4HKJA

Structure of cowpox cpxv203 in complex with mhci (h-2kb)
Total Genus 73
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
73
sequence length
277
structure length
277
Chain Sequence
GPHSLRYFVTAVSRPGLGEPRYMEVGYVDDTEFVRFDSDAENPRYEPRARWMEQEGPEYWERETQKAKGNEQSFRVDLRTLLGYYNQSKGGSHTIQVISGCEVGSDGRLLRGYQQYAYDGCDYIALNEDLKTWTAADMAALITKHKWEQAGEAERLRAYLEGTCVEWLRRYLKNGNATLLRTDSPKAHVTHHSRPEDKVTLRCWALGFYPADITLTWQLNGEELIQDMELVETRPAGDGTFQKWASVVVPLGKEQYYTCHVYHQGLPEPLTLRWEPP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system/viral protein
molecule keywords H-2 class I histocompatibility antigen, K-B alpha chain
publication title Structural Mechanism of ER Retrieval of MHC Class I by Cowpox.
pubmed doi rcsb
source organism Mus musculus
total genus 73
structure length 277
sequence length 277
chains with identical sequence E, I, M
ec nomenclature
pdb deposition date 2012-10-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00129 MHC_I Class I Histocompatibility antigen, domains alpha 1 and 2
A PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4hkjA02
3.30.500.10 Alpha Beta 2-Layer Sandwich Murine Class I Major Histocompatibility Complex, H2-DB; Chain A, domain 1 MHC class I-like antigen recognition-like 4hkjA01
5LGJB 4LEOB 1MJ7L 2YN5A 1XAUA 3TC9A 3ZTNH 3PGFH 4PY8J 4MNGB 5D72H 3I85A 3VXSE 4YFDB 2HVKB 4B7LA 3MCG1 5AG8A 4X8JA 2X5PA 2EDJA 4P99A 4JLRB 4KI5D 3VXPB 2GK0A 1D9KC 2FJFA 1ZMYA 4R7DA 4LIQH 1J0YA 3MRNB 1IKNA 4CDHA 4XCEB 2MQ3A 1BBJA 4PRHD 3MCKA 3DYOA 1MCHA 2QQNL 5EO0B 2LVEA 4LKXA 1YDPB 3E3QE 2DJUA 1NC4B 2A0LD 4KDTC 4UQ3B 1P7QB 3K2MC 4QCIB 1AO7D 5E8EA 4P2OD 1KB5H 4ZFOA 4X83A 2BVOA 3I6LE 5IMLA 2FH6A 3KPRE 3MUHL 5J9PB 5FGBA 4GRLD 2AEWA 4NJAL 4NO3A 1KIQB 3JUYA 4PP2B 4HD9A 4LBEB 4XNQB 4G6JL 5CJOH 2K7PA 1SJEB 2RCSL 4RWYL 4XX1E 2CLZB 1K5NA 4PJEA 1ZT7B 1S7SB 4P2RA 4GBXA 3SKUD 2WBKA 1UZ6F 1P1ZB 2KH2B 4P5KA 5TQ2L 4WFHE 1XGTA 5CINL 3CDFA 2HT2C 5TPWH 4HIIA 3MA9L 5HDBE 1T0NA 5DUPL 4DKAA 3QRFM 1HQRA 3C09B 4X6CB 2FJGB 3RZCC 3GNMH 1AKJA 1GH7A 4W4OC 1EIBA 3BIBX 4YPGB 2AS5M 3ZZ1A 3OGCB 3JSSA 5DVNA 1CICB 1CTNA 3NIFF 3A6BL 3BEWB 4K2UL 5I74B 2XQBH 4G9FD 2B1HH 3GSWA 2HP4A 5B3JF 5C0ND 4PJAF 2HFEA 4JM2D 1F6AB 5JPNA 5FUZH 5AZ2L 5FYJD 3L3JA 7FABL 5I8CB 3O3AA 3KPOA 5DGQA 3TO2A 3ZE2F 3SCMC 5EBMB 5BVPL 1DJSA 1MFBH 2VL5A 4NO5A 4PJ8C 4YZFE 3LRSA 3OKEA 2XA8H 4QXUH 3ZDZE 2VXQL 1A7NH 4WTXA 2DQJH 4YO0A 1PGRB 5DQDL 4ZFGH 4V3DB 4HIJB 2DMCA 2AABL 4K23H 1W72A 3MGTA 4U6VH 5JQHC 3QHFL 4YGVA 4P4RB 4WY7L 1CGUA 1L4IA 1UCBL 4OFIA 4WI3A 5KTEL 1LO3L 4EQ2A 3MJ8A 5DJCA 5TDOB 3REVB 2HA1A 1I8KB 4MHHI 3KXFD 4PG2C 1A0QL 4ZXBA 4I9WD 1V7NL 4JFZH 2B8OT 2DQDL 2BNUA 4Z9KB 5L0QC 1HHHB 1NAMB 2GJ6D 2XG4A 3G08B 2FD6L 5KVDL 3BX7C 5BZDA 4X4XB 5GS3A 2AJVL 1R3HA 4UDUA 1YEGL 2X41A 2DLTA 3KPQA 4F7TB 5HHOA 2EYSA 5TE6L 5IVXE 3S34L 4XWGL 4IRSD 4IMLA 1XGUB 4NKIL 3U4AA 5IKCA 1OL0A 2W9DH 5CJXA 2FRGP 3ARGC 2F53B 3V4PH 4ZPVB 4DZ8B 4HG4J 2YMXL 5FOBB 1WFTA 4QT5B 1G9NC 3E3QC 3FHQA 2FHCA 4RMUA 1S3KL 3CMGA 5HYJD 3P30L 4RBPK 3WDHA 2BRQA 3ULSB 1P4BL 1CN4A 1G7QA 1RV6X 3BGMA 3V5KA 3ULUD 4X4YA 2P7TA 3VXMA 3AU1B 4JPKH 5DJ2B 3QUKB 4PJEF 5HVHC 4DTGH 4JPIA 3IDXH 4YBQC 2M26A 4O4YH 2CDGB 1JF1B 5IVOA 3MRCA 1HI6B 3HE7A 4J3XA 5IVZB 4TULH 1DBMH 2AXJA 2ZJSH 4IJ3B 4QRTB 1MHHA 5L88H 3FFDA 3WSQH 5LGKA 2YUWA 3IFLL 2PYEA 4I0PD 4NQCA 1OSPH 4Y16D 5GRXG 3FQWB 1WTLA 1KPRB 4EN3B 4M6NH 3BN9D 5FCUH 2G2RB 5CCKL 1WJ3A 5JDJA 2VDRH 1F2XK 1J5OH 3S4SG 4PJCA 3N85H 3LDBC 2YPKB 4FN0A 4NNXA 1I4FB 5SWZB 1MCOH 1TLKA 4OZFB 1QA9A 2Q87A 4FFYH 3O6MH 4IDJH 4M4RA 1DUYB 4NN6C 1G9NH 5I1AA 4NQVB 3FN0H 1T66D 3NCJH 5DEGA 4YDLB 4L3EA 5IW6A 3EZ8A 5EC1B 2FZ3A 4KUZL 5EU7E 5HGDB 4NKOA 1WWWX 1EHXA 1I1AD 1CQKA 1UZ8B 2VSDA 4AH2A 5EU3A 4AENA 8FABA 4XVTL 4XHJD 4EBQL 4N0UA 4MD5A 3RL2A 4XC3L 1IEBA 1TCRA 1JWUA 4UZGA 1OP5K 4JDVB 4P0DA 2VZTA 4JN1L 1NGQH 4L3CA 5GZND 3S97C 4J1UA 3RWIB 1T5XA 3FONA 1OAKL 1RZ8A 2LU3A 4Y4HB 3ALPA 3RWFB 3BZFB 3GGWA 4OLXH 4H8WL 4Z6AT 5KVEL 4QTHA 3VDBA 2A9NL 1WITA 5C9JB 1YN7A 1T2XA 3VWJA 1OB1B 4IS6B 4JDZA 4WJ5B 5FHBL 1JYXA 5C0DA 2RAMA 5CZXD 2DI7A 4WI4A 5EZIH 4R8WL 1U93B 3MV7E 5TDPB 4GW4A 5EFIA 4EOWL 5DJYB 5F7YC 3QEQB 2G75A 1CBVH 3A6OA 1XGRA 3AS3A 5AWNL 2X4PB 1CGSH 3RL1A 4HHAB 4X6FA 3TH3T 4OQ1A 5DJ0B 4WWKD 3BEVA 1A6ZA 3EYUL 4L9LC 4XXDB 3OXRA 2XZAL 3I3DA 2UV3A 3TV3H 1KNOB 3MJ9L 4F9LA 5AEAA 5DMGD 4N1HB 3TBSB 1QOKA 1YEDA 4XVJH 3D2UB 3L3KB 5KS9B 1IAII 1VADB 4J7RA 3SO5A 3IDGB 4K7PH 4LLVA 3U0TB 4I3RL 4YDVB 1I1FB 3ARDC 3AS2A 2NYYD 3IFNH 3H0TA 2NY1C 2EDBA 1LHZA 2LVCA 3V6OC 1A9EB 3MV9D 1F11A 4G6KH 2R2EB 1RZIA 4FTVB 4HG4K 2V2TB 1BIIB 3KGRA 3HAEB 2FL5A 5CIPH 1FZJB 4LCUB 4DUVA 1TNNA 3EFFB 2Y06H 5IVNA 4F7PB 1FCCA 4GT7A 4PP1D 4S1QH 5KJRL 1AGDA 1FL5B 1GZPA 1WFOA 1IKFH 2AQ2A 2DIBA 4IM8A 4UTBL 1N0XL 3DVFA 3FT4B 3O6KH 2ERJC 3QUZC 3LS4H 1QPPA 3S37X 3SE3A 4YHLL 1ZHBB 5E6IC 1QR1B 3BP5A 2BSSB 5GGVH 5DZOA 3PWPD 3OKNB 3S5LA 3UX9B 3BXNB 5ACZA 5FKAB 3T3PE 3GM8A 5DD3L 4XWOD 5T1MA 2MWCA 4OLYH 4YLQT 5IJKC 2Q3AA 1EZVX 1PQZA 5FECA 2VDOL 4PJCF 2K7QA 4U49A 4G7YL 1KN2H 4OF8A 3OJVC 4OBSA 4BYHA 3OKMA 4RAUB 3SDAD 5FCSH 1A3LH 4WI8A 5EUOF 3UTTB 4PJBE 3FMGL 1ZEAH 1ORQA 1ZT1B 2YD3A 3P0GB 3PV6A 1FNFA 4NBXB 3ME0A 3OAYH 1QLRA 1F8TH 5EU7C 3RDTA 1SJHB 3HCVA 1J88A 4CJ1A 2QLVB 5EOTB 3CXDH 5JDSB 3ARED 1EEZB 4UINL 2FX9H 4OQTH 4ZAKD 3WIHL 1FNHA 3QI9A 3TFKC 1ADQH 4TVSa 1HH9B 4Y2DD 3WD5L 1EH9A 3WN5B 3CFCH 4PGBA 2XOTA 2NNAA 4FXLA 1KCKA 3MNWB 2WBJC 2FBJL 4PGJA 4U31A 4LVHC 1DCLA 3V7MA 1OQXA 1KLUA 1HSAA 1TPXC 3REWA 3L6FA 4Z7OF 2NW2A 4PREB 3F7VA 2X4NA 2VABB 3ZHLA 1BVZA 4WO4A 4XC1H 1KTLA 1DVFC 2I24N 4NQDA 2Y1VA 5HI4D 2VUYA 3FB8B 2MOVA 4F2MB 2GUOB 4WTZA 4HWEL 3UBXA 4OCSL 5D7JB 3ZKXB 1NCCH 4XMKL 5FYKE 5AAWA 3G6DH 1WCQA 4S0UC 4LCWD 3RWGB 3DX8B 1FAKT 4CNIB 3W9EB 3BUTA 2ORBH 4R0LB 1GGTA 1UZ6E 5DMIL 3MROB 3O3EA 4K71B 2DYPD 4OLWH 3B6SA 5D1ZD 3HZYA 3RU8H 3ZMRA 2GSIB 3VXTA 4WWID 3WFCH 3UXFA 4AL8L 3BPNB 3V4UL 2AXHA 1G0DA 4I5BB 1PW3A 1D5XA 4WEMB 3BKMH 4XNUH 1YECL 1XCTA 2YZ1A 4V3EB 1RULL 3PDDA 3FFCE 3NFNA 3K1DA 1YA5A 3NIFE 1EGJH 1ACYH 1RHFA 2AJUL 2CO7B 2CR3A 3SDCB 5HHMA 2DICA 2NY5C 1H8OA 4KHXH 4DUWA 5B3JE 5SX5H 4OCYH 5A2IH 3SE9L 4GKSB 3T0EE 4ELMA 2HJKA 1NFDB 3GBMH 1VHPA 1XH3A 4PGDA 4PJAE 3VFPA 3L3GA 3BIKB 4LDLB 5CEXB 4D9LL 2RQ8A 3BQUA 3GBNH 3C5SB 1T7VA 3ZE2E 3DBXA 2GHWB 3FOMA 1G1YA 5DD5L 3RIAF 1KXQE 5F1IA 3VWKC 1M7XA 1GHFH 2OBGA 1EO5A 2OCFD 3MRJA 4XB8A 4Z18A 2VZ3A 4BQ6A 4E41D 5FYJL 4LF3B 1N4XL 4JGUA 4GAFB 1G1CA 3BWAB 3C6LA 5DO2D 3VXOA 5ADPH 5AG9A 5C0BE 1GGBH 2XXCB 3BI9X 3WKNA 3VD9A 5GIRB 1TJIH 1GYAA 1Q1JH 3G5ZA 3L3OB 4OCRL 1UYWH 2WZPD 1TQCB 1YEJH 2G5BB 3UZEA 3DECA 4HMDA 2VC2L 2A1WH 1E27B 4L4VD 3GMNA 4APQC 1LO5B 4Y5VB 5F3BB 4NRXB 5HD8C 4RRPA 3QDJE 5EORH 3DMMB 1J10A 5L2KD 4MNHB 2JJSA 2EDKA 1OAQH 1G7PB 3D39B 3WXVL 5FHAL 1I85C 3A6CL 4POYA 4UNTA 2R4RL 1YMME 5IFHL 1MWAA 3L1OL 1CVSC 3K8MA 2ZOLA 5H2BB 1AR1C 2Z35A 1F4XL 2ZNWA 2DTSA 2PR4L 3MXWL 2VR5A 4BUHA 4WW1B 1UADC 5C0CA 1RUPH 2ADGB 1DQLL 5EUKB 4NKDA 4G6MH 2X4OB 1MRCL 1Q0YL 1MCIA 3B43A 1G0XA 3STZB 3RWJA 4MXWH 1J18A 4BSWB 2BJMH 4J4PC 4M5ZL 1ONQB 2E9JA 3S88L 4FP8H 2QKIA 1TVHA 3BMWA 35C8H 2HT2D 1FAIL 3H9HA 1NMAH 4JRYA 3OQ3B 1HOCA 3TO4C 2VLMD 4M03A 4LAQH 5EBWA 2DWEB 4GS7B 2XZCL 3IXAA 4OUUA 5DWUH 3RZCD 4HJGA 1JHTB 2OTWA 1GGCL 3VI4F 3NABH 3HPJA 1CXEA 1TDQA 1R3KA 4XP4H 4PJEE 4BZ2L 3RNKB 4UB0H 1QACA 1S9YA 2DQCL 5E00B 1KJ3L 5JXEA 4YDIH 2VITA 2R23A 1MCNA 1YQ2A 3ARXA 4XBGA 4U1SB 1U9KA 2NTSP 3S8WA 4OGXH 3L95B 2ATPA 5C0RH 4KDWA 1XIWB 2O5ZH 3SCMD 1BX2A 3CFJB 4FQQA 3BHBA 2YXMA 4PJ8D 4ZS6C 2L4OA 2P44B 2VH5H 1Y18A 3JV6A 2G60L 4U1MA 4LRIC 1GC1L 2QSQA 3PDGA 1JPTL 2NY4D 4X9BA 1T1ZA 4GUPB 3UTZB 3RIAK 3HMWL 4GXUN 1CT8A 4OV6F 5EO1B 5I1IL 1A4KB 4ZSOA 3U46B 4R2GB 5JHLH 4B41A 4D0BB 1QBMH 3GJEA 4ELMF 4Z7UA 3CX5J 1PSKH 2X4RB 2EDEA 4N1CA 4DN3L 2AKRB 3U2SB 2Q76A 3OKKA 3T0EC 5TGBA 5DSCA 1N6QH 5EN2B 5FYKH 4U05A 1YJDL 3RTQC 5BRZA 4R4NC 4OFDA 1MJUH 5I76B 4I3GA 5IK3B 4M5YL 3OKDA 3PJSA 4OGZA 5MHSE 3KYNA 5MEPA 4QNPF 4LPTA 1YEEL 4HZLA 4Q2ZB 2KQNA 1CF8H 1INDL 1UWXH 2HRPL 1KEML 2XRAL 3B9DA 1BLNB 3TJHD 4N8PA 2BVQB 1BPVA 1U3YA 3VXSD 4JZJA 3I75B 3C8KA 3DGGA 4ZTPL 1I7ZB 1BQSA 4P23B 1S7TA 3ES6B 3MACH 2VDNL 5KVMC 5KSBF 2IPTL 5IP4A 1FNGB 4CDGC 15C8L 3CMOH 4MXVF 3LZFL 4IOIA 3O9WC 1RMFL 3ARGD 4XH2B 1GGIH 4XPAH 4F3FB 3JTTA 1F13A 4LCIL 2DM3A 4O2EB 1I1RA 4X0KA 3SDDB 2WV3A 1VFBB 1MFNA 2B39A 4HC1H 2ICWI 2Q20A 4EUPG 3I6LD 3FT3B 1KCSL 3KPRD 4P3CH 2CDEA 2CKBL 2R1YA 3OAUL 1MREL 1FP5A 4R7NA 5HHOE 1JWSB 5ECJE 1WBYB 2DWDA 5IEKB 3QB7C 1AD9B 4YBQD 5EOCH 2B4CL 2CK0H 2BSTA 1RHHB 1IKNC 3O0RH 1T21B 5EULV 3C2AH 1JRHH 2ICWJ 3GFUA 4YX2L 3ARZA 5IBTH 4HFUL 1OP5H 3OKOB 4CVUA 4WFHD 1DQDL 1WT5A 4B7IA 5I1EL 3FRUA 3OKLA 2IBZX 3L3HB 4KRPC 3NACL 5FGBC 5HGHA 3VXME 4J3WA 5HGAB 1X5FA 1A6WH 2BHUA 4MB4A 3M1BB 4H0HB 3SGJA 1IRAY 5I19L 3FZUC 3LEVH 3SJVE 4UTAL 4Z0BH 5ESVA 1SYVA 4OKDA 3WFDL 1MAKA 4XT1C 1IM9A 2BERA 1CWVA 2VDPL 4NZTL 2BY1A 1XF3A 1JGUH 2PYEE 4NQCE 2HTLC 4KROC 2D7PA 1G7IB 4E0RB 2Z8RA 1AQDB 1IGTA 1T2QH 1WBZB 3WUZA 4C56B 4PRNA 2X1QA 2EIZB 4JKPL 1QSFB 5CGTA 4Z95H 4MHHG 4XAKE 4ACPA 1CGWA 2CDFA 2WUCL 1QFWH 5CHNA 2CRMA 3IDJB 3B9KB 4U6XA 5EUOE 3V6ZA 3QEUA 1ZLUK 3ZT5A 5FO8A 2H32A 1LD9B 1N64L 1KEGH 4W4NA 4WFFE 2NZ9C 4Z7UF 4QXWA 3HZMA 1QYGH 1I9RL 4L4TE 2Z92B 3ECBB 4M43L 4PB9H 1U58A 4JHWH 3GJFK 2MQCA 1G84A 2Y5TA 4EIGB 2Z0BA 4OM0L 3MR9B 4PJDB 2VIRA 4R90H 3FO9B 3CZFB 2QADC 5EZJA 3UTSB 3KDMA 2APFA 4GO6B 4NC0B 4Z7QF 1WCBB 4Z7OE 4FQ1L 5D6CB 3SDYH 1NGZB 4PLKC 3MBXH 2V7NA 4EXKA 3SOBL 1NCTA 2P5WA 3NFSL 1RURL 4XGZB 4HF5L 3KR3L 3ZE0F 5D7SH 1AI1L 1DLFH 3MV11 4YBLB 5ID0B 4F33A 1BEYH 3GSOB 2V9QA 1EFXA 3ARDD 4ZXBC 1OQOA 1KCRH 3U4BL 2NY1D 3WEXB 2COQA 1BM3L 4FZEL 4PJ5A 1TFHA 5TF0A 5IR1A 2C1PB 4GG6A 5I6XC 3CC5A 4JVWA 1QRKA 3TF7A 5DUBB 2R29H 1JNNL 5AZEL 3DYMA 2FX7L 4HKJA 3AB0B 1OARL 4JVPA 1DTUA 1F58H 1VFAB 1EO7A 5EBLA 2PN5A 4D3CH 2CKNA 3QUZD 2XN9A 4M6OH 1P2CB 3CPLA 4YXLH 1MI5A 1QFWL 1KCUH 5E6ID 1F00I 3BW9A 4ORGB 1PBYA 3TVMA 4LPYA 4TVPL 5CJXC 5D72L 1VDGA 5E8PA 3V7AE 4NN7C 5D6DA 1W72H 3GB7A 3LQAC 3H2WA 3QEHB 3WXWH 3P9LA 4LIQL 4X4ME 2D03L 4JZOA 4MNQB 1PX4A 1UQSB 1CD1A 1M7DB 3D18B 4ODHL 4RNRA 3VG9B 4CVZB 5DDHA 3QZWB 4HH9A 4N0FA 3RGVA 2R2BB 2X70B 2HLAB 3EO0B 4JANA 4WI5A 4HULB 2ICEB 5HHNA 1IC5L 3GRWA 3HUJA 1T03L 3DVNA 3IFOB 1IBGL 1KB5L 2E8YA 5C0IA 1O5DT 4XP9L 2ZUTA 4PJ7B 3HE7C 5IW1A 5I8KH 1AGCA 1FORL 2VWEE 4P9HL 3NIDF 1U8JA 2V2XB 3QUYA 1FVEA 1S5IL 4HWZB 4QHUA 4Z7NF 1XGYH 3JVGA 1BOGA 1NCAL 1DLHA 5FA3B 2HFGH 3EGSA 1J1PL 5FXCH 3WL9A 3AS1A 5BW7A 1J8HB 3WNKA 4DW2L 4LNRA 4PTTB 1OP9A 1BIHA 2Q86B 1PD6A 1W0YT 4TUKH 5E2UH 5K59F 2WBJD 3LQAH 5KAQG 5J13B 4D9QE 1QRNE 1UH3A 4K3JH 3V0WL 5I66B 2GI7A 5ADOL 1EHLH 2UWEB 2E9WA 5DK0A 4P57B 2WWKT 1T22A 1DVFD 1XR9A 5F1NA 3UZVB 5EIQA 1U8KA 3P3YA 4G9DA 4LMQI 4U3XA 4DCQB 2DB8A 1CGTA 5FO7B 3H7LA 4HUKB 3IDUA 3MV7D 3QUML 4ZDHA 1TTUA 1RJZA 1N59A 3BGFC 1HHIA 5HYEA 2D4DA 5I0ZA 3U4EB 1D7FA 1WWBX 5HGBA 2AVGA 3M07A 1IAMA 4A6YA 5FUZL 5LCVH 1MCLA 2GY7B 3V8OA 1UJ3B 3VGBA 2OJZL 1FNSL 5JW4R 1JN6B 4G80B 4KKBD 1DP0A 1MFBL 1MVUB 1T5WB 5J1AB 1GRWA 2I07B 2F74A 3VXRA 5L6YL 2Y9RT 3LKSA 2BSRB 4I18B 4PRPA 4ODXA 1F5WA 4NQDE 1U8MB 2BVTA 1WK0A 3GSXA 4EJ1C 1IFHL 3KWWA 3AMLA 3NAAH 5HYSA 1YEFH 1NEZG 5E8OB 4O02H 2DQJL 2OXGA 3VI4E 2HFFB 2WIIB 3DV4A 4KJWC 4QRUA 1A6VL 5GSRA 4PGCB 4NT6A 1ZVHA 4WV1A 4KJPC 4PS4L 2PW1A 4GG6F 1CK0L 4GW1A 1AGFB 3T4YB 3EDJA 3RWEA 1CD8A 3TIEB 4U1IA 3ZDXF 3TNMA 4V2CB 3U9UA 4PRHB 5DJXB 2FJHA 4U4BA 4F9LC 4PJIA 3MRPB 4JFZL 5BXFA 1E6OH 2BNRA 1P4LB 2DBLH 5BS0E 3VWKD 1OWRM 4P2OB 4RCAA 4HS3A 1B2WL 4GOSA 4RIRA 3RY4A 2UZIL 4Z8FH 1B0RA 1TZIB 3AROA 1U2CA 4X7SH 5DI8B 5IW3A 3GI9L 4GRLB 5I1HH 2D3VA 1F3RB 2V5RA 4IHOA 2LU4A 3HG1A 3TA3A 5IHZB 3EYOA 3BWUC 3EJZC 5HHME 2WK2A 4ODUA 2A77H 5CP7B 2J6EA 2IANA 2EXYD 2EC9T 4H1LG 4JFQA 4Z7WA 4OD2B 1X6NA 5F7LB 4ELME 3QH3A 3STLB 5JLZA 2P42B 4WHYH 4APQD 5IQ9B 4CMHC 3F5WA 5GGSY 1T7XA 4YNYB 2AJ3B 2L7UA 5HD8D 4ZUWB 3V4PL 4MS8A 3KLAB 4X4ZA 1A3RH 2YK1L 3SE3C 4JR9H 3KHQA 4H1LH 3H9SB 4ZODA 2FDBP 3D0VB 5E5MB 4C55A 1AGEA 3T4AB 1FV1A 1T1XA 5GSVB 1AR1D 1VACB 2VWEC 3I84A 4QNPE 3PIQA 3O41A 5E7FA 1MRDL 2QV2A 3KPNA 2BNQA 5DJAA 3TWCL 4DTGL 1ZKAA 3IDXL 1YY9C 5GRJH 5E70A 4AT6B 5KSBE 3B2VL 4Z7VA 2P24B 3MNVA 5CFHA 4G43A 1CG9B 4MXVE 4GKZB 1RUML 3E2HA 3V9FA 3O3DB 2R8SH 4XP1H 4J4PD 3M8OH 1AR2A 3B3IB 5B21A 4HFWB 4YE4L 4D0DB 4G59A 3MLWH 3RDTC 3TO4D 2FCBA 5C0AA 5AUMB 4FFYL 2CK2A 1JNLH 5C6WH 1JI2A 5C0CE 3FN0L 5MEQB 3CUPB 4FS0A 3QI9C 4M8QA 4TSCL 3BKYH 2OQJA 1TETL 3IDYC 2OSLA 4TQEH 5FYKD 4GXVH 1UB5A 2W0PA 1BQHG 5D2LB 1UKSA 3SE4A 4CW1A 4Z78B 5GS1A 1QHOA 4XAWL 3WHXB 5FKPA 2WM0A 4KTEL 3LKNA 4ZTOH 5FF6A 4TSBL 2R9HC 4JRYE 2ITCA 3UPCA 4KMQA 4YHIB 4HX1B 5TFSH 4WO4C 2GJ6B 5TQ0L 4ZS6D 4HKBB 1U95A 1U8PA 4OLXL 1U8QB 1HZHL 4HIXH 4OKVA 4OF3A 4R4FH 5D71L 2AJYH 4I77L 5CBEB 4MVBC 1OGTA 1Y0LB 1TJHL 4LLMA 3DTXA 4HS6A 1ZLWK 3MLTA 1IT9H 3FFCD 5HY9A 3BH9B 1QBLH 1QSEA 1FNAA 1LE5B 3BPOB 3LHPH 4IRSB 3BZEA 2C4FT 1OAZL 5KW9H 1UFUA 4OAWA 2EE3A 4HK0A 1CBVL 3T0ED 4OTXH 1JFMA 3E6HB 2OLDA 3QQNA 3VXQA 1OCWH 1G7LB 1WF5A 3RTQD 1P53A 2W0FA 5F71A 5HYJB 5FO9A 4R4ND 2NW3B 32C2B 4XPGH 1IAOB 3HZVA 3O6FA 1AXSA 3HC4L 3VH8G 1MCWM 1MF2H 4ZFFA 1FGVL 1T4KA 4PV8B 4ZSOE 4X6DA 5C0BD 2YBRB 4Z7WF 4U6HB 4Z7UE 4N5EA 1A4JB 2RHEA 4Z77B 2R2HA 1WTGT 1UACL 5CZVH 1A14H 3BQUC 2A6IA 5A2FA 4EI5A 4TNVF 2AV1A 2FB4H 1K3ZA 1N6UA 3D85A 1KENH 4HUMB 4I0PB 3GSNA 3DIFB 3GSVB 3QDJD 4G6KL 5F44A 1NCDH 2A9MH 4YFLI 2FR4B 5B38G 4JY4A 4S2SA 2L0DA 5BO1H 3FN9A 4G6AC 1YMMD 4KU1A 4S1QL 4PJHA 1C5DB 3GM0A 1CFQB 1NGWA 2Q8AH 3CSYA 3O6LH 5CD3B 3V8CA 3LY6A 1ORSA 2VRAA 2N7AA 5ELIA 1FYTA 5E1HB 2OTPA 2W38A 4M6ML 4OD3H 4U6YA 4Z7VF 3EOBA 4XCYB 1DBKH 2ZG2A 1I1AB 1MY5A 3QP3A 4S1RH 4XCFL 4ODBD 3ZKQD 3O2WH 4F9PA 5B39A 2NTFA 3SPVB 5IWLA 2JJSC 1C08B 3W11C 3MOQA 2Z31C 2VAJA 1CXFA 1KUMA 3WDJA 4RMVA 2VDQH 5DRWB 5JIKA 1OGAB 4OCMC 4QTIH 5T3XL 4L3AA 4LQFH 2NY0C 4KRPD 2E27H 2P8LB 4OZ4A 3BZ4B 4BQBA 2DIAA 4WRLA 4BK5A 2YD9A 1WBXA 1AXTL 1ZLUH 1RIVH 3FZUD 4G7VL 4Q0XH 4NWUH 1ZA6B 4OT1H 1Q9KB 5D70H 1E28A 2JK5B 4NHCH 3S96B 4MD0A 2GFBB 4LASH 4YDJB 3RVTC 1JUFA 3VGAB 2FX9L 4OQTL 2W9EL 2HTLD 3GJFH 4KROD 1QFOA 5IG7B 1E4KA 4JN2A 1IL1B 5F93C 4LLDB 3T2OA 3CFCL 2CKBB 5FA4B 2ZCHH 3ZT6A 4WWKB 1IQWH 1YEKL 2VLRB 5DURD 2J8UF 5IF0A 5FGSA 4UBDD 2J7LA 4NQXB 1AKJD 1NDMB 3T77B 5DFVC 2XNAA 1EXUA 1FZOB 5KG9A 1ZXQA 4NSKA 1MWAH 5K33A 1R5IA 3PGCB 5HDQL 5JXEC 1TQBB 2NZ9D 2C3VA 4J3OC 3C9NB 3NIDE 1UT9A 4JDTH 4DOHB 1JZ5A 3SDXE 5D5MB 5D4QA 3DYPA 1SHMA 2VN4A 4Z7NE 3MUGA 1R3JA 1RIUL 3RX8A 3MV9B 3ZTJH 3PHQB 2ORBL 4OLZL 2AK4A 4F7CB 4JB9L 4J8RB 1U8HA 4UV4H 1VFUA 2IF7A 3IS0X 3MREB 4M7LL 4TNVK 5K59E 1NCWL 5IOPB 4DVBA 3QDGB 2QADD 1FVCB 2NY6C 4X6DF 3WLWC 3QCTL 4YHKH 1TMCB 2NR6D 4KXZI 4WHCA 1CR9H 1MLBB 3QWQB 3PWUA 5DEFA 1MQKL 4PJFB 4PLKD 4L8CA 2EEBA 3BKML 4ZQKB 1HYSC 4XP6L 1YUHB 5DQ9A 4HXAL 1RU9L 5IBUG 4XP5L 5A2KH 1EGJL 1K4DB 1YC7A 3DI3B 1WICA 4ZOAA 4ZXBD 2VKWA 1LK2B 2Z93A 1T04A 2BC4B 4KMLB 1JGDA 3S6CA 4FA8A 4PJHF 2X4UA 1MH5B 1DL7H 3NZ8A 3GBNL 1WLHA 1P6AB 4I48A 3IJHA 3SDAB 3QXAA 1FJ1B 2PYFA 1GHFL 2OZ4L 3E0GA 1S7QB 2DQUH 3VFWA 5HHOD 4JZJC 2GT9B 1NKOA 1A22B 4P49A 1I8MB 1HXYA 3ILQC 3QIBB 4J6RH 5ADPL 3LKPB 2X42A 3HR5A 2Q7NA 5CJBA 3DETC 2HJLB 3D87B 4HT1H 3UJIL 3AREB 3U79A 3DUUB 1U6AH 1V7ML 2YA0A 4RMQA 4Y2OA 4ZAKB 4PJ5E 3IS1X 4Y5XC 1FRGH 4HEME 1VGKA 5E6YA 2J4WL 5EPMA 4GG6E 4BSVA 5BJTA 4Y2DB 2JJTA 3ALWA 3P0VH 3QUXA 3CLFH 3ZDXE 3BPCA 2ZUYA 1O7VA 1NSNL 1U3HC 1DE4B 2ZOKA 5DHVA 3MNZA 5MEOA 3VXMD 5DS8B 2NY5L 3EDEA 2R0WH 2XN9E 4PB0H 2VDML 3U6RA 3IVKB 1MI5E 5FK9A 5I1DB 4KRMB 1CXHA 5E2VL 5B22A 3SJVD 1HILB 2FIKA 3HE7D 1CLYH 1VFMA 4HS8L 4NNPL 1T20A 5DMKA 2OI9A 4Z5RB 1G9EA 1HH6A 4JO3H 1S7UA 2PYED 4QLRA 4NQCD 3RWDB 4DFIA 1MRFH 5ANME 1WT5C 3HS0A 3TIDA 2YZ8A 4HPOH 3V0AC 1M6OB 1B6UA 3CH1A 3KYMA 1F90H 1MUJA 1UM4L 4PGEA 5JXAH 3TBWB 3KJ4C 2HH0H 4NZRH 4G8IB 2YOCA 1NKRA 2DYPB 4XAKD 5D1ZB 3SGJC 1HXMB 3DX6B 3Q0HA 3N9GL 4LAQL 4OJFL 3FT2A 5ESAA 5CEZH 5DWUL 4WFFD 3HC3L 3LS5H 4L4TD 3MLZL 5LGJA 4LEOA 4PY7B 1AHWB 3V52L 1K6QL 3LEYL 5I71B 2YA2A 1TITA 1OOAA 4G42B 1JPSH 2J1KA 4Q6IA 3QNXB 4R97C 2XTLA 2X7LB 3OJ2C 4JLRA 4OFYA 2YA1A 1J0HA 2YR3A 1KB5B 3VXPA 3OJMB 1FH5H 1NL0L 4M7KH 2O5ZL 4H88H 1J86A 1R3LB 5EO0A 5F96H 1YDPA 5FV2A 2BMKB 1NC4A 4UQ3A 4MZ3A 4QCIA 3L5XL 1RUAH 2D0FA 4WIQA 4H5SB 5CD5C 4CBPA 4JFEB 1MOEA 3VGHA 1KIQA 4PP2A 4KJWD 4NM4H 4R26L 4XNQA 9CGTA 1QBML 1SJEA 4KJPD 2CLZA 4L4VB 1PSKL 3R06B 1GIGL 5HDLA 3SBWA 1EVUA 1ZT7A 5M7QA 3RJDA 3PG2A 3O3BA 3VFTA 5L2KB 3VXRE 4RFEA 1U92A 4PRPE 3BAEL 1RUKH 3P40A 3F7RA 4M6AA 4NHUB 4YR6B 2P8PB 4PJXA 5HPMB 4KJQC 3QFJB 4XVUC 3HI5L 3QUMB 3PP3H 1Y6NR 2V2WB 2LTQC 4M61A 4X6CA 3OMZA 2FJGA 3DUHA 4YC2B 1CF8L 1RK1A 4OIBA 2H32H 4EZMA 2HKFH 1CDGA 4YPGA 4HAFA 4MB3A 5E6ZA 3L7EA 1OVZA 5A16B 2IQAB 5LWYL 1CICA 2DAVA 4PJGB 4OCXH 3RVVC 3BEWA 1A7QL 2X40A 1WEJL 1FFNB 3MRKB 1JZ4A 3TF7C 4NC1E 4GFTB 4ONGH 1E4XI 4LSRL 1II4E 1N2RB 4E9LA 3V6FB 1G6VK 5I8CA 2BNRE 4PLJC 3VXUB 3WNNA 3X3GH 3KPPB 5EBMA 1FYHB 4YWGL 2R39A 5K9KB 3TVMC 4ZFZB 3HG1E 1AP2B 4RWHA 2VKXA 4P3CL 3OG6B 5T1KB 2P5EB 5D6DC 4X6EB 4RGOH 4Z7WE 4K94L 4U2YA 1YY9D 3TCXA 3CVHL 5F7HA 2R0KL 3O0RL 4P4RA 5DLML 4JEGB 1CXKA 1I8IA 3RGVC 5TDOA 2XV6B 4KKLC 4MQSB 3W0WB 2YPLE 4GKNB 3REVA 5K9QI 3B83A 2FYYB 3SCMB 4ODVL 1X5IA 2WLZA 1HINH 3ZYJA 3PP4H 1BD2E 2AJZB 2H3NB 4PJ8B 2IJ0C 3QEGL 4D9QD 1QRND 4N8VG 4EI6B 4ODTH 3IGAA 3IU4L 4J3VA 3QUYC 1NAMA 3G08A 3RDTD 2NY4B 4QGYA 3RA7H 5FM5M 2BNQE 2WWKO 5I16B 1C8PA 4X4XA 3WFEL 3TT3H 3LEVL 3UMTA 1ITBB 3JVGC 2HRLA 4Z0BL 1P9MA 3WFBH 5GISL 3QI9D 2R0LH 5BW7C 1WSST 4GW5B 5D1QB 3HNTH 3RBGA 4Z7VE 4F7TA 2IAMC 4LU5H 4OM1L 5BMFL 2HLFC 3EYVB 3LPWA 1G7MB 5FIEA 1KJ2A 3K4DA 4ZOBA 1T2QL 5FDWB 2F53A 2R9HD 4DZ8A 2YC1B 3LPFA 5FOBA 4QT5A 4OIIH 5C0AE 5L0QB 4WO4D 4MJ4A 1JMZA 4NQDD 5EZOL 2DIJA 3QSKB 1NLDL 1PLGH 4MQTB 4ZUVB 5E99H 3QG6B 2CQVA 1M1SA 3GRWH 3ULSA 5I9QB 1NBVH 2DKUA 2YSSB 3AU1A 5DUML 4MVBD 5CJ8A 3VXSB 2DQHL 3QUKA 1JBJA 2IPUK 3R1GL 4HGWB 2VUOA 2VQ1B 2CDGA 1JF1A 1HI6A 3FB6B 1W0WB 5IVZA 3QIWC 1H0DB 4ELKB 4KPHL 1SBSH 5F7NC 5LXGL 2A83A 2E9BA 5I8OL 4PJXF 5D1XB 3FQWA 2XY1A 2ZKHH 3ELAT 1E4WH 4EN3A 2DLHA 2OYPA 1A7OH 2J8UE 2G2RA 5BS0D 4P3DB 4X6CF 2E7MA 3EYSH 5F7KC 2R4SL 3WLBB 4KHTL 4OSUH 2YPKA 5SWZA 4F7EA 1FIGL 5DD6B 4OZFA 4MSWB 2VDKH 4WV1C 4CN6A 1JPGB 5J6HB 3C87A 1QSEE 1FL3B 5DVOA 2F8OA 4NQVA 5HHMD 1IEAB 3O4OB 1F4HA 5GHWH 1OT2A 5HGDA 1S7RB 4B0MM 5JUEH 5C0GB 1LEKB 4NC1C 3CK0L 1UZ8A 5CWSB 3BQUD 1MHEB 2AI0H 4GAGH 2OJEB 4KKNA 4B5EA 2QQKH 2ITDB 3PNWB 2J5LB 3MLVL 4JDVA 2APXA 5MP6L 4A6YH 4IRJB 1UA6H 3RWIA 4ONFH 1FZKA 4YHML 2Q6WB 1A3QA 1MPAL 5EOQL 4Y4HA 4HJJH 3TA3C 3WIFB 1AFVH 3RWFA 3NBNA 2YRZA 2CIIB 3SQBA 4NYLB 5C9JA 4QYOB 3BT2L 1OB1A 4IS6A 1LNUB 4K9EC 4WJ5A 5C08A 5E9DA 4BZYA 4CVXB 3T2QA 1OD9A 3WE6B 3K74B 5TDPA 4MS8C 2DQFA 1NGXB 5DJYA 3MODL 1F4AA 3QEQA 3W11D 1YEHL 2KDGA 3DVGB 1TZGH 2Z31D 3WXWL 1J0KA 3DI2B 1ZANH 4JZNB 5SWQB 3O8XC 2X4PA 4L8DB 4PJHE 25C8H 4KKAC 1XGPB 4HHAA 4KY1L 8CGTA 1LILA 4X9IA 3PV7A 4JAMB 1A6AB 4XXDA 2DDQH 2NY0D 1MIEH 5D9SB 1CLOH 4TOYH 1KNOA 1ZHKB 3MLXH 4HIHB 4LVOC 3BVNB 5C0CD 3TBSA 4WHTB 1RD6A 3D2UA 3L3KA 4V1DB 5JR1H 5KS9A 4H26B 1FIEA 1D5MB 4F7MA 3U0TA 1P4IH 2YUZA 4YDVA 3RVTD 3RX7A 5SX4I 5CIPB 1CL7L 1I1FA 2J6EH 3VW3L 2E7HA 1GZQB 5EZLB 1T0PB 1J0ZA 1EJ6A 1DQMH 1A9EA 3JUZA 4K9EH 2J3SA 1EUTA 1X6LA 3FQRB 4JRYD 1MQ8A 3QNYB 5JQ6H 4FTVA 5I30H 3QFDB 2V2TA 4OCWL 3HAEA 4L9LB 3MGOA 5GGRB 4XNXH 2D31B 4LCUA 5IB5B 4F7PA 1B6DA 5DFVD 3PWVB 1KTRL 3MV8E 4NKMA 5AYUL 3FCTB 2F19H 3FT4A 3NZHH 5DVKA 1YEIH 5C0EB 3MOAL 4ZNEE 1ZHBA 4P9MH 3ARRA 2BSSA 2V5SA 1QO3B 1D5IH 1I75A 1OF2B 3SE4C 1M7IB 2FEDC 4G8GB 2GJJA 4ORZC 3OKNA 5IVXB 5GS1C 4FFEX 3U7WL 3D3VE 2QJDA 3ARDB 3BXNA 5CUSL 3TYFB 4PRIB 2ZCLH 4FXGB 2QBWA 4X7TB 4BFIB 1GAFL 4UI2A 2EH7L 1WFUA 5FYLE 4BQ9A 2Y36H 1NFKA 1MFCH 2Y25A 2FEEL 3GUTA 3CU7A 3LPGA 1CDUA 4JCLA 1IAIL 3VFMB 1IGCL 2WINB 3SKNB 3DJ9A 4RAUA 2NY6D 3GMPA 4MLSA 3UTTA 3WLWD 5K9OA 5F97E 1W0VB 5CEYB 3WS3A 1BF8A 1DUZA 5ENWB 2FX8L 3T0VA 1YEFL 4D2NA 3QRGL 4EDXB 4LHUA 2D0HA 5EOTA 1EEZA 1H3XA 3RWCB 1RIHL 4P5TB 5F8RC 2AK4E 4JO2L 4GLRH 1DEEB 3CFDA 3EO1A 1MFDL 2VNCA 3KYOA 2PUQT 1N3NA 2EH8L 4Y4KC 5E2TL 4P46B 3MNWA 3U9PH 2ADFH 2DBLL 1DN0A 4WUUB 4Y1AA 1NMBH 4KGJA 4JQVA 3NH7H 4PUBL 3RUGE 4Z8FL 5ALBL 4PREA 4M48H 1YNLL 2VABA 5JZ7C 5E2JA 5GJSH 3ILQD 1ZE3C 3LH2H 4EI5C 2R0ZL 3DETD 3FO2B 4OUOA 3LIZH 1AC6A 2A77L 5DT1H 5D7JA 5JMRA 4LSVH 4LCCB 3W9DA 2JJUA 3SQOL 1PG7H 3RWGA 3HE6C 3DX8A 4Q74A 4EEEA 4CNIA 3VFSB 3W9EA 4QRRB 1EDQA 1PEZA 3HI6L 4R0LA 5IESL 4GSDL 3QDMB 2C4FU 3AUVA 3WNOA 2WBJB 1U3HD 1OD7A 5C3TA 4CUCA 1TPXB 3IDIB 3IJSB 3KG5A 1DQJB 1QNZL 4RFOL 2GSIA 1YYMH 5KS9F 3MYZA 4OLVH 4FZ8L 1L7TH 1DVFB 4JY6B 3EOTH 2OR9H 2KQMA 4I5BA 4F9PC 1BOYA 5IWLC 5L7XH 1G9MC 3FQUB 2IH3B 3MV7B 3UYRL 3SN6N 3QO0A 1U8IA 1PJ9A 3SDCA 2V7HB 1C12B 3EOAA 1A1NB 2E7CA 2LQRA 2VAAB 4GKSA 1KV3A 3D1MC 4K8RC 4NRZA 2ADIA 3GSNH 3Q5TA 5I1GH 1UJTA 3BIKA 3OKYA 4UDTB 5CEXA 2F58L 2IFFL 5IQ7H 3VD3A 1LWRA 2RFXB 4UQ2B 4M7LT 5FUOL 4XB7A 3NCMA 3D25B 4PGZA 1NUGA 2H8PB 4W6YB 4LF3A 1IM9D 1QFWI 4KK9C 2H1PL 5ISZB 1JNLL 3BWAA 3P11H 4H20L 4L8BB 5CJQL 5CMAB 1I9JH 3RNQA 1E4KC 3FAWA 4PP8C 1ZAGA 3L3OA 3RAJL 1AC0A 1HKLH 4D9RE 2G5BA 2C7UA 2GCYB 5DYOB 2BVUA 1JZ6A 3K4AA 1G9MH 4UNVA 2VLJB 2C1OB 1LO5A 4Y5VA 4NRXA 1FZMA 3GHBL 3DMMA 5J3HC 1YNKH 4MNHA 1UWGH 5T5NG 4MAUH 2DD8L 3UC0L 3B5TA 4FQ2H 3VWKB 1CGYA 4PD4J 5ACMA 1DR9A 1P69B 4K8RH 3O2DA 4DGVL 3DRQA 4HIXL 5H2BA 3B8YA 4LPCA 4YXHH 1MFAL 5CD5D 3WFZA 1Q72L 1QSVA 4UU9B 1A6TB 3N50A 5CP3H 1SEBB 1QBLL 4WW1A 1DBJL 2ADGA 1DN2A 2CPCA 4HXBH 5EUKA 2ZUXA 3BPLB 3TJEH 1JL8A 1KPUB 2X4OA 4ODSH 4OIAA 3VI3F 2LABA 1OCWL 4J3UA 1ONQA 4MAYA 4GAJH 1Z9MA 1A1OB 4KAQL 4PJBB 1V05A 5DHYB 3ROOB 2Q8BH 1BAFH 4KJQD 4XVUD 5A43C 4G9FE 2CH8A 2DWEA 3UYPA 1MFEL 4G8EB 2JCCB 1UM6H 5DXWA 3TBTB 1EFXD 2ZUQB 3V5DB 1E6JH 2HFTA 4J23A 4NCC2 1IGJA 4I3SH 3IT8D 3SGKA 3J8F7 1A7PL 4PJ5D 1FDLH 3RNKA 3OG4B 2KBGA 2W59A 3RVVD 5E00A 5CZVL 3QIUA 4OD1H 1AGBA 5A2JH 1SMOA 2P47B 3WIIH 4OGAC 4U1SA 1HNFA 1NCDL 5HHXL 1XF5B 3G5XB 2A9ML 3L95A 4PJXE 3T65B 4FABH 1FG2A 4PLJD 1XIWA 3VMNA 3BO8B 1KG0A 1ZWIB 2DM4A 2XN9D 3CFJA 2MQ0A 4YHYC 1XF1A 1MI5D 5SWSB 4X6CE 1ZGLB 3DSNA 5GGTA 3VE0B 4ZG1A 3TVMD 5C9KA 1IM3B 3CDYA 1YQVH 4HQQL 4GUPA 1S8DB 1ZLSL 3LN4A 3UTZA 4GMSH 5EO1A 3GHEL 3FO0H 3TESA 4AG4H 3LQZB 3VG0H 2JJTC 1T1WB 4EVNB 5EA0H 1A4KA 3QUXC 1FHGA 2DKSA 4D0BA 5HI3D 2FO1A 5GXBB 4U1LA 2Q7YB 1P7KB 2X4RA 1C1EL 4NQSB 2AKRA 3IJYB 4JJHA 4LGSB 2ED9A 3RGVD 1A21A 3U0WL 4KKLD 4Y5YB 5EN2A 4DZBB 3L5WA 4X98B 1XZ0B 1WAAA 3C60A 2XG5A 5KVGL 1XR8B 4LQFL 1KJMB 1XFPA 4IMKA 2EZ0C 2IPUG 4JO4L 4XMPH 5IM7B 5I76A 1S9VB 2OI9C 3FRPA 4N9GA 4JFXB 5IK3A 3QUYD 3H3KA 2VR4A 1CGXA 1QFPA 4Q2ZA 4Q0XL 4NWUL 4MWFB 4OT1L 1FBIH 4NHCL 2HN7A 3K2UL 1BLNA 4WCYL 1KIPB 2IAMD 1IQDB 5H8DA 1N26A 3I75A 2HLFD 1I7ZA 2CUMA 4P23A 4PR5A 2I27N 3F12B 4PJAB 1FNGA 2V17H 3U30B 4YFEA 2E7LA 2DL2A 1NCBH 3HN3A 5DD1H 4YXKL 4F3FA 4L8SB 1IQWL 4O2EA 2V5TA 1QFUL 4PD4K 3SDDA 5DHVH 1VFBA 4ESKA 1BWMA 2UVEA 3KJ6L 2J8OA 1JGLL 3BDYL 3CVHB 4MJ6B 4EUPB 3MLUL 4KZDL 4OFPA 4IBLT 4GG8A 3FL7A 4NJ9L 1JWSA 2AERT 1J0JA 1WBYA 5IEKA 4Q6IC 4UOW1 1QR4A 4O2CB 1AD9A 3GMRB 1LO0L 1RZKC 5ILTH 4JM4H 5F7DB 1Z5LB 2BVYA 3S3PA 4CKVX 4K7FB 3OXSB 1T21A 4QHMA 3QDJB 3QIWD 2F53E 2AAVA 3VXRD 2ZUVA 4PRPD 4X6BB 3JWOL 4W81A 4GRMB 5BOZG 5CBAB 3L3HA 1MCPH 2XWBB 5HGAA 2GKIA 5J6GA 1DSFH 3JV0A 3ETBF 3FO1B 4MDIB 2KZ1B 5GZOC 3F7YB 4X8JB 3PDOB 3SBWC 4KMTL 4I0CC 4M93B 4PYGA 3VDCA 1BBJB 3HNVH 4BH7B 2O5YH 1T3FB 3K7UA 1G7IA 4LKXB 2GITB 4KK8C 4JY5H 3GIZL 2JB5H 3MJ7B 2BNRD 1PX3A 1RZKH 1DL7L 1WBZA 2BVOB 2EIZA 4NP4H 4K3HA 1QSFA 4RAVB 5K9QG 4FQPA 3C09C 5SWZE 4RA3A 2Y7QB 1QKZH 3MLRH 3HG1D 3TA3D 3VXNB 3IDJA 2EICA 3B9KA 4LVNC 5JA8B 3H3PL 3O4LB 1CICC 4GQPH 1LD9A 2IAND 4JG0H 4PJEB 4RMRA 2ARJB 1QPXA 3LKRA 4LSPL 5I15L 2ZCKH 2Z92A 1EEUA 3ECBA 2CUIA 1KC5H 2X4SB 1FRGL 3JXAA 2CGRL 4M1GH 1HHJA 2H9GA 4MS8D 4N0RA 5H37H 4KQ3L 4TSAL 5EH1A 3UJTH 1Z9OA 1BD2D 2X89A 3MR9A 3O8XD 1SEQH 4PJDA 4KKAD 5E8DH 3FO9A 3S37H 4S0SD 4XMLH 3CZFA 2R0WL 3AXLA 4IOFC 3INUL 3UTSA 4Q6YA 3LKQA 4UT7L 2BNQD 4LARL 5SV3A 5C08E 1NGZA 5E9DE 4DAGH 1R5VB 1EAPB 3GSWB 4WU5B 3HFMH 4GMTH 4X80L 4P2QB 5E03A 4XGZA 4KV5F 1I8LA 5JPNB 1BVKB 3QEQE 1JK8B 2BDNH 5ID0A 3GSOA 3E1F1 2X09A 4NO5B 4WFGE 3WEXA 1ZHLA 5T33H 4HLZG 1SM3H 2C1PA 5TE7L 1J05B 1A8JH 1RZ7H 5C0AD 2EDWA 4LPUA 3IAGC 1P9MC 1OAYL 1VFAA 5KS9E 4OZGA 3NCEB 3DXAB 3LEXA 2IH1A 5C2UB 2IWGA 4HKXB 2EYTB 2ENYA 3QPXL 5DJCB 4LLUB 4XTRC 4ORGA 3VDAA 1B0WA 2FEDD 4H25B 4PFEA 1EUUA 3I50L 4DGYL 3W5MA 4ZXBB 1EJOL 5CKAA 3HB3C 4FTVE 4CADB 3FQXB 2YD5A 1NAKH 3QEHA 4XNMA 4LK4A 5I6XB 4M3JA 3MJ9A 1G7JB 4M7KL 3K1KC 1YY8B 3EZJB 3ZKSD 3G6JF 1R3HB 1UQSA 1M7DA 3D18A 3OAZK 4CVZA 3HNSL 3QZWA 2NXZD 4UDUB 5BV7C 4BSJA 2R2BA 2X70A 2V5MA 3EO0A 4DKEL 3Q6GH 3KPQB 1CFTB 3IDMB 2DQGH 1R0AL 2EYSB 3IFOA 5K9JL 1NAMH 3TGXA 1BJMA 1D6EA 1QSED 4RFNC 3TCLB 1Q94B 1RUAL 4TNWF 3DSFH 1I7UB 3NN8B 4IJ3C 2V2XA 1QVOB 1FSKB 2NY7H 4FQCL 4NN7B 1K85A 2NY3C 3GIVB 4HWZA 2HMIC 4O58H 5FA3A 4EN3C 2OK0H 2DJSA 5I1CL 1JHKL 1KJ2H 3KYKH 3S36L 1J8HA 3BGMB 4PTTA 4X4YB 2Q86A 4Y4KD 1RUKL 3UTTE 3OX8A 3Q2CA 4NFCA 4YDLC 4JPIB 5I66A 3SJVB 3D0LB 2UWEA 1KBGL 3CDGB 5JZ7D 2B0SH 4MXQA 4P57A 5INDB 3RVXC 4L29B 1MHHB 3VGFA 1AD0B 1OSZB 5BV7H 1B3JA 1CU4H 5C07B 2KKQA 5IV2B 2PYEB 4YHOL 1UH2A 4WEBH 1UEYA 4Q9QH 2CMRL 4FQLL 1MJ8L 3A67H 2FATH 3U7YL 3HE6D 5D2NE 3U4EA 3PHSA 1I9EA 1SQ2N 3VI3E 3PQYA 1S9WB 3Q5YA 1MHPL 3B9EA 4Y4HC 3MFFA 1QA9B 5EU5B 4FRWA 4Y1AE 5JO5B 4G80A 5F1OB 1Q9WA 1MVUA 3RPKA 1JI1A 1T5WA 5EUOB 5I1AB 3S9DB 3WNLA 2I07A 5IW6B 2BSRA 4I18A 3V5HB 2OL3H 3MRQB 2PTVA 1U8MA 2NLJA 3NGBB 3Q1SH 4LSUL 1MNUH 3QWOB 3WIHA 4OZFH 4L4TB 3QXVA 2IG2H 4WDIA 5EU3B 4PJ9A 4Y0GA 1NEZB 4M4PA 5I1KL 2HFFA 1TCRB 1JWUB 4MZ2A 1U41A 5JOEA 4PGCA 5F9OH 1B4JH 4BELD 4X7EC 2C3HA 1AGFA 4KJYB 3T4YA 1BF2A 1MCQA 1RZ8B 3TIEA 4BM7A 3UAJD 3P0YH 1A7RL 2X4QB 4K8RD 4PRHA 5DJXA 1OM3L 1FQ9C 1JGVH 3LOWA 3MRPA 3QCVH 4OZGF 3WNMA 1YN7B 5ICZB 2D7TH 3KLDA 2RIKA 1P4LA 3MV8D 5C0DB 4P2OA 1TENA 3TP4A 5I18L 5IGXL 4XBPB 4NQEB 5JNYA 4KK9D 1TZIA 1KXTB 5EFIB 5C7XH 5F21B 5L9DH 3P73B 3EFDH 5IHZA 5E5UB 2C26A 3D3VD 3EDDA 4GH7B 4HUUA 1NLBL 4LEXL 4TNWK 3U1SH 4X6FB 3BKJH 3DVIA 4OD2A 4H1LB 4YUEH 5FYLD 4B53A 3U83A 3STLA 2C4XA 4KVCH 5IQ9A 3P4LA 5B8CB 3DROB 1WFNA 2AJ3A 2XA3A 4YNYA 4ZUWA 2X4TB 5J3HD 2ZPKH 3KLAA 3NIGF 1AQKH 3W81A 3H9SA 1PLGL 1HHGA 1BFVL 4JFDB 5E5MA 3V95A 2X1OA 3QHZH 2APTA 3T4AA 3RQ3A 5GSVA 2WNGA 1VACA 1H15B 3V2AR 1K9TA 2UUDK 3C08H 1S7XB 3MLPA 4POZC 5DJZA 1W2KT 2AK4D 1NGPL 2VXUL 3MFGB 2OMBA 2YPVH 1SBSL 1CG9A 1GZPB 4GKZA 3CX2A 3AMKA 3PE9A 1KACB 1P5UA 5BZWA 4IEFB 1RPQA 2UWEF 4HFWA 3HAEH 1S78C 4D0DA 3EIFA 2MCPL 3TYGH 4N5UA 1WV7T 3C8HA 2APBA 5EIVA 1Q9OB 5MEQA 3CUPA 5T1MB 4DEPB 2JELH 1IGFH 1DZBA 5DR5H 2XPGA 3AY4A 3HMXL 3X14B 3EAKA 1DFBL 4L4JA 1KCVH 3MMEB 5D2NC 2Z4QB 4YIQB 5D2LA 3OKMB 1BQHB 5GRUL 4Z78A 4OGAD 3RY6A 1XF2B 5D7LA 4JQVC 4UNUA 4M7JH 1ORQB 4DN4L 2VE6A 1QRNB 1JNJA 4S1DC 4YHIA 1ACZA 4HX1A 1U42A 3THML 4LHUG 4LSQH 2UY6A 3RDTB 1AFVL 1CE1L 4HKBA 5INCB 1CFVL 5KSAB 1NJ9B 1MCFA 3VGGA 1IVLA 1U8QA 3MCLH 2ZP0T 5HHQA 4UIKH 3QI9B 5CBEA 3I02B 4PY8I 3IKKA 2BXZA 1FLRH 3QUXD 4PGBB 1JE6A 3BH9A 4F57L 5FM8A 2DMBA 5I1JL 4IRSA 1QBAA 3LV3A 5C0JB 6FABL 4LSTH 1D3CA 5C2BL 1AJ7L 5HPOA 1UB6B 3E6HA 3EKCA 3L6FB 4ISVB 4UILH 2EDXA 5C3LD 2AEPL 1JYNA 3KAAA 5HSFA 3BPNC 1X44A 2IPKB 4WO4B 1KTLB 1UEMA 1U36A 2X9XA 5HYJA 2I5YL 2EZ0D 2NW3A 1AE6L 1JWMA 1IAOA 1ZTXH 5SX5K 3VH8B 2FSEB 4UUJA 5F9JB 1S7WB 2H2PC 1N6VA 2YBRA 1LK3L 3SDCC 2H26A 2ESVB 4RGNB 1W8NA 3OPZH 3UPRA 4P5MB 1A4JA 4D9RD 4Z77A 4N9OB 3C6SB 4L5FL 4Y19E 3JWDC 5F7EL 5CILL 3HZYB 3TZVB 3SKJL 4R96B 4K9EL 4I0PA 4YQXL 3GSVA 1S9KC 1INEH 5BS0B 1H5BA 1I3GH 1DBAL 1KTDB 5B38B 2R15A 3BSZH 3X12B 3T2PA 2NY2B 4OF5A 1CD9B 2BVPA 1CFQA 3VU2A 4W6WB 3VFUB 5CD3A 4C54A 3G5YA 5HHMB 5BQ7B 3B4NA 5EU4B 1TQCC 1HQ4B 5T3ZH 4HJ0C 4KV5E 4ELMB 2MNUA 4OFYD 4XCYA 4Y5VC 3T1WA 2E7LE 3VFPB 3OTTA 3U7AA 4XHQA 3DMMC 2VXSL 1JRHI 3DBXB 4OZIA 3SPVA 1IC7H 1C08A 1HWHB 1X9QA 1UM5H 3SO3C 1GJIA 5I75B 1M05B 1WWCA 2ATKB 2CJUH 5DRWA 43CAB 1OGAA 3JWDH 5EOCJ 4NZUH 5JIPA 4Q9CA 5GJTH 3IKCA 3Q3GB 5T1LD 3MRHB 3X3FH 3GJFB 2OP4H 1KELH 1JFQL 4AMKH 5GZOD 2V9RA 1ZA6A 3GI8H 5JIHA 1Q9KA 2WQ8A 2AEQH 2JK5A 3S96A 4YDKH 1MEXL 4O9HL 5D2LF 4FQIL 3CLEL 1EBAA 5KSBB 1FGNH 2DM7A 1CDIA 2M2DA 4MAYC 2Z31B 5IG7A 1F4YH 1IC1A 5DRZB 4KK8D 3W39A 4YK4B 2QQLL 1IL1A 5F3HB 2MPAL 4LLDA 2CKBA 1S5HB 1LEIB 4QWWC 2ZOLB 1RUQH 4WWKA 1IARB 3X13A 3G6JE 3DO7B 1LDPH 2VLRA 3EUUA 4GS7C 1J87A 2NY0B 2VERN 4NQXA 3T77A 5I0DA 2ILLA 1FZOA 3SGKC 1CICD 4FFZH 1Z3GH 3O2DH 1FFPB 1KLGB 4ZPTB 1BGXL 4GRWB 3QIUC 4R4BA 5ETUA 3PGCA 1JTPA 3C9NA 5HVWA 3LIZL 1U8NA 1EO8H 3RWJB 1F4WH 3H7BB 4BH8B 1B90A 3ARFA 2EO9A 1T1YA 5D5MA 4M1CC 3SGEH 1XIWC 1PG7L 1BQLH 3FB7B 1LO2L 3MV9A 2QHRH 1HOCB 3PHQA 3IU3B 2XWTB 3CVIH 2P45B 4OUUB 3IXAB 3MREA 4HJGB 4OCLC 5C8JB 4TRPH 4BZ1H 3QDGA 2FO4A 4QXGL 4IOFD 5MERA 1DANT 1R3KB 1FVCA 1ZS8B 1ED3B 3BRFA 1I7TB 4G8FB 1TMCA 4R2GC 1MLBA 2WUBL 2ICWB 3V6OE 3CZJA 2I9TB 5L7XL 1YUHA 4JHAL 4AEHH 2AGJL 1T7WA 4YHZL 5GPRA 1T0MB 4DWHA 3P4MB 5IBUB 3WFHB 1VEMA 3R0MA 2W60B 1K4DA 4AIOA 2ARWA 1MCDA 3C60C 2QQNH 5EU6B 4IMKC 4TPRL 1UWXK 2BC4A 6CGTA 3ISWA 1MH5A 4KC3B 3UTSE 1BBDL 2YEZA 3IXTB 3OAZH 1CT8B 3SDAA 3VFGL 2NY6B 4U0RB 5TH2B 1FJ1A 2FNBA 4NJAH 2MHAB 2GQHA 4E5XB 1P84J 5F72S 4F58H 5GGTH 4G6JH 2BHYA 4RWYH 3GJEB 5CZKA 2GT9A 1I8MA 3QIBA 5D8JL 4P23C 3LKPA 2Q76B 1I9JL 4OZIF 1H3VA 4XTRD 1RK0B 1UH4A 2E7LC 4ZD3L 2HJLA 4RISH 5C92A 5AYQA 4ZAKA 4U2ZA 5TQ2H 2F53D 1JMXA 3GO1L 4Y7MA 5CINH 3HB3D 3MA9H 1G9ML 3SDDC 1MCWW 3CFEB 5B3NA 3OKDB 4XI5D 3KYNB 4XX1G 1DE4A 5JPMB 4FQ2L 4U1NB 4OZGE 1RVFL 5DS8A 4OLUL 1HIMH 2WAHA 3IVKA 4ZOEA 3A6BH 3S3SA 3ZL4L 2Y4SA 4N68A 1HILA 4YXHL 1K8IA 2C9AA 4NRYB 4FMKA 4R3SB 2BXYA 2HTKC 1BJ8A 1CL7I 3N1FC 5AZ2H 4Y5XB 5HYIA 7FABH 5C71A 2NY3D 3RWDA 2HMID 3LN5B 3TJEL 2GIYA 5BVPH 1FE8L 4EN3D 1M6OA 2G9HB 3L5JA 1WZ1L 4IOSD 1U3HB 5CS7A 1E0OB 5SWZD 2NX5A 4R6UA 1TTFA 1IGIL 5A1AA 5FYLL 3NCCB 3DX6A 3NIGE 2DWDB 3VFNB 4CN1A 3ROLB 2DBJA 5DQDH 4XCNB 5GGQL 4MCYB 2AABH 2BSTB 1IGML 4KZEL 5D5MF 4WY7H 3RVXD 1UCBH 2ZG3A 4W6XB 5KTEH 3R8QA 1LO3H 2F54B 1JTTA 4PY7A 1AHWA 1FDLL 1A0QH 5JHDB 1SVCP 2HAZA 4QRPB 3FRUB 1NC2D 3OKLB 1J8HE 5FAAA 2P8MB 2DQDH 1FFRA 2X7LA 2WANA 2FEEI 4NN5C 1I9IL 1L7IL 2FD6H 4Y4HD 4FABL 5KVDH 3B9KC 5ESQB 3Q5OA 2AJVH 3S35L 2DQTL 4DKFL 1R3LA 4ZYKB 1GPOL 2UWEE 1KJVA 5HJ3B 2BMKA 5ALCL 3HC0B 2PO6B 3BJ91 5C08D 5E9DD 1J7VR 5TE6H 5C1MB 5T5FL 5IHUL 3S34H 4GMSL 4H5SA 4XWGH 3SDXB 5DD0L 4NKIH 2WP3T 4JFEA 2P49B 3QEQD 4RDQF 2X9YA 1H3GA 5EA0L 1I3RB 3UO1L 5IT2L 3MUY1 2VR9A 2YMXH 3PQYE 4PTUB 4WFGD 4L4VA 4D8PB 1S3KH 3QO1B 2QSCL 3BIAX 5CHNB 4U6XB 2FHFA 4FQHB 3V6ZB 1JF5A 2W07A 1HYRC 4NHUA 4YR6A 2P8PA 2CLRB 4KDTA 2UZYB 3D2UD 4FNLH 5HPMA 3IRPX 4LHQB 1YN6A 3QFJA 1P84K 3QUMA 2HT3C 1LE9B 1I8LC 2V2WA 5KBNC 2X9WA 5IHBA 4C83B 4LQ1A 2UUDH 2Y5TB 4BFBD 1M4KA 4CL7A 1NUNB 1MCSA 4QHNA 3ZDYE 3IFLH 3BGAA 5A16A 2IQAA 4ZNCD 4H8WC 4PJGA 2C5DC 4FTVD 1FFNA 5GRZA 2P4AB 5J8OA 3FOLA 5CCKH 3CU1A 2AXGB 1NCBL 1N2RA 1IAIM 3V6FA 5DD1L 1D6VL 2YD2A 3VXUA 1FO0L 2X05A 2WWMC 5K9KA 4YBHA 4HIEB 4KUZH 4ZFZA 1AP2A 2XXMB 2P5EA 5T1KA 3BRGC 1BFSA 4X6EA 4XVTH 4OGYL 4EBQH 1HWGB 5IR1B 4POZD 4JM4L 1U2HA 4KTDL 4LDEB 4JN1H 4LKCB 5LGHL 4L1HA 4HKJB 1OAKH 1CCZA 4JFFA 3NA9H 4ZUSB 2KPNA 3W0WA 4C4KT 2EDLA 4GKNA 5DJ6B 3ESVF 4JREC 2FYYA 3UTTD 2IC2A 2O26U 3SCMA 4H8WH 2H6PA 3H9SE 5KVEH 4XPFL 5F7WC 3VJ6A 1FVDB 2A9NH 2AJZA 2H3NA 3FB5B 4EI6A 3LD8B 4N8VB 1S78D 5FHBH 4K3EL 3DX9B 43C9B 3RFZC 4HWBL 4LHUD 2XACC 1T7ZA 5I16A 2BRRL 1E4XL 1LQSR 3KPTA 4AEIL 3DWTA 2E5EA 3NFPB 4NM8H 4GW5A 5D1QA 5ANMB 3QQ3B 4DGIH 4KRNA 5AWNH 4RNRB 2GTWB 1NMCC 3PWLA 1XCQB 1G7MA 2X10A 3ARWA 5C09E 3RGVB 3EYUH 3QNZB 4MA3A 2JB5L 2VLKB 3MGAA 1PYWA 1RZKL 2WW8A 4Y1AD 5J12B 4MD4B 3MJ9H 4NP4L 5FDWA 2JB6B 2YC1A 1RFDL 1UCTA 2DI9A 4S1DD 5ERWB 4MXQC 2JTDA 3MLRL 3QUYB 3SE8H 1VPOL 5TJWK 4P2YA 3M17B 2B1AL 4I3RH 4ZUVA 4Y4FB 3QG6A 4JQIL 1A5FL 4QHUB 5MENE 3A0OA 2DQIL 1BOGB 4JG0L 1LEGB 2YSSA 2IADB 1INQB 4P4KB 3TJHA 4NUJA 3WL9B 2AJSL 3S98A 2IAMB 2W1NA 1T2JA 1UXSB 5EWIL 5EB9A 2VQ1A 1Q0XH 4MA7L 1V8HA 1LDSA 3L3DA 3FB6A 2J88L 4XBEL 5D7LE 1W0WA 2AV7A 3T1FA 2Z9TA 1H0DA 2OXHA 5DF0A 5KJRH 5E4EC 2GEEA 4UTBH 5D1XA 5HHVL 1N5YH 4YHLH 1R24B 4K7PY 12E8L 4P3DA 2V6HA 1U8KB 1ETZB 4PJ9C 3WLBA 3QAZB 4FFWC 3S4SA 1XT5A 4ZDHB 5E1AB 4MSWA 3HA0A 4F15B 3BD5A 4G5ZH 4U3HA 4AM0A 1D9KD 3TPUA 2H2PD 1JPGA 5J6HA 3SDCD 1L0YA 5HGBB 4HBCH 4AIZB 1JPFB 1S7RA 4LLQA 4NOFA 4LRNL 2VDOH 5C0GA 1LEKA 1RJLB 3QIWB 3CIQA 1MHEA 4N8CL 3VXRB 3H9YA 2OJEA 5T33L 3CFBB 2ITDA 3GSXB 4D94A 5DQJB 3FMGH 1FG9C 4IRJA 1VERA 2A73B 5GGVY 5HYSB 5GGRY 4ZS7L 3CNKA 2Q6WA 4DUXA 1GXEA 5D93C 3DV4B 1YC8A 3WIFA 3RGHA 2PXYB 3BKCH 4JPWH 2CIIA 4WTWA 1WZLA 4UINH 3EYQC 4GW1B 3TBVB 3WIHH 3NTCL 3RWEB 4QYOA 5IROC 1LNUA 4M1DL 4HJ0D 4U1IB 4O51A 3WD5H 4CVXA 1TJGH 4WEUD 3WE6A 2Q1EA 5HHPA 3DMMD 4WI7A 3QQ4A 2FBJH 2IBGA 1EERB 1J11A 2BNRB 4NOBA 1UC6A 2ID5A 1Z0NA 3DVGA 5KZCB 4RIRB 4NIKB 4JZNA 5SWQA 2Y07L 1LO4L 1QZ1A 4L8DA 1XGPA 2ZNXA 3RI5F 2EO1A 3BFOA 3HG1B 4JAMA 1A6AA 1X3DA 3ULUL 4BUGA 3MRDB 4P2RE 3T0XA 1C7TA 3EYOB 1KN4L 4HWEH 2DQGL 5D9SA 3P9WB 3F7QA 4OCSH 1ZHKA 4HIHA 1C16A 3BVNA 4JFQB 4XMKH 1EA9C 4WHTA 4V1DA 3VRLF 4PLOB 4H26A 3UTQA 4OZIE 1SJXA 1UG9A 2QEJA 3MRRB 3JTSB 5CAYB 5DMIH 2XKNB 2UYLB 2YPLB 4MAYD 4MCZA 5EZLA 5ID1A 1CVRA 2LAGB 4LNVA 3CH8A 4I1NB 2QHLA 1UWEL 1OGAE 1KJ2L 1BD2B 3S36X 3FQRA 3O8XB 1G6RL 4G3YL 5IB2A 4AL8H 1AGEB 1AIFB 3V4UH 4QWWD 3QFDA 1OHQA 1HDMB 5AD0B 1MAML 4L9LA 3BE1L 2D31A 3KPNB 4EDWL 4KFZC 5IB5A 2BNQB 5DJAB 3I6KB 1YECH 2VZSA 3G5VB 3PWVA 1EEYB 1RULH 3AY4C 1QLEL 3FCTA 1QLFB 2AJUH 5GS0C 4HGKC 3QIUD 5BV7L 3MNVB 2VLLB 1OP3K 1QO3A 1OF2A 3SE9H 2VO5A 4G8GA 5IB4B 4WEBL 4BK4A 3UDWC 3TYFA 4D9LH 4PRIA 3A67L 1XIWD 3MOBL 4FXGA 2D0GA 5DRNB 4X7TA 4BFIA 5DD5H 2W92A 2DJ4A 2VLRE 3JWNC 1FN4B 5FYJH 2JIXB 3QHTC 3EO9L 1N4XH 4HCRL 3BZDA 2J8HA 2WINA 1MCCA 1YPZB 4NCC1 1HEZA 4M8QB 5DJ8B 3SKNA 5LBSL 2OL3L 2OSLB 2KZWA 1W0VA 2DLIA 1MNUL 3PABA 5ENWA 4R2GD 3GMMB 3BPOC 4DOHE 5IMOB 3P2TA 1DQQA 2DTML 1C5BL 2IG2L 4IRSC 4KKCC 5D5ME 3MLSH 2XWJA 2B7DT 3RWHB 3RKDC 1NH6A 5GS1B 2A6KB 4EDXA 2IQ9L 3GKZA 1VGEL 3VFVB 2BCKA 4Y19D 3LSOB 3WUWG 1N8ZA 3RWCA 4P5TA 2ITCB 4XPHL 5GS0H 3C60D 5IMKB 1K3IA 1DEEA 3BP7B 3L9RB 3WXVH 3O2VH 2G5RA 3C8DA 4NZDA 5HDBF 2HKHH 3P0YL 1U95B 5HYFA 2O5XH 1UXWB 3K80A 2J8UB 3MXVH 3QDGE 3UROR 3L1OH 2NXZB 2WQRA 3E8UL 3LQMA 4P46A 2GTZA 1L0XA 4XPBL 4LLMB 1XGQA 3FQNA 4HMEA 2XZQL 4WUUA 2PR4H 4LP4A 1OW0A 3B2UC 4ALAL 1DQLH 3RI5K 3CCHA 1SJVA 4XZUB 5L9DL 4P23D 4TTGA 1MRCH 1Q0YH 1ZGLP 4QOKB 1CFNB 3FO2A 4UT6L 4FQXA 4I0PC 1GL4B 4M5ZH 3BKJL 2PTTB 4LCCA 5SV4A 4S1SL 3S88H 4NCDA 3LRHA 1H5BC 1FAIH 4RX4A 4MX7A 3VFSA 5ICYB 1K2DB 4QRRA 1J1XH 3SDDD 3HZVB 4ONHB 3WJLA 1AXSB 5LKNA 2FBOJ 4Y4KB 2Y5EA 1IGYB 3QDMA 1GCFA 3H9ZA 2XZCH 2WBJA 5C6TH 4GBXC 1GGCH 3IDIA 3IJSA 4PDCE 5ITFA 1DQJA 5GRVK 1OPGL 3OZ9H 4PRAB 4BZ2H 2P46B 4JCMA 2R2HB 4P48A 4IRZH 2DQCH 1KJ3H 4XCCL 2A6IB 1J1OL 2KUTA 5F89A 4JG1L 4PJCE 3FQUA 2IH3A 3C5ZA 2HTKD 1C7SA 2VXTL 5J89A 5GZNC 5KSVA 4HWNA 1CYGA 2FLBT 1SYSB 3HE6B 2V7HA 4U1KA 3BH8B 1C12A 3QXDB 4L3EE 3O45B 4UAOB 4PJHB 1A1NA 1ZOXA 2OZ4A 3MUJA 2VAAA 3TN0B 4TUJB 1T7YA 2X1PA 3CSYB 1U8LB 4X5XB 1JPTH 3HMWH 2RFXA 4N0UE 4UQ2A 3GSRA 4QEGA 3D25A 3T0DA 5CZXC 5LQBL 2H8PA 2GAZA 4I2XB 1GGUA 3GSQB 1Y6KR 5ISZA 1YYLL 2NTFB 4KRLB 1KIRB 4LCYB 3VGAC 4S0TD 1T6VN 3DLQR 2P43B 5CMAA 4DN3H 5J06A 4RGMC 1EEQA 5DR5L 5IFAL 4BQ8A 2IALB 1CLZL 4PRBB 3PF2A 5TE4L 1N5AB 1BJ1J 1QSFD 5DYOA 2GCYA 5A40E 5KVFH 2NX5E 2VLJA 4K3DH 1DDHB 2C1OA 4OF7A 3MRLB 4M5YH 4JFOB 3R4DA 2B4CC 4LSSH 3B9KD 3WMSA 4TVPE 5F6HJ 1YEEH 1OAUL 1HHKB 4M62L 3U0PB 3MV8B 4LSQL 2HRPH 1GSMA 2XRAH 4NWTL 3WJJA 3QYCA 3KNBB 4XXCA 1P7HL 1X5AA 4KQ4L 4YEFA 4ZTPH 3ARFC 2AQ3A 4BKLB 2IPTH 4WU7B 3D3VB 3MO1B 3HRZB 5MI0C 15C8H 4YJZL 1NEUA 3LZFH 4UU9A 1FLRL 2B2XL 1RMFH 1SEBA 2X89D 4LCIH 5DC0A 2BFVL 1KPUA 3OSKA 4UILL 3DURA 3F58L 2QTEA 2OTUB 4X5WA 3UTSD 1X5JA 4NSKB 1KCSH 1RZJC 3ZTNL 2CKBH 3PGFL 1MREH 1A1OA 5GGUA 4PJBA 5DHYA 3ROOA 3MBEB 2HT3D 1QQDA 4JFEE 5M95B 2B4CH 1MIMH 3TLRA 4WI9A 2JCCA 5I1LB 1MLCB 3TBTA 2CRYA 3DPBA 4JGJA 3K4ZA 3OPZL 5HDOA 2AK4B 1DQDH 4U7SA 5I1EH 2HVJB 3SDAC 3NACH 3KHOA 1XF5A 3G5XA 5DEFB 3RVUC 3QFJE 5JOFB 4NFDA 5I19H 3ZKMC 5CJOL 2XIDA 1ZWIA 3MZGB 3QIBC 3RUGB 2WWMD 3BSZL 4FXKB 4U7MA 3SKOB 5SWSA 1ZGLA 1AH1A 5F6IB 3KYAA 4HUXA 4Q9RH 4JKLA 3TFKD 4NZTH 4Q97A 1IM3A 4JHZA 4RDQG 1RZJH 5E8NB 1S8DA 1DANU 1OLLA 4ETQA 2DM2A 1T04B 3LQZA 4QKXB 4EVNA 1X7QB 5TPWL 2X4UB 3HI1B 3DRTB 3DARA 4OV5B 4JKPH 2Q7YA 1SMAA 1IAKA 3AAZA 3QXAB 4Y8DC 4NQSA 3VXUE 2PYFB 2WUCH 3ARQA 3GNML 3ULVF 4Y5YA 5LVEA 3TT1H 5FB8B 4M9PA 1X4XA 3QBTB 1XZ0A 4U6TA 1TZHB 1N64H 1NANI 4NKQB 1XR8A 3JWDL 1KJMA 3IFPA 4NDMB 5GJTL 2XQBL 3VGEA 5IM7A 2B1HL 2P5EE 1I9RH 2PNDA 4JFXA 1VEOA 4M43H 3X3FL 2OP4L 3FJTA 4AMKL 4MWFA 5BJTB 1KULA 1JVKA 1KIPA 3BPCB 3GK8H 4MJIB 4OM0H 3VRJB 5HXMA 1FO0B 3VWJC 4JFFE 1J8HD 3W0WE 3MNZB 3PL6A 2XA8L 3F12A 2CUHA 4QXUL 2EIBA 5BOPA 3FQTB 1A7NL 1PKOA 4L8SA 4ZFGL 4D0CB 1CDCA 4JRXA 4K23L 3SOBH 4MXQD 2OI9B 4U6VL 1UVQB 1U91B 3MPCA 3NFSH 1RURH 3T09A 5EO9B 4HF5H 3KR3H 1VKXB 3BISA 3CVHA 4MJ6A 1AHWC 4Z0XA 1Z3GL 4HAGA 4EUPA 2WP3O 2CRIA 2HG5B 4DQOH 3CH1B 1MUJB 3VRLE 3U4BH 4PGEB 1UKQA 1EO8L 1BM3H 4FZEH 4O2CA 5D7KE 3GMRA 3OGOE 4N0YH 2BX5A 3PQYD 4MMZC 5F7DA 1Z5LA 5D7IB 1AO7B 3PHOA 4AZ8A 4K7FA 3KPSA 1JNNH 3OXSA 4P9HC 1OARH 2CR6A 1GOGA 2YHGA 4WHYG 2F5BH 1S9XA 4X6BA 1U3ZA 5CBAA 4PJ9D 2JCCF 2XWBA 3H42H 4FFWD 4U3CA 4TVPH 2W9DL 3HZKA 1RSFA 1K4CB 3FO1A 4MDIA 3F7YA 4Q6IB 2F9BT 3PDOA 4AEHL 3HUJF 5DK2B 1JHLH 2AK1H 2D03H 1FL6B 3PP3K 4ODHH 4BH7A 2KL6A 1T3FA 1PKQB 2GITA 3VFOB 2ZG1A 2PCPB 3MJ7A 1IC5H 1JZ8A 4JPKL 3DNKA 1T03H 3V7AG 1IBGH 4NBYB 3VFRB 3CXHJ 4RAVA 5HI5C 4XP9H 5LAXB 4O4YL 1HSBA 1FORH 4P9HH 4G9FB 2Y7QA 4YC2C 1KCLA 1FFQA 5T1LB 4TULL 1DBML 2ZJSL 3TPUE 4F58L 3VXNA 5GGTL 3G04B 5DEZA 5IHLB 5F9WB 5L88L 1S5IH 3O4LA 4JM2B 1CZ8H 1F02I 3WSQL 3R0NA 3V79C 1NCAH 3EYQD 1OSPL 2YWYA 2ARJA 5EIIB 1NFIB 4LLYB 1J1PH 4PBXA 4DK3A 4AQ1B 4M6NL 5FCUL 3O3BB 3BP6B 4RISL 3VFTB 3C5JB 2VDRL 4RFEB 1U92B 1N7MH 4DW2H 1J5OL 2X4SA 3S5LG 3N85L 4EKXA 2ENSA 1NBQA 1MCOL 1KGCE 4PJXB 4IIQA 4C4KO 3O6ML 4IDJL 1EK3A 1G9NL 3V0WH 1H3PH 2EDOA 3H9SD 1I3VA 3NCJL 4M61B 4XNYH 5ADOH 2JF1A 2EDDA 2QL1A 1RK1B 1GVIA 2XTJE 1HIML 3F6IA 4LVNB 1X5LA 3L7EB 4XPTH 3QUMH 3QISA 4JRWA 3WO4C 3KXFB 4NZJA 1R5VA 1EAPA 5GGSA 4WU5A 4JJ5B 1NGQL 3RZWA 5J11B 1OP3H 4P2QA 2J12B 1JV5B 1BVKA 1JK8A 1PFCA 3QWRA 2OJZH 1FNSH 1JZ3A 5C09D 4LLAA 4ZO7A 5J56B 5L6YH 3RP1A 3GMOA 4LL9A 1IFHH 2NY4C 1J05A 5EZIL 3PWNB 3TNNB 2YD8A 3AGVA 4V1DE 5MEND 1A6VH 5D1QC 1EX0A 4PJIF 2R1WB 2IEPA 4JPVH 2W65B 4PS4H 3DXAA 3NCFB 1CK0H 4HKXA 5GS0D 2EYTA 3HPLB 1DEDA 1CGSL 1I8IB 5I73C 2WBWB 5A2LH 4LLUA 3TBYB 4H25A 2R56H 1V3MA 4WTZG 5D7LD 1NUFA 1UKTA 1LMKA 3UBXG 3TV3L 1YNTA 4OB5H 3IGAB 4ZOCA 4CADA 3FQXA 4XVJL 1I1YB 3FTGB 4XNZB 1B2WH 1G7JA 2UZIH 3NPSB 3T8XB 1YY8A 2CLVB 4K7PL 3S35X 2MJWA 3IETA 3SEPA 5I9QC 3GI9H 5DZLA 1MJJB 3TJHC 5E5RB 3ZO0A 3O3UN 3IFNL 1CFTA 1OTSC 3IDMA 4Y16B 5BRZE 2GJZB 2F8XC 3TCLA 4G8GE 1Q94A 3IF1B 3O9WD 5E7BA 1I7UA 4KKCD 2VDLH 3NN8A 1KJ2B 4EIZC 4LAJH 1QVOA 4PRIE 1G6RB 5T3XE 3RKDD 3C6LC 2CIKB 2Y06L 4GLRI 3GIVA 3NMEA 5D1XC 1IKFL 2YK1H 4Z7QE 1HE7A 3O6KL 3LS4L 3CFIC 3CDCA 3VCLB 3OV6A 4N0CA 5GGVL 1B0GB 2LAAA 1IE5A 3CXHK 1RAMA 5BV7B 3ZE0E 4FNLL 1MRDH 4NO0A 3TWCH 1LP9A 3O4OC 4RFNB 3SJVA 4OLYL 3D0LA 3B2UD 3OB0K 3CDGA 4PRDA 3BN3B 5INDA 4L29A 3B2VH 1AD0A 1OSZA 3TM6A 4O2FA 2A83B 5C07A 1VENA 5IV2A 1RUMH 1KN2L 5CEZE 2NY3B 3EYFB 3V6BR 3NCYS 1ZVYA 2J5LC 4NUGH 2D9QB 1A3LL 2APVA 4IRJC 4M7ZB 1ZEAL 2OL3B 4YE4H 1NBZB 2DF3A 1S9WA 4F7EB 1F8TL 4JQXA 4WUUE 5EU5A 4RRPG 1HKFA 1R3IH 2XTJC 5JO5A 4P2RD 5EUOA 3CXDL 4GBXD 4RA0C 4KUCF 3V5HA 4TSCH 3MRQA 1TETH 1ADQL 3JV5A 1M71A 3QWOA 4HV8B 3H8NA 4L4TA 4XRCB 4U1HB 1CDHA 2VTFA 3P4OB 4HKZA 3MJ6A 1NEZA 2E7BA 3Q6FA 4XAWH 4FG6C 4KTEH 4HUNB 2YRLA 1NC2B 4TSBH 4QRRE 2ZZUT 3HLAB 1FZKB 4KJYA 3QDME 1OGAD 3E6FB 3NA9L 2ARJQ 4XC1L 5TQ0H 3ZTJG 2X4QA 2WSKA 1EAJA 3I3BA 1HZHH 5ACLA 5D71H 4I77H 2R1XB 3GEWB 5ICZA 1TJHH 2EDRA 1NCCL 3G6DL 5C08B 5E9DB 1A1MA 5HVGB 1F6LL 5E2WH 4UT9H 2SEBB 3BYYA 2CD0A 5H35B 4XBPA 2D4FA 4NQEA 2A74B 2BOCA 2GW5A 2DQFB 1OAZH 3P73A 3LKOB 4NM8L 5J57B 4DGIL 1JNHA 1F3JB 4OLWL 2YKLH 4KWUA 5DJDA 3RU8L 5BCAA 3WFCL 1XF4A 2VZOA 4H1LA 2VLRD 4C57C 4JFPA 4V2BA 5B8CA 3ULVE 3DROA 4XNUL 4ZO6A 3PWPB 5DRXA 3HC4H 5TDNA 2X4TA 1AY1H 1FGVH 2B5IB 2CO6B 5ISZE 1ACYL 2K1MA 3SE8L 4F7MB 1YMHB 5DFWH 4KHXL 2MMXA 4JFDA 4OCYL 4WW2A 1UACH 1D5BA 1D5ZA 3ARFD 4JE4B 4L1DA 2AXFB 1H15A 3GBML 3VGDA 4WFEE 1A2YB 3JTCA 1S7XA 5F88B 5H94A 1CDBA 4LVEA 1Q0XL 4LFHG 5CLWA 5JIIA 2VLJE 3EJYC 3NCYP 3MGOB 1OT1A 2P5WE 3I2CH 3MC0A 4X4MA 3T04D 3QDGD 3CAFA 1J12A 4QHKI 4NKMB 3OR7B 4MA8H 2BY3A 1GGBL 5KAQF 1N5YL 2ZUUA 3BUYB 1LP9F 2O61B 1TJIL 1Q1JL 5IJVB 1UYWL 2UVFA 1YEJL 2GSGB 3DX7B 4M6MH 2A1WL 4CJ0A 3GDBA 4XCFH 4E42B 4G5ZL 3M45A 3UZQA 3BMVA 1X5XA 4P5TC 3I6GB 5EORL 1Q9OA 4K55A 3X11A 2W9LA 3VD5A 4JO1H 4QHKJ 4HBCL 5CLTA 1OAQL 1CTOA 2XT1B 3BESR 3MUZ1 3IDNB 3QPQC 3X14A 3GUTB 4OZHB 5F8QC 3ARBA 3MMEA 2Z4QA 4YIQA 4OLEA 5T3XH 4P46C 3RVWC 1BQHA 1NBYB 3GMPB 1A9BB 1XF2A 5K9OB 3WS3B 1DUZB 1BFOB 1OW0C 2FWOB 3RVUD 4X7FC 1AXTH 1QRNA 1RUPL 1WC7B 3ZKMD 4G7VH 3QIBD 5IIEB 3I3EA 4LCWB 5B4MC 3QA3B 4G6ML 5I2IB 4LHUB 2JCCE 5INCA 5KSAA 3BKCL 4JPWL 4TYUA 1NJ9A