4G42A

Structure of the chicken mhc class i molecule bf2*0401 complexed to pepitde p8d
Total Genus 72
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
72
sequence length
271
structure length
271
Chain Sequence
ELHTLRYIRTAMTDPGPGQPWFVTVGYVDGELFVHYNSTARRYVPRTEWIAANTDQQYWDGQTQIGQLNEQINRENLGIRQRRYNQTGGSHTVQWMFGCDILEDGTIRGYRQSAYDGRDFIALDKDMKTFTAAVPEAVPTKRKWEEESEPERWKNYLEETCVEWLRRYVEYGKAELGRRERPEVRVWGKEADGILTLSCRAHGFYPRPIVVSWLKDGAVRGQDAHSGGIVPNGDGTYHTWVTIEAQPGDGDKYQCRVEHASLPQPGLYSWK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords MHC class I alpha chain 2
publication title Narrow Groove and Restricted Anchors of MHC Class I Molecule BF2*0401 Plus Peptide Transporter Restriction Can Explain Disease Susceptibility of B4 Chickens.
pubmed doi rcsb
source organism Gallus gallus
molecule tags Immune system
total genus 72
structure length 271
sequence length 271
chains with identical sequence D
ec nomenclature
pdb deposition date 2012-07-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00129 MHC_I Class I Histocompatibility antigen, domains alpha 1 and 2
A PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4g42A02
3.30.500.10 Alpha Beta 2-Layer Sandwich Murine Class I Major Histocompatibility Complex, H2-DB; Chain A, domain 1 MHC class I-like antigen recognition-like 4g42A01
3SKNA 1A4KB 3O3EB 1CZ8L 1S7QB 3CFBB 3H9HA 4Q6IB 3FZUD 1J8HD 5ESQA 2DL9A 3ARFA 1T3FA 4HMDA 4O4YL 5GZND 2EDOA 1A0QL 4Y19B 1PSKL 4ZUWB 15C8H 3MXVL 5CSZA 4L8SA 4Z7NF 1AC6A 4LF3A 2Q8AH 4R7DA 4X7SH 4DAGH 4KHTH 2BNRE 4MHHG 4X7TB 4KMTL 3VG9C 2ZUUA 3PV6B 5SWSE 4NN7C 1EFXD 4P2QA 3BVNA 4K3JL 1XF2B 1NMCC 4EN3A 1LDPL 4ZDHA 4PJBE 3VXQA 4FQLH 4LP5A 4OB5H 3ZKXB 4H8WL 3UO1H 3MGOB 1E27B 4C55A 3P9LA 5IJVA 4HBCL 1NSNL 1CE1L 3HE7C 1ZA3A 1TVHA 3R1GH 3RGVD 3NA4A 5C6TH 3HUJE 1MFDH 3QHTC 1G1YA 3CFIC 2JELH 1HSBA 4KK8C 4QHKI 2X4OB 4G9FB 2BNRD 3DUSB 2BSSA 4NQVA 5SWSD 4F33B 3BP4A 4I18A 1BWMA 3KPQA 3QEUB 2AJSH 3L3JB 3JV5A 1MAMH 5C92A 3H9SB 4ZFZA 2GJZA 1EHAA 3MLWH 3ES6A 2GSGA 1EEYA 5CP3H 1FYTE 4HKJA 3H3BC 5LKNA 3HE6D 4ZUSA 5EO1A 1YN6B 3O9WB 2A9MH 4XCCL 2XKNA 4R4ND 4F7TB 2LAAA 5ABDE 2R4RH 1A3RL 5F44A 3WDHA 2E7LE 2ZJSH 1HNFA 3T2QA 5BQ7B 3AAZA 2YPKB 3WLBA 3K4ZA 1FVCA 3O41A 4Y5YC 4GAYA 3A67H 3ZE2E 1FYTD 1B6DA 3MJ7B 4W70A 3R0NA 1ES0B 4FQIL 3UTQB 1LEKB 2EIZB 4UV4H 3SDAA 3OX8B 3ZDYE 4UDUB 2NX5A 1S9KC 4FQJH 1W72L 3O4LB 2F15A 4X80L 4L9LB 5T1LB 3BPLB 4LKXA 3TN0B 1A14L 4M61A 1U8IB 4TSAH 3ULUF 2R1XA 1BM3L 3IJHB 4CUCA 1CLYH 3FCTA 3FRPG 2GHWB 3DTXA 1DFBH 5JA8B 1NCWH 3W0WB 3GMPB 1WQVT 4M1DL 4AIOA 5HYJE 2G60L 3QH3B 2FLRT 1EGJL 2VLKE 5KSBB 2D7OA 4LVNC 1U95A 1F8TL 1OWRM 3NH7L 1YZZA 5E2JA 3PE9A 5JR1L 1TCMA 5F72S 1EJOL 1JV5A 5E6IA 2P47B 4RGMB 1CGUA 1NGQH 3D85D 3C87A 3QB7C 4JLRA 4URTB 1KIPA 4XC1L 5I8OL 1SVCP 4HX1B 1CU4H 2WM0A 5HYJD 4LPVA 2R56L 3GSRB 4MB5A 1HSAB 4TUOA 4GG6E 1P6AB 2ENSA 2VLKD 2KH2B 2VDPH 3M1BB 2RFXB 1MPAH 1LGVA 1GGBH 2R2EB 5CIPH 5I16B 1KIRA 1CT8B 3MRMA 3WIHH 4G42B 1AGCA 5IVNA 5J13C 4YHZL 1I1FB 3GO1H 2CLZA 5D8JH 1NGXB 1R3HA 1YY8A 2HWZL 4XCFL 4WI3A 1RIUH 1DN0B 3SEPA 5L0QB 3CSYA 4DZBA 1CGTA 1BBDL 4LCWA 3OXRB 5IB1B 3IDXL 1E4WL 4N8VG 3SPVA 3U7YL 4QHMA 2YD9A 1FJ1B 4JQVA 4HG4K 3VGEA 4IMKA 3PL6B 1NGWA 3RWFA 3CMOL 3ZT6A 4PTTA 4YR6B 2WBKA 4BYHA 4NUGH 5F89A 3O11B 4JZOB 1IKNA 1CVSC 1UB6A 2DQEL 4IJ3B 1QO3B 3IDMA 4CJ1A 5FECA 5HHNA 5IG7A 3W11C 3CVHL 1UJ3C 5KVEL 1FC1A 2VZTA 1IGYB 4L3CA 3PWJB 4PTUA 4ZSOA 2FHCA 3BN9D 1A6WH 3TF7A 4AEIL 2FEEI 1A6AA 1KLUB 4Z5RB 1CICB 3O6LH 3VWKC 4LSTL 2QLVB 2DQTH 3MLUH 2L4OA 3GNML 1JNNH 4JQIL 1ZLVH 1JNHB 1M7IA 2NY5H 4DK6A 5L7XH 2G9HA 3L3GA 3QUZA 1D3CA 3FTGA 4N0FB 4XP6H 5FA3A 2WIMA 2ZPKL 4MNGA 2G2RA 1KBGL 2DYPD 4GRWH 2BDNL 4BZYA 1OGTB 4JY4B 1ZLVK 3L5IA 4KRLB 2YWYA 2G75A 5I71B 2CLRA 4PD4K 3DOSA 4M7JL 3TBVB 3GMRB 4PREA 3ZT5A 3ARZA 1WZ1H 2X1PA 5I15L 2NY2C 1ROWA 5AUMB 3PQYB 5H8DA 1WISA 1S9VB 4S2SB 3BMWA 3W11D 4P4RB 4PGEB 5DJ2B 2VQUA 2V17H 4YFLF 2V2XB 4TNWF 4NNYB 3SDDB 3SGKA 3GSUA 4P3DB 4PJHA 4KV5F 4PG9A 3RKPA 3SCMA 3STBA 3RX7A 1A7RH 1S78D 2BVUA 4H20L 1J1OH 1MCQA 1QNZL 3WUWB 1E4JA 1FIGL 1ZA6B 2O93L 3C08H 4WO4D 5HYSA 4CL7A 5TQ0H 5EOCL 3T2OA 5ILTH 4OBRA 3S35X 4X6DA 2IC2A 4LEXH 4YUEL 3OKLB 1HI6A 2XZCL 4Z7WB 3OKEB 3QO0A 3PP3H 5ALBH 5ADOH 1A1MA 4PP1D 2H41A 1YDPB 2VDRL 3QIUC 3VI3F 4HC1L 4NT6B 4XVTH 3MOQA 4ZTOH 3EYOB 4WEMB 1RZ7H 2VDNH 1PAMA 4MWFB 4L4VA 4HIXL 3KVQA 5F9OH 2R69L 1RURL 5KVGH 3MV8A 1KPVB 2OTUA 1QRNB 4HS6B 2XPGA 4MD4B 1ZTXH 5DD3H 1O7VA 1D5XA 4HS8H 1NCUA 1OOAA 2Z8WC 3IJSB 3C60A 1Z2KA 2FB4L 2Y23A 4HD9A 4WI2A 3LPGA 4NZDA 2AEQH 3C2AH 1WZLA 3KPSA 2RBLA 4OTXH 4PJAE 5E4EB 4GG8A 5ITFA 4DFHA 1K2DB 4OM0H 1DBKL 5B39B 3JWDH 2ATKA 5TDNB 4P5MA 2V2TB 4Y2DA 2F74A 1K9TA 4CW1A 3LKRA 2I9LB 3RVUD 4KRPB 1VENA 2VXSH 2I25N 5DS8B 4XMLH 1AP2B 5DHVB 3FOLA 3RNQB 2V9QA 3KAAA 2VL4A 2XFXB 3UCRA 2WBWB 1A3QA 2FZ3A 3TVMB 4D0CA 3SE9H 2DTMH 3WSQL 2APTA 3DX9B 4PJFB 5EOQH 4PYHA 5T1MA 1GXEA 2BVPA 5HI4C 2GY5A 1ZHNA 3GHBH 4GKSA 5JDJA 3B3IB 1S7TB 3B9VA 3P9MB 4UTAL 4PJEF 3TYGH 1AO7A 4G8FA 3U30B 4UU9A 3CH1A 1FL3A 4MYWB 4NDMA 5HDBE 3RL1B 3VFSA 1B3JA 2OS7A 4K23H 4KJWC 2P8LA 3GRWA 1WZKA 5CHNB 3O2DA 2JB5L 3QQ3B 4OF7A 2QR0B 1UM4L 3P30H 2BMKB 4Z8FH 1U93A 5JOFA 4EUPB 5FGBA 4UAOB 4X8JB 4YXKH 3V0AC 5CS7A 1U9KA 3MJ9A 2X89A 1UA6L 2Q1EA 4ELKA 1A7PH 4WUUB 4RFEA 5D7SL 1LILA 2QQLL 4H1LA 3NAAH 1NEZA 4HKXB 4YK4B 4W6WB 3V6OA 2X4NA 1NBZB 1MJUL 5DDHA 1KELL 4JDVA 3VFRB 4PJ5A 5IV2A 4GUPA 4HF5L 3HZKB 3VFTA 2VC2H 1K85A 2W9EH 1R24A 1RZKC 3BKML 3U1SL 5T5FL 2R1YA 3EO1B 1JI1A 2D9CA 1XF5A 3BAEL 2XACC 3HTLX 3LB6C 5C0RL 2IMNA 4YFEA 3T4YA 4KJWD 3WL9B 1KUMA 2HKHL 3E3QA 3NCFB 2X4RA 4GAGH 1BOYA 2FJFA 2NY1C 4Y16D 4PJCE 5TQ2L 4JFYB 3ARDB 1UEYA 3J8F7 4BSWA 5GGTL 4JO4H 2BSRB 5DEFA 4HDIB 4EDXB 5D2LB 2VDKH 5AYUL 4DGVL 2JCCE 2Q8AL 3WNOA 4UQ2A 2G5RA 4DAGL 5I1CL 4HKBB 5SX5H 3C2SA 1WT5A 4P2OD 3OJMB 4ZO8A 1J87A 3MNVA 1JI2A 1OT1A 3NCCB 4FTVB 5IB5B 1TZGL 1YN7A 5E8DL 3S37X 5CKAA 4TULH 1CFTA 2GSIB 3KPNA 5SX5K 1IZJA 1BIIB 1T1WA 3Q6FB 4JHZA 4ZS6C 4WWKC 4YJZL 4XVJL 4NQEE 2BRRH 3LB6D 3OZ9L 4OF3A 4G8GB 2IBZX 1RZJL 4KTEL 1T1XA 3CDGA 2X4TA 2VJXA 4OCWL 5D1QB 4F37K 2YN3A 3DX8B 1H5BA 1JGVH 1FP5A 2ZUWA 1BJ1J 1HYSC 3P4NA 2VZSA 1Z9SA 2J8HA 5KVFH 2IPKB 2UYLB 3VFMB 4JHBA 4N5UA 1PYWB 3D2UD 2W65A 3BHBB 1KCRH 2YPVL 1VKXB 1K5NA 1GGCH 3PDOA 5C07E 2A9ML 4NQED 5FV1L 1WBZA 4V1DA 5D1XB 1EO7A 1FH5H 3E6FB 3MNZA 3BDYL 1OB1A 3WJLA 2C1PB 4MS8C 4KK5D 4ZOAA 5HPMA 1G0YR 1GGIL 4OZGE 2NYYC 4GH7B 1VFOA 5FXCH 4P2RA 4KHXL 3CCHA 2R2BB 3VXUB 2VDQH 2VZOA 1BAFH 1OAQH 2Q86B 8FABA 3VXMA 4WWKD 5LJYH 2VL5B 1NFIB 2PO6A 4LCUA 4POYA 12E8H 2XYCA 5C07D 3UTPE 4FQJL 3CZFB 1NJ9A 2EC9U 4X99A 1A5FL 3ARTA 3T09A 3QHZH 1EK3A 1QVOB 5C9JB 1NDMB 2NMSA 2J8UE 3OXSB 2X6MA 3ROLB 3RFZC 1CLYL 4ODTH 4X6CE 5IW6A 4NOBA 1C5BL 2FDBP 2ADGA 3KPPA 1UFUA 2EKSA 4GT7A 3UPRA 2YN5A 3VRLF 3REWA 4UUJB 1U8QA 4H8WC 1INEH 1V3MA 4OQTL 1CL7I 1OVZA 2MKLC 3F5WA 2NYYD 3CLFH 3S8WA 3G5YA 3IRPX 5BO1H 4WFEE 4MA3B 1Z3GH 1IAKB 1AGDA 1DCLA 3HLAB 3MRHA 1NGQL 3ILPA 3MBED 4Z7VB 1GPOL 3FKUS 3RIAF 4BQCA 2CJUH 2GEEA 1CU4L 3BMVA 1YUHA 2EDRA 1U36A 2C3VA 4U1MB 1OD9A 4LCCC 1CTNA 4KXZI 3NFPA 3QNYA 5D5MB 5JPNB 1GGBL 1T03H 1XGUA 2ICWJ 1KXVC 5IT2L 3RVXC 3C5ZA 4WFED 1QFWM 4JR9L 4NRXA 5ETUA 3BO8A 1CR9H 4H0HB 4CN4A 3D0VB 3MODL 2H32B 4RBPK 3MO1B 1I3RB 2XIDA 1PLGL 5KSAC 3IETA 5TDPB 5CCKH 1QR1A 2VDOL 3F7PC 3G6JE 5F1NB 4NNPH 4GBXB 1CL7H 3AXLB 3VJ6B 1ED3B 2V2WA 4JG1L 3L3DA 1AI1H 2AJVH 5ESVA 4DVBA 3EYUH 3QNZB 5DWUH 4ODWA 3C5SA 5JUEH 3THMH 4Y4FD 3RBGA 1NBVH 5C0AE 4ODUB 4BJLA 5HYQA 3EAKA 3MRFA 1JYVA 2R0KH 4NUGL 4ZFOA 2E9JA 5HHVH 4XHJC 1RULL 2HVKA 3ARQA 3IS0X 5IVOA 3Q0HA 1OY3B 1UZ8B 3ZKMC 4HBQA 1WK0A 1F13A 4JANA 3MFGB 4P59H 1M6OA 1NKOA 3CC5B 1SJHB 3P0VH 3GM8A 4Y8DC 1LE5A 4TOYL 4HXAL 3CAFA 1K4CB 1A6WL 2XOTA 2VXTL 2YKLH 5EWIH 2XT1B 1JRHL 5C0AD 3O6LL 4XPAH 5DJYA 2DQTL 3TJEH 1CLCA 4XRCB 4X6EB 1JNNL 1C1EL 3X11B 1ZGLB 5IOPA 2NY5L 4KVNL 4JVWA 4PJ8A 3TA3C 3EOAB 4G6MH 5KSAD 5JO5A 4XP6L 2Y36H 3RRQA 4OCYH 2JJSC 2J5LB 5DRNB 3U4EB 1WLHA 3SBWC 5AZ2H 3L3KB 3BQUB 1IGJA 4LLMB 2BNQD 4FMKA 5KSUA 1X5XA 1LD9B 1VACB 1WZ1L 3TH4T 1T0NA 3EYFB 5CZVL 4K94C 4BK5A 1F11B 5BRZB 1T22A 2IFFL 3CFJB 4N8VB 5DMIL 3V0VA 2LABA 1KV3A 4RRPA 3KWWB 4JHAL 2FIKA 1N59B 1U3HA 5HVHC 3GUTB 4Z7WE 2FL5A 5HYSG 2WP3O 3FN9A 2O5ZL 3K3QA 4OD3H 4J3XA 4PJEA 3WO3B 4ERSL 4HT1L 1C16B 3L7EB 5EU6E 4EDWH 3TPUA 3LEVL 4J1UB 2VLJE 1KC5H 5B22A 3RTQC 3N85H 3TA3D 4DJMA 1FAKT 4LASL 1GVIA 3LKQB 1FFNA 3D5OF 4PJIF 5GJTL 3C08L 1QRNE 1NGPL 1QR4A 3P2TA 4OZIF 2NY3C 3EFFA 2OL3H 5B8CA 1RU9H 5CMAA 3VRJB 4AQOA 4Q2ZA 1JGUL 4WVRA 4GW5A 5HHPA 4MA1C 2GFBB 3JTTB 4HUUB 4OLUL 5EU6D 3WIIH 2VLJD 4R3SA 3ARSA 5D2NC 4P4KA 4C59B 3BYYA 4RAVA 5EFIB 3GSNA 1N4XH 4M5ZL 1RD6A 1UWEH 1XGTA 1YNKH 3DO7A 3MYJA 3IJYA 3FQWA 2VDNL 4XAWL 4F8TA 4RQQA 3UTZA 2DI7A 4LEOA 3FFDA 1BLNA 4IRZH 4NZTH 5KVGL 1HH6A 3KPLA 3P73B 5HJ3B 1MFEH 1YQVL 4ALAL 4PJXE 1P7QA 1ZMYA 3QYCA 5AZEH 2N7BA 4F15B 5FEBA 2GY7B 2P5EA 4P5TA 3HG1D 3WHXA 3GHEH 1K8IB 3WE6A 3QI9D 4N90E 2IPTL 3L3HA 4FN0A 1IL1B 4PJFE 4LLUA 2Y6SC 3ULUH 4LLWB 4I0PC 3QRFM 3RWHB 2NY3D 3OL2A 2GK0A 3EFDL 2EYRB 3I2CL 4L3EA 1K6QH 3NPSC 3OMZA 3ZKNC 2H45A 1W0VB 1XGYL 4OD1L 3RIFF 1WVZA 4M8QB 4JZJA 4Y4KD 2PW2A 2J12B 2HT2C 3C9NB 1CFQA 5I8KH 5GGQL 3GI8L 1XGPB 3WO4C 4RAUB 4LSQL 3V8OA 5B4MD 4JREB 4NZUH 2X2YA 4K2UH 4D9RD 2E7CA 3GHBL 4IOIA 4OD2A 4FXGA 2QJDA 4OI9A 3MZTA 2K9UA 3W5NA 3MRDB 2HN7A 3TYGL 1MQ8A 3G5VA 5IK3B 3IXTB 4L29A 1UCTA 2BHUA 4OFYD 1OSPL 5IW3A 4WEUD 4I0PD 3QAZB 3LKSA 3NCYP 2R15A 3M17B 1BQLL 4YDKH 3RWGA 4H1LG 1NEZG 2CR6A 4OLVH 4OT1L 2MCPH 1A7NL 3VGAC 2AQ2A 3WD5L 1IGCH 1X4YA 1S7UB 3P30L 5EIQA 3OKMA 4AQ1B 5C09B 4JFXA 3TNMA 2R0LH 4AEHL 4WRLA 4ELMF 3PWUB 1JF6A 4MJIB 1DBAH 5FM4A 2D31B 2FH6A 4ZPTA 5D7JC 2IAMB 5E2VL 5F9WC 4P57B 5I18H 5KN5B 5D7IF 5BS0E 2XWBB 1I85A 3UTSB 1TJIH 4MDJA 4F7MB 3FFCA 4OKVB 4I0CC 4DCQA 2A6KA 4A2MA 5DMYA 1A4JA 2BOBA 1IGIH 2VABB 3BIAX 3KLHC 4U4BA 3DUHA 3S4SA 1NC2D 4GAGL 2MQ0A 4HEME 1E4KA 1E28B 2HTLC 4NBYB 5BS0D 3U36A 1WWWX 1GYAA 5J7CC 1MH5B 1DQQA 1VHPA 1IQWH 1M05A 4PRNB 4TUKH 2RCSH 2JB6A 2XTJB 1EEQA 1IT9L 5BMFH 5BXFA 3GMQB 5IMMA 4R8WL 2WUBL 1MCEA 4Z7UB 3U2SA 4XP4L 2VR9A 4O58H 4RMTA 3GSWA 3VXOB 5HPOA 4HJJH 3QEQA 1ZHKA 2WZPD 1X5JA 5DUBA 3I3BA 3SKNB 1DTUA 4OZ4B 4I48B 2I60H 4OFIA 5D6CA 2N7AA 1MJ7H 3H9HB 1RHFA 5ESQB 3VXUE 5DGQA 1T3FB 4QRPD 3RZCA 2H8PA 3WJJC 2VE6A 1IC4L 4JQXC 4R7DB 3P4OA 4MQXC 3H2WA 3L1OH 3GI9L 1UXSA 3BVNB 5L2KB 4XBPB 5E8NA 4ZDHB 1GC1H 2IMMA 1FH5L 1NQBA 3BT2H 2J6EL 5DZLA 4WU7A 4PLJC 5DFWH 4LPWA 2J8OA 3MR9A 5IJVB 4ZNEE 5I6XB 2FNBA 1HINL 1ZA3B 2DLGA 2F54D 5GGVL 1TVHB 4FXKA 4HH9A 1KYOJ 2BCKA 5A2FA 3BIKA 4GAJL 1HSBB 4U6VL 3QUYC 4NQVB 2BSSB 4ZXBC 3BP4B 3R4DA 4I18B 4HKZA 5CP7A 1V7NL 3KPQB 3BKCL 1RJLB 1AHWA 4YX2H 3IRZA 2GJZB 3ES6B 2GSGB 1B4JH 5AAWA 1CIDA 1EEYB 4J8RA 5C9KA 1FNSH 3QCVL 4OZFA 5FO8B 5GRWA 5E5RB 3EBAA 2E6PA 4PR5B 3OJDA 1D5ZA 4LP4A 4NZRH 5I8CA 5GS0D 1P4IL 4PJ7F 2Y07H 1NCBL 1IM9A 5M94B 5AWNH 4GRLC 5D5ME 4LU5H 3QWQB 1INEL 3OGCA 4U6HA 3AAZB 4PLJD 3QUMH 1MCFA 1FVCB 2ADIA 3O41B 5F7EL 4QHNA 3AU1A 3RDTC 3SDCA 4BM7A 4S1QL 3MCKA 1Z3GL 1ZXQA 3GK8H 1RZJC 1Q72H 2LV4A 2YR3A 4JRWA 3HPLA 3SDAB 1YEEH 4ZAKA 3QUYD 1CGSL 2CDEA 2NX5B 1RPQA 5B38A 4ZXBD 5DC0A 5L6YL 2WW8A 4M61B 4HFWA 3UBXI 2R1XB 4FQ1H 1KPRA 1T03L 3FCTB 3DTXB 3B9KA 4YBQD 5TFSH 1JPSH 3SO3C 3F6IA 4L8BB 4PJIA 2X5PA 2EIBA 2XXCB 3SE8H 3HC3H 4KDWA 3HR6A 2WAHA 4GBXD 4OZIA 3HNSH 1IAMA 3DBXA 2FBJH 2X9XA 3U9PL 4JG0H 4GRLD 4ZPVA 3KJ4B 5GS1C 1JPGA 3MV01 5DWUL 2J88H 2OQJA 3RDTD 3BEWA 4LRNH 5DRXA 2CLVA 1GCFA 2H1PH 2X09A 1RUKL 2R0KL 1ZANH 4K3GA 2UWEB 1KIPB 4HFUH 4TNVK 4KUZL 3MPCA 4PRBA 4HQQH 3VD4A 1S7XA 4C56E 2IQ9H 2HFGL 4TUOB 4MJ4A 1KIRB 3MRMB 2H32H 4KUCF 3K2UH 1Z6JT 1AGCB 4BFEA 2QQKH 1F4AA 4EQ3A 4NPYA 4EKXA 2DBJA 3ULVH 2CLZB 4XPAL 4A2LA 3PGCA 1MFAL 1R3HB 5D96C 5TH2A 1YY8B 5CZXC 3CSYB 3LKOA 4RX4A 5HHME 4IRJC 5I9QC 4DZBB 3HUJF 5HDLA 4LCWB 2OM5A 3LDBB 5D6DC 4M93C 1QSEE 3SPVB 4C56D 4QHMB 4K8RH 3V95A 1NGWB 3RWFB 2CIKA 4HCRH 1JZ7A 4PTTB 3QIBC 4MVBA 2VIRA 1WGOA 1E0OB 7FABH 4LIQE 3VCLA 5F89B 5E8EA 1UB6B 4RISH 1IAOA 3IDMB 5FECB 5HHNB 4HXBH 3MX0A 5IG7B 1FZOA 2P4AB 4XP1H 3O3BA 4MAYA 1I7TA 1SQ2N 3BP6A 3KYNA 3H9ZA 5HHMD 5DD1H 2ZKHL 1MJ8H 3K80A 1H3VA 4ZSOB 4DN4L 1B0GB 1QSED 3JSSA 2P45B 2H2SD 1A6AB 2EEDA 1R0AL 1PG7W 5ACMA 2AJUH 4FFEX 4E41D 4J12A 1M7IB 2BY1A 2BXZA 2G9HB 3IB4A 3L3GB 2IJ0C 3QUZB 4YC2C 3FTGB 5FA3B 5CZXD 3RY6C 4Z6AT 1EMTH 4OLEA 2G2RB 1X7QA 4IRJD 5T3ZH 2AQ3A 3OKDB 1EUUA 3WS6C 1U8JA 2CLRB 32C2A 3CXDL 5FYKE 2IH3A 1JP5A 4PREB 3EIFA 3OR7A 1FGVH 1RU9L 2QSVA 3T2PA 1ZEAH 3OB0K 5C0GB 1GRWA 3WIIL 4WI9A 4NQSB 3MLSL 4ELMA 3MNWA 2W0PA 1FE8H 4OCSH 2KQNA 4U0RC 5KVDL 3D6GA 3SO5A 4LOUD 3H6JA 1YNKL 1Q94A 2J4WH 3RPIB 3MOBH 5D7IA 1JZ6A 4FQXC 1QBAA 3O0RH 3GSUB 4PJHB 3SCMB 4PG9B 5DUPL 1AE6H 1MFEL 2NY5C 4EI5B 4KPHH 3IDJA 3MGAA 3V4UL 4XWOC 4I5BB 2LAGB 1KN4H 1P9MC 4NN5B 1JGLH 3GHEL 4QXWA 5JHDA 4YWGH 5D9SA 5HYSB 3RVVC 1UACL 3HMXL 5EC2A 2AGJH 4UZGA 2BRQA 2A0LC 5D7LA 5EIIB 2OBGA 4GG6F 1AGFA 3QO0B 1YC8A 4YH6A 1ORQA 1C7TA 4G6FB 3RJDA 3CVIL 1A1MB 2NTFA 4G7VH 1KCUH 4JY5H 3KYMA 1G7LA 1JN6A 3WFBL 1B0RB 4LPCA 1FNLA 4YBLC 2X1OA 4GRWE 4HSQA 4DQOH 1OAKL 3GMOA 2EIEA 4FFWC 3MRCA 4N0CC 3RX8A 3JWNC 4LRIC 5I1HH 2MWCA 5GGSA 3UTTA 1BVZA 3MV8B 5DD6A 3FB6B 4FQXD 4JKWA 1IFHL 1RIVH 5FHBL 1AD0A 3BISA 4NZUL 2DD8H 4UBDC 2BVYA 3KJ6L 1ZHBA 3GMNA 4K2UL 3C60B 5EDXA 3HMWH 3O8XA 4HPOL 3I9GL 4XWOD 4A6YB 4W4OA 3TT3H 2OJEA 5C0CA 4GG8B 3BDXA 4HUWA 5ITFB 5D71L 2W0KA 2AV7A 2CKNA 3H8NA 4JFQA 5EU7C 1EIBA 2ATKB 3WS3A 4AG4L 4P5MB 4GQ9L 2F74B 4Y2DB 4CW1B 4YDKL 3RWIA 4NOFA 2R1WA 5JZ7C 1OL0A 5DQDL 5LQBL 3DSFH 5C0JA 1MCWM 3MA9H 3UJTL 4OFVA 2DM3A 1JWSA 3FOLB 4BKLA 4D0CB 2A1WL 3C8HA 4UOW0 3TCLA 4L9DA 1R5IA 5ALCH 4PP8C 1P5VA 5T1MB 1ZHNB 4GKSB 1LO3L 4M3JA 5E9DA 3NZ8A 3WFDL 5E00A 1MNUH 1PY9A 3AS0A 3IFNH 4YDIL 2FH8A 1TVBA 4G8FB 1BFVH 1TJIL 4TSBH 4UU9B 2R23A 1T6VN 3T0AA 4RNRA 2AABH 4KMLB 1FL3B 4UB0L 4NDMB 4NQXA 4F3FA 1UXWA 4UINH 3VFSB 3MUJA 5IM7A 1FO0H 2MJWA 2P8LB 4R6UA 5IB3A 1I9JH 2FX7H 3FO2A 4XPTH 1YEHH 2ATPA 1H3TA 1NL0H 1Q9LA 4LFHG 3N1PC 3GJEA 2A9NH 4J2XA 1NCAL 3WNKA 2R4SH 5CGYC 5F7DB 1G7IB 2ICWI 2C4XA 2CK0H 3U46B 1J5OH 1H15A 3ARBB 3RAJL 1GGTA 4PJ7A 2HFFB 4U49A 2VH5H 3BZFA 2D9QB 2D7TH 1AXSA 1NCCH 4NJ9L 4LAJH 1IQWL 1X4XA 2I26N 4H1LB 4KKBD 1NEZB 3OKYA 2X4NB 1SMAA 3UDWC 1B9ZA 1ERNA 3MRNA 5I1IH 5J57B 4PJ5B 5F7MC 1KCSL 1JNJA 3VFTB 5FHAH 1TMCA 2NXYB 2HG5B 2R1YB 3ZDXE 1RY7B 5I66A 4GXUN 2D3VA 1FV1A 4P2QE 1XF5B 3FAXA 3Q1SL 1FFQA 4C58B 4CMMB 1CD1A 5HYIA 3T4YB 3N1FC 4DW2H 2XZAH 3SHSA 1J8HA 2X4RB 4X9GA 1MF2H 4QXGL 3ARFD 1E4XL 5T1KD 4WV1A 4XWGL 3FB8A 4BSWB 5HI3C 1XR8B 5DEFB 2XN9D 3NFNA 4IOSD 2RGSA 4PRID 1EFXA 4UQ2B 4P2QD 1QYGL 5M95B 4EN3D 3INUL 2YS4A 4F7CB 3VMPA 4KQ4H 4NKOA 5C08E 1ITCA 4PJ9D 1YN7B 3BT2L 1CFTB 5DJXA 1NFDE 4N0YH 4M7LH 4JKPH 1T1WB 3RGVA 4DUVA 1P4LA 4N0UA 2ZUQC 5AD0B 2F53E 5E95B 3T0EC 4O2CA 4XNZC 2BNRA 3KR3H 4NQDD 5SWSA 4OZFG 3T8XA 5C8JA 4NN6B 1T1XB 3CDGB 2X4TB 3QISA 5K33A 1CXHA 1G7HA 5C08D 1H5BB 1AIFB 2DQJL 3T08A 1BJMA 3HE6A 3RU8H 2HJFB 3P4NB 4EBQH 3EGSA 1FNSL 5DVNA 3V4PL 1U8KA 3HUJA 3QCTH 2W65B 5J9PA 2F53D 2A77L 1K5NB 2B5IB 4YHOH 1H3PL 1HHIA 2FHBA 2DM4A 4V1DB 5EZIL 1I9IL 2WWMC 1OB1B 5HPMB 5AWNL 5B38G 4LPYA 4LU5L 4CVZA 4O5LL 4JFFA 3CCHB 3G6DH 1FYTA 4H88L 3STLA 1CQYA 5T3XE 3QXWA 4D9LH 8FABB 3T0ED 3VXMB 2OZ4H 4X9BA 4Q6IC 2PO6B 5CLTA 3TZVC 1Q72L 1TNMA 2NXZB 4KROB 1J05A 4NRYA 1NJ9B 4MZ2A 1R3KA 4X99B 3MUZ1 4YNYA 2C7UA 2CRMA 3HZVA 1FL6B 1N5YH 2OSLA 2DLEA 4UQ3A 4LMQI 5JQ6H 3CDFA 1JHKH 1A7OH 4U0QB 2PUQT 4X83A 5LGJA 5E2WH 2ADGB 5TFSL 1JPSL 1QEWA 3GMMA 1TTUA 4I0KA 1T5XA 3HNSL 5C6WH 1J11A 2H9GA 3F5WB 4JG0L 1NEUA 3OGOE 1FLRH 3JTCA 5LBSH 1S9YA 3G5YB 3SGJC 5E6ID 2VLLA 1HXYB 1DLFL 4PJCF 1SEQH 2LTQB 3D85A 1T1YA 1AGDB 5FUCC 1V7ML 2AXFA 4NM8H 4BUHA 4FFYH 1WWAX 3MRHB 3ILPB 5KZCB 3VGHA 1MCKA 2X10A 3TZVD 2BY0A 1N6VA 3GKWL 1H0DB 1Y6NR 2XNAA 1YUHB 2UY7A 2IQ9L 2FATH 4HGWA 3O9WC 1MCNA 2C3VB 3QNYB 3SDXF 3WXVH 3O4OB 4YPGA 1MRCH 4NRXB 5ETUB 3BO8B 2D03L 2QQKL 5A43C 3CNKA 3DV4A 4J23A 1ZAGA 1P5UA 3RWDB 2KPNA 4W4NA 5TE7H 1HXMA 1QR1B 4B5EA 2HFEB 1ZOXA 3VA6A 4X4ZA 2V2WB 3OV6A 4JCMA 5H2BA 4DTGH 1KPUA 3O3DA 4MJ5A 4GG6A 3WFCL 4DVBB 3LH2L 5ESVB 3MLZL 5C0BE 4ODWB 2I07A 3C5SB 2P7TA 4YHIA 5HD8C 3C6LC 3ARRA 5HYQB 1NMAH 1BVKA 4RGNC 4L9LC 3MC0A 3BPLC 3TN0C 1TLKA 1EAPA 3BKJL 5K9QG 4MNGE 4ZFOB 3MLVH 2V6HA 2HVKB 3L9RB 2VLRE 3HNVH 5CBAA 1I1AD 5IQ7H 3JWOL 5E99H 3GIZL 4PJDE 5JHLH 5C3TA 4JANB 4RSVA 4M6OH 4JGMA 3S36L 4Q97A 3MBXL 1M6OB 1VFBA 1XIWD 4ISVA 4LGRB 4MNQA 1LE5B 2VKXA 5GGUA 3FT3A 5C0BD 1EFQA 4RGNE 2F8OA 3DURB 3EJYC 3HC4L 1I3UA 5B21A 3RZWA 1M1SA 2DLTA 4JJ5A 4CVUA 5IOPB 3QG7L 1LK2B 3V52L 4PJ8B 1QPPA 1RUAH 3TO4C 2DYPA 2VLRD 5JO5B 2D7NA 5FYLE 2BC4A 5T3ZL 4PJHE 4RGMC 4MXQC 4FFVC 1KENL 4U6YA 2VAJA 1H8SA 1IGJB 4JFHE 3DUUA 5CEZH 5AYQA 1J1PH 4M03A 5HD8D 1BD2E 1I1CA 3F12A 1TZIA 2OCFD 1QLFA 5KOVC 4KZDL 1FGVL 2J2ZA 4RGND 1CK0L 1T0NB 5TGBA 2YD4A 1UJ3A 4X6CF 3OKNA 1JFQL 4FQCL 1T22B 4NC0B 4LNRB 1J1XL 3A6BH 2W91A 4X6DE 5DF0A 1DBJL 2GTZA 3X17A 1FE8L 2M26A 2FIKB 1U3HB 3ARED 4OUUB 5FYLD 1UCBH 4QRUA 2FL5B 2J4WL 1I3GL 3VWKA 2YK1H 1EA9C 3O0RL 4JFHD 4S1RL 1LO4H 1G7MA 3E8UL 5FDYA 3TPUB 1BD2D 3KXFE 4XMPL 3DVGA 2BNUB 5EUKA 3T3MF 1K8DA 1PZ5A 4L4VE 3PL6C 5A1AA 1TETH 3KPRA 1KB9J 5I8EB 3TO4D 1FFNB 1TFHA 2XA8H 3EFFB 3HI6H 4IJ3C 2PYEE 5B8CB 1XH3A 3ZE0E 4WDIB 4Q2ZB 4KK6C 1DQJA 4GW5B 5HHPB 3X13A 5ADPH 5MI0C 4G3YL 3EOTL 3KPSE 4TVPH 4J6RH 4R3SB 3KXFD 1KCUL 1S7RA 4P4KB 3U79A 1OAXH 1CICC 3GSNB 1W0YT 4PY8J 4L4VD 5DJ6A 1XGTB 3DO7B 3MYJB 5C71A 3IJYB 1MJJA 3FQWB 3MOAH 2DS4A 4RQQB 2C1OA 4Z7NE 5FYKL 2IG2H 3D18A 1WBYA 4CRPA 4MMXC 4LEOB 3FFDB 3G6JF 1BLNB 1EZVY 1NCTA 4RMQA 1HH6B 3KPLB 1C8PA 4MNHA 2PYED 2YUZA 4NRZA 1P7QB 2ORBL 2LVEA 4MD0A 1WV7T 2KKQA 5I71C 4P5TB 3HI5L 3KPSD 3HMWL 1A8JH 5DJ0A 1IKFH 1HHKA 3L3HB 2EDFA 4G7YL 4QNPF 1FRGH 4LLUB 4K7PX 1NUDA 1A6UH 1O5DT 1SY6A 1HQRA 5TE4L 2NY4B 3PP4L 1F4XH 4Y2DD 2GK0B 2EH8H 5L8JB 3FJTA 4XNMA 1MLCB 3DVNB 1AO7E 4KK6D 2OK0H 4L3EB 4EI6A 2PXYD 4X4XB 3QIUA 1DQDL 1WWCA 1DBMH 3BRDA 5ICYA 1L6ZA 3DYPA 5EORL 3OG6B 4NP4L 3TH3T 3QHFL 1ZLSH 4JZJB 2PW2B 1CXLA 1CFQB 2IPUK 4ZD3H 1I7ZA 1FHGA 4NWUH 2E8ZA 5HGGS 3DXAA 3O2VH 4A6YH 3W9EA 2VN4A 5E08L 2X4SA 4X5WA 1RUPH 1UQSA 5F96H 5DFTA 1AO7D 4IOIB 4OD2B 4FXGB 5I1DA 2QV2A 1FCCA 2PNDA 3G5VB 3ZMRA 4L29B 5GRVK 1KB5B 1QBLL 2XZZA 3RA7H 3V6OE 4OIIH 1BQHG 1I9JL 3LKSB 3NABL 3G5ZA 4PJ5E 1KYOK 4XPTL 2DQHH 5J6GA 4WGVB 3RWGB 3GSOA 1NCNA 1F3DJ 3ULSA 1FG9C 2ARJA 2CK0L 3OKMB 3JV6A 1UM5L 4NKMA 5EO9B 3TNMB 4JFXB 5LWYH 3ULUE 3E3QE 4LLDA 3T1WA 2D7TL 1JZ8A 1NCCL 2R0ZH 4O2FA 4ZPTB 2VMFA 3TJHD 3DHMA 3KYOB 4DKAA 4HV8A 4FOMA 2NXYD 3JVGC 4HLZH 4K3DH 5I1IL 3CLEL 4F80A 1EEZA 4PB9L 2OR9H 3TWCH 2RJMA 4MDJB 4G5ZL 1TJHL 2BXYA 3A0OA 4D8PA 1P4BH 5F6HJ 4DCQB 3GSQA 2MMXA 3CUPA 4BFBD 3ULUD 3Q6GH 1A4JB 2BOBB 4KRPC 5HVFB 4I77H 1XCQA 3VWJC 4Z7QF 4Y16A 2GTWA 2JF1A 3X3GH 2CQVA 3RHWF 4ONGH 1VADA 1HCFX 1N7ML 3FO1A 1JTPA 3IU3A 3TVMC 3U36B 1LO5A 3MXWH 1XZ0B 4PJXF 2HT3C 3WDIA 2X1QA 2FJGA 1DQQB 1IBGL 1G7JA 2F9BT 3FN0H 5IHUH 4P2OA 2AJZA 1M05B 2XWJB 2JB6B 1MWAA 5BXFB 5IMMB 3FHQA 2BJML 3DNKA 4PJCA 5DMJB 3U2SB 1T20A 1D7FA 1MHPH 3GSWB 4M7LL 3LZFH 3QEQB 3G6AA 1ZHKB 3LMJH 3DRTA 4V1DE 5DUBB 4MA7H 3QDJA 1NAMA 3NN8A 3VWJD 5FFLA 4P2RE 3SDXA 5D6CB 1S8DA 4UAOC 5I1EL 3F7VB 1S5IL 3LN5A 4J7RA 4S11A 1N3NA 1QFPA 2ITCA 4ORGA 2B1AL 4PRHE 3SKOA 3RZCB 3B2UD 2H8PB 3VXME 4NGHH 2VE6B 1V5JA 3D2UA 3I3EA 4MJ2A 2HT3D 5J3HC 3P4OB 2YA2A 3LSOA 4NQEA 4P3CH 4KZEH 1YPZE 5GRZA 5EO0A 1UXSB 3CPLA 3NTCL 5E8NB 2PR4H 3MV9A 4OGYH 3D48R 3N0PB 5FKPA 4P2RD 4WU7B 2AJXH 4PRHD 4IRSD 1WC7B 1D6VH 1KCLA 3ILQC 4BUGA 4WWKA 2HJLA 4FXKB 2MCG1 1NBYA 3BIKB 3JTSA 2WLYA 3OAUH 2OZ4L 5C07A 2OTPA 4ZYKA 5M7QA 1ACYH 5LXGL 3VE0B 4J3WA 4HKZB 5CP7B 3EZJB 1AHWB 4OZGA 3L5XL 5I1GH 1QFOA 4OM1H 1A3LL 4YXHL 2DWDA 4TUJA 4NKIL 4J8RB 1G1CA 1S7SA 2QBWA 2XKSA 4P46C 4MD5A 1JHKL 4OZFB 5J3HD 2DQIH 1OLZA 4TTGA 3OJDB 1D5ZB 4KV5E 4KJYA 5DA4A 2YRLA 5IBLC 5EU5B 3BKYH 5DHYA 1UH2A 5I8CB 3FQXA 1GC1C 5IHZA 4MS8A 4E5XA 1IM9B 3SDYH 5I75B 1U8MA 5CJOH 3OGCB 2J8UA 3RI5K 1YEGL 2ADIB 3AU1B 3NFSL 3SDCB 3S5LA 4OFKA 4X6CA 1HKFA 3MCKB 3ILQD 5D1QC 4LHJB 2X4UA 2CDEB 4FNLL 2BVTA 1D5BA 1KJ2H 3CFCL 1MQKL 2X4QA 5A2KH 2VQ1A 5HGDB 2VYRE 2B39A 2PYFA 4HFWB 3VI3E 2FATL 1BGXL 1NH6A 1Q9OA 1TJGH 2D4DA 2VUYA 3C5ZD 3DGCR 5T3XL 1QD0A 3VFPA 3D69A 4J3UA 3B9KB 4P46D 1RV6X 4H0IA 1QBMH 4PV9A 3DX7A 4PJIB 2UZIH 1V8HA 2WINA 4LSRH 5CSBA 4OZIB 4MXWL 5TE7L 5FAAA 3DBXB 4L5FH 4LSSL 4ZPVB 4UV7L 1RUMH 1NLDL 2CO6B 4P9HH 4Y4FA 4DTGL 4R96B 1JPGB 1VPOH 5DLML 1OM3L 3BPCA 2QSCL 3IKKA 2OQJB 3MLXH 3BEWB 1Q1JH 3SOBH 5KTEH 2D4FA 4O9HH 4QGYA 3S34L 1R5VA 2CLVB 3KLSA 3HAEB 4PG2C 1SM3L 1JHLL 5IFJA 2VDML 3G6JA 1S7XB 3MTRA 3BZDA 4M6OL 2O5YH 4M62L 4P23C 2VLME 3TT1L 1YEIL 4C54A 4Q9QH 3V5DB 1TCRB 1JGDA 4ODHL 4NPYB 5ANMA 1JBJA 4JE4B 4OGAC 1GHFL 5TH2B 5D72L 2VXQH 5KSAA 4RAHA 3LKOB 1RUAL 4OCRL 2FGZA 4R0LB 1NCDH 3QUXC 1U6AH 4PJEE 3GEWB 5JMRA 2BNQA 1AH1A 4PS4L 4X98A 2CIKB 2VLMD 4CKVX 2VIRB 4FFZL 2DQUH 3S3PA 1J1PL 5J12C 3VCLB 3LPWA 4I2XB 1F6AA 1LO2H 4QWWC 5E8EB 1BBJA 3DX6A 1IAOB 3J7HA 4F7EA 1MVUA 1FZOB 3O3BB 4MAYB 1I7TB 2QQQA 3BOVA 3KYNB 4C4KO 5JDSB 3ZE1F 5DVKA 4UT6H 3H42L 1UCBL 3ARXA 3PHQA 4P23D 1IMHC 1Q9KA 2LU7A 2GJ6E 4ZOEA 4HWZB 2L0DA 3ULVC 5EU4B 4MAUH 4OGAD 5KJRH 3TA3A 3B9DA 3O6MH 5E6YA 4IIQC 3NIFE 1J88A 1JPFA 3WMSA 5JORA 5IJKC 4WHYH 1X7QB 1XFPA 1EJ6A 4LARL 2PTVA 4XI5C 1OAYL 3U9UA 32C2B 3QWRD 4ZO6A 4K55A 2VZVA 1FORH 1TQBB 5EU6A 2P5EE 3ULVE 2GJ6D 1YMME 1EHXA 4QTHA 3TNNB 2WY3A 3QXAA 4J6RL 3UROR 4ELMB 3MNWB 5BV7B 3MCLH 3BX7C 1RIHH 1MRFH 5ENWA 1Q94B 5CWSB 3LRGA 5D7IB 1G6RA 4L3EE 5HGBA 1A22B 3MRPA 2ZOLB 4XNUL 2HLFD 2HKFH 2P5ED 3HG1A 3ULVD 1KCGC 3IDJB 4WGWB 2J5LC 1YMMD 3EDFA 2AI0H 4XAKE 3QI9A 4QRSA 2ESVE 4PGBA 1UENA 3QJHA 5JHDB 2ZNXA 5GHWL 2BZDA 4NKQB 5HXMA 2NY4D 5IVXF 3V4VL 4KVCH 1ZS8A 5EC2B 4K8RD 1PY4A 4JFOA 1IZKA 5D7LB 2PN5A 1AGFB 4PJXA 4DFIA 2ADJA 1ORQB 2B2XL 4YO0A 2NTFB 3KYMB 1G7LB 1JN6B 3RNKA 1B4RA 3KS0J 5CKGA 3OKOA 2BVQA 4XAKD 1AKJD 2ESVD 1GAFH 2P8MA 2XWTA 3MRCB 1ZLSL 4M6NL 5ID0A 1KEGH 3T04D 3LPFA 2CO7B 3LHPL 5GGSB 4WHCA 3UTTB 4NO5A 5DD6B 2F5AH 4XB7A 1AY1H 4NWUL 2EDKA 1AD0B 4QY8A 1H8OA 4A6YL 1BZ7A 1LE9A 4PD4J 1ZHBB 3GMNB 5F96L 3T0WA 4UOW1 4GMSL 2ED7A 5GRVL 3W2DH 3ZHLA 3O8XB 5JXEC 2LFGA 3X3FH 2EXYD 5CZKA 1YQ2A 5C0CB 1NMBH 2ICCA 4I0PA 1A1NA 4HUWB 4KKCC 1LVEA 3DYOA 4KDVA 1LO0H 2HMIC 3NACH 2AV7B 3H7BA 4JJHA 1YJDL 2X4PA 3WS3B 5IHBA 4PBVC 3UP1A 2CKBH 4JZNA 3RWIB 3RWEB 2A6DA 2R1WB 3FFCE 1SJEA 5C0JB 1H3WM 5BJTA 4UT7H 1HILA 2YD2A 5DZNA 3HNTL 1F90H 4XMKH 3U0WH 3IS1X 2IADA 4BKLB 3R06B 1DEEA 5HDQH 2OMNA 5IP4A 5LGHH 4F15C 3TCLB 1R5IB 1PD6A 4QXUL 1NDGA 1T66D 1EHNA 5DJZB 3VXNA 1OAZL 3MRIA 1OPGH 3NZ8B 4R90H 5E9DB 2A83A 5E00B 4CADA 3VRLE 3PUCA 3FFCD 1T0MA 1TVBB 2XZQL 1ITBB 2OR9L 2R23B 3TWCL 4RNRB 2EE6A 4JPKL 3GRWL 4XPFH 4NQXB 1FN4B 4F3FB 2Q3ZA 4L4JA 3VXPA 3PG2A 1QA9A 3O2DL 4KFZC 4KKCD 5INCA 2ATPB 1Q9LB 3MMEA 1NC2A 3FRUA 2EC9T 3GJEB 4TQEH 4Y5XA 4IDJL 3SKJH 3QEQE 3VFVA 3MJ9L 4HC1A 2CMRH 4LCYA 1H15B 1WAAE 4LSDA 4PJ7B 2YPLA 3MXWL 5L9DH 4JREC 5A2IH 3BZFB 4HS3A 4JO3H 1BQHB 1IC7L 4P9ML 1AXSB 2FLBT 1Z0NA 5IBTL 1XCTA 5D7JA 1FBIL 3HB3C 1IRAY 3H0TA 3KPTA 1S5HA 3MRNB 4POZC 4S1DD 3VXTA 5DYOA 3HC0A 3QEQD 1MHPL 2LE9A 1TMCB 3DWTA 4OI7A 3EOYG 3QAZC 3DROA 4LVEA 4KKAC 2W59A 5IWLA 5I66B 3MQIA 1FV1B 2NCMA 1YEJL 1CD1B 3QIWD 4LDEB 4XC3L 3EHBD 4MA7L 2EYTA 4GRWF 1CDGA 3WLWD 1A0QH 5HHOE 1MCSA 1J8HB 1L7TL 3V5KA 3MXVH 4QRPA 1L9NA 3AS3A 4KQ3L 2GUOA 1HZHL 4WV1B 5DZOA 5DURD 3FB8B 4HJGA 3OJ2C 4MSWA 4KMTH 3SGEI 3NFNB 4HWUA 1JF1A 3IDGA 3QWOB 1MIEL 3NZHL 1TTGA 3AS2A 2IAMC 3QPQC 1EFXB 2C3XA 1R3IH 1Y0LA 4S1SL 4WJ5A 4H8WH 4NKOB 4QRTB 5H37G 4HBCH 1L4IA 1NSNH 1ADQA 5HHOD 5JNYA 1CE1H 4OGYL 4NWTH 2OLDA 3E0GA 2FX8L 3FONA 2HTKC 5DJXB 4EZMA 3O2WH 1AGEA 4POZD 2AJXL 2F54A 3CSPA 3RGVB 3DYMA 4P5KA 1I7UA 1P4LB 4N0UB 2AAVA 2BNRB 3IDNA 1MFBL 3RY4A 1OQXA 4HZAA 5SWSB 3T8XB 5C8JB 3HRZA 1DQTA 2X7LA 4MDIA 4PJBB 3ECBB 3T1FB 3FO0L 1G7HB 2EDHA 4GSDH 3WJJA 4ZNEA 3SGEH 3HE6B 2F58H 3HA0A 4XCCH 2B0SL 4JQXA 2O61A 2Y7QA 2XTJC 2VO5A 5IROC 1JUFB 1U8KB 3HUJB 1ZVYA 4BQ6A 3VG9B 1A3RH 1BEYL 4L3AA 3S5LG 5J9PB 2DQIL 3BD3A 1NMCB 1HHIB 3BKYL 5HI5C 2Q76A 3VD5A 5DQJA 1CDIA 3MJ6A 4D3CL 1WITA 5E7FA 4FQIH 1KJMA 4JFFB 2J3SA 2B4CH 2NY6D 1FYTB 3GZKA 3STLB 4QRRE 2JJTC 4HWNA 3G5XA 3OKKA 2EO1A 4OGZA 5E70A 1W72H 2ZOKA 4MCYA 5EZOL 2ZZUT 4X80H 4ZAKD 4AT6B 3QUYA 25C8L 1A14H 4ZXBA 4PJGF 1BM3H 5KAQF 3FMGL 1J05B 3LOWA 4NRYB 4NQCE 1R3KB 3PHSA 3FQTB 4NUJA 2C7UB 4YNYB 4J4PD 4UIKL 5HVWA 1HH9A 3HZVB 4MB4A 1J18A 1RZGA 2OSLB 3L95A 1TJGL 3ZSTA 4UQ3B 2G60H 5FGCB 5LGJB 4QRRD 2WBJC 1EGJH 4D2NA 4TN9A 1YY9C 3GMMB 1QEWB 1SYSA 4ZMAT 4ZUVA 1VGEL 1F8TH 3BP7A 3NH7H 4U05A 1R3LA 2KZ1B 2IANE 1UT9A 5I6XC 1T5XB 4GRLA 5DVMA 3ARGC 1M71A 5HI5D 3IVKA 5BVJA 1EJOH 4NQCD 4JPIA 2H9GB 2V9RA 3NCMA 5A16A 5IB4A 4JPVL 1KB9K 1S9YB 3HFMH 3RDTA 2VLLB 1VPOL 4XC1H 2D2OA 5I8OH 3D85B 1SHMA 1T1YB 2AXFB 1A2YA 1Q1JL 3GJFH 5F1IA 2R56H 3IXAA 4G6JL 2EXWC 3OR6A 5HYJB 3VGBA 1T80A 1X6LA 5DA0B 2IAND 2VLKB 5ICXA 3PXHA 2XNAB 3GJFK 5IKCA 4HGWB 3S6CA 4YHZH 3Q5YA 1NBQA 5CP3A 4WI6A 3BIBX 4XCFH 3K4AA 4YPGB 4XT1C 4Q9QL 3QO1B 1BBDH 2WBJD 1NFDF 3VW3L 4YHLH 3DV4B 3IDXH 4X6FB 3V0WL 1E4WH 5FKAB 5F7HA 4O00A 5IVXA 4TSCL 5KS9F 1HXMB 1NC4D 1KG0A 1IGMH 3ARGD 3CMOH 1HIML 4C56A 4GG6B 5L8LB 5GS1A 5H2BB 4GW4A 1KPUB 3O3DB 4MJ5B 3HCVA 2W38A 1U6AL 3VH8A 4FA8A 3HAEH 2P7TB 4KGLA 4YHIB 5D1ZD 2DQEH 4BZ1L 4ZFOL 3I6KA 1X5IA 5FIEA 4GS7B 4OLYH 3CVHH 1YYMH 4MX7B 2DLHA 4LLAA 3AGVA 2MKWA 3M8OL 5CBAB 5K9KB 5HHMA 4AEIH 2P1YA 4ORZC 4LSTH 4H0GA 3LY6A 1VFBB 5B3JF 4JQIH 4UT6L 3VMNA 3L7FA 5GGUB 3UAJC 5KANI 2FYYB 2HJKA 5CILH 4E41A 5J56B 2ZPKH 1JL8A 1M4KA 4JEGB 1KBGH 3W9DA 4ELME 3WN5C 2DJ4A 2BDNH 3KJ4C 1MEXL 4IRJA 1DUZB 2DYPB 4L4TA 3SKUD 4M7JH 2FO4A 4JN1L 5D6DA 4LSPL 2BC4B 5I15H 4GJTB 4TRPL 4ODSL 4LMQE 3LD8C 5E2UL 3DUUB 1S9WB 3F12B 1TZIB 2PW1A 1QLFB 3QBTB 1X5LA 4I9WE 5JHDE 5TGBB 2ZSWA 3QXVA 5E94A 4JO1L 4F37F 3AVEA 3BPNB 3OKNB 4HWEL 4PGCA 3N1QC 4QOKE 5CIPA 1RIHL 1BJ8A 4QRUB 1WBXA 4H20H 3WIHA 4JRXE 1BQSA 3VWKB 2YD8A 1QNZH 4TTDD 1FIGH 4DEPB 1G7MB 2EZ0C 1F3JA 2HKFL 5EOCH 4I9WD 2YZ1A 3DVGB 4PRPA 5JHDD 3RY6A 1B2WL 1X5HA 1K8DB 5EUKB 4WO4B 5HHXL 1PZ5B 4IMKC 4NM4L 4YUEH 3UTTE 1A02N 1X5AA 2E7MA 2XZCH 4LK4A 3WS6A 4DKDC 3HZYB 4QOKD 4C83A 4OSUH 4PV8A 2RR3A 4RFOL 1WJ3A 4Z95L 2VDRH 3ZLQC 4OV5A 1XH3B 4JRXD 1M7XA 4GXVL 1DQJB 3LVEA 3WCYA 5TF0A 2NQCA 3X13B 3GSNL 5F97E 4Q58C 3UYPA 1S7RB 4HIXH 1MUJA 2R69H 1RURH 1GL4B 2ZG2A 5HHQA 2EYSA 4UTBL 1MJJB 4NCC2 4G8EA 4FQXA 1CD9B 3HKFA 1CLZL 2C1OB 3C8DA 3D18B 1WBYB 1MCPL 5DMGC 5CEZE 1S9XA 2E9WA 3QUZC 5CD3A 2DI8A 4MNHB 4NRZB 2PTTA 5FO9A 4MD0B 1I9RL 1BMGA 2EZ0D 5TPWH 5KBNC 3UJJH 1P9MA 2XA3A 4QO1A 3OHXA 3U7AA 4LGSB 2FHFA 1DBKH 1FDLH 1GGYA 1HHKB 5C1MB 3V7AE 4D0BA 1D9KD 1UEMA 4HHAA 4PJDF 3MCG1 5E9DE 3WEXA 1LO0L 4NHCH 5FYJL 4XNMB 4C57C 1LK3L 2IGFL 4CAGA 5CEZD 4EI6B 3C5JB 1GJIA 1D5IH 4PRAA 2FX9L 4M43H 3LEXB 2DJSA 5ICYB 3WSQH 2Y1VA 1CLOL 3H3PL 4N0CA 4KJQD 2Q7YA 4BFGA 5FB8B 4LRIA 4PJAB 2P46B 1F90L 4XMKL 3U0WL 5TDOA 3T0VA 4EI5C 4UTAH 1I7ZB 3MRGA 3MRJB 3QFJE 1VFAA 3O6FD 3PGFL 3W9EB 1N26A 3MRBA 2X4SB 1LMKA 4X5WB 1UQSB 4TVPE 1CN4A 1OPGL 3SGDI 4QLRA 5I1DB 4M9OA 2OMBA 1KB5L 4IMLA 5L2JA 5KSBF 4PLKD 2EDNA 2JB5H 1P7HL 3UZVB 4N9GA 4U1SB 4JY6A 1PGRB 3G5ZB 3QFJD 5J6GB 4OAWA 43C9A 4TQEL 1UA6H 1NLBL 4TVPD 3ULSB 4O02H 2H3NA 2ARJB 2QQLH 1JWMA 4NKMB 3BZEB 4OCXL 3UJIL 4LLDB 5KG9A 1MJUH 4JO3L 4XNYL 3PNWA 1KELH 1EVUA 1FZMA 4XNXL 4QTIL 3C60C 4ONFL 4HF5H 4O2FB 3LRSA 3U1SH 3BKMH 5T5FH 3VXSA 4HV8B 4OFDA 2AXGA 1RSFA 1J0ZA 2FEDC 3BAEH 4W68A 3SGDH 3O45A 2OXGA 1EEZB 1QHOA 5JOPE 5C0RH 2YEZA 3TCXA 4YE4H 5DRWA 1F4YL 2DWEB 2HKHH 3GSQB 3V6FA 3PWPE 2QQNL 1BVLA 3CUPB 1KLFA 5TQ2H 2DQDL 4EOWL 4Y0GA 1XCQB 1AQKL 5GGTH 4Y16B 4X9FA 5T1KA 2GTWB 1F4HA 5AYUH 3ZYZA 4DGVH 4N0UE 2XN9A 3QQNA 2GQHA 1VADB 3FO1B 4CU7A 4PRIA 3IU3B 4CMHB 1XAUA 5BW7C 5I1CH 5EB9A 1LO5B 5JOPD 4TYUA 1A6ZA 4PUBL 2FJGB 3I75A 4IOFC 1DLHB 1J10A 3PWPD 1TZGH 4HUKB 4MQ7A 5E8DH 4P2OB 2AJZB 1R3IL 5FDWA 4PJ9A 1MWAB 1Y18A 2F5BL 1ZLWK 4PJCB 3I6GA 4NWTL 1T20B 4Y5VC 4XVJH 2FEDD 3O2WL 3OZ9H 3G6AB 5JIKA 1IGFL 1RZJH 2JCCB 4KTEH 4NQDA 1F2QA 3DRTB 4OCWH 1ZWIB 3QDJB 1NAMB 4XCYA 4KY1L 4KUCD 1OAUH 3NN8B 5JXAL 1T7XA 4M1GL 4XPGH 3ARBC 5C08A 4UT9H 4JFFE 1HHHB 5I1LA 3LN5B 3SJVA 1N3NB 3K2MC 4K9EL 4U7SA 4ORGB 3SKOB 1NFDA 4QF1A 1EUTA 2YPVH 1C5DA 3IDYB 4GSDL 4K71C 1T04A 2CUHA 2F58L 3D2UB 5MEOA 4XBGA 2F53A 5KS9A 1MCOL 1IGTA 3BDYH 4LSUH 3LSOB 2ADFL 1GGIH 3IFLH 4NQEB 3GBML 5CINL 1C5CL 4LVOC 4Q9BA 3CPLB 1WFUA 4KHXH 4KJPC 1AJ7H 4E9LA 1CFVL 1FIEA 5ACLA 1EXUA 1ZKAA 5FKPB 1HHGA 4JFFD 5FGCE 3HE7D 1HNGA 5I76A 5J06A 2B4CL 4PP2A 3T0EA 4KK8D 4WWKB 2HJLB 2NLJA 1HK6A 5DFVC 3BWAA 1NBYB 3JTSB 1A5FH 3MFFA 3V79C 5C07B 4ZYKB 4FP8L 4OF0A 1GSMA 2HH0L 2KBGA 1IE5A 2B8OT 4OZGB 5J6HA 1JIBA 4MXVF 1C5BH 2E8YA 2DWDB 2MTPA 5FUOL 4TUJB 4NBZB 4I4WB 1CFNA 3GBLA 1S7SB 4MD5B 4OQTH 2YA0A 1RVFL 1KCVL 5DHYB 3FQXB 4U3HA 1VB9A 4KJPD 5IHZB 1U8MB 2UVEA 2SEBA 2VKWA 4K07A 3PGDA 2J8UB 3S9DB 4NN6C 1IEAA 3HFML 2DJUA 3S5LB 1GPOH 4X6CB 2ITDB 3MBEB 4Q6IA 4XVUC 3TZVA 2X4UB 4OLZL 1PX3A 5I19H 1D5BB 4F58L 5IT2H 2X4QB 1UJTA 2VQ1B 4JR9H 1QRKA 4JHWL 2G5BA 5DGRA 1JRHI 2NY0C 2PYFB 5DT1L 3PV6A 4MB3A 3MODH 1Q9OB 4S10A 5CJBA 3VFPB 2KZWA 1JMZA 3VH8G 1PLGH 2A6JA 3D69B 1N0XL 1MLBB 2VDOH 1RZIB 3DX7B 3T0DA 1E27A 4JG1H 1JYXA 4YHLL 4CN1A 2WINB 3NCEB 3FT2A 5E03A 4MNQE 5FYJU 3RJQB 1ZVSB 5HGAA 1IGML 2QHLA 3TBWA 1MY5A 4Y4FB 3I84A 3I3DA 1EBPA 3SGJA 2X4OA 1RULH 3BPCB 4F33A 1UKSA 4HMCA 4KAQH 4KROC 3L3JA 3VXRE 5EBMA 1QSVA 2NZ9C 4OLYL 1R5VB 1GH7A 4PB0L 4XVUD 1I1AA 3LQZA 1HE7A 1YYML 4LL9A 3KS0H 1T83C 3RVWC 1VEPA 4TOYH 4HXAH 4RA0C 5IFJB 2FECL 3G6JB 1KJVA 2VXTH 1XIWA 1YN6A 4MNQD 3O9WA 5C0DB 5DJ8A 1JRHH 1YPZF 3RL2A 5C0BA 2VZUA 2PCPB 1C1EH 1MCHA 5CBEA 5C0AB 2Z9TA 4KVNH 2NY7H 1SEBA 3VGFA 1BZ9A 1JGDB 5CILL 5GISL 4G80A 3I02B 3VXRD 4ODVL 2VLRA 5KSAB 3ZSSA 2DB8A 3O3UN 4PJDA 1W8OA 1KEML 5DQ9A 3MJ7A 3S3SA 1G9NL 4X6BA 4P9HC 5BZDA 3ZDZF 2BNQB 3OX8A 3C6LA 3O4LA 3L6FA 2IH1A 5CZVH 1UZ6E 4L9LA 2IFFH 4OJFL 5DMIH 3W39A 2DKSA 4AEFA 4Z77A 4JHAH 5SWQA 3KPRE 4J3OC 4D94A 1F6AB 3D0LB 1BBJB 1DBBL 3DX6B 1ORSB 1OWWA 4N9OB 4F7EB 4HIEB 1MVUB 2O5ZH 3AREA 4X7DC 4XX1G 3O4OC 3TLRA 4ERSH 3Q3GB 4HT1H 1HKLL 3W0WA 4B50A 3LEVH 1QZ1A 3VWKD 5I1JH 3PHQB 3VFNA 5D2LF 4V2CB 3MLRL 4QCIB 1BD2A 1J0KA 3LN9A 4HPYL 5KSBA 4LASH 1BOGB 4I1NB 2XQBL 5GJTH 3TA3B 1NGPH 3C6SA 3TO4A 3KPRD 4F9LC 3G04A 1XR9A 4JGJA 2FJHA 3B9EA 1JPFB 5JORB 1R6VA 1DJSA 5F9JA 4CJ0A 5I1AA 1JGUH 3DMMC 1UYWL 4CVXA 1OW0C 2CDFB 3U9UB 1T4KA 1HWHB 2NY2D 4OLUH 1QLEL 2DMCA 5GRJH 4HX1A 4OSUL 3N9GL 5KVMC 4AZ8A 1RZFL 5EU6B 2VRAA 5BV7L 2VLJB 4M5ZH 3KXFA 3T65A 1HDMA 1UWGL 2Z31C 2R2EA 1FZKA 4MLSA 4YHYB 3QXAB 4XAWH 3BZ4A 2CXKA 1GZPA 5CJ5A 1YQVH 4ALAH 5ENWB 1NGXA 4GFTB 1G6RB 2PYEA 4PPTA 1T21A 4WEBL 5HGBB 4Y4HC 2WK2A 5ID1A 5IB1A 4YGAB 1L0YA 2IPTH 3HG1B 5C7XL 4J3VA 2ENYA 3QI9B 4QRSB 1FAIL 2ZNWA 5TPWL 3UJJL 4L1HA 3LQMA 3EFDH 5FUZL 1FDLL 1DE4A 3I2CH 2ZUSA 3DXAE 3DMMD 2NY3B 2DLFL 2DLIA 4U7MA 4JFOB 4MA1B 1XGYH 2PXYA 4NHCL 4OD1H 4PJXB 3QIUD 2ADJB 1HOCA 1IGYA 4FS0A 1U3HC 4YO0B 1CG9A 1D5IL 2Z31D 4YEFA 1TPXC 4M43L 5GGQH 3RNKB 4Y4KB 1OGAD 3GI8H 3OKOB 3T2NL 2FIRT 4LSQH 2GT9A 4QYOA 2P8MB 2XWTB 1EO8L 3T4AA 5ID0B 3S96A 4U6XA 4NO5B 1PKQE 3DXAD 3Q48A 2XG4A 4Z0XA 1HHJA 2DICA 4Y4HD 3BD4A 5AG9A 5EUOE 3VFUA 4QY8B 1BZ7B 3ALXA 3QZWA 4PGZA 1OSPH 1N0LA 5D7KE 5LGKA 1MCJA 3GMRA 2ZCKL 1BWWA 1Z9LA 3LCYA 1BQLH 4WI5A 3V9FA 1FNFA 4HUNB 4I0PB 1A1NB 4DGIL 2OL3A 3KPMA 1A7NH 4OT1H 1S9VA 1WWBX 4RIRA 4QHKJ 5DO2C 3WD5H 2EECA 4RDQF 1N5AB 1U3YA 5DD5L 1RZ8A 5A3IC 4KWUA 1F5WA 4PGEA 3G08A 2Q8BL 3NPSB 4TNVF 3U6RA 4PFEA 2A6DB 1SJEB 2V2XA 3TP4A 4AEHH 3TBSB 5BJTB 1Z9MA 4O02L 5D7KD 2C4FU 1S7WA 1VERA 1HILB 2AJ3A 4FZEH 1A9EA 5IBUG 1T1ZA 1MREL 2HYMA 5E2VH 2I24N 1OCWL 5KAQG 3NIFF 1DEEB 3VMOA 5I30L 5HI4D 5KOMC 2YBRA 3WUWA 4Z7OF 4RFNC 1CDBA 3TJHA 1MHHA 1NDGB 1CF8H 4LSVH 4XZUA 4EVNA 1IAIL 1TQCB 1IJ9A 3LN4A 3VXNB 2AXJA 3MRIB 4CADB 3S36X 5I1KH 4KTDL 1T0MB 3ULVF 4UNVA 3PWLA 4YE4L 2R8SL 2CGRL 5I73B 1YNLL 4M00A 3VXPB 1QA9B 5DO2D 3CK0L 5E24E 2CDGA 1NC2B 3QUKA 3FRUB 3IKCA 6CGTA 4P0DA 5IW1A 3EYOA 4Y5XB 2DIAA 2APWA 3VFVB 5BS0B 2JIXD 4IBLT 4LCYB 3ZYIA 3BPOC 1A7QH 3QDJE 5INDA 4YDLC 1IT9H 2DM2A 4R8WH 2WUBH 3SDXE 4UILL 1G6VK 4XP4H 1XCTB 2XG5A 5F9WB 3VI4F 2B1HL 1KNOB 2V5RA 1JGEA 3JVGA 1S5HB 3MJGX 1VSCA 4R97B 3VXTB 5DYOB 3HC0B 2ZG1A 5SWZE 2H2PC 1IQDA 1ETZB 3VD9A 2W07A 3QDJD 1FPTH 3MV9E 3NGBC 3VWJA 2NY1D 1YYLL 2EYTB 1N64L 4JKMA 3T77A 4I3GA 1OAUL 3RNQA 3V5KB 4XPGL 1IC4H 4QRPB 4UT9L 1LWRA 5C2BL 3ZHDA 1BP3B 3TVMA 3WHE0 4O2EB 1XGQA 4HJGB 4RMUA 3QCUL 4MSWB 4NC1C 3GI9H 2VZ3A 1JF1B 3IDGB 5SWZD 4APQC 3IFOA 3LQAL 2J6EH 3IU4H 2BERA 2JE8A 4LSUL 4WJ5B 3IFLL 1Z9OA 3MV9D 4J3SA 4LAQL 4AENB 1I75A 3FOMB 1BFOA 4ZNCD 1AJ7L 3UYRL 5JNYB 2C26A 1HINH 5GGVH 1VGKA 3FONB 3RL1A 4PRHA 2WMPA 4IRSA 1JHTA 1AGEB 4GAJH 4ZS6D 2F54B 4U6VH 2COQA 4KK9C 4P5KB 1I7UB 4UDTA 1V7NH 3QQ3A 3BKCH 3IDNB 1V3LA 2QR0A 1D5MA 1YMHA 2AVGA 1YPZA 3EZ8A 3HRZB 4BQ9A 3BRGC 3MROA 1SBSH 5KW9L 2X7LB 2Z35A 1TVDA 5C3LD 2AK1L 3QCVH 2W1NA 4KU1A 4UI2A 5ESAA 1HYSD 4HKXA 4CNIB 4IEFB 1P4IH 4KI5C 2YD3A 2Y7QB 1BQUA 4HUXA 2O61B 1NCBH 4WNQA 2VZ1A 3QA3B 3VFRA 2XRAL 2LVCA 3EDKA 1WIPA 3MRKA 4MS8D 3DJ9A 3BGAA 4EIZC 1BIHA 2IFGA 5F7EH 3EO1A 5DD0L 3STZA 4S1QH 2FGWL 1QHPA 3T3ME 5T33L 4YFDB 4DZ8A 2AK4A 1FSKB 2ERJB 3OKKB 1CGSH 4KK9D 4UIMB 4WTZA 2ZOKB 4MCYB 3BP5A 3OBAA 1PX4A 4HW6A 3QUYB 5L6YH 1WAAF 2BFVL 4ZXBB 1WIUA 4HDIA 3QEGL 3MYZA 1PZUB 1PKOA 4RBPH 2K1MA 1J12A 4K9EC 5I19L 5FM5M 1UVQA 4ZQKA 1HH9B 4HKBA 1RZGB 3L95B 4G6KL 4P46A 4JCLA 3T3PE 3U0TA 4KI5D 5GRUL 4Y1AD 4PBWD 2X40A 3W81A 4JM2C 3U9PH 1SYSB 4CDHA 4ZUVB 1AR2A 3BP7B 1SJVA 1BIIA 1R3LB 2WIIA 4GRLB 3IVKB 1M71B 3BGMB 2RHEA 5DK0A 1DR9A 2V9TA 4JPIB 3HN3A 2FRGP 5DJDA 4RWYL 3LKPA 2B4CC 5A16B 4G8GA 5IB4B 5ANME 3RDTB 1RUKH 4QNPE 4NO3B 4KUZH 4DGYH 4KAQL 4DN3L 1JZ4A 4XP9L 1A2YB 3IXAB 6FABL 2HFGH 2Y5TB 4CU8A 4K7FA 3QQ9C 2BNQE 2IPKA 2UYLA 1RJZA 5ICXB 2YMXH 3BHBA 2VR4A 5IB2B 3RVXD 3NIDF 1G9MH 1MFAH 2OJZL 1LP9E 2NY7L 4GKZA 4W6XB 2IWGA 5IVXB 3AY4A 5HY9A 5C6PB 4MCZA 5LCVH 1BFTA 4C56B 3QDGD 3BN3B 1ZHLA 3UPCA 1WIOA 1U8HB 3QUMA 3O81A 4CU6A 3VH8B 1E6OL 2R9HC 1GOGA 1Z5LA 1CDHA 2ARJQ 3I6KB 2RQ8A 4NHUA 4XHJD 4RWHA 4OLWL 3LIZL 3ZKMD 2OP4L 1FL5B 2ZKHH 2AKRA 5J8OA 3VG0L 2YUXA 4DN4H 4RCAA 1OP5H 2PKDA 2Q3AA 5HHMB 3ROLA 1VEOA 1R0AH 1OLLA 2GI7A 5IMKA 3QQ9D 2DOCA 4WFFE 4P23A 1QSEB 2W9DL 4R9HA 5I1JL 3MRRA 3L7FB 4LHUA 1OP5K 4UUJA 4NO2A 2HJKB 4BSVA 4E41B 5JPMA 1T7VA 2Z4QA 3W9DB 5D96B 3TM6A 3TESA 5FO7A 4IRJB 3CXDH 4P99A 1WFTA 2FO4B 1J8KA 1QP1A 3QUXA 4Y2OA 1Q0YH 1I4FA 1UKTA 2VXUL 2WWKT 3QWRA 4WFFD 1B90A 5C0EB 3PWNA 2QADC 1U8LA 1HQ4B 1EZVX 3HG1E 1CGWA 4XBEL 2R9HD 5GRJL 2GJ6A 3MLSH 1Q0XL 2I27N 2PW1B 3IDIA 5T5NF 5KVDH 4Z7QE 1JPST 2ZSWB 4FG6C 2OYPA 5E94B 2EDBA 4PGCB 2BOCA 3UBXA 5CIPB 5DUPH 4U1NA 1DQLL 4M7ZC 3F7RA 2H32A 1WBXB 5EZLA 2DQGL 3D9AH 3V4UH 2BHZA 5D2NE 4PY7A 3EO9L 3P0YL 3RTQD 4X5XA 1YMMA 5DR5L 5KSVA 2XY1A 4R0LC 1QSFA 1F3JB 1JPTH 4IIQA 4YC2B 1UACH 5GGVY 3HMXH 5IJKA 1QKZL 3RUGE 2P5WA 3U4AA 4MVBC 5F1KC 1UH4A 3DVIA 4D9RE 5D70L 4M1CC 1RK1A 4HCRA 3CVIH 4C83B 3N1MC 5F9DC 4PV8B 4ESKA 2FWOA 1UZ8A 2QADD 4OV5B 3WFBH 5IMLB 4UNTA 1OAKH 4N5EC 1AXIB 1AKJA 2ESVA 3QZWG 4FG6D 2ZP0T 1K4CA 2H6PA 2HVJA 5CJQL 4U0RB 3NCYS 1IFHH 5FHBH 3L5WA 5HHQB 2EYSB 2BK8A 4XRCA 5D93B 1ZGLA 3X11A 3KJ6H 4FQXB 4LBEA 3KHQA 1S9XB 4HPOH 3I9GH 5CD3B 4GO6B 1J7VR 5EIVA 5A40E 2PTTB 3U4EA 5FO9B 3MLYL 3UZEA 2EDXA 1PEWA 4OUOA 4U33A 5D71H 4I13B 3D39A 3QEHA 3ZTJH 1JF5A 2Y6SD 4GRWB 1AFVL 1SY6L 1LD9A 1VACA 4AG4H 4D0BB 4GQ9H 2YC1A 4HHAB 3VFOB 1E6JL 5ISZE 1NKRA 1KIUA 5DHVH 5DQDH 4M1CD 5DK2A 5LQBH 1DL7L 5BRZA 1MHEA 4MA8H 3UJTH 2DQCL 5DK3A 3ZKND 3WUWG 1UADC 1OTTC 1DVFC 2MQCA 1OP3H 4N5ED 4JFEE 4YBLB 2A1WH 2HT2D 4LQFL 1C16A 2Q7YB 4D9QE 5TF1H 3UPAA 4FZEL 5IESL 1CXEA 3GFUA 1JWUA 1DSFL 3B83A 4ZO9A 2GAZA 1LO3H 3WFDH 4NO0D 1OP3K 5IEKA 5ISZD 1F2XK 3MRGB 4F2MA 4YDIH 4LDLB 3LKQA 1CF8L 4LSVL 4ZTPH 1W0WA 2YPLE 4UB0H 1K3IA 5IFHL 5I1KL 3D25A 4JFED 4IMLB 4QXTB 4YQXL 4EUPH 4D9QD 1NCAH 1FQ9C 1E4XI 2WNGA 3IGAA 4N9GB 4MZ3A 2P44B 5A2JH 1ZLUH 3RAJH 4NJAL 1KF9B 4OAWB 43C9B 1BF2A 4ONHA 2UWEF 4JFZL 4AM0A 4X4YA 1DVFD 1U8NA 4NJ9H 2YPLD 1ZLUK 2D0FA 2H3NB 9CGTA 3F8UB 1KSRA 3P73A 2XI9A 4Q9CA 5HJ3A 1INQA 1A7QL 5IEHA 5KG9B 5EBLA 5D7JD 3PNWB 1FZMB 3Q2CA 4QRPE 5F93C 5K9JL 1KCSH 3O8XC 1RK0A 4FXLA 3LRSB 2XICA 3IAPA 5H94A 2AXGB 5CJXC 1GOHA 3Q1SH 3BJ91 4DVRL 1XGRA 1WAAA 5IBUB 3RWHA 1OP9A 5DRWB 2QTEA 1BVLB 1XF4A 5IF0A 3QIWA 4QXGH 3MRLA 3KLHD 1E4XH 1FPTL 2R0WL 1FFOA 4XWGH 4U1KA 1AXTL 3QXDA 3ARFB 5T1KB 2F54E 2HTLD 3F6LA 5F7KC 2V7HA 5CSZB 5EPMA 4L8SB 2XN9B 4LF3B 2F8VA 2IBGA 4PRIB 3LRHA 3QDAA 4RAUA 1QYGH 3ROOA 1T6WA 1PG7L 1CYGA 3INUH 5IMOA 3UZQA 4P2QB 3NA9L 3I75B 4EN3B 1MWAL 3VXQB 3A6CH 5ERWA 4U3XA 3IU4L 4MHHI 5FDWB 5HHOA 4PJ9B 1Y18B 3P9LB 5GSVA 1Q38A 1CDJA 1PQZA 1RZKL 3V5HA 2YXMA 2EE3A 3I6GB 3WNMA 3E6HA 1PEZA 4JAMA 1K4DA 4R2GC 1NAML 4I3SH 3GB7A 2UV3A 4NQDB 1PVHA 1FO0A 1KTKE 4XCEA 2DQJH 4ZFZB 4XCYB 4U1IA 5C08B 1SBSL 43CAA 5IQ9A 1QUNA 3VFGH 4AMKL 3QXTA 5I1LB 1MI5E 4HKJB 3SJVB 3V4PH 4ZUSB 2X1WL 1QG3A 1NFDB 4G6AC 4QF1B 5EO1B 1JFMA 4LVHB 1C5DB 5ECJE 2A77H 3PWUA 3RKDC 2ZUTA 1A47A 4MQXD 5GJSL 1T04B 1H3PH 3ZE1E 3HHRB 5MEOB 4F57H 4XBGB 3MJ8A 2F53B 3BRFA 5EZIH 1I9IH 2XKNB 1IGTB 4AL8H 1J0IA 4WTZG 4OZHF 4O5LH 1T2QH 5MP6L 2IALA 2R2HA 5C0NC 1HCVA 3WLBB 4H88H 4OKVA 5F6IC 1EXUB 3ETBF 4RGOH 4U1HA 1HHGB 4GAYB 1MI5D 2ILLA 1O0VA 5I76B 4H26A 2ZUQB 4H5SA 3U4BL 4PP2B 3T0EB 4XNZB 2P8PA 2NLJB 4R2GD 2YRPA 1I1RA 5GZNC 5MENE 3MFFB 4WV1C 4LKXB 3O6KL 5E4IA 3EYSH 5IFAL 3UYOD 1NAKL 2VISA 2DQFA 4J4PA 4Q7DA 1L7IL 2VWEC 2ICWA 2UZXB 5J6HB 2XQYG 2PETA 5HVGB 3P9WB 4QRRA 2XTLA 1YC7A 5ACZA 5IROA 1CFNB 3DGGA 3LQAC 2X05A 4HEPG 3TH2T 5LVEA 1TITA 5EA0L 2HP4A 5J1AA 1CTOA 5MEND 1U95B 1L0QA 4NQCA 1OSZA 1DLFH 2QHRL 4AJ0A 3BEVA 3F62A 4NBXB 3G9VA 4R4BA 2SEBB 2VDLL 1JV5B 5E6IB 1V7MH 2P43B 3PGDB 3DO3A 2JJTA 3TC9A 3EW3B 4OZ4A 4DKFL 4I48A 1IEAB 1EERB 4JLRB 1HWGB 1IILE 3GKWH 5IVXE 4DGYL 5H35A 2R39A 3TZVB 3RGHA 2VXVH 2YD1A 4M6ML 1FGNL 3TIEA 2AQ1A 2IANA 3HE6C 1MCBA 2O26U 3CX5J 1P53A 4NCC1 4R4FL 3S98A 2G5BB 2YMXL 2E27L 2D03H 3JV0A 4X8XA 4R4NC 2BX5A 5L2KA 1G9ML 4XBPA 4M7LT 2W92A 2WBJA 2A6JB 1KLGA 1WEJL 2HRPL 2A2QT 5ITBL 2DRUA 3WFCH 1NC4A 3LH2H 3MLZH 5EBWA 3ARGA 3FT2B 3EJJX 1TXKA 4RRPG 5LCVL 3BXNA 5HGAB 3TBWB 4E41E 5D1ZA 3BKJH 1JK8A 3SE3A 3REVA 3JWOH 4YDJA 1RJLA 2OZ4A 3GIZH 4LHUG 5EBMB 4FZ8L 2E7LC 4L4TE 3S36H 1I1AB 3LQZB 3MBXH 4L3CB 4PTUB 3QDMA 5E1HB 1KJVB 5FO8A 1XIWB 2DTSA 4HZLA 5DJ8B 2X41A 5CUSL 3HC4H 4PR5A 4RDQG 3RL2B 5E5MA 5C0BB 4M8VA 4XPBL 4KTYA 5CBEB 3QG7H 3V52H 2EDJA 1MCRA 1SEBB 1KTDA 1BZ9B 3VFWA 2ZCLL 4G80B 4MNGB 4Q0XL 2VLRB 4L4TD 1FNEA 3B4NA 1KENH 2G75B 3OB0H 4PJDB 5DQ9B 4S0TD 3MSPA 3UC0L 5EH1A 3O3AA 4X6BB 4KZDH 1Q0YL 3QIBD 5BZDB 1VEMA 1CK0H 3UBXG 5JOEA 3C6LB 3L6FB 2IH1B 2B20A 4BK4A 4RGNB 4PRPE 4FQCH 1JFQH 4OCNC 3B6SA 4XX1E 3W39B 1I8MA 1J1XH 3SQOH 2YZ8A 4Z77B 1DBJH 5SWQB 2OR8A 4HJ0C 1F3RB 2EE2A 1I3GH 3AREB 3AUVA 3MLTA 5BVPL 4K7PL 4S1RH 1CFSA 4L8BA 3NCJH 3E8UH 3ABZA 4LIQH 5CGTA 3VFNB 5E1AA 4XMPH 3K4DA 3D9AL 3I85A 4ACPA 2QKIA 4XXCC 1BD2B 3WN5A 4PRPD 1MHCA 4M4RA 1LNUA 2OI9C 1JPTL 3C6SB 3TO4B 4MJ6A 1NPUA 2YRZA 3G04B 1XR9B 1P69B 2FJHB 3K81A 4X6DB 4ZO7A 4QOKA 5F9JB 5I1AB 1HI6B 4HMEA 1QFUL 4GS7C 4CVXB 1N6QH 1T4KB 4G3YH 3EOTH 2UWEA 4B7IA 2VITA 4JRXA 5K9OA 2EO9A 1RUQL 4K94L 3CFKA 3HI1A 1MIML 3KXFB 3T65B 5DJCA 1HDMB 3BN9C 1EHLL 1DDHA 1FZKB 3ALWA 4L4VB 5FYKH 3BZ4B 1TZHA 2A73A 4HJ0D 3MUGA 1G6RL 3CJJA 3FQNA 1GZPB 2OTUB 4P2YA 2XPGB 2Z8RA 1WCBA 2ORBH 1D5XB 2Q87A 2PYEB 1T21B 1CS6A 3WNLA 3HI5H 2E6QA 5ID1B 4S0SD 4G7YH 2PTUA 3KPSB 3L3IA 2NW2A 3BGFC 1NFKA 5TE4H 3RVVD 3PP4H 1D9KA 3ZL4H 3K7UA 1X5GA 3RI5F 1DE4B 1AGBA 3BH8A 2A0LD 1CQKA 1KOAA 1QFWL 1UH3A 3AB0B 3LKRB 4W81A 1DQDH 4GAFB 1BJ1H 3BPNC 5EORH 3CU1A 2PXYB 4MA8L 4NP4H 5MI0B 4M7KL 4GKNA 1HOCB 1SYVA 2W0FA 3QHFH 1MY7A 2DBLL 1CG9B 1B0GA 1Q8MA 4FFWD 4N0CD 1WTLA 1A21A 2FZ3B 1XF3A 3P11L 2GT9B 3OF6A 4QYOB 5FOBA 5EU7E 1S78C 5TF1L 4M6AA 3T4AB 4JFDE 3S96B 4DEPC 5E08H 1PJ9A 4HWBH 2BVPB 4U6XB 4WI8A 3O6FA 4G8IA 5EOTA 4UBDD 4PDCE 3TO2A 2D7MA 3S4SG 4Z0XB 4WO4C 1HHJB 1CVRA 1AO7B 3VFUB 3OKDA 3QZWB 4ZTPL 4XP5H 3KG5A 3CH1B 5IHLB 3C8KA 4Q6YA 1QBLH 2X9WA 4BQ8A 1UZ6F 5GS2H 1EEUA 3NABH 1IARB 3VD7A 1KXQE 1S7VA 4PP1C 5T1DL 2QSTA 5C0GA 2OL3B 3KPMB 4JFDD 4RIRB 3QRGH 4XNQA 4NQSA 3VXSE 3QFJA 3VD3A 1FZJA 5JZ7D 1RZ8B 1U93B 5JOFB 4BSJA 1YECL 1UM5H 3G08B 4M48L 4PJGE 3U6RB 3RPIA 2AJYL 4ELKB 5BZWA 5B3NA 1KFAL 1S7WB 4OZHA 2AJ3B 4RFEB 2IQAA 1A9EB 4WHTA 3FAWA 3D3VE 1T1ZB 4EI5A 4I5BA 5DDHB 4YBHA 2YBRB 3CLEH 4JDVB 2XN9E 5IV2B 1MHHB 4GUPB 4PB9H 4XPHH 3VXSD 4Y89A 4PRIE 4XZUB 4G5ZH 1TJHH 1ONQA 4EVNB 3PWVA 3LN4B 1R24B 2WSKA 1JMXA 2VB5A 4UMGA 3QULA 3ET9F 4YHKL 5JIIA 3DI2B 3PWLB 4YHNA 5EIIA 3KYKH 4BH7A 3RVUC 4BFIA 5E8OA 3D3VD 3QDHA 2FJFB 1N7MH 3QR2A 1F42A 1B0RA 1INDL 5CGYD 2AEIT 2CDGB 3QUKB 1G0DA 3IKCB 5IW1B 4YGVA 5HTSA 5C2UB 2AP2A 1A64A 3PP3K 1IBGH 4KDTA 4NQDE 4LKCA 3FB6A 1I8KA 3V8CA 5INDB 5E6ZA 3FQUA 3PWPA 3WHE1 2BJMH 3ARYA 2K3TA 3MNVB 4I3RH 3FHAA 2A6IA 2Y06L 5DJAA 3A6CL 3SJVE 4LCIL 1ZGLP 4A6YA 5F3BA 3KPNB 2E6JA 2L7JA 4Z78A 1JGEB 5KS9E 1CXKA 4WW2C 3E2HC 1OARL 5AG8A 4N8CL 5AAMA 1IQDB 4NIKB 1A7BA 3Q5OA 3BUTA 3WIFA 4I3SL 5I1EH 1S5IH 4HIHA 3VWJB 3WFEH 3B2VL 2B1AH 3T77B 5IVZA 2YSSA