3VH8A

Kir3dl1 in complex with hla-b*5701
Total Genus 78
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
78
sequence length
275
structure length
275
Chain Sequence
GSHSMRYFYTAMSRPGRGEPRFIAVGYVDDTQFVRFDSDAASPRMAPRAPWIEQEGPEYWDGETRNMKASAQTYRENLRIALRYYNQSEAGSHIIQVMYGCDVGPDGRLLRGHDQSAYDGKDYIALNEDLSSWTAADTAAQITQRKWEAARVAEQLRAYLEGLCVEWLRRYLENGKETLQRADPPKTHVTHHPISDHEATLRCWALGFYPAEITLTWQRDGEDQTQDTELVETRPAGDRTFQKWAAVVVPSGEEQRYTCHVQHEGLPKPLTLRWE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system
molecule keywords HLA class I histocompatibility antigen, B-57 alpha chain
publication title Killer cell immunoglobulin-like receptor 3DL1-mediated recognition of human leukocyte antigen B
pubmed doi rcsb
source organism Homo sapiens
total genus 78
structure length 275
sequence length 275
chains with identical sequence D
ec nomenclature
pdb deposition date 2011-08-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00129 MHC_I Class I Histocompatibility antigen, domains alpha 1 and 2
A PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3vh8A02
3.30.500.10 Alpha Beta 2-Layer Sandwich Murine Class I Major Histocompatibility Complex, H2-DB; Chain A, domain 1 MHC class I-like antigen recognition-like 3vh8A01
4YPGA 3UC0L 2DJUA 4NRZA 4PJCF 1PG7W 4X98A 5LGJA 1WAAE 5B8CC 3G5XB 2HVJB 3OSKA 3WNNA 5DA4A 4CW1B 1U8NA 3WIFA 4UV7L 3ILPA 1A3QA 3KHOA 4P2QB 2R1YB 5IUSA 1MNUH 1N2RA 4H88L 4UIMA 5IB4B 4H8WH 4P57A 4NM4H 1U8MA 1CFSB 3LKPA 2V6HA 1M7DB 3IS1X 2YUXA 3MLUH 4P23C 4OD2B 1M71A 3BVNA 1KB5B 1SBSH 4OZ4B 1CK0H 2J6EA 1HWHB 5D7LB 1OSPL 4WENB 2FGZA 3O0RL 3GM0A 2X4OA 2E9BA 1B0RB 2DD8L 2VZVA 2Q86B 15C8H 5B3JE 4AEIH 5KSAD 1S3KL 2FO4B 5DJZA 3EYSH 1X5FA 1OAQH 4M1DL 3RBSA 5LKNA 3L5JA 3VXSB 4PJ5E 3FB7A 5BXFB 1QVOB 1A2YB 5I1EL 4L1HA 1CZ8L 2P24A 2GQHA 3OXRB 5DLMH 2JCCA 3EJJX 4MGXA 4OLXL 4JM2A 4NKOB 4CNIA 4UOW0 3RZWA 3VWKD 5D2NB 1F6AA 1FBIH 2GK0B 4ZUVB 4ZUSA 4Z6AT 1WAAA 1PG7L 3F7VA 3N1GC 3ULVD 3PL6B 5IOPB 2NYYD 3V6OE 4OFVA 4NM8H 1R5WB 4Z7OE 1MCEA 4UT7H 4LP5A 5IR1B 3MRKA 3IDIB 1YYLH 6FABL 4XNMB 3P9MA 1C08A 4Y5XC 1IAMA 3BGAA 2BRRL 2B1HL 4WI6A 3DWTA 2I5YL 2KZWA 3GRWL 4NN5C 4Z7WF 1F3JB 4PV9B 4YHNA 4PLJD 1YEFL 5GGRY 1K8DB 1SYSA 5DZNA 2OK0H 3ULUL 1CF8L 5E6ZA 5I6XC 2JJVA 4NRYA 2Z31A 3BQUD 4HKJA 3TBTA 1ZGLB 4LLQA 1U92B 3IGAB 1TVBB 2GHWB 4GRWE 1XCTA 4LNVA 5IFJB 1A9EA 4LLVB 4MDJA 1D5XB 1UACH 4MAUH 3IDMA 5FYKH 4HJ0C 3H3PH 3DHJA 1AI1L 4C83A 1P7KA 4BQBA 5MENB 5IG7A 2BK8A 1PKOA 4PJCA 4FZEH 3DVGB 3GSNL 3RUGB 4Q2ZA 4CVUA 2RQ8A 4UUJA 5T1MB 4LEOB 1SEBB 4L9LB 1HXMA 3VA2C 5BV7H 5F9JB 2P46B 3CC5A 4HJGA 3FQNA 5J13B 3MUJA 2EDEA 1XGYH 1FO0L 3FB8A 5I1IH 2EDQA 1OTTC 3INUH 1OW0C 3D87B 4TPRL 4DOHE 3TNNA 1UKQA 3MYZA 4WUKL 5DJAA 1XF5A 1MCDA 3BD3A 1QACA 4G80A 5TE4L 3QXAB 3PWNB 5I71B 3RIFK 4KK8C 4P9HH 1JN6B 3FRPA 1N64L 3P9LB 3KLAB 32C2B 3GMMB 1EEQA 4O9HL 2FZ3B 5B38B 3O4LD 2YBRA 4U6XB 5ANMA 3H3KA 3FB5A 3GJFH 1I9JH 5I30L 4O2FA 5CEZH 3REVA 5H35B 3NFNA 1FLRH 2ITDA 1J11A 2IFGA 4W81A 1KTKE 5D1ZD 1TTUA 1HHIA 1ORQB 4R0LC 4OCRH 1J1XH 1NMBH 3JWOH 5J12C 5EORL 1ZHNA 1XGQB 5LBSL 1UT9A 5TF1L 2Y5TA 4XTRD 5FA3B 3HMXH 3MJ8A 4C55A 4KVNH 4XCFH 3HC0B 3SDDD 1BIIA 3QT2A 4BH8A 5ACLA 5C0AB 1NCUA 2OXHA 4PRIE 2APXA 5I19L 3HE6C 1VHPA 3RGHA 2VLKB 3TESA 4U05A 1WFNA 4KKCC 1G9NH 1JNHA 1CICD 5CGTA 5GS0H 4EVNB 1E28A 1RZ8B 3QUZC 2O5YH 5I18L 1VEPA 3QUYB 3T2PA 1P4IH 1XF2A 2Q3ZA 1MHPL 1U8HB 4ZAKA 4YQXH 5F93C 1GC1H 3W11C 3OZ9H 3I6KB 4D0DB 1KPRB 3L3JB 1NL0H 1PBYA 4Y2DD 3CFDA 3HI5H 1QSZA 2J6EH 5T1KD 4JHAL 2J88H 4OF8A 5T3XD 5BRZE 2UYLA 3ES6A 2OSLB 5I16B 2UWEF 5KSBB 1JFQL 5K59E 2YUZA 1E4XH 4YX2L 3S34L 2FHBA 5LCVL 4WHDA 5CEYA 3BKMH 7CGTA 4ODUA 2AEPL 4N9OB 4NQCB 1EBPA 1ORSA 1J12A 4LIQL 2AEQL 3R0MA 4L8SB 2C3GA 5DZOA 5MP6H 5IHUL 1QNZL 4GAFB 4IRSA 3FO1B 3GBNL 5I1CH 2IAMC 2GEEA 1U6AL 1KIRA 1KXTB 4X4XA 1XGPA 5AUMA 5L8LB 4Z7NE 1A0QL 4E5XB 5HJ3A 4G6FD 1RUKH 1WEJL 3C8KA 4KRLB 5J1AB 1W0VA 2VZ1A 4LSRH 3SJVD 3W9EA 3LMJH 4Z77B 5E9DB 3C09B 5HI4D 4F58L 3CIQA 2ZUTA 4RGOH 4GT7A 1ZLVK 4ELMF 3U9PL 3OAUL 4NZUH 2YWYA 3QPQC 4HGWA 5JDJA 3WFBH 5A2KH 2BNQB 3IJSA 1U95B 3QXDB 3VXUE 1A4KB 3AFLA 4BH7A 3ARBA 1MCSA 4DGYL 1S8DB 1U8KB 2B2XL 4OIBA 2I9TB 3U36B 1OLZA 4N5ED 4GKZB 1JCKA 1F90L 3GUTB 2V7NB 1MCKA 4ZUWA 2IPUG 1WK0A 4H1LG 3BN3B 4U3CA 4DTGL 3RTQC 4KK6D 1HHGA 3TPUE 5BW7A 3BD4A 4PREA 1DQLL 3QDHA 2IADA 3SQBA 4JAMA 1Z3GH 3IETA 4GAJL 5D9SB 3D0LB 3LHPH 5CJQL 4PGDB 3ALPA 2L0DA 5EU4A 3SKJL 3QO0A 5HYQB 4U6HB 5TDNB 5TF0A 4IJ3B 3HZKA 3ZDYF 4AH2B 2H2SC 4ZODA 2N1KA 5EZLB 4ELME 1N0XH 4U1KA 4Y5YC 2HH0H 5AG9A 2HMIC 4G7VL 3MRCA 4Y4HC 5ILTH 3MV8E 3WDHA 5K9JL 1EZVX 5GRUH 1B88A 4PJIB 4LQ1A 4RAUB 5FHAH 4BZ1H 5E6IB 4DN4H 3X3GH 2AJVL 4HXBL 4JFEE 4JG0H 3ULUC 4GXUN 2NXYD 2UWEA 4I0PC 5EO9A 5EU6E 2VSCA 5JW5A 2BSRB 4MXQA 2YRZA 1TPXB 1A6AB 4MD5B 2F58L 3QDGA 1KGCE 5CINL 3QFJA 3KHQA 3FAWA 1UA6H 3DVFA 3MXWH 3PWUA 1PLGL 3S97C 3S5LA 1TENA 3VGAB 1AGEB 1P4LB 3B3IA 2YA2A 5IB3B 4OI8A 2IANB 2YUWA 2IBZX 2X4SB 3BKCL 3TT3H 4M6OL 1ZVYA 3FT3B 2BSED 3UTTE 1R5IB 4ODVH 1GIGH 1NCCH 3OHXB 1T21A 3SGJA 1JPSH 4P4KC 2VDLL 43CAB 5I1AB 2EZ0D 4C54A 1G0XA 2HJLA 2XIDA 3DURB 1HQRB 5DHYB 5IF0B 1VACA 4Z0BH 4JJ5A 5CKGA 4CBPA 1H5BA 1RJCA 5B39G 4ELMA 5C6PB 5JDSB 1JGVL 4NUGH 3C6LA 5E8PB 3OKLA 5F6IC 2E9JA 3LQAL 4BA8A 4F7EA 1GGIH 1IJ9A 4HF5L 3MV8A 4EBQH 1LP9B 3QIWD 4KUZL 2DI9A 4YK4B 2V5YA 5KSAC 1BECA 5I2IB 3GMPA 1TIUA 4E42B 5L2KD 1E4KC 2DIJA 4JFPB 3HFML 3FQUB 4DCQB 4WTZA 3OG4B 2H9GB 3EJZD 1DBKL 5TFSL 3KJ4C 2X70B 3TYFA 1DR9A 4KY1L 5IBTL 3MODH 4ZUTB 3RDTD 5IIEB 4NKQB 4Z5RA 3CSGA 4PB0H 2CPCA 2D2OA 1A1MB 3M1BB 3ZT7A 5HYJD 2VDMH 2NY4C 2SEBB 4MJ4A 3MRIB 1YQ2A 4HUXA 2JB5L 4N0FA 4YHKL 3GSWB 5DURB 5KVEL 4JPIB 1TMCB 4NT6B 4OF3A 1WFOA 2Y1VA 1RJLB 3EGSA 1EA9C 4LEXH 4G59A 4KZDL 4M93C 1VESA 4YPJA 3SE4A 4FQXB 4RX4A 1HKLL 4KROD 8FABA 3BN9C 3ARFB 1OD9A 4WJ5B 4QWWD 3ARZA 2NY2D 3BGFB 5FB8A 5GZOC 4H1LA 4HLZG 1QBAA 2RBLA 4G8GD 3BH8B 4EI6A 4CADB 3G6DH 5A2LH 3L5XH 3F12A 4OLYL 5FGCE 5DRZA 5MERA 4HS6B 1U91B 2JE8A 4JFOA 1I8KA 4UQ3A 2QQLL 4DAGH 5ID0A 1FL6B 1YN7A 1AGBB 2O5XH 3CFJB 4QY8A 5I1JL 2BOCA 4U1JB 5I6XB 3MRBB 3V52H 4MXWL 4U2ZA 4BSWB 2OI9A 4EI5B 5GRJL 5C09E 1NANI 4RAVB 2W0PA 4L8CB 2BNRB 1IGCL 3HG1E 3GIZL 4NUJB 1JZ5A 3GZKA 3SDCA 4F7MA 3BEVA 3KWWB 1KT2B 2X10A 1J1OL 1WTGT 5GISH 4M48H 4KKLC 3PGFL 1MQKH 4QTHA 3EOAA 4CU8A 2BOBA 4ZXBC 1X5AA 3KPSD 1OT1A 1QZ1A 5DTFA 4IEFB 4CDGC 1UQSA 1I9IH 3P11H 4F80A 5ACZB 1IGYA 5I75B 2W9EL 3WUWA 4CJ1A 4M61B 1DSFH 2DBLL 3I3DA 3RWHB 2P5WA 4HKZB 4OZGB 5DD3H 2NX5D 1BJ1H 4Q9QL 1WWWX 4R97B 2R23B 4LFHG 1YEHH 4I3RH 4ODWA 4OB5L 1AR2A 3CXDL 2A9MH 4GMTH 3N1FC 5HHOE 5D7IE 3JV4B 1IQDB 1F2XK 4Y4KA 3P0VH 1GJIA 3QG7L 3THMH 2NW2A 5KVGL 5DA0B 4PJ9C 3CFIC 3I6LD 3LCYA 1PGRB 2JJTA 3EYUH 4QOKD 4JN2A 1IL1A 5C07A 1NAKH 3V2AR 3ROLA 2CUIA 2OR7A 4PY8J 4HWUA 3AS3A 5C09A 5KSUB 4LLUB 4MB5A 1J18A 3O41B 1SHMA 3TCLB 2FX9L 5D2LB 1A7NH 5DMKA 4LCCA 4TTDD 3NA9L 1E6JL 3BZ4B 5HGDB 3UPRA 1FZJA 2BVUA 4MJID 3SE3A 4I8DA 2E8YA 3MV7E 2HTKD 4ONHB 3VE0A 4MMZC 4PJFB 5BCAA 3JTTB 4O5LL 5ICXB 5KVFH 5INDA 1IEHA 1PY9A 4K94L 4CMHB 2Y5EA 1D3CA 3DYMA 4XMPL 2X6MA 4TOYH 3FOMB 3WO3B 4Y2DC 3SGEH 1M05B 4ISVB 2VQUA 3QEQE 2R1WA 2AV7A 2Z93A 5EPMA 1H8SA 2CDEA 3HE6B 2VAAB 2UVEA 2FB4H 4MZ3A 3HMWH 5CIPA 5HHOA 1WTLA 4UTAH 2R56H 1FV1B 4OM0L 3LKRB 1DANU 5EUOF 2OL3B 4UZGA 1GH7A 1BIHA 1P84K 1R3LB 3CH1A 3RZCC 4P5MB 1QLEH 3SDXF 1NDGA 5DJDA 5IV2B 5J1TC 1X5IA 1WFTA 3MROA 4R7NB 5IGXH 5F7EL 4PGBA 3ARTA 2XTJE 4HDIA 1IKFL 2MQCA 4NQVA 1XGUB 3F7RA 3K46A 3FL7A 1JPGB 5ALCH 5IK3A 1A7PL 4BFEA 3BUYA 4RZCA 2AEWA 4LPTA 3HRPA 3TBWB 1U41A 2V5MA 2R1XA 4D0CB 5GZNC 5I8EB 1NBZA 1OSZB 4U0QB 1EVTC 1A6UH 1L7TH 4NSKB 4J1UA 3O6ML 5HI4C 5C0JA 3MV7A 1MFBL 2GTWB 3VWJC 1YA5A 3WD5L 5FUOL 3QQ9D 1CGYA 2RFXB 3OTTA 4JFFE 1L6XA 3DUUA 2Y23A 1FFQA 2H32B 2EYRA 3LQAC 5LAXA 35C8L 2GY5A 3RWDA 3JVGC 3PDGA 1G6RL 3TO4A 2DDQL 4XHQA 3LVEA 1XCQB 2AJUH 4YO0A 5J8OA 4ZO6A 3BDYH 1QFWH 1HHKA 4N8VG 4V1DD 5K9KA 3H0TB 4RGMC 3SDXE 2IGFH 3HAEA 3TBSA 3I75A 4WU5A 2DQTH 3WXWH 5I8KH 2LVEA 4LF3B 2C3HA 1EUUA 4HV8A 1FGVH 3SE9H 3LD8B 5C8JB 3OAYK 3QUXB 4U1LB 1EK3A 1GZQA 2HT3D 2DM7A 5DI8B 1CDBA 4NIKB 1AHWB 4IOIB 2VLLB 1JK8A 1MHCB 2BC4B 2F8VA 2VIRA 3SCMD 3CLFL 3N50A 5F88A 2C4FU 1WQVT 1AJ7H 4KTYA 1KIPA 4X80L 5CZVH 3GMRA 4PJHB 3JWDL 5FUCC 5J3HC 4APQD 2Z31C 1JRHH 4JO2L 1S78D 2FCBA 4QHLA 2BNUB 3QYCA 1WT5A 1D7FA 4V2CB 4YLQT 3RBGA 4MA7H 4AIZB 4RMVA 1CDYA 1OP3K 4XVSL 1TVHB 1BAFH 2A1WL 3LV3B 3VFNA 1MREH 3WE6A 5D72H 2GAZB 5EUOA 3P4MB 2AXFB 2ZUXA 5D7JD 3MOBL 2EH8L 1EXUB 3SDXA 1HEZA 1KB9J 3VXPA 3F7YA 3HE7D 5JOFB 3HC4L 5DMJB 4WO4A 4F37K 3RX7A 1BREA 4L4VB 3KYNB 1DQJB 3WNKA 4KRMB 1T6VN 1U93A 5IMKB 4XGZB 4AIOA 2YPLD 4BJLA 4TN9A 1TCMA 4O51A 5J6HB 4XP5L 1UWXH 1IILE 1LNUA 4D9QD 4ELKA 1T1WA 3ULVE 3C9NA 1IAII 4PJDB 5CJXC 1AH1A 1EAPA 2VLJB 3P77B 1HDMA 3OPZL 4ZYKB 2D7NA 4NPYB 1VFAB 4GRLA 2AI0L 3FO2A 2DQUH 4JFQB 5K9OA 5CCKH 1RU9H 3PV6A 3NGBC 5DUPL 4X5WB 1EBAA 1YMMD 2EECA 2AK1H 4HPOL 5HHXL 3RGVD 1KCVH 3S37X 1T1YB 3L3OB 5T33H 1NPUA 3LRHA 3UJTL 5A40E 4DUXA 4G6KL 4PJEF 1FO0B 1DBMH 3FO9B 3C2AL 4G9FD 2QHRL 2JTDA 2R2HB 1IEBA 3QIUA 4RQQA 5HVWA 3QA3A 1KYOK 1LD9B 4Y19A 2P44B 5CIPH 2MHAB 5SWSA 3QG6B 5LWYH 1F8TL 1V7ML 1RIHH 5HYSB 4B50A 3X13A 3O3EB 7FABL 2HT2D 3F6LA 4K23H 1JV5A 3CLEH 3R06A 5FECB 3CMOL 4H25B 1JWUA 4ZSOE 3ZDXF 1RURH 1QSVA 2IBGA 2E27H 3OR6A 4J8RA 3LS5L 5KN5A 5ESVA 4X9GA 4OD1L 2AEIT 4ZAKC 2B5IC 3ZE1E 2LVCA 4L4JA 2YN5A 3VFRB 4NHUE 1S9VB 2YPVH 2ZSVA 1ND0A 1NDMB 4YXKH 4BFGA 4OGXH 2ZNWA 2WBJB 1K4DA 1RK0B 3BT2H 2X1QA 1A7RH 4R2GC 2P8MB 2R2BA 3FJTA 4K94C 3EO1A 4K7PY 1ZAGA 2C1PA 3O4LE 3V4PL 5EN2B 2F5AL 4NZRH 5J7CC 2LTQB 3MBEB 1NUDA 4RGNB 3V7AE 4JQIL 4IRSC 3LN9A 1HYRC 5D93C 4X99B 2VDNH 2VWEC 1FDLH 4LCWD 3KJ6H 4DKFL 3HS0B 3QDMA 3TWCL 4DVBA 1WC7B 4XH2B 5HGAB 3HAEH 2VQ1B 1J5OH 1WBYA 3QAZB 4MD4B 1ZHKB 1IC4L 1OAUH 2AGJL 4OM1L 4E0RB 2HG5A 3OR7B 4ZUUA 3STZA 1V7NH 3U0TB 1I8LA 4HJJH 2ED8A 3QO1B 3WSQL 1MAML 2OXGA 4HS8H 1JGDA 4MSWB 4QXGL 1Q9KA 1IQWL 4NQUA 3D85B 5J6GB 2DYPD 3FMGL 1W72A 2CMRL 4JEGB 3V5HA 1H3PL 4ERSL 2DQIL 2V2TA 2D3VA 3H3BC 4WI7A 1YEIL 4ODSH 3QEGH 3QXWA 5I17A 5JLZA 2F19H 5JHDA 2BRQA 2GSIA 1BBDH 1CLOL 1W0YT 4KKAC 3WIHL 4NO0D 5MEPA 4M7KL 4Q6IB 4PJEA 4P2OD 4W4OA 3D2UD 2Y07L 4X5LA 5DRWA 1G9MH 4OTXL 3DYOA 2DTMH 3KG5A 2E6QA 3ME0A 5T3XE 1MIEH 5L6YH 2AK4B 4FZ8H 1A1NA 5BV7B 1GZPA 2R4RH 3IJYA 1CFQB 3CGTA 2DAVA 2VL4A 3KPRA 4HEPG 3RNQA 1NGZA 1L7IL 3VXQA 1EHLH 1SYVB 4LFHD 1EJOH 1L9MA 1HHHA 3L5WB 2LV4A 4NO2B 4UU9A 4J3UA 5C2BL 2ICEB 3QP3A 1ED3B 1PZ5A 1S7RB 3SDDA 1LK2A 4GG6B 2A73A 4F57L 2LE9A 5I1KH 3H9SD 5DS8B 4Z7VB 3RP1A 4PJ9B 4FXLA 1P2CB 2F54E 1U8OA 4KTDH 5ITBH 4L29B 4KMQA 3JWDC 3SJVE 1UEMA 5C7XL 4OZFG 5GGVL 1LQSR 3QWRD 4MXQC 5C0CB 3T4YB 2GCYA 3QI9B 1AGDB 1FNFA 5F9AC 3RA7H 3GJFB 5E6YA 1RMFH 1T83A 2VERN 3WFHB 2CLRA 4FQ1H 4OFIA 2G60L 2GUOB 2GYSA 5HVFB 3J7HA 4NO5A 1UWGH 1ZHBA 1OGAD 1NFDB 3QULB 1P1ZA 4OZHE 4M6NH 4ZOEA 2CLZA 4FP8L 3TZVA 2NNAB 5B3NA 1IGMH 5CD5D 2I60L 2R4SL 1PQZA 3SGJC 2PXYC 4TSCH 4O2EA 1EEUA 2A6IB 3TFKD 1T66C 4O9HH 1CFTA 3QDJB 5I15H 3S5LB 3V6BR 1DBAL 4LSSL 4YPGB 2D7QA 3VW3H 4NRZB 3C6LC 1OGTA 5IBLC 4X98B 2XQBH 2DM2A 3Q5OA 5LGJB 2WUBL 4N0CD 4PTUA 4KXZH 5FCSH 4IMKA 3D48R 2F54A 5C9JA 2QQKL 4XPGL 2VXQH 4NJAL 3PDDA 3ULVH 1N2RB 2W9LA 4UIMB 2DN7A 5FUCE 4EXKA 2L7JA 5A16A 1JNLL 4P57B 5GS2H 3LKPB 4CN6A 3Q6FB 4ZD3H 1M71B 2IC2A 3CAFA 3I9GL 3WN5A 5DD0L 4Q9RL 1HK6A 4PJBE 1MFDL 3T3MF 4UT9L 4YHMH 4L5FH 1VA9A 3SEPA 1EX0A 2X4OB 5HDLA 2EDYA 5KZCD 2QLVB 5CMAA 4GSDH 3T2NH 1CL7H 2VC2H 4PRAA 4Y0GA 1QSFD 5DJZB 2IWGA 2X9YA 4P3CL 1C5BL 3B2VL 2MCPH 1I1AA 4N5EA 3T1FA 3FHQA 5D6DA 4P3WA 3UBXG 2B4CL 5HDOA 3W0WD 1U8QA 2P24B 3LKQA 1E4WH 5ITFB 2JCCB 2NY3B 5TGBA 4JM2B 1HI6A 4CNIB 4UINL 4F15C 4N9GA 3GFUA 4AL8H 4N0UB 4JO3H 3HZMA 1LO3H 1IAKA 3IU4L 5D1QB 3SCMC 4JHAH 1F6AB 4YHYC 4FQPA 5TE7L 1OT2A 2ADFH 2P48B 1X5JA 3F7VB 2A9NH 4APQC 1SJHB 2R29L 1JFQH 5C08D 3ALWA 3LRSA 5J11C 1LDPH 4YX2H 2QADB 3W5MA 1OLLA 4PRPD 3BPNB 5JZ7D 4KDWA 2WBKA 3CSPA 4FXKA 2VXUH 1H3TA 3P9MB 1C08B 4KU1A 3O8XA 2IFFL 4G6MH 4A2LA 4ZNEE 4Z18A 4K2UL 4YHNB 2FD6H 4XP4H 2GJZB 1GGTA 1W72H 3BZFA 3BKYH 5L2KE 1BFSA 3CZFB 3BE1L 3WFDL 4FQHB 3C5ZD 4PRBA 4QRPD 3TN0A 4NRYB 4NHCH 5DFTA 4GG8A 4HKJB 3TBTB 4LASH 4LLQB 3OKOA 3HE7C 1DEDA 3RVUC 4Y4FD 1RUAH 3IFNH 4PJ5B 1FE8L 4LHUB 2O61A 2CD0A 3BAEH 4MDJB 5ADOH 1A6WH 2ZP0T 3SDCC 1Z0NA 3IDMB 3MREA 3NCEB 4C83B 4OF0A 1P7KB 4JVWA 2IF7A 5IG7B 2X09A 4PJCB 2VUYA 4WFGD 5HYJE 1C7SA 4Q2ZB 1TDQA 4UUJB 1HXMB 1TLKA 4U7SA 1MRCL 3GJFK 4DGYH 2EEDA 3P30H 3QUMH 4CAGA 2V5RA 4JZJB 3KXFE 4XNQA 3NIGF 4M1CD 3CC5B 1JZ2A 1B4JH 4CVXA 2VR9A 5C0NC 2H1PL 3FQNB 1YECL 2W1NA 4DGIH 3BZEA 2UZXB 4YWGH 4JCLA 3FB8B 1QEWA 1YNLL 3QCUL 5CLWA 3PIQA 3QCTL 2XRAH 1OWRM 4GO6B 5E08H 2IEPA 5DJAB 1XFPA 1JPFB 1JMZA 4POYA 1XF5B 2HLAA 4G80B 2D31A 4G8GE 3C87A 2JJTC 1KXQE 4ZO7A 3UX9B 2I27N 2A6JA 3SDAD 3WCYA 2EXYD 2ADJA 4Z7UE 4WTXA 4HK3J 2YBRB 2ICCA 1FRGL 5ANMB 5HHMA 4GQ9L 1PSKL 3S3SA 5HD8C 3REVB 4LCCC 3B9KD 3ALXA 4NRXA 3I84A 1Q8MA 4NKMA 2ITDB 1A7BA 2HKFH 2IPTL 5CP7A 4LK4A 5T3XH 3WHE1 3L1OL 4JM4L 1HHIB 5A2JH 4M7LL 4X6DE 1Y6MR 4Y8AA 1PEWA 3BP5B 3UYPA 5BO1H 1ZHNB 2R0KH 4WDIA 2Y5TB 4RWYH 4XRCA 5C3LD 3MJ8B 1MI5A 1Q72L 2CGRH 3KPLA 4KQ3L 3KXFA 2W9DH 1BIIB 1NGPL 2A38A 3QIBD 4BH8B 2ERJB 3MC0A 5ERWB 4L3EA 3UPCA 3NPZB 1K85A 5DJ8A 4O4YH 4DJMA 4EQ3A 3FN0L 3AS2A 5IFHL 3KPSE 3ARPA 5FYLD 4JLRB 3RVXC 1ZLSL 4GW4B 4ENEC 1JNHB 1F11A 5A43C 4RFNB 1HILA 5D1XA 1E28B 1CYGA 2AQ2A 3T3PE 2NX5E 1JZ6A 3ARDA 5IB1A 1XF2B 2NTSP 3UZVB 4ZAKB 2B5IB 3UYRL 3MACL 5I1HH 3Q1SH 5IVXE 1Q9OA 4Z7UA 4BFIA 1XGTA 3PWPD 2BXYA 3FFCD 1IC5H 1S5IH 3BW9A 5J1SC 3ES6B 3OJDA 1BM3H 2QSTA 3I6LE 1DUYA 4R2GB 4QOKE 4M7JL 3AREA 1ZVSA 1JTPA 5CEYB 2GSGB 4TVSa 4X6DA 3O6FA 2PUQT 3KYMA 2CDGA 1ORSB 2JIXA 3IDGA 2CO6B 4FHBD 3SGKA 1NFIA 1CN4A 4G3YH 3S9DB 1KIRB 3MV9A 5AUMB 3C8HA 4LVNC 4DKEL 5HJ3B 4PRIB 3C8KB 5E2WL 4MJIE 4MHHG 4PJ7F 1S7WA 1TZHA 3KPSA 4F9LC 1W0VB 4JN1L 1YEKH 4HW6A 4NC0B 4YHZH 5FV2A 1A14L 1JGLH 2G2RA 2XN9D 3T65A 2J3SA 3MXVH 3AS0A 4HGWB 4HZAA 1ZA3A 2J12B 2ICWB 2YMXH 5DVLA 5CZXD 2V5SA 4OGYH 2EIZA 3IJSB 4J4PD 3DRQA 4N68A 5GPRA 1EFXA 3CFKA 1GGBL 2I07A 4YHLH 4BH7B 3ARBB 1MCFA 1FJ1A 3LEVH 2MCG1 4UMGA 3GSOA 2BHZA 5I1GL 4G9DA 4GXVL 3KNBA 4BZ2H 3ISWA 3IFLH 1S7UB 3S35L 5DC0A 3EZ8A 4ZUWB 1NMCC 2B4CC 4ZFOL 4IS6A 3GO1H 1IGTA 4QXUH 1RZJH 3BWUC 3N1QC 1R3JA 4WHTA 1HHGB 1GCFA 5CWSA 1WT5C 4PREB 3VCLA 4LLMA 2IADB 4HUWA 5E8DL 4ESKA 4R96A 3RVTD 1C1EL 1MCRA 2CIIA 2FL5A 3A6BH 4PJ7E 4FQLH 4DGVL 4RMSA 5EU4B 5TDOB 1CXHA 4NNPL 3VFWA 3SGDI 3HZKB 3K2UL 4L3CA 3CNKA 2A83A 3HB3C 4M62H 5DMIL 1BFTA 4U1IA 1OAZH 3UTQA 2VDPH 3NFSL 3FN9A 4Y2OA 3MRCB 4WO4C 4GAYA 3MJ9A 5IMOA 5H37G 3BRGC 4L4TE 3VXUB 4V1DE 1MRFL 5KBNC 1IAOA 2PO6A 1CT8A 5EO9B 5EBMA 1JIBA 5FYJD 4K9EL 3B5HA 5DD5H 5JW5B 1MRDH 2M26A 4WEUD 3QDGB 4LU5L 3MLVH 4HIHA 1X5YA 5KW9L 5IVZA 4GKOA 2ADIA 3UMTA 2PW2A 3PWUB 3RWCA 4UAOC 3ZSSA 3B3IB 4JFHD 1LEKA 1YPZF 4JRXA 4XWGL 1P7HL 3RVWD 3CDYA 4OUOA 3PGDA 2LU7A 1FL5A 3QSKB 3D69A 2P5EE 2OCFD 2DQDL 4PJ7A 4QT5A 4WW2F 1ZGLM 1Q9LA 3QJHA 1I7TA 1Q1JL 4L3AA 1DLFL 4XBGA 5IVOA 1UJ3B 1XR9A 1BEYH 5DEZA 4HIXL 4JJ5B 3QCVL 5CGMA 1X7QA 1H5BB 4ELMB 3EZJB 4DN3L 3RWFA 2CIKB 4OBSA 3C6LB 3OKLB 3IDYB 3QIUC 4F7EB 5GQBA 5JXAL 3F58H 3MV8B 2DQHL 4YZFE 5DQJB 1KCRH 4NCC2 3GMPB 2YD4A 4MQ7A 2AERT 4L4TA 4FQQA 5HDQH 3B6SA 4K8RL 5JQ6L 4E41D 1N6VA 5T3ZL 1F4AA 2JJUA 4DK6A 3NZHL 1Q0XL 3P0YH 3GSVA 5HDBE 1A64A 3TYFB 5IW1A 2IQ9H 2Q8AH 3IFPA 4EN3A 2CR3A 2R9HD 3EBAA 2YPLE 4HBCH 4Z5RB 5I1DA 3ARGC 2O26U 3QISA 4IIQC 4FTVA 4YDLC 1BVKA 4D9QE 1AKJD 2XZAH 1U8LB 5C0BD 3X11B 3CSBA 4N0FB 4HC1A 4HQQL 2EO9A 2P5EA 4G8IA 4JPWH 4BUGA 3V6FA 1DL7L 1FCGA 1URLA 1LK3H 4PJGE 3PHOA 3D18A 1AO7A 4XPAL 3VFGL 4WVRA 5GS1A 1FL3A 2E5EA 5F9DC 3N06B 4R4BA 3QUKA 3SO5A 1FAIL 2X89D 5FB8B 4IRJD 1YMME 2YUVA 1OAYL 1MPAH 3C5ZC 3VMOA 3U7WL 4ZOCA 3UXFA 5JA8B 4EI6B 3S4SB 5DEFA 1MSPA 3L3DB 2NY6D 1S7XA 4Y4FC 5D7JA 4QXWA 3WMSA 3I2CH 2NLJA 1T1ZA 3KPQA 4ONFH 3UTSD 1PKQE 3X12A 3O6LH 4XC1L 1CQKA 4G9FE 4LVHB 4KQ4H 1D6EB 3F12B 1I8LC 5SX4I 3WD5H 2OR9H 3L5IA 5MERB 3RPIA 4JFOB 1F45A 1NJ9A 4HKBA 1I8KB 3ELAT 3VFOA 1YPZA 1NLDH 5ID0B 3TT1L 4HAGA 1YN7B 4JFXA 4QY8B 4JB9L 2BOCB 4JPKL 2NXZD 3U1SL 3ZL4L 5EG6C 2BFVL 3UZEA 2OI9B 4ONGL 3S3PA 5B38G 4WW2A 1C16A 1CU4L 3KR3L 2ESVD 4U0RB 4CW1A 3S37H 3C5SB 4F7MB 3ABZA 1JWSA 1PW3A 4JZOA 2A6DA 2EE2A 1AXTH 3EOAB 4NWTH 2DMBA 5IB4A 4KRNA 1YUHA 2D4DA 5ICZA 3NIFF 2PKDA 1TZIA 3B9AA 1IGJA 1S9XA 4FXGA 1P5UA 3WUWB 1UZ8A 1QQDA 3DX8A 2ZCHL 2ZJSL 2FEDC 4PY7A 2P5WB 4M43H 5DVNA 4NYLA 2WK2A 3U4EA 1Q38A 3NZ8A 2NZ9C 4X80H 4JKPH 1PX3A 4Q97A 4G8FA 5I73C 3BH9A 4KDTA 4XMLH 5FF6B 1HH9B 2AABL 4EXPX 4KJQD 3DECA 1UCBH 5EH1A 5T5FH 4M3KB 2D7OA 5BXFA 2VISA 4ZTOH 2CJUL 1GPOH 4Y4KB 2DLFH 5FGCB 2KKQA 1A2YA 4R4NC 1RFDH 5FCUH 5A2FA 3MJ9H 1LO4L 5IQ7L 2NW2B 3OXRA 4TNVK 4F7CA 3ECBB 1MEXL 3BMWA 3N1MC 4N0RA 3LZFH 4KRPB 1IL1B 2EXWD 4Y1AD 2WUCH 3MZGB 3RIAK 2E7MA 3ROLB 2WAHA 4MXVF 1L0XA 4ZUVA 2A0LD 5C09B 2FJFA 1LE9B 2MJWA 2FIKA 2FHCA 4Y8DC 4HWBA 3HG1B 4ZS7H 1R5WA 3LEYH 3HC4H 1FH5L 1T83C 3OF6D 1SJXA 1K6QL 5CD3A 5ISZD 1TJHL 4KI5D 5IR1A 2A77L 1JBJA 3UPRB 2H45A 3IDIA 4RMQA 3RVVD 3L9RA 3VXNB 5CBEA 4D3CH 4GAGL 1XEDA 4R26H 4FABH 4XBEL 1RHFA 2Y06L 1MLCA 1F3JA 3MRGA 1QPXA 4HWNA 4PV9A 5INDB 1CIUA 3TZVC 4LDOB 1FNSL 2AV7B 2Z93B 5EPMB 3NCCB 1P6FA 3A67L 1ZGLA 2CDEB 3W2DL 4LSQL 2EDTA 3LQZA 4MJ2A 5CIPB 1KCUL 3DIFB 5HHOB 5IFJA 5D7IB 5DHVH 2LAAA 2EKJA 4LLVA 4MX7A 5T1LD 1D5XA 3K4ZA 3V8OA 3VRIB 4K9EC 3KS0J 2ENSA 2XQYG 3SKUD 4ODHL 1NDGB 2FATH 4MXVE 1KJMA 2VDRL 4H0HB 3F5WA 3MROB 4OCWH 4PGBB 4I9WD 4WFFE 4XX1G 2ID5A 4L9LA 1S7SB 4PJ8D 5AWNH 4NQVB 3UP1A 4OCMC 2XWBA 2HJFA 2VZ3A 1AY1L 5EOCJ 2PR4L 5IK3B 3B5GA 3BUYB 3WN5C 3BKJH 2W0FA 2KUTA 5F1SA 5TQ2L 3H9SE 2R1XB 2GJ6D 4XVTH 2C5DC 1NBZB 1F4HA 1FYTD 1U3HA 3W39A 3A6CH 4HC1H 4J1UB 5C0JB 2OP4H 3MV7B 1MCWM 3IFOB 3K3QA 4JGJA 5IVNA 4MCZA 5CSGA 1TVDA 1I1AC 4KAQH 4NFBA 1ADQA 1OTUC 5CZXC 5D6DC 3DUUB 5BJTB 2EYRB 2J5LB 2QQNH 5LAXB 3CFCL 3RWDB 3RPKA 3TO4B 3QEQB 3VXRD 3KLAA 3GMMA 4AIXA 1T2JA 2ZSWB 4YO0B 3TV3H 4PP2A 4LSPH 4DUWA 3LN5B 1HHKB 1IGFL 1N8ZA 4U6XA 5SWZD 5K9KB 4JHBA 1LO5A 3O4OC 2JK5B 5E4IA 3HAEB 3TBSB 3GKWH 3I75B 1ITCA 1KN4L 4K8RC 4KJWD 4WU5B 3EDEA 3HNTH 4YR6A 3H7LA 5BS0A 3WXVH 4HV8B 4FQCL 3H42L 5IQ9A 1HOCA 3RNKA 1CLZH 1UENA 1Q0YL 1TCRA 3VFTB 1XGQA 1OAKH 3KS0H 4Z95L 5FA3A 3O8XC 3HC0A 5IKCB 1JK8B 2VIRB 3TH2T 1CXEA 2Q20A 4NBZB 3WBDA 4MNGA 1KIPB 1NMCB 3GMRB 2NY7H 5EOCH 4RA0C 5ABDE 1QKZL 1G0YR 1UWXK 3EKCA 4QHLB 4WWID 3QWRA 1UFUA 2Z0BA 4EVNA 1T7XA 5DO2D 3TJHD 5EZJA 4PJXE 3RRQA 3WSQH 1I3RB 4LARL 4YEEA 4MAYD 2E7LE 1DE4A 1CXKA 1QYGL 1KBGH 3WE6B 1BPVA 4XAWH 2R0WL 4HUMB 5EUOB 1IQWH 5B4MC 1RIUH 1QRND 1QSFE 5C0EA 3KLDA 2P7TB 4PJIF 5E8OA 5E1HB 1NC2D 3IAQA 3SDXB 1HEZB 2JKXA 4P5TD 5DQ9A 3VXPB 3LDBB 2FLRT 3F7YB 4CUCA 4OLVH 2YWZA 4GBXA 4QLRA 3W0WE 2CKBL 4WO4B 1DUZA 4TVPD 2HYMA 4HIIA 4LHQB 4O51B 5KTEH 4G8EB 4M9OA 4P2QD 1LNUB 1XR8A 1HCFX 3EOYG 1KEMH 1VFBA 4L8SA 1WICA 4ELKB 1CBVL 4YBHA 1T1WB 1YQVL 3UJIH 3C9NB 5ECJE 5CJOL 2DRUA 5C08E 1EAPB 1HDMB 3MBXL 1KB9K 1KJ2A 5J1AA 2OJZH 3VRLF 3G6JE 3GBLA 4NZTL 4PRPE 3TBVA 5KS9F 2HWZL 4GRLB 3T08A 4JRYD 3FO2B 5F7NC 1J0YA 4MWFA 2XXCB 2MSPA 2HLFC 5K9OB 1T4KB 3PV6B 5BMFL 1UXWA 4J3WA 3VFVA 3BDXA 1KENL 3VXSD 4FFVD 3VGDA 3ZKXC 1XIWD 1QBMH 1MWAA 3V9FA 2M8XA 4QRPE 3ARYA 1P7QA 1S8DA 3DTXB 1O0VA 4AQ1B 3O2VH 4S11A 4GH7B 1ACYH 2Y36L 4JPVH 1X44A 3CSYA 1IEBB 2R9HC 3LAFA 5HYIA 4Y19B 4N8PA 4AEHH 4FQIH 2CLVA 5GJTH 3BDBA 2X4NA 4JY6A 3LB6D 3PL6D 4K3HA 1X4ZA 3DMMC 3ZZ1A 3B83A 1UM4H 4WFGE 3VWKB 5L7XL 3X13B 5C0RH 4GW1A 3QRFM 2ZCLL 4JJHA 3DPBA 4U1SA 3CX2A 1JV5B 4AG4H 2ORBL 3QHFH 4LCIH 4K3JL 3STLB 2WWKO 5D1XC 5GHWH 1EIBA 5KS9E 3OR6B 4J8RB 4YFLF 1OCWH 5KN5B 5ESVB 5C08A 4P46A 3ARDC 5FK9B 4I4WB 4HMDA 1KTDB 3MLYH 3FO0L 5F72S 2I25N 3QRGH 1H0DA 4JKMA 5EZLA 3HNVL 3SBWC 2ZSVB 1YEJH 4RISH 1K4DB 2BVEA 4PGEA 3OX8A 3W82A 3ARXA 5D71L 4PJIA 4XCYA 1OB1B 3AREC 5MEND 1FNEB 4M7ZC 4XPGH 2C1PB 3MLTA 1HNFA 1A7QH 4YUEL 3I85A 4D9LH 2E8ZA 4NFCA 2WY3A 4NQDD 3VD9A 4XNXH 4KHTH 5EZIL 5DVOA 5ALBL 5ICYB 1ZGLP 3SGKC 4MS8D 2Y7QA 1IM9A 2J8HA 1BOYA 1IGIH 1MUJB 1CTOA 2NXZC 3QDMB 1CGSH 4XVJL 5H2BA 4DVBB 3CX5J 1OF2A 2HTLD 3VU2A 4TSBH 3D9AH 4XVUD 5DDHA 6CGTA 3ESVF 3H9HB 2R0ZL 4O58L 4WHCA 2CH8A 1WBYB 1PVHA 3K1KC 4M8VA 1KB5L 1NCTA 2HG5B 3DX6A 2QEJA 4ZUUB 3ILQC 4YH6A 4ZSOB 2EDNA 3STZB 5KS9A 5L88L 1T6WA 1VDGA 3LKSA 2NY5L 4Z78A 43CAA 5IJKA 5GGQL 1JGDB 5AAWA 3GSRA 4K3EH 3O6KL 5FYLE 1F4YL 3L6FA 4NHUB 1KELL 4J3SA 5JNYA 3PP4H 1W72B 5A3IC 2NY0B 4R8WL 1B6DA 1V3JA 4OCXH 2G5BA 1V05A 1MFCH 1FFOA 5I17B 3BP6A 1KC5L 2F5BL 4JR9H 2GSIB 5MEPB 4NWUL 4E42A 4KJQC 5DRWB 3G04A 4QRRD 2NMSA 3PWPE 5GSVA 5KJRH 3O4LB 5IESH 4ZPTB 3FQUA 2D7TH 3PP3H 3FFCE 4HWBL 4HWEH 4LSUH 5CP3A 3CVIL 1IKNA 4Z8FH 3B9KA 4F7PB 4MA3B 1XH3A 1A1NB 3BPLC 3TPKA 2EXWC 3QUMB 5DYOA 3IJYB 4HIEA 3KPRB 5BOZG 3RNQB 2K7QA 5D1ZB 1NGZB 1A1MA 1UH2A 3JUYA 3VXQB 2QSCL 5DD1L 5I73B 2V7HA 1EO5A 4W6XB 1JYWA 1HHHB 4AYFA 5E2UL 4U6TA 4LRNH 4UU9B 3QPXH 1PZ5B 4KI5C 5AZEL 3SDDB 4JPIA 1LK2B 3BZDA 2A73B 3QIBA 3RVVC 1RJLA 1N7ML 4JO4L 1OOAA 5D2LF 3ET9F 1U8OB 1PY4A 5DFVC 1HZHL 1KXVC 5EBGA 3R0NA 5LXGL 1VFUA 1BFOB 3BYYA 3BI9X 2V9QA 4HCRH 2PO6C 3L3HB 1CICB 4OIIH 12E8L 4JDVB 2Q8BL 1KJ2H 2OMBA 2XN9E 1JYNA 2GCYB 3DVIA 4PJFF 3BRDA 3MLRH 4XP9L 2W07A 1PZUB 4I2XE 2CLRB 4CADA 3CVHH 4NN7C 1QSED 1T7ZA 1TQCC 5DJ6A 1ZHBB 2J8UF 3FFCA 4OD3L 4XHJC 1LO0L 4HS6A 1P1ZB 4NQCD 3TJEH 1X5KA 3GI9L 2X9WA 3DETD 3TZVB 4R7DB 3CFJA 4MVBA 3TVMA 2YKLH 4K3DL 3U9UA 5EWIL 4R4FL 4EI5A 3MA7B 1CFTB 4LQFH 1V3MA 1ADQL 2B0SH 1N6QL 1OGTB 3O9WC 2UUDK 5E9DD 1KT2A 4OF6A 4LSDA 3UZQA 4NZDA 3MLWL 1ODAA 2F54B 5C9JB 3HTLX 3RKDD 2BNQD 3TA3A 4X7EC 3SJVB 3PXHA 3BGMA 3NIDF 4I3SH 2B1AH 5A16B 3I50L 2H8PA 3FQRB 4ORGA 3NFPA 2HT4C 3WN5B 5EZOH 4JQVA 4XCCH 4EN3C 2DL9A 3QHZL 4MA8L 5D5ME 1CDGA 1GAFL 5CMAB 4PR5B 4PRAB 1JF5A 1IQDA 4WUUD 3KPMB 2APFA 5FYJE 2Q76A 5E4EB 4PUBH 4OZHB 1I1AB 1EMTH 1MH5A 3T1FB 1RZKH 1G1CA 3TP4A 4Y5VC 3V5DA 1AP2B 1KEGH 3LKQB 5AYUH 1PD6A 3LIZH 4XPBL 5TGBB 1HI6B 3UYRH 2WP3O 4JFHE 4N9GB 5GS1C 2XACC 4WV1A 1IAKB 5HI5C 1DVFA 4LLUA 4HKXA 3O4OB 3DROB 4LLYA 4U6YA 1DN0A 1ZT7A 4M7LT 2NY1C 3VFUA 2MPAL 4MNQD 4AT6A 3NCJL 3NIDE 3LRSB 1HCVA 2ZG3A 4ZFGH 1OTSD 4DW2L 3VJ6B 4PJFA 4PJHF 2B39A 3TJHC 4TUJA 3NN8A 2QJDA 4U4BA 4MAYC 3P0GB 4B7LA 3LEXA 1N5AA 3D39A 3T0WA 4PS4L 4JFZH 1EZVY 1NLBL 3REWB 2J8UA 3K1DA 5JOPD 4XCNA 3BZFB 2FIRT 2GJJA 2VAAA 3B9EA 3NCYP 3TBYA 3EYVA 3QHTC 4PRBB 3TN0B 2MKWA 4GG8B 1IC7L 3GI8H 4LMQE 3MLZH 3OKOB 4A2MA 4X7SL 5E5RB 2CDFA 1NC4A 5TPWL 4IM8A 2EDOA 1HSBA 3EDKA 5DSCB 4UB0H 2D0FA 4P5MA 1MCPH 5AD0A 2JF1A 3MREB 5FFLA 1J05A 5F3HA 5INCB 2RIKA 2LFGA 1VENA 3IJHB 2CXGA 5CP3H 1NCWL 3T2QA 3MRMA 3MYJA 1XGUA 5A2IH 4LAQH 4YXLL 1GGCL 5DQDH 1ACZA 4X5XA 1MWAL 1OAXL 4D0CA 1D5BA 1X5ZA 4XNQB 5AZ2H 4G7YL 1MQ8A 2X1WL 4EOWH 1H3VA 1WZ1L 5I8EA 4CVXB 1MLBA 3FZUD 4U6VH 2NY5C 4EIGB 4WGVB 3BZEB 4KDTC 1DBJL 4KHXH 1T04B 5HYSG 1MCWW 2OM5A 2VLRD 1G7LA 4FFVC 2WQ8A 2DKUA 4RCAA 1KTLB 1MFEL 2H32A 2ARWA 1A02N 4M5ZH 2QKIA 4Q0XH 2HLAB 4P23D 5FHBH 1TZGL 2D31B 5FYLH 3GHBL 4NC1E 1XCQA 4TULL 1UVQB 5D2NC 2BMKA 3ZYZA 1KJ3L 2ADJB 3UTSE 3S3JA 2Z91A 1S9WA 3NA4A 3MV11 1N5YL 1WWCA 4LKXA 5HHMB 3VGBA 3GMNA 1FP5A 3PL6C 5CEXA 1NAMA 3E3QE 4DKAA 4NRXB 4NNYA 4NGHH 3WFEL 2CRZA 2VDKH 4NKMB 5DURD 4KVCL 5HY9B 4QNPF 2DQCH 1RVFH 2EDFA 2FR4A 4TUKL 4U1LA 3UEZA 3NCFB 1SVZA 5D7SL 3MRPA 5DC4B 4WI4A 1ZK9A 2X1XR 1AKJA 4FQXD 3GHEL 4JFDE 4PRNA 4XP6L 3ARFD 4IOIA 4WDIB 2VRAA 1JP5A 4HT1L 2ESVE 1MI5B 3KPLB 3KXFB 4RNRB 2AQ1A 4PJHA 1G7QA 5TQ0L 4WCYH 4DQOH 2ZCKL 4KMTL 5SV4A 5DJ8B 4KROB 4F9PA 1ZS8A 1BFVH 1TETL 3NABL 3KPNA 1HKFA 2PTTA 4AIZA 1F11B 2X89A 1HILB 3SKOA 2G75A 4KPHL 3QH3A 4GLRH 4FQ2H 4G8GB 3W81A 5ESAA 5IB1B 3D3VD 3BRFA 2AXFA 4L9LC 1Q9OB 3VXMA 3UTSA 4MS8C 4Z7UB 4KTEH 1FCCA 4NP4L 4MMXC 1XGTB 3RKPA 1H9VA 3U0WL 3HI6L 2AJSH 4DN3H 4UT6L 4W6WB 3AC0A 3FCTB 3E3QA 3OJDB 2VZTA 3WFZA 4QRTA 2O5ZH 4R9HA 1DUYB 1MCOL 2BNRD 4XNUH 1NSNH 5IMKA 4XGZA 3SOBH 2GITA 4HJ0D 3WLWD 5JW4R 4GOSA 5J4MA 3AREB 1ZVSB 1D6VL 4Y1AE 2VE6A 5EU3B 5GSRB 2IBBA 4Z76A 1ZTXL 1YYML 4OCNC 1QBLH 4X6DB 3O6FB 4JFDA 3KYMB 4TNWF 2CDGB 2JIXB 1HINL 4P0DA 1I7UA 3IDGB 2ADGA 3SKNA 2VLJA 2BDNL 5ISZE 1UM5L 3MV9B 4F2MA 2B7DT 5J0BA 1G7HA 5HPOA 4KUCD 4JFQA 2WANA 2EIBA 1S7WB 1TZHB 3KPSB 1U8IB 2N7AA 2AV1A 4ZG1A 1JPTL 1OTTD 5GGUA 3V4UL 2P49B 3M8OH 4X5WA 1RD6A 3KYKL 4HQQH 2G2RB 3T65B 4CMMA 2NX5B 3HNSH 3ZDZF 1BF2A 4RDQG 2C9AA 1ZA3B 4FFEX 1IEAA 3L3OA 2EIZB 1JMXA 3WLBB 5DWUL 3DGGB 1X5HA 1EFXB 3CFKB 4KK8D 1NKRA 1SEQL 3TYGH 4GMSH 2I07B 4EDWH 2R8SH 3O2WL 1A5FL 3K8KA 1A4JA 2XZCL 4LBEA 4G9DB 4WFED 4B7IA 2YD6A 3KNBB 3U79A 1LD9A 3DARA 4WWKA 4ODTL 2VXSL 2P42B 1OAYH 2UZYB 5HGBB 3MLXL 4OZFH 2FGWL 4IS6B 3MCLH 1VSCA 3O3EA 1IGTB 5FYJH 1KFAH 1WCQA 1R3JB 3I3BA 4QF1A 5CWSB 5FECA 2X1OA 4H25A 3VCLB 4LLMB 1AE6L 3L95A 4HUWB 4PYGA 4KFZC 1EGJH 2DQEL 2BY2A 2CIIB 3QUYC 4OCSL 2FL5B 1DEEB 4P9ML 1JNJA 2GJ6E 1M4KA 2DL2A 1FYTE 4RDQF 1FN4A 5GRZA 3VFWB 4YAQA 3VFRA 2EEBA 1CGWA 4MJIB 4JB9H 4AMKL 5EOTB 3G08A 4YDIH 2A83B 1FNHA 3HE6D 3ZDZE 1QFPA 4RRPA 3S5LG 4U1IB 1QFUL 3UTQB 5GJSH 1CU4H 2VZUA 4GBXC 4YBQC 4KKCD 2HKHH 1I9RH 1LEGB 2ZOLA 2CKNA 5JXED 3O45A 1FIGL 1MAJA 2ZG1A 4A6YH 3QUZD 3VXRE 4NQXB 3BEWA 1ETZA 4IDJH 1DQML 5IMOB 1YEGH 4EJ1C 1FC1A 5SWZE 2VDOH 4WEBL 3WJLA 1TJIL 4L8SC 3DETC 3W11D 1IAOB 2PO6B 5EBMB 1GVIA 1M7IB 1SJEA 1U8PB 5TH2A 4XH2A 4LSTH 4HIHB 5M95B 5IVZB 2ADIB 2VQ1A 3OJ2C 5T1DL 3RWCB 1ZHKA 4PJ8A 1LEKB 1NAMH 4JRXB 3OR7A 1HH6B 1UM6L 3PGDB 2VITA 1A3LH 1FL5B 4TQEL 5F1IA 4ACPA 1B0GA 1RUQH 2MMXA 4P59L 3D69B 3LSOB 3PXJA 2GJ6A 2IQAA 4PJ7B 3K80A 4QT5B 1IBGL 1Q9LB 3QJHB 1I7TB 1MELA 2C3WA 3N1PC 3VG0L 2IAMD 4OT1H 2XZQL 4XBGB 1NBVH 5LQBL 1RPQA 3MA9L 2I9LA 3ZE2F 5F70A 4M02A 1EEYA 2XG5A 1MFAL 4NCC1 4RSVA 5DR5L 2QTEA 3CH8A 1CFVL 3VD7A 5DHVB 5E5UB 4H0IA 4Q6IA 3I02A 5E99L 3K74B 4D2NA 2P47B 4S1RL 3AB0B 3QNYA 3QPQD 2GFBA 1D5MA 4MQ7B 1I75A 2D9CA 1QRNE 4FQQB 4L4TB 3V5KA 5SWZA 3UO1L 3B6SB 1ZEAL 1KCSL 2HFGH 3UBXI 2H2PC 4P46C 5AEAA 4XNYL 4IJ3C 2E7HA 1O7VA 1SYVA 1ZWIA 4TVPE 5F8RC 1CXIA 5I1DB 3EOTL 5FYJU 5C0GA 4PTTA 4P2QE 2JCCF 5EB9A 1D5ZA 4NKIH 1BVKB 3RTQD 2YN3A 3PWVB 1U0QA 4YHOH 4UTBH 3B9DA 2DB8A 2P5EB 4LHUG 2YD3A 4G8IB 1P2CA 3V6FB 3EO9H 4XMKL 2D9QB 5E6IC 4P99A 4L8BA 2VDRH 4P48A 2MWCA 4JRYE 1R5VA 3D18B 4H20L 1AO7B 2OL3L 5FKPA 1FL3B 1DFBH 1S7TA 5F6HJ 1A21A 5C0CA 4R4BB 4R90H 3QUKB 1TPXC 3NPSB 2PR4H 4TRPL 1AGDA 3MUY1 3VXSE 4WNQA 5FGBA 1Q9WA 2EYSA 2NY1B 1MF2H 1JHLH 3VFPA 4K7PL 1QBBA 1AD0A 3RX8A 1UWEH 1G1YA 4Y4HD 5HBBA 3VGAC 3ARSA 4NKDB 4L4VD 3S36H 1QRNA 1GGUA 1S7XB 2QSQA 3GBMH 5D7JB 5D2NE 1EERB 1NC2A 3KPQB 2NLJB 1T1ZB 2EE9A 3X12B 3T0XA 2AJYL 4CU7A 1FIEA 5B3JF 1J8HE 3BP4A 3VFMB 4ZS6D 3RWIA 3HA0A 1UCTA 3RPIB 3PHQA 3HLAA 4QRQA 4HKBB 4ODBD 5JR1H 5IJKC 4YE4L 2V2XA 4JFXB 1FC2D 1RZIB 3MJ7A 3FRPG 4HS3A 4X4ME 1J0HA 4O02L 4JKWA 4NQED 4WW2B 5EDXA 3E8UH 1C16B 4WRLA 1MJ7L 3GK8H 3FZUC 4MQXC 2V9TA 1P69B 3MQIA 4YK4C 1F4XL 1T2QH 1I3GL 2EDWA 2VH5L 1INDH 5C6TL 1G0DA 1JWSB 4FN0A 4EUPA 5IM7A 4JZOB 2A6DB 1X9QA 4PJGB 1JF1A 3MGTA 2PYEE 4PB9H 4JRYA 4Z7OF 1YUHB 3RU8L 1T03L 5ICZB 4P4KD 3ZLQC 3JV5A 1TZIB 1IGJB 1S9XB 3Q6FA 1C8PA 2HRPL 4FXGB 1IKNC 3S88H 4WU7A 8CGTA 1UZ8B 1QQDB 3DX8B 3L5HA 2GI7A 5E0QA 3U2SA 4M8QA 4X0KA 1J10A 3T0EA 4PY7B 2XKUA 5D7KD 3DV6A 4NYLB 5DUML 5C0IB 3U4EB 3RGVB 1ZOXA 3NZ8B 2IG2L 2YEZA 4G8FB 4FRWA 3BH9B 2VR5A 1JGUH 4NQDE 1KV3A 1QKZH 2OTWA 1PKQB 2DQJH 2XA3A 3NH7L 4G9FB 1NMAL 2VISB 3S7GA 4OQTA 1J8HA 5JPMA 4NDMA 5D4QA 4GRWF 2XA8L 5ITFA 4WY7H 4S0UC 5D8JL 4F7CB 4XNZB 4OJFH 3OAZH 4FQXC 4OGAC 5BVPL 3ARFC 4N0UA 1RZFH 5D1QA 2Q3AA 2UY6A 3BGFC 3E6HA 2NY4D 2FJFB 5EO1A 5F44A 4KZEL 2FIKB 1SJHA 2WBJD 5D70L 4NO3A 3PGCA 3ZTJH 2YD7A 5IB5A 5CD3B 5CUSL 2VXTH 5GIRA 5DVMA 2PYEA 3DSNA 3L9RB 5CBEB 3VI4F 1WWBX 2BJML 1MLCB 3BN9D 3OL2A 1OP9A 1CE1H 3MRGB 1TJGL 3UJJL 4ONOA 1I8MA 2GJZA 3MRJA 1RUMH 4GFTB 1RULL 4MVBC 3CZFA 3TVMC 5GZOD 1NEUA 4FQHA 3HC3L 5JHLL 1QA9A 5FDWA 2GTZA 4QRRE 2NW3A 1W8OA 2YK1L 2Z92A 2EC9T 4NQDA 4EI5C 3LQZB 4OFYA 3ZKNC 1CDCA 2VXVH 4PJ5A 4LHUA 4MX7B 3DV4A 4JGMA 1INEL 1REIA 4QTIL 3WLWC 1C5CH 2BSSB 4UBDD 3WKML 1MJUH 3AROA 1FGNH 1T80A 1KJMB 3F5WB 4OUUA 4IDLA 1FORH 4FQJH 3TA3C 3MRDA 3EOBA 4OAWA 2P4AB 3STBA 5ADPL 5I75C 3OKEA 3D85D 3DXAE 4TTGA 2XWBB 2HJFB 3BD5A 4JZJA 1BQHA 3NACL 3CXHJ 2W0FB 3V6OA 4K71B 3KAAA 4JQVC 1AFVL 4R97C 4M5YH 3T4AB 1DQDH 4HXAH 4MHHI 3VI4E 5EU5A 2AS5M 1U3HB 4RFOH 3W39B 4KKLD 4WEMB 2M2DA 3BP7A 1M1SA 4UIKH 2OS7A 1HXYB 5I8CB 4MCZB 1JPFA 4ZXBD 4DZ8A 5JQHC 1A6ZA 3GMOA 2FBJH 4MD0A 2AK4D 4PFEA 4PLKC 25C8H 5KSBE 4P2OB 3MRHA 2OTPA 4J6RH 2ZOKA 1QSEE 4PP2B 5CJ8A 2K3TA 1N4XH 4S1SH 1N8ZB 2AXHA 5GGTA 1FVCA 1DVFC 1MNUL 4H8WL 1LO5B 4NQCE 4NM4L 4PD4J 5F9OH 3MLUL 2N7BA 1ROWA 1SBSL 4DEPB 1CK0L 4YR6B 3HCVA 1YJDH 1NFKA 5BS0B 3M07A 2RJMA 1F6LL 5IQ9B 1HOCB 3RNKB 4PJ9D 1FG2A 5K59F 4JZNA 3BP5A 5GGSA 15C8L 4BQCA 1TCRB 4AEIL 1P4BH 4BSVB 3TO2A 3EYSL 3DXAA 1OAQL 5EOQH 4PRDB 4NBXB 1CD1A 3DO3A 5E9DE 4CMHC 4TVPH 4CL7A 4ZFZA 1U9KA 3IDXH 2OZ4H 5LGHH 3H9SB 2AJ3A 3EJYC 1A3RH 5ERWA 4WW1A 3LH2H 3QI9D 3BIBX 4PG9B 3DBXA 4MNGB 3P9WB 4ZO9A 5DLML 4XX1E 2BNQE 3CDGA 4HWZA 4Z7NF 2ICES 1KSRA 4JLRA 5IW3A 3G5ZA 4GW4A 4JQXA 4XI5C 2XNAA 5JXEC 1FBIL 3OBAA 3WFCH 4EUPH 2YZ8A 2QSVA 5EZJB 2UY7A 4TYUA 4NM8L 1DE4B 4RMTA 3ZHLA 3BIAX 1YNKH 2IALA 4UT7L 5CSZB 4WUUE 5C0EB 1VPOH 2YSSB 5E8OB 1YYLL 3EFDH 1D9KA 3ETBF 3QDJD 3U4BH 4JHZA 2F8OA 5DQ9B 4JDTH 3W9DA 4S1DC 5FYKU 4GBXB 4QHNA 5B21A 1DUZB 3IKCA 3RZCD 1WVZA 2GSGA 2OK0L 2XY1A 3O2DH 4HIIB 1QFWM 1T1XA 2AVGA 4OQTH 3SQOH 3HRZB 3TF7A 3V8CA 5EU7C 5JUEH 1QPPA 2FLBT 1XR8B 1NCDH 3PNWA 1VFBB 3AU1A 3H2WA 4WTZG 4PRHD 4MNQE 4LLWA 4NOBA 1UACL 4MAUL 5C2UB 5FYKL 3H3PL 1F4WH 4PRIA 1KJ2B 4GUPA 4G6JH 1G7IB 1C5DA 4OLZH 5GZND 3TBVB 1SMAA 4FZEL 3TCXA 2EEAA 5HHVH 1XAUA 4CDHA 5EC2A 4MWFB 4Y16A 3ZTNL 5BV7L 4IRZH 4TNVF 1UXWB 3VFVB 3VWJD 2ICWA 3LD8C 5JOPE 1MWAB 4JANA 1JHTA 3RIAF 4JO4H 3QUXC 3WEXA 1XGYL 5EC1A 4JM2D 1P7QB 3G6AB 5I1IL 3INUL 1CVSC 1AHWC 4OLWH 5BRZA 4XXCC 3BSZH 3CSYB 1AGCA 1S7UA 3GGWA 2OLDA 4I18A 1T0PB 1MHEA 4OKVA 2F74A 2CLVB 2X4NB 4JY6B 1FFNA 2NR6C 4P9HL 4HIJA 5FUZH 1Z0MA 3MMEB 3R1GH 4LPVA 4GW1B 4HMEA 1NBQA 3S4SG 5KANI 2K7PA 4U1SB 3VH8A 1WISA 4DFHA 2FJGA 4JY5H 5FM5O 1KOAA 1I9JL 5CEZL 4MNQA 2EYTA 4NQSA 3HUJE 5TDOA 1A6VH 1FLRL 3PV7A 4P46B 5C08B 1TNMA 4OSUH 4ZO8A 5EA0H 2F53D 4PP1C 4KKBD 2XYCA 4G5ZH 3G6JB 1H0DB 4O2CA 2VLRE 4EDXB 4WFHD 4OCRL 5J3HD 1J1XL 1NMBL 3JWOL 4JVPA 3H7BA 1OP5H 2Z31D 5JIIA 1CXFA 4WI9A 3ERYA 1MIMH 3TEUA 4PGEB 3HMXL 4HUKB 1R3IH 3OX8B 1QFHA 4KVNL 2L4OA 4XCFL 5E2VL 2JELH 5FM8A 4XCYB 3VXUA 5HHNA 3MLTB 5KSVA 3JV6A 1SY6A 4ZS6C 5TJWK 3KDMA 1U3ZA 1MJ8H 2H6PA 1ZLWH 3FQTA 1G9NL 2WINB 2Y7QB 3SY0A 5GS0L 1IM9B 3BJ91 3WUWG 2O5YL 3OV6A 5DK2B 2GT9A 5ID1A 1NKOA 4GRWH 3QQ3A 5GGTH 1P4IL 3C60A 5H2BB 1OF2B 3TM6A 3TPUA 5I74C 4YQXL 5DDHB 1GC1L 1NCBH 5BVJA 1NL0L 2IJ0C 1LVEA 3HI5L 1WBZB 4HFUH 4ZNCD 2J6EL 2J88L 3DX6B 1I4FA 2X44D 3IS0X 5KS9B 1JWMB 5B8CA 3LKSB 4JO1H 4Z78B 2X4RA 2DS4A 5LJYH 1E4XL 1UJ3A 1Z9MA 3BKML 4FFYH 3GSRB 4OLUH 2QR0A 3L6FB 3MGAA 5JNYB 2CIKA 1MCCA 1NH6A 2P8PA 1G7MA 5KVDH 1LWRA 1LQVA 3CX5K 2G5BB 4WWKC 5MP6L 1VB9A 1BGXH 1FFOB 2BP3A 5I1CL 3BP6B 5DQJA 1RZ7H 2ICWJ 3D3VE 3JWNC 3CPLA 3OKDA 1T7YA 1RUKL 3SDAB 5C71A 4JFEA 3G04B 5B22A 5GSVB 1EO7A 4Q58C 2NPLX 1WCBA 4LSRL 5EU6A 3LMJL 4C4KO 3WS3A 4S1QH 5F7UA 2CO7B 4ZTPH 4H8WC 4HMCA 3B9KB 3WV0A 1XH3B 2BNRE 3MRFA 4N1CA 4RGOL 5ENWA 1BQLH 3HPLA 4NBYB 3MRQA 4JDZA 4NZUL 5DYOB 3P4OB 1NGWA 3WFBL 4HIEB 2XOTA 4CN4A 2AJXH 1EO8H 2XQYK 3VA6A 4MZ2A 2R0LH 2V7HB 4N0YH 3EYQC 1A8JH 2R15A 2WBJC 1U8LA 3X11A 2MTPA 4X7SH 3UTTA 1CVRA 2W60A 3RWGA 3QIBB 3BO8A 4OZGE 5F89A 1JHKH 2YRLA 4DZBA 2HA1A 5K93A 5E8EB 3Q3GB 4ZAKD 1NCWH 1BJ1J 2LTQC 3MBEC 3AAZB 4RGNC 5FGRA 3OKMA 3WIIH 1Z3GL 1OAXH 3CUPB 3JZ7A 4G7YH 3CK0H 3LHPL 5HTSA 3S4SA 3U7YH 1SMOA 3L3DA 4TSAH 1EH9A 4R2GD 3O3BB 1X5LA 3QAZC 3IDJA 4XBPA 1NANH 4N8CH 4U1NA 4PGCA 3IDUA 5DJ6B 1D6EA 3FFCB 4UBDC 1N0XL 5GRVL 3L7FB 2HH0L 2BVYA 1T5XA 1V3LA 3FQWB 4XPHL 5D7IF 5ILTL 4IRSD 1IE5A 3V6ZA 2VYRE 43C9A 1YNTB 3TVMB 2GW5A 1KF9B 5FHAL 4LPYA 4BZ1L 2FYYA 3U9UB 4YXHH 4M1GH 1IFHH 4DN4L 3X3GL 3O81A 4JG0L 4MB4A 1JE6A 1IC1A 2YD2A 2MKLC 3HAEG 3PABA 1E6OH 4I5BA 4UOW1 3C5SA 5CJ5A 2JB6A 5DMGC 4Q6IC 3E2HB 4B53A 3AY4A 1UA6L 3MXWL 4KK5C 2J4WH 3PWJA 3TA3B 1NGQH 3BGMB 2DBJA 3RAJH 4KV5F 2XFXA 3O3AB 3WO4C 3TT3L 1EHAA 3U6RA 2H8PB 4ORGB 3NFPB 3ARBD 5BV7C 2O93L 2XN9B 4ODVL 3DX7A 4D9RD 1GIGL 4I2XB 1NCCL 4D0BA 4EKXA 1AQKH 1HH9A 1U3YA 1JPSL 5FF6A 1FZKA 4KKAD 4HPYH 3KYOA 4P49A 1DTUA 4Z0BL 5IT2H 2MQ3A 3K0WA 2Q76B 1WSST 4NUGL 1EHNA 2HFFB 1MH5B 1T2XA 1GGIL 3ECBA 5E2JA 4FFZH 4EBQL 3V5DB 5K9QG 1SY6H 5DJCA 2DLIA 4P9HC 1OPGH 5E03A 1J86A 4R0LA 4WV1B 4ODXB 2A6KA 1DVFB 5IP4A 5I8OH 1FZOB 1LE9A 4HKXB 2FX7H 3QI9C 4LLYB 4U6YB 3AM8C 3HG1A 5TE6H 1N59A 1DN0B 1ZT7B 5FGBC 2X05A 1S9YA 3VFUB 2VN7A 4AT6B 4KI1A 1CR9H 1HSAA 3MODL 3L7EB 4RA3A 4KV5E 3VXNA 1W0WA 2XPGA 4PB0L 5C9KA 3SDYH 1YJDC 2P8LA 4QHMB 3KPPA 2VDML 4TUJB 3MLSH 3NN8B 4Y88A 3JWOC 2ATPA 2RCSH 3C5JB 5FM5M 4W4NA 1YC8A 3LEXB 3ZKMD 1N5AB 3D39B 3QUZA 3DOSA 4MXQD 4X4ZA 3MOAH 4Q7DA 2J8UB 4IMLA 4XCNB 5D5MB 3QDGD 4LEXL 1CDJA 1RHHA 2E6JA 3QFJD 3TBYB 3EYVB 3DIFA 3QZWA 5D7IA 3L3GA 3BX7C 2CDFB 1NC4B 3VRIA 3S8WA 1HSBB 1NCAH 1E27A 1RIVH 1G9NC 1FPTH 2VB5A 1YY9C 5AD0B 4NQTA 5GS0C 1J05B 3ULUF 4JREB 5F3HB 3ARQA 1S7SA 4XP1H 5I9QB 2PXYD 3MYJB 3MRMB 1Y0LA 4U31A 3G6DL 2VDQH 1ZT1B 1JZ7A 1GC1C 4FNLH 3K4DA 4HUVA 3L5XL 4W70A 1IT9H 1T66D 4OQ1A 3I3EA 5JW4M 4X5XB 3T0EC 3C6LD 1D5BB 1OL0A 5IBLD 1D5IH 1MLBB 3DVNB 4I77H 4P4RA 1J0JA 3MV8D 3NTCL 4DAGL 2FGWH 2O5XL 3SE8H 4G6AC 3IFOA 4A6YB 1RK1A 5L9DH 3V52L 1G7LB 1RJZA 3LS4H 5BJTA 4KMLB 4G43A 5KVMC 2QKIB 2NY3C 3P73A 4P9MH 2CK2A 4JM2C 3QEQA 5GISL 2ZSWA 5F1KC 5F7WC 1KGCD 1BBJA 2BMKB 2DMKA 4GS7B 4M48L 1MQKL 5M7QA 3LN5A 5CS7A 3EO0A 5D1QC 4ALAH 4AMKH 1CE6A 2JK5A 2Z91B 4JG1H 2FO1A 1S9WB 3ULUE 4P3DA 4LKXB 3P11L 1R0AH 1XZ0B 3GMNB 1X4YA 2EC8A 1NAMB 5CEXB 1DSFL 1JZ4A 3V95A 4NNYB 5CHNA 3FFDB 1WIUA 5LG1A 5DD3L 2QADC 2JJWA 5CILH 2BERA 3WNOA 2FR4B 3BPNC 1DQQB 5SWQA 3VFTA 1YEHL 4I3RL 3MRNB 3MRPB 2XKNB 5FO9A 4NQEE 2A9ML 1AKJB 4GMTL 2YRPA 2E9IA 4PRNB 5IKCA 2V17H 4EEEA 3P0VL 1JTTA 4KKBC 3E0GA 1OM3H 1BJ8A 2Q7NA 3OKKA 3THML 1G7QB 3ULVF 1JFMA 3BIKA 1RSFA 3Q6GH 5IFAH 3T1WA 1XF3A 5T1DH 1ZS8B 1NAKL 3OAYH 3PG2A 1HNGA 5HYFA 1M6OA 3S98A 1UM6H 3KPNB 2HFTA 2PTTB 4JFFA 4XPTL 4Y5YA 2CXKA 3IAGC 3GNMH 3SKOB 2G75B 1A7NL 1I3RA 5D7KE 5FGSA 2EH7H 1F58H 3QH3B 4Y4HA 3GRWA 1IBGH 3Q0HA 4GW5A 5ESAB 4X6CE 4LP4A 4YDKL 3VG0H 2NY6B 2P7TA 1H15B 3VXMB 3UTSB 1IRAY 1IAIH 2I26N 4JZJC 1CIDA 2Q7YA 3ARRA 4DUVA 5KVFL 4I0PA 3RVUD 1PFCA 4QRTB 1OP3H 4TOYL 3SDCD 4Z7QE 2GITB 2CK0H 1OHQA 4HK3N 2YZ1A 2VE6B 4Z76B 4G8EA 1T0MA 2FB4L 3HMWL 5DT1H 3QJFA 4RIRA 4JFDB 2R56L 3GSNA 1TQBC 1I7UB 3FRUA 2OTUA 2ADGB 3V7AG 3SKNB 1CGVA 2X41A 1QLEL 4F2MB 2P5WD 1SM3H 4XPFH 4JHWH 1G7HB 3A0OA 5IGXL 4QEGA 3LKOA 2J1KA 5C0ND 5I74B 2DQGH 3ZE1F 1N26A 1J1PH 1T4KA 3N85H 3RI5F 2AV1B 5GGUB 5JORA 3BFOA 4X6EB 3V4VH 5E1AB 1UYWH 3BPOB 4N90D 1HHJA 3NAAH 4CMMB 4PLOB 2ITCB 5F9WC 1IEAB 4M03A 5E2TH 3V0WH 5KSAA 3DTXA 1A6UL 1PAMA 1L7TL 4KRPD 2D7MA 4YFEA 1E4KA 3LPWA 1C7TA 5C07D 4UDTA 5MHSD 1A4JB 4LBEB 3HPJB 4IOFD 2ZNXA 2DOCA 4OZIE 3DJ9A 2ERJC 3QWQB 4UQ2A 4WWKB 1J9CT 5HD8D 4UV4H 1HYSC 3VWKA 4OCYH 3T8XA 4J3OC 2AJUL 1L0YA 4QF1B 1QFWL 3K8MA 2BVPA 3F7PC 3STLA 4RFNC 4JY4A 2IGFL 3L95B 5GXBB 1LE5A 3ORJA 2N4IA 5EUKA 4UDUB 5I8KL 3WXWL 5FK9A 3JTCA 4I4WA 3X3FH 1KTDA 3QFDB 1I7ZA 2P1YA 1JNNH 4LIQE 5E94A 1FGVL 2DM3A 4YAQB 1FN4B 3SE9L 4UILH 1U58A 4X6BB 2P45B 3DSFH 3G08B 4YGAB 2DI8A 4YHPB 2DLTA 1D9KC 5E00A 3UC0H 4KK9C 4QXTA 2VQTA 3CMGA 3RVXD 2AK4E 3CD4A 4ENED 2C3VA 1Z9LA 2ZOLB 1OB1A 3O45B 1FNEA 4UV7H 1CD8A 2VH5H 1K5NA 2BY1A 1AJ7L 5C70A 5CZVL 3BEWB 3BQUA 1ETZB 3TF7C 3CU1A 4H88H 1JRHL 5ICYA 2VSDA 3P3YA 2G5RA 5DUBB 4RMUA 4MA7L 5HGGS 1MUJA 4OZIA 5AG8A 1OSPH 1SJEB 4GG6E 1BAFL 1WIPA 3O0RH 5TH2B 2EDRA 2DD8H 3H9HA 2IG2H 1MREL 4J7RA 5D72L 4I3GA 2J7LA 4PJ8B 5HGHA 3RHWF 1S3KH 4M1DH 5M94B 2WZPD 3TIEA 4ZSOA 2VITB 5F1IB 1B0GB 5D96C 5I1EH 1WZMA 1CZ8H 1EEZA 1UKTA 2GJ6B 2IQAB 4C56D 2NQCA 1WBXB 4OLXH 4NHUA 3TO4D 3ARBC 2X4PA 2YA1A 3A6OA 3PHSA 5BZWA 2I9LB 4ZXBA 1EEYB 2YD8A 1NFDE 1T5WA 3CFEA 1PG7H 5CBAA 4XB7A 1KPVA 3BJLA 3I02B 4LVOB 3IU3A 1SVCP 3VXRB 1MCBA 5CGYC 3MOQA 1KG0A 3QNYB 5DF0A 5BW7C 1W2KT 1D5MB 2GFBB 3O4LA 1II4E 3V5KB 4ZPTA 2GY7B 5SWZB 4WHYH 5DJ2B 6FABH 3L3IB 2DQUL 3QDJE 4AM0A 2BRRH 2B1HH 3WO4B 4WI3A 4F7PA 2I5YH 3GRWH 5CCKL 4MA3A 1RU9L 1ZKAA 3QUMA 3LY6A 1YEFH 4OZHF 4PGJA 1NBYB 5D1ZA 2AK1L 1ZWIB 2XTLA 3ULUH 1CF8H 1KCVL 5C0GB 4PTTB 1D5ZB 4LRIA 5T33L 1FHGA 5JIKA 1DBML 4PRHE 1MJJB 2Y6SC 4NC2B 5F3BA 1H8OA 1AI1H 1WGOA 3KLHC 5LWYL 1RJYB 4L8BB 1RIHL 3GSNH 2X5PA 2VAJA 2Y9RT 1R5VB 1BFOA 3FHAA 1TNNA 3L3HA 1CICA 3U7AA 4K23L 5FKPB 3ROOA 3ZKMC 1S7TB 3CLEL 4JDVA 1T7WA 3HB3D 1RURL 2E27L 4WNQB 1Q9WB 1A6TA 2EYSB 4HZLA 4YDVA 3VFPB 4LGSB 3VDBA 5JO5B 1AD0B 1BD2D 3OMZA 4WO4D 4PJBF 4Y2DA 3PUCA 1FO0H 1QRNB 4JE4B 5T1KA 1H3GA 3PE9A 2FWOA 4TPRH 2H26B 1NC2B 4XC3L 3IXTB 2YPVL 3TLRA 4YXKL 4OGXL 4WUKH 2Y4SA 1BVZA 1UZ6E 3BT2L 3BP4B 2QBWA 3RWIB 5TE4H 4R7DA 1A7RL 3PHQB 2VABA 3B4NA 3HLAB 4QRQB 4ZFFA 3RZCA 4U1GB 1CQYA 1UJ3C 1N64H 2V2XB 3U4AA 3F65A 4HFWA 3MA7A 3MJ7B 2W0KA 4HS3B 1H5BC 3VFSA 4GRLD 1J8KA 4PIRF 2X2YA 2APWA 3IDYC 4MJ5A 4NZRL 3VI3E 5I30H 4CU6A 4PRHA 5I76A 2VDNL 4LGPB 1FDLL 2F53E 2WV3A 2DLGA 3OAZK 3KJ6L 4EUPB 5IM7B 1JF1B 3HN3A 3MGTB 3E6FB 3SJVA 4WFHE 4JRYB 4B41A 1J5OL 5EORH 3FQRA 5LBSH 1IVLA 1OAUL 3NCMA 4UOJA 5TF1H 2PNDA 3BWAB 5IW6B 4X7TA 4WU7B 4AQOA 1V7NL 4TNWK 3VWJA 1V8HA 3U2SB 4M8QB 1XIWB 4X0KB 4HJJL 4U3HA 3T0EB 3DV6B 3QIUD 4G42A 4HS8L 5I19H 4Y19D 3BESR 3JVGA 2YEZB 1T89A 3HR5A 5SWSD 4PR5A 4PJCE 3KPMA 2WWKT 2OTWB 4OZHA 3S96B 1ZXQA 5F6HI 1B90A 3GSQB 4S0SD 5FOBB 2FSEA 3BPCA 1J8HB 3FB6A 4NDMB 5JPMB 3QXVA 5I18H 4ODSL 1WZLA 3QEGL 1AP2A 2F19L 5GS2D 1MHPH 1BBDL 3SE4C 4BZYA 3EYOB 2EKSA 4FG6D 1G9ML 2WW8A 4LPWA 2WIIA 4OFPA 2DTML 3ARGD 3DROA 1MIEL 2KL6A 3E6HB 4I13B 4QHUA 5L6YL 5EO1B 5K33A 3FN3A 2Z4QA 4QO1A 4FZ8L 4NO3B 3PGCB 5IB5B 2F53A 2R4RL 3CFBA 5E5MA 4HX1A 3S34H 5LCVH 3X14A 4QGTA 4DFIA 5GIRB 1EHLL 2PYEB 3VJ6A 2YXFA 2AEPH 4LVHC 1EJOL 3P4LA 5JMOC 3VD4A 1OWWA 1A9BB 4LIQH 2AEQH 5ANME 2WIMA 5F7YC 5IHUH 1QNZH 4PJBA 3GBNH 1U6AH 1I8MB 3D25A 3MRJB 1GOGA 3REWA 1A0QH 5I1KL 4P2RD 4AEFA 1T22A 1YY8A 3FAXA 1WEJH 4KTDL 5ITBL 1QA9B 5FDWB 2GTZB 3QDMD 2NW3B 2OI9C 2Z92B 5EIIA 4NQDB 4YDJA 1RY7B 2C4XA 4POZC 5J06A 4JGUA 3IDNB 2X40A 3ZTNH 5DSCA 3DV4B 4Z7UF 4F58H 3MFFA 4U0RC 4K07A 4LKCA 2WLZA 3U9PH 3OAUH 5INCA 3RA7L 3AY4C 1RMFL 3IJHA 3MV01 2BZDA 3B8SA 1A1OA 4FQ1L 4OUUB 1EAJA 3K7UA 2BVTA 3C6SA 3EOBB 3MRDB 1TXKA 4OAWB 1UWGL 2XY2A 3OKEB 2B2XH 4OF5A 4Z7WE 1F13A 2FH6A 4X6DF 1BQHB 4M6NL 2NY0D 1F90H 4EIZC 1I7RA 3P40A 5CJXA 4ZMAT 1IGML 5JHDD 3F8UB 2FECI 5EO0B 4TSCL 4DTGH 1T04A 3FONA 2J2ZA 5EU5B 3OJVC 1T20A 3ESUF 4HK0A 1VKXB 2V2WA 3BP7B 3MUGA 1DQLH 4Y4KC 5I15L 1KTLA 3TIDA 3VW3L 4ZNEA 4DZ8B 4NN6C 4GAJH 1I8IB 1A6ZB 1TQBB 3GMOB 3QIWA 2XQBL 4HG4J 4MD0B 5CJQH 4KRPC 3SKJH 1UVQA 4LPCA 5L2KA 2FEDD 3MRHB 2ZOKB 3T3PF 3KPRD 4QRRB 3ZHDA 3CXHK 2F9BT 2VXQL 4IOFC 2NZ9D 4GRWB 2R2EA 1FVCB 3ULVL 2OR8A 1F97A 5IVXF 3BXNB 4NOFA 1YN6A 4ZD3L 4G7VH 3MLPA 3RDTA 5HY9A 1DCLA 3DRTA 4R4ND 2FDBP 5HVGB 5E2VH 5K9JH 1JI2A 3HCVB 2VWEE 4YHML 4L5FL 2CRYA 5F9WB 2IH1A 3SE3C 4LOUC 5HYJA 3PJSB 1FG2B 2AJVH 4HXBH 4GSDL 4JZNB 5GGSB 3T2NL 1CL7L 2VC2L 1J88A 4Z7WA 3TO2B 3DXAB 3WYRA 1CD1B 4GKSB 2XWJB 2MCPL 3SPVB 4RNRA 4ZFZB 2F58H 5C6WH 1AGFB 2AJ3B 5CINH 4WW1B 3WS6A 4QGYA 1E4WL 4PD4K 3DBXB 1DDHA 3QWOB 4HH9A 1PLGH 1P5VA 1AD9A 3CDGB 4HWZB 5FO8A 4AL8L 4DOHB 3G5ZB 3BKCH 4JO3L 4M6OH 2PETA 1LO3L 2PW1A 1X6NA 3U83A 2XNAB 3T0BA 3HR6A 3MO1A 4MQSB 4G8GA 1A47A 5HVHB 2ADFL 2A9NL 4D9RE 3QXUA 3R8QA 3ZHKA 3E1F1 5JTWA 5J89A 1V5JA 3TZVD 2VDLH 1LDPL 1QSEB 2IALB 2BVOA 4PDCE 1BQSA 2DLHA 4LGRB 3OGOE 1D9KB 1JGVH 2VXUL 3FCTA 3LQAH 2WSKA 3W9DB 1S7QA 5F7FA 4G6ML 4HF5H 3U30B 2FX8L 4OIAA 4K3GA 4KUZH 4YNYA 2D0GA 2FD6L 4QHNB 3GSXA 4XP4L 3IKCB 5GSRA 5EU3A 2LABA 1W72L 3BKYL 2F54D 1T1XB 3HFMH 1E4XI 4H0GA 4NHCL 4LCUA 4LASL 2C1OA 1G84A 3PNWB 1S7VB 1WJ3A 3AU1B 2J5LC 1DBKH 1RUAL 3IFNL 5TFSH 5HPMA 3BAEL 5ADOL 1A6WL 4KY1H 4LLWB 4X83A 1UH4A 5IBTH 4KGLA 3TO4C 2DJ4A 5E70A 4GUPB 3RWEB 3G9AB 1C5DB 3U46A 1U8IA 4Q6YA 4RBPH 5EC2B 4X7FC 3B5TA 4Y16B 2JB5H 4F7TA 4YHKH 2UWEE 3P30L 3QUML 1FVEA 1R6VA 2NX5A 5KVEH 5D96B 1I1AD 1GXEA 3OKYA 4X9IA 5FDYA 1OTUD 1B4JL 2WP3T 1JHTB 4JANB 3QDGE 2XTJC 1RV6X 3WLBA 3DGGA 3AXLB 4KZDH 3QFJE 3QEHA 5IVXA 4DGIL 3WEXB 5I66A 4YWGL 4LCYA 1HKLH 5EC1B 1LEIB 5GRVK 4WUUB 1G6RA 4U33A 4HHAA 1OP5K 4HAFA 5BRZB 1RUPL 2XRAL 5E08L 4YBLB 5TDPA 2APTA 1AGCB 3GGWB 3SGDH 5HGBA 3F6IA 4I18B 4QOKA 4K8RD 1MHEB 4OKVB 2F74B 5T3ZD 1FFNB 3KPOA 3PQYD 4HIJB 5DD6A 4XZUA 1G9MC 1ZLWK 3VH8B 3D0VB 5C0FA 4OLYH 2FJGB 4FFWC 2JLLA 2YPKA 1DEEA 3O8XD 1GL4B 4MNQB 2EYTB 4NQSB 4XPHH 3ZSTA 3G5YB 2QQLH 4Z9KB 2HKFL 5I1JH 4MJIA 1R3HB 5T3XL 3MNZA 5EOTA 4O2CB 4MXWH 2IMMA 3TN0D 3F7QA 2DKMA 3LDBC 3H7BB 5IBUB 5GRJH 5BO1L 2R0KL 4LPXA 4RWYL 5HHQB 3T09A 1IGCH 1LEGA 3GIZH 2CGRL 2W9DL 1J1OH 3D5OF 5L8JB 3EHBC 4NQXA 5DJYB 3H9YA 3PGFH 5HHNB 5DVKA 4YZFF 4O4YL 2E9WA 3BHBA 3LN4A 3OJMB 5KSVB 3JV6B 3KDMB 2H6PB 4BQ6A 4ZPVB 3FQTB 5B4MD 2W9EH 2VUOA 2DBLH 2X4QA 1M7IA 4NJ9L 3SY0B 5I0DA 5ETUA 1U8PA 3ZDYE 4F3FA 4Q9QH 2GT9B 5ID1B 2NTFB 3QQ3B 4GRLC 3C60B 3WL9A 4QCIB 3RWJA 3MCKA 5HDBF