1S7UA

Crystal structures of the murine class i major histocompatibility complex h-2db in complex with lcmv-derived gp33 index peptide and three of its escape variants
Total Genus 65
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
65
sequence length
276
structure length
276
Chain Sequence
GPHSMRYFETAVSRPGLEEPRYISVGYVDNKEFVRFDSDAENPRYEPRAPWMEQEGPEYWERETQKAKGQEQWFRVSLRNLLGYYNQSAGGSHTLQQMSGCDLGSDWRLLRGYLQFAYEGRDYIALNEDLKTWTAADMAAQITRRKWEQSGAAEHYKAYLEGECVEWLHRYLKNGNATLLRTDSPKAHVTHHPRSKGEVTLRCWALGFYPADITLTWQLNGEELTQDMELVETRPAGDGTFQKWASVVVPLGKEQNYTCRVYHEGLPEPLTLRWEP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords H-2 class I histocompatibility antigen, D-B alpha chain
publication title Determination of structural principles underlying three different modes of lymphocytic choriomeningitis virus escape from CTL recognition.
pubmed rcsb
source organism Mus musculus
molecule tags Immune system
total genus 65
structure length 276
sequence length 276
chains with identical sequence D, G, J
ec nomenclature
pdb deposition date 2004-01-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00129 MHC_I Class I Histocompatibility antigen, domains alpha 1 and 2
A PF06623 MHC_I_C MHC_I C-terminus
A PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1s7uA02
3.30.500.10 Alpha Beta 2-Layer Sandwich Murine Class I Major Histocompatibility Complex, H2-DB; Chain A, domain 1 MHC class I-like antigen recognition-like 1s7uA01
4YZFF 1O5DT 3V2AR 1GZQA 5I1DB 4O2FA 3TJHA 4XXDA 2ESVE 3OXRA 4S1DD 4NKOB 1RMFL 1RZGB 1JF1A 2FHBA 4LLMA 5F1NB 4KKLD 1I1AC 3SJVD 3NIFE 3SEPA 4UBDD 4JRXA 4MCYB 2L7UA 3TJHD 1PKQA 2E7LA 1N6UA 3B9KC 2RJMA 5FOBB 5DD3H 4WW2C 3ULSB 3SKUD 3KJ6L 3P11H 5JHLH 2BNQE 3WXVL 4LVNB 3CFCH 5F1OB 4OJFH 4XWGH 3WKML 2V7NA 2EIZB 3W9DA 4PJDB 4F7TB 1DVFA 5HI5D 4M7LH 3SCMB 1MVFA 5TQ0H 3T3PF 4M9PA 5CFHA 1A1MB 1MLCB 5B38A 1NAMH 4EOWH 1UJ3A 4BQCA 3B83A 1C12B 4R8WL 4DCQB 1U0QA 4R0LB 3LHPH 3C6LC 4FFVD 4DOHE 1G0XA 2GUOA 1CBVH 2FGWL 1XR8B 4HKZB 4MB5A 3CLEL 2ILLA 4NQXB 5D1ZD 2XRAH 1VERA 1PAMA 4PJHE 2P46B 6CGTA 3ZDYF 1OSZA 2ESVD 2EDJA 3MLVH 3VD5A 2AJXL 4FQJL 1QYGH 1RU9L 3LV3B 5LQBL 3MV8E 3QIBB 2BNQA 5IGXH 4BK4A 5BS0E 2V17L 5E2TH 5L0QB 3UPCA 4JCMA 1AR1C 4Z7WE 5KSBE 2ADIB 4UAOC 4Y88A 1B0RA 2NY6B 4FG6D 2PYEE 2NX5B 4IHOA 1NGWA 4PB9H 1NGXA 3ARYA 5I1EH 4UT7H 3O6LL 2BNQD 4HC1L 4DUVA 3KPQA 4PJXF 2I9TB 1OTTD 1MCNA 2O5ZH 4ZYKA 5F6HI 4JKLA 3ZDXE 4WI8A 2CPCA 1MREH 1FBIL 4YPGB 1U92A 4M3KB 2W0FA 4HJ0C 5FECB 4XMPL 1X5LA 5FA4A 5IESH 3DURA 5ILTL 3T2PA 1EBAA 5T1KB 3EDJA 4GRLD 3MRCB 4K3DL 3T8XB 4YLQT 4EUPG 3MV8A 3Q6GL 4X6EB 5SX4H 1D5ZA 3LKOA 4KJYB 1ZGLM 4IOIB 4EQ2A 4OD1H 1T1YA 4YDIL 3Q3GA 1JNLL 1T1ZB 1YUHB 5D7SL 1I7UA 3N50A 1BBJB 1S9YA 3WIIL 3S8WA 1RZ7H 1TVHB 1XF5B 3X14B 5CP7A 1RQ5A 2CUIA 2H32B 4BSWA 3GMPB 3VGGA 1N6QH 4MVBA 5BS0D 3AGVA 4I0CC 5I1IH 4R7DA 4U1LA 1E4WH 1Q38A 43CAB 5E2UL 1F4XH 2LFGA 2Z8WC 4BFIB 1ULVA 3MRMA 4Y5YB 4F37K 3UZQA 2PYED 1YMMA 2FX9H 4NKIH 1MFAH 3O2WL 1U8PB 2R1XA 1KPVB 3BIAX 4MYWB 3QZWA 1ZTXL 5AG8A 1MWAL 3M17A 5CIPB 1XCQA 2D7MA 2YPKA 4HIXL 5JXEA 1AR2A 2ERJB 3QO1A 4O2CB 5C0FA 3MRKB 4C4KO 2FECL 1G1YA 2RB8A 1LO5A 3ZE1E 1XR9B 3QO0B 1YA5A 5K9QG 1OGAA 1U93B 3IETB 3LSOA 4V2BA 5C2UB 4NSKA 4LVNC 5C0EB 4B41A 4LLWB 2X1PA 4PJFE 4KH2A 3TVMD 4ACPA 2ED9A 3WBDA 3ZKXB 1SY6L 2Q7NA 4DTGL 4ODSH 4S0TD 5GS0L 2DJSA 4L8DB 3SCMC 1J8HB 3STLA 5EOCL 5IP4A 1RJYA 2VXQL 1ZHLB 2EEAA 4LPYA 1SEBA 3B4NA 1QSFE 4U05A 2HRPH 4OZFH 4R0LC 4XZUB 3E2HB 3QG6A 5HHMB 1VENA 3QAZB 1H0DA 3CFBB 2BSSA 2EDQA 3F7YA 3L5JA 3FT4A 5D72L 3P73A 1VADA 1RULL 4Y5VB 3QIUA 4XH2B 3MRIB 3G6DL 4U1NB 3RWHA 4HS3A 3KPMB 3QIBC 3DSFL 5D6CA 4G6JL 3F6IA 1J8KA 4XB7A 2GITB 5ACMA 1JHLL 3S97C 35C8L 1B4JH 1I9IH 5L0QC 1SEQH 4YO0B 3MREA 5ICZA 4NZJA 5FCUH 4N90E 2OZ4H 3LKPA 5TE7H 1WAAA 4UU9A 2NY6C 5I8KH 4YXKH 2PXYB 1MHCB 3DMMC 1FFOA 1VA9A 4FABH 3RGVB 4KVNL 5CMAA 2XI9A 5EWIH 4QXWA 3OPZL 5HGBA 3QEUA 2FH8A 2AXFB 5JPMB 4XMLL 1NMAH 2BVPA 3EOAA 5ERWA 1RHHA 1VPOH 4WFGE 3OX8B 4IBLT 2YC1A 3S37L 1QSFD 1T6WA 5I30L 4M8QB 4NO2B 3MLWL 1B2WL 1JYXA 2YEZA 4HIJB 4JFYA 3ISWA 3CVHH 4IMLB 1S7TA 2LU7A 4DEPC 2YHGA 1F58L 3V8CA 2VQTA 1C08A 3E0GA 3ZDZE 4LFHG 4H8WL 3HCVB 1J1PL 2IPKB 3TNMB 1L7IH 4CVUA 5EH1A 3HAEB 3V4VL 4X4YB 1FAIH 3QEQE 4QHUB 2DD8L 5GZOC 1P2CB 4PLJC 3QIWB 3E3QE 3T0DA 4Y2OA 2EYRB 1H15A 3IDIA 3OKNB 4H26A 4PB0H 5BOZG 3H9SE 4N90D 4Y5YC 3BIKA 3OAUH 1TJHL 3EIFA 4P4KD 3INUH 2EH7L 4MA8L 2YWYA 2MPAH 4OI9A 5DYOB 2YD5A 4YBQC 4P23A 3QH3A 2X44D 4NNPH 5KS9E 4WFGD 4MX7B 5E95B 4NIKB 5DJCB 1SMAA 4ZFZB 1M71A 1IGFH 1GRWA 3QQ9C 3MRJB 5L7XL 4PRDB 1T4KA 4KPHL 2Y06L 1IC7L 5J06A 3SGJA 4TUKH 3PDGA 3QEQA 2Y23A 1HCVA 3GIZH 4I5BB 3I9GL 3HE7A 3E3QA 3NIDE 4Y16A 1ZVYA 1F6FB 1K6QL 1IC4H 1MI5B 1JJUA 4Z7QE 1EAPA 5D6DA 1FRGH 5C92A 4Y4FB 5M7QA 5BJTB 3VXRE 4XVUC 3MNVB 1MCQA 5EBWB 3BEWA 1FL6B 4GW4B 1PSKH 2JK5A 2VR5A 3QEQD 3MLTB 1BVZA 2C3WA 1MCCA 3E2HC 4Y16D 2DQTH 3QAZC 1F5WA 1A7BA 4N0CA 3H9SD 1VFOA 3KLDA 5I8CB 5CJBA 1ORQA 3PP3K 5EPMB 4KUCF 4GH7B 1GGIH 4ONHB 3V6OC 3KPPA 4PRPA 3RL2A 3QG7H 2G2RA 5CLTA 3KXFB 2OTUA 2I5YL 4AIZB 1WZLA 4QHLA 4F33B 2UWEB 4DN4H 4Y8AA 1KT2A 4N0CD 4JDTL 4P9MH 4UB0L 1PYWB 2BNUA 1MEXH 2B4CC 2MCPL 3L3KB 1G6RA 1R5IA 3QDJE 3WNMA 2XWBA 4JRYB 4L29A 5C0AE 1TZIB 1F4YH 2PXYC 1GGCL 4KRLB 2Q6WB 2WBJD 4LCWE 4WHDA 1AKJD 3ORJA 4IRJD 3RGVC 3MOAL 2OK0L 1K4CA 4I4WB 5DHVA 1VKXA 4KROD 4YNYA 3MRNB 3FB7A 3MCKB 1EV2E 2N4IA 4UQ3B 2H2PC 2VABB 4NHUE 3EGSA 1Q72L 3QXAB 2XNAB 2QLVB 3DX9B 3VXRD 5D70L 1ZS8A 1OTUD 4JDVA 4WTXA 5EZJA 3B2VH 4ZUVA 4RIRB 3MJ6A 1ZGLA 1WICA 5CJ5A 4YE4L 5DF0A 5CCKH 1CGXA 2DIBA 3QDJA 1CICD 5CJQH 1U3YA 2E8ZA 4FQCH 1JP5A 4LSUL 1NCWL 2NNAA 4OM0L 4V1DB 4M1CD 4TYUA 1A7PL 4PP1C 4NC2B 1ZMYA 2VDPL 4CDGC 3MFFA 1IBGH 3N1MC 1UG9A 4NUJA 1ZHNB 3DRTB 2X6MA 3C9NA 2AEQL 1MH5A 2BVOA 5C0AD 2W60B 4NHCH 2F54E 1BQLL 1YNLH 4GKZB 1XGYH 4MXQA 4QOKB 4LCWD 4WHTA 5KVGL 2O5XH 2B7DT 3DVGA 3O8XA 3OAZK 3BE1H 4IRZL 5F44A 4OCMC 4H1LA 3AXLB 1VEOA 2VDOH 2EO9A 2YA1A 3NMEA 3WS3B 2GSIA 4GMTL 4ZO6A 3EOYG 2IGFL 3MRHA 3B3IB 3IJSB 5ESQB 3QWRA 3CFKA 2CXKA 3HB3D 4YPJA 3BO8B 3U7WH 1JWMA 4X6BA 1QVOB 3O8XD 1AGDA 1KEML 1G7JB 1FFPB 5HGDA 3CD4A 3G6JB 5FA3B 2H9GB 3RJDA 2IPUG 1I1YA 5BO1L 5H35A 5CGTA 3QWRD 4HKXB 4I9WE 1FV1B 2CKBH 4WW1B 4Y4FC 1TETH 1EEUA 3OKMB 4DK6A 4X7CC 2VE6A 1GHFH 2B1AL 4DGIL 5I1CH 3O6KH 5HHOB 2YD2A 3UDWC 2XWJA 3IKCA 2HFEA 1XF3A 1J7VR 1JPTL 2AQ3A 4L5FL 4TRPL 4KVCH 5I8EA 3QULB 3WFCL 2IAMA 4L1DA 4PJAF 5DI8A 1OTSC 3K4AA 4OCRH 4M5YH 4XP1H 2F54D 3I50L 1TLKA 2VDMH 3C5SB 5CZVL 4E41E 1A21A 1WISA 1J1XH 3F58L 3U1SH 4UI2A 3MLXH 3VGHA 3GSWA 4Y4KA 1AE6H 4U1HA 3VWKD 5BVJB 1DN2A 1BGXH 4FZ8H 3QI9D 4PGCA 1MHPL 3T0ED 4AENA 4X7TA 1FJ1A 4HEME 2IPUK 3RVVD 4DJMA 3WNPA 4Q97A 3MBEA 5HVGB 3P9MA 3AS2A 2F53B 2BVUA 5JXAH 1NJ9B 1E0OB 1Z2KA 3ARXA 4XCNB 1AGBA 4I0PA 4Y4KD 1GIGH 3SDYH 1EFXA 1IEBA 1IVLA 1NMCB 1R3KB 3TNNB 4LMQE 4MA3A 2NY3D 1L9MA 4I9WD 2HVJA 3L3DA 1IGTA 1I9EA 2FIKB 4I0PD 2VQ1B 2Q76A 3QPQD 4QWWC 1KULA 1WF5A 1CDIA 2F8OA 1YNKH 4N68A 3CZJA 5FYKH 1PW3A 3LN5B 3K46A 1QEWA 1EERB 2UUDK 4P9HL 1KXQE 1HWHB 4ZOEA 3FQTA 4CL7A 3UYRH 3OMZA 5TJWK 4XP6H 4Q0XL 4P57A 3EHBD 1JN6A 1MELA 1ADQH 3HAEG 1KIQB 4E41D 3QUZB 5AAWA 5H8DA 4MXWH 4OQTH 3GSNH 5EUKB 1YC8A 3VFTB 3SE8H 2PYFB 4U6XA 5DR5H 5EZOH 1GGUA 4L8BB 4ODHH 3CX5K 5B8CA 4GBXB 5IMOB 2D7TL 5EA0H 4JR9L 3L9RB 1DUYB 4PJ9A 5C0BB 2ZOKB 1I3GL 3RU8H 5ALBL 4CMMB 1ZLWH 4GKNA 3IU4L 4QXTA 3DX6B 3TZVC 2WIMA 4OLWH 2CO7B 5DJZA 4S1QH 2YXFA 4I3RL 1ZWIA 1RK1B 4AMKH 3ARBD 4CVXA 1Y0LA 3NCEB 1UADC 2A9NL 4PJ9D 3RWJA 5ADPL 2E6JA 2ITDA 3KPRB 3QCUL 5GIRA 1A0QH 5DD6B 2ZJSL 1LNUB 1U8HB 1MRFL 5ISZB 5DHYA 3BZFB 2H3NA 1LO4L 1BZ9A 3G5VA 3O41B 2B1HL 3W9EB 1HXMB 3KYMA 5DMJB 5IW1A 4P5TA 1ITBB 3VRJB 3W11D 1A02N 3OKLA 1ZSDA 1NC2D 1VACA 3PV7A 2BOBB 5E2VL 4YXHL 5J6HA 4R2GB 2FCBA 1I8IB 3QWOB 2RAMA 2W65B 3S98A 1OAZH 4AEFA 1YN6B 5TDPB 1RUPL 4PJGF 3KYNA 3ARZA 1RV6X 2VAAB 1KTLB 3TYFB 2FRGP 1YY9C 2DF3A 1Q9KA 1II4E 2PO6D 4FXLA 3VGEA 5IEKB 1FNLA 4GG6B 4D9LH 4XP5L 2CDFA 5DXWA 1T22B 2J6EA 3MX0A 5IM7B 1YEHL 4L4JA 4PG2C 2JJTC 3F5WB 5T33L 4XXCA 1U91B 3LEYL 3ERYA 3IS0X 5BVPH 4HK3J 3N06B 5EUOF 3D2UD 2OLDA 2VITA 3B6SB 8FABA 1NMCC 3RVUC 5J11B 2DN7A 1J0KA 3SOBH 5BQ7B 5T1DH 5C0NC 1HYSC 1TFHA 1CGWA 4MWFB 5DMIH 3SDXB 4QRRB 2BXYA 4G6AC 4QRPE 2WANA 1AJ7L 2XWTB 1YN7B 4NYLB 4TN9A 4OV5A 3G5XA 1NLDL 5HDQH 1D5MA 5F8QC 3FFCE 4CDHA 3HFML 4XNMB 1ZLVH 1Y6MR 4OUUB 5CBEA 2CRYA 3HRZA 2D31B 4OGXL 2M1KA 4XPAH 3VXMA 1K85A 1FIEA 1J11A 2DQFA 2OL3B 4GAGH 3U4BL 3BOVA 3DRQB 5E03A 3PL6B 1JZ6A 1CLYL 3GUTB 3HR5B 1BD2E 5HGAB 4Y2DA 3V6FA 5C7XH 3N1PC 3QUZC 1SYSB 3QHZH 1Q8MA 2YWZA 2OJEB 4BFEA 2VXSH 3KPOA 5HYJA 4X0KA 4LCCB 4K94L 4YDVB 1MFDH 4IOFC 4WTWA 1F6AA 1K4DA 1ACYL 2IH3A 2ZZUT 5BV7H 1F3JB 1KELL 1W72A 3MV7B 4O51B 3MACH 4YHPB 4QRPA 4GBXC 1X5AA 2W92A 4Z7VB 2ZUTA 1TQBB 1HKFA 4PJ8B 2OTWB 4UT9L 5JO5B 1TZHA 2J8UF 1CDUA 1JYVA 4OIBA 3O2VL 2GFBB 3LN4A 3IS1X 2QQLH 3QEGL 1OAQL 3FFCD 1BD2A 5FGSA 4WDIA 4LVEA 4HJJL 5E8DH 4U49A 3NFNA 2BXZA 3TJEH 3A0OA 2AXGA 4MSWB 1JGDB 2PW2B 4BZ1L 3I02A 3PJSA 2Y5EA 2OR7A 3UTTA 2AP2A 3TO2A 1A7QL 2QR0A 2P5WE 1MCWM 1OARH 4NZUH 1IQWH 5H2BA 5C0DB 3NPSC 5TF1H 5LWYL 3QFJE 2WIIA 5I15H 1Y18A 2BCKB 4R2GC 5BZDA 2AK4B 4XMKL 3PIQA 2XZCH 4PJEE 2YKLH 2VL5B 1FPTL 1E4KC 4L8SB 2Q8AH 5D1XB 2X7LB 4P2QE 5E99L 1OL0A 5DO2D 5H94B 1OHQA 1ES0B 3HS0A 2Y36H 3KLSA 5I18H 5FHBH 3BWUC 1FHGA 2LV4A 1Q0YH 3LPFA 3T09A 4NT6B 2HVKB 1Z3GH 2DS4A 1MRCL 3ZHLA 1A6ZB 3FCTB 3L5HA 1N5YL 3QJFB 1OW0C 5HDLA 1JPGB 1MFCL 3O4LE 1KN4H 2P5WA 3G5YB 3ULUC 3TA3C 3MNZA 4ETQA 5J11C 3TCXA 3QFJA 1R5WB 4HUXA 3BUYA 4K55A 4POUB 4F37F 5J7CC 2X70A 4FFZH 1A5FL 3AU1B 1NAMA 2EDEA 4F7CB 5TDNA 4P2QA 1F4AA 2DYPD 1I1RA 2EDYA 3ZHDA 3TBYB 3OAZH 1YQVL 3P77A 4F58L 4GLRH 1LDSA 4ZPTB 3ARDD 4KGLA 1BFOB 3L5IA 3WNLA 2PUQT 1Q9OA 3S96B 1DQLL 3PL6C 4NZTH 1INDH 1QKZH 1RZKL 3GO1L 3O0RH 4P2QD 1R3IH 3SE9L 4ZTPL 3SE4A 4L8CA 4YX2H 1H3XA 1KJ3H 4HK0A 1I8MA 1CT8A 1G9MC 2HFFB 3R1GL 4ZFOB 4EKXA 2YUXA 5IW3A 3MJ7A 5D1QB 5SV3A 5A43C 5GJSL 1IAMA 3TV3L 1ITCA 3RWCB 3V4PL 2DRUA 3MLYL 1MCOH 1U8NB 3BESR 3MRGB 4U6YA 4IIQA 3QBTB 1U8LB 4M1GH 2JB6A 4ODVL 1WIPA 5HYQA 3PWJB 4PJCF 1U8OA 4R7NA 5JW3L 2CRIA 4F9LA 1DN0A 1TQBC 5IHUH 4PJ8C 3O4LD 4NQVA 2VDNH 5GSVA 5FYLH 1NC4B 3ZTNH 5D7JD 5SX4I 1KLUB 4NQDE 3GRWL 1UXWA 2DBLH 3S7GA 4XRCA 4YHIB 5MERB 1KJMB 4YH6A 1DQJA 2ZCLL 3U30C 3DWTA 2BNRE 1NCNA 3FQXB 2A73B 2GAZB 4KI5E 2WNGA 3IDYC 1LQSR 4JO2H 1YEJH 4U1JA 5CGYD 4OIIL 5ITBH 2O5YL 2D03L 4X6DB 4TULH 1YEIL 5IVZB 2EDFA 3OAYK 5DDHB 4PD4J 3TPUB 2VOTA 5IV2A 1KTRL 2M2DA 1CCZA 3C5ZA 4JFPB 5C3LD 3FTGA 2BSRB 1X4YA 4ZFFB 3RWFB 5DQJA 3VJ6B 1KYOK 5B4MD 3UAJD 3VD7A 4M6OL 3MLUH 4RMTA 3PP4L 4PREA 1RIHH 4WO4B 4WU7B 5EU7E 2OR9L 4J6RL 4RQQA 3MV9E 2R23B 4L8SC 2BC4B 3C2SA 5D1XC 3V6ZB 2AJSL 1BAFL 1H3WM 4HZLA 4EBQH 1MLBB 2LVEA 1G6VK 1FO0L 1JFQL 3FRUB 1MJ7H 3ZMRA 4ENED 1N7MH 1SBSL 2Z8VC 4MJ4A 4JFXB 5FO7B 3FN3A 1WT5C 1VFMA 1E6OH 1CYGA 4FXKA 1S8DB 1B9ZA 3PHQB 4XPTH 4HBCL 3IGAB 4RGOL 4NQDD 2R1YB 3PE9A 2W0PA 4LIQL 4NWUH 4EI5A 1T7ZA 4G43A 4LCUB 4EVNB 2B4CH 2BNRD 1VDGA 4IOSD 4KI5D 4PLKC 2P45B 5C2BL 2X4NB 3DNKA 3MJGX 4KK6C 1OSPH 3IFLL 2HWZH 2C4FU 2ICEA 5FKPB 5AZ2L 5I66B 4Y19B 2DQHL 3MV9A 2FEDC 2X4QB 4GW1A 4JFFE 4LLUA 4M7JL 3KG5A 5F21B 4EN3B 4L9LB 1HZHL 4OZFA 5JZ7D 2H2SD 3O3BA 4CVZB 4TSCH 3HUJB 2FHFA 4ODWA 4LU5H 3U6RB 1OGTA 1FIGL 2XV6B 2CK0H 4PP8C 4OKVA 5I8OH 4LLAA 1NCCH 3LS5H 3MV9D 1U8QB 4ZAKD 2BMKA 4PGEA 5HVFB 2UY6A 1FORH 2NTFB 1CDCA 1ACZA 4PGBB 2GT9B 2R2CA 4MNQB 5I19H 2BZDA 2VLRB 3QEHB 5DJ8B 3V95A 3JV0A 1NQBA 4BKLA 4POZC 4MXVE 3BP4A 3RHWK 5DD3L 3TPKA 3P11L 5JHLL 1EEYB 2FJGA 1EX0A 4HKBB 3QFDB 3EYFB 4XWGL 2OXGA 5SWZA 4DUXA 4RDQF 3OKOA 2DJUA 2FD6H 1ZT1B 1J86A 3UTQA 5TQ0L 3KWWB 3DV6B 3WJLA 2C3VB 5DRXA 1BX2B 1GJIA 2R0WH 2VLJB 3UC0H 4JPIA 1I1FA 3LHPL 4JFFD 4JO4H 3QUXB 1PKOA 3T1FA 1CBVL 3IXAB 4K7PH 1YYLL 2L7JA 5KOMC 4MJ6B 1J9CT 2XRAL 5L2JA 5KAQG 2XPGA 4N0UB 4U1SA 1CE6B 5JPNB 1FZOB 3TH4T 1EGJA 1ROWA 4Z7NF 5IGXL 4U2ZA 5E94B 1U8JA 3MMEB 1DL7H 4NC1E 1P5UA 2VDKH 4M1DH 5C8JA 4OM1L 3DO3A 4WO4C 3VG9B 3ZKNC 1PX4A 1WFUA 1BF8A 2JCCE 4IRSC 4PB9L 3MLSL 1EO8H 4UT7L 5I1KH 4ELME 2MQ0A 3W81A 4GQPH 3SJVB 2O5ZL 1U3HD 4KK8D 5L6YH 2DKSA 4PTTA 1IEHA 3BD5A 2I27N 3CUPA 1GZQB 1MREL 4R90H 1ZLUH 4LPWA 4O2FB 4XXDB 3QQNA 5M95B 3OXRB 3PWVB 4YHZH 4Z77A 1JF1B 5IB4A 2F58H 5IESL 4LLMB 2VSCA 3RWDA 5DC9B 1FE8H 3BPNB 1KCSH 4JRXB 5DJ2B 4NFDA 4KXZH 5F9DC 3VXUA 4X6CF 5D7LE 2AAVA 3FL7A 1PKQB 3TO4D 4OD1L 4W81A 2DDQH 3CVIH 1T04A 4JQXA 2YPLA 1GCFA 2AGJL 3EYOA 3MXVL 4QRSA 5FK9A 3BKMH 2VYRE 1N6QL 2V7NB 2ZKHH 3JVGA 3W9DB 4ELMA 4N8VG 1DVFB 2OBGA 4TSBL 3RZCD 5E24E 5I1IL 5MI0B 4JFQA 5B38B 3AREC 1UJ3B 2B2XH 3LKRA 4AEEA 2E6PA 2FX9L 3PQYD 3T1WA 2ATPA 2DL2A 4P46D 5B39A 2PNDA 5BW7A 3GI9H 1CFQA 2GUOB 4OBSA 4OIAA 2IG2L 3PWPD 5EG6C 3GJFA 5E8EA 4MJ5A 4Q9RH 1NLBH 4NWTH 1M1SA 5D7LA 4KZEH 3I84A 1OSZB 3DIFA 4QRUB 1IT9H 4GJTB 5IVNA 2BNQB 5FXCH 5TFSH 2V5YA 2Y4SA 2FJFA 1EHNA 2EEDA 3PWUA 1B0RB 4HPOL 4EI6B 3ARSA 4CRPA 4HXBH 4IHOB 1NGWB 3WIHH 1NGXB 1PZ5A 3KPQB 3BMWA 4LSSH 4ZYKB 5DMGC 2HRPL 4MHHG 3HZYA 3JBG7 3VCLA 5E00A 3QUXC 3O6MH 3KDMA 2ZUQB 1U92B 1DR9A 2DQCH 2W0FB 4G5ZH 2GJZA 1XIWD 5JOFA 4UOW1 5FA4B 4HT1H 4JHWH 3WFHA 1KB5H 2YD9A 3DURB 4YHNA 5JHDE 3S34H 4MZ3A 2OJZH 1T03L 4FFYL 1EK3A 3MV8B 3NACH 3WDHA 5E2WH 3UBXG 1D5ZB 3LKOB 5FO8A 5EZLA 5KSBF 1T1YB 1QP1A 1L6ZA 1B4JL 2J5LB 3Q3GB 2LAGB 5IIEA 1I7UB 1MF2H 3BT2H 5FCUL 4XWOD 2OZ4L 5TE7L 3VG9C 5I8KL 5CP7B 3NN8A 4BSWB 5JW4Q 2Z92A 4FABL 4WENB 1MJUL 1L6XA 4R7DB 4UBDC 4OKDA 2HJFB 3NFPA 3NFSH 2VC2L 3RI5K 3MRMB 1JFMA 4Z7UA 1JNNL 1NMAL 4OFKA 4NZDA 1AQKH 3TEUA 3TJHC 1YMMB 4XCCH 1RZJC 1VPOL 4MJ2A 1A9EA 3FAXA 4YR6A 3RY4A 2R1XB 5JHDA 2AABL 2HKFH 2V5RA 5CINH 3QZWB 4LSTL 3SDCD 1DQTA 1XCQB 3RUGF 3S35L 2O93L 2YPKB 4ELKA 4UNUA 3CVHL 3QO1B 2E7LC 1KUMA 1QPXA 2FHCA 3CSGA 1HKLH 5F96L 2HKHL 1LO5B 1B90A 1OGAB 3V7AG 4NSKB 3MO1A 1JPFA 4AQ1B 1FAIL 1AGEB 4NJAL 4O9HH 1L0YA 1A7RH 2EDOA 3EDDA 3STLB 5MI0C 2AJVH 3O2DH 1RJYB 5MENE 3VH8A 1UJ3C 4JGUA 4LEXH 1UZ8A 1G7IB 3INUL 3QG6B 3O9WA 3VXSE 3ET9F 4GRWE 1NFDE 1NBZA 2MPAL 1H0DB 4HIHA 3F7YB 1AC6A 4XPGH 3GKWL 3FT4B 1VADB 3QIUB 5JMRA 1QTYT 3MXWH 3F6LA 1W0VA 4WFFE 3RWHB 4HS3B 5CEYA 4EXPX 5D6CB 4HUKB 1CN4A 1MQ8A 3AC0A 1OTTC 3BVNA 5DVKA 4TUKL 1KIPA 3ZZ1A 1Q9WA 1HILA 2A1WH 3MREB 2VMFA 5ICZB 2R29H 5AD0A 4UU9B 2R2HA 1FRGL 2A6KA 3CSYA 3RIAK 4F57L 5I76A 1FFOB 1FCCA 4GAYA 4KQ3H 2E9BA 2DLHA 5T3ZH 5CMAB 1JGLH 3IFOA 4N0RA 5HGBB 3NCCB 4GRLC 3MYZA 1QG3A 3QEUB 3U0TA 1IAIH 3HTLX 3VXSA 2DQTL 3ARWA 1NFDA 2ZUQC 5GRVL 4MGXA 2BVPB 5HGHA 3EOAB 5ERWB 2FWOA 1RHHB 4QT5A 4P99A 4CNIA 5MEND 5ALCH 5IUSA 2YC1B 4D9RD 4OT1H 5DZOA 3D3VA 5ID1A 2RCSL 3QG7L 1NCAH 1WBXA 2APVA 2YEZB 4BK5A 1MY5A 4JFYB 3QT2A 3EYQD 5EU4A 2WWMC 4ZO9A 2X42A 1WBYA 4DN4L 1C08B 2XY1A 2J5LC 4P9ML 5L2KE 1WK0A 1MEXL 5HHXH 1CE1H 2DI8A 5AYUH 3SDDD 4DK3A 2FZ3A 3FMGH 4HQQH 3T2NH 4RZCA 3OB8A 3GSRA 4WFFD 2ARWA 2D7OA 3MBXH 3C09C 4ZSOA 4MVBC 4RAVA 3UZEA 4IDLA 3ARQA 5ELIA 2QSVA 1MHEA 3K74B 1H15B 3IDIB 4H26B 5TPWH 4WI6A 3WDIA 1T7WA 4OLXH 3BIKB 2E8YA 1QLFB 4RGNE 2EIBA 4HS6B 4L4TE 2VKXA 1FLRH 2IEPA 3B2VL 1BJ8A 2HMID 4QXGH 1I1AA 2UWEF 2OYPA 3LN9A 2NR6D 1YEGL 4NCC1 3OKYA 2DQJH 5HHNA 4P23B 3QH3B 1NCDH 4J7RA 3ZDZF 4M6MH 2GJ6E 2IWGA 2YMXL 3P0GB 3RRQA 3TVMC 2DM3A 3GM8A 3B9KA 4UIMA 4FMKA 3EYUL 3DOSA 5E9DE 3CH8A 5CJQL 4KQ4H 4PRAA 4JHAH 1T4KB 5D2LF 2Z9TA 4OGYH 4F9PC 1DBAL 1FP5A 4ERSH 4FQXB 1K2DA 3HE7B 4NM4H 3ULUH 4B7LA 5GRXG 1TJGH 4X7FC 5L2KD 1EAPB 4UUJA 3D85D 5B38G 5ANME 1WFTA 4NHCL 3RFZC 3BEWB 4JY5H 5HY9A 5D2NE 1YNLL 2JK5B 1XGYL 5E1AA 1IARB 1QFPA 1X5ZA 2O5XL 5IR1A 5AZEL 1PG7W 1EIBA 2VDOL 3UJJH 2OL3H 1RIVH 4D0CA 1C5CH 1N0LA 2A6JA 1ORQB 1CIDA 4RGND 1I7TA 4QHNA 3VRIA 3KPPB 4PRPB 2G2RB 3MUZ1 4L4TD 2OTUB 5DK0A 5C09A 4QHLB 5E9DA 1K8IA 2X1XR 4K8RC 1G9MH 1ZA6A 3THMH 1LILA 2BY0A 2RQ8A 1KT2B 3NIDF 2BNUB 4HG4K 1MIEL 2GJ6D 1G6RB 1R5IB 2BDNH 3K2UH 4Y4HD 3WLWD 2XWBB 2VR9A 4L29B 5GS2D 4X5WB 2CKBL 1CG9B 4KKCD 5IBTH 1MQKL 5E9DD 3C8DA 2X4PA 1GHFL 4ZUWA 5LCVH 3W2DL 1K4CB 4GSDH 3O6KL 1VKXB 3RWGA 4M4RA 4KVCL 3EGSB 1CK0H 4YZFE 3WYRA 2BHYA 1ZS8B 5EZJB 1WCQA 3G6JF 4ZUVB 2NZ9D 4BYHA 2E9IA 2VDML 3MRPA 2CUHA 1ZGLB 1J1XL 5DZNA 4CN4A 3P0YH 3EKCA 5F1IA 3MLXL 4PIRF 5EC2A 1AE6L 1BGXL 4FZ8L 3QDJB 1O7SA 5ETUA 1H8NA 3L5WA 1DBBH 2R9HD 2P49B 3CDCA 1P6FA 3C08H 1BOYA 1F45A 4P4KC 3SKOA 1R3HA 2NNAB 1YJDL 4PDCE 3MJ9L 4JFEE 4OLYL 1GIGL 5DZLA 3MFFB 4NRZA 5KSAA 3C9NB 1MH5B 2BVOB 3HA0A 1K3IA 3T3PE 4QNPF 3QQ4A 1HSAA 2NY2B 2VXTH 4WHTB 1KV3A 1OB1A 4JVWA 4P2RD 3FO1A 3DVGB 4K9EC 2X9XA 3O8XB 4H1LB 3A67L 3GBNL 2GSIB 5DJDA 4X8XA 3EZ8A 5KSAD 3MRHB 5GRUH 5T3XL 2XFXA 1JWMB 4X6BB 3HMXL 3ZDYE 5I1AA 4XGZA 1AGDB 4JN1H 3HI6H 1YEFL 4FFWD 4Y8DC 1ADQL 4NQCE 3DTXA 3FHQA 3SGJC 1I1YB 3HE6D 2XT1B 5H35B 4UTAH 5I1HH 1BECA 3E3QC 4OQTL 3GSNL 4Y16C 3UTSE 1T7YA 5D6DC 5CD5C 4HWBA 3SE8L 5C07E 1QSEE 1XGPA 2VE6B 4OZHA 3CIQA 5EZOL 1WZ1H 2MKWA 3N1FC 5D7KE 4PJXE 2AQ1A 2NXYD 3IAPA 3IKCB 2HFEB 1XF3B 4JFED 5HJ3A 4I0KA 1T89A 5I8EB 2IAMB 4OZGF 3VI3E 4N0CC 2BOCA 4ZPVA 5DI8B 3EZJB 2ZCHL 5E8OA 1JCKA 5E8NA 4Z0BH 4MJIE 2KUTA 3X11A 4AMKL 1XCTA 1RZ8B 3TWCH 4LSDA 4ZOBA 2WBJC 4IRJC 4NJ9H 1J1OH 4NQCA 2IADB 4U1HB 5IF0A 1DQQA 4PGCB 2AJUL 4AENB 2NY3B 1S7XA 2FDBP 2I9LA 4UINH 3UJTH 2QQQA 2UZIH 1KCUH 3MBEB 2Q87A 5C07A 1QSEA 1S5IH 4GLRI 1AGBB 4NQCD 4HPYH 4I0PB 2VXVL 5HD8D 1EFXB 1IEBB 1R3LB 3HI5L 4PBXA 4PJXA 1SMOA 4TOYH 4MA3B 4C83B 4I77H 3HG1E 3U9PH 2HVJB 3UTSD 4APQA 4I3GA 3WFDH 2X4SA 3L3DB 1IGTB 5C07D 1QRKA 1QSED 3S36L 1OAZL 1CICC 3EUUA 4C57C 2Q76B 3X3GH 4CADA 4JZNB 5D7KD 4L3EE 5IB1B 1UT9A 1NAKH 4FN0A 1QEWB 4AJ0A 2FR4A 3C87A 3FQTB 4MJID 4P57B 1BOGA 4RMUA 1JN6B 5J3HC 5JIKA 4GS7C 3J8F7 4KJWC 5BVPL 3L1OH 5CEXA 2O61A 3UROR 3ESVF 4R4NC 4U6XB 5T1DL 4AL8L 3GK8H 4UTBL 5DMIL 5B8CB 3HB3C 1MCLA 2VDLH 2VDQH 2VLLA 4LQFL 3BPLC 3O8XC 4JFDE 4KUZH 1DP0A 1A6AA 4L3EA 4GKNB 4QXTB 2J8OA 3HG1D 2P1YA 3DUUA 4P2OA 3BPCA 5DJZB 4XPAL 4Y0GA 3VFGH 1ZWIB 4GAGL 5GGTA 3VFWA 4CVXB 2NW3A 3NZ8B 3RHWF 1Y0LB 4WI5A 3RWJB 5L8KB 1IILE 2HT2D 1E6JL 2ITDB 5GIRB 5C7XL 5EZIH 3P0VH 2X05A 4YEEA 3QHZL 2F74A 4WUUD 5DHYB 2EICA 4P2OD 2VXSL 3TN0A 5JIPA 1LWRA 4HSQA 4LLVA 2H3NB 4J4PA 2E7HA 1BZ9B 3KLHD 3QQ3A 1BIHA 4Z18A 1MFDL 4LVOB 4LASH 1YDPB 1DZBA 3KYMB 4G7VH 5IW1B 1WCBA 4P5TB 3MACL 1JZ2A 1T66C 3HNSL 2NZIA 4W68A 5KVDH 3OKLB 1ZSDB 5GRYA 1LHZA 1TCMA 3P9LA 4JFDA 4J4PD 1VACB 2EDHA 5J6HB 5F72S 4NKMA 2IAMC 1PGRB 3VWKC 3U46A 5L88L 4OCWH 3QI9C 4ODUA 5CGMA 1YEDB 2I26N 3KYNB 4CMHB 3V6OA 2CJUH 3QUYA 3RPKA 3RVVC 4LIQE 2QQLL 1Q9KB 4JFDD 3HLAA 4G59A 1OAYH 4Y4KC 1KF9B 3DXAE 3ZT7A 1YPZA 2CDFB 5KG9A 3A6BH 3TJEL 3MRFA 2FH6A 3N9GH 2NY3C 4MAYA 4A6YH 5F6IB 1C16B 2NYYC 3WFBH 3VXOA 4PJ5D 3EYSL 1T5WA 4I0PC 2P8PA 3KJ4B 2VITB 4MQ7A 2WP3T 3CLFL 1IQWL 1ZT7A 1FO0A 3QCVH 5TF1L 1KCRL 5I15L 3SDAA 5D96B 1HHHA 2XKUA 3KPNB 4W6XB 2XZCL 1EO7A 4OV5B 5J6GA 3G5XB 4W6YB 4KHTH 1QBLL 2Q8AL 2K3TA 4ONFH 4M3JA 1HDMA 4IJ3B 4KJPD 4XVSL 3FB6A 3LZFH 5CBEB 3SDAD 3GGWA 4OD3H 3VXMB 2DQFB 1Q0YL 3DXAA 1L0QA 5JIHA 1EH9A 5IKCA 4YFEA 3W5MA 1Z3GL 1UKSA 1KJ2B 1UWEH 1BBDH 4Y2DB 3V6FB 3LQMA 2C3XA 4MQXD 3FO2A 3BN3B 3GHBH 2RGSA 4GXVH 3KPOB 2QKIA 1JWSA 5HYJB 1F4WH 4X0KB 3KVQA 4BQ6A 4WUKH 1KN4L 2DI9A 5C0CD 1F6AB 1K4DB 5IQ7H 1AGFB 2IH3B 2ADJA 5IEHA 5JNYA 4QKXB 3C6SA 1W72B 5C6WH 3MR9A 4MLIA 5EORL 3MPCA 4QRPB 2R15A 4FFZL 4PJ9C 3VU2A 4H1LG 2CDGA 4G6KL 1BZQK 1TZHB 1RZJH 4GO6B 3V0WL 4XPBH 1IAIM 1OAUH 1AO7E 3LN4B 2MWCA 4NZTL 4Z95H 1QKZL 3IDNA 2XA8H 2WSKA 1WSST 1BD2B 3GBLA 4WDIB 1QUNA 4X9HA 5DK2A 3NFNB 4LL9A 2EO1A 1KJ3L 2AXGB 3BZEA 1BMGA 3LH2H 3BH9A 3I02B 4YC2C 4LVOC 3PJSB 3UTTB 1P4LA 3TO2B 2QR0B 5CJOL 1D9KD 3RGHA 1T3FA 1HYRC 2OP4H 3OZ9L 3R4DA 5H2BB 3UDWA 1OPGH 2WIIB 2PO6C 5IHUL 1Y18B 5CKAA 1S78D 3FONA 1IZJA 2VDNL 2A74A 4WI7A 4KXZI 5FYLL 3PIQB 3EW3B 5IQ9A 5IFHH 2NMSA 1UENA 4CAGA 4P49A 4M62H 1AO7A 4M5ZH 2JELH 1JZ4A 3E6HA 4NGHH 3HS0B 3I3DA 4NPYA 1NUNB 4XNZB 1YEJL 4G9FD 2CDEA 3FHAA 1AO7D 3D18A 5EU6E 4AIOA 5DTFB 4KUCD 3LVEA 4GOSA 4K3HA 1U3JA 3KJ4C 1A1OA 3UPRA 5CS7A 2P5WB 4ETQB 3OG6B 4D0BA 3QFJB 4LCIH 1U6AH 4HF5H 4HUXB 2VZ3A 3BUYB 1RIHL 2X70B 3CU7A 3IDMA 1NAMB 5TDNB 5DJYA 3PGDA 3QJHA 3IYLW 4P2QB 2YD7A 3BGMB 4IJ3C 4KJQC 3P77B 1MJ7L 1NGPH 1N7ML 1RFDL 1DCLA 4X6DF 1JNHA 1HHGA 1FLTX 5GGVY 3U9UA 4XPTL 3FB8A 1CFNA 4J1UA 3LQAC 5EC1A 3TLRA 4Y2DC 4Z78A 1BQHG 4L8CB 4ZO8A 3GFUA 3HZVA 1E28A 4HK0B 1I8MB 1HINH 4K7FB 1CT8B 1JF5A 5DQDH 3QUMA 3MJ7B 2XACC 3GJEA 1S3KH 1F11A 4Z8FH 4D8PA 4KK9D 4NO3A 5FDWB 2GEEA 2PETA 3VMNA 1FVEB 1IEAA 4IIQB 1OSPL 5EU6D 2DLEA 3CSPA 2FO1A 3IDJA 4LK4A 1A6TA 2JB6B 4PBVC 4RAUA 1I9RH 5HYQB 2N7BA 1U8OB 4R7NB 2FATL 2ORBH 1DN0B 4DAGH 5ENWA 1HEZA 4HV8A 4NQVB 3CU1A 1PD6A 5GSVB 2EXWD 4TSCL 1XGTA 4KTEL 3TZVA 4LU5L 2EDKA 1FSKB 3EO1A 1WTLA 1UXWB 4PJAE 1NCCL 3LS5L 4LKCA 1KB5A 4RMQA 4XRCB 3R8QA 3QDGD 1DQJB 4YHKH 4NO5A 1JGEB 1BIIA 4DKEL 4KHXH 4U3HA 1EMTH 2GK0A 3V5KA 1VHPA 3K4DA 3RDTA 5I19L 5SWQA 4G8IA 4RFNB 3VGAB 2XG4A 4QO1A 1KBGH 5JA8B 5CJ8A 2AI0H 5FO9A 4J3UA 3MODL 3AUVA 4M7LT 4AH2A 3RIAF 3BGAA 2NY5C 3C5ZB 5DD5L 3FTGB 3PHSA 3U2SA 5DQJB 3HUJF 5I74B 3S9DB 1JL8A 5DO2C 3QPXH 4DGYH 2FD6L 4ZFGH 4PREB 5DD0H 1A6WH 4ZXBD 1U41A 4RQQB 4JM2B 4ONGL 1CXEA 3GMLA 5EU3A 4PLNC 2VH5H 4HZLB 3UC0L 2XQYG 4J23A 4Y5XC 3S5LA 4LRNL 3BW9A 4XCFH 4XNQA 4WTZA 4FXKB 4K7PL 4X9GA 5SWSE 1N3NA 1HE7A 2DBJA 5MHSE 1UYWH 1YY8A 3RWIA 2H1PL 1SM3L 4K8RH 3TT3H 4EI5B 2DQIH 1PG7L 3MROA 5F7EH 4UV7L 3Q5TA 4HGKC 2JIXA 3VWJA 4CKVX 1G7PA 1UCTA 3AAZA 1X6LA 4G8GA 1AFVH 3WO4C 5JR1H 1XF4A 4OF0A 3IDXL 4OBRA 4BJLA 1LO0L 2ICEB 3M8OH 3SY0A 3MV9B 1QBMH 3VW3H 3CXHJ 4GW1B 4XTRD 3S4SA 4LLUB 1Y6NR 3GHEH 4PRHE 5L6YL 1JPST 2D4DA 4X9FA 4OZFB 3KLAA 3O3BB 3OB0H 5JQ6H 4ODWB 3VGDA 1NCTA 2DI7A 4FQ1H 1OGTB 3SGEH 2XQYK 5D93B 4OKVB 4UNVA 4YHZL 2BMKB 4PGEB 4WFHE 3MUGA 5L8JB 2WK2A 3OQ3B 1FE8L 5F7DA 1OM3H 2Q8BH 2ZP0T 4PJBE 3K8KA 4BFGA 4I2XA 3SE4C 2F9BT 4N5EA 1BZ7A 3WD5L 2I07A 1I8LA 4D3CH 1YYMH 5DMYA 3V0VA 3UO1H 1WWCA 4Q9CA 4N0YH 4V3DB 4HUUA 2G60H 5SWSD 4BKLB 1CLZH 4PY8J 2DDQL 3CVIL 3BP4B 3F8UB 5MHSD 2X4RA 2OMBA 1IAII 5IVXF 3CZFA 2FJGB 2PTUA 3BKML 3C60D 3D9AL 1LEKA 5SWZB 2EKSA 2ZKHL 3OKOB 2MJWA 2P8MA 1FL3A 1A6VH 4LVHB 4MD0A 4JQVA 3U7AA 4RMWA 1T83A 2J1KA 2HJKA 4NO0A 5CGYC 5T1LD 1NCBL 1NKOA 1TZGL 2LU3A 2APTA 2B2XL 1FSKC 4K9EH 5IG7A 2G5BA 2W91A 1G84A 1Q0XH 1I1FB 2FIRT 3NCYS 3RVWD 4PJGE 3ARUA 3GI9L 2A2QT 4PRHD 2HFGH 4G8FA 3T1FB 2X1QA 5KN5A 1T1WA 1IQDA 1NLBL 4NWTL 2AEPH 4C55A 4NO0D 4HWZA 3UAJC 5L2JB 1UFUA 4UT6H 4KZEL 2LU4A 4RFNC 1LE5B 3F12A 2XPGB 4U1SB 2IMNA 4HMDA 1AGCA 4WFHD 1ZKAA 1IT9L 4FS0A 3FN0H 3ZKMC 5IK3A 5TFSL 3C5ZC 3KAAA 5LXGH 3WCYA 4KDTA 3HNVH 1MHHA 5I74C 4ENEC 5C8JB 2XN9D 4HXBL 3V7MA 4RWHA 3WIHL 5E0QA 4IS6A 4R96A 4FP8H 3V6BR 4LCYA 1MAKA 1QR1A 4L4VA 4PJGA 4ORZC 3CUPB 3O6ML 3UX9B 1UM4H 5DEGA 4KI5C 4DUWA 1CXIA 2DQCL 4G5ZL 4Z77B 5IB4B 3RWDB 3T65A 4NRXA 5KTEH 3D39A 1A14H 2OJZL 4NN5B 2N7AA 1H8OA 1TMCA 3WHE0 3VXUB 3W0WE 4LHUA 1UZ6F 5E2WL 1G6RH 1DE4A 3FOMA 3Q2CA 2GCYA 4L3AA 5JW4M 1T04B 2V9TA 1H3VA 2H2SC 2YPLB 1I9JH 3TA3A 2VUYA 3DVFA 1MF2L 3BQUA 3KR3L 5EUOA 4WJ5A 4AIXA 3EYOB 4QRSB 5FK9B 4LHUD 5DHVH 4ELMB 3Q5OA 2XZAL 3L3HA 2MOVA 2EDBA 2GKIA 3WS6C 3IFNL 3ARGD 2ATKB 4JFQB 3NFSL 3ARFD 3AS3A 1S9WA 3GSQA 3QRFM 1U8MA 4Q2ZA 1JI2A 1AQKL 3LKRB 5D93C 4XCCL 2J8UE 2ATPB 5A1AA 5LKNA 1N8ZA 5B39B 1CFQB 2HKFL 4PRIA 4ORGA 5CINL 5I2IA 2RR3A 1NFIA 1B6DA 4ISVA 5E8EB 4MJ5B 3FZUC 2OM5A 5D7LB 5K9OA 4D9QD 1D7FA 2FX7H 1RUKH 1FNFA 3DIFB 2E7MA 2VDRH 4URTB 4LSVH 3MGTA 4TQEH 1FNSH 3W0WD 2I60H 2GI7A 2APFA 2FJFB 3O3DA 4LPCA 4NN6B 3F65A 4LVHC 4O9HL 1A7RL 3PWUB 1QSVA 2AJVL 3O2DL 3RNKA 5CD3A 4DVRL 2BRQA 2R2BA 4X5XA 5LG1A 2J8UA 2BRRH 1IM9A 2PCPA 4H1LH 3HZYB 3I6LE 3VCLB 5E00B 3WJJA 3ZTJH 3KDMB 5FFLA 2P44B 1WTGT 1CIUA 2P8LA 1OVZA 2D4FA 1A4KA 3AS0A 4G6FB 2GJZB 1FNHA 2DMKA 1FG2A 4OFDA 3REWA 5JOFB 3WFHB 4G6MH 3V4UH 2APBA 1IKFL 2ENSA 2P5EA 1KIRA 1IM9D 4OZIF 3BZDA 4MAUH 4NP4H 4Z9KB 1LEIA 3UTPE 2LAAA 3P40A 1HHJA 5KVFH 5FO8B 2DQEH 3HMWH 4KK8C 5E6IA 5DFWH 3AROA 4LOUD 1A8JH 15C8L 2A1WL 5IIEB 4YAQA 4CU7A 3RTQA 4R6UA 1X5IA 1OAXH 4Y1AE 3GSXA 3NN8B 3PNWA 2CUMA 2Z92B 4NZRH 1JVKA 1BREA 4O4YL 5T3ZL 1JGLL 3NFPB 1MFNA 1H3UA 5ESVA 3P4MA 4Z7UB 4JGJA 3RTQD 3D0LA 1WT5A 5F88A 5DGRA 3TO4C 5J0BA 1A9EB 1YC7A 4YR6B 5T3XE 2COQA 4GG8A 5ALCL 2B5IB 5JHDB 4J3SA 3QDMA 5DA0B 4PFEA 5FYJL 4OT1L 5C86A 3I6LD 1HIML 1CU4H 4B5EA 1NCAL 3QRGH 4ELKB 3FRPG 2NXZD 3QNYA 1OF2A 3DSNA 5C08E 4JQXC 4PTUA 3ECBB 5HHXL 4QYOA 4HW6A 4NC1C 1CE1L 1FCGA 1CL7L 3GI8H 5AYUL 3FMGL 3T2NL 1UXSA 3MO1B 3MBXL 1JPFB 2DKUA 3UTPD 4RX4D 5KANI 1QSZA 3JVGC 5HYSA 1CXHA 4P46C 4UQ2A 4FQPA 3BRGC 1V7NL 1Z6JT 4OZFG 5JLZA 4WHCA 1NDMA 1BF2A 2HT3D 3VH8B 4L3CA 4BSVA 5DWUL 5EOCJ 3MSPA 1LEGA 4Y1AD 4AYFA 1AIFA 3H8NA 1UZ8B 1A3LL 4XX1G 3O9WB 1FLRL 1H3GA 4ZS6D 4JG1L 4KI1A 2NY1B 3SQOH 4HIHB 5I1GH 2HFTA 4UILH 4KTDH 1EHAA 2NY4D 2DMBA 5GGRY 1NCDL 4M6ML 5FM5M 5T3XD 1W0VB 5CEYB 2WQRA 1F90H 3CH1A 2E27H 2DAVA 5I1LA 3BVNB 4OGYL 4ERSL 3HC3H 4U1MA 1KIPB 1Q9WB 1HILB 4NN6C 4FQIL 4MHHI 4NM4L 3BAEH 3ULUL 5AD0B 1FYTA 5C08D 2AS5M 3CCHA 4PJCA 4MQTB 4C56E 3VMOA 3CSYB 2A6KB 4RGMC 5I76B 1WUNT 4GMSH 4Z0XA 5TGBA 4GAYB 1C7TA 5T5FH 5DLML 4E5XA 4JY5L 3IFOB 2C7UA 4FQLH 4HFUL 3U0TB 3VXSB 3BD4A 1NFDB 4S1SH 1U58A 5HGHB 2FWOB 4IDJL 3UJJL 3VFVA 4RMVA 2OL3L 5FOJA 1P9MA 1JYNA 4QT5B 1C5CL 4CNIB 3VG0H 4JPWH 3OGOE 2MQCA 2YPVH 3G5ZA 1P53A 4CJ1A 3D3VB 5BRZE 5ID1B 1QNZL 4WIQA 1AHWC 1WBXB 2C3HA 3ROOA 1S7VA 4PP2A 5EU4B 2NY0B 1K8DB 5IHZA 1G9ML 3THML 3WFZA 2X10A 4JLRA 1DLFH 2WUBH 2HT4D 3K2UL 2FZ3B 3NAAH 2DQGL 4PRNA 4RZCB 1X5JA 5I9QC 1VEMA 3GSRB 4C56A 1EEQA 4ZSOB 2OX5A 5IBTL 4RAVB 4IRSA 1GAFL 3OV6A 1B3JA 1MHEB 1RJLA 5IJVA 3O3AA 1ZHKA 1DBJH 4Z76A 2V2TA 3GMRA 4C56D 3K80A 4QGTA 1CK0L 1JV5A 1UCBH 1A7OH 2E9JA 2B5IC 2WWKO 3OHXB 12E8H 4LSRH 3C8KA 5MP6H 1I1AB 1NBQA 3C6LD 1W0YT 2Z31D 3EFDH 1M6OA 2HTLC 1Q1JH 3H9ZA 5CEZE 3DETC 1X9QA 2CSPA 2JE8A 1LK3H 3B9KB 4UIMB 2I25N 1JIBA 4PRAB 1DBBL 5ESAA 5BRZD 5FHAH 2MCG1 3C08L 1UB5A 5DEZA 4XC3H 3ZT6A 1K2DB 2VLKA 4WWKA 5GGRA 3SGDH 3TIDA 2IANA 5TE4L 4JDZA 4UUJB 3U4EA 4OFYD 1LDPH 2DWEA 3WXWH 1CVRA 4LARH 2A6IA 2F19H 1CXKA 3AREA 4YHMH 5HY9B 5C70A 5E1AB 1OWWA 3OKEA 4NQEA 5ACLA 5B39G 2VIRA 2XTJB 4WWKD 3O9WC 5IR1B 5DQ9A 1QD0A 1JHTA 1LK2A 1TJIL 1MNUL 3VFSA 1INEH 2X4OA 5F9JA 4D0CB 2A6JB 2ITCA 5GRUL 1MCBA 2Z4QA 1Z5LA 3C5JA 3H42H 1I7TB 3LQAH 4QHNB 3VRIB 2R4SH 1UQSA 5DK0B 5C09B 2BHZA 4KY1H 2JB5L 2F5BH 2FGZA 3HNTL 1K8IB 4JFZL 4A6YA 1ZA6B 3HI6L 4PJDE 5DFVD 4Z7NE 5I1HL 4P3CH 5HDBF 4DKDC 1OLLA 5E6YA 4LFHD 4UAOB 3LPWA 1W72H 5HHPA 5FUOL 2X4PB 3V52L 4BZYA 4ZUWB 1WJ3A 1WZ1L 5GRVK 3LEVL 3EYQC 4OCSH 3RWGB 1JBJA 4NRYA 4I13B 4XVTH 4KMTL 4S0UC 1OD9A 5KBNC 1OP3K 4I8DA 5ABDE 1UM6L 1NH6A 4Z0BL 4A2LA 2V9QA 4WHYG 2CKNA 4FQ2L 5IVOA 3MRPB 5GHWH 3TWCL 1WVZA 4XP9H 2ADFH 2YBRB 2NY0C 1WIUA 3J7HA 5F1IB 4R26H 4P2CG 4C4KT 4ZFOL 5EC2B 1CFVH 4X6CE 4S1RL 4KAQH 2X89D 5ETUB 1OOAA 3L5WB 3PGFH 1N26A 3FQUA 3I2CL 2NY5H 4O58H 1NL0H 3UJTL 1I7ZA 2UZIL 4WGWB 1KCUL 3SKOB 1R3HB 5BV7B 1SHMA 5TH2A 2HMIC 4HPYL 5ADOH 2Z8SA 3VFNA 3EYVA 2WBKA 1TXKA 2W1NA 5GRJL 2XICA 4NRZB 3SCMD 4I77L 1CFSA 1JGVH 1GPOL 3U9PL 5A3IC 1XH3A 3QP3A 3WFDL 2DJ4A 3ULVF 3QQ4B 1HSAB 2J2ZA 3BXNB 3RL1A 3B9EA 5FUCC 3FO1B 4LLQA 4OLVH 2AEIT 1UEMA 2RFXA 3X3GL 5DJDB 2FX8H 1KFAL 1NAKL 4OB5H 2ZUSA 2A9ML 5I1JH 4X6CA 2XFXB 1SBBA 5DUPH 3TYGL 4XGZB 4BH7A 4OGAC 5F3HA 4QF1A 3QIBD 3DTXB 4WNQA 3JV6A 4TVPH 4DFHA 1N59A 5E2JA 5D5MF 4AG4L 5J12B 5D1ZA 3VH8G 3NH7L 4G3YH 5FYLE 1RMFH 3ARTA 1JHKL 3MGOA 4NOBA 4OZHB 5LGJA 4PYHA 4RGNC 2ESVA 4LBEA 1OY3B 3OJDA 2HTKD 2VDLL 2XTJC 2VDQL 5HJ3B 2VRAA 1AD9A 2BOCB 4X9IA 5E8OB 1QQDA 4Y4HC 5E8NB 3WLWC 2WUCH 3LCYA 3VFGL 3X11B 1XCTB 3KJ6H 5EBLA 5BZWB 2VN4A 3WKMH 3GMPA 3BKYH 1WBZA 5EZIL 3BPOB 4X99A 4RA0C 5AEAA 2BP3A 5IF0B 1DQQB 1E4XH 4UZGA 1VB9A 2NW2A 1S7XB 4HUWA 1PFCA 2I9LB 1J8HE 4XNYL 4F8TA 2EDXA 5IBLD 4CN1A 4X4XA 4KGJA 5C07B 3DMMB 1QSEB 1CLOL 2J12B 4KKAD 1C5BH 5HPMA 1ODAA 4GRLA 4PJXB 5HHME 3CAFA 3VI3F 4EIGB 3IF1A 2BX5A 3TFKA 3CLEH 4HHAA 4APQB 3S3PA 2X4SB 3BEVA 4O2CA 5F7WC 1XF2A 3OR7A 1FAKT 5DVLA 5AWNH 3VDCA 4TSAL 4OCWL 1WZMA 3B5TA 1RUAL 5FYLD 4PJHA 3EFFA 1JPSH 4OAWA 4CADB 5LQBH 4F7MA 5F97E 1FFQA 5D7IB 5C9KA 2J8HA 3TFKD 1OAKL 4YBQD 2ICWJ 4LLWA 3RUGE 4DEPB 5BS0A 2KDGA 3I3BA 2FR4B 1EJOH 3N9GL 4Z7WA 3K2MC 5KSBA 1BOGB 3QQ9D 2PYEA 4HC1H 1GYAA 1ZANH 1ZT4A 1MSPA 3WFBL 1IGYA 5BV7C 1J10A 4HH9A 2V2XA 1A6PA 3V9FA 5CEXB 2O61B 3UTOA 1QLRB 1CGVA 1FBIH 3TCLA 4I48A 3EO9H 5GGQH 5KSAC 3QCVL 1J8HD 4C58B 5K59E 3JXAA 3VXQA 5ICXA 2VLLB 3MRIA 3OTTA 4NFCA 4WU5A 4KHTL 1QBAA 1SJHA 4FFWC 1A6AB 5HHMD 4L3EB 2YD6A 1CTOA 1IC1A 3LZFL 5IOPA 1PEZA 4P2OB 4YDIH 3BPCB 5FEBA 3RUGA 4OD3L 3TVMA 3TIEA 5D7SH 5GSRA 3GMNA 4K94C 1FFRA 2NW3B 1BBDL 5L9DH 4YK4B 4F9PA 3FQNA 3GHBL 3QDHA 2F74B 1FNAA 2NXYC 3TN0B 1F4WL 4LLVB 5E4EB 4GQ9H 1A9BA 4JVUA 3QQ3B 1U8KA 3I6GA 4YDKH 1XAUA 5J12C 3K7UA 5IQ7L 2Y5TA 1MFBH 2PXYD 2XY2A 4NOFA 3BFOA 3RP1A 3OGCA 5E5UB 1WCBB 2F5AH 1CQKA 2QSCL 3O2WH 3RGVD 2CH8A 4P4RA 1F97A 5CUSH 3K1DA 3NCYP 3RWEA 1IM3A 1P7QB 2VXUH 5KJRL 3P9LB 5HI3D 5MEOA 4JFDB 3QYCA 1ZLWK 4R4FH 1T89C 4HIXH 4NKMB 4UV4L 2H2PD 3U46B 1RZJL 3BDXA 4ODUB 4XPBL 1T0NA 1OAUL 3V0AC 4EXKA 3QUYB 3H3PL 1TTFA 1A7NL 3U4AA 2XA8L 1TTGA 3HAEA 2W38A 4M9OA 3BPOC 1YPZB 3QIWA 3D1MC 5TF0A 5KG9B 1K5NA 4DTGH 3MRFB 4JHBA 3KHQA 4PJFA 1MI5E 4MAYB 5EOCH 2EIDA 1ETZA 5DD1L 3VXOB 3FB5A 3FQRA 3SGEI 1QSFA 2P8PB 3E8UL 3QIWD 4AQOA 2OP4L 3DVIA 4MQ7B 1ZT7B 1OPGL 2FBOJ 4QTHA 3SDAB 1NBVL 4APQC 1KCGC 1HHHB 1M7IA 5J6GB 4ONOA 3G6DH 5IFHL 1X44A 1HWGB 5DJCA 3KXFE 4M62L 1U2CA 1HDMB 4M5ZL 2JELL 1NANH 3FB6B 2UWEE 3GGWB 3KPLA 35C8H 1QOKA 3RNQA 4RBPK 4MD5A 2G75A 3DXAB 1VSCA 3HI1A 1MI5A 4LDLB 2Z93A 1ZE3C 1EGJH 4G80B 4OZ4A 4ALAL 3FO2B 4KVNH 1ZK9A 4P4KA 4GW4A 2QKIB 1JWSB 3AY4A 5D2LE 3AB0C 2VL4A 5E7FA 3MCLH 4XMLH 1UH2A 1MI5D 3BN9C 4YIQA 1KC5H 4PJIF 2ADJB 5IEHB 1X5GA 4HF5L 5JNYB 5FIEA 3MOBH 3C6SB 4G9DA 3MR9B 5EPMA 4EDWH 2XYCA 5AUMA 1B2WH 1RZKC 2CDGB 2HT2C 1ZLVK 1FDLH 5KVEH 5DVOA 1DEEA 1NGPL 4PYGA 5HXMA 4P2OC 1XGUA 3CSBA 2QQNL 3MGAA 4XPFL 1R0AL 4H8WH 1B6UA 3KLHC 4I18A 1KLGB 2OSLA 3IDNB 1QPPA 3KXFD 2DD8H 5DK2B 2AERT 4YK4C 4V1DE 1J0HA 3IAGC 1GVIA 3BZEB 5D2LA 3TN0C 3KYKL 4H0HB 4XP4L 5E4EC 5GRWA 1E4JA 4J4PC 3BH9B 4CN6A 1EJ6A 1S3KL 1C1EH 5F3BA 1AXTL 3H9SA 1P4LB 1TJHH 4LRIC 2BVQA 2D0HA 4QOKE 5DT1H 1IL1A 3DVNA 2EH7H 4HMCA 2CIIA 2ORBL 3RY6A 4V2CB 3O45A 1IGIH 4DAGL 3VXNA 1IGML 3FONB 2A74B 1ZA3A 1IAKA 1QA9A 5IQ9B 4OTXH 5KS9A 3MRQA 1AO7B 4W6WB 1OP3H 3QUYC 3UPAA 3GJFH 4AM0A 5L7XH 4KPHH 3E6HB 2Y06H 3G6JE 4QWWD 2WBJA 4YHKL 1AKJA 4IRJA 3FAWA 4NPYB 3I9GH 5C6PB 1J0ZA 3TC9A 4KZDL 1CD9B 2CDEB 3G08A 2HN7A 4MAYC 3D18B 1KBGL 3BP7A 1BFTA 2DM4A 2AI0L 2WP3O 4UIKH 5F9AC 1WWAX 3QNXA 3VXRA 3CDGA 5HHOE 4V1DD 1A1OB 3UPRB 2VZOA 3KNBA 2GY7B 4KJPC 4D0BB 1KJVA 4DGYL 3SDAC 4ZFGL 3SPVA 3BWAA 4ZD3H 1P1ZA 5DD0L 2F8VA 2VZTA 4MMXC 3O81A 3IDMB 3BKJH 4QOKD 1CICA 5T5NG 2KZWA 5DJYB 5TQ2H 2I5YH 2R0KH 3PGDB 2VH5L 4QNPE 3QJHB 3BHBA 4YDJB 4MQXC 4DW2H 3OG4B 5SX5H 3TBTA 2Y72A 3FT3A 1JMXA 2X1WL 1JNHB 1HHGB 2EZ0D 5CILL 3U9UB 4KRPB 1BQUA 3KPTA 3QXDA 4WHYH 1AXSA 5CP3H 1EPFA 3FB8B 5AYQA 1CFNB 4J1UB 4U7MA 5EC1B 3SO5A 5EIIA 4JY4A 4J3WA 4K8RL 5DUMH 2DQIL 5C0AA 4W4NA 4Z78B 1BP3B 2F53E 3HZVB 4Q9QH 1E28B 4HUMB 5DJAA 4LCWA 3QUMB 4DGVH 3MC0A 5CKGA 4WFEE 1AFVL 2YS4A 5JR1L 2M26A 3RPIA 4GXUM 4D8PB 4JM2F 4NO3B 1Q72H 3QULA 1IEAB 5GJTH 3H3BC 3IDJB 4NHUA 1A6TB 1UB6A 4RAUB 2ARJA 5D70H 1M4KA 2OI9C 1QBML 2GY5A 3VW3L 1YEKH 5HHOD 5ENWB 1HEZB 3MRBA 4HV8B 2AEWA 3GHEL 1H3PL 2MTPA 3ROLA 2YUWA 1XGTB 3TZVB 5JQ6L 2R8SH 2DB8A 1T21A 3T0EE 4OZGE 2FLRT 1D5IL 5GZNC 4M48L 4LKCB 1KB5B 3TESA 3CK0H 1T80A 5EOQH 5FAAA 4NO5B 5DMKA 1YY9D 2Q8BL 1OM3L 4HIIB 1BIIB 4LSUH 3REVA 2GK0B 4D3CL 3V5KB 2CGRL 5FDYA 3UO1L 3RDTB 5A40E 5I71B 2EIEA 5SWQB 1A7PH 3T3MF 4N0YL 4G8IB 2VDPH 2G60L 4JKPH 1N64H 1CVSC 1FH5H 3X17A 1CLZL 1IRAY 1V3LA 2AEQH 5FO9B 4AH2B 1BQLH 1AC0A 4PS4H 4O02H 2HLAA 2F54A 2F53D 4JKMA 5KVGH 5T3ZE 2GK2A 4IRZH 5C0BE 4LSQH 4EIZC 4DZBA 2UV3A 4WFED 1RZIA 1A6VL 4GMTH 3RVUD 4BA8A 5C0ND 3VWKA 4HKJA 1DQMH 1KTDA 3QI9A 3GMLB 5EU3B 3T0EA 1IC5H 4G6AD 4OZGA 4JO3H 4K9EL 4HDIA 1Q0XL 5FYJE 1ONQA 3S5LB 2OQJA 1ZVHA 3BW9B 3KPRE 3GMMA 2HFGL 5BO1H 3MZGB 1N3NB 1KNOA 4WI3A 2AEPL 2JF1A 1YY8B 2VLME 3RWIB 3VFRA 6FABH 3VFTA 3JWNC 4QCIA 2PYFA 1U95A 3H2WA 3MROB 3NOIA 5I17B 4DKFH 2B1AH 2JIXB 3JTSA 5EIQA 3VWJB 3OJMB 1G7PB 3AAZB 4G8GB 3QUZD 3NCBB 1V7MH 2AKRA 1XF4B 1A6UH 3VFUA 4TRPH 1S9KC 4PV8A 4LDEB 1X5HA 1HHKA 5J9PA 3I75B 4JPVL 1S9VA 3SY0B 3I50H 1IAOA 4PV9A 3S4SB 1RK1A 1QHPA 4FP8L 5GGSY 5T3ZD 4GRWH 5CZVH 5C0BD 3KLAB 4XCEA 4E41A 3TBWA 1ZEAL 5IFAL 1UM4L 4KRPC 4NFBA 4XVJH 3MUGB 5KTEL 3TBSA 1TVBA 5IB2A 1A14L 5F7DB 1W8NA 4H20H 4I2XB 5FYJD 1BZ7B 2UVFA 2I07B 3V0VB 3KPRD 5BCAA 3E6FA 1F8TL 4HUUB 4M8VA 1G6RL 1RUML 3MA9H 5ISZD 1LO2L 1M7DA 2W9EL 3DPBA 2X4RB 2VAJA 2VLMD 1TDQA 4WCYL 2W65A 3CZFB 4QRRE 1GC1L 1QRNE 1LEKB 1H5BA 2EKSB 3IRZA 3ARBA 2P8MB 4MD0B 4ZTOH 4H88L 4KWUA 1XZ0A 4R2GD 2HJKB 4HX1A 4XPHH 3SBWA 4NO0B 1ORSA 1SJXA 5E1HB 5IG7B 3VE0A 2UYLB 2G5BB 3STZA 3ZT5A 3E1F1 3K8MA 3R0NA 4PJBF 5IM7A 3QA3A 4G8FB 3QWQB 4HCRA 5KN5B 1T1WB 1IQDB 3DGCR 3JV5A 1FNGA 2MSPA 3RDTC 5I71C 4HWZB 1TVDA 3GKZA 2R4RH 1UVQA 3L3IA 1NC2A 4NC0B 2FX7L 2X9WA 1AGCB 1RUKL 2VDRL 4X6FA 1Q94A 3U7YL 2BVTA 5IK3B 3MV7E 1NDGA 2CIKA 1FNSL 2IBZX 3UYOD 1QFWH 2I60L 1QRNA 2D7TH 3O6FA 4UOJA 5I16B 1MHHB 4OF8A 5IB5A 5C0RH 2R69H 1FL5A 2QQKL 2RIKA 5EU5A 3HC0A 1UWGH 1I3GH 3ZE0E 3NPSB 3V79C 3ULUD 2PO6A 4AEIL 2I24N 3DYOA 1BWWA 1ED3A 2W9DL 3WIFA 4U3XA 4P3DA 4IS6B 3HZMA 4I3RH 4QRRD 4R96B 4U2YA 2A0LD 3O6FD 1QRND 1EUTA 2BRRL 4XHJD 4LCYB 1QR1B 5ADPH 4L4VB 3QCUH 4JZJA 4DN3L 5DEGB 1CD0A 2QADB 1MCWW 3U36A 4XAWH 3D2UA 5GS2H 3T65B 4RBPH 4LCCA 3SGDI 3D39B 4JJ5B 3PL6D 2B1HH 5GGSA 1ZVSA 4N8CH 2NTSP 1TMCB 4MAUL 4NP4L 1UH4A 4LHUB 3NABL 4OI7A 3VWJC 4XNXL 4XTRC 2YA2A 5JTWA 1DE4B 3FOMB 1F02I 2AW2A 4L1HA 2GCYB 4QEGA 5CZXC 3S37X 1CI5A 3TA3B 3LDBB 3L3OA 3BQUB 5EUOB 3D87B 4WJ5B 3GBML 5TE6L 2J3SA 1GGYA 4F3FA 1E27A 1FZMB 3MV7D 3L3HB 2VKWA 4PJ8D 1ZLUK 1S9WB 5KW9H 3GSQB 1A1NA 4XP5H 4ZUUA 1MCIA 5SV4A 3ULVL 1YEHH 1N8ZB 2E6QA 5J8OA 4M61A 4PRIB 3FT2A 4ORGB 3CMOH 5I2IB 1MCKA 4NNXA 1NFIB 4N5EC 4ISVB 5T33H 3SQBA 4JG0H 3RA7L 1CU4L 1I8LC 4YWGL 3C60C 4PJ7B 1F42A 4F80A 1T20A 1PLGH 1JUFA 4O5LH 5K9OB 3CFJA 4JFHE 3VMPA 3F7VB 3QR2A 1EEZA 1CDJA 1SYVA 3GI8L 4MA1C 1R3JB 3MGTB 2W07A 4PY8I 1NLDH 3O3DB 4MZ2A 4Z7UF 4AK1A 1OCWH 4ODTH 1J5OH 3HFMH 3O4OB 4JQVC 3VA6A 3FFCA 1MUJA 1T83C 2GW5A 4YFLI 3RNKB 2VWEE 5CD3B 2Q86A 2R2BB 4X5XB 2J8UB 2PCPB 1CLYH 1DBKH 3RX8A 4BH8A 5D1XD 2EC8A 4P0DA 1KTKE 3U30B 2P8LB 3SQOL 1A4KB 1KPUA 4KTDL 4UILL 2BJMH 3REWB 1FG2B 4PBWD 3IDYB 1G7QA 3KYAA 1BWMA 4K94H 2P4AB 4HWEH 2NY7H 2P5EB 2PKDA 1LEIB 1GGBL 1KCVH 2IFFL 1F90L 1HHJB 3WDJA 5MEPA 1EHXA 2E27L 4FOMA 5DS8A 4KDTC 5E6IB 3LAFA 4N8VA 4PLKD 4HWBH 3BAEL 4JFHD 2VZVA 3R0MA 5EULV 5HYEA 1QR4A 4KK6D 4YAQB 4LGPB 1G9NC 3RTQB 3GSXB 3PNWB 4GMSL 3X13A 2E5EA 2FJHB 3LB6D 4LPVA 3DX7A 5IB3A 3S5LG 3RVTC 1OAQH 4FQLL 4Y5XA 4HS8H 5ESVB 3HHRB 1YNTA 4WRLA 3P4MB 4S1SL 4WTZG 1FC2D 3D0LB 2QADC 5F88B 2HFFA 4YHOH 5D1QA 3P3YA 4GG8B 3VG0L 4X6DE 5LGKA 3D6GA 2YPVL 5HGGS 3QDMB 4TTDD 5K9JL 3TPUE 3CFEA 3QNYB 4M43L 1OF2B 4AEHH 4LKXA 5C3TA 3ARGC 4PTUB 5D1QD 1FGNH 4QYOB 2DYPA 3LDBC 3ARFC 3F7RA 3BQUC 4POZD 3NBNA 3NAAL 1P7KA 2A77H 1UXSB 3ARDA 3OF6D 3NTCH 3IVKA 1FPTH 3T0XA 5HYSB 3S4SG 4PJEA 4OD2A 3O11A 4UQ2B 1WC7A 1RY7B 5JLZB 2WW8A 3N85L 5E5MA 3MUY1 1NDMB 2GAZA 1X5YA 1NC4D 3SN6N 4BSVB 1LEGB 1MCSA 1K3ZA 1UCBL 3BDYL 1E4XI 4JM4L 1MRCH 12E8L 2YUZA 4LSRL 4RCAA 2EDLA 5MP6L 3FO0L 3EFDL 3JTTA 1G7LA 3UBXA 5B22A 3LS4H 5AAMA 4H5SA 4S10A 2J6EL 2QHRH 3WLBA 3O4LA 4JRWA 3G9VA 1TIUA 4QLRA 1HOCA 3V7AE 1T2QL 5D7JA 5I1LB 1KB9J 5FHAL 2HRLA 2PR4H 4OCXL 2XQBH 4U1MB 2X9YA 4XC3L 3H6JA 3C2AH 4LGRB 1FYTB 1MFEL 3O4OC 3CCHB 4PJCB 3ZLQC 1AY1H 3TBVA 3HUJE 2W9LA 3BX7C 2XZQH 3WXWL 4Z0XB 4WO4D 5TGBB 5C0IA 4E5XB 3DUSA 4YHML 2BY3A 1RZKH 2C7UB 5F71A 1PZUB 3X3FH 4HIEA 1CTNA 1JGUH 3WJJC 5IMKB 3SE9H 4ZTPH 5JOEA 5IFJA 1U58B 2BFVL 4RNRA 4MNQE 1JTOA 1INEL 2VLRE 3R1GH 3VFVB 2FO4B 4EDXA 5GGTH 4WW2F 5GJSH 4XT1C 4LOUC 3AS1A 3G5ZB 3V4PH 3MLYH 3H42L 1KJ2L 1X5XA 2X41A 4KY1L 1S7VB 4PP2B 1N6VA 4ODVH 2IBZY 5IHZB 3BSZL 1FZKA 4O00A 5JW3H 2AQ2A 4HC1A 5E6IC 3VFOA 3V5DA 2D7QA 1QFUH 3ILPA 4P3CL 1FNEA 4PRNB 1RURL 2CK2A 3RTQC 1DSFH 4C56B 4H0GA 1W72L 1RAMA 1HHIA 4IRSB 2VLJE 4Y19D 4NCC2 1RJLB 4NQDA 3L3GA 2DLIA 2K7PA 3MYJB 5IJVB 2ZCLH 1CXFA 1ZHKB 3CMGA 4EN3D 4Z76B 2NTFA 5B3NA 2XXMB 2NXZC 2V2TB 1EAJA 4PGZA 1MJ8L 2BNRA 3GMRB 1Z9MA 4MNQA 4OIIH 4HJGA 3HZKA 1JV5B 4FTVB 2O5YH 2H6PB 5ECJE 4N0UE 4WEMB 3C8KB 2UY7A 5EBGA 1VFAA 3VGFA 1M6OB 3KHOA 1YECH 2QHLA 5DURB 5GHWL 2Y25A 4PLOB 4XP9L 4MNQD 4R26L 2VLRD 1NGYA 1CFVL 1YJDC 1HXYB 4M6OH 2H45A 3IXTA 1N4XL 1A64A 1WZKA 3ZYIA 1OT1A 5ESAB 4J6RH 2NY5L 4O58L 1NL0L 4RA3A 1UB5B 4MNHA 3SO3B 5IVXE 2VLKB 4JZOA 4ZAKA 1BAFH 5DUBB 5GGRB 3TIDB 4ZS6C 4N0FA 3MLRL 1FO0H 2VUOA 4JAMB 1JFQH 3MFGB 2IANB 5FUZL 5ITFA 1KENH 4JDZB 1SBSH 4LSPH 4J3VA 3U4EB 2DWEB 3WS6A 1A3RL 1MPAH 1MWAA 2A6IB 4M03A 2NY4C 3AREB 1JGVL 4PD4K 3ELAT 2FNBA 3OKEB 4NQEB 4HLJA 2VIRB 2VLJD 5DMGD 1JHTB 4OLVL 3BP5A 4CGTA 3QUXD 3VFSB 2YRZA 5IBUB 2X4OB 5F9JB 4QTIH 1PKQE 3D5OF 2ITCB 2Z4QB 5C2BH 1Z5LB 2ICCA 3C5JB 4OB5L 5I1JL 1Z0NA 5DUPL 1UQSB 1SY6A 3IFLH 5K93A 1M05A 3VFPA 4A6YB 3CFCL 5IVXA 4TPRH 3ILQC 4OJFL 4WV1A 4TVPL 2OTPA 3IKKA 4JFFA 5F7MC 5HHPB 4M7LL 5GS0D 1NANI 1FIGH 1GZPA 4G3YL 3PWVA 1EVUA 1NAML 4EOWL 3BMVA 4NBZB 4TUJA 3PDDA 1AI1H 5DJ2A 1U8IA 4NRYB 1UA6H 1ZXQA 2R0LH 3QXVA 1UKQA 1DLHA 3F7PC 3VRLE 4G7YH 1P9MC 3OKKA 2HT4C 4KC3B 1KIUA 3VD3A 2WUCL 2EYTA 3MLVL 2Q20A 1QYGL 3RBSA 5ICYB 1QHOA 5ACZA 4JRXD 5KZCD 4PJDF 2JJSC 5J13C 4WY7H 4GRMA 3BKYL 1UZ6E 1BVLA 2BSTA 5HI4D 1U3HA 1E4XL 3QHFH 5E2TL 1D5BA 2VO5A 4OZHF 1EBPA 2OMNA 3FQUB 5J4MA 2HJLA 3O3UN 2Y6SC 1I7ZB 4M6NH 4LQ1A 1I3VA 4ZUSA 3P4NA 3PQYE 5I1EL 5TH2B 1LP9B 1JWUA 4JKKA 1C5BL 3VFNB 1DVFD 2Z31C 3EYVB 3PWPE 3OJ2C 3T77A 4WVRA 4HXAH 4OLEA 3FKUS 1YYLH 3BJLA 2R39A 1CFSB 1XH3B 1HNGA 1B88A 3TO4A 4P2YA 5AWNL 3RL1B 4LLQB 1ZOXA 5J56B 1JPSL 4QRUA 2RFXB 4MB3A 2ZPKH 4WWID 4EJ1C 4JO1H 1LO3H 4X6CB 2HG5A 1FQ9C 1TNMA 3EDEA 4B0MM 5A2KH 3RZCA 4OM1H 3LKNA 5EBMA 1EJOL 4EI6A 4L9DA 4BH7B 2KL6A 1RZ7L 3LIZH 3MLSH 5F3HB 4QF1B 5D8JH 1ZANL 3SO3C 4WNQB 2JCCA 5HYSG 3BH8A 3JV6B 3PQYA 4WWKC 5JORA 3ALXA 4P46A 1N59B 2HYMA 3UTZA 3QNZA 1PDKA 3PWPA 1E4WL 4NN7C 1QFWM 3EO9L 5D1ZB 5GGQL 1F4XL 4WEUD 1YMME 1JI1A 3MGOB 5LGJB 5T5NF 4K2UH 5KSUA 2ESVB 4LBEB 4FA8A 1F2XK 5KANG 3R06A 3OJDB 4NKIL 1MFAL 5D7IF 1A2YA 4BQ8A 4YBHA 3EDKA 5GISH 4ZODA 2EDTA 4ZOAA 5LJYH 1AD9B 5DFVC 3AFLA 1QQDB 5ID0A 1A4JA 3HPJA 2A83A 1MCHA 3GSUA 5EBLB 1OGAE 2AGJH 3PF2A 3MXVH 4OZIE 3QUMH 1CGSH 3MV8D 1WBZB 2WWMD 4X99B 5L9DL 3NA9H 3WO3B 4TSBH 3DARA 3UJIH 2NW2B 1CXLA 3ZSSA 4HUWB 4GQ9L 2WLYA 4FRWA 2HJFA 4ODSL 1PEWA 1IFHH 4YDKL 5BMFH 4X4XB 5IHBA 1XIWA 1U36A 1MFBL 4BZ2H 1FN4A 4MVBD 2F5AL 1INQA 5HPMB 4MCZA 5CUSL 2IG2H 4GRLB 3DROA 4CW1A 4DOHB 2VXUL 1DANU 3IF1B 4KKNA 4R4FL 3FO9A 4HHAB 3MV11 1UWXH 3BEVB 1XF2B 3OR7B 1G7MA 1YMMD 4PJHB 3QXTA 3EFFB 4DQOH 3TF7C 4OAWB 1DJSA 4F7MB 4BELD 4CJ0A 1DDHA 1AHWA 1S7RA 2LE9A 5CP3A 4B7IA 2DTMH 2GQHA 4OZIA 5JXED 5BS0B 1AGEA 5DRWA 1I9IL 2C1PA 1SEQL 1WAAE 4HPOH 4Z7WB 5KSBB 1S9YB 3RX7A 1OGAD 2PYEB 3C09B 1ZT4B 4YXKL 4S1DC 1IGYB 3AM8A 4HFWA 4KKLC 1I85A 4HH9B 4Q9BA 4RRPA 1G7IA 2V2XB 5EWIL 4K07A 1Z9LA 4U1LB 3SDCA 3TCLB 4I48B 3GMOA 3ME0A 4JY6A 4F7PA 1OQOA 3P4OA 4U6HA 5EO9A 5F1SA 5FGBA 5JUEH 5A16A 1KXTB 4NNYA 3VXQB 5JA9A 5ICXB 4S2SA 4WU5B 3MZTA 1T03H 4FFYH 5IMLA 1SJHB 1QLEH 2X40A 3H9HA 3CGTA 1YPZF 3M17B 4V3EB 1L8JA 5IOPB 5C0FB 3RUGB 3TVMB 3TIEB 1N5AA 3QIUD 5GSRB 1J88A 3GMNB 5HI5C 5F8RC 2X2YA 5GQBA 1EGJL 3PDOA 4S0SD 3LSOB 2D9QB 1L7IL 3IU3A 4K8RD 1NSNH 5GGVH 3L5XH 3RQ3A 3FQNB 3BZ4A 2HTKC 4B50A 4FFVC 1MJUH 1GOFA 1QBBA 3WMSA 1A9BB 2DLFH 1J18A 2VC2H 1U8KB 3I6GB 5K9KA 3UCRA 3MCLL 4F15B 4LEOA 1JNNH 4PB0L 3S88H 1KC5L 5D1ZC 5GPRA 5K59F 3T0VA 2Y5TB 1CLCA 1EO5A 1YQ2A 3LEXA 2RHEA 4M02A 3OGCB 1SEBB 3MOBL 5FYKU 3OSKA 2AABH 1REIA 2G9HA 3OAUL 1WITA 4P4RB 5FGCE 4D9RE 4EDWL 3RWEB 1IM3B 2ZG2A 4LSTH 5MEOB 4J3OC 2Q7YA 3S35H 1VGEH 1FDLL 4YFDB 5IBUG 4KKBD 2BSSB 5KVEL 3MOQA 3P73B 2GJJA 5F96H 2HKHH 1T0NB 5IT2H 1IKNA 1BHGA 1AXIB 4RMSA 4NNPL 5HPOA 4R4BA 2UZYB 4FG6C 5L8LB 5IBLC 1IGFL 4LLYA 4KKAC 5HVHB 4NJAH 2B39A 1F3RB 1K5NB 2PW1A 3GIZL 4PJFB 4NBYB 1J12A 3LKPB 3SKNA 3FFDA 1IC4L 4RDQG 1C1EL 1ETZB 1HH6A 1FVDA 2V7HA 1QLFA 5LAXA 5MENA 3FB5B 3FQRB 5TDOA 5DT1L 1QSFB 4HS6A 3ZYZA 1PSKL 1Z9OA 4TVSa 2PTTA 4QTHB 1IGIL 1KGCE 3TFKC 2LQRA 3GKWH 3RIFK 2ERJC 3CC5A 3WE6A 1M7IB 4X80H 4OTXL 4LF3A 4PRPE 3SDDA 4KMLB 1GGIL 1Q9LA 4BUHA 1MRDH 3G04A 3KPLB 3RNQB 1S7TB 4P23D 4MD5B 1BLNA 2G75B 4FQXA 4G42A 2DQDH 3HI1B 1A47A 3ZKXC 2XA3A 2Z93B 4U1GB 2ICWI 2APXA 5C6TH 4F57H 4OZ4B 3D48R 1S5HA 4UIKL 3I3EA 1F4YL 1VGKA 4P4KB 1T1XA 2VR4A 1RUQH 4FQXD 4OCLC 3HE7D 1G9NH 2XKSA 4YIQB 5DJ0A 2CO6B 2ICWA 5CD5D 1G0DA 4ZD3L 4Y5VC 4G9DB 1EHLH 2FSEA 4N8PA 4Z7OF 2GYSA 5AUMB 3QB7C 3BKJL 2RCSH 5TQ2L 2WAHA 4J3XA 2R0KL 5JMOC 4DW2L 2DICA 3PXJA 1DEEB 2Y7QA 1KGCD 1XGUB 2B8OT 1QFWI 4I18B 1RIUH 2OSLB 2J7LA 5L2KA 2C26A 1M71B 1W2KT 5CCKL 4H0IA 4PRPD 4X5WA 3D85A 1CG9A 2EC9U 4WGVB 5DUML 4FQCL 3PWLA 3LKQA 2R56H 4Q9QL 3PGCA 3QEQB 5D2LB 4DGVL 2YSSA 5HI3C 4Y16B 4JANA 4YHYB 3B8SA 4LAQH 1B4RA 4F15C 4NM8H 5F3BB 2OXHA 1IBGL 3JWDC 5HDBE 1DUZA 3H9SB 2DWDA 1R24A 5GJTL 2BVQB 1IL1B 3DVNB 3K4ZA 5BOPA 5CJXA 3IFPA 2V5TA 3IDGA 2CIIB 2R1WA 2MHAA 4L4TA 3O45B 4OLUH 1YEKL 4RISH 1YEGH 3VXNB 1P4IH 4PPTA 3BE1L 7FABH 1ZA3B 2YMXH 1IAKB 1NEZA 1QA9B 2AV7A 3LKSA 4NUGH 2R8SL 2GJ6A 4Y4HA 5KS9B 3MRQB 3EYUH 1R5VA 3EJZD 5DA4A 4AM0B