GB 4X6FB 3HNSH 3UTQB 1M7DB 5FYLE 3ZKMC 2A1WH 3CFEB 2DN7A 4TOYH 1KTLA 2I27N 5CKGA 4FQXA 2VIRB 3DVGB 3FT3B 3X13A 1U8PA 5AZEH 1U93A 4J4PA 2Y36H 1MHPH 5HY9A 1GSMA 2GQHA 1MHHB 4M8QB 2DQJL 1NGXA 5D7JB 5IHZB 3HE6C 3ARDA 1EEQA 1IC7L 5FUCC 1S5IL 4JRXE 1IQDA 1WFUA 3ULSA 3GUTA 3QQNA 2GSIB 2F53D 4HJJH 1J11A 4YC2B 1N4XH 4UIMB 1EHXA 4R4ND 3ESVF 4O02L 1EHLH 4MJID 3MBEB 5ICYB 3LSOB 1M7XA 3QI9B 4WHTA 2Q7YB 1BBDH 1U92B 2WQ8A 3TLRA 3GSRB 1BIHA 1SJEA 4GUPA 2EDWA 1NUDA 2JF1A 3IU3A 3WXVH 4FOMA 4I8DA 1HOCA 2JLLA 5JZ7C 4G6MH 1YNTA 4KJWD 3Q5TA 4GAJL 2KBGA 4LSQH 4KUZH 3V6OE 3O4LD 5C3LD 4ONGH 3HG1E 3SKOB 3Q0HA 1D6EB 2QSCL 1HE7A 4PJDF 4LVEA 4CDGC 2X1QA 4F7EA 1GOFA 3O9WA 3GBLA 5CJ8A 5KSBA 3L1OH 1R5IB 4NN7C 3C5ZC 1W0YT 4JRYB 3AC0A 2BCKB 4MS8C 5DVLA 1NUNB 2WMPA 1NLDH 4W4NA 1V3JA 2H6PB 2JJVA 4EI5D 1A0QL 1J88A 3O4OB 1XGQA 2X4QA 3ES6B 2VLKB 3HB3C 1G7HA 3B5HA 5EZOH 3X14B 2G9HB 2BSSA 4NBYB 2CJUL 1NDMB 1LEKB 1EFQA 1TTGA 2V17H 4QRSB 4JFEE 5D96B 3QO1A 3MYZA 1B4RA 4KDWA 2W9DL 4FQ2L 2FO4B 3N1PC 4PJ5B 4UIKL 3K46A 5E8NB 4LL9A 3MCLH 1FNAA 2D31A 5DO2C 1B0GB 5LBSH 1J0IA 3UTOA 1JNHA 3BIAX 1RULL 2OR8A 2GSGA 3U4AA 5JMOC 3K74B 1GAFH 1HXYA 4YR6B 1A4KB 2VZTA 4WDIB 2XTJB 1AJ7L 4HPOL 5C0IA 4HKZB 4I77H 4OIBA 32C2A 3AM8A 5EBGA 2H9GA 2Z4QA 4JANB 3BRDA 1YJDC 3SJVB 2EIEA 3GIVA 1R0AL 4Z7VB 1T83C 2QQLL 4Y4KC 5DJZB 3RDTD 5CD5C 2UUDK 1QFWL 3EAKA 4KTEL 4X6DA 5E2VL 2BSED 3V5KA 2LU7A 4BUHA 1EA9C 4OZIB 1C5BL 1V3LA 1WEJH 1LQSR 4NT6A 5HTSA 1KC5H 3FT2A 3BN9C 1DDHB 3C60C 1C08A 2JCCF 1MREL 3PIQB 3MGAA 4M7ZB 2NW3A 3BDYL 2ZG2A 3G6AB 3T1FA 3O4LA 3LV3B 2J12B 5E6IA 5JXEC 2APTA 3PWUA 4MA7H 5C70A 4APQB 5HDBF 3UYRL 4HAFA 4RAHA 4HEME 2W9EL 3X12B 2FBJL 3M45A 2GYSA 4PB0H 5IMLA 2I9TA 1V7ML 5C08A 3NCBB 1UM4H 4NQSA 2BX5A 4JE4B 4XXDB 1ADQA 1I1AA 2ICCA 5DJCA 4KAQH 4PJFF 4X98B 1A6AA 2H2SC 3HE6D 4M7KL 1OF2B 1F3DH 3SKUD 4GG6F 4KFZC 5DC9B 2HVKA 2X44D 1C5DA 2A38A 4OUOA 5ACLA 3V4VL 3T4AB 5KSBE 2NTSP 3ELAT 4HMCA 4HMDA 3MBEC 4CW1B 3AROA 5DSCA 4UV7H 1MAML 1YEHL 1R3LA 3OL2A 2AEPL 4RFNB 4PV8B 4XBEL 3MUGB 1KGCD 2J8UA 2W59A 3LEYH 1U3HD 4XVJL 4O51A 4GRMA 1EGJA 1G7LB 1J05A 2JJUA 1KJVA 3HMWH 3L3DB 3S37H 1ZWIA 4X0KA 4HGKC 4F7PA 2BSTA 4FXKB 1IGYA 4X7DC 2YPLB 5M94B 5E5MA 3TYFA 1PEZA 2VLJB 3TFKD 1KLGA 4OBSA 5FHBL 3SDXF 5BV7H 3IDXH 4XNZB 4OF6A 1FC2D 2EYTA 4RGNC 2NYYD 5EIVA 2RAMA 2HT4D 4HS8H 4LKCB 3QEGL 2EZ0C 3FN0L 3ZKSD 2P4AB 3C2AL 2FSEB 3O4OC 1EGJH 3ARED 3MLXH 3FFCD 1OOAA 1A9EB 5GRXG 1F4XL 1SYVB 3NIFF 2I07B 3SKMA 2YD7A 1HK6A 3BWAB 1PJ9A 1VGEL 5IMOB 2QQKH 4NQEB 5I8CA 4ZOBA 2EDTA 1QHPA 4FFVC 1GGYA 5IMKB 4HJ0C 4D2NA 1KCSH 4BZ1L 5ISZA 4X6DE 1MJJB 4C83A 1WC7A 3CUPA 1N6QL 4LSUL 4KMTH 1TZHA 3HZMB 4Y1AD 3RI5F 3B9KB 2BVQB 3D87B 5DURB 3EO0A 1X5AA 2R4RH 3WS6C 5IM7A 1CK0L 2EDHA 3BZ4B 4WJ5B 4ZQKB 5IB2A 4TTDC 4X9FA 4GAFB 1MRFL 1W2KT 1IAKA 3GFUA 3U7YH 1KN2L 5C0GA 5J6GB 4P2QB 3O4LE 4FQ1L 3ZTJH 2O5ZH 2DMBA 1ONQB 2WBWB 4KKAC 3MJ8B 3NN8B 4U6VL 2VXSH 3WE6A 1WCQA 2HT3C 3GBML 4MDJB 1FGVL 2CLRB 4RFEB 1WBYB 4I18A 3ZSSA 4YBHA 4ZPTA 1MWAH 4Q0XH 5IVZB 2HP4A 5C08E 3MV9D 1MCCA 4N8CH 3SEPA 2Z9TA 4H88L 5IB4A 1U3HA 3O6LL 1UADC 1KUMA 3MV8B 3E8UL 2VKXA 1F02I 3BP5B 3WD5H 4M7ZC 2F5BL 4QHUA 1KENH 1FE8H 2ZCHL 4OTXL 4M48L 4APQC 3ARFB 3NZHL 2O93L 4JPKL 5HYIA 1N0XL 5DI8B 3GMPA 4NOBA 2J8UE 1WWAX 3CLEH 2V2WB 5TDPB 1B0WA 1FCCA 1RJZA 1UVQA 1NGZB 1HIML 3KPRB 1G7JA 1DFBL 1KT2A 4OI7A 1U36A 4K8RL 3AREA 3BXNA 5JUEH 2VXUH 3DRTB 5D7JD 4P9ML 5CHNB 4NQCD 5IVNA 3B6SB 4MVBC 3DSFH 3OJDA 3TBYA 2J8HA 4S1RL 4OD3H 2Z8RA 5HHPA 1VEPA 3NIDE 1SJHA 4WO4B 1HHIA 2GJJA 4Q97A 5CCKL 5BQ7B 1I8MA 3QIBB 4RFNC 1J1XH 3U4BL 5GPRA 3EOTL 4XCNB 1G7PB 4C4KT 1IKNA 1EUTA 4KUCD 1QRND 3D18A 5L88L 3GMNA 3QI9D 3OG4B 2WWKO 4WI4A 4QY8B 4HK3N 1C12B 4JY6A 4Y1AA 5J9PA 1MJ8H 3OQ3B 3QUYD 3ZYJA 4Z0BL 1J87A 2HRPH 1N7MH 3K8KA 4XMKH 4FG6C 4XI5C 3QWRD 1SQ2N 1ZVYA 4XNZC 4M00A 3X3FL 2C3XA 5ISZE 3V7MA 3MRLA 3I02B 4NYLA 2FWOA 2CRYA 4XXCA 2JB6A 5TDNB 1NEZA 4C56D 5A43C 4JPIA 5K9JL 1EK3A 2B1AH 4DJMA 4DW2L 3MV9A 3RIAK 3IJSA 1C5CH 1EVUA 1X5ZA 3L3HA 3OX8A 1NCWL 5IBUG 4D3CH 2AERT 4IJ3B 5JO5A 5DMGD 3TPKA 3CCHA 4UMGA 4MB3A 3U0WH 4MAYA 4LHUA 1FZMB 4K3EL 5IVXF 2A9ML 1ZGLP 3PWLB 4XMLH 3CVHH 1JV5A 1W72L 1AFVH 4K71B 3UTSB 1CG9A 2W65B 1YJDH 5DDHB 1ZS8A 3L5WA 4H20H 1KGCE 3RY4A 4XRCA 3TEUA 5C0EA 3E2HA 1BX2A 3BW9A 3VRIA 2YBRA 4W6WB 1JGDB 3C8KB 4HUUA 4FP8L 4QOKD 3GGWA 2RCSL 2GK0B 4XVUD 4L8SC 4X99B 1TZGL 2XTJD 4G6FB 4NZUH 1QEWA 5CUSH 2EDYA 4NQCA 4YHZL 1RUKH 5EOQL 5C0ND 2IAMB 3MV7A 1I1FA 4QRUA 5EU6B 5H35B 2AQ3A 3NCJH 3SJVD 5IFJB 4GAGH 3WCYA 2FHCA 2HFTA 3VG0L 4XWOD 2OTPA 1DANU 3LQAC 1L8JA 5DRWA 4NFDA 4GKZA 3MOQA 3DECA 1QRNA 3G5XB 5LQBH 4ZFOA 4I2XB 4JQIH 2BHZA 1SM3H 1HNGA 4G6KL 4TSAL 5DK2B 5E6YA 5F9WB 2DD8L 5JW4Q 1MCPL 3QUYA 3IGAB 3UTZA 1MF2L 3U36A 3WL9B 1P7QB 4X7SL 2EO1A 1NCCL 3ARFC 4BUGA 1VPOH 5A16A 1CVSC 1HHJB 2YSSA 3JWNC 4PTUB 1DUYA 1QD0A 5I8EB 2OZ4H 3HNTL 5H8DA 1CTOA 5FDYA 4HZLA 4NZDA 1KPVA 4Y1AE 1MJ7L 4C56A 1Z0NA 5DZNA 3QPQD 1S7XA 1KB5B 4WWKA 2V9QA 3BIBX 5DLMH 3MRRA 1U8JB 5KBNC 5I1LA 3BPCA 3QXWA 1YPZB 4M03A 1PLGL 3Q6GH 4EDXA 1DBKH 1LK2A 4WO4C 2D7TL 1UWXH 4G43A 1DZBA 1EAPB 1PYWB 3QIBC 1EAJA 5EULV 3LKNB 3W5MA 3T3PE 3L3IB 1RZKC 3MV9E 1GIGL 2EYRB 4LRNL 5CEXA 1G9NC 2DDQL 4PRNB 5I19L 4U49A 2V2TA 5D71L 1EFXD 2B0SL 5TQ2H 5CP3A 5HGBB 3BVNB 4QOKA 5E56A 4FQQB 3TNNA 1CFVL 1VEMA 4HIIB 1ZAGA 4AQ1B 3N85L 3PG2A 3RZCB 4DKFH 1AIFA 2XWJA 1EDQA 4EVNB 1ACYL 4IHOB 5H2BA 2DWDB 2VDQL 1ZLUK 3V2AR 1U8QB 2ZG3A 1F97A 2V5YA 1K2DB 3MJ7A 3RNKA 4TTGA 4NQTA 3HUJF 2BVYA 3D25B 2WLYA 5JPMB 3GSXA 4ENED 3BJLA 5MEQA 5IV2A 3AY4C 4PRHB 4IJ3C 2PCPA 4YDVB 4NQCE 5I8OH 3MXWH 5CINL 1XCTA 1I85A 3HRZA 3QNYA 4KI5E 2I9LB 4K3GA 4MCZB 5DWUL 3LS5L 3MV7E 2D0HA 2YUWA 3KJ4B 3S9DB 4JO3H 3F6LA 4XVSH 1YECH 1ZHNB 3RTQC 3TCLA 3L3JA 3EFFB 1QRNE 4NKMA 3HA0A 4BJLA 4EIGB 5FYKE 1CF8L 4JVPA 2APFA 4DK6A 3P0VH 5ICZA 1VERA 1JYWA 5C3TA 1AI1H 1M05A 1RD6A 3B9KD 1WBXB 5DURD 2OQJA 1S7TA 2NY0C 2BHYA 1U8LB 4LSPL 1Q9WA 5HGHB 1A1OB 1D5XA 1FP5A 4JGUA 4RAUA 1IGFH 4LMQI 2J6EL 1HILA 4MNGA 3GSQB 8FABB 1P9MC 4F37K 4Z7WB 2VITA 3W39A 5CBEB 2H26A 2HMID 4U1SB 4CAGA 1BVKA 1JYVA 2FX9H 4C56E 1L0YA 2XN9B 4JGJA 3FL7A 1PKQB 3IJYB 2NX5B 1CQKA 5F9WC 3NFSH 3CSGA 3MV8D 4LARL 4FZ8L 3NCFB 3MOAH 1EFXA 5GSVA 2PTUA 1UZ8A 3K1KC 3ZHLA 3OTTA 4N8VG 1UCBH 4IMLA 1J1OL 3HI6H 2JJSA 4ONOA 4LFHD 5EOCH 1A3LL 3ARFD 1YEFH 4CDHA 4ZOAA 2DQHH 4WTZA 4UDTA 1BAFL 2ZUSA 4KZDL 2NY3B 3QQ3B 1FFOB 4JFXB 5DQDL 3N1QC 4OCSH 1CLOH 2GJ6A 4QYOB 3CSYA 3S98A 4L8CB 2R4SL 2IEPA 3F7QA 4QOKE 1T5XA 1FH5H 2P7TA 3BKYL 4GW1B 5CJXC 5DD1L 4RX4A 3OGCA 1HHGA 3RWFB 3DYMA 5IB5A 4PBWD 1G6RB 5BVJA 1VADA 2GTZB 2MQ3A 2QJDA 1WVZA 2YPVL 3X17A 4WO4D 4R96A 5TDOA 1E4JA 1XF3B 2AEQH 2V7HB 4GMTL 3QIBD 4XC1H 3W9DB 1CBVL 1I3GL 4K7PY 2BHUA 4FQJH 2VR9A 4KQ4L 3BD5A 4PJHA 1HXMA 2HLFC 3RUGA 4BSWA 1E28B 4LCWA 2ZUWA 1YEKL 1GC1L 5FM4A 4OQTA 1QUNA 1FJ1A 1H3PH 1BFSA 3RZCC 2BSRB 3BESR 2R56H 3U9PH 3C5JA 1CU4H 3U2SA 1A6VH 5TGBB 3SDAA 5EORL 5GGVY 4NRZB 3D2UB 4QXUL 5KG9A 3EJZD 3KR3H 3NTCH 1XFPA 3PABB 3VXUA 1NCAH 1AGDA 4JJ5B 3SE4A 5E8DH 1ZLVH 4LCIL 3MLUL 5GRVK 1KIRA 5CBAB 4P46B 4YXKL 4O58H 2X4UA 5E00A 5E9DA 4JHAH 3SY0A 1H5BB 5FGCE 2CGRH 2YD3A 3QEHA 5JR1H 3KJ4C 4KJQC 1A02N 4MNGE 1KELL 5ANMA 3HPLB 4PJXA 3SBWA 5BMFL 5FYLL 4NN5B 2VKWA 1GZQB 1EH9A 1MEXL 4HC1H 3LEXA 3ZTNH 3MLWL 4H0HB 3WNOA 1IC4H 4JHZA 5IOPB 3RWJB 2AJ3A 2AEIT 3AS0A 3CVIL 1GVIA 5IROA 1R3HB 4NO3B 4GRWE 3EYOB 3STLA 5L6YH 1DBMH 1K6QL 2X1PA 3VRLE 4KH2A 2ZNXA 1T04B 3M8OL 3WFZA 5CILH 3QIWD 4AQOA 1GGUA 3PE9A 4IDJL 4TUKL 2IAMD 2GKIA 3O8XB 4JN1H 4DVRH 5FA4B 3PWVB 4ZMAT 4JG1L 1KEMH 2AJZA 4O2FA 3CLFL 1XGYH 4HKBA 3FB6B 4ZO6A 4JFYA 2GHWB 1JZ6A 5T5NG 2EE9A 3MZTA 2VUOA 2MCPL 2WP3O 5L7XH 4NP4L 4NZTL 5LCVL 1GCFA 4NRYA 1TDQA 1TZIA 1WISA 5DT1L 1A6WH 1PZUB 1W0VA 1T3FB 2VSDA 3O11B 1U3JA 4OKVB 3LB6D 15C8L 4JO1L 1OARL 3E6HA 4DVBA 5D5MF 1T03L 1S9WA 2NY3C 1B88A 1QBML 1HI6A 1BLNB 3C8DA 4OF0A 4KROB 3HMXL 4KV5F 4PJHE 4L9LB 3RUGE 4UNUA 1YNLH 3FO0H 1OP5K 2F58H 4LCWE 5KZCB 1RZKH 4XP1H 4LIQE 2B39A 1K4CB 4J3TA 1BQHA 4DCQB 5TFSL 1Q0XH 5ILTH 1DQJB 3VXPB 4NZRH 4AK1A 5I1IH 3CIQA 3HLAB 4OAWA 3KPLB 1MJUH 1UJTA 2X70B 3OXSA 2CD0A 1F6AA 4TOYL 1HHKA 3DURB 1HEZB 5KVEH 3M17A 1CIDA 1XCQB 4F7CA 3VXUE 2XOTA 3L9RA 3U0PB 2Y36L 1MHPL 3D39B 3QHFL 4CN1A 5E9DE 5SV4A 3TC9A 1AHWA 2FJFB 4LPYA 3GJEB 1DBJL 3RWDA 3MMEB 4Q9CA 1I3VA 5ANME 4PJXE 3PQYA 3C6LD 4X80H 1T89A 2BVTA 3VJ6B 2Z31B 4OV5B 5DJAB 1N4XL 4FNLH 2ZZUT 3DVFA 1EHLL 1QA9A 3K0WA 1FVDA 1X4ZA 5CD3B 4EOWH 4OGAD 1BZ9A 3C9NA 1Q94A 2NZIA 3T65B 2EDRA 1NGPL 4NNYA 4OB5H 3RVWC 5F7FA 4AIZA 4P46C 2UV3A 4EXPX 5HVHB 4PRHD 4QHMA 3I6GB 4U6XA 3VA6A 2FZ3B 3QZWA 5CJQH 3WXVL 3P73A 5HPOA 4G6ML 3E3QA 1R6VA 1UEYA 4Z7UB 4LSQL 4BSJA 1MCWW 3BPOB 4KUZL 3V0WL 3EHBC 3P9LB 4KJQD 4NN5C 2IALA 3ZE1F 5LAXB 3V0VB 5F1IB 3LRHA 3L1OL 2NY6D 1CLCA 5EBLB 3X3GH 1UJ3B 3E6FA 3GSOB 4KI1A 5GS0D 4LSVL 1HDMB 1EZVY 4Y8DC 3S5LB 1X4YA 4L4VA 1NCNA 2JKXA 4XCEA 2RJMA 3UPAA 5I1KH 4ZD3H 2V17L 3DUUA 1B90A 4M7LL 5J11B 1MFBH 3GSVB 1OQOA 1F8TH 2VL5B 5D70L 4X6CF 3S4SA 3MYJA 1AKJB 1JHTA 5F88A 3FO2A 1T1XA 3MCLL 4MQSB 5DJ8B 5MEND 4V3DB 1M4KA 4PG9A 3GMMB 5LBSL 3BO8B 2XN9D 4S1DC 4EBQH 1OCWH 2DB8A 3BGAA 4M3KB 2CDFA 4UILH 3O45B 2YZ8A 3G5VA 4U2ZA 1GAFL 4GOSA 2AP2A 3R8QA 3MRIB 2OI9A 4D9LH 3FO1A 1KB5H 4OUUB 4FS0A 4MLSA 3ARYA 4G5ZH 2W0FA 3D85A 3RY6C 4H5SB 4PV9A 4Y4FD 3F6IA 3KLHC 3C6LA 4NWTH 3IVKB 3SGKA 5FF6B 2R8SH 4KROC 2ZOLB 1OGAB 5CSZA 1BIIB 2DLFH 4MNHB 4K94H 3ZKND 5J8OA 4FTVB 3M1BB 4NOFA 4NC1E 1D5ZB 3W82A 1D5BB 1IAOB 2DBLL 5IG7B 1MHCB 1JTOA 1WZ1H 2GCYB 1ZHBA 2R2EB 5IT2H 3CX2A 1KNOB 4ONHB 4Z0XB 3BRGC 1KC5L 1VFBB 3PNWB 1MAKA 1NBZB 4MXQD 5CEYA 5D6CA 1YUHB 3PQYE 2VJXA 2KPNA 4LBEA 4PJEF 1MQ8A 4Y4HB 5I2IA 2E9WA 2CSPA 4X5XA 3FQWA 3BIKA 4HWBA 4PJCB 1AXTH 5KTEL 4E42B 4MA7L 1G9EA 4XPTH 1PG7X 1X6LA 3AXLA 3DSNA 2C1PB 1CLYL 4K3DH 2HRLA 3P30H 1V8HA 4XP5L 3RWGB 5DVOA 1FRGL 1UM4L 5INDB 1XR8A 4PLOB 3E3QE 5HI3C 3ZT7A 1SBSH 1ZT7A 4M1DH 4CNIA 2DMCA 5I1AB 1TMCA 4R2GB 4BFEA 3QHZH 1KN4H 2Z31C 2PW1A 4HWBH 1S78C 3F7YB 3IFPA 4POYA 3PWJB 1RZIB 1MCWM 4OLVH 4CKVX 4KXZI 5GZND 4UV7L 1WWWX 3SKNA 3D2UD 5MENA 1AGBA 2BRRH 3JVGC 2B7DT 3CZJA 5GS0H 5HVHC 4Z7OF 5EZIL 1ADQL 3HMWL 3PV6B 2QADB 3N50A 4Y8AA 5EO9A 1QNZH 4BK4A 4EI6B 1CE6B 3U1SL 3KPSA 1OWRM 1M71B 3BPOC 3EZJB 3O3DB 1RUAH 4QF1B 5J12C 3STZA 4H1LB 3UDWA 3VD4A 4Y4FA 5BV7L 3IDXL 4XHQA 1FZKB 1AE6H 3PP3K 2R1XA 3IXAA 3CGTA 3QXVA 3FQNB 5BVPH 3BX7C 5JHLH 2VH5L 3ULUF 3MLXL 1EGJL 4NQDB 1NEZG 1F45A 2AJXH 2EC9U 2AJVH 3BGMA 4LU5L 4XHJD 2QQKL 4I0CC 1T7XA 1J1PL 2YWZA 5ENWA 5EU3A 5J11C 2WV3A 4YEEA 3U79A 2PTVA 3S3PA 1N2RB 1ZXQA 3QXUA 1IRAY 3O8XD 4LHUG 4R7NA 1KCSL 4P49A 2WUBH 2P46B 4KMTL 1MCHA 2YD1A 2AJYH 3DX9A 2CH8A 4U31A 5EUOA 3F7RA 4LLUB 4D0BB 4F33B 3N06B 5J56B 3H3KA 5DHYA 2XPGA 4JKPH 3HC3H 2R4RL 2B5IB 5I1GH 2AK1H 3I75A 1K8DB 2VB5A 1CFTB 4OCYL 5C2BH 4AJ0A 2Z93B 3U7YL 5EO1B 4YHLL 1B3JA 3VWKB 1G6RH 4YZFE 2VXSL 1G7MA 1LEGB 3BEVA 2HJKB 4OI9A 2QBWA 4JDZB 3FB8B 3LPFA 2ZKHL 4PGCA 3VH8B 1EO5A 4XC3H 1I7TA 2XZCH 2ZSWB 4G7YH 4Q0XL 3QULB 2ZUQB 5MEPA 3VFPB 4N8CL 3GIZH 1UG9A 5KZCD 1KIPA 2RQ8A 5KJRH 4NSKA 4N9GB 3WD5L 5DFVC 1Y18A 3IETB 2A6DA 5L8KB 1FE8L 4ZXBC 3WJJC 3NCYP 4ZUUB 1T20A 4KKNA 4LLDA 5K9KB 3G9AB 1IZKA 2O61A 2E7LE 2A2QT 1NC4B 4BH7B 1F3RB 2XG5A 5MENE 3BN3B 3CLEL 4ZUWB 2EDKA 1R24A 3TBTA 1IL1A 3FAXA 4F57H 5DUML 4P23C 1SMAA 5F93C 4QHLA 1QLEL 4ESKA 2UZXB 2IBZY 4JQVA 1BD2D 5FO8B 4M93B 2VXUL 2P8MB 4LLVA 3KPSE 5T1LD 1BQUA 4H0IA 4WI7A 4DUWA 4R2GC 3CDFA 2AXJA 3TESA 3L7FB 3DSFL 5K59E 4N5EC 2P47B 5ID1A 3QSKB 4GT7A 4OD3L 3V8CA 4HFUH 3FCTB 4RQQB 2HG5B 4Z7QE 5IUSA 5KVFH 4PRAB 5F6HI 3WIFB 2O5XH 7CGTA 3FO9A 2YUXA 4AG4L 1HQ4B 2R39A 3RIFF 1JTPA 2F54A 5F6IB 4YO0A 5GGQH 1XGUA 4D8PB 2DQDH 1MJ8L 3OHXB 1DQMH 2QADC 2CDEA 1SY6A 3Q6FA 1S8DA 2HRPL 4NDMA 4PJ8D 3GRWA 5FUZH 1WK0A 1L7TH 5CZXD 4F7TA 4XMKL 1GH7A 5DUBB 3ILQD 3WFDH 4MD4A 3GO1L 4JFQA 1BZ7A 4KDTC 1CICB 3DBXA 2FATH 1YEIH 2DJUA 5EUOE 2B1AL 5AYUL 2YD8A 5AZ2H 2VR5A 2AS5M 1LP9A 5FDWA 3TT3H 3DX7A 4JQXC 1NMCB 1CXKA 2K7PA 4FQPA 4NQUA 4CN6A 4ELMB 4NUJA 4OLWL 3VFVA 3U0WL 4J1UA 4ORZC 4ZOEA 3LH2L 5ERWB 4LVHC 5DFTA 4DN3H 2AK4D 1FV1B 1AFVL 4LEXH 2DKSA 4WI8A 5T33H 3UTTB 1AKJD 3GMRB 3D69B 1I9IL 1S7SB 3DX6B 4IBLT 3CJJA 4LEOB 3ILPA 4Q2ZB 3K3QA 2B5IC 3KPOA 1EEZB 1BD2A 1JK8B 1IGIL 4AT6B 4ZSOA 4NZUL 3S3SA 3MXVL 5T1LA 2G2RA 4I5BA 3REWB 2XYCA 4DQOH 2G5BA 4EKXA 3VWKC 5C0CD 4D0CA 4IOFD 3LOWA 3RKDC 3NCJL 3WDHA 1WT5C 3NACL 3LPWA 2BVOA 4JY5H 1S9VA 1YMHA 1T5WA 2P5EB 3H42L 4HKJB 1S9YB 2ZUQC 2UWEB 1KPRB 3EYVB 3VFTA 2IBGA 5HI4C 4KK6D 1MRCH 4JZJA 1NC2B 3CSBA 4WHCA 2Y07H 3OJMB 2HJFA 3KDMB 3I9GH 5I18H 5IFHL 4L3AA 3F65A 4Y4HD 1ZGLM 4OZFH 1VPOL 3LN5A 4LCCC 2VQTA 3G08A 3UJJH 3MRDA 2DWEB 1NFIB 2OZ4L 1P4IH 4IRSB 2F54E 3OAZK 1II4E 4P57A 4ZOCA 3NCYS 2HTKC 1S7RA 3TA3D 3OMZA 3ARPA 5GISH 4ZFOL 5J89A 2R0KH 5FYKL 2NY5C 4OFKA 2G60H 3VI3E 4GW4A 1CDBA 3GSUB 1FVEA 5KS9B 1RHHB 1XH3A 4LLWB 5D72L 3VMNA 4WFGD 2J4WH 4J6RH 5DLML 2YEZA 3KXFA 3RX7A 4KKBD 1YQ2A 3NBNA 4YHPB 1P2CA 2Q86A 4L3CA 1IQWH 1DQLH 3MA7B 3P4OA 1U8KA 4KK8C 1QR1B 3QRFM 1XEDA 4HIEA 4ODUA 4ZS6D 1DJSA 2AK4A 2OS7A 1KOAA 2J88L 3P0GB 1I1YA 3MRGB 5F6IC 1GRWA 1NH6A 1U8OA 2VWEE 5HDQH 2E7MA 1LP9E 4Q58C 3QCVH 3O6KH 2WIIB 2DLGA 4M4PA 1N5AA 1TNMA 5E4IA 1UZ6F 4YJZL 2YA1A 4XP6L 1RPQA 3TYGH 5IEKA 1F11B 1T22A 3TPUB 3LPGA 3TIEA 4Z7NF 1CFNB 1TJIH 4DKFL 5D9SB 1ZT1B 5DEZA 5C0CA 1CICC 2LTQB 4U7SA 1JTTA 5C0RH 4KGJA 4OFIA 4MQXD 1D5MB 5DMKA 1DE4A 4NQDD 2EDQA 5CGYD 1BD2E 3DXAA 4LVNB 4ZSOE 4PREA 5GSRB 4YHYB 5HHQA 5I8OL 2NQCA 3MXWL 4U1IB 4ZDHB 4POZC 1FN4B 3QDHA 2WSKA 5BS0A 4HFWB 4W6XB 4R3SB 2E6QA 1DL7L 4PTTB 1SEQL 3TNMB 1I1RA 4J12A 1CDIA 2EKSA 3NCCB 1W0WA 1YEDA 1QBLH 1DTUA 1MFCH 3CZFB 1UT9A 2DOCA 3MREB 1HSAA 4OGYH 5L2KA 3IFOA 3R1GH 2P24A 3P0VL 5HYEA 4NFCA 3TA3A 4EUPG 3KYKH 1AI1L 4NKOA 5CWSA 1TLKA 1QSED 4QT5A 5INCA 1H15A 4JM2F 2IANB 3FQTA 4M1GH 1KSRA 3DX8A 4G3YL 5KSVB 3RA7L 5C0JB 4KVNH 1QPXA 2I25N 4Y16C 4QXTA 1IGFL 5IVOA 2VZOA 4YHNA 5DHVB 3WEXA 4QCIA 1LDPH 4PYGA 4PR5B 2FX9L 5EU7E 2X4RB 1HCFX 1H3WM 5J4MA 2D9CA 1KACB 3NFSL 3VGFA 3FOLB 4WHYH 4TSBL 3KXFE 3OZ9H 2MMXA 3ALPA 1HINH 1UCBL 3VGBA 5DHXB 3QXTA 4PJAA 1IEAA 2BNRA 5DJ2B 3HI6L 1ZKAA 2BC4A 5EOCL 2AK4E 5IB3A 2V9RA 4C4KO 2IG2H 3DV4A 1NC4D 3ZDXF 2DQHL 4FMFA 1FAKT 4IRSC 2CIIA 5FGRA 3PL6D 4X6EB 5FECA 1FAIH 3AU1B 5IF0A 4Z76B 4OCSL 4R4BB 1CLOL 1G7QB 4XH2A 1RZ7L 2OXHA 3L5XH 5B3JF 1NCTA 3FQUA 5EB9A 1QSFA 4K9EC 4BH8B 1WTLA 3W11C 1VDGA 5C0CE 2OCFD 3IDIA 1G0XA 5T5FH 5GGVH 4P5MB 4H1LH 1N3NB 5DK0B 2XG4A 3RL2B 4NNXB 3TBVB 4ZFFB 4XC1L 5FUCE 3JTTA 1I8IB 1T66D 2X4PB 4R97B 4ACPA 4FQJL 1RHFA 4M62H 5EWIL 3DXAE 2BOCA 5SWQA 5A2LH 3QG6A 3CFEA 2MHAA 4JCLA 1QSEA 4IRJB 3QUZC 1MFNA 1H3PL 4EN3B 2R69H 2JJTA 1FIEA 2A6JA 2XTLA 1T0MA 3U9PL 1E6JH 1CS6A 2HTLD 4HUWA 4LOUC 3CFBA 2LTQC 3QUXB 4MJ5B 2NLJA 4WI5A 4JN2A 3QO0B 5IHZA 1FGNH 1ITBB 4QTIH 5L2KE 1TTFA 4MHHG 4R26L 5TE6H 3NTCL 1NCAL 2NW2B 4LVNC 1CD1B 1FL6A 1X5FA 5E8DL 4W68A 1PSKL 4WFGE 5IHLB 4RISH 4IOIB 4O58L 5DC4B 1X4XA 4JHAL 5D1QD 1E6OH 5FA3A 5H37H 4J8RA 4Y19B 3QZWG 4GXVH 4YHMH 1UCTA 4I3GA 3O3BA 3QCTH 1DN0A 4N9OB 5KSUB 4JO4H 3ARWA 4KJYA 4HC1L 2X7LB 4HKXB 1RURH 4OZGB 4K7FB 4PGEA 1FG2A 3PL6A 1IC4L 1OAXH 2EXWC 4U2YA 3ROOB 3GM8A 3Q5YA 2EDXA 3S96A 3RBGA 2VDNL 5DJ6A 1RVFH 1F13A 4Y5XA 4G6JH 4ZTPL 2VQ1A 2Z91B 5FV1L 1DBML 4PJAE 3I3BA 4MX7A 1JMZA 2BNRE 4TNWF 1A14H 1U91A 1NUGA 3MRCB 2PYEA 1KG0A 1DEEA 3MLTA 1XF5B 4M1CC 3PDGA 4X9IA 4JN1L 1WBZB 4OFVA 3LKQA 4DVRL 1FO0A 5D2NB 5C09A 4WEBL 1PKOA 3BZDA 1KEML 2IWGA 1A3QA 2K9UA 4ODBD 3S4SG 4OFPA 1RJLB 3RP1A 2Z8VC 5F96L 1LE5B 3MACH 1QSFE 3OR7A 2AXGA 3IYLW 1YZZA 5L7XL 4HMEA 2WLZA 5ACZA 3W9EB 2VDKH 1S7QA 4O9HL 1JL8A 2COQA 3F8UB 1X5XA 3PJSB 1BQSA 5KOMC 1A6WL 4X9GA 3OBAA 1MLBB 4URTB 1C1EL 1FO0H 3T4YA 3W0WB 1KCRH 2ESVB 4AH2B 3WS6A 4KVCH 1N8ZB 5GGSY 1FFPA 2F19H 3FO0L 4YK4C 2X41A 1AGFB 2F58L 3ZKQD 7FABL 4H26A 3KPNA 1QSEE 5GGTA 1H9VA 1Q0XL 2BVUA 5TJWK 5FO9B 4NZRL 1JI2A 5D1QA 1T1WB 4LSTH 1MJUL 1EEUA 3C5SB 1TQBB 3EDEA 5D2LA 4AM0B 1NFDF 1SYSA 5KVEL 4MA8H 2YK1L 4R97C 3S35X 3BQUD 4QTHB 2PN5A 1UKTA 1F3JA 3LMJH 2R29L 3F12B 1S7VA 4IRJC 2GFBA 5GJTL 4FXGA 2DQFA 4EN3C 4MXVE 5EG6C 3JWDH 1OM3H 1CGUA 2YMXH 3KWWA 1CT8A 4M61A 4X80L 3HS0A 3QUXC 3DV6A 3SGJC 3KPQA 2YD4A 4U1MA 1GJIA 4JY4B 4FNLL 4JDVA 4R9HA 2AJSL 1JI1A 3MLSL 1U8IB 3QG7H 3GBNH 4HDIA 2UY6A 4JPVH 4RGNE 5CJQL 2C7UB 2FX8H 2Q6WB 2PYEE 4P59L 4UTAH 4MA3B 4NNPL 5HYQA 3F7PC 5JW5A 2BY0A 5C09E 5I71B 3LQMA 3VRJB 5A3IC 4M7JL 2ZCKH 2DLEA 3NVQA 3X3GL 2D9QB 4YDJA 3U6RA 2ED7A 1A3RH 4XZUA 4YPGA 4PRBB 4KKCD 3QJHA 6CGTA 4AIXA 1A6TB 3MRBB 3IFNH 4JFFB 5ICXA 1CVRA 1MFBL 3D48R 3RNQA 5FXCH 1F8TL 2CDGA 5D2NC 4QO1A 3WHE1 4M1CD 5K9OA 3FOMA 1RK0A 1I75A 3MROB 4S10A 1S9XB 5DS8B 1X3DA 4OM1H 4C59B 5E99H 4EBQL 3BQUA 4UILL 5IMKA 3WN5B 1JZ8A 1OY3B 1KPUB 3T09A 5HPMA 1JF1B 2OL3A 3JV6B 1BOGA 1CFSA 2YC1A 1CDCA 4G5ZL 3MGOA 4Y5YA 5I17B 3BHBB 3GSNA 3QXDB 4Y5VC 5D2LE 4E0RA 4XCYB 2BNQB 3R06A 3PGCA 4HIHA 4ODXA 2ZCLL 2YHGA 4PGBB 5I16A 1JPGB 5IW1B 2R8SL 1ORSA 3QNZB 2DLFL 1RZGB 4K94L 4YHIB 5HHVL 4L8SA 3IAQA 1U58A 2IPUK 3H0TA 3QIUB 3LKRB 1WAAA 1WZ1L 3QHTC 3I50H 3MJ8A 2ZSVB 5J1AB 4LKXB 1AO7D 4PPTA 5HGAA 3FRPA 3VXRD 2OL3H 4W4OC 1RZJH 2A83B 1MVUA 5EOTA 4ORGA 5E94A 1J9CT 3DO7B 4N0CC 1T1YA 3QDGD 5JQHC 3QQ9C 1VKXA 3QWOA 3G5YB 1A1NB 1FBIH 3QDMA 1VESA 3O41A 2DQEH 1AXTL 2AXHA 2ATPA 1LEIA 3VWJB 4XPTL 3JV4A 2HFFA 3O3EA 3F5WB 4BKLB 4K3DL 3P30L 5HI5D 2JIXB 4OZHB 8CGTA 3G6JA 3GZKA 2BNUA 5ESQB 1SBSL 1MH5B 4E9LA 5HHNB 2YXFA 3KPRA 1KN4L 2ADGA 3QHZL 2XNAA 3VXTB 3KPMB 5A2JH 4HWBL 1WFOA 4ZFZB 5F7EH 3MQIA 3RI5K 4OLVL 2W60B 3V4UH 2K1MA 3ZHDA 4AEIH 1U2CA 2JK5B 2IBBA 1OTUD 3ZMRA 5GS0L 2GUOB 1L6XA 4G8IB 1BZQK 1HHHA 2VLLA 3CH1A 3HI1A 1NGQL 3VGAB 2APVA 4GG8A 3QFJB 4Y19D 4NGHL 4QRRB 3NFPB 5I71C 1HH6A 2IH3B 2X4OA 5EC1A 4P3CL 1VFAA 3I2CH 5EUKB 3BFOA 4NHCH 2HLAB 1A7PH 5DHVH 4I0PB 1CGXA 1Z6JT 2AAVA 5BVPL 5E1AA 1A47A 3OAZH 2V2XA 2FD6L 3EYSL 3UROR 4UQ2A 5C0AB 1DBAH 2GAZA 1LO4H 1AO7A 1MLCA 4AYFA 2E3VA 4WFED 2Z35B 3T8XB 3ARBB 2RR3A 1CI5A 4WI6A 4KRMB 3QDGA 3LEVH 4RDQF 4N0UB 4OLUH 3KJ6H 5JW3H 3BT2H 3O6FB 1E27B 4V1DB 5GS1B 1FNEB 2WUBL 2EH8L 1W72B 2A0LC 2NXZD 3EJJX 4ZYKB 1WAAE 1A6ZB 2AJYL 1N5YL 4YFLF 5IEHA 2HJLB 1KF9B 4LCYA 3NOIA 3QH3B 5GQBA 2LAAA 3HC3L 4PIRF 5I1GL 3WKMH 1R5WA 3V4PH 3MLZH 5TPWL 3QDME 3RTQA 4Z77A 4DZBA 1H3TA 4HWZB 1JFMA 2BY2A 1G6RL 5CKAA 4IMKA 2EDNA 5EN2A 3MRFA 4X7FC 4E5XA 2W07A 4FQLH 1ZOXA 3EDKA 3EYFB 4P2OD 4LSSL 3BEWB 1FVCA 1A7RL 1CL7H 4RGMC 4PRDB 2XZCL 4G7YL 1CXEA 3G6JE 3LKPB 2E8YA 1OLLA 5C8JB 1LHZA 1ED3B 5EU6A 1IM9A 3CU1A 5DYOA 3KPRE 2PETA 1IM3B 5GGSB 1P4LB 2DQJH 3KLAA 3QYCA 5KAQG 1ORQB 1QFUH 4OD2B 1AP2B 1IC7H 2ICEB 4DKAA 1S5IH 5LGKA 2V7NA 1BFVL 4KU1A 3J8F7 1KULA 4HIJB 4X7TA 4JO2H 2DS4A 3L3KA 1MRDH 1X5YA 3VFUB 3UZVB 3A6OA 4PJ7B 4FFZL 4LNRB 4L3ED 1T1ZB 3A0OA 3GHEL 1JMXA 4P5TB 3MR9B 4FQCL 2Y4SA 3LKOB 5CP7A 4Z18A 1JZ7A 1G84A 1OWWA 4HFUL 4LLYB 3VXSB 3MZGB 4PJIA 3G04B 4QHNB 2AQ1A 5KVFL 1JZ2A 1IARB 4PJGF 1DUZB 5DMIH 3F7VA 5LWYH 1PVHA 2O5XL 4MD5B 1Y6MR 4J2XA 3MCKB 3S36L 4PGDB 2Q8BL 1ZA6A 5GGQL 1IEBB 5GRYA 2H3NA 1AO7E 2E7CA 1DQML 4U7MA 2AV1B 4LQ1A 3VGAC 4JR9H 4ISVA 3KPPA 2ITCB 5FUZL 3QDGE 1L7TL 3BKCH 4M5YL 4QGTA 1T7ZA 3ARVA 4DOHE 2WWKT 3IDMA 3KYNA 4PRNA 5DGQA 3V5HB 1KIQB 4KKLD 3E1F1 5D6DC 3MNZA 5JPNB 1MUJA 4JAMB 2L0DA 3VDCA 4I0PC 1KB9J 4P2OA 3U7WL 1LD9A 3GKZA 1MI5B 1UB6A 1WITA 4FQ2H 3IDJB 4UIKH 5AZ2L 2Y23A 1JPST 3BZEB 3DVNB 4MWFA 1OAQH 1N6VA 3TT3L 5I30L 4NM8H 5FK9B 3ARBC 4N1EA 1RULH 1HWGB 3V6ZA 5HDOA 4JFFD 3MRNA 4P3DB 1YA5A 3O6FC 3D0VB 1AJ7H 4DN3L 4P4KD 5T33L 3RGVD 1LO2H 4LCUA 1ETZA 4Z78A 2DYPB 3HZYA 4GSDH 2O26U 5MI0B 3LRSB 1R0AH 3VFSB 4MCYA 3VU2A 1MCNA 2AV7A 2ERJB 1YC8A 2R9HD 3W2DL 4KTEH 5IBUB 5IKCA 2EKJA 1FL5B 2BOBB 4HH9A 3DUSA 1RK1A 1TQCB 4L3EA 5HHOB 3UBXA 3MRKB 1CDGA 3HR5A 4NBZB 4Q9QH 4QRPD 4JY5L 3HZVB 2R0LL 2EICA 1RI8A 3U83A 4MDIB 3MNWB 4Q6IA 2EXYD 3S3JA 3QIUD 2CIKA 1QZ1A 1MRCL 4K23L 4K55A 4I48B 1NGWB 3O2VH 4PJBF 1EO8H 2W9EH 1MHEA 2XKNB 4V2CB 5GRVL 1O7VA 3MUHL 5F7HA 1V7MH 2CLVA 4G6AC 4UINL 2A6KB 4UNVA 3QDJA 2XXMB 3M07A 2E9IA 3ULVD 1IJ9A 2VC2L 4PJIE 3JTSB 3P40A 3WO3B 3P2TA 2PTTB 1EEYA 4M7KH 3UJJL 3VWJD 5BJTB 1X6NA 2CQVA 3U82B 3V4VH 5DJ0A 4Y2DB 2R0KL 2JIXD 2DQUL 2G60L 3OJVC 4MA1B 4OSUH 1YEHH 4P5TC 2AEPH 5B8CA 3QUKB 4UUJB 4J6RL 3OKKA 4K8RD 5I74C 3OR6B 3VXQA 4LF3A 5HGDB 3FAWA 1EJOH 3ZSTA 3MX0A 4PG2C 4L8CA 5FO7B 5SX5K 43CAA 5SWZB 2F74B 5DD6A 2JB5H 4P4KA 5D7LA 3RGVA 4NFBA 2CUIA 3NABH 1GZPA 3IDGA 4U0QB 1JNNH 5HDQL 3PGDB 5CSBA 4XTRC 3G5ZA 3VI4E 1TNNA 2C9AA 3QEGH 3TF7C 1Q9OA 1YMMA 1LO3H 2R23B 1XGRB 1PQZB 4G8EB 5E8PA 3TYGL 3UP1A 4JM2C 3V5DA 5HBBA 2XZAL 4PJDA 4R4FH 1TJIL 2FIKA 2QHRL 1F3DJ 1JGEB 4TUOA 4QRPA 5AAMA 5C0RL 1JE6A 1ACZA 1NCDL 1WV7T 4KUCF 4CMHC 3OB8A 3VXMB 3ETBF 1DEDA 4N1CA 4NQVB 5GIRA 1N6QH 4L3EE 2KUTA 2Y7QA 4LLQB 4KK5C 3RAJH 4E41B 4JFPB 3QUMA 1I7ZA 4HBQA 5C0BB 5D7IB 4DFHA 1YY8B 4U3XA 1CK0H 4TUJA 3DTXA 5DA4A 5T3XE 3BP4A 5FKPA 4ZUSA 1MRFH 5KSAB 3O6FD 4RMRA 1A6PA 1QBLL 5DFWH 5F3BA 5MI0C 2CLZB 4OFYD 2H8PB 1MCEA 4OGYL 1QBBA 4CVZB 3R1GL 1FNFA 4HGWB 1UB5B 2NNAA 3GBMH 4XNYH 1PD6A 1CXHA 1FGVH 5DZOA 5C7XH 4TVPE 3PHOB 3FT4A 4M1GL 3LHPH 2ILLA 1NAMA 3QDJE 4LVOB 3QUMH 2EEDA 2ATKB 4KVNL 2WWMD 3D5OF 1KLUB 3ULVH 1AD9A 2FJHA 2B20A 3DI3B 5EZLA 2Z92A 2D7NA 3VFOB 4JRXB 4HS6B 2FR4A 2H2PD 1LDPL 2ZCHH 3EYQC 3CXDH 1FLRH 4M48H 1TXKA 4JPKH 2JCCA 1U8NB 2YKLH 2J7LA 2PXYB 3T04D 3OB0K 1NAMH 1XIWA 1XF4A 3NA9H 1HIMH 3OZ9L 1DFBH 3MODL 1HINL 5JIPA 3OKDB 4K8RH 2BVEA 5F8RC 4CMMB 1QLFB 3MLRL 4PJ9D 1T2QH 2BY1A 3RRQA 4P9MH 4PGZA 1X5HA 4JREC 4LRIA 3OG6B 5D7LE 4Z7VF 3IF1B 4B7IA 4WUKH 2P48B 1HSBB 4U1LB 3HG1B 4Y2DC 3UPRA 4RWYH 1I4FB 1HH9B 2E6PA 3TZVB 4MA1C 4PJFA 3OKMA 3RY6A 3L5XL 1YMME 3MFFA 3U4BH 4RIRB 1TVHA 4OZIF 1K8IA 4XMPH 5L88H 4GG6A 3TBSB 1SEBA 5ID0A 4N8VB 4PJDE 2WBJB 1A2YB 3W5NA 5I1DA 4GKNA 3HAEA 5FYJD 3BD4A 3VE0A 3EOBA 4U1HA 2KH2B 4N8PA 4QRPE 4Z0BH 1QFHA 5EU4B 3C08L 1FZOB 3VCLB 3WHXA 3VXSD 3IJHA 3CPLB 1I8KA 3GMQB 4JFEB 5B21A 4G42B 3OKEA 5DC0A 4HJGB 3X3FH 4AENB 4OFYA 1V7NH 1OLZA 5CJBA 1VGKA 4M62L 3RWIA 3ZE0F 1FG9C 1BVLB 3EYUH 5K9JH 2MFNA 3QBTB 3K8MA 2R69L 4DW2H 3SDXA 1GC1C 3VFMA 1E6JL 1R5VB 1NCWH 3ALWA 2DM3A 2DMKA 3TN0C 1DLFL 4QTIL 4N5UA 1J18A 2JELH 2A9MH 3ZYIA 1KTLB 4GAYA 5C0DA 4FQXB 1OTSC 2FJGA 3BUYA 3SDCC 3BYTA 3X13B 2Z31A 1U8PB 4D94A 5GHWL 1U93B 2F9BT 5DJAA 1UYWH 4HH8A 5HY9B 1U95A 2NXYB 3QEQD 1E6OL 1NGXB 4BSVA 3ECBA 2C3VA 1OVZA 2UZIL 2YR3A 3ARDB 4KK5D 4YHML 2UY7A 4DGYL 3QCTL 4NO0D 2RCSH 1IQDB 2OTUA 3CD4A 3ULSB 3GUTB 4YHZH 2DYPD 1KJ2A 2NY4B 2JCCE 2EDLA 4R0LA 4XPHL 4ODHL 1RVFL 1LE9A 4G6JL 3AMLA 3LVEA 1SJEB 4GUPB 3IU3B 4RMWA 4F8QA 5HHOD 1HOCB 4J23A 1R3JA 4TSAH 5HDBE 3RVVC 4ELKA 1YNTB 2YZ1A 1J7VR 3H9SD 4WW1A 3KVQA 2CK0H 1MF2H 4YBQD 2IQAA 5EU5A 1S7UA 5DMJB 1NCCH 2B2XL 4H25A 5D1ZD 3O9WB 4GS7C 3QRGL 5KSBB 4I0KA 4PJFE 3WFHA 4PJHF 3RUGF 4BYHA 2PXYC 3B2UC 1U8MA 2X1WL 2VXQL 3MACL 2H32A 4GG6E 3UZEA 1J10A 4OF7A 3L7EA 1YYML 4MJ2A 1VA9A 1XGQB 4U1JA 2X4QB 4PY7A 2X6MA 1G7HB 2BSSB 5FYJH 5F3HA 4HPYL 1JBJA 1FO0L 1P7KA 2WP3T 3V6OC 5B38A 1KCRL 4JHWH 3QO1B 4KVCL 4Z5RA 4XNUL 3TZVC 2A6IA 5IJVA 3TO4D 2F19L 5JIIA 1FNSL 2D31B 2O5YL 4PP1D 3SDXE 3TIDA 2GSGB 2V5TA 3QEQA 2OJEA 1HXYB 5F9JA 5C0IB 1UACL 2X40A 3TV3H 4NO0A 4U6TA 4Z0XA 2IQ9L 1ZLSH 1I8LC 2FH8A 1NBQA 2H9GB 4JB9L 2Z4QB 5T1DH 5SWZD 4ZAKD 3N85H 3GIVB 4M6AA 4U1GB 1E4KA 3V7AG 2C4FT 2VDQH 1ND0A 5AD0A 4X6DB 3DHMA 4ZXBA 4MJIB 5GGTL 3V5KB 5GGRA 4NN6B 1FC1A 1WIUA 4LPWA 3JWDL 1BJ8A 3LN4A 4NT6B 5J1TC 5D7SL 4NC2B 3EO1A 3FT2B 3O3AA 4X5LA 1OM3L 1C08B 2NR6C 1HYSC 1IGCH 3SE3A 3D3VA 2NW3B 4P23A 5GXBB 2BRQA 5DWUH 3H9SA 4CADA 3T1FB 1HN1A 3LS5H 4H8WL 3O4LB 1D6VH 5E6IB 5HYFA 4FQXC 3PWUB 3EO9H 5DJDA 2IMMA 5D1ZA 4KMLB 4D9RD 4OCLC 2R2HA 2Y9RT 3OXRA 3QFDA 2I9TB 5C08B 1N59A 1TCRA 5IVXA 3PXJA 4L4TD 4NQSB 2DQIH 3ARDC 4L5FL 3DMMD 1I1AB 5DJCB 4UTAL 5C0BD 5FYJE 1A6AB 1OD9A 3JBG7 4JZNA 4LSPH 2NZ9D 1YY9D 2HVKB 3QA3A 3U4EA 4MZ2A 5KSAD 1C5DB 2NY4C 2ZCKL 5J6HA 3EDFA 5BV7B 2E6JA 4UBDD 1A3RL 5DSCB 3TO4A 4WTXA 1R3LB 3O3UN 2J8UB 4HGMA 1JUFA 4O51B 4GRMB 1J05B 1NDGA 2DL9A 1J8HA 1KJVB 5MEOA 1ZWIB 2KL6A 4X0KB 2W0KA 3IFNL 4LARH 4F7PB 2BSTB 1UXSA 2LVCA 5D4QA 4DGVH 1IGYB 2BMKA 5E5MB 3TYFB 1EERB 3EJYC 1XZ0A 1BOYA 4OLYH 1KLGB 5M95B 4ZAKA 2EYTB 2GJZA 3MBXH 1A3LH 4OM1L 2PW2A 3MUZ1 4PP2A 2ZJSH 1TETH 2PXYD 5IK3A 1IGJA 2XKSA 1RFDH 5DJXA 5K9QG 3QEQE 4KC3B 3SKMB 2R2BB 4ODVH 5BCAA 3BH9A 2ID5A 1FNHA 4PFEA 2Q3AA 3JSSA 3HG1D 3K4AA 5MHSE 5ISZB 4C83B 1WC7B 3CUPB 4YUEL 1TZHB 3VWKA 5MERA 4RNRA 2D7QA 5IGXL 2OL3L 1WT5A 1RZJL 2CUHA 3BSZL 4LPVA 1KCGC 4C58B 3GSNL 2WBJD 1A22B 3EO0B 4L4TA 5IM7B 3BMWA 3H6JA 3AM8C 3D3VE 3DMMA 5IB2B 1FBIL 3T0DA 1MCJA 1GC1H 1IAKB 3H9SE 1VCAA 5C0GB 2DQEL 2QSTA 1JGVL 3L3GA 2OJZH 3WE6B 4UT6H 3TJHD 4JFED 4UTBH 4R4NC 1DLHA 1KFAH 2BDNL 1TJHL 4I18B 2PO6D 4KXZH 4S2SA 4WFFE 4ZPTB 2EDEA 5IVXE 4LCCA 5IB4B 1U3HB 2Y5EA 2PYFA 2MQCA 1VSCA 2LU4A 4G8FA 1PDKA 4LCIH 1YPZF 4YNYA 3WNPA 4KJWC 5BZDA 4QHUB 3HUJA 1K5NA 1Q72H 4BFGA 2ZPKL 2PNDA 1EUUA 1S7WA 5BMFH 3S37X 2W1NA 3GMPB 4LGSB 5ADPH 1WLHA 1RJZB 1G7JB 3MLWH 1KT2B 1J8HE 1K4DA 1WZMA 3GMLA 4J4PD 2NXYD 4EI5C 3AREB 3BXNB 2P44B 1INDH 3DROA 1J5OH 5DRNA 5E2UH 3EGSA 3WNLA 3P4MA 3OJDB 1NEUA 3TBYB 2A9NH 3M8OH 5HHPB 5IHBA 5BV7C 1SJHB 1A7PL 1HHIB 4MJ6A 4U6YA 1CGYA 1X9QA 1I8MB 3WNNA 3CFCH 4QWWD 1Q9LA 4PP8C 5DQ9A 3D18B 3GMNB 5TH2A 1ZHLA 1DBAL 1T7VA 4GKOA 4YEFA 4Y1AB 4JY6B 1FFNA 5J9PB 1JFQH 1KCVH 4UDUA 4WU7A 3LEVL 3P4LA 4NZTH 4M9OA 4YZFF 3AS2A 4OLUL 5JW3L 4O2EA 3MRHA 3BT2L 3RVTD 2ZUUA 2ICWA 5DT1H 3SDYL 1NUFA 3MRLB 3GKWL 4NYLB 3RDTC 2FWOB 3O9WD 15C8H 2DQGL 1MSPA 3QB7C 4JO1H 3TJHA 4OI8A 1T03H 5E1HB 3SKJL 1NEZB 2X1OA 1QBMH 3P0YH 4FZEH 3UZQA 4JPIB 2PO6A 2XT1B 3MV9B 3IJSB 4L4TE 2XACC 3FQRA 3L3HB 3E0GA 3V4PL 3MLZL 3OX8B 5JO5B 3MRJA 5DRZA 3WLWD 3ZT5A 5L2JA 4DKDC 3UBXG 4MAYB 3DO3A 4FQLL 4LHUB 4Z7WF 1JV5B 2UYLA 1XR9A 1CL7L 1CG9B 1E0OB 4LLMA 5HYSA 1ZS8B 1RIHH 3L5WB 5HHMA 4ZUTA 4AEHH 4XRCB 3MNVA 5C0EB 4DKEH 3E2HB 1BX2B 4Y16A 3BW9B 3VRIB 2YBRB 4AL8H 3MSPA 3VD9A 1GGIH 4HUUB 5EA0H 3GGWB 3QHFH 1QP1A 2XKUA 3HUJE 2DJSA 2Q76A 1QEWB 1QFUL 4NQCB 1DBJH 4MZ3A 1MPAH 2HVJA 1LVEA 5E8OA 3ZL4H 3U30B 3WFCH 2DICA 1I1FB 3MV7B 4QRUB 4GXUM 2HFGL 5FYJU 4JO2L 4G59A 4I18C 1CGSL 4CVXA 5JHDA 1MRDL 1TFHA 3MLVL 5DRWB 4GKZB 1U3HC 1QRNB 1CFQA 4ZFOB 2XA3A 1AQDA 1CR9L 1A7QL 3IDNA 5T3ZE 4F80A 1NGPH 1L9NA 3QUYB 3CXHJ 3UTZB 2OR9L 2Y06H 3U36B 4BQBA 4EZMA 3AB0C 4LLWA 1QSVA 1Q1JH 4XBGA 3TFKC 5A16B 5DMIL 3MFGB 5LWYL 3OKOA 5E6ID 3V0WH 2VLRD 2YSSB 3D6GA 4Y88A 5ESVA 2LFGA 2NYYC 1DUYB 1Z2KA 2VISA 2HT4C 5CJOH 1KTRL 4LP5A 3L6FA 1VACA 5F1KC 4HZLB 1XF2A 4N0RA 1KPVB 2X4SA 4C56B 3DPBA 3QEUA 3AREC 1WJ3A 5C08D 4JR9L 5EBWA 4OCWL 1S7XB 3N1MC 3NFNB 4LSVH 4WWKB 1I1AD 3BKCL 2ADFH 3MRRB 5E8EA 2N7BA 5I1LB 3BPCB 4EDXB 1LK2B 3SGEI 4G43B 3IKCA 2FRGP 4M7LH 43C9A 3QUZA 4WNQA 5EZJA 5F8QC 5D70H 1CFNA 2D2OA 3RWEA 1V3KA 4PRPD 4GBXD 4KY1L 4L29A 4XBPA 5CEXB 4MB5A 1OAQL 2GTWA 1LO5A 2V2TB 4NM8L 3AAZA 3SOBH 4D0DA 2MWCA 1IAIL 4QOKB 2EYSA 3GM0A 2CMRL 3TNNB 5HYJA 5LG1A 2XI9A 4RSVA 5F1NA 2XWJB 1G0YR 1LO2L 1IEHA 5H2BB 2ADJA 4GSDL 5HHME 1FN4A 3ZDZF 1KBGH 1WSST 2DLHA 2P8PA 3MJ7B 3RNKB 4M8VA 3K4DA 2XZZA 4UOW1 3GSXB 4BZYA 4KK9D 4YWGH 4CJ1A 5MEQB 1QPPA 5IV2B 5EH1A 2DBLH 2PCPB 3HPJA 3B43A 5D5MA 2IFFL 4G9FD 5TQ0H 4Q9QL 1XCTB 3HRZB 3QNYB 4W81A 5DVMA 3U46B 4U6HA 3HTLX 3MRQA 5JHDE 3V9FA 2FH6A 2AJUH 5ISZD 1U3ZA 2VLRA 5KTEH 2YRLA 1IBGL 3TCLB 3OAYK 3L3JB 4KHTH 5F89A 4NKMB 3O2VL 5ICZB 1CLYH 1EO8L 1AQKL 2R0WH 3KS0J 1M05B 2EE3A 2VDRL 3EFDL 2EDOA 4XP5H 2N56A 2OQJB 3WIIL 1FRGH 1S7TB 5D7JC 3UO1L 2DQCL 4NBXB 1Q9WB 3KAAA 1OSZA 4DGIL 1I7RA 2AVGA 1Q9KA 5FGCB 3U30C 3VFWA 2Y1VA 1H8NA 1QHOA 3O6ML 5T3XL 4CJ0A 1VENA 3MJGX 1D5XB 4RAUB 4Y2OA 4MNGB 1HILB 3TJEH 2DIAA 4YC2C 4OBRA 2VITB 3W39B 2H26B 3ZDYE 3H7BA 4X8JA 1BVKB 3BISA 4RWHA 1LP9F 4WCYL 4BQ9A 2XA8L 3QI9C 4F3FB 4OSUL 4IIQA 4PRPA 4GBXA 3GJFK 2BP3A 2PUQT 2W0LA 3TO2B 4TVPL 3LDBB 1UQSA 1Z5LA 2ADIA 3RVUD 3QUYC 4L9DA 1EFXB 5GSVB 5EZIH 1UZ8B 1ZLWK 4F58H 1ADQH 1EJOL 4GRWB 4PLKD 2Y5TA 5IP4A 4IMLB 3U1SH 3VD7A 3HAEG 2FB4H 2JB5L 1UXWA 1WCBA 1P53A 3NABL 1JNNL 4UDTB 4F7MA 4LP4A 3RWHA 5E24E 1C8PA 1ZVHA 1FPTL 1YDPA 5DK0A 5BRZD 3CSYB 1LO3L 2IPUG 2VH5H 4EJ1C 2FIRT 4MQ7A 1ZV5A 5IIEA 1T5XB 3ROLB 5HYJE 2P7TB 4R4FL 2GIYA 4M6NH 5DMGC 4XCCL 3CFJA 3OGCB 4LU5H 1HHGB 4G9FA 5IB5B 5BVJB 5J3HC 1VADB 1J1PH 5D96C 4R96B 5DTFA 4EN3A 3ISWA 3NZ8A 5ECJE 1YN6A 1A7OL 2QQNL 3MA9L 5F1SA 4HSQA 4HK0A 3HFMH 4PJHB 1HXMB 4R8WH 3RUGB 1FNGA 1OSPL 4BSWB 1HQRA 4LCWB 3RAJL 5D5ME 2YD2A 3HE7D 4N0YL 4KJPD 4X6CA 4HWEL 4XVUC 4Z7UF 1N0LA 4OLEA 1FJ1B 2XTJC 5SWSA 1BEYH 3GHBH 4OCYH 3C5JB 2P5WA 4JPWL 5AAWA 3U2SB 5C0NC 2D03H 2FEDD 4HUNB 4YHLH 3SDAB 4GKSA 2VLRE 1ZVSA 1CD9B 4Y0GA 3ZHKA 1DSFL 4XNYL 4XWOC 2IH1A 2ZKHH 3QWQB 5DEFA 5C7XL 3KNBA 5KG9B 3NGBB 3LCYA 2NY1B 3VXUB 1AGDB 3LHPL 2IPKA 4M4RA 4KMQA 1KIRB 3QUML 2X4UB 3LQZA 5E00B 3MRMA 5E9DB 3SY0B 3ULVL 5ITFA 3QEHB 3TGXA 4MAYD 4LHUD 5ANMB 1BWWA 4PJXB 1RZFH 1OPGH 1CL7I 3CXDL 5CIPA 1FLRL 4BQ8A 3S5LG 2BY3A 3LEXB 1GL4B 2YKLL 4GRLA 4LASH 4PRPE 3S97C 2QSQA 5L0QB 4PJEA 1NAML 4DAGH 3WLBA 3NA9L 2AJ3B 3QPQC 5DUMH 5BRZA 1QLEH 3GNML 3D0LA 5T1KD 2EE2A 3PWPD 2HT2D 3NAAL 1T2QL 2HH0L 4LAQL 4F15B 1LE5A 5B3NA 2DI8A 5AEAA 4KI5D 1PZ5A 4WUKL 3RJDA 3MV7D 4BK5A 3NMEA 2X9YA 4DTGH 1I3RA 1OB1A 3RHWK 4RWYL 3JTCA 5B38G 1EMTH 3TH4T 2AJZB 4O2FB 3TH3T 4Y5VA 4F2MA 3DETD 3LDBC 4HKBB 4MNQD 5HXMA 5IFAL 4XMPL 4UT9L 4AG4H 5FYKD 3ZE1E 5IW3A 5DQJA 4NRYB 4G9FE 3HE7A 1DR9A 1TZIB 2JJSC 1W0VB 3L3OA 4QRQA 4PJCF 2V6HA 5GS3A 2PR4H 3BP6A 3E6HB 4DVBB 3GO1H 1S9WB 1V7NL 1HI6B 4M5ZH 1INQA 4ENEC 4UV4L 1CZ8H 3EYUL 5DVKA 4FABL 4X6CE 4GW5A 5AYUH 1OD7A 1BQHB 4WWKD 5SWSE 3I6LD 1L9MA 5HVGB 4HXBL 1HWHB 2P5WE 2FL5A 5E2TL 4OAWB 1RUML 4OLWH 3B5GA 3OXSB 1JRHL 5J3HD 1F6AB 2JELL 2D7PA 1HHKB 2WANA 3LH2H 3AVEA 5LGJA 1N6UA 3KYMB 4HULB 2ORBL 4TULH 1BF8A 3M17B 4A6YA 5JOFA 4F7CB 3L9RB 1UYWL 1I9IH 3B9KC 5JDSA 4KRPD 1XGPA 1FDLL 4PJAF 3SGDI 1AHWB 1ZT4A 4Z95L 1I7UA 5T1KA 1IAII 5C2UB 4I4WA 1QLRA 5GZOD 1RIVL 3RWDB 3PWPA 2NY7L 1IGIH 2YWYA 4GFTB 3PQYB 3BKMH 1PG7L 3MXVH 3QIWB 3SDAC 3X11A 4OQ1A 5I1EL 1SVCP 1RQ5A 4FMKA 1QA9B 1OTTD 3NACH 2HMIC 1FVDB 4TRPH 3NGBC 3H42H 4PJEE 1BZ9B 5BRZE 3C9NB 1Q94B 5AYQA 3OWEA 3SE4C 1VFMA 4NNYB 4MNQA 4AIZB 5IBLD 4CU7A 4QHMB 5FM8A 3QZWB 3P73B 3GSWA 1EIBA 5DK3A 2CK0L 3SBWC 5IFHH 3TWCH 1MFAL 1KJ2L 2IALB 1RU9L 1OAUH 1NSNL 4JFOA 3UTPE 5E0QA 2HKHH 5LXGL 3E6FB 3C6SA 5IROC 4YGVA 5FYKH 5AWNH 3UBXI 2VDPL 5TF1H 4XCEB 4F15C 1BWMA 5D72H 2WZPD 2XWTA 5FYJL 3LKSA 4KQ3H 4WFHD 3PUCA 1EJ6A 3DUUB 4Z7OE 4JHWL 4FFWD 3S4SB 1JPFA 5F9OH 3MYJB 4J3WA 5DJYA 1JHTB 1IFHH 5F88B 1T1XB 1P4BL 2ENYA 4PG9B 2J88H 2CDFB 4YH6A 2J5LB 5I73B 3G5VB 5EIIA 2OI9B 3FO1B 4N0FA 3T77A 5C0FA 4XP6H 2W0FB 3TV3L 2GW5A 3D85B 3ULUE 3H9HB 1IGTA 4PV9B 1ZLSL 3C6LB 5T1DL 1AGCA 4LSRH 5JLZA 3CC5A 2VDOH 5CSZB 2X4NA 4EQ3A 1XGTA 4NKDA 3EJZC 4OCXH 3PF2A 1KB9K 2GJ6D 3QXAA 1ZHBB 1DQTA 5CEYB 3PWPE 5CP3H 1KJMA 1L6ZA 5IJKA 2J3SA 2ITDA 1IGCL 4I3RL 4LBEB 3VFRA 3MRPA 5I2IB 4RX4D 1WTGT 4X5XB 2BERA 1JWUA 1Q8MA 3FQWB 1D6VL 3BIKB 5IQ7L 1DL7H 1SEQH 2CK2A 5FGSA 4K71C 3EO9L 3AXLB 4JG0H 2DIJA 4TPRH 4HUXA 5I76A 2NY6B 4MNQE 4P2RA 1AHWC 4FA8A 3QCUL 1XR8B 3IS1X 2WK2A 2DQIL 4LCWD 1ZT7B 4P4RA 4CNIB 1GPOH 5I15H 3QIWC 2QTEA 4G3YH 3RA7H 2PW1B 2IAMC 3IFPB 3SDAD 4GJTB 1T4KA 4ODWA 4JZOA 4OT1L 1OGTA 5F7YC 2CR6A 4HXAH 3SKNB 5MENB 1AGBB 5EUKA 5HJ3A 2NY1D 3VXUD 6FABH 2ZUVA 3PDDA 4GO6B 3WS3A 1ZA3A 4ELMF 2LABA 3B4NA 3E3QC 3I6LE 4BELD 5EO9B 5E9DD 4TSBH 2H41A 1WIOA 5D2LF 3KPSB 4DGVL 5SX4I 3EOAA 5C0AA 3STZB 2IGFL 2A73A 1X7QA 4OLYL 3LB6C 4Y4FB 4TNVF 1OAKH 2VZSA 3MBXL 2R1XB 5TE7H 3NCMA 5LVEA 3IRPX 2VAAA 3ZE2F 3IXAB 2ZJSL 3U9UA 1TETL 1HKLH 2OXGA 3H3BC 5HVWA 1RFDL 4XNQA 1RZ7H 4JVUA 3BGMB 4ODVL 1NMAH 3UYOD 4ZNEA 3JZ7A 4GRWH 3C09B 3QH3A 5ENWB 5EU3B 1K9TA 3MGTA 1QFWM 5E08H 5JA8B 3CX5J 1QKZH 4HS3A 4R7NB 4TN9A 2UWEF 1BECA 4K94C 3ZYZA 2EO9A 2XRAL 2ZUTA 3DJ9A 3S6CA 3WUWA 4GH7B 5HYSG 3DX9B 4RMTA 2D7OA 3MLYL 5EUOB 5EWIH 1ZE3C 2XPGB 2RIKA 3I75B 1MCFA 2OK0L 3CNKA 2R15A 4K2UL 3C6LC 4K3JL 3SGKC 3S88H 2OJZL 4RBPK 1G7MB 3BEVB 4K07A 4UT6L 2EDDA 1FYTA 5F7MC 4PGCB 3REVA 4UTBL 1KFAL 4LGPB 1DQDL 5F72S 3V79C 2FHBA 4P2RE 4AEFA 1I7TB 5MEPB 4OGAC 4YIQA 1MCQA 5KS9F 2UUDH 4W6YB 1KIPB 1WF5A 4R26H 5KOVC 1JPSH 4JVWA 3P9MA 2CKBA 4B7LA 3KYOA 3QJFA 4NSKB 3V6FA 1JWSA 2X89A 4LIQH 1PSKH 4WI3A 4OQTH 4WFHE 2A6DB 4Q6YA 3VFUA 2MPAL 1F4YH 1XAUA 1Q72L 1T20B 4LLDB 3U48A 2O61B 1JRHI 4JDTL 3TBWA 2AEWA 2NY6C 5ADPL 1H0DA 1MCBA 2MKLC 3TT1H 5GRJH 1R24B 5CMAA 3TBTB 4PG2A 1IL1B 3OAYH 4OCRL 4EUPA 1AR1D 4HX1A 5GS0C 3DARA 2E7BA 4QHLB 5J13B 4UU9A 5C07A 1UWEH 1PGRB 1INDL 2CKBH 3GJFA 1J5OL 4U1NA 3CDGA 5E2UL 2VDNH 2W0PA 4LLVB 5B39B 1UA6H 3MCKA 1AD0A 3FN3A 4ZTPH 5C0AE 4YHKL 2NY5L 5GGUA 2RFXA 1PY4A 2A9NL 3PQYD 5HD8C 5ID1B 2WM0A 3P11L 1AY1L 3ABZA 5CEZD 3OF6A 2E7LC 4R7DA