1N3NA

Crystal structure of a mycobacterial hsp60 epitope with the murine class i mhc molecule h-2db
Total Genus 65
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
65
sequence length
276
structure length
276
Chain Sequence
GPHSMRYFETAVSRPGLEEPRYISVGYVDNKEFVRFDSDAENPRYEPRAPWMEQEGPEYWERETQKAKGQEQWFRVSLRNLLGYYNQSAGGSHTLQQMSGCDLGSDWRLLRGYLQFAYEGRDYIALNEDLKTWTAADMAAQITRRKWEQSGAAEHYKAYLEGECVEWLHRYLKNGNATLLRTDSPKAHVTHHPRSKGEVTLRCWALGFYPADITLTWQLNGEELTQDMELVETRPAGDGTFQKWASVVVPLGKEQNYTCRVYHEGLPEPLTLRWEP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system
molecule keywords H-2 CLASS I HISTOCOMPATIBILITY ANTIGEN, D-B ALPHA CHAIN
publication title Structural analysis of mycobacterial and murine hsp60 epitopes in complex with the class I MHC molecule H-2D(b)
pubmed doi rcsb
source organism Mus musculus
total genus 65
structure length 276
sequence length 276
chains with identical sequence C, E, G
ec nomenclature
pdb deposition date 2002-10-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00129 MHC_I Class I Histocompatibility antigen, domains alpha 1 and 2
A PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1n3nA02
3.30.500.10 Alpha Beta 2-Layer Sandwich Murine Class I Major Histocompatibility Complex, H2-DB; Chain A, domain 1 MHC class I-like antigen recognition-like 1n3nA01
5I71C 1C5BL 3SGEI 2ZCKL 1NEZG 1YQVH 5T3XH 4WW2B 1J8HD 4KJPC 3MACH 3ZTNH 4K2UH 5BVJA 5HGDA 3VFVB 5I1DA 5EZIH 5DJYA 1KG0A 3U30C 2DKUA 3G5XB 1L7TL 3GBMH 5IMLB 2YXFA 1JGLH 5L8KB 5BRZE 1CGYA 5B22A 3B4NA 3OKLA 5ICYB 2HFEA 1NGWB 4LSRH 1A6TB 1NGZB 2W9EL 2F19H 2E6JA 3H9SE 4Q6IC 1JZ8A 4WTZG 1QBML 1T2XA 4UUJB 3SKJL 2DQFA 4JAMB 2VE6A 3PWVB 1ORSA 3LD8C 4ZDHB 2X4QB 5MEPB 2N7BA 2JIXA 4U1MA 4H5SB 2UWEE 2BCKB 5LWYH 1XR9B 4HGWA 5J11C 5L2KB 2F15A 2H1PL 3H7BB 4PRBB 2HN7B 3VXQA 2RCSL 1GGYA 4OLEA 5C0EA 5GRVL 5FIEA 3QFJA 2H26A 1NC2D 4R96B 3WKNA 3D85D 5ADOL 3EFDH 3MRPB 1HKLL 2QQNL 2H2SD 3ESUF 1BD2D 3K2UL 4GG6F 3ECBA 4OLZH 3TIEA 3KDMA 3GM0A 1RUAL 2JB6B 5E4IA 4Z8FL 1H0DB 1XGQA 4HH8A 1IGIL 2AERT 5CZXD 3D9AL 4JM4L 1OTTC 3SE9H 1I7TA 4PGJA 4LVHC 3RX5A 5D1QA 4QTHB 3EYSH 3QULA 2FJFA 3BN9C 3V5DB 5JXAH 1D6VL 1HHKB 1JHTA 4HMCA 3VW3L 4PJDE 2WMPA 4X7DC 3U4EB 1B0RB 4NP4L 5MEQA 1U92B 2R2CA 3QH3B 1VGKA 2VLKD 1M1SA 3P30L 1BZ9A 4IJ3C 5B39G 4ELMF 4LRIA 1QR1B 3MUJA 4J2XA 4M8VA 3RA7H 1UM5L 1EJOL 1OAYH 32C2B 4X99A 1LO2H 1FFOB 1I1RA 5EBWA 3ZO0A 4L4TE 5JORA 3TPUB 1EHAA 3GI8L 1ZOXA 2A6JA 4A2LA 1LO0H 2BERA 2WK2A 3U4BL 5AAMA 4ODWA 1BD2E 4WW1A 3RUGB 3T08A 5KAQG 5D7KE 4P2OD 3H9HA 3ARBC 1NANI 4NO3B 2XWTB 2HKHL 1QPPA 4O58H 5F9AC 3TV3L 5KZCB 1MHHA 3GSWB 1AIFA 1BQHG 2V7NA 2JJVA 3LKPA 4Y4KA 4LLVA 1YYLL 5CWSB 1NUDA 4MAYC 1I8IA 4RDQF 5D5MB 3W9EA 2IANA 3MLRL 2WINB 1SQ2N 3OBAA 4EUPG 3GDBA 3WLBA 4JG1L 3MMEB 4TTGA 1Y0LA 3DURB 1DDHA 1NCDH 1MRDH 3WIFB 3WD5H 2E9WA 4OBRA 5I1CL 4E5XA 2EDBA 3E2HA 4PJEB 5EPMA 1YPZE 3ROLA 5HBBA 4Z76A 1UB5A 4QRPA 1A4JA 4E9LA 3ARED 2ERJB 3LPFA 1FVDB 2Z91A 3S7GA 2P8PA 3BP4A 4FQJL 3T2NH 4WHYH 2W65A 5DMIL 4A6YB 5HDQH 5C0FA 3BH9A 5DJ8B 4PTTB 3MJ9A 3PIQA 3A6CH 5EC1A 1JV5B 3L7FA 3LEXA 3RAJL 5KG9B 4TVSa 5HGAA 5EZJB 3VGDA 3OWEA 5JOPE 4PRAB 1A0QH 3AU1B 3QUYC 1QRNB 2JLLA 3ULUD 5KS9F 3O6LL 4G8FA 2XFXB 1T7YA 2GYSA 4POZD 1JWUB 1YEGH 5CSZB 2DN7A 3LKQB 3HE6C 2D2OA 4X6DA 4QLRA 2OK0L 3CFBB 4KJYA 3TYFA 3EJYD 2F54A 4G8GB 3VFPA 1FZJB 2Z8RA 4ZFOL 2IPTH 2QADC 2UVFA 4K7PY 4E0RA 4NQXA 3C09C 4TUKL 3PXHA 2WUBL 3MRCA 3RL2B 2QR0B 1RJZA 4NGHL 2VL4A 1UWGL 3NBNA 1I1YA 2YD7A 1NBYB 4XP5H 4K3EH 5I16B 3BXNA 2A38A 1A6AB 4YBQD 3MV9A 2H32A 4LVEA 1S5IH 4HIJA 1JGEB 3DSNA 4PJIF 5IB1A 3QO1B 5AWNL 1NCNA 4XTRD 5C8JA 3LRGA 1XGPB 5EIQA 2IH3B 4PREA 4GMTH 2KH2B 4LSTH 2ZSWA 3ARFC 2KKQA 3T4AB 4Z0XB 1QACA 3H3PL 4LCYA 3DV4B 4OZIE 5KSBE 1Q9LA 1YEIH 1KENL 4QRRD 1S8DB 3VA6A 4ORZC 5HI3D 2A1WH 3ZHLA 2QKIB 3LN4A 2VXTL 1BVLB 4H88L 3C5JB 2GUOA 2AXGA 2VZ1A 1MJ7L 1FNHA 1IC5H 3OGOE 4ZTOL 1J7VR 1UEYA 4X8JA 1TZGL 1U6AH 5FYKU 3G08A 5E5MA 4Z18A 4J23A 5TDPA 3VXUA 4HXAL 5D7LB 3S4SG 2GTZB 4WJ5B 43C9A 4RFOH 2CGRH 1FFPA 2D4FA 2D0HA 3Q5OA 1MHCB 4GG8B 1LEIB 5JW3H 2NX5D 1LDPH 3ORJA 4IRSD 4X6FA 1XGYL 1JZ6A 1Q0YH 3EO0A 2CXKA 2A0LC 4QKXB 4NFDA 3H9ZA 3EOTH 1HCVA 1X5FA 4FP8L 5SWZB 1FORL 1MCHA 1W2KT 4F7PB 5CEZD 5FKPB 4JM2B 4MNHB 2A6IA 3D18A 3ARGC 2AJYL 4EZMA 4Q0XH 1A2YB 1E28A 5E08H 2WNGA 2NY4B 5AYUL 5C09A 3EDEA 3VFRA 5IFHL 4XPBH 2DAVA 3Q1SH 3VG0L 3L6FB 1G9NC 3TO4D 3STZA 4QRRE 2YSSB 5C08B 3NFSL 3VFGL 1JPFA 4ZXBA 4G5ZL 3WEXA 4O00A 1I7ZB 1SEQH 5DDHB 1M4KA 4Z7UB 1QEWA 5EU5B 3P0VL 1GSMA 4PG9A 1AO7B 2HP4A 5AUMB 3JWNC 4ETQB 4XRCB 1AGFA 4UILL 5JO5B 15C8H 1A7PL 3WXVH 4KAQL 4R90L 3U48A 4EXPX 1TTGA 2QSVA 2CK0H 2WQRA 2GSIA 3HC3H 2GY7B 1EFXA 3MBXL 2I9TB 4HH9A 3HFML 3IDNA 1S5HA 3NA9H 4HUWB 4AEFA 3QPXH 4H20H 2IQ9H 1JE6A 1FVEB 5CEZE 3NFNA 4HF5H 2VUYA 5B4MC 2YS4A 4L8DB 2X1XR 3TH2T 1DBML 2G60H 1OOAA 4APQB 4P5TB 2RFXB 2HTLC 3ZL4H 1F97A 2AEPL 5GQBA 4KJPD 1BIHA 5TDOA 1DBJL 3HLAA 2PCPB 4XCNB 4MXWH 3UYPA 3V4VL 5A43C 4LPTA 1FZKA 3FAXA 4F15C 1TQBC 2XZQL 4OT1H 4YC2B 4O5LH 1K4CB 1WVZA 2JF1A 5DC9B 1FNEB 3DVGA 4PJXA 3MRKB 1RHHB 1BFVH 2J5LC 5B38A 5GS1A 2IADB 3REVA 3NN8A 3U2SA 3RRQA 3WFBH 2VR5A 1NCWL 4MD4B 4LDOB 4PJHF 3KGRA 2NY7L 2X5PA 1YEJL 3UPRB 4J1UB 4YDVA 4MQ7B 3X12A 1WT5A 1RK0A 3DPBA 1C8PA 3FL7A 5IFAL 3BKYH 1MRCH 1NFDF 4QRSA 1EH9A 4YH6A 4XCCL 2ICWI 1U2HA 1G9MH 1MSPA 3QFDB 3SKMA 3S88H 3BJLA 1ZE3C 5FV2A 4YEEA 1LNUB 5DGQA 1E6JL 1YNLH 1NCAL 1MCWM 3TVMA 4GQ9H 2AGJH 4BA8A 1OTTD 3QCTH 2EDEA 4I0CC 3FFCD 3CXHK 4NC0B 3DO3A 3BN9D 4H25A 1E6OH 1NMBL 1QSFD 1QHOA 2D3VA 4GAYB 1UADC 5FA4A 3PDOB 5D96C 2ZG1A 4CKVX 3WHXB 2EIZB 3TP4A 3I9GL 1RIVH 1G84A 3KPPA 4QCIA 3SE4A 4R4BA 5I1KL 4YQXH 3MNVB 5EN2A 1HEZA 4DKEL 1G7JB 4TOYL 5E9DD 5I2IA 5EOCH 4NUJA 1FNLA 2K7PA 1S7QB 4GMSL 4MGXA 5A2LH 4HQQH 4WUKL 4P3DA 3L7EB 4JB9L 1SJEB 3T1WA 4XVUC 3HZKB 4OLWH 3S35L 4AL8H 1K85A 4WEBH 1KCLA 1N3NA 2EH7L 2YD9A 3U7WH 3F65A 3O6FA 2UVEA 2XZCL 1EBPA 1PQZA 2KDGA 3QG7H 2HKFL 4AEHH 5DJ0A 1NUGA 5DEFA 1QA9B 2R15A 4LKCB 2NTFA 4JDVB 2VQUA 4ZPVB 2YR3A 3RTQA 4NO5A 3ARBD 4DN4H 5KVGL 4EQ2A 4LP5A 1DQQA 3CLFL 2NXYB 3L1OL 4WCYL 4GSDL 1KLGA 3A0OA 4F7CA 1S78C 3UC0H 4XBPB 2DD8L 4QHLB 2NY5H 4OZGA 4HWBH 3H0TB 4ZFGH 4MAYD 4MAUL 4D9QD 2BVTA 1QSFE 3IAGC 1RU9H 4LAQL 4YX2L 3CFJB 1JPSL 3K8KA 1LEGB 4Y0GA 1OP5H 1HHGA 2YD2A 5GGRY 2I5YH 3BT2H 1WITA 4JGJA 3WKML 4FFYH 5JNYA 4W6XB 4P23B 1JHLH 2HAZA 4MJ4A 3MUGB 4CMMB 5IUSA 4KI5D 4HJGA 5E9DE 1UGNA 2IAMA 4TUOA 2J8UE 3IKCA 3TT3L 1QSVA 4U7MA 5TQ2H 1HZHH 2VC2H 3PWNA 4JDTL 4U31A 3V6FA 1GGUA 4M5YH 3T77A 5J0BA 2EDTA 3FFDB 1FG2A 3LZFH 2YD3A 3T0EC 3ARDA 4IS6B 5I1GH 1SJHB 2OXHA 1ZHKA 5KJRL 5ANMB 1FC1A 2XRAL 3P11H 3QUYD 4KQ3L 5K59F 1A6ZB 4Z5RB 4UV4L 4G6MH 4LL9A 4NRZB 3DO7B 3AM8A 1FFNB 3HTLX 1JZ7A 1NUNB 1BAFH 3MUY1 2APWA 3MRGA 1VEMA 4HCRL 3BO8B 3DUSB 5C0CE 1JWMA 3TFKA 3HE6D 4D9QE 2UZIL 4GFTB 4KRMB 3MC0A 5D1XC 3I85A 2QADD 3UBXI 5D2LE 3KPSB 1CXHA 1G7MA 3QEGH 5IEHB 2BVQA 4Y19B 4AIZB 5IB5B 1JK8B 3A67L 1J8KA 4YPGA 1D5XB 4KI5E 3FKUS 4X5LA 3TEUA 25C8L 1Q9OB 3G5VB 3C6SB 3GIVA 4XP9H 4Z95L 3RWFB 3V2AR 4KKCC 2MPAH 1R5WA 2DMCA 4MHHI 1N4XH 3QA3A 3BP6B 1FNSH 2B4CH 3QUMB 4PY7A 5EO9B 3SKNA 2CIIB 3MRFA 1T1ZA 1JHKL 4AIOA 3HB3C 2Y07L 4WFGD 1FYTA 3T8XA 1K3IA 3QNZB 1CLCA 2UUDK 3CZJA 4J3OC 3ARFD 3FT2A 1P84J 1HOCB 2QQQA 1QYGH 2E9JA 4ZMAT 1YYMH 5IQ7H 3VMPA 3GMOB 3BDYL 4WUUA 1HCFX 1SBSL 2BNQE 4F7EB 2OL3H 5FCSH 4K55A 4ZFOB 3EYOB 1OGTA 3IDJB 1EEUA 5F7DA 1CGTA 2ITCA 3IDIB 3OTTA 4OCLC 4MX7A 2ATKB 4PJ8C 1LEKA 3QDMA 5KSAA 2VISA 5TH2B 3B9AA 5CUSL 4NQCB 5HHVH 4WDIA 1U91B 1XIWC 1DLFH 3D25A 4WTXA 4Z7VA 2KUTA 4ELKB 4YHOL 5ALCL 3UAJC 1U8LB 3BQUB 3UYOD 5F21B 2Q8BL 4JPWH 1KN2L 1NFIB 3I02B 1Q0XL 5AG9A 2A0LD 5B8CC 4XMLH 5GGQH 2C3VA 1EK3A 1T2QH 3GJEA 3D87B 3MYJA 1T5WA 4PRHA 2ZSVA 1F4WH 3SO3B 4WI3A 4YIQB 3ARGD 3D69A 2MCPH 4NT6A 1F3JB 1FO0L 1NBZB 1AE6H 3IFOB 3C5ZA 3HHRB 1HIML 4UTBL 4H1LG 1DQJB 1XGUB 4F2MA 3D2UD 5E2WL 4G6FD 5IR1B 1FCGA 3W9DA 2X4PB 3VGEA 2AK4A 5E8PB 5D72L 4O2CA 4LLUB 3KVQA 5HPMB 1D5IH 3VDAA 2GJ6D 2DQCL 2WV3A 5BJTB 4J3SA 1RUML 3DX8A 2K3TA 2OR8A 1W0VB 5CLWA 1AXSB 4C56B 4YPJA 5EA0H 5DZOA 2R2HB 3U36A 5EUKB 1HQRB 1TLKA 1KV3A 3ZE1F 3FHQA 3RDTA 3G6DH 4QYOB 3IVKB 5J1AA 2GI7A 2ZCHL 3IDYC 1L8JA 3AY4C 2OP4H 1H3PL 3PJSB 4R7NA 4XPFL 5ISZE 1NUFA 3CAFA 1U3HB 2ADGA 5D9SA 5FUOH 3VI4E 2XPGA 4WENB 4U05A 2J12B 3BI9X 3LMJH 5B4MD 2FECL 1U8MA 3HN3A 3V5HB 1I4FB 2HTLD 3CMOH 5DURB 3TIDB 5DS8B 1UCTA 3QIBC 1DVFA 3QI9A 1RIHL 3OG6B 4I13B 3QT2A 3PP4L 4X4YA 5BV7L 4OCXL 3OGCB 2GJ6E 1QNZL 4DGIL 2HVJA 2Q76A 3VXTB 4NZRH 4YAQB 1AGDB 1D5ZB 1TJGH 1A6VH 1ONQA 1BOYA 4Q9RH 1IM9D 3DETC 4OGXH 5HGHA 1RVFL 5E24E 5E4EC 3HNSL 4GRWB 3HR5B 4NNYB 4K07A 3KS0J 1OP5K 5GS0H 1MY7A 2JCCB 2HFGH 2XTJE 3IFPA 5IBTH 1BQSA 3WNOA 2VR9A 5TGBA 3GHBL 3VDBA 3RGVD 2O61A 4MZ2A 1Z9SA 1T7WA 3VXSE 5HHXH 3GKWH 3BVNA 3M17B 3HMXA 2VZOA 5CCKH 1I9IH 4DGYL 4KXZI 3JUZA 5SV3A 2Z93B 3LPWA 3P0YL 2BVEA 4F8TA 1KPUA 3MLUL 1KLUB 3QIWC 4OCSH 5DMJB 5DMKA 1LK3L 5DD5L 3GHEH 1KTRL 4KKLC 5F3BB 2VDPL 1FRGL 1K6QH 4PJFF 3U6RB 4JFDA 4N0UA 4EBQH 4EUPB 2I24N 4WO4B 3SDCB 1UM6L 1OD9A 3ZHDA 3VFOA 1IJ9A 1UXWB 3X14A 3B2UC 3LEYL 2X09A 1EEQA 4KV5E 1C16B 1AI1L 4LVNB 4NJ9H 4P2RE 4WI6A 1BBJA 3MV7B 3O81A 3SJVE 2C7UA 1YNKL 3T2OA 5CEZL 4NC1C 4XXCA 5DWUL 5KW9H 5CHNB 4JFOA 2CRMA 2ITDA 4G7VL 1IGMH 3OR7A 2G9HA 4XVUD 3OZ9L 4Q97A 3D39D 5A2JH 1AP2B 4MNGA 1CTNA 3O11B 5GGTH 3B2VL 3OKKB 2AS5M 3P4OA 1MI5A 1H3WM 4K7PX 2XIDA 4XAKE 4R4NC 4FFWC 1EO7A 3U0TA 1JUFA 2N56A 2CSPA 4K71C 4I77H 5HHQB 4YHNB 5IESH 3HAEA 1I1FA 1J5OH 1NGYA 4XMKL 2VDML 1S78D 1KCUL 2WIIB 2MTPA 4M4PA 4KVNH 4F7MB 4FXKB 3NZHH 4ODUB 1NLBH 2APTA 3TBWB 4AY0A 4L8BA 2DWDB 2R0ZH 5LKNA 3P4NA 1MHEB 3E6HB 5HHMB 1A9EB 3DROA 1U8JA 2GSGA 4PLJC 3OKOA 2LTQB 2ZJSL 3TM6A 3G9AB 4WVRA 4HS8L 4YXKL 4JN2B 5BZWB 3UBXG 5IQ9B 4RMVA 2Y7QA 5FM8A 2VAAA 1G9MC 4K3DL 4LVOB 3ZDZE 2V5RA 4Y5YC 4YXHL 2VIRB 4K9EL 3OJDB 4PJBE 3CNKA 5BRZB 3LSOB 5TE6L 3P9LB 3WFDL 5T3XE 2CQVA 3T0ED 1JGUH 3GSOA 4MDJB 2BY0A 4JKPH 2Q7YB 4XPHH 4JN1L 4CVUA 3H9SB 1OAKH 1OSPH 4L9LC 1N0LA 1I3UA 4OD3L 4WW2A 5DQJB 4X6DF 2IGFH 5DD3H 1JMXA 3DYMA 5IIEB 3VFVA 3BKMH 1XF3B 1QFWI 1N59B 4WGWB 2UWEB 2FRGP 1NBVL 4FQLH 5IMLA 2Z31B 1MFCL 5F7EH 1KBGH 1GGCH 3S4SB 5B3JE 5F96H 1NGWA 5D1XD 1A6TA 1CFSA 1IBGL 1NGZA 3S96B 2XT1B 5DI8B 4KU1A 5EZOL 1NC4B 2CUIA 1MFDL 1SY6L 3D3VD 1CF8L 5BS0D 4UUJA 2NY0B 4P2YA 1LK2B 4HC1H 5KSUB 4JAMA 2VDKL 3PWVA 3ARZA 1IRAY 4WRLA 1N5YH 4I0KA 2D03L 4TSAH 3FB6B 1OAQH 5HY9B 1XR9A 3Q0HA 1KB5H 5DJ6B 1A9BB 1Q38A 4KKCD 1C7TA 4J3TA 3P4MA 4MYWB 3SDAC 5L2KA 3H7BA 4X6EB 2HN7A 3WFCH 4F9LC 4I2XA 5HYEA 4WGVB 4UBDC 3FN0L 2Z9TA 3MRPA 3HB3D 5D70L 4IIQC 3GRWL 1XCQB 2AV1B 5F1OB 3N1QC 4PJDB 2CDFB 3T0EE 5LXGH 1JNJA 4MJ2A 3CX2A 2NY5C 2V5YA 1J1OH 1H0DA 5JR1H 1DFBL 4M43L 1VA9A 2FIKB 3CVHL 5KVEL 4P2QD 3BZ4B 1JF1A 4KKAC 1OP3H 3SGKA 4QTHA 3MLVH 5ITBH 4LNRB 3GUTB 1B6DA 3V5DA 2I9LB 3SKUD 4YDJB 1ACYH 3ALWA 3CLEL 2NY6C 1CVSC 3G6JE 1BBDH 4X5WB 4L4TB 4MQTB 5I15L 3JV6B 4KROB 1PJ9A 4PJ8D 1NC2B 3MRBA 4M7LH 3QH3A 2H6PB 4HD9A 1BD2B 3D3VE 4M62L 1EHLH 4XVSH 4JDZB 5BS0E 5CGYC 3UTSE 4HDIB 4EJ1C 2A9NL 4KMQA 3UAJD 3VRLF 32C2A 4OM1H 4C83A 5L6YH 4YHKL 4LCIH 3RX8A 4JZJC 1CT8B 5CEYB 4JY6B 3WCYA 2VDOL 1MCEA 1OWRM 4OD2A 3KYOB 3WNKA 5HI5C 2P8MA 3QEUB 1BFTA 4PV9B 3K2MC 3MLWL 4OB5L 2XXCB 3FTGB 4DGVL 1MPAH 1A14H 3RUGA 3OAZH 3BGMB 3PGDB 4NO3A 1YEDB 3PP3K 5LAXB 4Z77A 1CFVL 3SO5A 3GSWA 3LDBB 1KEML 4HAGA 5DLML 4EDXA 1JI1A 3QHZL 1ACZA 2DICA 1U41A 4N1HB 1YPZB 1OGAD 3WUZA 4XAWH 4YDLB 5EWIH 5CWSA 4HFUH 1LDSA 1T2JA 3L3OB 2VH5H 1QLFA 4UNUA 1T1WB 1R5IB 3S3PA 4KDVA 1CE1H 2BRRL 3T1FB 2WINA 5CJQL 4Y2DC 3T0AA 2M26A 2ICWJ 4DN3L 1QKZH 5HSFA 3EAKA 5FYJU 4HFWB 5DMYA 4JQVC 3GB7B 3HE7A 3GJFH 5I8EB 2QQLH 3OKDB 4EI6B 4I0PC 3MRHA 5H37H 2B4CC 4LU5H 1IAOB 3O45B 2X9WA 1FVDA 2APXA 4K23L 3QHFL 1KELH 5DD0L 3HC0A 5CZKA 5EG6C 5SWQB 1JNNL 4PTTA 1EUTA 5DJAB 2W9LA 1GOFA 1JV5A 1HSBB 2GTWB 4Y5VB 5KSVB 1D6EB 35C8L 3V0VB 5EZJA 1KCKA 6CGTA 4PRAA 2Y1VA 2VDNH 5DUMH 3AU1A 3OXRB 2F5BH 1QRNA 3QIBD 3ALPA 3DYPA 4XCEA 5JA8B 3T2PA 1AHWC 2CKNA 1QVOB 1BIIB 5FGCE 4BQBA 1ED3A 1JWUA 4FZEL 5CSZA 3DX7B 1QLEL 1UQSB 3LKQA 2FGZA 3AREB 4OUUB 3JZ7A 3CFBA 4PRPE 3KJ4C 4FNLL 3BGFB 5EIIB 3MLYL 1WJ3A 4G8GA 1BZQK 1N5AA 1PEWA 3DETD 3WO4B 3R8BB 3RL2A 4PP2B 4LPUA 3OKNB 4QHNB 3NIFF 1NBYA 5I16A 3QDGA 1A6AA 3MV8A 1FAIH 4OZIB 5KSBB 1JGEA 1A3RH 5I18H 4AQOA 1H3GA 2AEQH 4JQXA 5A3IC 2BSTB 1GGTA 3OJMB 3GMPB 4LHUD 1MFAH 4NRYA 4F58L 1TITA 3IJYB 2HG5B 5LJYH 4LLQA 1LP9F 12E8H 3QIWD 1MAML 4GAFB 4Z0XA 1UWEH 5TF1H 4KKLD 4BSWB 5BV7B 3RWDB 1DQDH 1MCKA 4OCRL 5EU4B 3DV4A 4NDMB 1KJ2B 4LKXB 2RAMA 4JRWA 5JDSA 3DVNA 1MQ8A 2QKIA 3L3KB 5EUOA 4MMXC 3C5JA 4ZS6C 3B2UD 3OAYH 1AR1C 4WWKC 3T0XA 3EUUA 1OD7A 2VXSH 2MKWA 4GLRH 5D7LA 5FB8B 4WJ5A 2FBJH 5CJOL 1W0WA 3LN5B 4TSCL 5JQ6L 2A9ML 1MHCA 4FTVD 5IOPB 2QQKH 4FZ8L 4YHZL 3HC4L 4ODSH 5JOEA 1LEIA 5C6PB 4W4OA 3FQWB 1Z5LB 3TBSB 3PGCB 5IF0B 4LEXL 1E4KA 4YHML 5C0BE 3CDGB 4QRRB 4G6JH 5SWZA 4F7PA 5IVXE 3MODL 1OARL 4R4ND 4FFWD 4MNHA 2ARJQ 5C0AA 3QCVH 1A2YA 1C5CL 4F80A 1CL7L 4K8RL 4OZGF 1RV6X 2NCMA 5I30H 4RAVB 1H3XA 2GT9B 1AKJA 1T66C 1NCUA 1UZ6E 1GZQB 3L6FA 3VI3E 4AH2B 1BP3B 1L6XA 1GGIH 2O93L 4Y1AB 3RU8H 4IRSB 2BJMH 5C08A 3KPTA 4U6VL 2VKXA 4QXGL 1I7ZA 5DDHA 4Z7UA 1N8ZA 1OP3K 5GS0C 5BW7A 4DZ8B 5AUMA 4ETQA 4XRCA 5EU6D 1X44A 4PLJD 3PV6B 5JO5A 4NCC1 4OD1H 2YRZA 4BK4A 1A7RL 3Q48A 3O2WH 3WIHA 1U36A 1JIBA 4FTVE 1F8TL 1MJ8H 2FECI 4XPAL 3GO1L 3QRFM 1P7QD 2X1WL 1JNLH 4DUXA 3F5WB 3FB5B 4HUWA 4JREC 2WUCL 4AM0B 1FVEA 5HDBF 3S37L 5E99H 4X6CF 5E6IC 4L8DA 3P2TA 2DM3A 3QAZB 4PJ5D 4P5TA 2RFXA 1NEUA 5GRXG 1ZAGA 1KJMA 1E4JA 1RUPL 5CIPB 4XCNA 2PCPA 3F12B 1ZT4B 1MWAB 4ISVB 5F97E 3T3MF 4BH8B 4V3DB 2N4IA 4NZUL 4G7YL 4LPXA 1DQMH 4WHYG 1T89A 1UCBH 1RHHA 3MRKA 4XMPL 1CQKA 4HJ0C 1GH7A 4UT6H 2IBGA 3KYMB 3MRLA 4X9HA 4UT7H 4RMTA 4KZDL 4ZG1A 3OB0H 4POYA 5IHZA 5DVMA 2DQUH 4JO2H 3EO9L 4L4VA 1F3RB 4PJ7A 4RGNE 4IOFC 4N1CA 3ULSB 1INDL 2XI9A 5E00B 1BEYH 2ZUQC 4HWUA 5HI4C 3S37X 2D0FA 1V7ML 1PFCA 3DUHA 3SDAD 3U7AA 3GJFK 3BWAB 3D0LB 1AD9B 1G6RL 3MJ9H 3DGCR 3UXFA 3OX8A 4UBDD 4H1LB 3WSQH 1E4XL 2NLJA 3QFDA 1NAKH 2J6EA 3M1BB 1MCIA 2ICCA 5DR5L 3QUZA 1KTDA 5MP6H 4PJ5E 5HHOD 2X4TB 4PJ9B 1B4RA 4NO0B 2X7LB 1MREH 4J3VA 1YEHH 1EAPA 5IG7A 4P99A 3LQZA 3U46B 3B43A 2FO1A 1N7MH 3EOAB 3O6ML 2H9GA 2FJHB 5IJVA 5TE7L 4KKAD 4BH7A 5JMOC 3LD8B 4P4KC 4N9GA 4UOJA 4OM0H 5DYOB 4X4ZA 3MOAL 1T0MA 3FHAA 5J11B 2NY6D 3PDOA 5DT1H 5C0GB 4HT1L 4X6BB 3VD9A 4M1CC 4W70A 4Z7VF 4FXGB 5GRJH 3WHXA 1PY4A 3HI5L 1DN0B 4YO0B 2YD4A 3FO1B 5FGBA 4NQUA 3ZKXB 1J0YA 5TE4L 4YHYB 5CBAB 4OIBA 2HT4C 5CGYD 1KIRB 2VLLB 4HUMB 5T3XL 1N2RB 1S7QA 3EKCA 4K2UL 4L3EA 5SV4A 3ET9F 5EZIL 3L7EA 2F8OA 2P45B 5T1KA 3UDWC 1SJEA 1WBXA 3HZKA 4LVHB 2D7MA 3GBML 4LEOB 3TA3A 2EDKA 1VADA 5E70A 1UJ3C 5LCVL 5T1LB 5HI5D 5E7BA 1QSFB 3EYQC 4GG6E 4NWTH 4QOKE 4HZAA 2WWKO 3VXMD 2F19L 4N8VG 1QA9A 4JDVA 4ZPVA 4N5EA 1EO8H 5HHOE 4B5EA 2X9XA 3LS5H 4I48B 5I6XC 1Q72L 4HLZH 2VLRD 3OQ3B 4IJ3B 5E9DB 2J8UB 3QRGL 4XBPA 4GAGH 4QHLA 4XNUH 5IV2B 3IB4A 4OSUH 1VGEH 3RQ3A 1QQDA 4JJ5B 2BX5A 5IMOB 3R1GH 4Y2DD 2DBLL 2XN9D 3CFJA 1LEGA 2CH8A 1B4JL 5GRUH 1IEAB 1SMOA 4P23A 4KVCH 4U0RB 4ELME 3MUGA 3AFLA 4JKMA 1CDYA 1I75A 1YJDH 4I0PD 4LHUG 1J0IA 2X89D 4ODTH 1YNTA 4PRDA 3SE9L 5DHVH 1WZKA 3EYSL 5DRNB 5HYQB 4Z7OF 2AI0L 4J6RL 3TJHA 5JXAL 4B7LA 2FR4B 1A8JH 5C0CB 4PB9L 1HYRC 4MAYB 1ORQB 2IALA 3IDXH 4M1DH 3S36L 4CVZB 2J8OA 1P9MA 3MREB 1UACH 4IS6A 1SJHA 2B1AH 4LHQB 1TJHH 1S7WA 5D2LB 4XP4L 1ZHNB 4M9OA 1KGCD 4MNQE 1A6ZA 3NABL 4Z5RA 2YRLA 4S0SD 4HIIA 4WV1C 4NRZA 3MV01 3GSVB 2VLRE 3LKNB 1FFNA 2ZCLH 1OAYL 4JY5H 5TJWK 3ULVF 5CD3B 1T04A 3BO8A 3DUSA 1IAIM 2X4RA 1LO2L 1QFUH 2D7TH 2A77H 3W11C 2JELH 4F33A 3P9MB 3P4LA 3PWLB 4LCCA 2IQAB 4HV8A 4Z7QF 1IGFL 2P5WD 1JFQH 1PG7L 1ZLSH 3KPSA 5IROC 2BZDA 5GSVA 1QBLL 4Y19A 4AIZA 3O3EB 3V7MA 5I1HH 5IB5A 1JK8A 1D5XA 1G9EA 5E8EB 3QYCA 3R0MA 1S7SB 3C6SA 4U1HB 3W0WD 4YHPB 3S36X 1JJUA 3NCFB 4NWUL 2Y6SC 4H26B 2BNQB 4ZOBA 3F58H 1FE8H 1XR8B 3TYGL 5A3ID 2CIIA 3CFCL 2C3WA 1D5MB 5MEOA 1HQ4B 4FS0A 3BSZL 2E7LA 1XGTB 5GGRB 3QNZA 5CJXA 1RURH 2VKWA 3FRUA 1NCDL 2QADB 2AJZB 3VFTA 4RFNB 4M6MH 1HOCA 1J9CT 1FJ1B 4KK8C 4XXDB 3X13B 1KGCE 3VRIB 2FSEB 3ETBF 2DQEH 3GMOA 3KPRD 3PWUB 4PJAA 1WF5A 2VXQH 2XY1A 5IFJA 4ZFOA 4UZGA 2ZG2A 3T2NL 4ZS6D 3S34H 4LLMB 4YZFF 5DHXB 5ESQB 5HDQL 2I07B 2H45A 3N1FC 2B5IB 2DS4A 1AR1D 1N64H 1NKOA 3IFNH 2ATKA 1R3LB 4WWKD 1YN7A 3RY6A 3UBXB 1CLZH 3ELAT 4NQCA 3T65A 2RHEA 1D9KC 2UY6A 2GK2A 4B0MM 4LLYA 5F7YC 5ACMA 1EGJH 1A0QL 3TJEH 5J06A 1V3JA 1WWWX 1U8LA 2VWEE 4X8XA 3W0WE 2Q87A 4PJIE 4G42B 3I02A 4IRJB 3DMMC 3VWJC 3MFFB 4LQ1A 1ZT7B 1KJVB 4WY7H 3WJJC 2NXZB 2D9QB 1AQDB 4MCZA 4YIQA 2IPTL 3LPGA 1WFTA 3RWJB 4M7KL 1NBZA 2ZUUA 3QG6B 1DQJA 1KIPB 3MRNA 5IR1A 1T66D 1W72H 2X4PA 2PYFB 5HYFA 2HTKC 4C58B 5E8PA 4XP5L 2BK8A 3L3HB 4K3EL 4LLUA 4MQXC 5HPMA 3OV6A 1FIGH 4TQEH 5IJKC 2X4OA 3MLZL 5F1NA 4ODVH 3E3QC 5ISZB 3ARYA 4D0DB 3CH8A 1SVZA 5GS0D 1AXSA 4C56A 2D9CA 4WFFD 1MIEL 5F9JA 4PB0L 5T33H 2R2HA 3IJSA 4GMTL 1F4XH 1HQRA 2QSTA 3B5TA 4HIHB 1IQWL 1NJ9B 3BD3A 4LSTL 1OL0A 1R3HB 4OFDA 1LO4L 4KDWA 1PZUB 3KPQB 1UH3A 3MBEC 4KQ4H 2Z35B 5FDWB 1FCCA 4KH2A 3D0VB 2VZ3A 1JF6A 3IVKA 1F4YH 4RMSA 3UTTD 3D2UB 2X10A 4G6FB 4YXLH 4I3RH 1YEIL 3BW9B 4BYHA 3PJSA 1GAFH 2A1WL 4YFEA 2BNRE 2GJ6B 4FQ2L 3OKEB 1IC5L 5C0DB 5E6ID 4KHTL 1F13A 3V5HA 2LVEA 1R5VB 5DZLA 2B39A 5CKAA 3TIDA 1A1MB 2IWGA 1HINL 4JFED 1G7PB 1LDPL 2XTJB 1L7IH 3ARSA 3OGCA 3HNTL 1YMHB 3X3FL 1P4BH 5IW6B 3BPOC 4MDIB 3VXTA 5FYKH 1NCTA 3MGTA 1AGDA 4YAQA 1D5ZA 4HJ0D 1JYXA 3VXSB 2NY3B 3DHJA 3KPMB 2O26U 1DL7H 4Q0XL 5ESAA 2NQCA 5FUCC 4HSQA 3WV0A 5E08L 1RZIB 3HR5A 4NNYA 4RBPH 4J3WA 3STLA 4NQDD 4IOFD 3WE6B 1MNUL 3ULUF 4IHOB 4R97C 1J86A 3RVUC 1CFBA 5HJ3B 4ZUTB 5HI4D 3Q1SL 5HGBB 3UTTE 5CBEB 3L5WB 2DQIL 2CO7B 1TQBB 3FQTB 2R29H 3GI9L 1WTLA 2XZZA 5D1QC 3M17A 3JUYA 3BP7B 3U9UA 1T21B 4CADA 2QBWA 2J5LB 2ZOLA 2Z93A 4HS6B 5SX5H 1IM9B 2R23A 4P2RB 15C8L 5A1AA 3WXVL 3SJVB 5F3BA 1M71B 1R3IH 3V4PL 3T0VA 4P4KD 2NNAB 3HC3L 3U6RA 2XKNB 3TCLB 5ALBL 3ZLQC 1MH5B 4R9HA 4WO4A 5FA3B 1GOHA 5GXBB 2YC1B 4LRIC 5DTFB 5CILL 4M1CD 3B8SA 3RGVB 4M6OH 4JO3L 2XOTA 2C9AA 4HF5L 5MEND 1C16A 1PEZA 4YR6A 1FZMB 3T0DA 2G60L 4L4JA 2HT4D 3K74B 4PJHE 1DN2A 4NQDE 4RA0C 3V6BR 3BD5A 4Z78A 5DFVC 4Q9QH 1G6RB 4MXWL 3F7VA 3DUUB 1JN6B 3WFZA 1PZ5A 3OF6A 2FEDC 1NFDE 3OG4B 2MSPA 3LRHA 3NGBB 3O11A 3I50H 3OKKA 3QUXB 3KAAA 3EYQD 4LSVL 4OCWH 4Y4KC 1K8DB 1X5GA 1Q9WB 5FO7B 1RIUH 1YY8A 2XWBA 5E1AB 4MSWB 1FIEA 2FGWH 4KHXL 4BKLA 3NCJH 1MUJB 5F6IC 2WIIA 2ZUXA 1WIOA 7FABH 1DE4A 4F7MA 4FXKA 2CKBB 2R2BB 2Z8WC 5IBLC 1CXLA 3E2HC 3BPLC 2DWDA 3BKYL 1MRCL 3KYNB 1HHIB 4PJBB 1K4DB 3E6HA 4QRUB 3LRSB 1P4IH 1PKOA 2VDLL 5C0RH 5MERA 2VXVH 3S88L 2F53A 4JJHA 4PGEB 4Y88A 1YNLL 1DLHB 1YECH 1WCQA 1IAKB 4JN2A 5BZWA 5CP3H 2AGJL 3QCTL 4V2CB 1MJJB 1CFQB 3NCCB 2FD6H 4MJID 1SJXA 4MD5B 4PLNC 2VIRA 3OJDA 1TCMA 4MB4A 4YK4C 5BRZA 3LSOA 3P9LA 3KXFA 2F58L 3CSYA 4M5ZH 3HNVH 2W38A 4MDJA 3U9PH 3NAAH 4C57C 4ONHB 2Q7YA 1DBAH 3VCLB 1IMHC 2D7QA 2YUWA 3EDJA 3H9SA 4NYLB 2AK1H 4QO1A 5C07D 5IIEA 1XF3A 4ZUVB 2FH6A 4HQQL 4OAWB 4LSQL 2RBLA 4MD0B 3VG9C 1FDLL 1A6WH 2DLIA 1PLGH 4AL8L 3W11D 4WEBL 2JJWA 3S4SA 4QGTA 4JHAH 2GEEA 4Y16A 4KC3B 3ZT5A 2DYPD 5DI8A 4KRPC 1NC4A 1FL3A 3GSXB 3T0EB 1LK2A 1KXVC 3EO1B 4LARL 3EOBB 4OTXL 3FB6A 3DWTA 2I25N 2ZWLT 4P9HH 5CGMA 1A9BA 2ZUWA 2Y6SD 4PGCA 4X6EA 3WDJA 4MJIE 5CMAB 3W81A 5BOPA 4OBSA 4ZFGL 3F7YB 3U1SH 5D7JC 1RU9L 1C08B 3G6JB 1ZLWH 1CI5A 3DXAD 1TTUA 2H8PB 2BXZA 1MVUB 3GSUB 4E41E 1FZOA 1G7IA 3TPKA 1XCQA 2AV1A 4PBXA 2I5YL 5D1XB 5ITFB 3BT2L 3CCHB 4GS7B 5K59E 4MA1B 4FFZH 3CFEA 4KK8D 1ZGLA 1FGVH 5EUOF 1NL0H 3D3VB 3KPNB 2FIKA 5JLZA 3NCBB 4HCRA 5BS0B 3KPOB 5C07E 1KTLB 3UTSB 5L88H 4RGMC 4LGSB 5DVKA 4QT5B 3SOBH 2IMMA 4LNRA 4M6NH 4NO2B 5TQ2L 3PG2A 1IE5A 4YDJA 4OCYH 2VC2L 3F7RA 3EGSB 1CWVA 1R24B 3N85H 3VE0B 2WWKT 4UDTA 2Y36L 4X5WA 4L4TA 1S7RB 3ULVH 1H15B 1GC1H 1HWGB 3JV6A 4R2GC 3ZYJA 3PHSA 1CGWA 1KN4L 3HZYB 5JPMB 1N6QH 1BGXL 1D9KD 4XC1H 5I1GL 2VB5A 3UJTL 1ZANH 4KFZC 2R2EA 3P11L 1TXKA 4WEUD 4HDIA 1MLBB 1A7BA 4FQCH 1IILE 5E8OB 3NVQA 5DFTA 4XP1L 1K3ZA 1YC8A 4HEME 5ERWB 3UJIH 4NKIL 2WLYA 1MCNA 3DMMD 2Z4QB 3VWJD 1TFHA 1CT8A 5CEYA 1V7NL 3HMXH 3KYOA 3ILQC 2KQMA 4NPYA 3DXAE 2VLMD 4RAHA 4UDUB 3V6ZB 3BGMA 4ZXBC 4LF3B 1NAMA 1YEDA 5LAXA 1RZJC 2AJXH 3FQNB 3SGEH 2XA8L 1RSFA 5DHYA 3BP5B 1V5JA 1JWSB 1AD0B 2HTKD 4XP9L 4MQXD 2OYPA 3O4LD 5E1HB 4HMDA 3L3OA 2MPAL 2W07A 2OJEB 4LSSH 1T1WA 4L5FL 1LVEA 3RWIA 1CU4H 1N4XL 4PUBH 5GSRB 1R3KA 1FNSL 1T7XA 4NHUE 3BPNB 2NMSA 3IFLL 5HGGS 4HFWA 3EYVB 3UP1A 4NN6C 3MBED 3OKDA 4EI6A 2EZ0C 5IQ7L 3R8QA 1IAOA 3RVVC 1GOGA 1S3KH 5FGCB 4TSBH 1FL5A 3RIFK 4C54A 2V7HB 3KNBA 3SDDB 3UPAA 1IGYB 4PS4H 1FO0A 2FX8H 3TH3T 4PRPB 2X42A 5DJAA 1B2WH 4WU7B 3LY6A 3MA7B 4OKVA 4Y5VA 1HSBA 2GTWA 5KSVA 1D6EA 2VLME 4NZTL 1NCBH 1Q1JH 5HHVL 4ORGB 4CU8A 3C6LB 1YEFH 3OXRA 1DLFL 4UAOC 2O5YH 1PKQE 3I6LD 1JZ3A 3B9EA 5TPWH 5GS1C 3QZWA 1WCBA 3QNXB 5D7IF 1F90H 1QVOA 1BIIA 3H42H 4Z6AT 4ZFFB 1EHNA 1XCTA 4JPWL 3O4LE 2WLZA 1UQSA 1CR9H 2C3XA 4XMLL 5GGQL 3IDYB 4H8WH 4AMKL 1KTKE 2JIXD 3MFGB 3E3QE 1DBKH 3SCMB 4TN9A 4PJ7F 4I3GA 3MX0A 4HUXA 5I66B 3RWCA 4NKOB 1F4WL 1WT5C 1TQCC 2EE2A 4PP2A 1AE6L 3QFJD 3ZE1E 4PP8C 3HI6H 4IMLB 4YWGH 2DI8A 4HMEA 3AUVA 3RVUD 3OR6B 3TBYB 5IB4A 3RY5A 2Y5TB 2FZ3B 1JGDA 1J1XH 1R3JA 2K7QA 5KSBA 1KULA 4N8VB 3TVMC 3GMPA 2W0FB 5MI0C 5D1QD 1CIDA 1AGBA 2HG5A 2R1XA 2EDFA 4ZTPH 5TQ0H 1PX4A 3G6AA 3O6KH 4BJLA 1MQKL 4Y4HB 3IYLW 3BZFA 5E4EB 4Z0BH 1LQSR 1C12B 3I6LE 3EOYG 1I1AA 4OGYH 3SE4C 2EE9A 4LKXA 4MA7H 1MRFH 2E9IA 4IEFB 1SMAA 2Q1EA 2WBJC 4NZDA 5JOFB 2OP4L 4HZLA 4BZ1H 4ZSOA 3L3KA 4BQ8A 5C0BB 3T2QA 4NHCH 4JO4H 5F1KC 3T3PF 5TDNA 2CLZB 5IVXB 4P9MH 5KANI 1VEOA 3GMMB 5FB8A 4D0BB 5FUCE 2PN5A 3CMOL 4IRZH 4U6HB 3QFJE 3WL9B 5CS7A 3O6FC 4MJ5B 5IOPA 3FO0H 4EOWL 5DFVD 1Z5LA 2FHCA 3TBSA 3C8DA 3PGCA 4XVTL 4XNYH 1DP0A 3ULUH 3DHMA 3RTQC 1F00I 4GW4A 1DANU 3HCVB 2FEDD 3A6OA 3CDGA 3GSNH 4X83A 3LHPH 2PTVA 3C60A 4NZRL 3FT3A 4Y4KD 3QWRA 1A6VL 4Q9RL 1I8MB 4P0DA 4OGXL 3K1KC 4U1IB 2IAND 5GGSB 4RAVA 3QSKB 4PJFE 1GZQA 5J1TC 3UJJH 4AH2A 4FTVB 1CD8A 4Y1AA 1OSZB 3O9WB 1I7UB 3ZT7A 5IBLD 2AXFB 3RPIA 5CFHA 3WNNA 1J1PH 2IAMC 4WI9A 3VGGA 5JW4Q 4NQVB 2A74A 3GKWL 1E0OB 4QRPD 3VH8B 4DZ8A 5CSGA 4BZYA 3ESVF 1Q9KB 3SBWA 4LCWE 5C0JB 2R4RH 2R56H 3PV6A 2GFBA 2EEAA 2YPLA 4OCSL 4UIMB 1RZKH 3JTSB 3GHEL 2O5ZH 2IPUG 4FQXA 4CGTA 5F6HI 3ARDC 1WBZA 1K6QL 4NZJA 4JPIB 2B0SL 2B2XL 5I19L 4LLAA 3VXNB 2NW2A 1ZHLB 4PLOB 3F5WA 3FB5A 4XNZC 4G3YH 3AM8C 2DLEA 2PR4L 3KLAA 3UTPD 4NJ9L 1VENA 1T7ZA 3TFKC 4F7TA 2R9HC 1TETH 3PQYE 4JLRB 3WDIA 2IANE 3WIIH 2F54D 1T1YB 5IW1A 5CIPA 3RKDC 3WS3B 1GPOH 1B90A 3F12A 4RGNB 4GOSA 4HUNB 5H37G 4ISVA 4MCYB 5FDYA 4KPHH 1IGML 4X4XB 5C2UB 3VGFA 4LRNH 4U1LB 3GMLA 5GGTL 3PHQA 3K4DA 3REWA 4CJ0A 3KYMA 4QRPE 1S7XB 3MV9D 1BFOB 4KRPD 3LKSB 5DQDH 5DRXB 5K9JH 5IW3A 4I77L 5ACZB 4PJ5B 5IESL 2J7LA 5F8RC 2ORBH 5E00A 1J5OL 4HJJH 1OPGL 4PY8J 4M93B 2HJLB 3ZDXF 1FC2D 2XNAB 4KVNL 3BWAA 4JG0L 3D0LA 3VFWA 1NLBL 1MAKA 2ESVE 2IG2H 4MZ3A 3VA2C 5IHLB 5EOTB 5D7JD 2R0ZL 1IAIH 1XGRB 5F89B 1IQDB 4NNXA 4O2FB 3M1BA 4PJAF 2X4TA 3MQIA 4PJ9A 4NO0A 2X7LA 4X6DE 3CVIH 3AXLA 3U46A 3QIUA 2IH1B 5KSAC 2FJHA 2HJFB 3CUPB 3BMVA 4OQ1A 5J6HB 3VXUD 1IGJB 2W9DH 3PABA 4G9FE 2PO6B 5CP7B 1ZA3A 3SDAB 4JCLA 1T1XB 4X6BA 3K3QA 4C55A 1SY6A 4FXGA 4AEIH 1NH6A 4R2GD 3CMGA 4MLSA 2JJUA 4YO0A 3FO1A 4GG6B 1JGUL 3MV9E 4QOKB 3PL6B 3K4ZA 4JKPL 4IIQB 4GXVH 4XPHL 4X98B 5CBAA 1EV2E 1OAKL 1KIRA 3ZMRA 5HHOB 1AGCB 5DD3L 2IGFL 3BKML 4NKDB 5D71H 4OLYL 5I1LB 4OLXL 1MY5A 3C5ZC 3CH1A 5C09D 3B6SA 4UU9A 5T1LA 3GSQB 2G75B 4JO1H 5F7EL 3ILQD 1YMME 2EDQA 1INEH 5F96L 1SEBA 4GXUN 3P73B 2ZG3A 3CVHA 3GK8L 4ZUSB 4ZXBD 5IK3B 2ZOKA 5DC4B 1HDMA 5E7FA 4I48A 2VQTA 4ELMB 2BOBB 3JV5A 5JPNB 4TSAL 5E9DA 1LO5B 1HN1A 4JFYB 5EZLB 1KB5L 1EO5A 2E7MA 4BSJA 4JJ5A 1IEHA 3UTQA 5IMOA 1NGXB 8FABB 3RDTC 4C4KT 2APFA 4BZ2L 5FUZH 4NSKB 1EFXD 5D2NE 2J4WH 4P9HC 4ZNCD 1J1OL 2NTSP 5JR1L 1JPTH 3VRLE 2EZ0D 3B8YA 2C1PB 4MNQB 3HRZB 1XEDA 2VLRB 3MLVL 5ITBL 3RVVD 4F9PA 5E03A 1FBIL 1ACYL 3HS0B 4G8IB 3O3UN 4W68A 1HHJB 1DVFC 1KIQA 3QI9C 4HBCL 2FX7H 5C09E 4CDGC 5C0CA 1BBDL 1ZLUH 4PJGF 1P4LB 5HHNB 3UZVB 5ICXB 5CGTA 4TUJB 4CVZA 4Y2DB 3MREA 2W0LA 4HXBL 1AXTL 3F62A 4HWZB 1ZHNA 1EHLL 2DDQH 2I27N 5I9QB 1IFHH 5GGVH 3ULVC 4I0PB 1GC1C 2VZSA 4JVUA 5SWSB 4OM1L 5CD3A 1U9KA 1JBJA 3B5HA 2EIEA 3GZKA 4XCFL 4WI2A 2IQAA 3VGHA 4P57A 5F93C 1JVKA 2OZ4L 3CFKB 4K3JL 5E5RB 1MPAL 4ZQKB 4DVRH 3TZVB 1RZFH 1M6OB 1P7KB 4NBXB 5GGUB 3RZWA 2UZYB 1KYOJ 4U3XA 4D94A 1ZLVK 4IOIB 5K33A 4UI2A 5E8EA 1QRKA 1WC7A 4CN6A 5KS9B 2OL3B 3SDYL 1S7SA 5KANG 4U1HA 1RMFL 4CBPA 3ES6B 1WWCA 1MCPH 1ND0B 3BZDA 5EWIL 2F5AH 2EKSB 2BNQA 2VH5L 1XR8A 3TVMD 3JWDL 4UINH 1CE1L 5GISL 1HQ4A 4GKSB 4AT6A 5J89A 1XGTA 3O2DL 2W60B 5GGRA 1VHPA 2LV4A 3FQUB 3UTZB 4OI9A 4F3FB 2AJZA 3EDDA 1CGUA 1FJ1A 4HWNA 2HLAB 4HIEB 4XX1E 3B9DA 3RX7A 2FSEA 4P5MB 1TVHA 3PWUA 3MRRA 3S9DB 2WBJD 1FNGB 3ROOB 3W0WB 1T20B 1KELL 4PJIB 5FHAH 4XXCC 4LLMA 2I07A 3UMTA 3X11B 5FYJH 2UYLB 3U79A 1MJUH 2DLFH 3VJ6B 2SEBB 4DEPC 5DUML 2VDNL 2QV2A 1VACA 3NIFE 2F5BL 3O6FD 3SPVB 4ERSL 1BLNB 4G42A 3RTQD 4X5XB 4IRJA 3S98A 3PWPE 2DQGL 3MFFA 1ZT7A 1KJVA 3VFNB 2ZCKH 4GRMB 2J6EH 2QHRH 5BZDA 5FOBA 1FP5A 1GYAA 1HH6B 4IMKA 4J8RA 3RWJA 3TN0A 4WWKB 3QG6A 3AS0A 1KIPA 1G7LB 4ZUUB 4WI8A 5FYKD 1QZ1A 4RFEB 2W9EH 4GW1A 3MSPA 3O4OC 2Y5EA 4MA8H 4P4RA 3L3HA 2BNUB 1P2CB 3L3IA 1U8NB 1A3RL 1QBMH 1J0JA 2AEQL 2IAMD 4NFBA 3SKJH 5FO8B 5ISZA 5J56B 4EQ3A 1ITBB 4D0DA 3BE1H 2B1HH 4Y7MA 2BNRB 3UCRA 4N68A 4FHBD 1MFAL 1EJ6A 12E8L 4PR5B 2JE8A 1R3HA 2RCSH 1IL1B 4O2EB 1VFUA 3D0VA 4HLZG 4OZFA 1DQDL 1OM3H 3ARDD 5ADOH 3WHE0 3JTTB 3RI5F 3K2UH 2EDXA 4FQ1H 2EYTB 4WW2C 4IDJH 5F9WC 4NKQB 4O51A 4XBGB 1RUAH 3E1F1 3QPQC 3QXUA 4Z8FH 1I3RA 2DLHA 1IGIH 5F72S 3D9AH 4JM4H 1U8PB 1CE6B 5C0DA 3MYZA 1R5VA 4OZGE 4RMRA 2P46B 3TFKD 2R9HD 4KRLB 4HIXH 1A1MA 1UYWL 3RKDD 1T0NB 4R4FL 1A4KA 4ODSL 1DZBA 4FXLA 5FYKE 4UT9L 1S9VB 3GM8A 3X17A 1ROWA 3UTTB 4X9GA 3Q2CA 2R1YB 5J9PB 3GMNA 5ELIA 1P6FA 5IW6A 2V5TA 3FRPA 3P30H 2JJTA 2LFGA 4RZCB 1LHZA 3DBXB 3VXSA 4JREB 1EVTC 1EJOH 3F6IA 3KPMA 1DSFH 3QCVL 4XCYA 3DX9B 5I30L 3WE6A 4IHOA 1HE7A 5KN5B 1WUNT 3VWKA 5HJ3A 4ZUTA 1FYTD 5HGBA 3OPZH 3L5WA 5DFWH 1GGIL 3RU8L 3MGOB 2BJML 4Q58C 4DZBB 2HKHH 4OZ4B 5HDBE 3FQTA 5FCUH 4AK1A 4NRXA 4X6CE 3SGKC 4WUUD 1ES0B 1T21A 5D8JH 1IC4L 3DV6A 4UOW1 3ZKSD 5JIPA 4P2RA 2VTFA 4QXUL 3QQ9D 3SJVA 1IZKA 3O2WL 3QDMD 4PJHB 5KSAD 2F74B 3T3ME 5C92A 4NQDB 4OFKA 2XKNA 4MA3A 4CVXB 4HUUA 5FA3A 1EIBA 5IT2L 1NFDB 5I1CH 4ONFH 3RGVA 2P47B 1BJMA 4YBLC 4KMTL 5E99L 1FZMA 4YJZL 4MB5A 4K94H 2R69H 4WI5A 1LD9B 1Z6JT 4FQJH 3S3SA 1KUMA 3IGAB 5DMIH 5E8NB 1A1OB 1ZTXL 4PRHD 5EOQH 3TO2B 5BVPH 1G6RA 2ZP0T 3DUUA 3LCYA 3RL1B 1FYTE 4PGZA 1C1EH 1REIA 3C5ZD 5F8QC 3FQRA 4X7TB 4P4KB 5IGXL 1WISA 5I0DA 5DSCB 2Q7NA 4XX1G 1OT2A 2E8ZA 1Y18B 1DQML 1MCOH 4NFCA 3QUXA 4P3CH 5B38G 1UCBL 3JWOC 2AK4D 3O6LH 2HRPL 1I9EA 4UV7H 4C59B 5FO7A 4S1QH 5E1AA 3SDXA 4HKZB 3V7AE 2DQUL 1INQA 5GRZA 5ETUB 3QQ3B 3CK0L 1F3DJ 2NZ9C 1MUJA 4YDIL 5C6WH 3I3EA 3L9RA 1WK0A 1ZHBA 1BEYL 2OSLA 3EDFA 5E6YA 2M2DA 3SGDH 2R2BA 3HE7C 1G7QB 4LCUB 4PGBA 5HVFB 4Z7VE 4HK0B 3KYNA 3RDTD 1HHIA 4YBHA 4NGHH 5D1ZA 1UWGH 3QISA 1UJ3B 2IFFL 2X4UB 5F9DC 3WSQL 4L8CB 1NAKL 4MXVF 3ZE0F 1ZVSA 5MP6L 4MS8A 1UB6B 1ADQL 1DLHA 1YEHL 3GNML 5FF6A 2FO4B 3TCXA 4R6UA 5I6XB 1B3JA 1CIUA 1MJJA 4ZYKB 1CFQA 4EXKA 2RIKA 5INDA 4G8EB 2DTML 4S1RH 1VSCA 3CXHJ 1DVFD 3QI9D 3U83A 3OXSA 3BISA 5DJ2B 5DT1L 2VMFA 4ZS7L 5GRJL 1X5IA 2Z92B 1FFQA 4D8PB 4ONHA 4Q2ZB 4R3SB 4Y4FB 4W81A 4N9OB 3VCLA 1SYSB 4KXZH 1P5VA 4NKMB 2DBJA 4NYLA 2VXTH 1KB5B 4H88H 2VZTA 2P7TA 3ARTA 3S5LG 4MLIA 3C8KA 5MHSD 3NZ8A 5LGJB 3ULVD 4ZTOH 1JYNA 4OQTL 4MD0A 1W0YT 2H41A 5AD0B 1UG9A 4JFFA 4MJIB 4XWGL 1IKFL 1U3YA 2XZAL 5ILTL 4U0QB 4HG4K 4JQIL 5K9KB 4KWUA 3JV0A 4NWTL 5ENWA 4WHTB 4E41B 1M05B 4LGPB 1EXUA 4LSUL 4JQXC 5I8KL 5IMMA 2J88L 3ARPA 3EO1A 3VGAB 1SYVB 2MNUA 4FP8H 4TVPH 3H3KA 4JZNB 1UXSA 5C07B 3SY0B 4CDHA 4Z7OE 4WV1B 1BWWA 3T0BA 2N7AA 2AJYH 2VABB 4HEPG 3BKCL 3F7YA 4ODBD 5DJZA 1DBBH 5AYUH 2P43B 3R1GL 3OJ2C 2H8PA 4JFDD 1MVUA 3GSUA 3VG0H 4M8QA 4GBXA 4GO6B 5GRUL 5EU3A 2CUMA 4M61B 3NFSH 4TTDC 1ETZB 4G5ZH 3D3VA 5I17A 1YJDL 3KPOA 3UTSA 4BSVB 1UWXH 4QT5A 4RWHA 5K9OB 3ULVE 5F6HJ 4NO2A 5B3NA 4HPYH 1PG7W 1JZ4A 5IVZB 3EGSA 1A7PH 1R24A 3VXRE 5ADPL 3Q6FB 1VFOA 4Z7QE 4KAQH 1H15A 4W4OC 2JJSA 5DK0B 3IDXL 2B8OT 1E4KC 3QJHA 1HXYB 3HZYA 3CPLB 5JPMA 1UACL 1FHGA 3DXAB 4GKZB 1TJHL 1J8HE 3HFMH 1UVQB 4JRYD 2GIYA 1MI5D 2IPKB 2VDRH 4XC3L 1MLBA 3E6FB 2B7DT 1H5BB 1BOGB 2WWMC 4LAJH 5ERWA 2VOTA 2Z4QA 1DBMH 4U3HA 2D7TL 2A77L 2FL5B 1P6AB 2JELL 2CO6B 1VFBB 4EI5A 1EBAA 2AEPH 4OZHF 1S7TB 3CX5K 1CXEA 2R1WA 1DBJH 3O3BB 4NHUB 1A1NB 3V4VH 1ZWIA 4U3CA 4JFDE 4N0UE 3U0PB 3GJFB 5JW4N 1ZLSL 4LF3A 4ZAKB 1J88A 3H6JA 4Q7DA 3FQNA 1X4YA 4N0FA 2BY1A 3BP5A 5BW7C 2A83A 1JWSA 1H3VA 4XNMB 1AR2A 1QFWH 1QO3B 3V0WH 4Z7WF 2OJEA 4YZFE 3JV4B 4WI4A 1FE8L 3DMMB 3VWJB 1NCWH 2PW2B 2Y06L 3R06A 2NY7H 1YEJH 3BAEH 3ZSTA 1BFSA 1RURL 1A47A 3O41B 4MNGE 2BHUA 3OHXB 1ITCA 4JRYE 2VL5B 5I8CB 1PKQB 2PUQT 4XCCH 3V7AG 3MRMB 4P5TC 5CJ5A 3FONB 1I8KB 4Y5XB 2I60H 2VXQL 3SDDA 1E6JH 3MNZA 2X41A 3QPQD 1HILB 1A6UH 1RK1B 4PRPA 3EYFA 4WU7A 4DW2H 3MA7A 4YC2C 3NTCL 2VLKE 2VITA 5C86A 4ZO9A 1CLZL 4U1SA 4ORGA 5HHPB 4DAGL 3C6LA 4OIIH 4CNIB 1EGJL 2FWOA 3TJEL 4PV8B 3SE3A 3QNXA 4X4MA 4F37F 1WEJH 3ZE2F 4DKEH 4TOYH 3AY4A 4R7DB 3UO1L 5JUEH 3SCMA 3TBTA 4HPOL 3QUML 5BVJB 5L2KD 5HGDB 5ACLA 2YEZA 5I1DB 4XHJC 5CAYB 2X70B 3S35H 2DM2A 2EH7H 4CW1A 4V1DA 3KJ6L 2EECA 4PIRF 1W72L 2ARJA 3OKLB 3OR6A 5HDLA 2Y5TA 2HKFH 3QUZC 2X4SB 5DEGB 1FLRH 3MJ8B 4TQEL 1IKNA 5DVNA 4N8VA 2DQFB 3CLFH 2AKRB 3L1OH 4WCYH 2VE6B 4GSDH 1DCLA 3MR9A 1ORSB 1XAUA 2JIXB 5T33L 2YRPA 4NQEA 2KZ1B 1WFOA 3TF7A 4Y4HA 1FVCA 4MAUH 2IFGA 4KQ4L 5E6ZA 3QFJB 2H26B 5FGBC 2ID5A 4R97B 3OKYA 5JOFA 3WKMH 1IC7L 1JPST 1GAFL 3BMWA 5C0BA 3TIEB 3UZEA 3KDMB 3AS3A 5DK3A 2BMKB 5H2BB 4UQ2A 5IVXA 5D1QB 3TA3C 3TWCL 4ZNEA 4D0BA 2HT2C 4I2XE 3QULB 2FJFB 3ULUE 4JDTH 4U6HA 3WL9A 4MJ5A 4LIQL 2XXMB 2QLVB 1JHTB 4PJFB 3MO1A 4N5EC 5FYLL 3HCVA 3TBVB 1BZ7A 1L7IL 4GKOA 5KJRH 5KZCD 2XRAH 1P4BL 1VGKB 3QJFB 4L29A 1ZK9A 2ICES 4U6TA 1CDGA 2DM7A 2CDEB 5CEXB 1I8MA 1EDQA 4X99B 4U1IA 4XH2A 4JANB 1DL7L 1LO3H 4I5BA 3BZEA 4LCWB 1CK0H 2GK0B 1F02I 2NZ9D 5EBWB 3OKMA 2UZIH 3T4YB 3Q5TA 5FECA 3B3IB 3O9WA 2ZZUT 1AY1L 1IAII 2AXFA 3HE7D 4WW1B 4P46C 4F57L 3FCTB 3H9HB 1KCVH 1UWXK 4NQVA 1JRHI 1MHHB 2R29L 2DWEB 3VH8A 3UX9B 4XBEL 1AIFB 4NNPL 2V7NB 4Z95H 1I9JL 2E6PA 3QEHB 3TJHC 2ZUVA 3LKPB 4Y4KB 1FPTH 2V2TA 1O5DT 3KR3L 3GIZL 3PQYB 3DIFA 2IANB 1P9MC 5K9QI 1T80A 1Z3GL 1JHKH 1TJIH 4UTAL 4YDKH 1R3IL 4JPIA 2DRUA 2Y07H 4YHIB 4KK6C 4HKBA 1DQLL 3VXNA 1DDHB 1QRND 1XF1A 1ZHLA 2CPCA 4B7IA 4GUPA 4GQPH 4LOUC 3O0RH 3E2HB 3BPLB 3C2SA 2CIKB 1NAMH 4Z76B 1UB5B 3BDYH 4QRPB 1A4JB 1WFUA 2PXYA 3DSFH 2UZXB 4JLRA 2P8PB 1CZ8H 3MRIA 4ZFZB 1RQ5A 2XTLA 4LCCC 5C0IB 1ZS8A 2W65B 1T1YA 1ZVYA 1CS6A 2NX5E 4G8GD 3WS3A 5C0FB 2EIBA 3BH9B 3FOMB 5FHBH 5JHLH 4Q9QL 2Q86A 4JRXA 5EC1B 4JGUA 5CUSH 3L7FB 3LEXB 4EN3B 4OV5B 4K94C 3I50L 2ESVB 3ZT6A 4CMHB 1DEEB 3KWWB 3QDGD 3MV8D 4YK4B 1BFOA 3NA4A 2Q8BH 1RIUL 2EEDA 1OHQA 1Q0XH 5DRXA 1KNOB 5I74B 4J12A 4D9LL 5ACZA 3HAEG 5F1SA 2FGWL 4I4WB 4X6DB 4KJYB 1AJ7L 2E7LC 4JFXB 4QTIH 1RULH 2HJLA 5CJXC 3VFPB 5DUBB 2XNAA 4E0RB 1N6VA 4NQXB 2VNCA 3A6BL 3TESA 1FO0H 3MRCB 4G9FB 1HIMH 5DEZA 3RFZC 2YN5A 5E2WH 1RJZB 5F89A 1IQDA 2NW3B 3QQ4B 1I1YB 2VR4A 1K5NB 3MV11 4LP4A 5C0RL 2VXVL 3MV9B 4TTDD 2PF6A 4HX1A 5IB1B 3MLTA 2OI9B 1YECL 2MHAA 4PJCF 3RWEB 5C8JB 1I85A 2V6HA 3RY6C 2HJKA 3PE9A 5J6HA 4PREB 5D7LD 4WNQA 2PO6A 5CP7A 4LHJB 2VLJA 2DJUA 2V17L 2UV3A 5ESVA 1YMMB 5D7JB 1A7OH 7CGTA 2YD1A 3HNVL 3I6GB 3QDGE 3MV8E 3U9PL 2ZCHH 4QOKA 3NAAL 3PL6A 4O4YH 1Q9LB 4DKDC 1CTOA 3RVTC 2AK1L 1AGCA 3SO3C 1UKQA 2AXGB 2WWMD 5C0AD 4I18B 5I1LA 4JPKL 5GIRB 4RGMB 1KT2A 5TDPB 1A6WL 4XB8A 5AZ2L 2MFNA 1AKJD 1TZHB 5KTEL 1FFPB 1NMAL 3H8NA 1RIHH 3P73A 5C08D 4X6FB 4R2GB 4ZUSA 3PP4H 2CLVB 1TPXC 3MUHL 5IK3A 3EO0B 5D2NB 5EUOE 2YPVH 5DHVB 4ELMA 2BOBA 5JPNA 3LEVH 3M8OL 1Q8MA 5EZLA 3FZUC 3D18B 2R4SH 3EZ8A 4U33A 3GEWB 2HVKA 1G0DA 1NGXA 3MNWB 8FABA 3U1SL 1OB1B 3G04B 5C09B 1NGPH 3VFRB 2R39A 4G9DA 3QXAB 3VFMA 1XF2B 1UZ8B 1C5DB 5M7QA 2PYEB 4FFZL 3C08L 3MCLL 1JPFB 4ZXBB 1FGVL 1NL0L 2C1PA 4MNQA 3FFCE 1KB9K 5L88L 4PG9B 5C0AE 1CFNB 3K81A 4P5TD 3SOBL 5I75B 4DGYH 4MJ6B 4RWYL 3P0YH 3HS0A 4OCYL 2E7BA 3MLUH 1HHJA 4GT7A 2QSCH 3N85L 1AQKL 5HHNA 1OQOA 4K7PH 3ULVL 4TUJA 2VDPH 4LLWB 5F3HB 1QSEA 3S35X 3W5NA 5C08E 4R0LB 4HWZA 4MVBA 5HVHC 4HH9B 5E2JA 4WHDA 5SX4I 4GH7B 1CDHA 4RMQA 4NN6B 5JQHC 1A21A 1VFMA 3DI2B 3NFNB 5FYJD 5SWSA 1I9RH 1IEBB 1OAUH 4DCQB 3UJIL 1V3LA 4L4VD 3IF1A 4K7FB 3UYRL 4D9RD 5TDOB 3CFKA 4XHJD 1WAAF 5E2TL 5F1IB 3TZVA 1M6OA 1P7KA 4W6YB 5GGUA 4OI7A 3EZJB 4PGDB 3OZ9H 4IOIA 2DL9A 2AJXL 3B2VH 3VFUA 5KS9A 2BRQA 4UAOB 4G43A 3ES6A 5L2JA 5FFLA 3K46A 3QUZD 5B38B 2P5EA 2FBOJ 2YA0A 1MF2H 3VGBA 3U2SB 3IXAB 4LK4A 5EO1B 1CU4L 5IMKB 3IT8D 3VRJB 3G5YA 4GKSA 4XMKH 1KCUH 3V5KB 2W60A 5EFIA 3UTZA 3FQUA 4WO4C 3M45A 4F3FA 1S7VB 5CIPH 3BESR 3JSSA 2OX5A 5DJXA 1RY7B 1KPRB 1CICB 2HLAA 4HIEA 1DUYA 2JK5B 3N1MC 1TQCB 4AENA 5D7IE 4QRSB 4P5MA 2EH8H 4LVNC 5E2VL 1FNGA 1U8OB 5FYJE 5TF0A 3ROOA 4MB3A 3W0WA 5J4MA 1S3KL 1T20A 4TSBL 2ZJSH 4RIRB 2OQJB 1NDMB 4L4VE 3LB6C 3PWPB 4PJ7E 1DTUA 4HS8H 4L3ED 3BYTA 4A2MA 1LE9B 1PY9A 1T0PB 2BDNH 3X11A 5T1KD 2FX8L 4IBLT 3RHWK 2UYLA 1B2WL 4D9RE 3IETA 4AG4L 4K3GA 2KZWA 5MI0B 1LP9B 3TA3D 2Y23A 2SEBA 1W72B 1NCBL 2HT2D 4H25B 1YEFL 4YXHH 1X9QA 1T5XB 4K9EH 5TPWL 3V52L 4JHWL 5FAAA 3HUJA 2EDYA 4BUGA 1P69B 2BVPB 1F90L 4N5ED 3MXVL 3QEQA 5GJSH 5L0QB 4HKJB 4X5XA 3E0GA 4R4BB 3SDXF 1EHXA 4Y8AA 5J3HC 2WBJB 4GRMA 4H8WL 4QRQA 4QRTA 5K9QG 4OD3H 2J8HA 3MXWH 5I2IB 5DJCB 3CIQA 1DBKL 4TULH 1U2CA 4NIKB 1HH6A 3S5LB 1J11A 1ZSDB 3RNQA 4OI8A 1MFCH 2CR6A 4ZUUA 3HI6L 3ZSSA 4XGZB 2A73B 4RFEA 1IBGH 3O6FB 1YDPA 3HR6A 5DJ0B 1MFDH 4PG2A 3OB8A 4P46D 1MCRA 1NEZB 2LE9A 3T3PE 1CYGA 1DQQB 4L3EE 2D03H 4WFGE 2BNRA 5LBSL 5IB2B 5L9DL 1KLGB 4LVOC 1BQUA 2MOVA 4JCMA 5EO0A 3TJHD 4ZTPL 4PR5A 4OZGB 4RISH 1IL1A 2YPKA 4QEGA 4H0IA 4O2EA 4LFHD 4Z0BL 3BRFA 3I6KB 3P40A 2NY1C 3FN0H 4OGYL 5D70H 3JTTA 1MRFL 2WP3O 3CJJA 4M3KB 3LN9A 3WMSA 4PRID 4KK6D 5JHDA 2EYTA 1F5WA 4BZ1L 4ZOCA 5JNYB 4XBGA 4LOUD 3P0GB 4M43H 4NHCL 4HJGB 2W0KA 3CVHH 2IAMB 4CVWA 2PW1B 4P9ML 3N9GL 2BFVL 4CUCA 2Q20A 3CLEH 4RCAA 4UMGA 4IRZL 5DZNA 3S97C 1T0NA 4Y16C 3FO0L 3KPSD 4KZEL 5C9JB 4ZO8A 1L9MA 1S9VA 4PYHA 1FN4B 1RZ7L 4XNYL 4Y19D 2RR3A 3ULUL 1FG2B 2FB4L 2NY0C 3BIKB 3ARDB 3HG1A 1YC7A 4S2SA 2R1YA 5CZVL 5E95B 4M62H 3GSNL 2X4NB 4RZCA 2Y9RT 2EXWC 2A9NH 4S10A 4L8SC 4X6CB 1TMCB 2CLRA 1WICA 3MRGB 5GHWH 2VDOH 3MRDB 3SGDI 5BOZG 3OAUH 3V4UH 4DGVH 3UJJL 2A6DA 1KJ2L 1AH1A 1MVFA 4PRIE 4UNTA 2VERN 4OZ4A 3FO9B 1CFVH 1RFDH 5B39B 1KEMH 2OS7A 5DLMH 3QHZH 4Y2OA 1ES0A 5LVEA 3HI1B 1YN6A 2Z0BA 1BVKA 5F9OL 3TLRA 4FA8A 2R56L 1GVIA 3F8UB 5HVGB 1R5WB 3I3DA 2BRRH 1U8KA 5J13B 4KROC 1RZKL 1AGEB 3SKNB 1BWMA 1T1ZB 4NQDA 1OCWL 3B9KB 3INUL 3MGAA 1XF4B 4JFQB 3T8XB 1FYTB 1VB9A 3ZTJG 1B0GB 3FT2B 1NFDA 1BQHB 3QDJA 4G3YL 1L4IA 3R0NA 4XNXL 4K23H 1LD9A 3RVTD 1TETL 5DD0H 5E8NA 4PBVC 1A1OA 1OGTB 1JNNH 2Y72A 5A2IH 2ITCB 3ZDXE 2E7LE 3RL1A 4MX7B 1ZEAL 1LEKB 4X7TA 4P4KA 3LDBC 5DUPL 5DSCA 2C5DC 3BHBB 1Y18A 2XICA 3IS1X 4Z7VB 5C3TA 2PTTB 4PJAE 5EBLA 1VDGA 1CDJA 1JL8A 4FMKA 1LQVA 3AMKA 3EYUH 4FZEH 4TRPL 1U3JA 5K9JL 2P1YA 5ETUA 3QQ3A 3HPJA 3CFDA 2C3VB 4C56D 1GJIA 4FNLH 3S6CA 3BEWB 4ODHH 2FHBA 2ORBL 3MLYH 5HYJA 4HJJL 4BELD 4NJAL 1NLDL 2ZSVB 3FZUD 4HS3B 3WN5A 3D69B 4FQHB 4NT6B 1G7QA 4E42B 3L5JA 4LCUA 1P1ZB 2IG2L 1WZ1H 2MQCA 1KACB 4HK0A 2ZPKL 2WIMA 2X6MA 4F2MB 4I8DA 1UA6H 5INCB 4TVPD 3CSBA 1JZ2A 2AJUH 3W9DB 4L8CA 5ID1B 4EIZC 3V6OA 1YEKL 4O2CB 1UB6A 4F37K 3NACH 1QOKA 4U6YA 1JP5A 2FATH 2QJDA 3TH4T 2BSSA 1J05A 2BP3A 2FO4A 3CVIL 2Q8AH 2OR9L 2E9BA 5IWLA 4Y5VC 4Z9KB 1MWAL 2Z8VC 1ZT1B 2W9DL 4OF8A 1HH9A 4AEIL 3B9VA 2AJ3B 2Z92A 4OCRH 1YEEL 3RDTB 4Q2ZA 4Y4FA 5GZNC 5DMGC 1X4ZA 1GHFL 1TVBA 1SYSA 4NKMA 4GXVL 5F7WC 4ZPTA 1KB5A 5DRWA 3O8XA 5K93A 3U4AA 1FGNH 3WO4C 5LGJA 2VXUH 1PSKL 3NH7H 2XPGB 3D39E 1QHPA 4QHMB 2YKLL 1U8MB 1NFKA 2YD6A 4MJIA 1BHGA 5GJTH 3CZFA 4TSCH 4JO1L 2A9MH 4MHHG 3NCYS 1DVFB 4YHZH 3HC4H 4TVPE 5KVDH 4WHTA 4LEXH 4E41A 4S11A 2CD0A 4YHMH 5DD1L 3LQAH 1A3LH 4OZFH 2HVJB 3AS2A 2Q76B 3QXTA 3G5XA 1OARH 3SY0A 2M1KA 1ONQB 2IF7A 5FK9B 1IGCH 5ICYA 2VABA 5I1IL 1C5CH 4K8RH 5BV7C 4PJGE 2GJZB 1I1AC 3VXRB 1GGBL 3O3DB 3CXDL 2I26N 2DQHH 4WO4D 5BMFL 4XP6H 4ZDHA 2X4QA 5MEPA 1KCSL 5TGBB 1ETZA 1NGQH 4H5SA 4U6VH 2BCKA 1J8HB 1JPTL 4BSVA 4BQ9A 1EFQA 4PRBA 4U49A 5K9OA 4R96A 2OZ4A 3LB6D 3SGJC 4GXUM 1CD0A 1A7RH 4LFHG 4RRPA 3N06B 1FSKB 1HXYA 4GRLC 3CPLA 2JB6A 3V95A 3GO1H 4LPWA 5EDXA 4JFDB 4N0UB 3QBTB 1UVQA 3LH2L 5JIIA 2DDQL 3C60C 3VFOB 4DJMA 4PP1C 3E6FA 1H5BA 1BOGA 1FFRA 4ZUWB 4D3CL 5GGVL 3S37H 3L5XL 3BDXA 2HWZL 1HHKA 5J3HD 3O2DA 1NMCB 1VFBA 3O3AB 1S7TA 3D85B 2ICEB 1RUPH 3U4EA 3U7YL 1B0RA 1U92A 3O3BA 1A1NA 3DLQR 4WFED 1XIWD 3GJFA 4OV6F 2ITDB 4ZAKA 1QR1A 1RZFL 2G9HB 4HGMA 1DQTA 1VPOH 2E5EA 3HMWL 4MNGB 2BVOB 1IZJA 4DEPB 4JRYB 1NSNL 1FFOA 4XNMA 3W2DL 3SBWC 4G80B 1MCPL 2F53D 5J7CC 1QO3A 1I3GL 3TPUA 3U0TB 2X44D 4RSVA 1E4WH 1P53A 2JB5H 3DMMA 4FQXC 5A16B 3FB7B 4RGOL 3WJJA 1UH2A 2AEWA 1I1FB 2AABH 2XWTA 4XPGL 1T7VA 2VLKB 3OHXA 4U7SA 2HLFC 5BRZD 4P2QE 1FYHB 5I8CA 3KXFD 1PKQA 2NY1D 4QF1B 3P4NB 3QAZC 4KTDH 2D7NA 3MRMA 5D5MA 3DROB 3H9SD 1I8KA 3IKKA 4L3CB 1QR4A 2B20A 3O4OB 4Y5XA 1JF5A 1WV7T 3IU3B 4JR9L 3OKOB 4XVJH 4LQFH 1HILA 1RK1A 3MMEA 2EXYC 3MCKB 3MLSH 3DURA 5FYJL 3LS4L 3O6MH 1EAJA 3WIFA 5TE7H 4R26H 2Y7QB 4WFEE 2VAAB 4ONGH 3MOAH 2DLFL 3HZVB 4P2OB 4PJEA 5FKAB 5GS2D 5KVFL 3FN3A 4CNIA 4Y16D 1X6NA 3DX6B 4PV8A 2EDHA 1NC4D 4A6YA 3F6LA 2F53E 2NY0D 4QY8B 5DJ8A 5TE4H 4Q74A 4R7DA 1FV1B 5F7MC 5BO1H 2P8LB 4LGRB 4HWEH 4X80L 2X1QA 2J6EL 5F9WB 2QHRL 2EXWD 3Q3GB 5KG9A 4K9EC 3LAFA 4JPVH 3QCUL 5T5FH 3GSRB 2X70A 4F8QA 3MA9H 3I84A 2XKSA 4PJXF 3RNKB 2XFXA 1GIGH 1PDKA 5LCVH 1OGAE 3KXFE 3TT1L 2J1KA 1CFSB 2L4OA 2X4SA 4MA8L 4PJ9C 5DEGA 3AAZB 3MJ8A 2CK2A 2V2WB 1PD6A 1FZJA 3QIUC 1Q72H 2AKRA 5JMRA 3BE1L 2B1HL 3BRGC 5GGSY 4GAJL 3WUWG 1J12A 3QRGH 2QR0A 1MCWW 4U6XB 3P4MB 2YN3A 4ODXB 4LNVA 1SHMA 4L4TD 4I2XB 4R8WH 4KROD 4RA3A 2DBLH 3GSNB 3ZKXC 1OM3L 1B4JH 3QO1A 5CINL 2YD5A 3BH8B 3KHOA 4OFVA 1FQ9C 4YHYC 5D7KD 4FQ1L 1XGPA 3TC9A 4RX4A 4XB7A 2IH3A 4IDJL 2OJZL 2BMKA 5EIVA 1UM4H 5H2BA 3T4AA 1JF1B 1IAMA 2AI0H 4CU7A 1WLHA 4J6RH 5IB3B 4HIXL 1OW0A 5DK2B 4M9PA 4PB9H 1S8DA 2V5MA 4CN1A 3S36H 4PJFA 1CQYA 6FABH 1BVLA 1X5ZA 3TBVA 3MRBB 4ENEC 4XP4H 4M48H 4KTEH 5EORH 4IDLA 3NABH 3QJFA 2GTZA 2CDEA 5CEXA 5CKGA 5A2FA 1DSFL 4YBLB 4JANA 1ZXQA 4GG8A 4C83B 4LCWA 2V2XB 2GK0A 1O7SA 4OD2B 2WP3T 3T4YA 1S9WB 2P8MB 1IGFH 1XFPA 3K8LA 1RAMA 3B3IA 5J6GB 1KYOK 3OPZL 1PG7H 5DJDB 1VCAA 4U0RC 5IHUL 5E8DL 4U1NB 3RZCC 5HYSG 1QBLH 5JOPD 3FCTA 5FKPA 4JM2A 1G9NL 4JKKA 4Z77B 5FCUL 2DWEA 4EDXB 2FYYB 2MWCA 4F9PC 3QEHA 4U1GC 3QWOB 5D8JL 4NWUH 4DFHA 4X9IA 3TYGH 1QLFB 1F3DH 3PQYA 3QNYB 4P59L 4XZUB 3CFCH 3EJJX 2NX5B 2YSSA 1RUKL 3BSZH 4Q9BA 4YHIA 5EU5A 5H94B 4YUEH 2WQ8A 1H3UA 1CGVA 1AO7A 1UH4A 1QBBA 1CGSL 3MOBL 5JXEA 3HE7B 4KI5C 5A2KH 4ONFL 3MRHB 4OKDA 2KPNA 2CIKA 2FCBA 5GZND 5DMGD 4K94L 4NC1E 1VESA 2R69L 4U7KA 4ZFZA 5C0IA 1EZVY 3HC0B 3K1DA 2VDQH 3FOMA 3RJQB 2I9TA 5EOQL 5BVPL 4RAUB 1JGVL 3TO4B 2ZUSA 4YE4L 1FG9C 1C1EL 4EN3A 1GRWA 3KYKL 4OV5A 2ILLA 2ADFL 3IRZA 2ESVA 3O2VH 5JDJA 3DVIA 1MCOL 4P3CL 1RI8A 1DEEA 3KWWA 4ONOA 5FM5M 4XCEB 4APQA 4MXVE 1ADQA 3ZE0E 4UV7L 2XQYK 1ED3B 4S1QL 4B53A 1KNOA 4OUOA 5HYIA 3OAZK 4I4WA 4RNRB 1NPUA 4JFXA 2IPUK 1K4CA 1N5AB 2VJXA 5DUBA 1FNEA 4RFNC 4M7KH 1KSRA 4G9FA 2IADA 3CU1A 1I1AD 4I3SL 3MJ6A 5EU6E 2NW3A 3QQ4A 1A3QA 1K5NA 5I71B 1L0XA 3QDGB 4MD4A 3MV8B 3STBA 4OQTA 3MLZH 2ED9A 2B5IC 1A64A 2OI9A 3RWEA 3UPRA 4J1UA 5IKCB 4MQ7A 2OLDA 1GL4B 3IU4L 3EFFB 1MIEH 4PB0H 1QFPA 4NRYB 3U30B 2FLRT 4LLQB 3C2AL 4OF3A 4OJFL 1IQWH 4S1DC 3WXWL 1LO4H 4S1RL 1F58L 3KG5A 5JIHA 1YMMA 1MIML 5D7JA 1KXTB 5EBGA 1LNUA 4GRLD 3I6GA 4IRJC 3HUJF 2X9YA 4Q6IB 4M03A 5JDSB 3DVNB 2NXZC 4Q9CA 1S9YB 1U93B 3GBNH 3C60D 5EUOB 4PP1D 2AP2A 3QWRD 5BCAA 4FQ2H 5C70A 4IMKC 2WZPD 4TPRH 4GAYA 4I18A 4KHTH 4RMWA 3TN0C 5GIRA 3GMQB 2CKBL 2OBGA 2EIZA 2QSQA 1T4KB 1TZHA 2WM0A 1CLYL 1W0WB 3MNVA 1EX0A 1HINH 3MUZ1 1G7JA 4M1GH 4Y1AD 1QBAA 2CLVA 2WBKA 1YQVL 4ZSOE 1XT5A 3NCYP 5D2NA 3MACL 3HNTH 4POUB 3ZTNL 3X3FH 2H32H 5DHVA 1D5BB 4KY1H 4OLVH 4TVPL 1JGLL 3FFCB 1W8OA 4YHLH 2YPLD 1XF5B 5C0AB 5J12C 2ICWB 4LSRL 3MNWA 3LQAC 2RJMA 4FQXD 1OB1A 3G04A 4JFZH 1DBBL 1MNUH 4LKCA 3KLHC 1AKJB 2ED7A 3QXAA 4EDWH 1XF2A 1UZ8A 2E3VA 1C5DA 4PLKC 4QNPF 2DMKA 1TZIB 2DQIH 2PYEA 4P48A 5LQBH 3PHOB 1AC0A 2HLFD 1V3MA 5LWYL 4K8RC 3GI9H 1N8ZB 3H0TA 4PFEA 1CFNA 1EUUA 4WU5B 4X0KB 4MJ6A 4OFYA 4HPYL 2DLGA 1EMTH 1X5XA 4XI5C 4OZHE 3EFDL 3RVXC 2EXYD 5I1EH 4LLWA 5F3HA 2XTJC 4OLZL 4W6WB 3V4PH 2ZUYA 3OAYK 4Y1AE 4CMMA 4KJWC 5ALBH 4R0LA 3ARBB 2JJTC 2UUDH 5CILH 5C7XH 2VDRL 2NY3C 4JO3H 1BVZA 4Z7WE 2L0DA 2BY3A 4YFDB 1IEBA 3I2CH 4DCQA 2XY2A 5E5UB 3WJLA 2YPLE 4K7FA 3FFDA 2EDLA 3VWKC 3VXME 1KJMB 1WSST 2P24B 4FFEX 4JGMA 3IJHB 5ANMA 5F1IA 4BQ6A 1BQLH 1KFAH 4PGDA 3DO7A 3BOVA 2W0PA 3JVGA 3RA7L 5E2UH 1RZJH 4LSVH 5D7IB 4PJ9D 3K7UA 3MRLB 4NO0D 1QFWL 2WSKA 2O5XH 3V0WL 4N0CA 5T1DH 5IHZB 2XQBH 2XN9E 3IXAA 4KHXH 2DIJA 2EC9T 2V9TA 5EO1A 5KBNC 3QIUD 1RHFA 5IMKA 1LO0L 4L4VB 3VRJA 1F42A 4PJ7B 1T03H 5IEHA 1KJ3H 1EGJA 3V5KA 3RIAF 3VXOB 1UC6A