4G42A

Structure of the chicken mhc class i molecule bf2*0401 complexed to pepitde p8d
Total Genus 72
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
72
sequence length
271
structure length
271
Chain Sequence
ELHTLRYIRTAMTDPGPGQPWFVTVGYVDGELFVHYNSTARRYVPRTEWIAANTDQQYWDGQTQIGQLNEQINRENLGIRQRRYNQTGGSHTVQWMFGCDILEDGTIRGYRQSAYDGRDFIALDKDMKTFTAAVPEAVPTKRKWEEESEPERWKNYLEETCVEWLRRYVEYGKAELGRRERPEVRVWGKEADGILTLSCRAHGFYPRPIVVSWLKDGAVRGQDAHSGGIVPNGDGTYHTWVTIEAQPGDGDKYQCRVEHASLPQPGLYSWK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system
molecule keywords MHC class I alpha chain 2
publication title Narrow Groove and Restricted Anchors of MHC Class I Molecule BF2*0401 Plus Peptide Transporter Restriction Can Explain Disease Susceptibility of B4 Chickens.
pubmed doi rcsb
source organism Gallus gallus
total genus 72
structure length 271
sequence length 271
chains with identical sequence D
ec nomenclature
pdb deposition date 2012-07-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00129 MHC_I Class I Histocompatibility antigen, domains alpha 1 and 2
A PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4g42A02
3.30.500.10 Alpha Beta 2-Layer Sandwich Murine Class I Major Histocompatibility Complex, H2-DB; Chain A, domain 1 MHC class I-like antigen recognition-like 4g42A01
4JO4H 4I5BB 1Z0MA 5IKCA 4WFGD 1U93A 3QO1A 1Q72H 5ABDE 1BLNA 3ARSA 3DUUB 4DKFL 1CXKA 4OZHE 1EGJL 2DJSA 1WAAA 4NZTL 5BJTB 2BOBB 4LVHC 3DMMA 4HBCH 5C09B 4RMQA 2CXGA 3MFFA 4BKLA 4OJFL 1U2CA 1K5NA 1EIBA 4OLVL 4ONGH 4LHUA 4PRIA 3ES6B 3VG9C 1EGJA 3TWCL 3WFCH 3RZCB 3UYRL 3QIUB 4Y19E 3KR3L 4PR5A 3EGSB 3AGVA 5KSBE 1GZPB 2GW5A 4YNYA 5EU6E 1FNEA 1S7TB 1T22A 5HI4D 1Y6NR 5ADOL 3O4LE 4CU6A 3UPAA 3VFOB 1OY3B 1U8PA 1CGUA 1WCQA 5D2LB 4OCMC 2DQJH 1OGAE 4XNUL 1FFQA 3T8XB 2XKNA 4HT1H 1F4XH 1DLHA 3CSGA 5SWSE 3LEVL 3U9PL 5KZCB 3D48R 3C60A 4UOJA 1RJLA 5GGQH 4X4XB 2AXFA 3H3PL 5KVEH 4HIEA 4O51B 2YPVH 1ZT7A 5D7IE 4U1JB 5SX4I 1NC4B 2LU7A 3R4DA 2WK2A 3BUTA 3PGFL 2DQGH 2XZQH 5EPMA 2YN3A 1I3GH 1Z0NA 2OLDA 2R0ZH 4S11A 4LPVA 1BIIB 2MNUA 3EOAA 4NO2B 1ACYL 1L0QA 1TVBA 1R5IB 4RGNB 4GJTB 3QDJA 4TSAL 1E28A 3CH8A 1EO8L 5C0CD 2AQ1A 4HWEL 2AXGA 2VUYA 3QDGD 4U1IB 3ULUH 1UZ6F 1FH5H 3ALXA 1S9YA 2Q76A 5MEPA 3IXAA 4M7JH 5EC2B 1OWRM 5I1EL 2W1NA 3UC0L 1ZVSB 4FQ1L 4OT1H 5F7EL 1FNGA 1YYMH 1FL3B 2YKLL 1E6OH 4PG9B 2XA8L 5C6WH 4Y4KC 5F21B 1TZGH 3BVNA 2CMRL 3VFTB 1YQ2A 5EUOF 1NBZB 5KSVB 5CEXA 4DW2L 1NDGA 1JFQH 4ODWA 4PJ9C 4V1DD 2P1YA 4ZUWA 1DSFL 4HPOL 4WW2A 3KXFB 4PBXA 1AP2B 5E1HB 5E2JA 2NY0D 2NY1D 5ISZD 1YNTA 2P5EA 2X7LA 3G5VA 5DMIL 2F8XC 1M7IA 1C08B 1J18A 5IBLC 5I18H 3ILQC 4JFZL 2FATL 4LHQB 4RBPK 1G7HA 3LN5B 1NLDL 1AJ7L 2C7UB 4YHLH 4MXVE 3SDAA 2A1WH 5CBAA 4JY5L 1MHHB 5J1AA 4KJQD 3AFLA 2BMKB 1DQJB 2DJ4A 4D8PA 5MENE 1ZXQA 3E2HC 5C0AB 2R4SH 1FO0L 2AJXH 1KYOK 3U0TA 2XZZA 4OCSL 3ARRA 3ARYA 3DROA 4WUKL 2G60H 4MHHI 1C5DA 4G8GE 3NTCH 3I75A 4WJ5A 1FO0A 4L4VA 4NCC2 3MYJB 2XXCB 4X0KB 5CJXC 1H5BA 4MXQC 5JORA 1GGTA 2IFGA 2IPKA 3HAEH 3SO3B 5DMGD 4PRHE 1J9CT 3S88H 3RWDB 5EZOH 3P0VL 2PO6B 3MRHA 3WUZA 4DCQA 5IGXH 1CTOA 4OZIA 5BVJA 2VH5L 5KW9H 4K9EL 2WUBL 3OKKA 4QXUH 2JELL 2IPTH 2V2XA 3VXUE 5SWZE 4EJ1C 2OP4H 5B3JF 5C6TH 4LCWD 1JYXA 5F7NC 1QQDA 4R8WH 3P4OA 2LFGA 5ALBL 1JYWA 3O4OB 5HHPB 1DVFA 1UQSB 3OXRA 2R4RL 3GSNB 5B38B 5D1QB 1CT8B 4JLRB 5F3BB 3I50L 4XWOC 3VXTA 1MWAH 5AZEL 4AIXA 4B7LA 4DKFH 2DB8A 4XNMB 3V95A 3L3IB 5MI0B 1EGJH 4QRQA 4H1LA 4NZTH 5F8QC 2EO9A 5LGHL 4CW1B 2XACC 2FH6A 5C0DA 3M1BB 5FEBA 2MWCA 2EDBA 4DUWA 4OJFH 1OB1B 4OLVH 4RNRA 1EUTA 4YEEA 2EDTA 2EDYA 1UEYA 3MV9D 4HHAB 3MLZL 4KJWC 4YHKL 3V0VA 2DTML 4FMKA 3UYRH 2M8XA 3KR3H 3WNLA 5AUMB 1DQDL 2L7JA 1RZGA 1TPXB 2DYPB 2E3VA 5ADOH 3QXAB 4D0CB 2BVPB 4XNZC 3K4ZA 2XRAL 3CFEA 2V2TA 4OUOA 4TUJA 1TZIA 1IGML 2LVCA 3ZKXC 3ULUD 4MVBD 2Z9TA 3LEVH 3FO1A 4M93C 5IB4B 1OP3H 4JFEB 2HKHH 5IBTL 5A16A 1I75A 5INDB 3H3PH 4LHJB 4NQVA 4JB9H 1PKOA 3OG4B 3LEXA 4WUUD 1RUKL 1JGEA 4LDOB 1KJ3H 5KSAC 3PGFH 3WFHA 3MV7E 4QOKE 2DI8A 3EDDA 1CXHA 3MJ7B 1EBPA 5E5MA 1A4JB 3ROLA 2E7BA 5D72L 4OUUB 5DJ8B 5ELIA 3DV6B 3DUSA 1WT5A 4U1SB 3WNOA 5CEZL 4TSAH 2H3NA 1EO8H 5C8JB 2HT4C 3F5WB 4HWEH 5FO8A 4ZS6D 4OIIL 5KS9B 3QIWC 4TVPE 3L95B 1UA6L 4YXHL 1J8KA 4PTTA 3L5JA 1Q94A 2CK2A 5I1EH 3T3ME 4JG1L 3UC0H 5EORL 4FQ1H 3O45A 1ZLVH 1KJ2L 2XA8H 1ED3A 1PEWA 3RIFK 2R1WB 3EJZD 5E94A 1CLYL 2CMRH 4KMQA 2X70B 2YUVA 4F7TA 4Z76A 1MNUL 2AI0H 3QEUA 1VGKA 3BT2H 1KJ2A 3NH7L 3PQYA 1DSFH 4HPOH 2OXHA 1TFHA 3BP4A 3CZJA 5F44A 5DXWA 4U1NA 3D3VB 3TV3H 3CSBA 1XR8A 5IW1B 4OCXL 4YC2C 4LVHB 2Q6WB 2PUQT 5CJQH 5L8JB 4JFZH 2DWDB 2FATH 2HTKD 5HGAB 2YA0A 1NLDH 3S3PA 4ZPTA 3HC0B 1QBBA 3VG9B 2VDPL 1W0WA 2GFBA 1FO0H 3OB0K 4X6CE 4OCSH 3JWDH 5GZND 1EO5A 1F4WL 4M6NL 4WUKH 1E0OB 3T4AA 5I8EA 5GS1A 2YS4A 3BGMB 4KJPD 4X6DF 5GSRA 4ELMF 3BI9X 3QUZA 4PJHB 4RIRA 5LQBL 1N7ML 2Q87A 3QI9A 1A4KB 3P0VH 2EIDA 4KK9D 3N06B 1HSBA 5JW4N 3TPUE 1PG7L 1OD9A 2VH5H 3TH4T 1QA9B 4OZFA 1NGZA 4PGEB 4K9EH 4Y1AE 2WUBH 1KIPB 4U49A 2JELH 4YDVB 2ED8A 3P73B 4QWWC 4M62L 4XT1C 2QHLA 1A02N 4XMPL 4RZCB 4JY6B 4XI5C 4GG6B 5I6XC 1X6LA 4Y19A 2CRMA 3DUUA 3GIVB 5FYKU 2AQ3A 3DGGB 1CLCA 4Z77B 1R6VA 5EU6A 2BXYA 3CNKA 3DX6B 4KROD 3O4LA 2V2WA 5CGYC 3GI9H 1KBGL 3C60D 5C0IA 5LJYH 2WY3A 3I50H 4ZO9A 1OGAA 1A6WH 5AZEH 4KJYB 5DJAB 3VFUA 1U3HD 3O6LL 4Y4KB 1MRDL 2I07B 4OAWB 4O4YL 2EIEA 1GZPA 5LGHH 1Y18A 4NQSA 3V4PL 4PJ9B 3VFOA 4GAFB 1QLRB 4EIGB 4M9PA 5IMKA 5D7IA 3MLZH 4YHKH 1FNHA 1XMWA 2EDKA 3H9SB 4L4JA 5EU5B 4DK6A 3QDJD 1DQDH 1IARB 1U6AL 4YHIA 3TO4C 1JPGB 2HYMA 3Q0HA 4OV6F 1A6UL 2BY3A 5EZJB 3WJJA 3U36A 4GAGL 4HUXB 4N0FB 5IB5B 2BNRB 4OQ1A 2XRAH 5DD6A 2KKQA 4U1JA 4PIRF 4RAUA 1GCFA 5EO9B 1U8MA 3LS5L 5IBTH 4YO0B 3E2HB 4L3EB 3UZQA 2VKWA 4PJDE 1C16B 3SQOH 3CXDL 1TJHL 2NX5D 1RUKH 4RAVA 4XVSL 3VGAC 1MCIA 5I1KL 1UJTA 5C0GA 3ZKMD 3QXTA 1KB5A 3T3PE 2ADJB 1FL6B 5IUSA 1BWWA 2PYFA 3OPZL 4ZSOE 5D72H 1YEHL 2C1PA 4OCNC 1K8IA 1A7RL 2E6PA 5TDPA 4G8FA 4PJ5B 4LLAA 3O6FC 5T3XE 3QZWG 2DM3A 4LSVL 4Z9KB 4OIIH 3N0PB 2EEAA 3VFTA 1UA6H 4YXHH 4XP6L 3D5OF 5CBEB 5DGQA 5KSVA 2OK0L 3NGBC 4JG1H 5EORH 2QSVA 5E8PA 3WEXB 4XMLL 5FIEA 2BSTA 3VGFA 1AP2A 1KJ2H 4TUKL 4YXLL 2D4DA 4F58H 4Q0XL 1CLYH 3QFJE 4S1RL 4YR6A 3VD9A 4APQA 1GHFL 3UBXB 5MENA 1MNUH 1KULA 1P4IH 3NH7H 1J0ZA 1D5ZA 5IP4A 3LN5A 3O3BB 1NDMB 4PREA 4PJCB 4G8GA 4IRJC 4NPYA 3VRIB 3KNBA 5F1NB 1ZT4A 1DQJA 3GSRB 4P2QA 3BDYL 4OCXH 3UX9B 2D7NA 3A6OA 3EYSL 2BVYA 2UZIL 3LQMA 5BO1L 4MA8H 4ELKA 2AEPL 2XTJE 4MA7L 4P23D 1MLCB 3W5MA 1B4JL 1NC2A 4XBGB 3WSQL 3C8HA 1J86A 5GPRA 1YEFL 3WIHH 2FGWL 3JV4A 5E8OA 3MYJA 4Z8FL 5BW7C 1ZAGA 4JKPL 1D6VL 2CO7B 1LP9A 5FGCE 3N1MC 2IPUG 2OMBA 2D0FA 4HLZH 4XNZB 1QVOB 3BW9A 4M6NH 3BD5A 3RWDA 2AJZB 1I1CA 3UTQA 1D6EA 3U4BL 3ZKXB 2ADIB 3LKNA 4J23A 1T20A 4M93B 1FAIL 1RZ8A 1OPGL 5IFAL 4MJ4A 1N7MH 4CVZA 4WEBL 4TUOB 4U6YB 1E6JL 5GS2H 3J7HA 2OTUA 5DK3A 2ZCHL 2C3HA 1UZ6E 3LKPB 2GSIA 3GSNL 3ARQA 1LK2B 1PG7H 3ZDYF 5KSAB 2YEZA 3WN5A 1NCBL 4P2RB 4UV7L 1J7VR 1DCLA 3GMOB 1CDHA 2BSED 2VL5A 2VQ1B 3ESUF 1CGYA 1NMCC 3GSNA 3DPBA 4M62H 5GGSA 1CT8A 4JLRA 3ZE1F 4AZ8A 5F3BA 2VZUA 1HHGB 1TNMA 4LKCA 5EUOE 1WBZA 3L3IA 4ODUA 5JOEA 3PG2A 1N59B 4PG2A 1E4KC 2UV3A 3D0VB 4X6FB 4PGJA 1KBGH 1N6QL 4KZEL 1W72L 3RVUD 1TQCC 4KKLC 1P6AB 4PGDB 3O6LH 1MRDH 2H2PC 3EYQD 4PV9A 1ZLSL 3K80A 4PLKD 3LEYL 1AR1D 1W72A 3V4PH 3CFJB 4BUHA 2BVPA 3CVHH 1FL5B 1YEEL 1TETL 2F19L 5T5FL 4K7FB 4L4TE 2QADD 5J3HD 3FONA 3Q6FA 5EDXA 3DRQA 3D39E 3MV7A 1YPZB 2VDKH 5C08E 1W2KT 4MS8D 1U6AH 4JFEA 5CP7B 3WHE0 4TVPL 4YC2B 1CXLA 5CJ8A 3CFDB 5CEZD 4AH2B 3FAWA 4NO3B 3MRQA 5HI5C 1A6PA 2QSQA 5E6ID 5K9OB 4NRYB 3ZE0F 1LNUA 1T7WA 3T65B 4ZMAT 4R7NB 1SBSL 2WWMC 5T3ZE 2LE9A 2E7LE 1A4JA 4X6EB 1KB5H 3B5GA 3VMOA 3QG6A 3DV6A 1CFTB 4OIBA 3CXDH 1TJHH 3PQYD 4XPHL 4FQ2L 5I1KH 4Y88A 2EXYD 2JIXB 3QNZB 3FQRA 1JGVH 3PGCB 4N90D 2Z4QB 3EYOB 3OXSA 3L95A 1FVEA 3BQUC 5D1XA 5B3JE 3DBXA 3OPZH 1VA9A 5CZKA 3ZYOA 3G6JF 1T1YB 1YEHH 3RIFF 1ND0A 2D7QA 3GMRB 5FUOL 2R9HD 1A7RH 2DQEL 3V2AR 35C8H 4H5SB 2F9BT 3NZ8B 5IBUG 2R1WA 2UZXB 5DZNA 4LSVH 1XAUA 3BAEH 5J06A 3SPVB 1UFUA 4I18C 3IF1A 2X70A 2YMXL 1JTPA 4XP6H 3TJHC 3GJEB 3L5XL 5BV7H 6CGTA 2G5BB 5EOCL 4ZAKC 3UZEA 1GC1L 3IVKB 4QGTA 4ISVA 3SOBH 3SGJA 1JF1B 4GXVL 4TUKH 5FYKD 4PJXF 1SJHB 2CDEB 2WWKT 4YXLH 5I6XB 4S1RH 5I0ZA 3VMPA 4PJ7F 2FIRT 1GHFH 3TIDB 5E70A 1QFOA 5AG8A 1HHKA 4OSUL 4PGBA 3MJ8A 3PE9A 2Q6WA 4P4RB 2DWDA 3D2UB 4JPKL 3U30C 2MPAL 2LAGB 1MUJA 2J8UF 3HC0A 2ZG3A 3WL9A 3QI9D 1FLTX 1OD7A 1INDL 2EDFA 4RGMC 3HNTL 4AQOA 2GKIA 2P42B 3MBEA 3ZYJA 3BDYH 3RL2A 1YNKL 5A43C 3HB3D 2YOCA 4XCYB 2UZIH 5BO1H 3LN4A 1FJ1B 1F97A 2AEPH 5C0FB 4MA7H 3NACL 1IAII 4JRWA 1B4JH 4IRSA 3A6CL 5EUKB 3HZVA 3WSQH 2GTZB 2GJZA 4QTIL 3TPUA 1YJDC 2IBBA 2FGWH 1U8LA 3S37H 1NBYA 4JKPH 1D6VH 3F7PC 3GSUB 4OF6A 1JNHB 4I2XE 4X5WB 4Y1AA 1TVHA 3TO4B 1MFEL 1XF5B 2X4NB 3O8XA 3CH1A 4X8JB 1Y0LB 4XC1L 5C09D 5TE7L 4OD1H 4C56E 4MNQB 5JA8B 1T2QL 1MIML 3AC0A 1OGTB 3U4BH 4JO3L 3RZCD 1OGAD 1N4XL 1QA9A 3QIUD 4HGWA 1PX4A 1A7PL 1OPGH 1IAMA 3JVGC 4UQ3B 3BN9C 1E4XI 2VISA 4NUGL 3IS1X 1HILB 1E6JH 4X9FA 4DN3L 2BDNH 5CD3A 2FJFA 2J88L 5DFVC 3RPIA 3VGAB 4F15C 4NBXB 3ILPA 3LZFL 4GMSL 3DGGA 2FJGB 1PKQE 4UV7H 3DX6A 5GS3A 3L5HA 5DZOA 5KZCD 5IM7A 1HOCB 4R26L 1S7QA 3OKMB 1TTUA 3VWJC 2A74B 2QR0A 5KN5A 5DJAA 4HS8L 1BEYL 3O6FB 3F12A 4LNRA 4LVEA 1IL1B 1NC4D 1OP5K 1BVZA 5DK0A 2VLJE 1IEAA 5DVNA 1GGBL 1J0HA 1X4ZA 5ILTH 3ZL4L 1BQLL 2DQHH 5ECJE 1N6QH 4KZEH 3IFLL 3NGBB 5C07E 5TE6L 1W72H 3TIEA 1D3CA 5ANME 1AFVL 1XGTB 4WFFE 2D9CA 3H9SA 4F7EB 4RGND 3WIIL 4P9MH 2C1OB 1ZLSH 3OKOB 3AVEA 3LEYH 1SBBA 2NY7H 3LKSA 3QQ4B 3HC4H 2XOTA 1YEEH 4PJDA 1TETH 3IDNB 5T5FH 5IB5A 2BNRA 1I3VA 1A9BB 4AJ0A 1A7NH 2P5WB 2RAMA 2FO1A 4E5XB 3R06A 5D6CA 4IRJB 3D9AL 1YECL 1YMHB 2DBLL 5DC0A 5T3XL 4L8BB 1S9VB 3ARDC 3JV5A 1MCDA 3FRPG 1A7QL 3FQTA 4TVPH 3VXSB 1J88A 2E7CA 3MLUH 4NSKA 1C16A 3F62A 1CTNA 4IOIB 4X6DE 1HH9A 3G9VA 4ELME 1NGYA 4U7MA 2EIBA 4OM0L 3F58L 3QJFB 3KXFD 1KXTB 2PXYB 5LXGL 1SBSH 3LAFA 1JGDA 1RIUL 3S96A 3H2WA 4BA8A 4HIIB 5HYEA 5MEND 2IQ9L 3IS0X 1AC0A 3C5ZA 3NZHL 3GBLA 1LEGA 5I66B 1QR1B 1RUPL 4FQ2H 3OAZH 4GAJL 5IK3A 4XCFL 3QFJA 1BVKB 3IT8D 1OAKL 3ZYZA 4YFDB 3JV0A 8FABB 5DQDL 3EFDH 4P2QD 5IV2B 5C0AD 5FUOH 4QYOB 5DD5L 4KUCF 1DDHA 2DQEH 1EHLL 2RB8A 1JE6A 5GRUL 1NCWL 3BZEA 3V6OC 2FCBA 3DNKA 4GKZA 2XI9A 3MRCA 4NBYB 1I7ZB 3L5XH 2LTQC 1I9EA 1G9ML 5A40E 1GC1H 3DVGA 1NMCB 2BFVL 4GXVH 4UDTA 1NDMA 4U0QB 3BZ4B 5E8EA 3TH3T 3MRLB 5FUCC 1HHIA 2PO6D 3SHSA 4PDCE 3O2WL 4WWID 1AIFB 2H1PL 4YHOL 3B5TA 4OLXL 4EXPX 3HPJA 3KYKL 4OSUH 3HMXL 5GGUB 4R4BA 5B4MC 4BFIA 4CRPA 1EBAA 3AAZB 2UUDK 4JPKH 3X17A 2MPAH 1TQCB 2F5BL 1QFWM 5DJYB 4XBGA 5EU4B 1GXEA 2XWJB 5AG9A 1MCKA 3HMXA 1F4HA 1ZWIA 3HNTH 5I1AB 3DIFB 3IDGA 3WV0A 1SEBA 2CK0L 1QSFE 4ZS7L 1YNKH 2XZAL 1G9NC 5IG7B 4GQPH 3U4AA 4OF5A 1QSEB 2G5RA 1UH4A 2W65A 4MDJB 4EUPB 3UMTA 4QTIH 3HE7C 5D1QD 2BZDA 1DE4B 2Y07L 1EHXA 4MD0A 4N0YL 3FFDB 4L29B 1HZHL 1PG7X 1NFDF 4XC1H 4TUOA 4HKJB 5TE7H 3RWCB 5KSUB 3DSNA 4ZFOB 2DQFA 3LKPA 1KCSL 1MIMH 1X4XA 5EUOA 4NKDB 3GGWB 3VH8B 1F11B 4JO3H 1NL0H 3QEQB 5D93C 1N4XH 5EC1A 4XBEL 5GRVK 4KXZI 4P2RA 1YNLL 1Q0YH 5A2FA 2AW2A 4NUGH 2DYPD 5DJDA 2AJ3A 4G6FB 3V0WH 5IVXF 1RZIB 5IIEA 3JTSB 3EOYG 2J88H 5TQ0L 5LBSH 1NKOA 5C0BE 2XG5A 1FRGL 3LZFH 2H32B 4GMSH 1N59A 3U0PB 3BKJL 4DKAA 3QIWA 1FVDA 3BQUB 1J5OL 1KT2A 1BWMA 4JFED 5IMLA 4L4TA 5CEYA 4KTYA 3EKCA 3BUYA 4JQVC 4PGDA 3IFPB 3NFNB 1WCBB 2IWGA 2B5IC 4I18B 1GGBH 1BOGA 1UKTA 4MJIE 3ZL4H 1BQLH 4TVPD 3VFPA 3IFLH 5TE6H 2UVEA 4Q9QL 5GJSL 4ZAKB 4M4RA 4HK3N 5BRZB 1F02I 4ETQB 1JYVA 4NRZB 4ODTL 3WIIH 4OD3H 4M1CD 1X5IA 2Z35B 2R1XA 3RNKB 2WLZA 5JDSB 2E7LA 4L1DA 2EDNA 3MLRL 5HDBE 4HDIA 4K3HA 3CFDA 3U30B 3GMLB 1V5JA 4RMTA 3G5YA 3LQZB 4NRYA 3D9AH 1YECH 2XYCA 1AD9B 4RGMB 3M07A 1V3KA 3BD4A 3CXHJ 5T3XH 1R3LB 2VAAB 4XGZB 1A7QH 2FEEI 3KPQB 5HPMA 1C12A 3MUJA 4KH2A 2Z31A 2VLKB 3PJSB 4FQJL 2BOCA 4HH8A 3F58H 4OM0H 3OSKA 1F2XK 5FK9A 3LVEA 3PGCA 4ZTPL 5IHUL 3FO9B 2DWEB 3VXME 3SKOB 5LXGH 1N26A 3D3VD 4M3KB 3ROOB 1I7TA 4NQTA 5FA4B 4NC2B 4I77L 1CE1L 2IQ9H 3GMRA 3ORJA 1MJJB 3ZDYE 3NZHH 4L8CB 3V5DB 2ZNWA 2EH7L 3EDJA 1QRNB 1RUPH 4G6KL 4XCNB 2VDOH 4H1LG 4GAJH 4XCFH 3O0RL 1QRKA 2HJKA 4WHYH 1XF4A 3AB0C 1OAKH 1I8KB 5DRNA 2VR9A 2QBWA 2VSDA 3ZE1E 5DVMA 1PY9A 2AEQL 5DQDH 3RDTA 2G5BA 1IM3A 5DD5H 4LEOB 1JF1A 2APWA 1HHJB 1EHLH 1KEML 5GRUH 2PW1B 4JDZA 1NCWH 5FCUL 4IS6B 3ARZA 4F15B 3TIDA 1FBIL 4HUUA 5C9JA 3HI1B 3M17B 3U7YL 1G9MH 3B6SB 4KI5F 1T66C 1A6AB 5CWSA 2J1KA 3O8XD 3VWJB 1AKJA 4N5EC 3SY0B 5F6IC 4C55A 1MQ8A 5GXBB 4YHOH 3G04A 2FSEB 3HMXH 5SX4H 1CDCA 1RK0A 2V17H 4NYLA 1IZJA 4XCYA 2O61B 4N1CA 5JTWA 1KCVL 2WV3A 3BP7A 4JHZA 1UKSA 4C56A 2R2CA 1B6UA 3DYMA 4MAUL 2F5BH 3HUJB 5EUKA 2X6MA 1WBYB 2FWOA 1CFQB 4S1QH 2MJWA 1I3UA 4BQCA 4PRPB 4ZS7H 3VCLB 4QHLB 4HUKB 4N8VA 3P3YA 1JWUB 2XZAH 5I30L 4X4ZA 2BCKA 1V3MA 1HXYB 4FXGB 4MNQA 1KFAL 4Z7NF 3PWJA 1S7RB 4WNQA 2LAAA 5I2IB 1HQRB 5I9QB 4KY1L 3BO8B 1ODAA 2OBGA 1PKQA 2GY5A 4Y4KD 3ARDB 3L7EB 1W0VB 1CDJA 1HZHH 1MLBB 5AD0A 1K6QL 4NQXA 4YHZL 3H9HB 2ZUTA 3ECBA 1KCSH 2WIMA 4PJ9D 3TESA 4NFDA 3L9RA 4Z0BL 3G6JE 4M8QA 4XBEH 2VLJA 3H9SD 4AMKL 4DZ8A 5I76B 3PWLB 2ZOLB 1YNLH 3HFML 4N68A 1PQZB 4M6ML 1MCJA 2P8MA 2Y9RT 4NIKB 2Z92B 2FZ3A 5C07A 1HYSC 4PJ7B 3DSFL 1KTKE 1KNOB 1XCQB 5ANMA 3LRSB 4M03A 5IBLD 2WP3T 1MEXL 3ILQD 2BNRD 3O6FA 1FRGH 1IL1A 3S35H 3BKJH 4GKSA 3VRJB 4UDUB 1JWMB 2FBOJ 4PJXE 2MTPA 1CFNA 3C5SB 1S9XA 3O6KL 1FFRA 3BZFB 3L3GB 4ODHL 1AGCA 2NW3B 4MZ2A 5DHVA 3QQ4A 4WO4C 3EYVB 5DJCB 1NGQL 4F33B 4LLMA 2J8UE 5HXMA 1UADC 1AGDA 4Q9QH 4MXQD 1EX0A 1QEWB 4X6DA 3FT2B 4ELMA 1U8KB 1JTTA 2JCCF 5J57B 1I8LC 2P5WA 3AREA 3VXQA 2OSLB 3BXNB 3BEVA 3AU1B 2VABB 3LPFA 3LV3B 4PJ5D 1T1ZA 2Q8AL 1UZ8B 3L3HB 3FFCB 1RY7B 1VFAA 4MD5B 3HG1E 4R9HA 3MLRH 4WI4A 1VADA 2MQ3A 1CDBA 1INEL 1CIUA 4ZFFB 1KC5L 5I1JL 2K1MA 4ZNCD 3JTCA 4A6YB 4JFHE 4OZFG 4UNVA 2GITB 4X83A 3O41A 3T2QA 5A3IC 4JDTL 1M7DA 5JIKA 4YHYC 4R2GC 4CMHC 1YA5A 3MYZA 4S0SD 2W9EL 4Y5XA 3QEHA 5AYUL 3E3QC 4G3YL 1I1AC 4FQJH 1MCEA 5EH1A 4P5TA 3TNMB 2HLFC 2XTJD 4JGMA 1SJVA 1T1XA 4ZTPH 3SJVB 2FBJL 4KI5C 3RWJB 5BZDB 4XWOD 3MRRB 1EEZB 1EV2E 1R3HB 4I77H 4OGYL 1CE1H 5FA3A 5SWQA 5CJOL 5GQBA 4QRUA 4MCZB 3TNNA 5D93B 4KJWD 2CO6B 1F5WA 1ZHKB 3F6IA 4P9HC 2AEQH 4UAOC 2W9LA 3VFNA 2IBZY 1MFDL 1NMBL 3SE4C 1BQUA 1KEMH 1CLOH 4P2CG 5M94B 5I8CA 3C09C 4CJ1A 5HHNA 5FCUH 3QIBA 2VZ1A 3MXWL 1FBIH 1QSFA 1EFXB 2X9XA 2YD6A 3NA9L 3MGOB 1E4KA 4GW4A 3HI5L 2HN7B 3D0LA 3U7YH 3O3AA 4BQBA 5K59F 3LOWA 3OX8B 2J6EA 4ZXBA 3GZKA 1JPFB 1LDSA 4M1DL 1WTGT 3G9AB 3U1SL 2B5IB 1PX3A 4MJ6B 4GAYA 5KSAD 1A6ZB 2AJSL 5DEFA 1M4KA 4P2RD 3VE0B 4L1HA 3V6FB 1UJ3C 1IKFL 3RQ3A 3S5LA 4MAUH 3DO3A 2OQJB 4GKOA 4MDJA 3U46B 4GBXC 4G59A 3RAJH 1DE4A 1U58B 4ZFOL 4XH2B 1BVLB 2Y23A 2CIKB 2HT4D 4JREC 1AHWA 4X7FC 5ETUB 5T1KB 1RPQA 2HP4A 3OB8A 5DHYA 1J0JA 1IGYB 2P7TB 2EE6A 5I30H 4PJFB 3QIWD 1CICA 2FB4L 5KSUA 5INCB 1KFAH 2GJ6E 3ABZA 1AQKH 2A2QT 5GRYA 4AQ1B 1G0YR 2OS7A 3GGWA 5C0BA 3WXVL 3MNWA 1F11A 2R0LL 1B6DA 2ICWI 4AT6A 1OP3K 5GGRB 1K6QH 1OLZA 4HIJB 3SDCA 5GGVY 1SYSA 4YHZH 3U4EA 4DOHE 5CLWA 2CRZA 3MNZA 4Z0BH 1IKNA 4IHOB 4YUEL 1QSZA 3N85L 2ZOKB 2J5LC 4AMKH 3U0PA 4MJIA 3HFMH 5KOMC 5IB2A 4P3CL 2G2RA 2P8LB 3ET9F 3FO0L 4WFHE 5F7KC 4KQ4L 1BJ8A 1MEXH 4JY4B 1F6AB 3WMSA 2VE6B 3IETA 3Q1SH 3AB0B 2CKBB 4WCYL 3TJHA 4BZYA 4UTAL 1QBML 1O5DT 4DTGL 1G9EA 5DHVH 4YQXL 3T04D 1ZLVK 1R5WB 2ADFL 3D69A 1ONQB 4ETQA 2DKMA 2EYRB 4NRZA 4ODHH 3V4VL 4QXTA 4IDLA 3RJDA 3RNKA 1S5HB 3QCTL 1DTUA 2JIXD 5TQ2L 4F7CA 1NGQH 2X4RB 3EO1A 1J1XH 4JFFB 4K8RH 2FX7L 3H42L 2CJUH 1FCGA 2XKSA 3QYCA 4XX1G 3PWUB 4JHAL 1AD9A 5F6IB 2PTUA 1GOGA 1R3LA 1U8NB 3RU8L 3OAUL 3VFSB 1KV3A 1OSPL 1YJDL 2YUWA 3VWKC 3UROR 1I4FB 3K2UL 1INEH 1RVFL 2VLKA 5K9KB 1KC5H 5C86A 3BKCL 4YDKH 1Z2KA 3FL7A 3TZVC 3FQXB 5E7FA 2PF6A 4LF3A 4FTVE 2B4CC 1H8SA 4QWWD 5J0BA 3H9YA 4X7SL 3EDEA 1K4DB 1MAKA 3FO9A 2DWEA 3SKOA 4XI5D 1NFDE 4KKBC 5CLTA 3TBSB 2Q20A 4JDTH 1RHHA 3ROOA 3RI5K 5B38G 4UUJA 1YZZA 4OD2A 4LGPB 5HGGS 2W9EH 5AYUH 3V5DA 4G3YH 2UY7A 1QRNA 1IGJB 3KYOB 4XCNA 1S7XB 5CGYD 4HS6B 3D2UD 3WE6B 4NGHH 3DRTA 4K7PY 4PJBF 2ESVE 5FDYA 2AK4E 5DJ2B 3KPRB 5IVXE 3ZYIA 4OGYH 4OFIA 2XN9E 3JVGA 2A73B 4LEOA 4JM2F 4JHWL 4Z95H 5CJOH 3LN9A 1UXWA 5DGRA 2HTLC 1JZ5A 4WIQA 1UVQB 1BFOA 2OMNA 5SX5H 3PDOB 4MX7B 3MZGB 3KPMB 3FQUB 3KLAA 1A6AA 4QRTB 3TO4D 4NNYA 3STZA 5I1GH 3ARWA 3NCEB 4B5EA 2QQLL 4MNQD 1HSAB 5GZOC 2J6EH 1QBAA 3G5XB 4OI9A 1NUGA 5F88B 4Y5YC 4FFWC 3T2NL 4WI2A 1FV1A 1XGYL 3UTTB 4ESKA 2O61A 3OQ3B 1U8HB 4J1UB 4MDIB 1N0XL 3U7AA 1OARL 4CN4A 1RZFL 1J0YA 5FKPA 1CFQA 4M1DH 4Z7VB 1ZS8A 4PBWD 3U1SH 4PRPA 1MVUB 3CC5A 3UTSB 4WO4B 4FNLH 4JDVA 4CNIB 4AL8L 2OCFD 1HXYA 4W6XB 5E2VL 1P4LB 5C07D 3IKCA 4HV8B 3UPRA 4D9LL 1K4CA 3ZDZF 4NKOB 2VDNL 3BO8A 3G6JA 4LL9A 4JPIA 2YC1B 5IEHB 3GB7B 4NC1E 4N0UE 3O6FD 4Z7WF 5EOQH 3L7EA 1MLBA 5HTSA 1N5AB 5TDOA 5ACLA 2QJDA 1OCWL 3O3EB 5ENWB 3GNMH 1T3FB 3TEUA 1A64A 4O2CA 3NA4A 1IMHC 3WXVH 3H3KA 2R0LH 3D18A 1I85C 5F6HJ 3BKYL 4YHNA 5H8DA 3WCYA 4RISH 4PJXA 4UT9H 5CFHA 5IB1A 4YHYB 4R2GB 4CMHB 4PJ7A 4LPWA 4RCAA 1EERB 4H8WC 1I1AB 5L9DL 1RUAL 2E6JA 1LEKA 4YUEH 5CKAA 3N85H 3I9GL 2P5WD 1XF3B 1F2QA 4IRJD 1G7MA 1QACA 2GCYB 4UDUA 2WWKO 2J8UA 1NCNA 1JNNL 4P3CH 3CVIL 5F1KC 1UYWL 2MMXA 3FO0H 4M3JA 3CMGA 1DN0B 1OAQH 3MV01 4WTZA 3V8CA 5KVMC 2X2YA 3R0MA 3L3GA 1L9NA 5FCSH 3FN0L 2QQKL 3U0WH 3QUML 1UM4L 4G6AC 3HRZB 4WCYH 1IAIL 1JI1A 3EYVA 3U7WL 4UTAH 3HG1A 2YPLE 3QXDB 4DTGH 3GI8L 2DRUA 3EO0A 3HLAA 4UAOB 3BRFA 1QEWA 4YQXH 2ADFH 3QUMA 3TT3L 3IAGC 3V4VH 3C09B 3AU1A 2VABA 2F8VA 3LV3A 4D2NA 5TGBA 4P5TD 3QCTH 2WBWB 3QNYB 5E9DB 5TQ2H 4CGTA 5DTFB 2APVA 3CPLB 1DQML 3H42H 2PKDA 1N3NB 2YSSA 2Q86B 4FFEX 1A7BA 1HQ4B 1EEYA 4YJZL 1E4XL 5LCVL 4X5XB 3OAUH 4Z7NE 1OSPH 2CRIA 2HFFB 3A67L 2BERA 3MROB 5EZLA 2APBA 5DWUL 5AAMA 3K2UH 1RVFH 2PTVA 5DMGC 1UJ3B 3BKCH 3PDDA 5L8LB 1R24A 1MCSA 1QBLL 5FOBA 5ICYB 3HE7A 4GBXB 1QUNA 2B7DT 1V7NL 1PAMA 2ARWA 1LO2L 1J05B 5F72S 4JREB 3VFWB 2DL9A 4HZLB 3MO1B 5TH2B 1IAKA 4N0CA 1GYAA 1AQDB 3WDIA 3P4NB 4RA0C 1KIRA 4EZMA 3QHZH 1MHCB 5I8OL 3OJMB 4KUZL 2LABA 2B39A 2FX8L 4DN4L 1TQBC 4KKLD 4OF7A 2FYYA 3VFMB 1ZHKA 3UDWC 1CG9B 2H2PD 2DF3A 1KTDB 3KPSE 4NHUB 4JHWH 4PGCB 4WI6A 3LDBC 2H9GB 3VDCA 2ZWLT 4IRZL 4ODSH 3WO4C 1QSED 1ZHBB 3IDJA 2VSCA 3GSXB 5BQ7B 4BFBD 4POYA 4KGLA 3PP4L 2J5LB 5T5NF 5L2JB 1DJSA 4LARL 2JCCB 2HAZA 1PEZA 2IFFL 3OX8A 4GRWF 2EDLA 2PR4H 2VDQH 1PJ9A 3V7AE 1B88A 4MLIA 1YN7A 1PZ5B 3LKQB 1JPFA 3C2SA 3SE8L 3MUY1 1GGIL 1WSST 5HI5D 3T2NH 4EN3C 1XGYH 3QEQD 1HNGA 5I17A 1A6ZA 5DUBA 3QDMA 3VE0A 4EQ2A 3KJ6L 2WWMD 3QCUH 1RJYB 3S98A 3V6FA 5MEQB 4JFDE 1MCWW 2IAMC 3C8KB 3RTQA 1N0XH 5DR5L 1OARH 3DX9B 2OQJA 5HHXL 5H35B 3U46A 4G6FD 1UEMA 1J0KA 4JANA 4GKNA 4XH2A 1BVLA 3BGFC 3FB5A 3ULSA 2CIKA 3IGAB 1A9EB 5JNYA 1QO3B 1JNJA 2P7TA 4AL8H 4O58L 4O2EB 5E2VH 3EYFB 5DSCB 4UOW0 4QKXB 3HC3L 4D9LH 3DURB 2VDNH 3H9ZA 1UGNA 1LK3L 4V3EB 1CGTA 5HDOA 1Z9LA 3MNVB 3P9MA 2FECI 3VWKB 1PG7W 1OCWH 3OR6A 3TJHD 1YUHA 1S9KC 2XNAB 4G7VH 4N9GB 3TZVB 3UBXG 4ZAKD 1F6FB 3MUZ1 1QHPA 1Z5LB 3I2CL 1G1YA 1ITCA 5L7XL 4RDQF 2XFXB 2CUIA 1OF2B 4QCIA 2DM2A 4ZUTA 3BKYH 3T1FB 4NFCA 1BP3B 1JGLL 3O3UN 3ZKQD 1I7UB 5DMKB 1YYLL 2IQAB 5L9DH 1RUAH 4LPYA 3E6FB 3RGVC 1CU4L 1I8IB 2XPGB 3KLHC 4J6RL 3I9GH 1T1WB 4Y2DC 5DS8B 5FFLA 3P4MA 4XVJH 1JNNH 3WKML 4U1KA 3K0WA 5D6DA 1UYWH 5D9SB 3QH3A 2HRPH 5DQ9B 1F3JA 2MOVA 3BH9A 5FYJU 5LG1A 2VLKD 1NCUA 2OM5A 4OFYD 5GJTL 3FN0H 3MRKA 4NQCE 4OGZA 2E6QA 3QUMH 5K59E 1P7KB 1V8HA 1IAIH 5DJ0A 2F54E 2V7HB 2X4RA 2ADGA 3GI8H 4ONOA 3SKJL 2D31A 5F9OL 1A2YB 3OJVC 1XCTB 4FTVA 3TT3H 4MQXC 3V4UL 1HKLL 4W81A 3VGEA 4B53A 1BD2B 5JOFA 1QRND 2J12B 5ICZB 1NFDA 1U8NA 1J11A 4Z7UB 1NEZB 1H3GA 1FFOB 4E42B 1A1OB 1P6FA 3MUHL 5EBWA 2MHAB 1DQMH 3IKKA 4PPTA 5K9KA 1MI5B 3JZ7A 5C2UB 1U91B 2IGFL 5I0DA 1C7SA 4RX4D 1AO7E 3BN9D 2IH3B 2ESVA 5EU7E 5FYLD 4X80L 4Y4HC 1EMTH 1E4XH 1OW0A 2AK4A 4LASL 4YK4B 5LCVH 3E8UL 1DQQB 1ZVYA 2ZUUA 5DFVD 3A67H 3GO1L 2ICWB 5DWUH 2XN9A 1OM3L 3NIFF 2ZG1A 4U1MB 3WNKA 1LO5A 3MCG1 3EOBB 3B83A 3GM0A 2IEPA 1QBLH 4HS6A 1RUQL 3DMMC 1V7NH 3TT1L 4LCCA 2XTLA 3VWJD 3WJLA 5DJ2A 1EVTC 3SEPA 2YK1L 2ZSWB 1M6OB 4TN9A 1OSZB 1OT1A 2OL3L 3PWPE 3QFDB 1X6NA 2DLFL 5DZLA 5I8OH 5SV3A 3I6KB 4YAQB 3EDKA 1G7IA 4QRSB 2CR6A 4KUZH 4BYHA 3VGGA 2Y36L 3QJHB 1RMFL 4UTBL 5C0CB 3HZKA 3FO2B 1QHOA 3QDGB 2OL3A 4PRPD 1OLLA 4XTRC 1NUNB 5I1DA 1RK1B 4F37K 2IANE 4MHHG 4IRZH 1ZLWH 3PHQA 3GRWL 5FGSA 1FNSL 1JFMA 4HKBB 5GHWL 3H6JA 2PTTB 4HKZA 1KCUH 1CN4A 4NWUL 1U8HA 1ZOXA 2IFFH 3ARDD 2DN7A 5IMMA 3BWAB 3GRWA 3O2DL 1EZVY 1AE6L 1FN4A 3TBVB 2EC9T 2FEEL 4O02H 4I0CC 3SE8H 2DQTL 1GGIH 4M00A 1VSCA 4N0UA 4XXCC 1YN6A 5DQJA 2BNQE 3BYTA 5C0EB 4QRPB 4WO4A 4CNIA 1QKZL 1HHHA 3KJ6H 4Q2ZA 3I84A 4OFKA 1U3JA 3ZO0A 1PYWB 5DR5H 5HHXH 3TF7C 1UWXH 3QO0B 2JK5A 4HV8A 1I8LA 1UB5A 1SY6L 4NKOA 2XA3A 3M8OL 5H2BA 1N2RB 5EFIA 4OI8A 1MJ8L 4O58H 3O3EA 2F15A 1SY6A 5ENWA 3ZLQC 3VXRB 3HI6H 3IFOB 4R3SA 5D7LB 3HC3H 5EO0A 4U6HB 1R5VA 3MA7A 5K33A 3B2VL 1X5GA 3PHOA 3K1DA 5FF6B 5HGHA 4WW2C 2FJHA 5DK2A 5KTEL 3EYUL 2D9QB 1P1ZB 3GMNB 3MTRA 1EUUA 4PJBE 4X7DC 4Q7DA 2UYLA 3E3QA 2VXQH 1I1AA 1U92B 4QY8A 4X7TA 4Y4FA 5IW6A 5L7XH 2A6IA 3R8QA 4X99B 4EOWL 1S7SB 2ZJSH 3ARPA 4WW1A 2GCYA 3SDAC 2YPLA 2QQNL 4QHNA 3RRQA 3N1FC 1JGLH 3MGTA 5EBMB 1DN0A 3FFCD 4MNHB 4P9HL 1YYLH 5B4MD 1JN6A 1VDGA 5BVPH 3VG0L 3Q5YA 5D7JA 1CU4H 3OAZK 3E1F1 5CZVL 3L7FA 1PFCA 2YWYA 2B1HH 4ZOAA 5ESQB 1SMOA 1TQBB 3HRZA 5BCAA 3TO2B 3QXDA 3UCRA 4QHMA 4K07A 1QPPA 2I9TB 1H5BC 4AG4L 3JWDC 3LDBB 1HDMA 3OF6A 3R1GH 4NQDB 1G84A 1KB9K 4GRLA 1I9IL 2V5MA 3HE7D 2DLEA 3VDAA 4HH9B 5IB3B 3RHWK 3SKJH 1NMAL 1KEGL 1KCGC 5F9OH 3NCBB 2EKSA 2HG5A 3G6DL 2BSSB 4RFEA 4PTUA 3V4UH 1AD0B 4Z7WB 1HKLH 4LAQL 1VFOA 4X5XA 1TJIH 2DIJA 4EN3B 3NABL 2IH1B 1S7VB 4K9EC 4M6OL 3ZDZE 2AKRB 1A1NB 1UJ3A 2IAMB 4KXZH 4GG8A 4NBZB 4Q9BA 5ICYA 1D5MA 4I9WE 1DVFC 2YUXA 1VFBB 4XRCB 3MA9L 2VLRE 1VFUA 4LASH 3BGFB 3E8UH 2IADA 5EU3A 2IMNA 1TLKA 4LPCA 4G9FE 3GO1H 4FXLA 4HZLA 4LCUB 1QFWI 2FR4B 1BOYA 1V05A 1OM3H 1EFXD 5C1MB 3DO7B 4NQEE 2PYEE 1S78C 4JFQB 5MHSE 4BELD 1OAXL 4WGVB 4ZNEE 1WWCA 3CSYB 4L5FL 4WUUB 4OZHF 3TP4A 2X4TB 1M71B 3VFMA 3TYGL 4XP1L 5IQ9A 3GSQA 1A6VL 3WFDL 1KTDA 2GSGA 3BPOC 3T0XA 4NHUA 4HCRL 2OL3H 3QDMD 2DLFH 2W0FB 3EJYC 3OKDA 4XPFL 1ZHBA 2Z93B 1DQLL 5HYQA 1RMFH 3MRJB 4UTBH 3CGTA 5KSBF 4HWZB 1BREA 4NNPL 3JXAA 3MRGB 4HCRA 1XF2B 2JCCA 5T1KD 1IEBB 5DRXB 4P48A 4YFLI 3GSWB 2YXMA 4M02A 1OP9A 1UC6A 4JRYE 4R96A 3GRWH 1FNSH 5EOCJ 3WXWL 2YN5A 3RGVB 5HGBA 4P59L 2EYSA 3RIAF 1OHQA 3SKNB 4Y2DB 3EYQC 3REWA 4YFLF 4NWUH 1AR1C 2AEWA 1CIDA 1SYVB 5HDQL 5HYJE 3DX9A 3ME0A 2MQ0A 1AE6H 3GKWL 1ACZA 1CLZL 3HE6C 2RIKA 2DQTH 4DVRH 3ARUA 5F9JB 1CD8A 1QO3A 1U8IB 1WT5C 3P9LA 2VLLA 5FECA 4L3CB 2JTDA 3HAEB 1SEQL 2OR7A 5DSCA 4MYWB 1IQDB 4XCEB 4EDXA 1SY6H 5D5MB 2XWBB 4XC3L 4F7MB 1FDLL 1EDQA 4O9HL 3MNVA 1MJ8H 2KUTA 3JWNC 1MAML 5E99L 4N9GA 1YDPA 1U36A 1I3RB 1Z5LA 3NPZB 3SDDA 2XFXA 1A1MB 1OF2A 4PRAB 4Y4HB 3MODH 5KTEH 3EYUH 5IKCB 1U93B 4HPYH 1BLNB 5DMKA 2X9WA 4OZGF 5H94A 2IQAA 4JFFD 2HT2C 3MRBA 1T66D 2Y06H 4LFHD 4LRNL 3X14A 4X4YB 5C0RH 3DMMB 1I8IA 2VO5A 2XPGA 4NQCA 5DF0A 1UCBL 3MFFB 4BKLB 1MWAB 2DJUA 1GZQA 4N5ED 4LHUB 2QQNH 4PRIB 4HIHA 5DMYA 3SE3A 4PR5B 2HVKB 3O11A 4MXVF 3VG0H 4YNYB 4PS4L 4AEEA 1FNEB 1T22B 5CZVH 1MQKL 1P7KA 3GHBL 2V7HA 5GS1C 4EUPG 1T21A 2VXSL 2D3VA 1DLHB 2R69L 1C5CL 4AG4H 3QUZC 1AO7A 1JK8A 2HLAB 3FRUA 1RJLB 2AXFB 1HI6B 4BFGA 2HWZL 1S5IL 3QI9C 1I9IH 1MCHA 2H45A 4G42B 1FFOA 1MF2L 1ZT7B 4Y5YA 4S2SA 3SDXF 3T77B 1PSKL 3EUUA 1KEGH 3VH8G 5EPMB 1Q8MA 5M95B 5I1IL 12E8L 3VI3F 2COQA 2XQBL 2N1KA 3EOAB 5HHOE 5JW5A 1WIOA 1TVBB 3INUL 1KCLA 2ICWA 3NABH 4EBQL 3OJDB 1NGPL 4U7KA 4NNXA 1OP5H 2AXGB 3PWPA 1CGVA 1HYSD 4ERSH 2Q76B 5MEPB 1CFBA 4ORGA 3RP1A 5JMRA 4XPGL 3CLFL 4HBQA 4N1EA 5DYOB 1FNGB 2YD5A 4HG4J 3BFOA 3EBAA 4LEXH 1MFNA 1XH3A 4ONHA 1OSZA 3UTTD 2IANA 2V9QA 3QFDA 3BVNB 4LAJH 4JRXE 4YAQA 1JZ6A 1TTGA 1JZ8A 1K2DA 4L5FH 1WBXA 3IDMB 5CEXB 1YC8A 1NDGB 4H8WL 5IROA 1BFTA 4ZUWB 4JE4B 5IVZA 3TYGH 4WW2B 1MAJA 4XP1H 1A6VH 3WFDH 3W11C 3UTSD 1T83A 5DLML 3VI4F 4LPTA 4LKXA 1YNTB 4HCRH 1T4KB 2P5EB 4WO4D 2JJVA 2X7LB 3DLQR 5FAAA 3UO1H 4CDHA 4QRRE 1M7IB 1RURL 4L8DB 2R23B 3RWHB 3GBML 3WJJC 1ETZA 2KQNA 1DQLH 4C4KT 2BNQA 3SJVE 1L6ZA 2F74B 2EKJA 5JHDE 3WKNA 4MMXC 1QLFA 2I27N 3SDAB 5FDWB 2CDFA 1NUDA 3WS6A 5E5UB 4D8PB 5E00B 5I16A 2JE8A 1IC1A 3WXWH 3U0TB 4P59H 4H20H 4LLVA 3MBXL 3DROB 3RUGF 4QHUA 4E41E 1NCDL 5GSVA 2WIIA 5A3ID 1C5DB 5HDQH 4WJ5B 1PD6A 3C2AL 1FO0B 4L4VB 2ZPKL 2JF1A 1WIPA 1CZ8L 4R2GD 1SVCP 3GKWH 1H5BB 4B41A 4I48B 4HMEA 4KWUA 2IPKB 4PBVC 1I1AD 1LWRA 3IJHB 5BS0E 2HLFD 5GS0C 1N2RA 4PJIB 4KI5D 1G6RL 3MRHB 4U6VH 2QEJA 4DCQB 4IBLT 1SEQH 1BZQK 1LILA 1RU9H 4JFXA 4OZIB 4J7RA 1CS6A 1E4WL 3N9GL 2VXVH 1IT9L 4MA1C 2Y5TB 1IM9A 3OKKB 3B8SA 4XC3H 1G6RA 5ACZB 1WVZA 3NIFE 4PYHA 4JM2A 5D7JD 1HH6B 1FDLH 1XEDA 4O9HH 3GMNA 2CH8A 5FGBA 2D03L 1MAMH 1FPTL 1QQDB 5IEKB 1HCVA 4OQTH 2UVFA 3P4OB 1UB6A 3F7YA 4APQC 5BV7C 5DRWA 5J8OA 4DK3A 1DVFB 2GTWA 3OXRB 2X5PA 4YIQA 1JZ7A 4GRLD 1QFUL 1I8MB 4HULB 3VXTB 5E9DD 4OFVA 1ZA6B 5D96C 4MNHA 1CF8L 2BP3A 4NN6C 2D7TL 4QRQB 5HI3C 2ZUWA 2HH0L 4LRNH 5HHQA 4M48H 5C0DB 3OG6B 4RNRB 1RJZB 3FB8A 4FN0A 3V0VB 2I9TA 1CQYA 4HT1L 3BPOB 5A2LH 2PETA 3NFPA 1X7QB 2QHRL 4MMZC 5GGQL 1MQKH 1F6LL 3BP5A 5KVEL 4GBXD 2W0KA 2YPVL 4HH9A 4X6CF 3CFEB 3MLVL 4TUJB 5I8KL 1TZIB 1CD9B 1T89A 3TYFA 2VXSH 2R69H 1C5CH 2Q8BL 1IFHH 3TFKC 4HLJA 3FO1B 4Z7WA 5A16B 2VLRA 5T33L 2HWZH 1S5IH 5DUPL 4DGYL 4NKMA 3BDXA 1PSKH 1JGEB 1JUFB 2EEBA 3LPGA 3VGBA 1F3RB 2AKRA 3WFHB 3WN5C 1NJ9A 5FGRA 4ZNEA 5I1IH 1FH5L 2ED7A 5TF0A 1VFBA 2XQBH 4M7JL 3HE6B 5E5MB 3ROLB 4F3FA 5DC9B 4J3XA 2EICA 3INUH 5F89A 3LMJL 4EBQH 4F7PB 5CSGA 1NGPH 2P24B 1WLHA 3H8NA 3IXTA 5FO8B 4JFQA 4QHKI 1TZGL 2NY4C 5KBNC 2CIIA 3B43A 4JFOA 1QPXA 1Q94B 1Q9OB 3TM6A 4Y8DC 1M71A 3CSPA 2Q1EA 3O45B 1H3PL 2RQ8A 1DBML 1QR4A 4WTZG 2KL6A 2VWEE 4JJ5B 5IF0B 5E94B 2GY7B 4JRYA 4F7TB 5L8KB 4Z76B 5FO9B 3QDAA 3QEUB 1KLUB 1VGKB 3MRJA 5D4QA 1KJ2B 4H8WH 3PQYB 1M05B 3WIFA 1XF2A 3MRGA 3BP4B 1ROWA 4YHLL 5J6GB 3VD5A 4QTHA 1IEBA 5IW3A 3EZJB 5HYJA 2J4WH 3IDYC 3BHBA 1YMMB 2R4SL 3SGDI 4G7YL 2F53B 3ULVE 4AEIL 3DVIA 3IDIB 1JV5A 5DMJB 4ZPTB 2OX5A 3KPRE 1M1SA 2EH8L 4BH8A 3MOBL 5F7FA 3VWKD 5C92A 3GJFA 3TZVD 1U8IA 3MBXH 3N1QC 2ZG2A 1D5XA 2C26A 1NCDH 5EZOL 5GS1B 4KKBD 1KPUA 4WI9A 3C2AH 2P8PB 3HAEA 1MPAL 4BH7B 1CZ8H 5D1XC 3QUZB 5L0QC 5B22A 4QXUL 4RIRB 4UT7L 5EZIH 1LMKA 3T3PF 5AYQA 3UJJL 1XIWC 3QI9B 4G5ZL 3HTLX 1G6RH 1CL7I 1HSBB 3ARGA 3FMGL 4BSVA 4R8WL 1FNFA 4OZHB 3ZTJG 1E4WH 3N9GH 5DEZA 1NGZB 3H7BA 3F8UB 3GFUA 1T0PB 3SGJC 5IJVA 2HTLD 3SGEI 2NXZC 2D03H 3LS4L 5DVOA 1FPTH 1MWAL 5EBGA 2YD1A 4Y19B 4JVPA 2WINA 4FP8L 5KSBB 2XZCL 1GC1C 4R0LA 5EU6B 4X4YA 4EI5C 1GRWA 5HD8C 2EE3A 3O4LB 2V2WB 3UYOD 1WEJL 1MWAA 1QTYT 3ALWA 3U9UB 1BD2D 2A83B 5C0IB 5I1LB 2VLMD 1QFUH 5GZOD 3NCMA 1OGAB 3RJQB 3VFUB 1CF8H 2ARJB 4NFBA 4FFWD 4U31A 5JZ7C 2EIZB 3FOMB 5SWSB 2D7TH 3MBEC 2HVKA 5D2NE 2HH0H 1WIUA 3NFSL 1MI5D 5CJ5A 1Y18B 3AS0A 2ATPA 2Z91A 4NQSB 5DURD 5K9QI 2BVQA 4TTGA 2DLGA 3VDBA 5IMKB 4NCC1 2DICA 2E27L 3EFFA 4IRSC 5D7IB 3TJEL 4Z6AT 3I6GA 9CGTA 4LOUC 4YGAB 4OLEA 1LEIA 4PJ8A 3CVHB 1R0AL 4GXUM 4YHIB 2HLAA 2HKHL 2QHRH 4QO1A 3H0TB 1WV7T 3O8XC 4JB9L 3U36B 1HI6A 2VDRL 3CUPB 3T0EE 4G42A 5SX5K 5DD6B 3T77A 4Y16A 3MLVH 5I8KH 2R1YA 2AAVA 1KJ3L 1IQWH 1KTLA 4RAUB 1T7VA 2Q8BH 3QBTB 1U8MB 2X1PA 1XT5A 4PRNB 1NFIA 2WAHA 4R4FH 1D5BB 4JJHA 5JPMA 2FECL 5T33H 3VD3A 4DKDC 5DUPH 2EC9U 1XZ0A 4XXCA 3FN3A 4DGYH 1T5XB 2VZSA 4RAVB 4U0RC 3OJDA 4NM8L 3PWVA 4JHBA 2APFA 5C0GB 1KB5B 3TF7A 3U6RA 1P2CA 1KXVC 4XBPB 4LP4A 4OV5A 1JPTL 2PYFB 3ESVF 4DFHA 3WUWA 1F3DH 5DYOA 1H3UA 3LMJH 2C1PB 4K71C 1K8IB 2MCG1 5TDPB 1Y6KR 2WW8A 4G8FB 3MCKB 4V2CB 4MCYA 5DDHA 1H15A 2BSRA 1G7JA 4GUPA 1DUYA 3TN0A 4JO1H 4KRLB 2AI0L 3IDMA 4MA1B 1GGYA 3BT2L 3UJIH 3MRPA 4KKNA 5E8PB 5ID0A 2H26A 1TCRA 4AK1A 1H3PH 2BSTB 3W9EA 1DBMH 4I3GA 2AJYL 2D0GA 2Y7QA 4OZGE 2Y6SC 4Z5RB 5ESVB 5I1CH 4G6AD 4YR6B 4QRPD 1T4KA 3TV3L 2W07A 5BV7B 1QSVA 4APQB 3DXAE 4L8DA 5MENB 2R23A 3RWHA 5JPNA 1BZ7B 3BD3A 4M4PA 5CJQL 1D5ZB 4NHCL 3BPLC 5B3NA 2F74A 4LFHG 4E41A 5HGDA 4PREB 4G8GB 4NPYB 3KNBB 5FDWA 5D96B 4NN6B 1ZT4B 1DLFH 1BM3L 4P2QB 5E00A 4CN6A 3VXRD 5EG6C 4PRHB 2DQIL 4G7YH 5D7LD 1H8OA 2ZNXA 1KIQA 1MHPL 3JWDL 1MHEA 2MKWA 4ELKB 2C3VB 4AEIH 4NKQB 3GJFH 1WC7B 4Z7QF 1NC2B 3STLA 1FYTE 3B3IA 2EH8H 3MJ9A 3A0OA 3MOBH 1KPVA 3JV4B 5E8OB 3DGCR 1LP9B 4I48A 1QNZL 2BHUA 1HXMA 1NANI 4XNQB 3SDXE 3L5IA 5SWZB 3VXUB 3IJHA 3C5ZC 3BW9B 3MGAA 4PJIA 1AI1H 3PWNA 4ZQKA 3VI3E 1J8HE 1MPAH 4LIQE 1D6EB 5E5RB 2X05A 3UTQB 4LLYA 3LKNB 1OTSC 1T20B 1B0RA 2Y5TA 2X09A 1RZ8B 5ACZA 4UT7H 4CVZB 3UJJH 1HH6A 4JFYB 4G5ZH 2OTUB 7CGTA 1TENA 4TRPL 3FMGH 2GSIB 4J2XA 5IEKA 3RNQA 4JZJA 4WRLA 4O2FA 1QFPA 2YEZB 1G1CA 3K2MC 1X5JA 3U48A 3WN5B 1ERNA 4HK3J 4HKXA 4X4ME 3AS3A 4PJGF 3BDBA 4X9HA 1FVCA 2VL5B 2C3XA 5E8NA 3GI9L 2XTJC 4NQDD 3OWEA 5GGSB 1JHTA 4D9QE 3QWRA 1I8MA 3LS4H 4GRWH 1A6WL 2BNUA 2KBGA 3ZT7A 1ZA6A 4LKCB 3Q5OA 1WBZB 1S7UA 4ODUB 4FP8H 1G9MC 4WEMB 2NY4B 2XZCH 1DBJH 1WEJH 3VI4E 2ZZUT 1RJZA 5J6HA 1KYOJ 4U6TA 1SM3H 4E0RB 3MV8E 4EN3D 1O7SA 4MLSA 4PV9B 4EKXA 1PW3A 1BBJA 1X7QA 3NFSH 2FHFA 1W72B 2IAMD 4DVBA 3VGDA 1EJOL 2C3WA 5GRWA 2BVEA 1NCTA 3TJEH 2E27H 4WHTA 3FONB 3Q6FB 3DRQB 3K8LA 1ADQL 3MV7B 4QOKB 5JOPE 5DVLA 3IDYB 1R0AH 4FFVC 3RUGE 1I7RB 4PP2A 3DX7A 4BSJA 2GEEA 2VDRH 4D9RE 1RIHH 1GPOL 2IF7A 2NLJA 1ADQA 3SQOL 5L2KE 2X4SA 1X5YA 1CBVL 3MRQB 1JUFA 5LWYL 4Q9CA 1QZ1A 1LNUB 4ALAL 3DVFA 4ZPVA 1PDKA 3WS3A 2UWEF 3HE6A 4MNGE 2EDJA 5D1ZA 4GH7B 3QG6B 4JKLA 3X13A 43C9A 5J56B 4F7PA 1JL8A 5D70L 3RWFB 2P24A 4NM8H 4BM7A 4HAGA 2NNAA 3FQRB 3CU1A 3OXSB 5E2WH 1MRCL 1FVEB 5D1XB 4NO5B 2AERT 1MFAH 3DBXB 3P11L 1JPTH 1Q9OA 5M7QA 2W59A 1ND0B 3DVNB 2NYYC 4L9DA 3RGVD 1XIWB 2WLYA 3C6LA 3KLHD 3TPKA 1KLFA 4JJ5A 5IF0A 4Y2DD 3UTPD 4F58L 2N56A 3CX2A 5F1OB 3IF1B 5GRJL 4LVOC 3RY6A 3GHEH 3D25A 4G6ML 5FO9A 2X1QA 1KLUA 1T0MB 4K2UL 1P4IL 3VXOA 4OKVA 1U42A 4JFPB 1M05A 4ISVB 2AJYH 5J6GA 2NXZB 4CVWA 3HS0A 1WFNA 2L0DA 5TFSL 2D7OA 2VIRA 3V6ZA 2E7LC 1YMMA 1HHKB 5IT2L 3QWOA 4PGBB 3MJ8B 3LQAC 4JR9H 4X6CB 4EI5B 2NTFA 2F53A 2UY6A 4MQXD 4NHCH 4MA8L 3IDIA 1OOAA 2EDXA 1MUJB 4CKVX 3WL9B 3R8BB 2EYTA 3WIHL 1KELL 1BM3H 1W0YT 3MBEB 3CK0L 3MJ9H 3RL2B 2DQIH 1KGCD 2MFNA 1IGIL 4I0PA 1MHPH 2Z31C 5D8JH 3LN4B 3FCTB 3WIHA 4Y4HD 4FXKA 5C6PB 2DM7A 3NCFB 4IRSB 5DVKA 3W0WE 3HZVB 3QDGE 2GJZB 3TPUB 4RMWA 2P8PA 1U8LB 5CUSH 4AM0A 4BH7A 1NBYB 3S4SA 2DMKA 2HJFB 3QULA 1QNZH 4Y1AB 4OCLC 1QD0A 1QFWL 1TVHB 4MD4A 2K9UA 2BY1A 1INQA 3O8XB 3CH1B 2YA1A 3MQIA 2H2SC 3DMMD 4HJJL 3MACL 4M6AA 4LSDA 1T04A 2VOTA 4LHUD 4PRID 4OZHA 3JBG7 3KYMA 4GO6B 3ZHLA 3ARFA 5IHZA 3NN8A 1JCKA 1PY4A 4HGWB 3RDTC 3IAQA 4V1DE 3NVQA 5TJWK 3I6LD 2VISB 5MP6L 1FFPA 3V7AG 4ZOBA 4UIMA 4TRPH 4U1HA 5CD3B 2FJFB 4U0RB 3RPIB 5ISZE 3ILPB 5KSBA 5D2NA 1IE5A 2N7BA 2ZSVA 3DOSA 3QRGH 4XTRD 4RAHA 3S6CA 1OAYL 5IM7B 5T1MA 1O7VA 3U9UA 1A6TB 2A83A 5I1LA 2NMSA 1S7QB 2X1XR 3PGDA 4K71B 1GH7A 4PJAF 2QR0B 5KN5B 2ARJA 2FX9H 2EIZA 3F12B 3FOMA 4LNRB 5SWSA 3FHAA 5DK0B 4CMMA 1IEAB 3UTZA 3MRFA 4BQ8A 25C8L 5DJZA 2GK0A 3CVHL 5KAQG 4ZUSA 3T0EA 4HUVB 1NCCH 3TIEB 3KYNB 2IG2L 3BIKA 4LSPL 3SGKA 5CSZB 3PNWA 4PJEF 2VDKL 3CVHA 1JZ2A 3TBYA 3LKSB 1IBGH 3H0TA 2DKSA 2ICCA 1EJOH 1KLGA 4PJDB 2HT3C 3CUPA 1OT2A 4J4PA 3BPLB 3VFVB 5DI8B 5EULV 1ADQH 3R06B 2YBRA 5D6CB 3BEWB 4PV8A 4PRNA 1RSFA 1MELA 1ZLWK 1D5BA 4POUB 2Q7NA 3FQTB 5I15H 1KB5L 4DKEH 1AGFA 4NSKB 1XGUB 1TTFA 4NDMA 4LCWE 1GPOH 4HX1A 1RZJH 1T5XA 3DTXA 1SVZA 1CD1B 1HH9B 3MLPA 1CBVH 1NGYB 5LWYH 3LIZL 3FT4A 5GS0L 4ALAH 1JGVL 5BMFL 5KJRL 2P43B 1JGDB 2P5ED 3S96B 4XBPA 4K23H 1G7PA 3FTGA 5I19H 4MSWA 3C5ZB 4OZGA 1LEGB 2ATKB 5D70H 35C8L 5JXAH 3MCKA 4FQHB 5IK3B 3QFJB 3BAEL 3SDAD 2E5EA 3DXAA 1MRCH 1UWXK 3TC9A 3P11H 5BV7L 5D7KD 4TNWK 3SOBL 3PXJA 1T5WB 3MV9E 1DDHB 1YY9C 4Z5RA 4Q58C 1I1FA 1B9ZA 5E2UL 5ESVA 3UAJD 1TJGL 3BZEB 3SKUD 4RMVA 5GRJH 4G6MH 4HD9A 4YE4H 5DO2D 4GKZB 4L4VD 3MRCB 4CVXA 1BZ7A 5AWNL 4K2UH 5LAXA 4U05A 3DVGB 2XTJB 3MREA 4UDTB 3AREC 1QOKA 5E8EB 1FYTA 4HIXL 1IGTA 3ULUE 1HHIB 4WDIA 5TFSH 5HVFB 4JCLA 2P49B 4GMTL 4LIQL 3HPJB 4K8RC 5FGCB 1NEZG 4PRHA 3SDXA 5IT2H 4R4BB 3UZVB 3RVXC 4BFIB 3ARBC 2C3VA 1ZEAL 2ZUVA 2CLVA 5FHAL 3IRZA 1LVEA 1WC7A 4P4KA 3DI3B 5HDBF 3AXLA 1J8HA 3B9DA 3S37L 5F97E 1KELH 1ZWIB 3IDGB 3IJSB 1SEBB 2AV1B 3CK0H 4XNQA 2APTA 5SWZA 3VXUA 1IGIH 3MOQA 4Y5XC 5J9PA 1DVFD 4OD1L 2W65B 4P5TC 2YD3A 4D3CH 5F7UA 4EEEA 1DANT 4H0GA 1WWBX 4NZJA 4XAKD 5DD1L 3QWRD 4PRDB 4EVNA 1GAFL 5GISL 2DKUA 3TFKA 4YPGA 4H0IA 4MD0B 1QFWH 4X4MA 5D2LF 1S78D 4UT6L 4NZUH 1EAPB 3OL2A 1GL4B 4XWGH 4JFYA 4HJJH 2NY5L 3MACH 2C9AA 3MMEA 2DQFB 2BDNL 2Z8VC 2MKLC 3V7MA 5EUOB 4UILH 2AK1L 4U2YA 2G9HA 5EC1B 5FM4A 5MERB 1CCZA 3P40A 4DGIH 3P2TA 4ZUUB 3EAKA 2H6PA 1YEKH 1ZHNB 1UXSA 3EJYD 5MP6H 5DJDB 2AJ3B 5C0NC 1MH5A 2CQVA 4PY8I 5IIEB 3QG7L 4X7CC 3HKFA 3MV8A 3QIBC 1WZLA 2OTPA 1PGRB 3QIWB 1OAYH 5DJXB 1FVDB 3LY6A 5ILTL 2DQHL 1KT2B 1CGXA 5IMLB 5IESL 1CK0L 2X4PB 4L4TB 5CEYB 2GAZA 3BUYB 4EDWL 4ZXBC 4U1GC 4E0RA 1A22B 4P9ML 3VRLE 5ERWB 4C4KO 5C08B 1KG0A 2A6DA 1BOGB 2NY7L 4LVOB 3RUGA 3TA3A 4DGVL 3HC4L 25C8H 3QZWA 2PN5A 5BOZG 1HIML 3PL6C 3VFPB 5A1AA 3MLWL 2AEIT 3HE6D 5L2KA 2IG2H 3GKZA 4LSPH 1VEMA 4GS7C 3LB6C 3MJGX 1TCMA 1A7NL 1JIBA 3VJ6A 4QOKA 2R1XB 1AHWC 1MJ7L 3TH2T 2EDRA 4F9LA 1BMGA 4MNGA 3MRNB 4HSQA 1I7RA 4Z7QE 1CICC 3AS2A 2AS5M 3MLUL 4HDIB 3AM8A 2E7MA 3MLXL 4KKAC 5JLZA 3L3OA 1EHAA 3K8KA 2OTWA 4U1LA 3G5YB 2VC2L 4K3GA 4KHTL 5IFHL 2DOCA 5JW4Q 3KPOA 1WJ3A 5GGRY 1W8OA 1MCLA 1CVRA 1C12B 5HPMB 3SDCC 4WU5A 2Z31B 3RWFA 3W39B 2BOCB 3LIZH 1FP5A 3ZSSA 1IKNC 5GS0H 5FK9B 2X4QB 5BMFH 3VW3L 1LHZA 5KJRH 1FZMA 4Y7MA 1IC4H 4NO5A 1I7TB 5JO5B 1AGBA 3JWOL 2XWTA 3EFDL 5LGKA 1YMMD 3DVNA 2HT2D 5JA9A 3HA0A 1XIWA 6FABH 1H3WM 2ICEA 2F53D 2HJKB 3FB6A 3JV6B 4PJGE 1XF4B 1K8DA 1WZKA 2CPCA 5DRNB 2EDHA 3CDGB 5I74C 1T0MA 4MWFB 4I8DA 3RDTB 1OVZA 1IM3B 4IM8A 4JFPA 1JMZA 4Z0XA 4ZYKA 5E2UH 4JDZB 3QDJE 1TJGH 5I73C 5JR1L 4JKMA 4XHJC 4HUUB 5C9JB 3DV4A 2XQYK 5AWNH 2Q7YA 1REIA 4X6CA 4EI5A 3QUZD 3CCHA 5JQ6H 4R7DA 5CWSB 2I60H 4OCYH 3W0WA 1KN2L 3FHQA 4EI6B 4HIXH 1AKJB 4NM4L 5FO7A 4GMTH 4LIQH 3G04B 4E9LA 1RK0B 2SEBA 4NYLB 5HPOA 3L6FA 2VN7A 4GW5A 3BP7B 3V5KA 3FCTA 1ZEAH 5GS2D 4U33A 2NX5E 5FM5O 5FHAH 4C56B 1G7LA 2YXFA 4DAGH 5IOPA 1P9MA 1UH3A 3BRDA 3CX5K 2FWOB 4YDJA 4M43H 2J7LA 4R6UA 2HJFA 5TPWL 1Q9KB 1R3JB 1JMXA 4Y19D 2OYPA 1FIGL 2NY6C 1C1EH 2ITCA 3L5WB 4N8VB 4V1DA 5EU6D 2BCKB 3E0GA 3O4LD 3PWJB 4KMTH 5CP3H 3GUTA 4WNQB 5ISZA 2UWEE 5JXEC 5C2BL 5EO1B 5DD1H 1GAFH 1NL0L 5GISH 1PKQB 1KACB 2B1AL 4JVUA 5SWSD 1O0VA 4UT6H 3EZ8A 1AXSB 1Q0YL 5AD0B 1B2WH 3GMPA 2NY5H 4NQXB 3V0WL 4KQ3L 3ECBB 1LO0L 7FABL 2XKUA 2AK1H 5LBSL 3L9RB 3D85B 4M8QB 3ARXA 2VLJB 3HPLB 3OGCA 3W11D 4DZ8B 1HNFA 2P8MB 3RPKA 2R2BA 3S3JA 2FZ3B 5C07B 1A6TA 5ANMB 1BQHB 2E9JA 4OF8A 3QG7H 2ZUQC 1JPSL 5HJ3A 1A47A 4J3SA 4JQXA 4X98A 4KK5C 5MEOA 2OR9L 4UI2A 1GOFA 4POZC 4ZO7A 3EHBC 4GKSB 1FZOA 4HUVA 5IESH 1CK0H 1JWSB 5KS9F 1CFNB 3KYNA 1RIVL 1S9XB 4EDWH 5CSZA 3VXNA 3BX7C 4HGMA 3KWWB 4OD3L 2CXKA 4BJLA 1AGCB 3CX5J 4DGVH 5DHVB 4XPTL 4LLMB 1BQSA 1KJVB 2YZ1A 1HIMH 2NR6C 1S7WA 4ZFZA 43CAB 1AGDB 2FO4A 1MREL 2XIDA 3MLWH 4X6DB 3JTTB 4ELMB 3HAEG 3PDGA 3QP3A 3VFVA 5DI8A 1YEGH 3AREB 3VXQB 4YHMH 5GS0D 3BEVB 3MX0A 3BEWA 3NOIA 3CFKA 2HA1A 1MJ7H 4PB9H 1T1ZB 4G43A 2GUOA 1CL7L 1VFAB 4ZSOA 1XGUA 1VADB 3UP1A 1DQTA 4H25B 5BOPA 3MLXH 1PLGL 3ARBB 1CD1A 2VC2H 5T1LA 4KHTH 2HJLA 5IFHH 3BN3B 4ZUVB 4GRMA 3O41B 4CL7A 2IALA 2D2OA 3PV7A 4C59B 1M7DB 3RVWC 4APQD 5HHME 4P2YA 3DX8A 4Y5XB 1RUML 3QEHB 1L7IH 1NCAL 3MV9A 2B2XL 2ATKA 4PUBL 2VDOL 4FQHA 4P5TB 1ES0A 4FG6C 5T5NG 4MQ7A 2ID5A 4FQIH 4JKKA 4XXDA 5BZWA 1Q9WA 1T1XB 4J8RB 4TNWF 4Z78A 3VW3H 4JZNA 4G8GD 4F57H 4I4WA 3JWOH 4LHUG 3OR7A 5HI3D 3EDFA 4X8XA 3ZT6A 5FA3B 4HUNB 4PRHD 1FSKC 1T5WA 5SWQB 1KPRA 3CZFA 2NTSP 2ENYA 4PJHF 3BP6A 4MVBA 1EVUA 4CU8A 5KANI 1CDIA 1NC2D 4QRUB 1V7ML 3TNNB 5B8CA 3QUXC 2AJUL 4PJAE 3HR5B 3RL1A 3VFNB 4HFUL 5GGVL 1NGXB 4Z18A 3VXUD 5SWZD 1KOAA 2ITDA 1Q9LA 1X3DA 5I8CB 5HHNB 2XT1B 3L3JA 2W0PA 3QIBB 3W2DL 5JR1H 5TDNB 2FNBA 2EZ0C 1QSFB 2FLBT 2V17L 4GG6F 4GW4B 3TFKD 3D0LB 3K4AA 3O3AB 5CEZE 1WWAX 4BZ1L 5ICXA 1LE9B 4PJEE 3T4YA 4J3VA 1KN2H 1VGEL 4ZXBB 4NM4H 1YEIL 4U1GB 4BZ2L 4S1QL 4BSWA 5FOJA 4HWNA 2G75A 3IJSA 1NGWA 3WLWC 2AV1A 1KJMA 1H0DA 4GAYB 3SKMA 2IMMA 5DEFB 3REVA 1BHGA 4YLQT 3PL6B 3S5LB 4RDQG 4GS7B 3O9WC 5CILH 5EOTA 4N90E 4PRDA 3BSZL 2AV7B 3QHFL 5TPWH 2FD6L 1AHWB 3WD5L 1FIGH 3K74B 5DHYB 3F7RA 4N0CC 2NY4D 1B3JA 1EAPA 4XP5L 1CICB 4M5YL 1WQVT 1JHLH 3BRGC 3IFNL 4DEPC 3MZTA 4Q74A 5F93C 1ORQA 5C0BB 2ORBH 5C2BH 4G80B 3MNWB 3V8OA 4AT6B 1KN4H 5MERA 5CINL 4ZUUA 2B1AH 4NRXA 3Q48A 1RULH 1ZHNA 4LNVA 4WTXA 1FFNA 3SDCB 1SYSB 1OTTC 1BBDL 4KQ3H 4L9LA 1QYGL 5FYKE 3U4EB 3RZWA 1LO0H 7FABH 1D7FA 4AIZA 2Y5EA 3MNZB 2B0SH 4KPHH 2D4FA 4WV1A 3S35L 1ORSA 5DJXA 4MJIB 3MV7D 4QOKD 4BQ6A 2W60B 5IB2B 2G2RB 2X4PA 1ZT1A 2C4FT 1WTLA 1JPSH 4KK6C 3D39A 4K7PL 3E6HA 4O00A 3MOAL 3SGDH 5ERWA 3IETB 5C08A 4CADA 4Y5VA 1JJUA 2OR9H 5I74B 3H3BC 5T3ZL 4FZEL 1G6VK 3RTQC 1RIVH 4Q6IA 5ESAA 1T7YA 2X44D 3LQAL 3D69B 5K93A 4KU1A 1S9WA 4QXTB 3UBXI 5I73B 4XPTH 4F7CB 3MRNA 3FOLA 2DS4A 4N8CL 5D1XD 3EO1B 5C09E 1F45A 1K85A 1MREH 3DUHA 5E2TH 2JJTC 3FN9A 5F96H 1XIWD 2NY3D 3VXMB 4WHDA 5CMAA 1CL7H 4PJCF 4M7KL 2VDML 4F9PA 1PLGH 3W39A 1P5UA 1HKFA 1U3HA 4LF3B 4BQ9A 4PJGA 5D2LE 1NLBL 2X4QA 1CFVL 2NXZD 4QEGA 5E0QA 3SGEH 1RHHB 5JO5A 4UUJB 2NY6B 4OD2B 2VXTH 4FQQA 2ICWJ 5IMOA 1RUMH 3FQNA 1NCAH 4YHPB 4EI5D 2B2XH 5HD8D 3B4NA 4PUBH 5F70A 2YRZA 3DRTB 5F1IA 3HCVB 3JV6A 3HN3A 3W0WD 5CSBA 2M1KA 1I9RH 2E8YA 1FIEA 3OHXA 3CDGA 2DQDL 5CD5C 5JZ7D 4MWFA 2WUCL 5D6DC 3MBED 4OCRL 5FM8A 4HEME 3P9WB 3L3KA 3O3DB 4K3DL 1CLOL 1UXWB 4RGNE 4IRSD 2FIKA 1BFOB 1V7MH 4HFWB 4H26B 4LOUD 3B8YA 1IJ9A 1ZHLB 3QUKB 4OIAA 2AJUH 3V6BR 4HFUH 2WBKA 3KLAB 4Y1AD 5GGVH 2NX5A 4NNYB 3STZB 4GSDL 3ETBF 4EI6A 2ZUQB 3QNXA 5C0JA 4JGJA 1U0QA 4FOMA 4TULL 3W2DH 1F58H 4I2XA 5CAYB 2Y72A 1FV1B 4F2MA 4IOFC 3S37X 4BZ1H 3D6GA 1IAOA 4KRPC 4P0DA 1VGEH 1XFPA 1AXIB 3KXFE 2BVTA 2UWEA 3RVVC 1YEIH 5FKPB 3OGOE 3RAJL 4BZ2H 4M61A 1OW0C 1ZS8B 3CFBA 5JIIA 1Q9KA 4ENEC 1R3JA 3BIAX 3CC5B 1VENA 5FKAB 1SJEA 3L5WA 4PLJC 4JDVB 1VESA 3RWGA 4I3SL 1AQKL 1ZSDA 2VDLH 3IKCB 3UPRB 1JZ3A 1I1RA 1K4CB 5EO1A 4LCCC 3BSZH 3G6JB 3QHFH 5AZ2L 3WJLC 4JPIB 5E56A 2IJ0C 2FD6H 1P4BH 3BMVA 3WD5H 1X4YA 3KLSA 1FLRL 1AXSA 2CUHA 4P2QE 4XP5H 5C0AE 5TDOB 4M5YH 3X11B 1YPZF 3C08H 2VR4A 3IFNH 2ZUXA 4YWGL 4O2CB 4K3EH 3QQ9C 3QPXH 3D85A 3D18B 3KPPA 3S3SA 3HPLA 2Y6SD 5CINH 4YHNB 3B9KA 3NCJL 1LP9E 1MCCA 4PJXB 5IB1B 4P23A 4J3WA 1BBDH 1QYGH 1BQHA 5DEGA 4FZ8H 2NXYC 2JB6A 1D5IL 5J89A 1LEKB 3Q1SL 3BH8B 1CR9L 1IC7L 2CR3A 3UPCA 1G7MB 3DI2B 1C7TA 2J8UB 1U8JA 3U79A 4XX1E 5IHLB 4RSVA 2FEDC 1JWSA 1FSKB 4L8SA 4K7PH 3MOAH 3GMQA 3HRPA 1XF1A 3KWWA 4NC1C 1BF8A 1YY8A 5T3XD 4C54A 5T1LD 3KPLB 3OAYH 4R4NC 3HG1B 5F1SA 1KJVA 5T3ZH 2LTQB 3QUXB 3EO0B 2ERJC 3HLAB 4FZEH 1U8OA 4IMKA 1J1XL 4GOSA 1TVDA 3HZMB 43CAA 3JTTA 4K8RL 3I85A 2CJUL 3LQAH 1TZHA 3S4SG 5HYIA 3QUMB 3WFZA 3H7LA 3C5ZD 4G9DA 1NANH 3TWCH 4HLZG 3F7VA 1JGUL 5TGBB 4P2OC 3QFJD 2PW2A 1OTSD 4N8CH 4XPAL 5HHMA 3LPWA 4H25A 3ARBA 1NQBA 1FC2D 4YDKL 2YSSB 1EEYB 2PCPB 2X1WL 4XNUH 4ZUVA 2I5YL 4MXWL 2BC4A 3PABA 1A14L 1VKXA 1A5FL 4QXWA 3U9PH 4ETYA 4D0DA 5EZLB 4UBDC 4M7KH 2VDMH 4FFYL 4JN2A 1R24B 3KPNA 3MUGA 1B0GA 3GJFK 4Y4FC 4NGHL 5FOBB 3O9WB 4JPVL 1NLBH 3HE7B 5SV4A 4J8RA 5DUML 1DANU 1CFVH 1BZ9A 4PJAA 5C3LD 1IAKB 4JFEE 5DD0L 3LRHA 5GRXG 5EBLA 1KIRB 4Z95L 1ACYH 3CLEL 3G5ZA 4XPBL 5D7JC 4DEPB 3AMKA 1TXKA 4PRBA 1F3DJ 4MS8A 5EB9A 4Z7OF 3CU7A 2FYYB 2DQDH 3OKLA 4OLZL 3BZDA 2WUCH 1VCAA 3HR5A 4OCRH 1XGPA 2V9RA 1NGXA 4M5ZL 2C5DC 4PJEA 3QPQC 5I1GL 5F7EH 4K3DH 5E6IA 1AXTL 2YKLH 3PF2A 3IDJB 3QUYC 4GRLC 2J6EL 5TDNA 3GSOA 5KS9E 5IJKA 4KC3B 4DW2H 1LE9A 2FRGP 4FFVD 4GSDH 2YHGA 3LKRA 3TBWA 2DDQL 4WI3A 4RGOL 1YN7B 4Q9RL 2A9ML 4TULH 1RZKL 4X6BA 5F9AC 5DMIH 4UQ2B 4HUWA 5I17B 5DUBB 3QDMB 1ZK9A 4FNLL 4DZBA 2A38A 2R2EB 2K7QA 3N1GC 3PL6A 3IJYB 2GJ6B 1A8JH 3RTQB 3RVTC 2ED9A 3I3BA 4LLWB 1AJ7H 4UZGA 2A6JA 1Z9OA 4JANB 4GKNB 5FYKL 3TBTA 2AV7A 4OI7A 3FB5B 1X5LA 3QQ3B 3ISWA 4JY5H 3C9NB 3D3VE 4LRIA 3ULSB 4G8IA 1R3KB 4KFZC 5JNYB 5B21A 5EOQL 5IWLA 4PGZA 4I3SH 3SDYL 2CLRA 3GNML 1ZGLM 4DOHB 5E1AA 4URTB 4HK0A 2XY1A 2OI9A 4L4TD 4JAMA 2NYYD 4G80A 1LQSR 5AZ2H 2O5ZL 3D39D 5C08D 1FLRH 2V5RA 3K81A 4RISL 4UT9L 3P9MB 3W9DA 1XGQA 2VN4A 3OR6B 1YUHB 3CFCL 4YWGH 1OL0A 3HZYA 4HAFA 3OKEB 4JPWL 3PV6B 4S1SL 4YGVA 4QCIB 3ZKNC 4ZUTB 1LO3L 3NCJH 1JBJA 4MAYA 3RGHA 2W60A 5T3ZD 3MRDA 4PJHE 1OAQL 1ZV5A 4I5BA 5I71C 1D5IH 3QXUA 3U0WL 1G0DA 3AROA 1CR9H 3CFIC 5DA4A 2DMCA 1IC7H 5ALBH 3P4MB 5BJTA 2BOBA 4U1KB 5C09A 4H1LH 4LBEB 3QH3B 1GGCL 1JI2A 2HFTA 2R4RH 4KVCL 4WI7A 1F3JB 3BH9B 1EO7A 3TLRA 2Z31D 3KS0H 3ES6A 3RZCA 2IBZX 4GG6E 3MRKB 4GFTB 3QIUA 4KDVA 2VZTA 3EGSA 2WQ8A 5DJ0B 4HS3B 2ADGB 4XP9L 4LPXA 1S7TA 5LKNA 2D31B 4FTVB 2RR3A 2H2SD 5D2LA 5JOFB 1JGUH 1FZKB 2DTMH 3VXMA 1NFDB 3NMEA 3T8XA 1B90A 3BOVA 3U82B 1KTRL 4XPAH 4X4XA 5EBWB 3RBGA 3RDTD 1FNAA 1VPOL 4O51A 4KRPB 3SDDC 1AY1L 1EAJA 2ESVB 1NC4A 1AC6A 2CGRL 2I5YH 1IGMH 2AK4B 3H9SE 4MXWH 2Q3AA 1A14H 4KKCC 1A5FH 3K8MA 5IVXB 2BJML 2IC2A 1JP5A 2XN9B 3PHSA 1BIIA 4FFYH 4YHPA 3DHJA 3WDHA 4NO2A 5CGMA 1LO5B 4MQTB 1R5IA 3QHZL 2BNRE 3HCVA 3EOTL 4JPVH 5JXEA 4RRPA 5DUMH 1FORL 4LCCB 4U1IA 1AKJD 2VUOA 5EC2A 5DD0H 3SE3C 4L3EE 3CLEH 1XGRB 1ZVSA 2GK2A 3O3DA 4HZAA 1FL3A 4FQXC 4XPBH 4ODSL 1G7IB 1DBBL 4C56D 5CEZH 4M7LL 4PG9A 4HFWA 4HXAL 3HZKB