1MHCA

Model of mhc class i h2-m3 with nonapeptide from rat nd1 refined at 2.3 angstroms resolution
Total Genus 68
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
68
sequence length
276
structure length
276
Chain Sequence
GSHSLRYFHTAVSRPGRGEPQYISVGYVDDVQFQRCDSIEEIPRMEPRAPWMEKERPEYWKELKLKVKNIAQSARANLRTLLRYYNQSEGGSHILQWMVSCEVGPDMRLLGAHYQAAYDGSDYITLNEDLSSWTAVDMVSQITKSRLESAGTAEYFRAYVEGECLELLHRFLRNGKEILQRADPPKAHVAHHPRPKGDVTLRCWALGFYPADITLTWQKDEEDLTQDMELVETRPSGDGTFQKWAAVVVPSGEEQRYTCYVHHEGLTEPLALKWRS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Nonclassical binding of formylated peptide in crystal structure of the MHC class Ib molecule H2-M3
pubmed doi rcsb
source organism Mus musculus
molecule tags Histocompatibility antigen/peptide
molecule keywords MHC CLASS I ANTIGEN H2-M3
total genus 68
structure length 276
sequence length 276
chains with identical sequence D
ec nomenclature
pdb deposition date 1995-08-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00129 MHC_I Class I Histocompatibility antigen, domains alpha 1 and 2
A PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1mhcA02
3.30.500.10 Alpha Beta 2-Layer Sandwich Murine Class I Major Histocompatibility Complex, H2-DB; Chain A, domain 1 MHC class I-like antigen recognition-like 1mhcA01
3O3EA 3UZQA 4GBXA 2UUDK 2XTLA 2EC8A 3W0WE 5JORA 4P2YA 3T8XB 5CBAB 3C60B 1CFQB 4KKLD 1S7WB 3U7AA 1KNOB 1NEZB 1KBGH 2AXGA 3G6JE 3VD9A 4F37F 1FFPB 1HHHA 1YPZE 1T1WA 2K7QA 4HXBH 3D1MC 4OI8A 1MIML 1NAKL 1S9WB 4FFWD 4JHAL 3L1OH 1BGXH 1DQQB 5EOQL 3IDGB 3WN5C 1A64A 1DUYA 4ZFGH 4HBCL 3EUUA 1RVFL 4K7PX 4LSUL 3QCVL 4LASH 4U1SA 4PRPD 3DV6B 2X4PB 1F8TH 4LPYA 2E7LE 5DD3L 1BZ7B 1KACB 3B9KC 5ITBH 4Q9CA 4PB0H 4GAFB 4JM4H 1QFWI 2D3VA 5EO9A 4HHAA 4D0CA 3SE9H 5I1AB 2E5EA 2DJSA 4QO1A 4Z7WE 3PABA 4XBEH 4XX1G 1WK0A 4IHOA 5C70A 3ULVH 4Q6IA 4R0LB 2XZQL 4UIKL 5C0FB 2HJLB 1YYMH 2AEPH 4LCYB 1KUMA 3MV9E 3DURB 5E2JA 5F6IC 5GRJL 3RVTD 3HR5A 3QUYB 3C6LB 1IM9B 2FX8H 2F19H 1TQBB 4EKXA 2E7MA 4LHQB 5J9PA 4F15B 1MVFA 5DRWA 3ILQD 1HHJA 5HHOB 4JY6A 2VDKH 2BMKB 2RBLA 5HGGS 1DN0B 1P4LB 4DWHA 4WUKL 1UYWL 3IDMA 2CDFB 3O11A 2VZVA 3L7EA 4CAGA 5JW4N 2AK4D 1A9BA 1QBAA 1UZ8B 1HKFA 1I1RA 3V79C 4NPYB 2ZOKB 4KKLC 1YYML 3QH3B 1KLFA 1TVBB 2VLKE 4IOIA 2R56L 3DV4A 1QD0A 1MCRA 4XWOC 5DURD 2YZ1A 5D7IA 1T6VN 1RZKC 1FFNA 2FEDD 3CD4A 3O0RH 2WP3T 2AV1A 4I0PA 4OF5A 2WLZA 4ZPVA 3QWRA 3RRQA 2NY2D 1A7RL 1IAKA 4RFNC 4M5ZL 2H26B 1G7IA 3QH3A 3CDYA 4YR6A 3TWCH 2NX5D 3CZFB 5T1KA 1CF8L 3FB6B 4L3CA 5IHLB 3N9GL 5D7IB 4XXCC 5I1HH 4UOW1 3RP1A 5SX5K 5FM4A 3PUCA 1NMBH 3MRMB 5E2TL 5FO7B 3K46A 3NAAH 5I1JL 2A6JA 4ENED 3QG7H 3G6JA 4MDJB 2AV7A 3FO1B 3DIFA 3T3MF 1YEKL 2GT9A 4NQDD 1H3WM 4I2XE 4UILL 1XF4A 3FO9B 3GBLA 4M43H 1SMOA 1HZHH 4WDIA 4I48A 1JNLL 3UJIL 1NGWB 2I25N 3MV7D 5GZNC 3SDDB 3IB4A 1DSFL 2R4RH 4YGVB 4KY1H 1AR1D 1NAMB 3TVMA 4NN5B 4HWBL 4PJ9A 3I9GH 4OCMC 3DXAB 2VO5A 3MUGA 4NHUB 4MS8A 3IU4H 3LN9A 2X10A 1IC4L 3IGAB 1K9TA 3VRJA 3BAEH 1ZHBA 2L0DA 3VXPB 5D4QA 1BAFL 1A0QH 2YRPA 5IHUH 1KT2B 4YBHA 1IARB 3AMLA 4ISVA 3S4SG 4C59B 3LSOA 1RJLA 4F58H 2OR8A 3TVMB 3MOAL 4AQ1B 1JGUH 2IANB 2CKNA 3CXHK 5I15H 1FORL 1A6VL 2B1AH 3ZT7A 2ZCHH 3GMLB 3VE0B 3QYCA 4ZS7H 5I8CA 2JCCF 3ZYOA 4ZDHB 3L5XL 1O7VA 1AH1A 4KKBD 1ZHBB 4G6JL 5D71L 1YEDB 4RZCA 4UDUA 4YHKL 1EFXD 1LEIA 4YE4H 4JG1L 4D9QD 2XWTA 3EYQC 1NBZB 1BZ9B 2WINA 4KKAD 3T4YB 3WXWL 5DFWH 5DLML 3BN3B 2Y06H 4XP9H 4Z76A 4UOJA 4QHNA 2NYYC 4FP8L 1ORSA 4ODTL 4M6AA 5AAMA 5JHLL 5J4MA 3QIWA 1U3HB 5GS0H 2ADIA 1P4BL 2X1XR 3TNMA 4JO1H 1OARL 3KPNA 2P5EB 5CWSA 1N4XH 3SE3C 2B5IB 5BS0E 2XWTB 2PXYA 2EO9A 5EZLA 1H3UA 2IF7A 1J11A 5C09E 1V7NL 4LPXA 3MCKB 1J12A 1ZT4A 1WV7T 3QIUA 3O8XD 4K3DL 3QFJE 5KS9E 4KZEL 4QHNB 4XRCB 2JIXA 5CEXA 5JO5B 2H3NA 1AC6A 3IDIA 4G6MH 5CIPH 2XWJA 2CDEA 1DANT 2ADIB 3L9RA 4P2QA 1OAYL 4JKPH 3DO7A 4L5FH 1AR1C 3GSWA 5SWZD 1F5WA 1X44A 5C71A 4OLYL 4JVPA 4OZGF 1T03H 1QRND 3E2HB 5LXGL 1JFQL 3IFPA 3OTTA 4YXLH 1BREA 2V9QA 3D85B 4YC2B 4FQJH 4YDIL 4F7CA 5EC2A 1FPTH 1WBZA 1Y6NR 4E5XB 2YMXH 3EHBD 3QNXB 4LLWA 4P3WA 1PFCA 5I8EB 2X4RA 3K1DA 1KPVA 2OXHA 1YEIL 4DK6A 4X4YA 3S9DB 3MREA 3F7PC 5IBLC 3SN6N 1FVDA 4NJAH 3ZKXB 2D03H 5HGAA 1BVLB 3MRRA 3G6DH 5K9QG 3RZCD 2CRMA 1UA6L 1KF9B 2A83A 4L8SB 2OZ4A 4X7CC 2YD9A 3QWQB 4YGAB 4MJ5B 4JM2A 4LLWB 4MYWB 2VDQL 3RVWD 4KKAC 3AU1B 3BWAB 5E94B 4PRPB 4ZO7A 3QCTH 3Q3GA 2YRLA 2XN9B 3WD5H 4UAOC 1KPRA 4DKEH 2PTVA 5F9OH 4ODUB 2ZJSH 2NX5E 1U8HB 4PJGB 3JTTB 4E42A 5IEKA 5F89A 1LP9B 3VMNA 1U8MA 1J0JA 1OQOA 4JG1H 4CNIB 3MRNA 2MQCA 3PGDB 5CEZL 1ZVSB 5DD3H 3HB3D 2FIKB 1KB9J 4DVBB 4LRNH 2EH8L 3CH8A 3UZVB 5B38A 4NUJA 3UDWA 1LE9A 1JNJA 2EDEA 4MXQA 4DGIL 4PV9A 3DLQR 5DMIL 3GSUA 1DBBL 4FQXC 3VD5A 1FO0B 3VGAC 3DTXB 4M5YH 3TJHC 3VXQB 1PG7W 3G5VA 5DFVC 5IG7A 1I3GH 3DVGA 4DVBA 4YO0A 2A6IA 2KBGA 4JB9L 4RMSA 1YC8A 4X6BA 1L7TL 4L3EA 3V0WH 1X4YA 3X3FH 1N8ZA 2AJYL 2FJFB 3SKNA 2NTFA 4OGYL 1FSKB 4CDHA 5CGYC 1FZKA 1F4XH 3WV0A 3ZDXE 2AABH 1PVHA 2ICES 4LCUB 4U2YA 4ZFFB 4AG4H 3SKUD 5I0DA 1YEJH 3DSFH 5TPWH 1MAKA 3WUWB 1Q9KA 4BUGA 5F1SA 1KN4L 2ENYA 5EWIL 5T3XL 4UT6H 1I7RA 2E27L 2F5BH 1RZIB 1OGAD 4IDJL 4J2XA 1TJHH 1CF8H 2K9UA 2F8VA 4OCNC 5FECB 4PYHA 2P5WE 3ARWA 2UVFA 4N9GA 1DQTA 4PG2A 2O93L 3U46A 4KK8D 5KVFH 1N5AA 4FMKA 3P30H 1J0ZA 4AG4L 4APQD 2YPLE 1HSAB 3H6JA 2YD6A 4KMTL 3WNMA 4M48L 1NKOA 3LEXB 1QLEL 3AS0A 1FVEA 3RDTD 4LSTL 1M71B 4WU7A 3KYOA 4XVSL 2X70A 3MRIA 4LLDB 3VI3F 2AJZA 3FQUA 1U8NA 5DK3A 1JHTA 1FGVH 3HZYA 5GS0D 3ARGB 1NL0L 1R3JB 2N7AA 3HE7C 2B20A 1HOCA 4KUCF 3B83A 3QI9A 4XNMA 1XCTA 4Y5VB 1J05A 5CZXD 3RGVB 3BZEA 3GSOB 4NCC1 5ACZA 3TC9A 4R4ND 3KYOB 4LSRL 2B4CH 2EC9T 3MOBH 3MRIB 4LLDA 2F15A 1KCUH 2JK5B 4WEMB 1CIDA 4OLXL 3ZL4L 4ELKA 5C2BH 1S7TB 1CTOA 1KEML 3MNVB 3W9EA 4OLUL 5FO8B 1R3JA 2XTJD 4LRIA 3ECBB 5DVOA 3BPOC 4IOFC 5GRZA 4KROB 1WAAA 4HJJH 4TULH 1J05B 1QBLL 2ZKHH 3I02B 3CJJA 3CSBA 3RL1A 1NGZB 4BKLA 3UYOD 2YPKA 3BIKA 3L95A 2FL5B 3C09B 3EOBA 4DJMA 4BK5A 4Y5YB 3O2VH 1EO8H 4NZRL 5ESVA 3RNQA 3DETC 5LGKA 5FO8A 1IRAY 3WIFB 5I71C 2W0FA 5C0BA 4JFYB 4ZUUB 1JWSA 5E00A 1INDH 1FG9C 1QSEE 3VFWA 1C5DA 2IMMA 2XN9E 3ILPB 3C8HA 3QB7C 1AQKL 3UYPA 3FONA 1OB1B 1YY8B 4HMEA 4BSJA 2QSCH 2EE6A 4MQXD 1TMCB 3T2NL 4IDLA 3OKEB 2FEEL 4X7DC 2DQFB 1BBDL 2FGWL 1IBGH 2W0FB 4KUZH 5EBMB 5EO1B 4Z7VF 3VGDA 1MWAA 2R4RL 4LF3B 3PP3K 5F6IB 3STLA 3W5MA 2XYCA 1CI5A 3V52L 1K5NB 2VB5A 3DRTA 4PJCA 1MRFL 4PRHD 5CKAA 4P3DB 1BVZA 4P4KC 5I1GL 2MJWA 5IVXF 2YEZB 4ZODA 4GLRI 5F7NC 5K33A 2VXVL 4M7JL 2Z0BA 5F88A 3RU8L 3OJVC 4WI3A 4YHNA 5D7LE 1KJ2B 2UUDH 4JPKL 3RVVC 2DAVA 3QPXL 2QKIB 5IQ9B 4OD3H 3S37X 4IEFB 4QXWA 5D7LD 2NTSP 1U3HC 4M7KL 2IH3A 4R97B 3O4OC 3GMQA 3HUJE 3U0TB 1QHPA 2VDPL 4N0YL 4LARH 1T22A 4ZOEA 1SM3H 3STZA 4AT6B 1UJ3A 3L6FB 5GJTL 3VG9C 4J3WA 3CX5K 4PRBA 3ARYA 2G5BB 2R9HD 1X5ZA 4MX7A 4LVHC 1D5ZA 1HHKA 3QHFH 1CFNB 1FORH 2DKSA 3HMXL 2VL5A 3HS0A 4Y4KD 1B0WA 2Z4QB 4GG6A 4NJAL 4K3EH 4MAYD 5JPNA 5I66B 2EIEA 4NIKB 1AI1H 4TNWK 2IH3B 1S9XA 3DX8B 3GMQB 5EC1B 2EE9A 5DJXB 4HUVA 4NC1C 3HCVB 4BZ1H 1DUZA 1MCNA 4NM8H 4ZUWA 3W5NA 1UJ3B 1VEOA 4N5ED 4JZJA 4EN3C 1BZQK 4PRBB 4ORGA 1FNEA 4O51A 5L0QB 2DQIL 3C8KB 4G80B 5F7WC 4TQEH 4WI8A 3RWDA 1JRHH 2COQA 5AYUH 4Z0XB 4TUKL 3D2UB 4EJ1C 5I73B 5L8LB 3BKYL 3DX8A 3WFCL 2XNAA 4M1DH 1AXIB 4HUVB 1YMMD 4M8VA 3PWUA 3TBTA 3FO2A 4PRDB 2Q7YA 3BP6B 1FNEB 2C4XA 1EGJL 4O51B 5BJTB 4OV5B 3FQXA 4HQQH 1A14H 5DC4B 3DGGA 1EPFA 5EZJB 1QFPA 3T0EB 5FF6B 1B6UA 2O61A 3S35H 3MTRA 3IXTA 3HNSL 3BAEL 1HINH 4NWUH 3V5DA 4PJHB 2EIZB 2XTJE 4GW4A 4U1IA 1FFRA 5DR5H 4C83B 4S1RL 3F5WA 3NABL 4M1DL 1I9RL 3NPZB 4Y16B 4PJIA 4LQFH 1N3NB 2Z92A 2BNQD 1FZMA 3WNOA 4HG4J 2EIZA 4FQXD 3OKNA 2D03L 3RVUC 1VFBB 1JZ6A 4FQLH 5HYFA 1VEMA 4GG8A 4F3FB 3NCJL 1VA9A 1II4E 4KTYA 3PHQA 4KKNA 5C6TL 1Q8MA 2HT3C 1OCWH 3VXSD 1NDMB 2JJUA 3D0LA 3PL6A 1ZGLB 1HIMH 2DF3A 4NSKA 4WWKD 1MFCH 2BOBA 2DKUA 1TVHA 4LPCA 3RTQA 3K74B 3LIZH 2DOCA 4F57L 4JDZA 3K2UL 2BNRD 2X4UB 1J1OL 5LCVH 5BMFH 3GIVB 5FYKE 1C5CL 5HGHB 1LMKA 2BNUA 4M62H 1H15A 2RFXB 4OB5H 5H35B 1FL6A 1OTUD 3D0VB 4WUKH 5DUMH 5F1KC 1B9ZA 1I4FA 3QZWA 2GTZA 4HKJB 5JQ6H 5MEQA 4R90H 2WBJA 5HHMD 1R3KA 2NY3C 1HZHL 2OTUB 2ZUYA 5DRXB 3GB7B 5I2IB 2DQEL 4K71B 1U6AL 4PJ5E 5HGHA 3F6IA 5L2JB 3QHZL 1VENA 5IKCA 3KPQB 5HY9B 3VXUA 1K2DA 1P5VA 3SE8L 3U9UA 1U2CA 4LCIH 3S5LG 3LS4H 4WFGD 1TNNA 1AC0A 2FR4B 5MEQB 4BQ8A 1A9EA 2DWEB 5D5MB 2V2XA 5GSRA 3DNKA 3EOYG 3S36L 4F33A 2BDNL 1A5FL 2H2SD 2PO6D 2LV4A 3SEPA 1C08B 4S1DD 3MLYH 4B41A 4ESKA 5DDHA 5IVXA 1KEGL 3QFJD 3MUZ1 1A47A 4OZFH 1CGXA 5ICYA 3S5LA 5C09D 1CE1H 4NWTL 2EDBA 1EERB 5CJQH 5BVJA 2EO1A 2X2YA 3MNZB 5DO2C 2FJHA 5TDPA 1XMWA 1V3MA 4M93C 1CICC 4I0KA 4MJ4A 4PY8J 4JQXA 1MOEA 3L3KA 5DUPL 3F12B 5IFJA 4LLUA 4MAYA 1B3JA 4KKCD 2F19L 5CSBA 1IGIL 1T0PB 5SWZB 1S9KC 4PJ8A 1CWVA 3N1GC 4GG6F 5DK2A 5CSGA 4NZUH 4Q58C 4NYLB 5B3NA 2RHEA 2X41A 5IWLA 3BMVA 4LLVA 5TDOA 4TSCL 3P77B 1U2HA 2Y6SC 4RMTA 3OBAA 1CLCA 5J6HA 2Z8SA 4KWUA 2DI8A 2V5SA 3ULSA 5F97E 5HJ3B 3K2MC 5MP6H 5C6WH 3FOLA 4O02H 3U36B 3QEUB 1KULA 4OB5L 4HIHA 3QUML 3QNZA 2O5XL 4G8GA 2B1AL 1Z9OA 3FHAA 3RWHA 4ZS6D 2QADD 3F7QA 4N8PA 2KL6A 4LKXA 2QLVB 3B8YA 2DJ4A 5I18H 4JHAH 2UZXB 1TTFA 2V2TB 5SWSE 5C09B 4QTIH 4N5EC 1Q94A 4M5ZH 5JR1L 1ZGLP 4XNQB 4K8RL 2EEAA 3PHOA 1ZA6A 1QFWL 4JREC 4S1DC 4XCYA 1N5YL 4MJIE 3MBEC 4LVNC 2HFFB 5C3LD 3QIUB 1CICB 3BGMA 3KPOA 1OAQL 2D9QB 2HRLA 1JYVA 3LHPL 4GKSB 3IDUA 3MGOB 3MFGB 1L9MA 3LS5L 5C0BD 3WXVH 4MAUH 3K81A 2DQDL 2WMPA 4OFYA 5BS0D 1YEHH 2Z35A 4DQOH 3QI9C 4K7FA 4UV4L 2ED9A 3BJLA 1BD2E 5JPMA 1BBDH 3LQAC 3TYGL 5E56A 2X89D 4F7CB 2HMID 5EC2B 3T04D 3K80A 1QSEB 3B5TA 3NTCL 4RSVA 5KVGH 3OKKB 3P9MB 2ESVB 1CL7L 4JQIL 5TF0A 4RGNC 3REVB 1P2CA 5I8EA 3BRDA 1DQJA 3PQYD 5IROA 1JTTA 3RHWK 4MNGE 4MXVF 4PJ8D 1JRHL 1FVDB 3H0TB 1OSPH 3F7VB 5GISL 4BQ6A 4OJFL 2FYYA 3N9GH 3G9AB 1NJ9B 1G6RH 3ZT5A 2KPNA 4G5ZL 1ZK9A 2Z91B 5KBNC 4FHBD 4OD1L 4HS8H 4QXGL 4X5XA 4H1LA 2GTWB 1JF1B 1TQCB 4EVNA 4AY0A 1FCGA 2NXZB 3MV01 2HVKA 3OR7A 5DD1H 5C8JA 5F89B 1LEGA 1I85C 5F9AC 4GKNB 4KRLB 2PCPB 4S10A 4APQA 1UH3A 4FQXB 1G0XA 5CKGA 3SDAC 3QCTL 3WE6A 5D7IE 6CGTA 3ZKND 1QBML 1MH5B 2YPVL 5I1IH 4KC3B 3T65B 5E70A 4PP1D 4ZUSB 5L2KA 4Y88A 3AC0A 4EBQL 3UBXI 5L8JB 2JB5L 4ZOBA 5CJ5A 5SWSA 4LNRB 1W0YT 3E8UH 4ONHB 4HK0B 1SJHA 3VXUD 4NQDE 2XA3A 3GIZH 2X89A 5HDLA 2XACC 4PRAA 2J5LB 4U1NA 3NIDE 4HCRH 3B9KD 4KMTH 5KG9A 3WFHB 3QUXD 2CKBB 1JJUA 3WL9B 4UBDC 5FYLH 1F2XK 5KVFL 2P24B 3ARSA 2PXYC 2SEBB 4JFDB 4GAJH 1H3TA 3DMMC 2XA8L 2HA1A 4HAFA 5F7UA 1MRFH 3CSYA 1CG9A 4YLQT 3ROOB 4R4FH 4KJQD 32C2B 4YDLC 4P57B 3CU7A 5EU5A 3RTQD 1OSPL 3KPSA 1RUKL 1A6UL 2VAJA 1D6EB 2XQBH 3L3GA 4J7RA 3C60A 1GPOH 3WKMH 4Q9QL 1AXSA 1F4HA 2VERN 5AWNL 3VXSA 1LK3L 4LVHB 4ZTPH 8FABB 1WLHA 3WIHA 4YIQA 5C0CE 4KI5D 4RMUA 3WKNA 4TULL 4YHLH 4G8GD 1T83A 3GMOB 3A6CH 4HK3N 3S37L 2PYFA 5A3IC 1AO7A 3BSZL 2Z31B 1EJOH 3C08L 1NMBL 5E2TH 3VDAA 4CVXA 3VWKB 3WUWG 4CU8A 1VB9A 1CT8A 1QBLH 4K3GA 4M02A 4WU7B 1IEAB 3M8OL 3MUHL 4MWFA 1MPAL 3A67H 1ZLUH 2BSTB 2LAAA 1DL7H 5TQ2L 4F15C 4KQ3L 15C8H 4FMFA 1H8NA 1IT9L 4UOW0 2C1OB 3F58H 3QI9B 1EJ6A 1EBAA 3ZDZE 2LABA 4RGOL 4CVXB 1MCWM 3SOBH 5D72H 5IHBA 1CBVL 1CTNA 1AD0B 1D5XB 4OIBA 1H8OA 1U92A 5E8DL 4R8WL 2HJLA 5EO0B 2BSTA 4O2CA 3SCMA 3ALPA 4XHJD 5SWQA 3ZDYF 1VHPA 4Y4FC 2YUZA 5F1NA 5IV2A 5CJXC 1KLUB 3RGHA 4FQJL 5DRWB 4OF6A 4X6DB 1U8KB 4XCEA 1J1PL 3NCEB 3CC5B 3QFJA 5KS9A 4OLZH 1U92B 2I9TB 3L7EB 3I50H 2AI0L 2LAGB 1KCVH 2NYYD 1VSCA 2BZDA 4HG4K 2EYSB 1ACYH 1PYWA 3GSQA 2VISA 3QUYD 3MLZH 3P0YL 1FN4B 4NKMA 1G1YA 1XF5B 1YN7B 2DLFH 5JUEH 4ZTOH 3BGFC 1TZIA 4PS4L 1XGUA 1GZPA 2YR3A 2CIKB 3LAFA 5IW6A 2NY7L 1XGTA 4PGDA 1K4DB 2J8UA 5EBGA 3RPKA 5GS0L 4GT7A 5JXED 1M7XA 5AYQA 1EAPB 4Y2DD 1N59A 3O2DL 4BFEA 3CZFA 4NKMB 3IAGC 1C5BH 3WJJC 3EDKA 3PWPA 3MX0A 1XGUB 4PJCE 2DBJA 3WIIH 3KLSA 3S6CA 3T3ME 4LPTA 4NDMA 5T5NG 2J8UB 1F4XL 3O6LL 4HS6A 4PRHA 5FA3A 2NZ9C 2VTFA 3GJEA 1V3JA 2AEIT 3RFZC 3JTCA 2VAAA 2ZCHL 4CL7A 4RGOH 1G6RA 3CLEH 1LK2A 1IGCH 1AO7E 1JTPA 2H32A 3VMOA 4KXZI 3B8SA 4Y1AA 1DP0A 4I18A 3VJ6A 4M6NL 5E8EB 5EZIH 5BVPL 3HE7D 1FAIH 4DEPB 2JELL 4L29B 4XC1H 1AGBB 1CFVL 2VR9A 1NCUA 3MJ7B 3MRKA 2Z4QA 4JQVA 4GG6B 3VMPA 4KK6D 1DQML 5EU4A 4YXHH 1GRWA 4HLZG 3KDMA 5JXAL 3C60D 3RWIB 4RAUB 4PP1C 3LN4B 3OJMB 5ESAA 4F9PA 1VADB 4H26A 4OCLC 2BNQA 5E8PB 5AZEL 4WHTB 4ZUVB 4M7ZB 4RWYH 3VH8B 4POYA 1XF1A 3HLAB 2VR4A 3MJ7A 4U0RB 3MRKB 2QV2A 3VE0A 3JXAA 2HN7B 4PJXB 3CVIH 3DUUA 4F7TB 4AH2B 3GRWL 3VXNB 3TIEA 4YPGB 1CQKA 4UDUB 2I60L 1FRGL 5ESAB 2VDNH 4X98B 5E4EC 2VWEE 1CLOL 4ZUVA 4OT1H 2GY5A 3K8MA 1OP9A 3JWOH 4LFHG 5DK0A 4L8DB 5HVWA 3FQXB 2DJUA 3MXWH 4MQ7B 4UTBH 3O6FD 3MRHB 4Z78B 3B9KA 1G0DA 5IBLD 4Z76B 1DQLH 2EDWA 2DIBA 2AEQH 3I2CH 3FQWB 3IVKA 3TJHA 4E0RA 2VLJB 4XNXL 5HHNA 1DVFA 2FBOJ 4CVZA 2EYTB 3V5DB 3O9WC 2YSSB 2GITB 1CE1L 4NWTH 3U7YL 3F5WB 1I8LA 1NUFA 2IPTL 4X6EB 4WW2C 3B9KB 2WWMD 4DGVL 2EXYC 1NFIB 2WUBL 3FQWA 5JO5A 3MLSL 4N5EA 3ETBF 4D8PB 5FKAB 2EKSA 2XWJB 2EXWD 3UX9B 1GIGL 5CAYB 1U6AH 4NQUA 5T1LB 3QPXH 2CXKA 2ZUVA 2J88L 4GG8B 3NFNA 4LLMA 3L3DB 2AJVH 3DARA 1RUQH 4NQTA 2MKLC 1MI5B 1P7KB 1J1XH 1M7IB 1RJZA 1BQHG 4I3RH 1G7MB 3IFPB 2K1MA 4UI2A 3OKMA 1CN4A 2VLRE 1MY5A 5ICXA 4V1DA 5C0IA 5DHXB 4O2FA 4WUUE 3UTTE 2B1HH 3HB3C 5KSUA 2NW3B 3PXJA 4ZQKB 4QXUH 1NH6A 1N64H 3FZUD 5HI4C 4LNVA 5D6CA 2BXYA 1ZHNA 3QEHA 3DX9B 4ZFZA 1RMFL 1BQHA 3QISA 5I9QB 3LDBC 3QDGA 1L9NA 4O2FB 2ZUUA 1WAAE 1WWCA 1DCLA 3OL2A 2VABB 3O3BB 3MRGB 2ZZUT 4ZMAT 3GJFB 3LD8B 1HCFX 3BWAA 3VI3E 4MZ2A 1FYHB 3MXWL 4WHCA 5BV7L 1KFAH 1MEXL 1ZV5A 1E4KC 4ZNCD 3GGWA 4OFYD 5BS0A 2BVTA 4JPKH 4OZGB 3ALWA 1U8MB 1QACA 5JQ6L 4I5BB 1GYAA 5IB2B 1X9QA 5ANMB 3QO0B 4OFDA 4YXKL 2HTLC 3VWJA 1A9EB 5MEND 5D5MA 1NC4B 2ITCB 1CGTA 5BCAA 4WV1A 4DZ8A 1JNHB 5CHNA 4QXTA 3RWCB 3DYOA 2OX5A 3TV3H 1NANI 4GQ9L 2L7JA 3CXHJ 3LN5B 2J8UF 1KJVA 1F11A 3BPNB 1QQDB 1BFVL 2EDKA 2JTDA 3ULUF 2YS4A 5I6XC 1Z3GH 2FJFA 5HHXL 4LKCB 5D1QA 4DZ8B 4QXTB 4YX2H 4MNQD 5E08L 2VQ1B 4JM2D 3NIFE 3SKMA 5AYUL 1EVUA 2H2PC 5CEYB 2UY7A 2OLDA 1HHIA 2C3XA 1JVKA 5TE6H 4HGKC 3FQRA 2B39A 4LSUH 1XIWA 3TZVA 4ZFFA 5DJ0B 1KPUA 5GGQL 1OVZA 3EDDA 3ERYA 1HQ4A 2HT4C 5INDB 1EIBA 1DLHB 3BKYH 4XVSH 5J6GA 2Q7NA 4MA7H 1EAJA 5DI8A 1HHIB 4XBGB 3FT4A 5MI0B 2N1KA 3FQRB 1SY6H 1KENH 4ZUTA 1PG7X 1IC5L 3GKZA 2R4SL 15C8L 2BFVH 4ETQB 2ADFH 1R24B 1I7UB 4K71C 4OZFA 1I9RH 4N9GB 1NEZG 1WIUA 3IU3B 3TH4T 3IDNA 1MHEB 2I07A 3QNZB 3T1WA 4PUBH 5DI8B 5FEBA 5FM5O 2FH6A 3FT4B 1HSAA 4LKXB 3W11C 2YN5A 4YFEA 1J18A 4G8FB 2HTLD 1KC5L 4QRPA 3W9DB 3I6KA 4PP2B 1X5AA 3GMMB 4J3VA 4PV8A 5C09A 3BGAA 3BZ4A 5C0AE 1ONQA 4ZYKA 3FFDA 4P0DA 2F8OA 2NNAA 4QRPD 4P4RB 1MJ8H 4NO0B 3IDNB 3KYAA 4UV7L 5E7BA 2D7OA 1B0RB 3F7RA 5JLZB 1NGQH 3NOIA 1OGAE 1OD7A 1I9IL 3E3QA 1CDIA 4TPRH 1CICA 2BHUA 2IANE 2JELH 3EJZD 2Q76A 4FN0A 4U6YB 5E5RB 2QQQA 4G8EA 4L9LC 4U1MB 4F7PB 2FBJL 4P23B 3SDYH 1HIML 3VXRB 3K8LA 5F96H 4ODXB 5DJYA 4KXZH 5GGSB 3D3VE 2BCKA 1I1FA 4NQXB 4DUXA 4KHTL 3FAXA 1NGYB 5KJRL 5TE6L 5JW3H 1QLFB 4IS6B 1F8TL 3QJHB 3PP4H 4U1MA 1KTRL 2DD8H 1ZWIB 4YX2L 4XCFH 4JRXD 2FL5A 1FYTD 4NGHL 3VXRA 4Y5YA 5FB8A 4WW2F 5EIIB 4N0FA 4W4OA 4MXQD 1DEEA 3BYYA 4JPWH 2MCPH 3CK0L 3CFCL 3FQNB 4KJYA 4QNPF 5DHYB 3OPZH 4MNQA 4YWGL 3EFFA 3QJHA 4QHUA 4LOUD 4WNQB 1LE5B 1MCJA 2OI9B 4IRJC 3VFNB 2AP2A 1BP3B 2JB5H 4N0UB 4Y1AD 3C08H 1H3PL 5FA4A 4TOYL 4MCYB 1YEKH 4G9FD 4N0FB 4LLQA 1G7PA 4DZBA 3HPLB 5E9DD 4PJEA 1F4YL 2Y6SD 1U41A 4Z7NF 1ZTXL 4GFTB 4KJQC 4EOWH 3JUYA 3L5JA 4UAOB 5CP7A 5FYLD 5ILTL 3RY4A 1ZHLA 1ZA3A 2R0KH 5CILH 3CFBA 4FQXA 5D1XA 2R0LH 2ATKA 1HYSD 4K7PL 3A6BH 1A6UH 4QRTA 3WDJA 4Y19B 5ACMA 3BPNC 4JAMB 4HWEL 2NW2B 2ZNXA 3HC3H 3T2NH 3EJZC 4IRSA 3VXMD 3TF7C 2M2DA 4ZOCA 3IKKA 3JBG7 3QDJA 4OAWA 4FQLL 1ZHLB 2H45A 1JNNH 5IQ9A 3CFBB 5SWSB 2O5ZL 2P8PA 5CEZD 3SDCD 1JF5A 3SGDI 4EOWL 1FBIL 3JWDL 5FUZL 3FCTB 1D5MA 4K23H 3ARDC 1E28B 1KIRA 4FQQA 3NMEA 1QLEH 4GKOA 4OZGE 1SJEB 3KS0J 5IT2L 4GMSL 4EI6A 2OSLB 4L4TD 3HS0B 3ZKMC 1QRKA 3S34H 1UKSA 4NNYB 4HIXH 2SEBA 4JFDA 4WEBL 5IB1B 3GUTA 2C1PB 1P4BH 3MLZL 5IOPA 3M8OH 4PP8C 3E6HA 4OM1L 3LRSA 1XCQB 1U8IB 4S11A 1DUZB 4JRYB 4L1HA 5EIQA 4WY7H 5BV7C 1MHHB 2AK4A 3CH1A 1FL3A 1MCCA 2BVPB 3OJDA 2Y4SA 4P57A 2RGSA 4JJ5B 3BQUC 4N8VA 3WIHH 4LSQH 3VFVA 2I26N 4JHZA 5LGHH 3SCMD 1S7RA 1YEJL 3DSFL 1XCQA 1UWGL 3JV4B 4JRYA 5CJBA 5F7EL 5GGSY 4WUUB 2GJJA 4YDKL 3OJDB 5B4MC 3QEQD 5J13C 2P1YA 1Q72H 1IEHA 4R2GC 2OBGA 1R5IA 2XQBL 5B8CA 4OLEA 1QVOA 5E2UL 2DDQL 3T0EA 4QXGH 5JORB 2UWEE 4FZ8H 4OQTL 2VXSH 5C0CB 2PYFB 1BAFH 2ZSVB 3GHBH 4L4VA 1OD9A 2MQ3A 1E27A 5GGTA 1SMAA 1S7WA 2BDNH 4QWWC 2HG5B 1Q38A 1BGXL 5D7LA 5EOQH 4BK4A 1DVFD 2FZ3B 1SVZA 3AREA 1D9KB 2APTA 1BJ1J 1OAUL 3WS6A 1BJMA 1G7LB 3KPLB 1N3NA 3MODH 2Z92B 1S9WA 1IEBB 1FZMB 2NXYB 5FO9A 5FV2A 4NKOB 5KVGL 4N1HB 1JPSL 1HHGB 3HMWL 3CFJB 2Y1VA 1RZJH 3VGHA 1GJIA 2DQJH 3GMNA 5DJ2B 1I75A 4OUUA 4HZAA 3RPIB 3QPQD 1JK8A 2C26A 5A16B 5HSFA 3ARGC 1IEBA 4O2CB 3SCMB 5SWQB 2CJUH 3MV7A 1SYSB 1KCUL 4L9DA 3KLHD 2AERT 3P2TA 2NR6D 4TVPD 1IGJA 2XZAH 4OZ4A 1GOGA 4JDZB 2QADC 2A73B 5CLWA 5EULV 1M7DA 3ARRA 1FFOA 3QXUA 5DJAB 5I17A 4K55A 2BNUB 2X42A 4LSVH 4HDIB 3JTSA 5H35A 4QF1B 4PGCA 2Q1EA 2BSSB 4PB9H 4PJ7F 4S2SA 5FK9A 5HDBF 5HHOA 1FN4A 1G9MH 2XZCL 4MCZA 3AY4C 1KLGB 4L4JA 3VXTB 3GDBA 4PJ7B 2G75B 1RUAL 1TZIB 3I6LE 4OGAD 5F7KC 1XF2B 1WCBB 1ITBB 3QWRD 4HCRA 1SYVA 1DANU 4YBQD 1EO8L 4NZRH 2ZOKA 1XGTB 4UV7H 5HPOA 3ULUE 3FB8B 4JFED 2DQTH 4JFZL 4Z7WA 5JUEL 3MROA 4TYUA 5F9WC 4Y16C 4JFPA 2DL9A 3EW3B 1GC1H 5GZND 5KN5A 3QI9D 4WO4D 1ZLSH 2CXGA 4CMHB 4HFUH 4NDMB 5D6DA 3MJ8B 2OK0L 1XZ0A 4NBZB 3LV3A 3UTZA 1XGYL 4EDXA 3ULUD 1UM6H 3LMJH 5DVMA 3LH2H 5DVKA 2XZQH 4WU5A 5CUSH 4Y8DC 1CXKA 1WFUA 1UZ6E 5DA4A 2VE6B 3OAYK 1I1AC 3RDTA 1FL5B 2F54D 4KHXH 4OIIL 1SY6L 2AAVA 3QRGL 2AK4E 3CUPA 5DJCA 4E41E 4PJGF 2PYEE 1O0VA 3GSNA 3LKSB 1XZ0B 3P3YA 4P3CH 3EO1B 5IVZA 4YQXL 4HLZH 3F12A 4MJIA 3UJJH 4ALAH 3U7YH 2KH2B 5LBSH 2HJKB 4PJ8B 2CRYA 2EDQA 5DJCB 3RWIA 2XPGB 3TO2A 4XCNB 3EO0A 5CUSL 5HD8C 1NLBL 2EYRB 3GFUA 3U4EB 5E9DB 5I18L 5F9JA 1RIVL 4LGPB 3FKUS 3BKJL 3OAZH 3QRGH 4LLAA 5HHME 3V6ZA 2YD5A 3P77A 3L7FB 4MJIB 2KZ1B 4NBXB 5ID1A 4TSBH 3HE6C 1BJ1H 3NIGE 1MLCB 3TM6A 4HBQA 2PN5A 3GMRB 5HJ3A 4BH7B 5KTEH 3VXPA 5KS9F 3TIEB 3P11L 1JGEB 1G9NC 2P8MB 4G42B 3O6KH 3TIDA 4E41D 3QEUA 5E03A 4EN3B 3TT1L 2VJXA 5CMAA 2VZTA 4DCQB 3T1FB 3GMPB 3MRHA 4KK9D 5D71H 1YEDA 5H37G 4RZCB 4LIQH 5DEGA 1L7IH 4KDTC 4NRYB 4JZJC 4EN3A 4POUB 3QCVH 4LASL 3TN0B 5GGUB 1A6ZA 3MXVL 1N2RB 4NUGL 5KJRH 1MVUA 3OAYH 1D6VL 1T04B 3L3OA 5J1TC 3K8KA 3HNVL 4WI5A 1I1CA 4XMPH 1H5BC 1DBMH 3S96A 5DS8B 3S4SB 3SJVB 2QQLH 4N90E 4PREB 2B0SL 2IC2A 4LCCA 4JHWL 1MJ7H 4H0HB 3NFNB 4LLMB 1PQZA 4X6CF 3OGCB 5D2NC 1UG9A 1A0QL 5IHUL 1XH3B 1OF2A 1U8JA 3T0VA 4LPUA 1KXVC 1GGUA 1AGCB 3L9RB 4PGJA 1EZVX 2VLRB 1KXQE 4QOKA 3VCLB 4P2QB 5D2LF 4P5KB 3BRFA 4P9ML 2B4CC 3GSWB 4I0PC 4LCCB 4WEUD 4OLVL 2ICWB 2BHZA 3L3IB 4DN3L 5C08B 4R7DA 2X4OA 5IUSA 3LY6A 3F7VA 1XH3A 2CPCA 3DXAE 4JFHE 3D85A 1N6UA 4LDOB 1DE4B 3MPCA 4QOKB 4DN4H 3N85L 1PX4A 3O3DA 3TLRA 3O6KL 3TFKC 3AXLA 4OFVA 1MNUL 2XKNA 4ODTH 4R7DB 4JFFA 3IJYB 3JWOC 4J6RL 3P9LB 4K23L 4DTGL 4KI5F 3D39A 4CRPA 3QQ9C 2BERA 2XY2A 3PQYB 3HRZA 1LEGB 1JNNL 1EHAA 3DMMB 3HI1A 4W68A 3MRQA 4OJFH 1UH4A 3O6LH 2D0HA 3WE6B 2XKNB 3MA7B 1M05A 3WO3B 3VXOB 1OAZH 1AKJB 4YDVB 4K3EL 1UCTA 3T65A 3V8CA 1EHLL 1R3IL 4NM4L 1IGCL 1MRDH 4ODUA 2CLZA 1QFUL 3VXSE 1NDGB 4PBXA 3BHBB 4MA3A 1RZFL 3SBWA 1OM3H 2NZIA 25C8H 5DMKB 1IGYA 4DTGH 2OTPA 2X4QA 4XVTH 2A6KA 2WV3A 1NUNB 2FIKA 3B9EA 4LEXL 3TT3H 1C1EH 1M05B 1NQBA 1YNTA 2VLKB 4TVPL 2IADA 2GJZA 1LE9B 1QSFA 4LKCA 2CLZB 5D1QB 3IJSA 2CKBA 4M9OA 2DIAA 3I6LD 3AFLA 4TRPH 1DEDA 5AZEH 4QOKD 1KXTB 2ILLA 4LPVA 1MCWW 4JGJA 3K4ZA 5ISZE 3KLHC 2GSIA 1CG9B 4KPHH 4WFFD 3RX7A 1ADQL 1X5XA 4OFPA 1ZANH 1YDPB 1B6DA 3CSGA 4YHMH 1NEUA 1H3PH 3QT2A 1EHXA 4QRRE 2OQJA 3ULUC 3GEWB 4DGYL 4Y2DC 1KB5H 3S37H 2OP4H 3O2WL 4JRWA 1JHLL 4UMGA 1AGEB 1ZLVH 3M1BB 4PB0L 1F4WH 3WDIA 2IMNA 2Y5TB 2Q6WB 2PR4H 43CAB 5HI3D 1GGCH 1FNSL 2RIKA 4MQXC 1F6AA 5DQ9B 1NFDB 2XN9D 3F58L 4LCUA 5KAQF 2Y5EA 3BH9B 2QADB 1WZ1H 4R8WH 4LSSL 3IU3A 4PJ9D 1IQDB 3IETA 4NO2B 5IW1B 4P59H 5T3ZH 4LBEB 4ODVL 5CEZE 2MPAH 3CLFL 1KIQB 4JO4H 4KVCH 2H8PB 2RJMA 3KJ6H 5KSVB 4U6VH 5EU6D 3TESA 4Q9RH 1FNHA 5ECJE 4NOFA 1BOYA 3X11B 2DI9A 1IEAA 1QPPA 1D7FA 3U46B 4P4RA 4HUXA 4LSPH 4G8IB 4NQSA 1KBGL 3QAZC 1CFSA 1IGTB 1SEQL 1WC7B 3WMSA 4MLSA 2YK1H 1T5XB 1AY1H 4JZNA 2E9WA 5EORL 4JVUA 4U1SB 4KRPC 1ZS8B 1RFDL 1CGUA 5JIHA 2ZWLT 3RY5A 2A9NH 2XY1A 4G8EB 1C1EL 1T4KB 1YMMA 3ARED 3C2SA 4GXUN 2V9RA 2J88H 1J0YA 5DVNA 4X9FA 3HFMH 4DVRH 2OR9L 2ESVE 1EEUA 4FQ1H 1TTGA 1CFSB 1IGTA 4GMTH 3STBA 4JFXB 3BEVB 4MJID 3FB5B 3OR6B 3WDHA 3ARFC 3QWOA 2FEDC 1OSZB 2BRRH 2P5ED 4N8CL 4FFVC 1U3JA 3T0XA 1ITCA 3JWDC 5FB8B 5I30L 2NY5H 2V7NA 4HUMB 1BLNA 1GXEA 4KQ4H 4P46A 4LHUA 4BFBD 4DW2H 4MNQB 5GGRY 4PR5A 1F00I 3BMWA 5E2UH 2GFBA 5HHQB 1NGPH 1FO0L 2FECI 4OGXL 4XC3L 2WBWB 3VG0L 5F70A 4QHUB 3WSQL 2JCCE 1NGZA 1DBAL 3VFNA 1TZHA 2MKWA 1LO3L 2UYLB 3OMZA 4XPGH 3EOBB 1GZPB 2Q20A 3UJTH 2PW2B 3MV8E 1I1AA 3IJHA 5E4IA 4NPYA 3MCG1 2IBZY 4PGDB 3VGBA 3IDXH 1X5FA 4FZEH 1KTDB 1UYWH 3WJJA 2C9AA 5C6PB 2BJML 3DVNA 3DWTA 1ZA3B 3U2SA 4ELME 1IL1A 3MLXL 3U7WH 2BVUA 1TMCA 3GI9L 1C5CH 5E8OB 43C9B 4OM1H 1WWAX 4LSPL 1JL8A 1OTSD 5ADOH 5EBMA 2HT2C 4GXVH 5JDSA 5B4MD 2NQCA 2AJ3A 4JVWA 4HUWA 5J06A 3BO8A 2VAAB 3ISWA 1A6TB 1C12B 1KEMH 3C5ZC 3RU8H 2WBJD 4F7EB 5FYLE 3DRQA 4HGWB 3FCTA 4HWUA 1U8OA 3J8F7 1A6WL 2E7LC 2R2BB 1PKQA 5JDSB 1SHMA 1MFEH 3UBXA 3MLWL 2AJYH 2B2XL 5T1MB 4CVUA 5C0EB 3D87B 4NT6A 1KJ2A 3BP4B 1G7QB 4WCYH 1E6OL 3CFKA 3VFPB 4I48B 1H0DB 5K9OA 2O5XH 3KDMB 4X5WB 1G7JB 3D6GA 3KLAA 1F45A 1QZ1A 1AE6L 2ID5A 3LRSB 1U8OB 3KXFD 1U8IA 3KPSE 4KY1L 5HYSB 3PXHA 4QHLB 1EUTA 3ULVF 1PKQB 2X7LB 4HPOH 2G5BA 1FL3B 3UBXB 1JZ4A 2EXYD 4XAKD 2XWBB 4NFCA 3OAUL 1MCOH 3RVWC 1RU9H 2HN7A 1G7QA 2JKXA 5E5UB 3ZKNC 4HWBH 3PWJA 1NLDL 5HGDA 5EC1A 3HZMB 1BQLH 3JV4A 3ZSSA 3RUGB 3ZE1E 1K8IB 2E27H 1F4AA 5DK0B 5DFTA 1FNLA 4N5UA 4JKPL 2XWBA 5HI4D 2IJ0C 1CXFA 1S8DA 2OL3L 4DK3A 5CD5C 3VH8G 4ZDHA 3TYGH 1R3LA 3NA9L 3CFDB 1Z9LA 4EI5B 1D3CA 5KVEH 5A2IH 1S5IL 3LQZA 1YEHL 1ZXQA 5HYQB 4S1SH 3RUGA 1GZQA 1QO3A 3V4VL 5C9KA 1NC2A 1JZ7A 5CJQL 1UZ6F 1RZ7H 1F97A 4XWGL 4LHUD 1L0YA 3VWKC 4PJEF 4XBPA 4FRWA 3BP7B 1D9KA 3MYZA 2ZG2A 2D7QA 5FKPA 2NMSA 5LAXB 1VFAA 1YEIH 1CFTB 4TTGA 1RZFH 4HJ0C 1YY9C 2IH1B 1JFMA 2CR6A 5HDQH 1RUML 4EZMA 4PJHA 3K0WA 4Y4FA 3CXDH 1HHGA 1MAJA 1PZ5B 2HWZH 2F8XC 2EICA 4XBPB 5EU3A 5E2WL 3SKJH 4AM0B 5J7CC 1VGEL 5CIPA 1QYGH 1GGIH 1GHFH 1JWMA 5GSVB 5HYJB 2CGRH 1CFTA 2EEBA 5ICXB 3LQAH 5IMLA 2EKJA 1OAYH 4Y4FB 1DJSA 1JI1A 4RIRB 2MNUA 1ZLSL 5HYEA 3QJFB 3SDCB 1Q1JH 1FNSH 4LP5A 4R7NA 2XOTA 2WIMA 5C7XL 5C3TA 2GCYA 4F3FA 4WTZG 5FYJL 3BQUB 5EPMB 2A73A 1Z0NA 4S0TD 3SO3C 4B53A 1JHLH 5I8KL 4OKDA 3MXVH 2BY0A 3H9SE 3QIBC 5FGRA 1BQHB 2CLVA 2JCCB 3CFEB 1EX0A 3PL6B 1YPZF 1H3XA 5D2LE 3NN8A 4I9WE 4JY4A 4NQVA 2V9TA 2NY4C 3TPUB 4NSKB 4RIRA 5LCVL 5F6HI 2XQYK 4PGCB 4BZYA 4OF8A 1BEYL 3O3BA 1A6AA 3TCLA 3EO9H 1KCKA 1QR4A 4DUWA 2Y7QB 4UV4H 2FX7H 2X4UA 4GRLD 4WRLA 2GW5A 3ABZA 3VGFA 2CLVB 1BVLA 3MRRB 3GGWB 2XTJB 4JB9H 4JO4L 4TVPH 1CFVH 4PIRF 3TO4C 1EEYA 4U0QB 1JN6A 3SPVA 2D7PA 4JDVB 3OKDB 3SE8H 5ITBL 1R3KB 3NIDF 1REIA 5CZKA 3TYFA 3X3GL 3LEYL 3GRWA 4LHJB 2DQEH 4JO3H 5TH2A 3S88H 2P5EE 5GS1C 5L2JA 1JNHA 4PJEE 3LCYA 1QRNE 1J8HB 4MNGA 3KPSD 3MV8B 5TDNA 1GH7A 4HUKB 5I19H 1EEYB 4LCIL 2LQRA 4WU5B 2GAZB 4J4PA 2DWEA 2IPUG 1LO5B 2CK0H 3BKCH 4LEOB 3O8XC 1JHKL 4O5LH 2WW8A 1YPZB 5D7IF 2XZZA 1N6VA 3V95A 4E41A 3QA3B 1IM9D 2VQ1A 1LVEA 3DTXA 4UNVA 4K3DH 1MLBB 4CVWA 3NACH 3UROR 1IAIL 1BBJB 5FDWB 5E1AB 1U58A 4QEGA 5ID0B 4FQ2L 4NZTH 2HJKA 4QHMA 1V3KA 4P4KB 4MMXC 1IM3A 4I4WB 3GSNL 3LQAL 1DLHA 4PRIB 5T5FH 4JPIA 1YEEL 4Q0XH 1JPTL 3BDXA 3EYQD 3LD8C 5EZIL 3WUZA 2D7TH 2W38A 4H20L 3MBED 2F53E 2GSGA 4MA8L 2AJSH 4GKZB 3L7FA 3OXRB 4KKBC 2VLKD 3BISA 2NXZC 3BN9D 4FQIL 3SGDH 2H1PH 5SWZA 4ETQA 4P49A 3O4LE 2DI7A 4XVUC 5JW5B 5DRZA 2HP4A 4LCWE 4P23C 3N1QC 4OTXH 5DMGC 5D6DC 1NBVH 1XGPA 4AIZA 4FXKB 2EH7H 1YEFH 5I1LB 4HKBB 1SJXA 2HKFL 2VUYA 1MRDL 3UPRB 3OXRA 1OLZA 3ZDZF 2MMXA 4U4BA 3C2AL 4FQCL 2IBGA 5GS2D 4U33A 3IS0X 1I7TB 3S35L 1ONQB 1HEZA 4JZOB 1T6WA 4U6HB 1QEWB 4NO0A 1OOAA 1N5AB 4HIHB 1NCCH 1NGXB 2X09A 4WO4A 5TPWL 3SQBA 1FC1A 1I8KB 4GAYA 1A1MA 4Y5VC 5T1DL 3O3UN 1A6ZB 3WFBH 2QQNH 1A7NH 3ROLA 1W72L 4LVOB 4R9HA 1INEL 3T3PF 4MS8C 1I7TA 4XNQA 4DGVH 3QUZB 1DFBH 3PNWB 3S96B 1ZHKB 4RGND 2VDLH 1UQSB 3LEVH 2NCMA 1ACYL 2AJZB 4XNYH 4P2RA 2Y23A 5EUOF 1NGXA 4WFEE 4PREA 4WO4B 3S34L 1UB5B 1CDBA 2IBZX 3LS5H 2P4AB 3BW9A 1LD9A 4XH2A 4S1QL 5J0BA 1LNUB 4NQXA 1KYOK 4HPOL 3TJHD 2HJFA 3ARVA 3WFCH 3TZVD 1BOGA 5J3HD 3PV6A 2XZCH 2R29H 1FO0H 4U1KA 2VXUL 4Y1AE 3GJFH 3QUZA 4M5YL 2XI9A 1J10A 5DQJA 3QDAA 2F54B 4N9OB 4ELKB 4X0KB 5C0NC 5D1QD 4EUPA 2W92A 3L3IA 4X6DF 12E8H 3ECBA 3LIZL 4XHQA 3HC3L 1MWAH 1WEJL 4H88H 4PD4K 4XP1L 4HWEH 4EN3D 2ADGB 4P59L 4PBWD 3RWEB 3I02A 3SOBL 1U95A 5KSBB 3WEXB 4CU6A 2A74B 2R0LL 5GJSH 1L8JA 5E08H 3LDBB 5DVLA 4GJTB 3QDME 3B2UD 3TJEL 5CINH 5ESVB 2MHAB 3UP1A 3O3DB 4FABH 2R29L 3QRFM 3DVFA 1OP3K 3A67L 1HXYA 1UCBL 5KOMC 4I77H 1A22B 3IRPX 4PJHF 3BQUD 3D39B 3V8OA 1J0KA 1NJ9A 3QHFL 3BVNB 1T1XA 3RWJB 1ES0A 2VDRH 5E5MA 4X9HA 4DKEL 2ATKB 5FYJU 2R8SH 4NKQB 1WJ3A 1IBGL 3BH8A 3PWLA 4ZD3H 1MWAB 2ED8A 3F7YB 3I3BA 4HFUL 2ARWA 4PGZA 3BXNB 3DUSA 2APVA 4YHIB 3VFSB 4NN5C 4L4VD 2FX8L 4MB3A 2DQGL 2W1NA 2P8PB 4FXLA 4UIMA 3BX7C 1B0GB 1ZKAA 1D5MB 3KPRB 1PG7H 1AE6H 1UWXH 5C0RH 1VACB 3HZKA 3QEQA 2CO6B 3OG6B 1HYRC 5KSAB 1QSFB 3QDGE 1ORQB 4PJGE 4UT7L 4GSDH 3O9WB 1M6OB 4OQTA 2ESVD 2C3VB 4YQXH 1UWGH 3LPGA 4CW1A 4PRPE 3HPJB 3Q48A 3U0TA 4JKMA 4XVJH 4P2QE 3TFKA 4P5TA 4RBPK 1T20B 1Q72L 1OP5K 3QEQB 3MLRH 4LSVL 4HX1A 1ZLWH 1Q0YH 2YN3A 3PDDA 1HHKB 4UUJB 4X6CA 3ZDXF 1UACL 5KG9B 1DL7L 5H94B 5TQ2H 5EZOH 2YUXA 2HRPL 2EEDA 2PW1B 1OW0C 3WD5L 3QUMB 2P24A 4LCCC 2OR7A 4G43A 1A1OB 1U8PB 3HCVA 3CSYB 4L4TA 3QG6B 4P5TB 4XTRD 5IBTH 3ZYJA 5E9DE 4P2QD 1G6VK 1CDJA 3UTTB 1AY1L 4JFEA 4Y5XB 5DUBB 4U3XA 1D5BB 3T0EC 3C8KA 3EYSL 5GJTH 4XZUB 5ERWA 3LRGA 4GS7C 3FT3A 5H94A 5EU5B 2V5TA 3C9NB 1P6FA 2YC1A 1RZ8A 2OJEB 1WFNA 4QYOA 4M6ML 2GUOA 5EOCL 1RZJL 3RVUD 4J3XA 3CFCH 3QAZB 3E2HC 4M48H 5AUMA 2VDRL 3TBTB 1QHOA 2YD2A 3O6FA 3QIWD 2IQ9H 3SGKA 2HT3D 2RCSL 5EZJA 4M7LH 5DF0A 4JR9L 2W65B 5JHDA 5D1XD 2VITA 4AL8L 2NY0C 1F90L 5GS3A 3RL2A 3M17A 4IOFD 2NY2C 3VWKA 2PETA 3JWOL 4PTUA 3BUYA 2Y07L 4MJ6B 4WW1A 4NNXA 3WSQH 4Y19E 1MFDL 3ET9F 1VERA 2CO7B 5E6ZA 1LO0H 4Z0BL 1JCKA 1HH9A 3NPSB 4Z7VE 5FHAL 3W0WA 1P6AB 1S3KL 5CJOL 3TPUE 1H3VA 1OTSC 1P1ZB 3RVXC 5IMKA 5F96L 3P4NB 5DA0B 3P4MB 1UEMA 2P7TA 2R69H 3ZSTA 1HSBA 4EI5C 4FP8H 5ESQB 1W2KT 1FFOB 5DJAA 5E4EB 4F9LC 4CMHC 4JRXA 4B7LA 1IGFH 4YHML 5IV2B 4UT6L 2E6JA 1MCHA 4XAWH 2Y36H 4S2SB 4X6DA 5FK9B 3P4MA 1U8KA 4XCEB 2P7TB 1MFBH 3FO0H 2NY3B 3TH3T 5IR1B 3D9AH 1FNFA 3H9HA 4LCYA 2G75A 3CIQA 3JSSA 2I9TA 5ESQA 3T2PA 1KN2H 4ONFL 5I16A 2WAHA 4TTDD 1RJCA 2DLTA 4NN6B 4D0BA 1H15B 4U1GC 1T5WB 1GOFA 4BFGA 5HPMB 4B5EA 1XGRB 3V0AC 3RKDC 3G6JF 3U83A 2F9BT 4Y2DA 1YN7A 3SO3B 3DROA 3IDMB 3O11B 1BQUA 5JXEA 3CXDL 3C5ZB 1TETL 5DRXA 5DSCA 4FNLH 5T3XD 3V5KA 2APBA 1FPTL 3D18B 3B3IB 3MJ8A 3U9PL 2F58H 3KPQA 3UTZB 2EZ0C 4MJ2A 5GS2H 1YMHA 5HBBA 3LB6D 4OZHA 2ZCLH 4PJ5B 5SWSD 1HILB 5D9SB 1B4JH 1JPTH 4IOIB 4ZAKC 1G9NH 1A6TA 5L2KD 2PF6A 3EGSA 3RGVD 1T2QL 3AY4A 3T0AA 1JZ3A 1FFNB 1MCKA 1BHGA 5ICZB 3GBMH 3C5SA 3NA9H 4F2MB 4LOUC 1YMHB 3EO1A 1WFOA 4LLYA 1GGYA 2CRIA 2BFVL 2CMRH 1K6QH 3GK8H 3QDMA 4A6YL 1CD1A 4WJ5A 2H32B 3QULB 3VFUA 3JWDH 5FUZH 1K3IA 4HEME 4IRSD 3PQYE 4MDJA 4JN1L 1VKXA 2WUBH 3P4LA 3RWFB 4YK4B 4F80A 1LO2L 1T21B 4TQEL 3FO9A 3KJ6L 1B2WL 3MGTB 1HYSC 1CR9H 4R97C 3BT2H 3G08B 5T3ZL 2M26A 4RAUA 2R15A 2AXJA 4DOHE 1A3QA 3ARBA 3HZMA 5JOPD 3LPFA 3TN0C 1NAMA 4GRWE 4NYLA 3QEQE 4PBVC 3RZCC 4M61B 4TVSa 4DCQA 2QQKL 3BD4A 4NQCD 1U8QA 2F5AL 3BIBX 4L8BB 3MLTB 1BPVA 3RJDA 3CLFH 3MGTA 3KYKL 3VRIB 4XXDB 3RA7L 1TENA 3CFDA 4PRID 5DJDB 3IFOA 4HMCA 1AO7D 3ESVF 4IMKC 5JIPA 4YPGA 3THML 5IM7A 4FQPA 1N64L 3CX2A 3MBEB 4RAVB 4KROD 2Y06L 1ZEAH 3U48A 1Z3GL 1AXTH 1ND0A 4M61A 4J4PC 4Z8FH 3CAFA 5FYKH 1U8QB 4L8BA 4GW1A 1UC6A 4XI5C 3TBYB 3EOAB 3BGFB 1W8NA 4FQHA 4G59A 5KAQG 2W91A 3KJ4C 4HIIA 2V2TA 1VFAB 1MVUB 4OQ1A 1UJTA 2VLRD 3QNYB 3UPAA 2YA1A 3TA3B 2AW2A 3REWA 3EJYC 5DS8A 1VEPA 1Z2KA 3NH7L 4OI9A 3R8QA 2DM4A 2HT2D 3MOBL 1X5LA 3PHSA 1RAMA 1PQZB 5HHMB 3NCBB 4OCSL 1VCAA 4AM0A 1UFUA 4ZSOA 1J8HD 2FWOA 4NC1E 1ORSB 2D7MA 4D8PA 5FCSH 3QNYA 2BVQA 2HRPH 1T3FB 3PGFL 4JRYE 3VCLA 1IKFL 4XPFH 2X9XA 5FUOH 5JIKA 4JFQB 3B9DA 4JO3L 3QJFA 1MCPL 1GOHA 1DDHA 4PJAA 4AEIH 4M00A 2W9EH 2ICWA 4M1GL 4HD9A 1NCCL 1OCWL 1NGPL 4OGXH 4XC3H 4Z7NE 2HVJA 2I9LB 4ERSH 4XRCA 2H3NB 3L3JA 4RA0C 4MHHI 1W0VB 1A3LL 3KXFE 3ME0A 3SQOH 4JO2L 3RKPA 2A2QT 2G9HA 1VPOL 2V7HB 4G9DA 4O00A 4Q6YA 5DGQA 1KTLB 1FV1B 4O4YL 5C07D 1Z5LA 4YC2C 4F58L 4PJBF 5J56B 3IJYA 4GXVL 3CCHB 2VDOH 4MXVE 1LQSR 4AEIL 4I8DA 4HIXL 1JTOA 1WT5A 4TN9A 3JV0A 5EN2A 2VABA 2V7HA 1IC7H 3MRQB 2VKWA 1JZ5A 2X4RB 2DTML 4UINH 1RZGB 1A21A 1WTLA 3QHZH 5M7QA 4Y19D 4DAGL 1SEQH 5IVXE 4PJFE 3MACH 3UTSB 3ZE0E 2D31A 1DLFH 3FN0L 3NCFB 4EXKA 1B88A 3EKCA 4GKNA 4L8SA 3BHBA 4XMKH 5DFVD 2ICEB 2JJSC 4NHCH 2LU3A 2ADFL 5EFIB 1PJ9A 3WHXA 3MLVH 4XVJL 1RULL 4FABL 1RZGA 2VLKA 1AGFA 3MCLL 5E6YA 4PJ5D 3AAZB 4AENA 1E6OH 2DMKA 3IJSB 5HDOA 2GQHA 1T2XA 1Q9OA 3OQ3B 1MLBA 1AGDA 1JV5B 3UTQB 1A3RL 2OMBA 1A7RH 2FGWH 3O81A 3A6BL 4H25B 3VFTB 4L3ED 2Y36L 3JV5A 1OHQA 2ZOLB 1A4KA 1PD6A 4QHMB 1IILE 4RMRA 3ARQA 1CGVA 2ZSWB 2BOCA 1P7HL 5DRNA 3O4LB 4XMPL 1E4XL 2BK8A 2LVCA 3VD3A 3R06A 1AGEA 3DOSA 4MHHG 3PGCB 4ZAKD 5CBEA 3T09A 3RAJL 4P3CL 4ZS6C 3EO9L 3KHOA 5D7SH 3QSKB 4HULB 4FXGA 3H3PH 1KNOA 3KPPB 4YO0B 1R3HA 5F9DC 2A6IB 5J3HC 4KTEH 1BFOB 3LKPB 2GK0B 1U8LB 2JB6A 4UIKH 1T1WB 2NY4B 7FABH 4WWKA 4LIQE 4GUPA 4HIEA 9CGTA 4OD2B 3C6SB 1MFDH 5JW3L 3C8DA 3DBXA 3PL6D 1V8HA 4HJGA 2H8PA 1V3LA 3GI9H 5KANG 5MERB 2H9GA 1U93B 1AXSB 5AWNH 4U1LB 5ENWB 3VXSB 3X3GH 1Y6MR 4X9BA 4NGHH 4DFIA 3LKPA 3QDGD 1WQVT 4NQCB 1HEZB 4YDJA 3MLSH 1QFWH 2J4WH 1U3HD 1AFVH 1FDLL 4WWKB 4QRQA 2R0ZL 4S0UC 1AO7B 4TUJB 4BQCA 4KQ4L 1KIUA 1I3RB 4I3SH 5BRZD 5C1MB 2AI0H 2BNRB 4GRLA 5IGXH 2HTKC 3PABB 4HH9A 4NO3A 4PLJC 4JJHA 4PV8B 1RUMH 1MJUH 2BXZA 2CGRL 3QCUL 3SDAB 2UZIL 1QFOA 4MAYC 1GGBL 4Q2ZA 5KOVC 3KR3H 4QRQB 3CZJA 4DW2L 2ZCKL 1CVRA 1DQQA 4K9EL 4P4KD 1IGFL 4NFBA 3SDXE 2CKBL 1ZSDB 2E9JA 2HJFB 3C6LC 4OSUH 1HHJB 2BJMH 2BMKA 1S5HA 4NRZA 4XNYL 1J8KA 1UM5L 3SDAA 3QWOB 5T5FL 3TVMC 3ZE1F 3H9SA 1OAUH 4L4VE 2OYPA 5C0JB 3IDXL 3WJLC 4NNPH 1UKQA 4M3KB 4ODXA 5GGTL 2AVGA 1ED3A 4YFDB 4EUPB 4D0CB 2R4SH 5F1NB 4P46B 1HOCB 4HH8A 4X4ZA 5H8DA 2FH8A 4FZ8L 2WUCH 4OQTH 4KVNH 3O8XA 1FJ1B 4IHOB 1TVBA 4V2BA 5F7MC 3H9SB 5K9KA 3OV6A 4XP4H 4GSDL 3RJQB 3ZTNH 1WSST 1A6PA 2OMNA 1IAKB 5GISH 4B0MM 1KTDA 1D9KD 4JG0H 4HKZB 4JY6B 4Y4KA 4CN6A 1BJ8A 2DQHL 3U0WH 1ODAA 2OI9A 3EYUL 2Y25A 2YPKB 3L5HA 3BVNA 5ALCH 4TPRL 3BPCB 1A9BB 2CIKA 2EDNA 1WUNT 4K8RD 4LLQB 1I1YA 1MFEL 43C9A 3HAEA 5GIRA 3G6JB 3Q1SH 2IG2H 4JFYA 4ZUUA 4UB0L 4PB9L 1HWGB 3BXNA 3DUSB 4KFZC 4OF0A 4J23A 3C60C 2R0KL 2ZUXA 3S7GA 5IVNA 3T77A 1MIMH 1L0XA 1NAKH 1NGWA 4M7JH 4Z7QE 4HGWA 3P0GB 3SDDA 1I3VA 5IHZA 1IAIH 1HH6B 4TUOA 2RB8A 4M6OH 3UXFA 3O41B 3AB0C 3D25A 2NW2A 3IDYC 1JBJA 1W72A 4HC1L 5KSAA 4Z77A 3QR2A 5T1KB 3NFPB 4MS8D 2DBLL 3QUKA 4RGNE 5D2NA 1G6RB 1K5NA 3BP4A 3IGAA 1OGTA 4NQED 1UA6H 3DRTB 1TPXC 3GJFK 5F9OL 4NQEA 1K4CB 3HG1E 3H3KA 1V7ML 2Z31D 3EDFA 1KT2A 4M6MH 2P49B 1L6ZA 3GHEL 5F7FA 4QWWD 5HYSA 5DEFA 2AV7B 3FO1A 3VWKD 4OBRA 4OCRL 3D39E 3UDWC 4UUJA 4CDGC 4NRXB 1GGTA 5IT2H 1ZEAL 5IESH 1AQKH 1MFAH 4KK5C 4NNYA 4PJXE 4ZNEE 3QUMA 3BJ91 3VRLE 3PWPD 3SGEH 2F53D 5CEZH 5E8PA 3FFCB 5C0AD 4FOMA 3CDGA 2Z93B 2HWZL 4PJ9B 1QTYT 3E0GA 4KI5C 3DXAA 4M4PA 3MJ9A 4RBPH 3LKRB 4JJ5A 3JV6A 3ZTJG 3FT3B 1N7ML 1H9VA 4LCWD 5JPNB 4C58B 1R3LB 4LVNB 5TFSH 4H0IA 4QYOB 1KJ3L 1QP1A 3QDHA 4ISVB 2R8SL 4ZG1A 4NCC2 1QOKA 3FFCA 3TNMB 5HYQA 5AUMB 2FD6H 3EDEA 3UMTA 5GGVL 1HKLH 5EOCJ 3U4BL 4YZFF 1OPGH 4JQXC 4L8DA 3MCKA 4G80A 4LGRB 1R5IB 5EUKB 5CEXB 1DFBL 3IDIB 2G60H 1IKNC 5LJYH 4D2NA 2CUMA 2IH1A 3EDJA 2IAMC 5I75B 2EYTA 5F3BA 2APWA 4WUUD 3N85H 1RZKH 4Y4HB 3SE4C 2AEPL 2DIJA 4PTUB 4RDQF 4JO2H 2HKHH 2J1KA 3ZYZA 5HI3C 4XHJC 5DQDL 3X12A 5C2UB 3GM0A 4G7YH 5J8OA 2PTTA 1PEWA 2H2SC 2R39A 3CDFA 2W9DH 3QQNA 2FLRT 2P5EA 5CWSB 4JM2C 2VZ1A 4Z7WF 5I1KH 5J89A 1MUJA 1MREH 3L3DA 1KPVB 1ZT4B 3PP4L 3RPIA 5DTFB 2GJ6A 3E3QE 1N0LA 2QSQA 4RX4A 2JCCA 1MFAL 5F7DB 1GL4B 2PTTB 2P42B 5CINL 5JW4M 2H1PL 3NN8B 1L7TH 1MHCB 5DHVB 1CK0L 5L88H 5DWUH 3OJ2C 4GXUM 1VFBA 2NW3A 2A1WH 2AJXL 1A6AB 3TCLB 4PLKD 1RK0A 3VRLF 4Y5XC 5E94A 3B5GA 4PRPA 5JR1H 4GQ9H 4KRNA 1CGSH 2LTQB 4N0CC 5D93B 3S35X 2AJVL 3U0PB 2O26U 3F65A 2VRAA 1YJDL 4PJGA 4P5TC 3EFDH 1T5WA 5HPMA 3D9AL 4CNIA 5SV4A 3ZTJH 1J9CT 5ACLA 3KYNB 3HUJB 4NZUL 3SGJC 2VLLA 4I9WD 1MJUL 3Q5YA 3C5ZA 3V5KB 5DSCB 1QLRB 1HE7A 4YNYB 1LO4H 1YECL 1ZVHA 3VW3L 1WWBX 5BO1L 2A6DA 3S36X 4QTHB 3ARFD 5I76B 3AB0B 2R0WH 2ENSA 5J13B 3GKWH 4JFPB 4OSUL 4ZO9A 1YN6B 3BP5B 4KDWA 2B7DT 2XN9A 4NN7B 5KN5B 1Q0YL 3PWPE 5ICZA 1CE6B 4ENEC 4OZFG 2UY6A 1RI8A 3HRPA 4WV1B 5IEKB 3FQTA 3LV3B 3HI6H 3ARXA 4LSTH 4UDTB 2FGZA 5EA0L 2UWEA 5GS0C 3GZKA 2VE6A 4MSWA 4ORZC 2FNBA 1XF3A 5GSRB 3O0RL 4HUNB 1R3IH 3MRFB 1CE6A 4NM4H 3CUPB 2QL1A 3EBAA 4NJ9L 4X80H 1MRCL 2EH7L 5I71B 4YXLL 4J6RH 2WP3O 5B8CC 2HMIC 4TSAH 3OB8A 4TNVK 3RWFA 1IGML 3KPTA 3P0YH 4KDTA 5AZ2H 3UAJC 2QQNL 5HHXH 4Z7UA 1WBXB 1J87A 4OIAA 1Z9SA 3KLDA 5INDA 3SO5A 2NTFB 4OKVA 4HIJA 1S7UA 4LSRH 5J6GB 4DOHB 3MNZA 1XGPB 3EYSH 1EXUA 4JPVL 4UQ2B 1MI5D 3L3KB 1ZAGA 4ZUTB 1P4IH 2Z9TA 4ONOA 1T7WA 4L8CB 4Z7UB 3F62A 1QRNA 1FVEB 2X1QA 1NMCB 2FO1A 4JZOA 4BUHA 2MWCA 4RFEB 1UENA 5ADPL 1Q9KB 1MHEA 2I07B 2V17L 1EBPA 4MXWL 4OF7A 2AK1H 3CMOH 2W9EL 4M1GH 1G6RL 4PG9B 3QXAB 4Z95L 5KANI 4G8FA 5D7JD 3OB0H 4XNMB 4NKDB 5ACZB 3FFDB 4QNPE 4HXAL 2BY1A 1S78C 4RCAA 4XB8A 5DEGB 3I75A 2PXYD 5FFLA 4G8GB 1PEZA 3M45A 2XFXA 1UB5A 4PG9A 5HHMA 2QEJA 5HVGB 3GK8L 5HHPB 3L5IA 4X7TB 3I9GL 3LEXA 4WY7L 4WTWA 4UTAH 2BNQE 5MENB 4HUUA 3Q0HA 3VXMB 1FZOA 1KCRL 4YHLL 5DQJB 4JFQA 1JHTB 1QSVA 3FB7A 3RNQB 1EVTC 1BFVH 5IFHH 3C5JA 3K4DA 1EJOL 4CADA 5EIVA 1A7QH 2A9MH 4YHKH 1F3DH 2ADGA 1GHFL 4OV6F 4XP6H 4HUUB 3A6CL 4LCWB 4IOSD 1KGCE 2J3SA 3UC0L 4N1EA 1CD9B 1MRCH 2VLRA 3RUGE 1DZBA 2CLRA 3E6FA 3L3HB 4Q9RL 4TVPE 1S7TA 4BA8A 5L7XL 3V7AG 4BFIB 3Q1SL 3OKYA 3GO1L 4I1NB 2AEQL 3I2CL 1GSMA 1LHZA 1NCBH 2IPTH 3RL1B 4O2EB 4RA3A 1OT2A 1OTUC 4WCYL 5MI0C 3B2VH 4PJCB 2CLRB 5ETUB 5I1HL 3E3QC 1IT9H 35C8H 2VQUA 3RWJA 5EN2B 3W2DH 3GI8H 3HKFA 4YZFE 3VI4E 3REVA 4X6FA 3MLWH 4G6FB 4KJPD 4JDTL 2EH8H 5DD6B 4BZ1L 4KAQL 1SBSH 3ZKMD 4YHNB 2DQJL 4L5FL 4D3CH 3UTSA 3FONB 2QKIA 1UXSA 4AIXA 2DS4A 4Y89A 5DC0A 5TF1H 5E0QA 3RZCA 3HI1B 2V17H 1WWWX 1RD6A 3D69A 1BD2D 4R3SA 4N0CD 3U30C 5I1CL 2CDGB 1CGWA 1MIEL 3MR9A 3HZKB 1AQDB 5IMOB 1AKJA 1DLFL 3OGOE 1IE5A 1RY7B 5LVEA 4OCXH 1ORQA 1HXMA 2ORBH 4U49A 4U1JA 1KCVL 4BJLA 3DMMD 2ZPKL 4MA3B 1KCLA 2EDDA 4BQBA 1AGDB 1FH5L 4UNUA 4J1UA 2W07A 3MR9B 1T20A 2UWEF 2BHYA 2ZOLA 1A4KB 4L1DA 5HTSA 5LBSL 2DMBA 3FFCE 4XGZA 2YKLH 5JNYB 2O5ZH 2C5DC 3OWEA 3MC0A 4EI6B 4DKFL 4N1CA 1HKLL 3U4BH 4QCIA 1S9VA 1KB5B 2ARJB 4PJCF 5IK3B 1RUAH 4X83A 4G43B 3THMH 3DECA 1KJ3H 2BVEA 4X99B 5JXEC 1F3JA 1CR9L 4FA8A 4C56B 2ADJA 1TJHL 4K7PY 3UTTA 4R2GB 1BFOA 2E6QA 4L3EE 5GRUH 4OM0H 3WFHA 1RZKL 3INUL 3ELAT 4FQ1L 3O3EB 3NVQA 3V0VB 3ZT6A 4ZXBA 3TBSA 5I66A 1YEEH 4Q0XL 2KUTA 1DQLL 4MB5A 43CAA 2GUOB 4DKDC 2F53A 1X7QA 2GI7A 1EH9A 3C09C 3Q6FA 4PJBA 2EIDA 1AJ7H 3MZGB 3BOVA 4M7LT 3MLPA 4A2MA 5HYJE 1JZ8A 5JXAH 2ZG3A 1D6EA 3L3GB 1F4YH 4Z0XA 5C0CA 4I3GA 2XNAB 4CJ0A 3IDGA 4M62L 5JTWA 1I3RA 1UVQA 3CDCA 3DX6B 4NBYB 2HG5A 5D7LB 2DYPA 4U6VL 2ATPA 3H9YA 3Q6FB 1MCEA 5FGSA 1BIIA 2VXVH 1G9ML 3PHQB 1G7LA 4K7PH 4FZEL 1OP3H 1QKZL 2O61B 3T8XA 3BDBA 4HHAB 4WHYG 1P1ZA 2VXTH 2P8LB 4GAGL 3DX6A 3ARTA 1NEZA 1S7SB 3DJ9A 1ZS8A 4LP4A 4C83A 3ALXA 3ZKSD 4LL9A 1S5HB 4NRZB 3UO1L 3FTGB 4UU9A 2MQ0A 4UB0H 4F9LA 5C0FA 1JK8B 1RURH 4KTDL 3DURA 2VZUA 4KHTH 4Z9KB 4J12A 1ED3B 2F5BL 1P69B 5FYLL 4WI9A 2RFXA 2P8LA 1JP5A 4M8QB 5I30H 4I18C 4Y16D 4FFZL 2WBKA 5B38G 4W6XB 3WJLA 2YXFA 3NGBC 1TFHA 2GTZB 4O58L 5IR1A 2DWDA 3RY6C 3FTGA 4NQDA 3I3DA 4JGUA 4JRXE 5EBLB 3MO1B 7FABL 5EO0A 4XPTH 2Z8RA 3CK0H 2MCPL 2W59A 5I17B 3TNNA 3WNNA 1LO4L 3DI3B 3BSZH 1X5HA 5BZWB 3JTSB 2DLFL 3KNBB 4LHUB 3HAEH 4NKIH 1I3UA 1RK1A 4ZAKB 3LKNA 4YAQB 3SBWC 1OTTD 3SDXA 4J8RA 3DV4B 5LGHL 2DWDB 4Y2DB 3RBGA 3MSPA 4FFYL 2A77H 1EGJH 3QQ4A 3NBNA 3ESUF 4YFLI 2YHGA 2J6EA 3TNNB 2PW2A 4WIQA 2X05A 5B3JE 2HLAA 2F54E 1AHWA 3SDYL 5J9PB 3KNBA 4CJ1A 1C7SA 2H26A 1P53A 1RK1B 3DO3A 5IIEA 4URTB 4XVTL 3B4NA 1CLZH 3O6ML 5MENE 1I4FB 3QZWB 4HKJA 3HC4H 5JOPE 5TQ0L 2B5IC 2JF1A 4EIZC 3QZWG 3W39A 2NXYC 3X3FL 4M9PA 1NMAL 2AABL 5FGBC 4K9EH 1RIUL 5E8OA 4ZFOB 3WHE1 4PJIF 3VXUB 5E2VL 4EDXB 1E6JH 3TFKD 2VIRA 3T0WA 4LDEB 1C12A 4JKLA 2NY5L 3QDMB 2OTWA 2YPLB 2DQGH 4S1SL 2B2XH 1BVKB 2DRUA 5GGTH 5DD0H 1F90H 5E8DH 1KCGC 1INDL 4JFDD 2ERJC 4ZO8A 4XCCH 3ZE2F 1BD2B 1INQA 2P5WA 4YBLB 4LVOC 1G7IB 2WUCL 4K94C 4M7LL 3IXAB 1LEKB 3MRBB 3S5LB 3AGVA 2EC9U 2YPLA 5FOBB 1H0DA 5K9OB 3QP3A 5FO7A 2EECA 4Y1AB 4P2CG 5HVFB 4EUPH 4OZIE 3T0BA 3ARDB 1P7QD 3TV3L 3I85A 4G6JH 3U4EA 2IANA 4JDTH 2DQDH 3T4AB 3MRPB 4X4XA 3SGKC 3HN3A 3IXAA 3JV6B 4JHWH 5FHAH 5ID1B 4XPTL 1M4KA 3GM8A 2R0ZH 1JGEA 1VADA 3TIDB 1TTUA 1BZ9A 2WINB 1CL7H 3KHQA 4JQIH 1JGLL 1WF5A 4G5ZH 2D0GA 4GW1B 4X4XB 2R2HA 3WN5A 4ELMB 3U82B 1F3RB 4HIIB 5D96C 3ARGD 1J88A 2D0FA 4GAJL 1UKTA 2IG2L 4LIQL 4X98A 4K8RC 2I5YL 2ZPKH 2DKMA 4RFOL 4NRYA 1GZQB 1QO3B 1NMAH 4J3OC 3TN0A 5IFHL 2VH5H 3UBXG 4OCXL 3BP7A 2R1XA 2OI9C 3EAKA 3VFGH 1AP2A 4KPHL 4MD5A 5J11B 3ULUH 3V6BR 3B6SA 3S97C 2JIXB 3FRPA 4AEHL 1L7IL 2HT4D 5IVOA 5GRXG 4XP6L 1UB6B 3FN3A 4DGYH 3FT2B 1QSEA 5E99H 3HZVA 1LEIB 4ODHH 1TZGH 4QRSB 3IDYB 4XP4L 4W70A 2PO6C 3BE1H 3V6FA 2FJGA 3JVGA 1P2CB 3NIGF 5EU3B 2R1XB 5CIPB 2VDOL 5F7HA 2I9LA 5DTFA 1PX3A 1FAIL 5L8KB 2AKRA 5KVDH 1YQ2A 5K9JL 4RRPG 3GBML 1W8OA 5FKAA 5TGBB 1UB6A 1QNZL 1IC7L 2Z31C 1IGIH 3IRZA 4BQ9A 2G9HB 1JGUL 4H1LG 4D3CL 2HH0L 2FJGB 1KTLA 1CXLA 5IMMB 1KCSL 3HUJF 5C08A 2Z35B 4X4YB 4H1LB 1P7KA 25C8L 2R1YA 5IFAH 2AKRB 4OGYH 1AD9B 2LE9A 2E3VA 3OKMB 1IFHH 5FCUL 2HVKB 4XMKL 5TGBA 3CFEA 1TQCC 3D39D 4JANA 1NBQA 1A6VH 2VNCA 3UEZA 2IWGA 3DO7B 5FUCC 2DQHH 4ZPTB 5KSUB 4GO6B 3KYNA 1DQJB 1YA5A 4LQFL 4RNRB 5FUCE 1NUGA 5D6CB 4OZHE 5I0ZA 3TA3C 1LDPH 1AD9A 4AEEA 4S1QH 2IALB 1GVIA 4G6AC 2ORBL 3ZHLA 1EDQA 1Q0XL 3VGEA 2A6DB 1OARH 4YH6A 4QTHA 4V1DE 4LNRA 1EV2E 4XPBL 2NY1C 3QUMH 1KOAA 1E4WH 5AD0B 4HK0A 1JN6B 3NCMA 4AJ0A 5IJKC 4HZLB 4IDJH 1JYXA 1I8MA 2VDPH 1OGAB 1RUQL 3MA7A 1HCVA 4Z5RB 1EUUA 3MFFB 1SEBA 4YHPA 4BSVB 3U6RA 5BS0B 1EFXA 4PV9B 2CK0L 3BKCL 2NZ9D 1JYNA 2PCPA 4APQB 1LDPL 3EYFB 3QO1A 4JM2B 4YJZL 1JV5A 2HFTA 1I8MB 5MEPA 3FHQA 2WQ8A 1MH5A 1LDSA 3ULUL 1EK3A 4XX1E 4LEOA 4YHPB 5HDBE 4BSVA 3MRFA 5D2LB 1R5VB 1U8HA 4PJDE 4E42B 2WANA 5CHNB 4WFHD 3QIUC 4I77L 1T89C 1EHNA 4GRWH 3LN5A 1RIHH 5IGXL 4TSBL 2HH0H 1DQDL 8FABA 2AJSL 5D2LA 5JIIA 4AL8H 4MD0B 1G84A 4DFHA 1IM3B 3R0NA 1R5VA 1QNZH 1ZLWK 1FC2D 3N0PB 5BW7C 1TIUA 3M1BA 3A0OA 4GUPB 1AR2A 5CBAA 4YEEA 3VXQA 2OK0H 4GKZA 3R1GL 1XIWB 1G7HA 4FQIH 4L8CA 4X6BB 2AXGB 3VWJD 3TA3D 5FAAA 4Z6AT 5BXFA 2OXGA 5D7SL 2YWZA 3K7UA 5FECA 1MQKL 4RFEA 4RFNB 3QQ3B 2EDYA 3KPSB 3MV8D 5BVPH 1IQDA 5FYJE 4Y8AA 4AIZB 5I1LA 4EXPX 5CJXA 2IAND 5KSVA 1G7HB 5D7KE 2NX5A 4I0CC 1MHPL 1NL0H 1K3ZA 3QDMD 1KGCD 4YXKH 3LKQB 2GK2A 4TNWF 2DN7A 4Z7UE 2NY6B 3VXME 3QQ3A 4U6XB 1CVSC 4U05A 3VG0H 5CGTA 2IPUK 2QHRL 2ED7A 2R2CA 3E1F1 1BX2B 3HC0A 5HHOE 4QOKE 1ZSDA 1OLLA 3ROLB 3RGVA 3BZEB 1QG3A 3O2DH 3BZ4B 4ZYKB 3CC5A 4WFHE 1MCBA 2AJUH 2V2WB 4D9RD 4JR9H 4GRMA 1MREL 2JIXD 1P7QB 3MOQA 2AQ1A 1KELL 1N6QH 3WFEH 2JE8A 2QBWA 3BW9B 3HC0B 3C5JB 4XPFL 4FFWC 2BSRB 1RULH 2C1OA 4YHYC 3RZWA 2DQCL 1S5IH 3O8XB 1LP9F 3G9VA 4UQ3B 1TQBC 4OUOA 5ADOL 3WS6C 4BSWB 4S1RH 4GRMB 3L3HA 2B8OT 3HZYB 2V7NB 3GBNH 1GIGH 2BCKB 5A2LH 2C4FT 3NCCB 4BFIA 1KLUA 3ARBC 3TCXA 4MA1B 5C0BB 1EAPA 2DQUH 4Y4KB 3GSOA 3GSVB 4PGBB 2R69L 4MNQE 2A74A 4BSWA 4KDVA 5ETUA 3WXVL 4R2GD 1DBJL 3UJTL 1JPSH 3H8NA 3MNVA 5HDQL 4YUEH 2CRZA 3HAEB 3C87A 4RFOH 5D1ZD 5HHOD 1PYWB 1QSED 2V6HA 5CP3H 4HS6B 2XICA 4PRHB 5FA3B 3IAPA 2VN4A 3OB0K 4N68A 3V4UH 4BKLB 3DVNB 1FP5A 3U2SB 3VDBA 3OAUH 1T1XB 1KIPB 3RZCB 1QA9B 4P48A 3K2UH 3D69B 5CCKL 4APQC 5CGMA 5IW6B 4I18B 4WWID 1JE6A 2VDNL 2ZUTA 4UT9L 4F37K 2BVYA 2XZAL 4C54A 1AQDA 5IMOA 1RURL 1YNLL 5T3ZE 5E00B 1W72B 4FTVA 3VFWB 4W6WB 5J57B 1NAMH 3IF1A 5ISZD 2H6PA 5I1KL 1MCDA 5HGBA 3PWPB 4HS3B 2YWYA 4B50A 2A77L 2FX7L 4K3JL 3LN4A 3BZDA 4YGVA 4WHYH 3O4LD 2A9ML 3BEWB 4HJJL 4NQCE 5EO1A 1YUHB 1L0QA 4IRSB 5TE4H 4TRPL 5E7FA 1CFNA 3CFIC 4NRXA 1P4IL 4OCWH 4QRPE 1ULVA 4ODWA 3V6OE 4QCIB 1LK2B 3HE7A 3VRJB 2OZ4L 5T5NF 2JJSA 4POZD 1QR1B 1BFSA 3HPJA 1J1XL 5C9JA 2YEZA 1E28A 3H7LA 1XGYH 2E7HA 1H8SA 2DYPD 4Y4HC 3UYRH 3EFDL 5F88B 1QFWM 3LZFH 3RDTC 3LKRA 3RVTC 3D3VA 5DJ6B 5F7LB 1K6QL 1Y18A 2YPLD 3V0VA 1N5YH 3HE7B 5CZVH 3TH2T 3IVKB 2NY0D 4ZXBB 1QBMH 1NLDH 3UTPD 2X4NB 4H26B 2OCFD 3G04B 4XPBH 3V5HB 5D1ZC 4PRDA 3L6FA 5LG1A 1UWEH 1MCOL 3B9AA 4V3EB 4Y5XA 4JRYD 4OLYH 2Q86B 2EDJA 3MMEA 4WFED 1I1AD 4X6EA 1X4ZA 4HXAH 1KSRA 3BWUC 5A3ID 4R4BB 5MHSE 3DUUB 4AH2A 4EI5A 2XT1B 3BT2L 1MELA 4P5TD 4YBLC 4KVNL 4PJFA 3TBWA 3G04A 3V5HA 1JMXA 4ALAL 4GW4B 3HHRB 1OTTC 4U1IB 3B5HA 2E6PA 1FE8L 2ATPB 1FGNH 1TPXB 4KU1A 5DJZA 2Q87A 2I60H 4H0GA 5FKPB 2DLIA 5MEOB 3UAJD 1JRHI 1TCRA 4CVZB 2OL3H 1YNKL 1RFDH 1ADQA </