3VH8A

Kir3dl1 in complex with hla-b*5701
Total Genus 78
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
78
sequence length
275
structure length
275
Chain Sequence
GSHSMRYFYTAMSRPGRGEPRFIAVGYVDDTQFVRFDSDAASPRMAPRAPWIEQEGPEYWDGETRNMKASAQTYRENLRIALRYYNQSEAGSHIIQVMYGCDVGPDGRLLRGHDQSAYDGKDYIALNEDLSSWTAADTAAQITQRKWEAARVAEQLRAYLEGLCVEWLRRYLENGKETLQRADPPKTHVTHHPISDHEATLRCWALGFYPAEITLTWQRDGEDQTQDTELVETRPAGDRTFQKWAAVVVPSGEEQRYTCHVQHEGLPKPLTLRWE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HLA class I histocompatibility antigen, B-57 alpha chain
publication title Killer cell immunoglobulin-like receptor 3DL1-mediated recognition of human leukocyte antigen B
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
total genus 78
structure length 275
sequence length 275
chains with identical sequence D
ec nomenclature
pdb deposition date 2011-08-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00129 MHC_I Class I Histocompatibility antigen, domains alpha 1 and 2
A PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3vh8A02
3.30.500.10 Alpha Beta 2-Layer Sandwich Murine Class I Major Histocompatibility Complex, H2-DB; Chain A, domain 1 MHC class I-like antigen recognition-like 3vh8A01
1T1YB 4U1KA 4U31A 2Q87A 3NCMA 5CEYA 5L2JA 4ZYKB 1H15A 4HQQL 1LQVA 3O4OC 1MCWW 2H45A 5L2KE 3HZKA 1U8HA 2FDBP 5E9DB 1RZ8A 2AEQH 2R1WA 3UPRB 4LVHB 5DMJB 5IB5B 1BM3L 1RZKC 2G5RA 1FFPB 4OZHF 1CWVA 4XPBL 1IGFL 4DEPB 5J12C 4JY5L 4JFQB 1ZHKA 1SBSL 1XGTB 3S4SB 3ZT7A 4V3EB 4K7PH 2BXZA 3BQUD 4JQIH 2MFNA 1KCVH 3LQAH 3D9AH 1J8HA 5DUBB 1GGTA 1JPFA 1ZLVK 5C6TL 1IT9L 4LAQH 5T5NF 1MCOH 4Y4HD 2P5WB 1JZ8A 5T1MA 4J12A 5B8CC 1INDL 5TE6L 2ID5A 4OZIF 3L3DA 3R8QA 3QFJD 4KTEL 5F1NB 4R4ND 1OP5K 2IQAB 1UCBH 3T65B 2J7LA 4S1SL 5C0GA 1U58B 2PF6A 4NZRL 5A40E 4NUJA 2WWMD 5CZXC 3KPRE 3K4AA 4CW1A 3IB4A 1QEWA 3MV7B 2A6DB 3C6LB 5MERA 1KJ2A 3WIHH 3KJ4C 3W82A 2J8UA 5KS9B 1B4JH 5C86A 3GHBL 1D6VL 2QR0A 3K3QA 3RWCA 2CKBL 4GJTB 1MH5B 4DKAA 1BECA 5I1IL 1MHCA 4P2RD 3X11B 1F4WL 3GGWA 1EX0A 3CFBA 4JM2B 4M93B 5H2BB 1AD0A 1OD9A 4GRLD 4JREB 1PYWA 2FX7H 4XXCA 4L8CA 5DVNA 1TJGL 4RQQB 4S2SA 4Y19A 4F9LA 4X98A 5F7UA 4Z95H 2E7BA 1HZHH 4JREC 4JN2A 3T0EC 4X4MA 4IMKC 1WCBB 15C8H 1KACB 2DTML 1SYSB 1Q9LB 5I8EB 3TBYB 5K9KA 4ZFFA 4NNXA 2VXUH 1HHIB 3BWUC 1TJIL 3QG7H 1ZLUH 1V3KA 3C9NA 3RZCC 2A6KA 5CJXC 4TOYL 4FABH 5D96C 4PJAB 1TDQA 4GSDL 2AEWA 1QRNE 2EE3A 1IQDA 1A7PL 2VQUA 2XTLA 3VFWB 1JGEA 5CUSL 3IFPB 4MZ2A 2OMBA 4O58L 4UNVA 2W9DL 4HH9A 3L3JA 5E5MA 1A3LL 4RAVA 2BX5A 1K8IA 1FV1A 3QIWA 4ODBD 5I1JH 3QNXB 1PX4A 3AM8A 1BJ8A 5D2NC 4Y4KC 5B39A 1HH9A 3SDDB 4L3EE 4M62H 1MHEB 4MD0B 1MRFH 2F58H 4WHYH 4G6MH 2CLZB 3I75A 1FNSH 4UBDD 1RVFL 1E4JA 1X6NA 4YK4B 3F5WB 3CH8A 4JFHE 5F7FA 3U4EA 5D7IB 4AQOA 2EIDA 3IJYA 3LEVL 3WIFA 4HCRA 1CDGA 1U91B 4AH2A 3GI8L 4ISVA 5TF0A 5DJDA 2QQLH 3WIIH 4S10A 3FONA 2EDLA 3FAXA 3MJ7A 1RK1B 4I3RH 1IEAB 3A6OA 4ODWA 4HK0A 2D03L 2X4TA 5BQ7B 4NGHL 3CDGA 4UIMB 2R29H 2Z8SA 1KG0A 4HF5H 3DO7A 1FFNB 3V52L 4WTXA 5DK3A 4P2QD 5E99H 3F12B 2DWDB 2JJSC 1KGCD 4NKOA 2XKUA 2BVYA 2YC1A 3ZSTA 4N0UA 4NUGL 1FSKC 2OLDA 3CFJB 3MODH 5DO2D 5KSUA 3F7QA 1T7XA 4MJ6A 3B9KB 3GMOB 3MJ8A 2HP4A 4K3DL 2DJSA 5DGQA 4XRCA 1RIHH 5T3XE 3P4OA 4BH7B 4BK5A 1RZGA 1B0GA 5IFJA 3SEPA 4LF3A 4K9EC 4IRSD 2BOBB 5IHUL 5GJTL 5IB2A 3QDGB 3TBTA 4OI8A 5FA3B 3BP6B 3G5VA 5ACZA 4R7NA 2XQYG 3LIZH 1AGCB 5K59F 2HH0L 3OMZA 1LO0H 4XNUL 3VGHA 1FH5L 3O41B 2X7LB 4F7EA 4KH2A 3Q1SH 3UDWC 2Z31A 3NTCL 4P9ML 5EBWA 4ZUSB 5J06A 3N85H 4XVTL 4NQSB 4R7DA 4S1DC 3DVNA 4X8JA 3PWJB 1CFTA 4R6UA 5GGVY 2CUHA 3MBXL 3QDJD 4BSVA 3NIFF 1A7OH 2GY7B 2WM0A 3V79C 4ZUUA 1V3MA 1OT1A 1XR9B 1K9TA 4BZ2H 1NDMB 4QF1B 1T66C 3GBNH 1N0XH 4QXUL 1ZK9A 1QFHA 4QWWC 5FA4A 1QSZA 4ODUB 1CD0A 4YHIB 1NAML 5HY9B 3QB7C 1MFNA 3MLPA 1ACYH 2EDQA 3ULSB 1MY7A 1RIUH 2H2PD 4LCYA 5IVZB 4RWYH 1BVLA 3EYSL 4JFZH 3IDMB 3MBED 3Q6FA 1F00I 3MRQA 2OCFD 4WI7A 3BHBA 3IKCB 3K1DA 3NFPB 4Q6IC 4UB0H 1O7SA 4F80A 3HB3C 1VFBA 3PV6B 3R06B 5JXEC 1OSPL 1RHHB 2AJXL 4BQ6A 2W9EL 1S9XA 2P5ED 1MWAA 4XI5D 2ZSVA 4ZPVB 3ZMRA 1XCTA 5B38B 4XHQA 1WJ3A 3O6FA 3UTTA 2GK0B 1WZMA 5C0AD 2R2EA 4JQVC 1H0DB 1P5UA 3TO2A 5TQ0H 1Q0XL 2CLRB 1IAIL 4Y5YA 3U0PB 5ID1B 1FG2B 3H9ZA 4MZ3A 2OP4L 4RRPG 4QXTB 1N6QH 5I8OL 3EFFB 5L2KA 3ARQA 1BLNB 4N90D 3PP4L 3S34L 4PJ5D 1JPST 3DROA 1I8LC 5E8PB 3QP3A 2DICA 1LEIB 3IFLL 3ERYA 1PVHA 1AGDB 4D94A 4G8IA 5F3BA 1LO3H 3SCMB 1J5OH 5F9WC 1YECH 1R6VA 2DQUL 4WU7B 4XPTH 2OR9H 5ID0A 2BY1A 4CVZB 4NN5B 5DURB 5KG9B 4QT5B 1R3IH 3THML 4LGPB 1YY9C 2D31A 5IJKA 3Q6GH 3UROR 2IMNA 1RJZA 5EO1B 5DMKB 4AQ1B 4FFZH 4RGNB 4KKAD 2BERA 2GJZA 2AJYL 4JFEB 1ITCA 3V8CA 2GITA 4M1CC 4U6YA 3BZEB 5EBMB 5CJQL 4F7CB 1ZS8B 4TUKH 1FZMB 3KPRA 4JPKH 3RY6A 5J3HC 4X6DF 2LVEA 3BGFC 3MCG1 1MF2L 4I2XA 5DMGC 3FOMA 4ODHL 2DM4A 2VL5B 2EZ0D 4UV7L 4ZUVA 2FJHB 3VFGH 3MV9D 4Z7VE 2X89D 4OBRA 1KTDA 1XMWA 3BEWB 5D1QB 4AG4H 4RFEA 2BY3A 4L8BB 5K9QG 4YR6A 2FR4A 2CDEA 1NC2B 3OZ9L 1FFOA 4JHAH 4MB4A 4M3KB 3PWUA 2FD6L 1LDPH 5FUZH 1YEFL 2GK2A 1T0NA 4I0PA 4AIZA 4GKSA 1JPSH 3MGOA 3L3GB 3GK8H 5CILL 4NIKB 1I1AA 3OHXA 4IJ3C 5GGVH 4BA8A 1EZVX 5IG7B 3V5DA 4FHBD 5CZVL 4BJLA 3S9DB 3MGTB 3MLYL 4NOBA 1FGVL 2R0KL 3CFCH 4HH8A 1AQKL 2FGWL 5HD8D 1FAKT 3ARBA 4CADA 4ENED 3FRUA 1EBAA 4DKEH 1QRNA 2OR8A 4NBZB 2NY6C 2BC4B 4GFTB 1FP5A 1NCBL 1KPVA 3BP4A 3IFOA 5J1AA 1R5VB 3DV4A 1DR9A 3D0VB 3LKNA 3QJFB 4FP8H 5DA0B 3HC4H 3GHEH 2B4CC 4R96A 4KKLD 2APXA 2Z93B 1C5BL 4OCYL 1JTPA 4PB0H 4L3EA 3ZTNL 1NDGB 4QCIA 2J4WL 4N0CD 2R8SL 2NY5L 5FO7B 1BEYL 1FNEB 4FFYL 1PW3A 4J3WA 4WWKC 4QRUA 4C54A 3CDFA 5IQ7L 1LE5B 4LLUB 5F88B 1F13A 2VZUA 5H94A 3QQ9C 4WW2C 1ZVYA 1VENA 3FQNA 4Z7QF 4CVXB 3PWLA 1AC6A 4F8QA 1A6UL 3SE9L 4HJJL 1QLRB 4IRZL 4KPHL 1XH3A 4FNLL 1L0YA 1CG9B 1AXIB 5FYLL 1JYNA 2V17H 3FQXA 4HFUL 4N5EC 2AK4B 4AL8H 5I2IA 4TTDD 3L3IA 2BNQE 1IGIL 3VH8G 5KAQF 4UMGA 3DHMA 3CFDB 2RJMA 5I75B 1I7UA 5IJVA 1TZIB 1OM3H 3TZVB 1JBJA 1XF5B 5IFAL 3B9EA 1TVBB 4M48L 1Q1JH 3GB7A 3EYFA 2WIIB 4K3EH 5D7LB 1IBGH 1WISA 4P46B 5GS0C 2LABA 4XP1L 4IDJH 4OLVH 1HH6B 4YPGB 4OQTL 5ESVB 1D6VH 3O9WC 4CU8A 1EK3A 1OWWA 3L6FB 3HE6A 1KENH 2PR4H 3T4YA 3WHXA 2YZ8A 4K23L 5JHDE 1IAOB 4LLDA 3QO0A 3SKNB 1U36A 3C08L 2K9UA 5LXGH 1XF3B 5HGAA 1CD1A 1Q9WA 1GC1L 1OAKL 2UZIL 3IDYC 43CAA 4RA0C 2XWTA 1J1PL 5EB9A 4JANA 2NR6D 4HEPG 2BVEA 3BD3A 3OR7A 3PP3H 5IFHH 1PGRB 1KT2A 2YZ1A 4QEGA 1KCSL 1L9MA 4AEEA 1N0LA 2EE9A 1SYVB 3HE7D 4PR5B 3ZT6A 1TJIH 2Z92B 3MNVA 1S5IH 3L3OB 2QEJA 4H8WC 2GIYA 2X10A 1C16B 1M7DB 2A74A 4H1LA 4F7PA 1UQSB 2JELH 2PETA 5C3TA 4U7MA 3TT1H 1SJVA 4FMKA 4P3CH 1VACA 4M43L 1TIUA 2Q8BL 4W6YB 1JHTA 1I8MB 1A9BA 3PDDA 4AEHH 1YZZA 4DFHA 5D1ZD 2OSLA 1MEXL 1QLEL 2V2XB 2OTUA 1CXHA 3KLAA 1FO0L 1VEOA 3QZWG 3P4NA 4IHOB 4NHCL 4WFGD 3TN0B 4YDLB 1F2QA 3D2UB 5C0BA 2ZUQB 3AMKA 5E6IC 1JGVL 1U41A 4NKIH 1IGTA 3PDOB 1I1FA 1MPAL 3FO2A 1G7HA 2YRPA 5F9DC 2LTQC 1KN2H 3AROA 2AXJA 3QULB 4G8EA 3BEVB 1FAIL 1Y18B 1EFXB 4UQ3A 3VG9B 2DJ4A 4V2BA 3HCVB 4GG6F 4FFVD 1I8KB 3AY4A 4JFOB 4ORZC 3RY5A 1Z5LB 3MRCB 5DJ2B 4ZO9A 2AV1A 3I9GL 1AFVL 5DF0A 1IC5H 2GAZA 3IJHA 4S1RH 5DA4A 3OAUL 3ALXA 1Z3GH 1XGPA 4OF8A 2PO6A 5AG8A 2FNBA 4WVRA 3TLRA 4W6XB 5GS1A 2X4PB 3ZDYF 2XNAA 4ELME 2P5WE 3MV11 5EZJB 2I9TA 3RX7A 3FB6B 3RJQB 2W60B 4XAKE 2Q8AL 2OBGA 2IPUK 1CDHA 3LRGA 4RAUA 4P4RA 5TDNB 4QHUB 4XCFL 3UTSD 2W59A 3VDAA 5C3LD 1MRDL 4XGZB 3AREC 3MV7E 4UILL 5L9DL 4F57L 1WUNT 3VRJA 3MPCA 5KS9E 4KY1L 4HK3J 4JFXA 3MRMA 4MD5A 4K3GA 1I3RB 5EUOF 1LK3L 5F89B 3ZDXF 5TE4H 2IAMD 3TIDB 1X7QB 2E7MA 4XNZB 4R26H 2FECI 4G7YL 4J23A 3ESVF 5J9PA 2G9HA 2HFGH 4F9PA 3RHWK 5LGJA 3QQ4A 4L4JA 3SDCC 3QZWB 2QSCL 3T0EE 1TTGA 3GIZH 2WLZA 3LD8B 3NTCH 4P9MH 4XZUB 4RIRB 3FMGH 4PJ7F 2QLVB 2HTLD 4MD4B 3QIUD 4KJQD 2L4OA 3OAYH 4JB9H 3S36X 4GG6A 1NCDL 4PY7A 5FF6A 5BZWA 1IKFL 3K81A 2VLKB 4J3OC 4DQOH 2ZUWA 3PABA 3BFOA 3B8SA 3PQYB 4FXKA 4NPYA 4IM8A 3OBAA 2CRMA 3I6GB 1A1NA 5EU5B 3WFBL 1GAFL 2ICWA 3RNQB 2E3VA 5FK9A 5IWLC 3ILQC 3LKRB 4QXWA 3HR6A 4QO1A 5B21A 3JTSB 5DUPH 3EYSH 3B2VH 4NNPH 3UTQB 4LOUD 3FT4A 3C5JA 2VAAB 2W9EH 1J88A 3FT2B 4H0GA 2YA1A 1QFPA 1U8LB 4MS8C 5CSZB 4J6RL 4HXBL 4I9WD 2X4SB 5C70A 4DTGH 4P0DA 1R5WB 3EZ8A 1FL3A 3GKWH 5F7KC 2BHYA 3RWJA 2DKSA 3T77A 4ETYA 5JIPA 3B2UD 1TQCC 5D7IE 3OGOE 4G6JH 1Q0XH 2O5YL 4MGXA 3X12A 2EYSB 3F6IA 2H32A 3GI9H 1KCGC 1I7TB 4X6CB 4YHNA 5CSBA 1ZT7A 3PL6B 5EUOA 4ZAKD 1DANU 1CK0H 4FA8A 5KVGH 4NP4H 4NT6A 3FHAA 4MJIB 4XBPA 2XACC 3QUXC 3BH9B 4Q74A 4NQEB 5IW1A 4QNPE 3G5XB 5HHMD 3QUYA 5T1LD 4DZ8A 4PJ9A 2OMNA 4MNGB 2CUMA 5FGRA 3O3DA 1NEZA 1RU9H 5GGSY 1G7QA 5HPMB 1SJEB 3VXSD 4HUNB 5JOFA 1F3RB 3DV6B 3QO1B 5C09D 2BVOB 4YHML 1J1OH 1YDPA 3SHSA 5EO0A 2XZCL 3KXFE 4X6FB 3JV4A 5KSAC 1G7IB 2YPLD 5JMOC 4TRPL 5GRXG 3TJHC 3PNWB 4OV5A 3DMMA 4ZNCD 1TCRB 2EYRB 3VDCA 2FIRT 3LQMA 2PYEB 2NY2B 2P45B 5DYOA 2CQVA 1MAMH 1NAMA 2BNQA 4G3YL 4X99B 3ABZA 2RCSH 1LO2L 3QUZB 5C2BH 1GJIA 4K8RL 3VFTA 2X5PA 3WJLA 2R2BA 3BMVA 1ZA3A 2VSCA 4JVPA 4P2OD 3P30H 3TBVA 3VMPA 4R3SB 5JDSA 1QR1B 4HT1L 1NFDE 3CUPB 1HNFA 1A7BA 3N9GL 2OM5A 1NGYA 1A3RH 5DK0B 3T0VA 1QNZL 2R0ZL 2H6PB 3GJFK 1MJ7H 1QVOB 4XNYH 2YOCA 5HGBA 1N2RA 1HWGB 4NYLB 5JHDA 3VMOA 2VISB 1GOFA 4ODSH 3CLFL 3D18A 1FL5A 1HHKA 1N4XL 2I60L 3K8LA 4ZO8A 1G7JA 4A6YH 3BQUC 4KK5D 1MNUL 4WUUB 3TH4T 3RRQA 1LD9B 1UXSA 5E8DL 3VFOB 1Z2KA 2ADJB 2X4NB 3C60B 1JK8B 2AABH 2HWZL 1B4RA 3UPCA 4CVUA 4EI5B 5JLZA 4X7EC 5LKNA 1JP5A 3H9SB 3OPZH 4Y4HC 4GRWH 4MJ4A 1YN6B 2R69H 4NZDA 3KS0J 3GIVB 4WEBL 3AB0C 1FGVH 5FDWB 2BNRD 4R4NC 2B0SL 3ARFB 3M45A 4GUPB 1YUHA 2CDFA 2HT2C 5IV2A 2NYYD 2B1AL 4HV8B 3DETD 5DJZA 5B3JE 2OTWA 2YBRB 1P4IL 3QUMB 4PJBB 4X4XA 2WWMC 5LBSL 4RNRA 2GSGB 1HIML 2F74B 4HPYL 4P4KA 3BE1H 4EUPA 2J2ZA 1D9KA 4XP6L 8FABB 1IAKA 5GZND 5HYSB 5C0DA 1C5BH 4MXQD 3PHQB 2EICA 2Y36H 3VFUB 4OD1L 2Y7QB 1T1YA 3UO1H 3LS5H 3TH2T 1YNTB 4ODTH 1ZHLB 4FN0A 1R3KA 5CD5D 1FRGH 4Z6AT 4ZYKA 3TC9A 2R1YB 1HKFA 1GZQB 1DLHA 5HHOD 4YEFA 4GRLC 1OGTB 3PXJA 3ZHDA 2F54D 1NMAL 4GLRI 5E9DA 4K71C 4TQEL 5DMIL 4ELKB 3KPLB 4G9FB 2Z91B 3E6FA 4NZTH 1FFPA 1W72L 3CMGA 4KUZL 4JFQA 2Q1EA 1XGTA 4IRZH 4NQDD 1MCJA 4WY7H 2ZNXA 4DVRL 4K7FB 5GXBB 1QSFB 2P24B 5F97E 3UTZB 4Y16C 4OFIA 5ITFB 4M4PA 2C3GA 1MCPH 1BBDL 4YGAB 5DUBA 2UZYB 3WLBB 1EJ6A 5FYJD 1DVFB 2C1OB 2R4SL 3HI6H 4ELMA 2P5WA 2C3XA 3PGDB 1BAFH 1CYGA 2ATKB 1RULH 3BW9B 4U0QB 5F1NA 1CLOL 4M48H 3QCTL 5JPMB 4NN7B 2IQAA 3T65A 3TM6A 3BIAX 5FYJH 4M6OL 4JFEE 4PGDB 1KFAL 3EKCA 1UXWB 1U58A 1J0YA 1AO7B 3U9UB 1TLKA 3PHSA 2VJXA 4OJFH 4WFEE 4K2UH 4OQTH 3MV7A 1BD2B 2A6DA 3C6LA 4UBDC 2VR9A 1PY4A 3QPXH 4XWGH 5KS9A 4M5ZL 2QV2A 2R0WH 5BW7A 4Q9RL 3ZYOA 4Z8FL 1GGBL 2NCMA 3W0WB 4HJGB 4XP9H 1TJHH 1MH5A 5DR5L 3X11A 1J8HD 1T03H 3BN9C 4JM2A 5H2BA 5MEQB 1B6DA 1JNJA 4NWUL 1NGZB 3QPQD 4RQQA 4EN3C 1I7RA 3ZE2E 2KQNA 2DYPB 3ALWA 5IBLD 3ARXA 2B39A 2ZCKH 5TPWL 1HHHA 1WCBA 2GHWB 5I6XC 1MCNA 1SYSA 1Q9LA 4P9HL 5I8EA 4WIQA 3TBYA 2UY7A 1HHIA 4WO4C 3ZYJA 4R2GB 4JPVH 1JYVA 4CU6A 2NX5E 4YX2L 1W8NA 4KTYA 2VUOA 3O0RH 5DO2C 2H1PH 3AFLA 2YN5A 4L1DA 4PJAA 5DZLA 1IGCL 2PKDA 4D9RE 5IT2H 3SE8H 3MRDB 4JO3L 4U2YA 3VFWA 2CD0A 4C56E 5D71L 5J6GB 3IFPA 1BFVL 3PGFL 1LE9B 2AVGA 4PREB 4S0TD 3BIBX 4IOIB 1MFBH 3WJJC 1KJVB 4XVSL 3QNXA 1P7KB 1D3CA 1WBXB 4Y19D 4YDJB 3LDBC 1MHEA 4MD0A 5F9OL 1ZA6B 3L7EB 3C2AL 3REWB 5TE7L 4WV1C 2FJGB 2CLZA 1BF2A 4ZUWB 5ICYB 1UENA 2PCPB 2E9WA 2VNCA 3F5WA 3F58H 2ZPKL 1Y6KR 2F8XC 4DFIA 5D7IA 4XBEL 2CRZA 3VXMB 3ULUD 1U91A 4ODVL 2A2QT 1A1OB 4ONGL 2KPNA 5CJOH 1KOAA 1KIUA 3L3KA 5K9JH 2OX5A 1RK1A 1IEAA 3RX5A 4J7RA 1HYRC 2PXYC 2JJSA 2LU4A 3QWRA 5BQ7A 2DQJH 1F6FB 3ULUH 4UIMA 3QIWD 4FFWD 5F6HJ 3D87B 1FFNA 3RUGE 2DM3A 2BDNH 2H8PB 2DWDA 2WINB 4GW1B 2H2PC 1NBYB 1ODAA 4JO1L 1CD8A 4N0FB 3HNVL 3WXVH 3CFJA 1FLRL 3MBEC 1X3DA 4JFPB 2YD5A 4IBLT 5E4EC 5D7LE 3B9KA 1W8OA 3IDNB 3BPNC 4XI5C 4U6XB 4YHKL 1JPTH 2C9AA 4BH7A 2ZJSL 4ZTPL 3CXHJ 5DQDH 1W2KT 4G7YH 2EDYA 4HBCL 4NJAH 2LV4A 4PB9L 3QDGA 1CDBA 5GIRB 1LILA 3O4LE 5FA3A 4HCRH 3BP6A 1QACA 4DVBB 3D85B 3QXTA 5AD0B 1AGCA 1UA6H 1KB5B 5TF1L 4HGWB 4QRPB 3O41A 2X7LA 1TETH 5FKPA 2FRGP 2VC2H 4BELD 1EIBA 2NXYB 2Y6SD 1JMXA 4ZUSA 1XGUB 3TJEL 3QFDB 3HS0B 4NQSA 3GSUB 3VXQB 2JK5B 4KQ4L 4XB7A 3PWJA 3R4DA 1MI5E 2SEBB 2VQ1B 5FV2A 1WWAX 4XC3H 1H3XA 5LQBL 5SX4H 3MLXH 4N9GB 3IXTB 4M9OA 1EHXA 2FEDD 1L0XA 1WZ1H 3TVMC 1AXSB 3WFBH 5IVXB 4JFDB 1K2DB 1XR9A 1NDMA 3ARPA 4QF1A 2YR3A 1OB1B 3BI9X 1I9IH 1TCMA 2FECL 3N1MC 3WN5B 4ODUA 4YHIA 2F5AH 5HY9A 3WNNA 4KKAC 5EOCJ 4LSQH 3ULSA 4PJXF 2P4AB 5IVZA 1QO3B 3IDMA 2KBGA 5D72H 5DJXA 2K1MA 4X9BA 3IKCA 3W9EA 1N59A 1CGWA 3NFPA 5GS2D 3E8UL 5E2TL 2CGRH 3PV6A 1ZWIB 2Z31D 3BPCB 3WXWH 1RHHA 1YPZB 1J1XL 3EOTH 4X4ZA 1BQLH 3O11A 4ZPVA 5B38A 3U7YL 2GK0A 1I1YB 2EZ0C 3N0PB 2JIXB 4GQ9H 1YJDH 1H0DA 5GS2H 4IRJC 1T2XA 5D7SH 1U93B 2CLRA 3QIBB 4LPXA 2X09A 4XP4L 4P48A 4N5UA 3U0PA 5ID1A 1FG2A 2B5IC 2ZOKB 1QPXA 1SJXA 4QXTA 5AYUL 3EFFA 4LCCC 1BLNA 1JYXA 1MFAL 5DXWA 1U3YA 5SWSB 5I30L 5DVKA 2XTJD 4UT6H 5CGTA 4OZGB 3CK0H 5HJ3B 4OD3H 1LEIA 1IEBB 4FQJH 1AGDA 1JI1A 2QKIA 3EGSB 4NC2B 5DHVB 1YC8A 1L0QA 3SCMA 4KTDH 4NFCA 4HWBL 4DOHB 4WU7A 1U95B 5HD8C 4HXAL 3T2NL 2NXZD 3T0BA 3GBML 4TPRL 4CVZA 3O6FD 1NBVL 3UTTD 3S8WA 4JRXD 5DD0H 5KG9A 1I9JL 4QT5A 3KJ6L 3GM0A 1A14L 3QUML 4GT7A 1L9NA 4ZTOL 1RUAL 4ZPTA 4QHNB 5EO1A 5DMKA 4PJCF 2JKXA 3WS6C 3GSNB 2EC8A 1KELH 2QSQA 4KI5F 3C6SB 5L2KD 4E9LA 2EKJA 4HT1H 4PJGB 4JFEA 4X9IA 2MMXA 2Q76B 3EDDA 4N0CC 3BZEA 2QSVA 2BHZA 3RVVD 4F7CA 4WENB 1FZMA 1JNNL 1QSVA 1DSFH 1QFUL 1U8MB 1Z9SA 2R0ZH 4N8CL 3GMLB 3LV3B 4P59H 3SKJL 4KAQH 2VL5A 4M03A 4K94L 2NZ9D 4YHOL 1WZKA 2FJHA 3PWPB 2F9BT 1BBJB 1C5CL 2YEZB 4CU7A 3PHOB 4L9LC 3BEWA 2VZ3A 5D1QA 1N4XH 2VXTL 4WGVB 3M8OL 2ZUVA 1CFSB 5I8KL 1WFTA 5F9JB 5IGXH 2XKSA 3D39B 2VLKE 2ZP0T 2YPVH 5ILTH 4L5FH 5IEKB 3PQYE 1NAKL 1J18A 2E7CA 3RI5F 3B9DA 4HIEB 1CGSL 3UTOA 4X80L 3L3GA 2QL1A 3WSQL 1OHQA 3HKFA 2NY1D 1J0KA 4LSVL 5HHVL 1ZT4B 2HG5B 1QBBA 4LU5H 4WTZA 5IG7A 1HINL 2X6MA 4PBVC 4JY4B 4QRTB 2W0PA 2B1AH 2AQ3A 3KPRD 1DP0A 3MGTA 2PTVA 1VFOA 1GOHA 1KCRL 3D3VB 3U4AA 5BV7B 3EYQD 5L88L 3QYCA 2CRYA 2HJLB 2DOCA 3OG4B 3RAJL 5HVWA 1Q72L 1DTUA 3FTGB 4W4NA 1J12A 2FJFB 3D0VA 3QJFA 4YEEA 2YMXL 3A6CH 2PTTB 2EH8H 4OD1H 1BF8A 3HZMB 3WE6A 2H3NB 1RUKL 4CNIB 3KPMB 1I3GL 5J56B 1QP1A 4OKVB 4Q0XL 4OZFB 1NGWB 1NDGA 4Q97A 3HAEB 4I0PD 5FO7A 4MJIE 4TQEH 1FNEA 4NO3A 1G6RB 3GSXA 1QBMH 1SY6L 1ZT1A 3BGMB 3RVTD 1I1AD 3WL9B 5JOEA 1LE5A 4NQEE 3QJHB 4LLUA 5F88A 4YXKL 4PP2B 4H88H 3L7FB 3GRWH 3W5MA 1S5HB 3HE7C 1JF5A 1NMBL 2IQ9L 4KK6C 3KNBB 4NM4L 4NOFA 3ARBD 3EDFA 4CVXA 1QLRA 1QRND 1DBBH 1M7IB 2ADFL 1CG9A 4QRQB 3K80A 2Y25A 4R97B 1WIPA 5JORB 2AK4A 2W9LA 2R4SH 1KJ3L 2OL3H 2BVUA 1RSFA 3RIFK 3QCVL 3V7MA 5ADOH 1MFEL 1AKJD 1WK0A 1H3PH 4LQFH 3CC5A 1ZLWH 4FQXB 3CFDA 3RUGA 4L9DA 1AJ7L 4L3ED 4FQIL 5EU6B 1XIWC 4O4YL 5I0ZA 5D1ZC 2AJUH 4N68A 3TZVA 1XF5A 1TVBA 3GO1L 2WIIA 2EDHA 4JKWA 5D7LA 5C07B 2HTKC 4P46A 1HSAB 4G59A 4JFHD 4XVJL 2QQNH 1HH6A 4YPGA 1A02N 1WBZB 4MDJB 5ESVA 4S0UC 1EUUA 4P49A 3L6FA 1NGPH 2FBJH 3ULVF 2X4RB 4H0HB 5DR5H 5JW3L 5INCA 2R2CA 2XZQH 3BKYH 3MLWL 2GTZB 3VD9A 1XF3A 3MV8B 3ULVH 1KEMH 3FRPG 4EIGB 3LPWA 4WUUE 3WV0A 2J5LC 4PLOB 3DX6B 1JRHI 2HAZA 5KVDL 3VD4A 1L6XA 3ECBB 3H9SE 4Y4FB 2ZCLL 3W11D 4P9HH 1SYVA 5C6WH 4PR5A 2Z92A 2IANB 3LS4H 4G6KL 3L3OA 5HVHB 4PUBL 5EDXA 4ONFH 4M7LH 2FHCA 4LSUL 3K46A 1C16A 1M7DA 3B5TA 2EO9A 5AZ2H 4EXKA 5I1EH 3WFDL 1EH9A 1RUPL 3CSPA 2WLYA 4RAHA 4D2NA 4PJBE 3HE6D 5T3XD 5ACMA 5IUSA 3LQZB 4JN1L 4BK4A 2C4FT 4N8PA 2VLLB 5EOCL 1V3LA 1NGQH 4HWZB 1I8MA 4M7KL 4OUOA 3PP3K 2MCPL 2V2XA 5T3XH 4M4RA 4IHOA 3KYKH 3TN0A 1RMFH 2P7TB 3D2UA 4BFIB 3PDOA 3FQWB 1UFUA 2ZUYA 4YDIH 5I8CB 1CDIA 1E28B 3QULA 4YBHA 3BEVA 1Y18A 3BDYL 5HDOA 5HSFA 1EFXA 1T1WB 4G9FE 5B3NA 1KB5L 2CSPA 3HCVA 1DQQB 1OAQH 3VXOB 2BXYA 4L8DB 1Z5LA 3MRCA 5DJ2A 5EOQL 3LH2H 3JWDC 1FFQA 4ODVH 5CMAB 1A6WL 1RHFA 3QIUC 5D6DC 5J13B 4HKJB 4OD2B 3BT2H 3PWNB 2VDLL 4RZCB 5F71A 3KR3H 5F7YC 1PBYA 4UIKH 3V0WL 4KZDL 2E8ZA 3QG6B 4H20H 4Z9KB 4W68A 4TNVF 4D9LH 3G6DL 3IXAB 4KK9D 2X4PA 2R1XB 1CLZH 2ESVB 5IIEB 5JR1L 4OM1H 2VITB 3TBWB 1A5FL 2CJUL 2CK0H 4YFEA 5EZJA 1KYOK 5IHZB 3FB6A 1IM3A 2W60A 1VEMA 1NANI 3QISA 1NBQA 1MJJB 4JPIA 2XRAL 4LOUC 2Y06H 4X5XB 5TDNA 4QHUA 2IPTL 1CF8H 2OYPA 1AO7E 1QFWH 4B5EA 4U7SA 3UJTL 4XGZA 4GBXB 2P47B 1HK6A 5DD6B 4HGKC 4NKQB 1BD2E 5IMKB 1EFQA 4OCNC 3RNKB 4MWFB 3B2UC 5KW9H 5AZEH 3UJIH 3OKNA 2WUCL 3VI3F 3L95B 1I3RA 3REVB 4JRYE 5F89A 1E4WH 2J88H 5HHXH 3TIDA 1X7QA 2PO6D 4O9HH 4DN4L 4JPWL 1E4KC 3QI9B 4TVPL 1A47A 4ZAKC 1A7RL 5TF1H 3QZWA 2VLRB 5JHLH 5LVEA 4P2QE 2OJZL 3SPVB 1EO8H 4XZUA 5DD3L 2A1WL 3CVHB 3VRLE 5FCUH 3TV3H 5IBUB 4RIRA 3HUJB 1NUGA 5ICZB 4MD4A 3ARTA 4NO0B 3AAZA 4FQ2H 4GMTL 4U1NB 1QYGH 4CMHB 1OTTD 4D0DB 4LARH 1LHZA 1CFVH 1B2WL 2X1QA 3AS1A 4NQCE 1U6AH 2VLKA 1PDKA 5I9QC 2OQJB 2AGJL 4Y5XB 3PQYA 3BO8B 3I6GA 3KS0H 5EU5A 5FXCH 3O6KL 4EBQH 5FKAB 5FAAA 1UACH 4PJFF 3RNQA 3HRZB 1WWBX 5DZOA 3QEGH 3LKRA 1P6FA 3JTSA 4MA8H 3DRTB 3W5NA 3UTQA 35C8L 3CIQA 3GSNL 4P2OC 4YAQB 2VAAA 3OAYK 3SGDH 1QBLL 1OSZB 3O8XC 5EU7C 3F62A 4OFKA 5A3IC 4LSTL 4X0KB 1R3LB 4LSPH 2J8HA 3FT2A 1U8LA 3K0WA 5CSZA 2X4SA 3JUZA 1R5WA 1NMCC 4Z7VF 4QRRB 1KJMB 1KXVC 4KJWC 1NLBH 5IMOB 4OCMC 2VDRL 1CI5A 1CD9B 1RZ7L 6FABH 3QNZB 2EYSA 1QQDB 4GW4B 4X6CA 3PL6A 4M6ML 2EH7L 2F19H 1KIRB 4MJIA 3QDMB 5HYIA 1P7HL 3BH9A 2AEPH 3MLUH 1PLGL 1H3WM 4NQEA 4JRWA 3KLSA 3G5XA 4CL7A 5DT1H 1MCEA 4MNGA 3OV6A 2HRLA 5HPMA 2NY0D 1SJEA 3SDAD 1FBIH 3DV6A 3QO1A 2EEAA 2XG5A 2BVOA 2JB6B 2WWKO 4X6FA 3LCYA 1F6AB 3HC3L 2P5EE 3PNWA 3MRIB 1FDLL 5JW4N 4TPRH 1TCRA 2EYRA 2NYYC 4JO2L 2XWBB 3DETC 1DUYB 4EDWH 3CCHB 4LVNB 3LMJH 1H3UA 4HZLB 1UVQB 2XICA 4X99A 3JBG7 3QUZA 2CLVB 4JQXA 4YBQD 1ZTXL 3IT8D 2HVJB 5GZNC 5L0QC 4MXQC 1RY7B 2NLJB 4GXVH 2HA1A 3SOBH 4X9HA 1WAAA 2I07A 4OFYA 2ZUSA 4R3SA 1QR1A 2R15A 4ZFGH 1EUTA 5GSRB 1PEWA 3CUPA 3MR9A 4FG6D 3QUYD 5KVEL 1EHLH 4PJ9D 1QFUH 2GT9B 4UOJA 5JA8B 4MNQB 1N5YL 4G8GB 2XOTA 1J05B 5GGQH 3FN0H 4HIXL 4HK3N 5DK0A 1G6RL 2DJUA 2H41A 3S5LG 1U3ZA 3VGFA 3CZFB 2H6PA 3O3BA 3HR5B 2BP3A 1QVOA 3DMMD 4CMMB 1ZGLM 1S7SA 2VISA 3RWDA 2W0LA 1RZJH 5MP6H 5CJ5A 2BNQD 3GMMB 2NW3B 4M6NL 4WUUA 1LD9A 1CGSH 3VFOA 2ADJA 2X4NA 4JFDE 4JZJB 3C60A 3UX9B 5F96L 4F58H 1JK8A 5TQ2H 3PJSB 2WWKT 3SN6N 3RPIB 5C7XH 3H9SA 3V6ZB 5HHVH 1YN6A 1NLDL 4HWBA 1SHMA 5D4QA 3GIVA 3KLHC 5FDWA 3MLVL 1OP5H 3MJ9H 3ARFA 4H25B 4GUPA 5KVFH 3OKKB 5D7KE 4PRPB 3S3PA 4UV4H 4FZEH 4HV8A 1SEBB 5L88H 2AJSH 4KMLB 2YBRA 2COQA 3QUMA 2BCKB 4PJBA 2GSGA 3QUKB 3WNPA 4JFFE 2F74A 3OQ3B 5HYEA 3EJZC 1H3VA 5JHDD 2MQ3A 5DVMA 2IFFH 8FABA 1YNLL 4YFDB 3X3FH 4NQUA 1BMGA 3TF7A 3K1KC 3PHQA 4RGMB 5T5NG 1M4KA 2ZUTA 3VFUA 2EO1A 2Y7QA 3B5GA 4U1GC 4YE4H 5D1XB 3JTCA 3MUGB 1OL0A 1YNTA 3BSZH 1ZHLA 4UINL 5B39G 4KQ3L 2R1YA 1GZQA 4JJ5B 1OGTA 3MROB 2C3WA 3VW3H 1I9RL 3CXDH 4Z77B 4Z76B 2HFEB 4ELKA 3KPLA 4OZGE 4G9FA 3D1MC 2Z91A 4XX1E 2VZVA 2ZKHL 4J8RB 2IQ9H 1KXTB 1EMTL 3S5LB 4AEIL 5DD5L 2V5SA 1H8OA 4KMQA 4MVBD 4LFHD 1U3HB 5DWUL 2N7BA 3PE9A 4K7FA 1QSFA 2P24A 4P57B 4KROD 4KMTH 3UTZA 4P4KD 4J1UA 5ITFA 4NWTL 3NABH 4HKBB 4GS7B 1D9KD 4MA7H 3WLBA 2QADD 3JWOH 1EJOL 1DVFA 4MAYB 5D2LB 2C1OA 3U30C 4OLUH 3LHPH 3PGDA 3HZVB 3UZQA 2ATKA 2GCYB 3BW9A 3WKMH 4ZXBB 3RA7H 4JGUA 3WO4C 5JPMA 1A3QA 1FVEB 3NGBB 3GO1H 4XXCC 1JNLH 4PJGE 4PGDA 2Q20A 1UXWA 4R4FL 1AO7A 3U9UA 4F9LC 4O5LH 4OZHB 3PUCA 4F2MB 4KRLB 3FQTB 3AMLA 2UYLA 5EA0L 1BD2A 2VXQL 1P84J 1FNLA 1RZKH 3IGAB 4I8DA 3VU2A 4IMLB 4HFWB 3RTQB 3HNSH 3UBXG 1U8NB 2DQTH 4PV9B 3RBGA 3DTXB 3W0WA 1CL7H 3MLWH 4HJGA 1S7UB 4XXDB 1IQWL 5KVMC 2BFVL 5HVGB 1P6AB 1T5WB 4EN3A 1WCQA 5AAMA 2FH8A 1SY6A 4YIQB 2ICEB 3LKOB 5DQ9B 5MEQA 4KUCF 1SEQH 2I24N 3OGCB 5JW4R 2P5WD 1NGZA 2KQMA 2B2XH 2DYPA 4KHTH 2PN5A 1HI6B 4NCC2 5CZXD 4U0RB 4OCLC 3QIWC 3HTLX 2VDOL 4N1CA 3EZJB 4CKVX 4JHWH 3VI4E 4L4VB 4LSUH 2AS5M 3SQOH 4X6BB 2DDQH 2G5BB 1FJ1B 4PRDB 3IAGC 2X1XR 3MV7D 3C6LD 3JTTB 2P8PB 1S3KL 1MJUL 5F8QC 3M07A 4LLYB 4OF7A 4HLZG 1MJ8L 5BOZG 4JKLA 2C1PB 3MRDA 2GW5A 3MLSH 4M7KH 2X05A 1E0OB 2WBWB 5T5FL 5J6GA 2DD8L 1QFOA 1LE9A 4PREA 1TPXB 4IOIA 4JM2D 4OLWH 1KJVA 5E08L 1FIGL 3BZ4B 1P7KA 5SV3A 4C58B 4XCEB 5GGTL 1WBXA 1F4YH 4YDJA 1MHPL 3RVWD 1ZA6A 3L7EA 4PLJD 4Q6YA 3REWA 1YMMB 1U9KA 1SVZA 1OLZA 3LEYL 2FJGA 3RQ3A 3TO4B 2EDRA 4ZUWA 5ICYA 3WMSA 2PCPA 1AGBB 2DQIH 3ARZA 2CUIA 2VUYA 5A2KH 1NC4B 5I15L 1ONQA 2IG2L 2V5MA 3KLDA 4P23C 3I2CL 3CVHL 3VXMA 2FSEB 4H8WL 4MCZB 3V0WH 1A1OA 5I19H 1ZGLP 3T0WA 1UJ3B 3B8YA 1CE1H 1EV2E 1CZ8L 3FB8A 2FEDC 2KDGA 1VFAB 3ES6B 5JR1H 4JG1L 1OCWH 5I1LA 4S0SD 4OB5L 5EZOL 2DBLH 4EEEA 2H8PA 4GAFB 3PDGA 2WINA 4L29B 4GW1A 1NBYA 4N0FA 5GRWA 4GAJL 5J1SC 1YPZF 4JFPA 3KGRA 2MHAB 1V7NH 4FQQB 4ZNEE 1CBVH 2Z31C 3IDNA 3VWKB 3ET9F 5C0EA 5DUML 2A77H 4FZ8H 4U6XA 4FTVB 4OT1H 2D0FA 1DQLL 3VXRB 1MCBA 3O2WH 5I74B 2D7NA 5GIRA 4YDKL 3MV8E 3DSFH 3QWRD 5D5MF 4DVBA 1FL6B 3D85A 4QOKE 5AD0A 5GRJL 1KB5A 3NCEB 1N64L 4HGWA 4QRPA 2JJWA 4JR9H 3EJYD 5GRYA 3X13B 2XTJC 3OKOB 5F93C 1D5IL 5I1KL 3KXFD 1XGUA 3QFDA 3HS0A 1B3JA 4GOSA 1CFQB 3GSUA 3VXQA 3VFMA 1RK0B 1CLYH 2JK5A 2IANE 3V4UL 3CU1A 4MA3B 5KANG 2IJ0C 3B9KD 2SEBA 2VQ1A 3MRPB 4DW2H 1KNOB 4IIQB 5F1IB 4N9GA 5ADPL 3IXTA 3WUWB 5IB3B 3SGKA 1AXSA 2W91A 1HDMB 2Y1VA 3O6FC 5IVXA 4JFDA 1K2DA 1URLA 3V6OE 1MIEH 3BVNB 5D7JB 3T3PE 3KWWB 1OB1A 1XF2B 4IRSB 3CMOL 5D8JL 2A9MH 4K9EH 4G8FB 1GGCH 3WN5A 4Y5YC 3MNWB 2FO4B 4HPOH 1JPGB 4UDUB 3V5KB 1FORL 1QO3A 3GSRB 4LSTH 3S3JA 3WD5H 5ALBH 1ZWIA 3BPCA 3RY4A 4RDQF 5D70H 1YPZA 1YQVL 5H37G 3MXWH 4KFZC 3STLB 3TPUB 2E9IA 1I1YA 3NCJH 2JIXA 3P4LA 1J0IA 2HRPH 2W92A 3FB5B 2EIEA 4QWWD 5I73B 5CD3B 1EEZB 5M7QA 5DTFB 5BZDB 4XMKL 4ZUTB 5E2UL 3NCCB 3VE0B 4JAMB 1JFQL 4BZ1H 5FFLA 2MTPA 1V7MH 1X5HA 1YEIH 5E2WH 1L6ZA 4HC1A 4M1GH 1UB5B 5EZIH 3Q48A 5IJKC 1JZ4A 1T7YA 3U0WH 4F15C 4LPCA 5SWSA 1FPTL 4OZGA 5HJ3A 5EBLB 3UC0H 5F7NC 3VFRB 1OARL 1IEBA 3EGSA 2YD3A 4GKNB 2RHEA 2RBLA 3EO9H 5DHVA 3MLZH 5FGSA 5ITBL 3G04B 1UWEH 1AGEB 2A9NL 3NFSH 7FABH 2AK1L 4OTXL 1A6VH 5FHBH 5DSCA 4JO2H 1DBKL 3RY6C 1DJSA 1EBPA 1U95A 4PJHB 5SWQB 3MACH 3WS6A 3F7RA 1UWGL 3NIDE 3EYQC 1RZFL 3MYZA 1ZTXH 4Y89A 3OKLB 1CDCA 4QHNA 1I9EA 3UPAA 4GH7B 4JG0H 2ARWA 5H35B 4HUXB 3C6SA 5ESQB 4PJGA 4DCQB 1RUML 4AENB 5KVEH 1WEJL 2FX8H 1OGAB 4I0PC 4OQ1A 4W6WB 1FGNH 4FQLH 4XAWH 4KRNA 4KHXL 1G9NL 3FAWA 3VXSE 1I1AC 4U05A 5C09E 1U8MA 3SDYH 5T3ZL 1LEGB 3SCMD 3GMLA 3LV3A 1XR8A 3WS3B 3C09C 2Z0BA 4E0RA 4JM4L 3PWPA 2YEZA 4M5YL 3PHOA 1GOGA 2L7UA 1A7QH 3ARBC 3BDBA 3G6JE 5DURD 2VDML 1CFSA 1KN4L 4M6NH 5F9JA 3D39A 4DUVA 4PIRF 4Y8DC 5F96H 3BZDA 4XH2B 4RGND 12E8H 4HIEA 4I18B 3SY0B 5INDB 2V2TB 3MRJB 5D93B 2BMKB 4PGEB 3B5HA 5CIPH 5J3HD 1IC1A 4JFED 3T1WA 1ZT4A 2HG5A 5DMGD 4YHZH 2J6EA 5CINH 4JY4A 1UM4H 4QRTA 4WFED 1WVZA 4X6DB 3UTPE 2Y72A 2GYSA 4U1MB 4H1LG 2RFXB 4OGXH 2HJLA 3QAZC 2VIRB 3FTGA 3MV9B 3JZ7A 4K7PL 1VDGA 5D1QD 1JGLH 4JQIL 2J1KA 4YFLI 4QRRE 1KCVL 2DQHH 1S7QB 3D9AL 1FC2D 1CVSC 2IMMA 4S1QH 4CNIA 4WGWB 4UINH 4LAQL 5EORH 1MCOL 3KPMA 5FYKE 4OKVA 4ZS6C 4OZFA 3RI5K 1NGWA 2WP3O 3HAEA 4HWUA 1CCZA 4X7FC 5GJSL 4AZ8A 3CFIC 4RGOH 1UCBL 2CPCA 5MHSE 3CH1B 3WL9A 3QJHA 3MX0A 2FH6A 4CDGC 4PP2A 2BNRE 1X5LA 3P9WB 1C1EL 4P2YA 3L7FA 4HMDA 4L4TB 3W11C 2NX5D 5HGGS 1PSKH 4J3UA 1FE8H 1T1ZB 1S5HA 4W70A 3MTRA 3X3GH 3KNBA 3UMTA 2D7TL 3WIHL 1K85A 2YD7A 2A6JB 3ZE1E 4D9RD 1M7IA 2DQDH 3QEQB 4QRQA 5ACLA 4NDMB 1ZANL 4C56D 5AAWA 2DQFB 5JORA 1EEUA 3HE6C 1XIWA 4XVUD 3FJTA 1YYMH 1GGIH 1QA9B 5FYJU 1JN6B 4R0LB 5IMMB 4PJDF 2B4CH 3DURB 2FX7L 4FQXA 5I1HH 2V7NB 3F7VB 1CN4A 1K5NB 3VXPB 5EU6A 1A7NL 4HG4K 1RZIB 2ERJC 3CZJA 3DUSB 4MLIA 2XPGB 3BAEH 1D7FA 4Z95L 4AIOA 4TUOB 3B43A 3O3EB 1HZHL 4AYFA 1HILB 2DI9A 2I27N 4JDTH 15C8L 2FBOJ 4IDLA 5C07A 5EA0H 4ZNEA 1HSAA 5ERWB 2VXUL 4MNQE 2NY4B 3QG7L 5CWSB 4B7LA 2LVCA 4G8GE 1RIVL 1WBZA 4KJYB 4MDJA 4MHHI 4N5ED 4FABL 3WDIA 4UTBL 1KTRL 2X4RA 4LMQE 1ZLWK 5CSGA 2AK4D 3WFZA 4JKPH 3MV8A 2O93L 1H3TA 1IFHH 4X6EB 1ZHBB 4MJ5B 3LN4B 4QOKA 1CICB 1RUQH 5I1JL 4JCLA 1HNGA 4F37K 3DX6A 3L1OH 3MRNB 5K33A 1NCWH 4KK9C 4M62L 5GS0D 4Y4FA 2J3SA 4HJ0C 3ROLB 2P8LB 3B9AA 1MRFL 2F58L 2DLFH 4G6ML 1DL7H 3EHBD 3VFPB 3T09A 2IANA 2DIAA 5LG1A 4LK4A 2CKBB 5D7LD 4P46D 4EOWH 5ESAB 4WDIB 3ZKMD 1KCUH 3NCYS 5GS0H 1JF6A 3DGGB 3ARGB 5DC9B 3DSNA 3GSOB 3FFDB 2LU7A 3CSBA 3LQZA 3V6OA 3AY4C 1XGYL 2DD8H 3WIIL 2VLLA 2QQLL 4HWZA 1J8HE 5JW4M 4I3RL 2Y5EA 1T1XB 3RHWF 3O4LD 5T1KB 4FMFA 1JRHH 1UM5H 1DLFH 2R29L 5TDOB 2PO6C 4YC2B 2P7TA 4HF5L 5GS1C 4U7KA 4V1DB 4WEUD 4RFNC 4LKCB 5E99L 5T3ZE 5I8CA 2RIKA 5CEZE 3CAFA 3EYUH 5D6DA 1T1WA 3MODL 4PDCE 3MO1B 5E0QA 3O2DH 1DQQA 5EIIB 2YD8A 3WFCH 5CMAA 5CJ8A 4WHDA 7CGTA 2J8UE 4HKJA 4OD2A 2AW2A 3PWNA 5CGMA 4RZCA 1CZ8H 1KCLA 3DLQR 1RIHL 3IU4H 2VXSH 3U4BH 3QG6A 4UAOB 4KGJA 3IXAA 3OKDB 1PD6A 2R1XA 3QQ3B 5DJCA 2ESVA 1J0ZA 3OXSB 5CAYB 2VITA 3TBWA 3ZT5A 1OW0A 3LIZL 5IHZA 3TN0D 3T2OA 4LSRH 3S37H 4Y19E 3D2UD 1LO0L 1NEZG 4APQB 4F9PC 1MJJA 1Q94B 1H5BC 5HBBA 5I66A 3Q1SL 4X5XA 3N85L 1CIDA 1EFXD 3FN9A 4DGIH 4NKDA 4OZHE 4XPAH 1DEEB 4FXLA 3OXRB 2VDPH 4GBXA 5DD6A 4N8VG 4LIQE 4RFOH 5IMKA 3T0XA 4OGYL 3LSOB 3RNKA 1A7OL 4MWFA 4WU5B 5F70A 5LGHH 5GGTA 3ZZ1A 3L95A 4BZ2L 2AI0H 2H26A 4A2MA 3RWHB 4YBLB 3GBNL 2VABB 4TNVK 1QD0A 2YA0A 1OQOA 3QI9A 2PUQT 3HI5H 2DLTA 4KVNL 1G9MC 4OZIE 2VLRA 1NANH 1ACYL 3ESUF 4RWYL 4JFZL 1WFOA 3SPVA 3VA6A 3ZKXB 5BVJB 4M8QB 3CVHA 2EKSB 4UB0L 3HUJA 5C0FB 5ICZA 4U1NA 2NY0C 4L4VE 1MAKA 1TVHB 1G7PB 2CO7B 4I0CC 2AXFB 4BQ8A 4D0DA 4XPFH 3UTSB 4OF0A 3I85A 3G6JA 4PJIF 1KYOJ 4Z0BH 4PLNC 2ILLA 5TQ0L 4UTAH 2AJ3B 4Y5XA 1X5IA 3BO8A 4M61B 2IEPA 4NO2B 5FKAA 4U1SB 1OOAA 3OF6A 3HRZA 4LRIA 2NMSA 2IAMB 1N6QL 3IDJB 4UT7H 5FV1L 2JCCF 1FORH 1BOYA 2W07A 3DRTA 4XNQB 1M05B 4QXGH 4YAQA 1D5BB 1CXEA 1OSZA 3WNMA 2QJDA 4FQPA 4HIIB 1YMME 4PJ7B 1R3LA 4X0KA 4FG6C 5FDYA 3QUYC 5DMYA 3SBWA 4PJ9C 3M1BA 4PPTA 3S35H 1J5OL 1TQBC 4OFPA 1YECL 1OWRM 3MA9H 3C2SA 1JGDB 4EUPG 4XPTL 1UH3A 4N8VB 2MQCA 4QRRA 1KJMA 4OAWB 1SM3H 1H8NA 5IMOA 3QNZA 3DMMC 1T3FB 1R3IL 2VLKD 3BJ91 4GW4A 3PQYD 1QFWM 3Q6GL 1T0PB 4FFZL 1KIRA 1ZGLB 3V8OA 3G5ZB 2DN7A 3QDMA 4Z7UF 3WJLC 1Q8MA 2WIMA 5KSBB 3QRFM 2AKRB 4UUJB 1OARH 5EUKB 4KXZI 4Q7DA 4MS8D 5CCKH 4LNVA 2YPKB 4G80A 5F7DB 1QLFB 2JB6A 1E6OH 4GMSL 1F6AA 5DVOA 3S4SG 2JJTA 1MY5A 3VFGL 5JDJA 3BMWA 1E4XH 1DBAH 3N1QC 4WW1B 1RZFH 4M7ZB 1DE4B 4AG4L 1F8TL 3NFNB 2D9CA 3CCHA 1MVUB 3HRPA 4HZLA 1UVQA 2NTSP 1EGJL 3DBXB 3MA7B 1RQ5A 1FFRA 2CLVA 4FTVE 4JHAL 5J11B 2AJZA 3PL6D 4MXVF 2HVJA 5IQ9B 1OF2B 1VHPA 1RJYB 1LDPL 3QSKB 5FUZL 3VXRE 1F4XH 2NLJA 5C71A 3E2HB 3QWOB 4FRWA 5CFHA 1XGRB 4MJID 1RUMH 3LAFA 3PXHA 1F4AA 1JYWA 1JPSL 3NA9L 3I3DA 3GK8L 1E6JH 4NQED 4NRZB 2C4XA 5GSRA 5GGVL 1JTOA 1ADQH 5HHMB 2GT9A 4MNQA 3DGCR 3OKEB 4HS6B 4G8GA 1PKOA 4NFBA 2G2RB 1J05A 3CFCL 2ED7A 1J9CT 2H9GA 5KBNC 3CZFA 3RWEB 3HR5A 3BYTA 3GNMH 2YPLB 5BMFL 4DKEL 4PS4L 4MCYA 4CMMA 1NCCH 1LVEA 3JWOC 1QSEB 3U7WH 1KN4H 4I0KA 2VE6B 1NUNB 3HC4L 4P4KC 2NW3A 1X9QA 3GHEL 3TNMB 1AHWB 3QUZD 5D2LF 1D9KC 3D5OF 3TNNB 4JZJA 4ZO7A 2QADC 3PJSA 4ZS7H 5HI5D 4PB0L 3RPIA 1HKLH 3IDXH 3V6ZA 3IDUA 4JDZA 4OFYD 3H6JA 1GVIA 5K59E 3LPFA 4I3SH 1INQB 4H25A 3C5ZB 3OKKA 4KRPB 4PRPA 2VO5A 2XY1A 4LVHC 1SEBA 4QHMB 1T22B 4DJMA 2BCKA 2MPAH 4TSCH 3MRGB 4A6YB 1P4BH 3QUKA 2BRQA 1YQ2A 4DEPC 5IROA 1HSBB 2ADGB 3TPUE 4WI6A 2V17L 3NIFE 2ED8A 3HFML 4AL8L 1ZLSH 3MCKB 4ZMAT 5D1XA 2L0DA 3FKUS 25C8L 4WUUD 3MUGA 3NH7H 4F7TB 3L9RB 5JQHC 3C60D 1HN1A 5GJSH 4JJ5A 4NM8H 2HT3C 2PW1B 2ATPB 3H9SD 1G7LA 3MROA 2HT2D 4X5WB 1OM3L 4Z77A 4Z76A 2HFEA 4FXGB 1C1EH 5ISZE 2E7LE 1KIQA 1Q1JL 4JO4H 4K3EL 1IBGL 4KZEL 2ARJQ 4J8RA 5K9OB 3P0VH 2D7TH 4IDJL 4OLVL 1ES0B 4I2XE 3S5LA 2GQHA 4MJ2A 2X41A 3DARA 2DTSA 1U3HA 4Y1AB 1ZANH 1KENL 3RIAK 4M02A 3FO9B 3O2VH 2PR4L 3C6LC 3DRQA 4B53A 4PG2A 5IMLA 4HS8H 4HKBA 3SO3B 5JIKA 5EFIA 1K6QH 5BW7C 4Z7WF 4MAYA 5LXGL 3T3MF 5D2LA 5EULV 1VGEL 1A7NH 4YXHH 3HZVA 4RMTA 4JVWA 3QXAB 2GCYA 3ZLQC 4JM2C 4M93C 3GSVB 4ZXBA 1HQ4A 3P4MB 2D9QB 5IFHL 1FVEA 3P40A 4OUUB 4Z0XB 4NRYB 3P3YA 1TMCB 1YEHH 1P7QD 4G9FD 1DDHB 4I48B 3RVWC 4OZHA 1S5IL 4PLJC 4F2MA 3FQTA 1RIVH 4M9PA 1OT2A 4Y16D 3VCLB 2P44B 3EOAB 3IGAA 5DC4B 1H8SA 4IMLA 3BH8B 4HFWA 4UTBH 5IBTH 3RTQA 4GKZB 1UWXH 3T1FB 2DM7A 4OF3A 2GSIB 1CE6B 4OCXH 4RMQA 2JELL 1U8NA 2DKUA 1K4DB 5A2IH 2QHRH 3MOAH 4PV9A 5F44A 4FQ1H 3TT1L 1HEZB 1QSFD 1VGKB 1A1MA 2LQRA 4P3CL 3DTXA 1S7UA 4XXDA 1IGMH 1MCIA 3DVFA 1T5WA 2OI9B 4QGTA 4YIQA 2ICEA 5DQ9A 4AEHL 1FZOB 1I8IB 3B3IB 3OGCA 3HG1B 4TN9A 5LGKA 4OZIA 2HN7B 5JPNB 4LEXH 1HI6A 3QRGH 1T5XB 3QR2A 4NKIL 3CXHK 5EZLB 3SDDC 1BVZA 1KN2L 3VA2C 4L4VA 1AO7D 1S9YB 4X6BA 5FHAH 2G5BA 1FJ1A 3OKMA 2XG4A 4X6DE 4D8PB 2I26N 1BD2D 3JTTA 2P8PA 4YK4C 3BN9D 4LLYA 1IC5L 1XGYH 4O2CB 5I71B 2C1PA 1KIPB 3W0WD 4S1RL 3I50H 4G43B 4JRYD 1GC1C 2I5YH 4EN3D 4LHJB 1Z3GL 3VG0H 4L8SB 3NPSB 3T4AB 4TVSa 4ZSOB 3T0AA 3BZ4A 4OSUH 2F53B 1NCTA 1AR1C 5T1MB 2BVTA 5HDBE 4PJ8B 2DYPD 3AVEA 4WO4D 1EAJA 1YMMA 5I1CH 1A6TB 4P23A 3TO4A 5DJ8B 1LO5A 1AE6H 1BFTA 4YPJA 3LOWA 3OWEA 1AGBA 4FOMA 3BUTA 2NNAB 3EJYC 4R2GD 1NC4A 5B38G 1HXMB 3E6HB 4XMPH 4CW1B 1F97A 1QEWB 4NQCD 5SX4I 3UBXA 3BYYA 1FO0B 2FSEA 3P73B 4MCZA 1YY8B 3B9KC 1SMAA 3STZB 1UJ3A 3QEQE 3ARVA 2E9BA 5F1OB 3ES6A 2Z35B 4ZFOB 5TE4L 2BSED 5EH1A 1MHCB 3FQRA 2VDQH 4R26L 4X7TB 2FWOB 2HFGL 2ARJB 1GXEA 1V5JA 1VA9A 3GIZL 4L29A 2ENYA 1ZOXA 5CP7A 2C4FU 3D25A 3FMGL 3P9MB 2MHAA 3VGGA 4NC1C 4FQQA 1MCFA 4BQ9A 4JB9L 4OGYH 3BJLA 3VWKA 4Z7QE 4LP5A 1ZEAH 2JB5L 2JTDA 4FTVA 4OKDA 2VOTA 2PXYD 4HWNA 4DQOL 3EO1B 1AXTH 1DZBA 1BFOB 2I25N 3VXRA 4D3CH 3T0DA 1JCKA 1HOCB 4U1HB 3ZE0F 4KVNH 4JKKA 1FL6A 1QOKA 1K8IB 5F7MC 3IDIB 5CHNB 5DUPL 3B2VL 4NNPL 5C0BE 4EVNB 2PNDA 3X13A 5BXFB 3K8KA 3OKOA 1CU4H 2DWEA 2WAHA 5A2FA 4NRXB 3H0TB 1CFQA 3MZTA 4HSQA 4MA3A 5LCVL 4PJHF 2YUZA 4DTGL 3GKWL 3MRPA 1KNOA 2C5DC 4IIQA 5F1IA 3BKMH 4EDXB 5A43C 3CPLB 4G6JL 4Z78B 4YHLH 1WV7T 3WUWA 5IB3A 1LWRA 4S11A 1HDMA 3GI9L 3RU8H 1JHKH 3BPOB 3BVNA 2UY6A 5D7JA 3KWWA 2HJFB 4G5ZH 4KKCC 4LLQB 1UEYA 1CK0L 5KVGL 3TA3B 1XF2A 4IRSA 4NP4L 5L7XH 1KEGH 4G8FA 3MNWA 4ZD3H 4XNXH 4YZFF 1G6VK 1JPGA 4UDUA 2X4TB 1R0AH 4WTZG 2MQ0A 3T04D 3MXVH 3GSRA 4V1DE 4QYOB 1RU9L 4U4BA 5FO8B 1J1OL 1BHGA 2DLHA 2EEDA 2IADB 5E00B 3W9DB 2DIBA 3LKQB 3TVMD 2E9JA 2EDJA 3STLA 3TPUA 5SX5H 1NGXB 3SCMC 1F90H 3JV6B 3W2DH 3BRGC 4XCYB 3FB5A 3K74B 3MJ8B 5CD3A 1EEZA 5DTFA 4ZUTA 3ZKNC 3A67H 1IVLA 1MAML 3VE0A 2RCSL 4JAMA 2EDBA 5C2BL 4NN5C 4JFDD 4LHUB 4R8WL 1PG7L 4IOSD 3N1FC 5IK3A 1UB5A 1TZGL 4Y5VB 4WEMB 4EI6B 1XCQB 4PJXB 3LKSB 4RGNC 5ISZA 2E7LA 3P30L 3JVGA 4I5BB 5EBLA 2QBWA 3VFRA 4RA3A 5D7KD 3VFNB 4GMSH 4RSVA 3X14B 3G04A 2RAMA 1HWHB 1AGEA 1A3RL 5EBWB 1JZ6A 4IRJD 4JFFD 2CDGB 5DD1H 1MJ7L 4NKMB 4PJHA 5SWQA 1AD9A 4XNYL 1F8TH 4GG6E 1VERA 2OZ4H 4XP5H 1EGJH 4URTB 2V7HB 4ODSL 2JIXD 3S96B 2R39A 4LEOB 4BUHA 2FL5B 3OG6B 4GO6B 4L3AA 3OKLA 5D1QC 4A6YL 1N7MH 3JUYA 5A2JH 4ZUUB 4LGRB 1OAZL 2CIIB 1ND0B 1T2QH 2AABL 5MEOB 5H35A 3OR6A 2HKHH 4HUXA 3NA9H 5ESQA 3ZDYE 1EEYB 3OPZL 1G84A 1II4E 4DCQA 4AENA 4C59B 1TZHB 2R69L 4HAGA 2FX9H 1OGAA 1EZVY 1NFIA 5AG9A 4PJEF 3MREB 4P5TB 4LCYB 4EQ2A 2DF3A 4HC1H 4NQVB 1LEGA 3VRIB 1FNHA 5BMFH 3WS3A 1Z0NA 4PS4H 4OI9A 4BM7A 2VWEC 5IHBA 1X5YA 3BE1L 5FOJA 4HHAB 4RMVA 3WFEH 4ETQB 2NXZB 3V95A 4JRXB 3HMWH 3RIFF 4PJCB 2Y36L 2BVPB 5EUOE 3UO1L 3VWJB 3LS5L 2UUDK 3ARWA 4XH2A 4ODTL 4XVUC 3DX9B 3ZDXE 4I18A 2YKLH 3SY0A 1FRGL 5INDA 2V2TA 3KG5A 2DB8A 4PP8C 3STBA 3W39B 2XQYK 3GDBA 3SDXF 4X6DA 3ARDB 4NZTL 4U1MA 5HI3C 2W0KA 4O51B 4PJ7E 5I1GH 4BSWB 2RFXA 4WY7L 4ZFZB 4NN6B 2VIRA 2E7HA 1B88A 2VERN 3HFMH 3RGVB 3ARSA 5FGBA 1CTOA 1MCPL 1S7QA 5H8DA 25C8H 3D39D 4HWEH 4Z5RB 1MRCH 1VFMA 1BPVA 3HI6L 4OLYH 5C0ND 2HLFC 3FT3B 1BAFL 5EPMB 2Z4QB 5TDPB 1RULL 2V2WB 1W0WB 1MHHB 2X4OB 5DEFB 1MQKH 4WHTB 3CH1A 2NY1B 2GJ6B 5FYJL 5I75C 2J12B 4KZEH 5EU3B 3GMRB 2EC9T 2WY3A 4L4TA 5EU4B 5EG6C 3TZVC 4OJFL 1T1ZA 4K3JH 4K2UL 4YFLF 3EHBC 3KYAA 4OFVA 5LWYL 1CR9H 2A6JA 3FOMB 3QPXL 4P46C 4XWGL 3V4PH 2R0WL 1OY3B 3QEQA 5FCSH 3ZKMC 4MDIB 2J6EH 4NDMA 2DQFA 2DQGH 4XP9L 4LAJH 1TJHL 4NHUB 4J3XA 4PD4J 1QA9A 1QPPA 1VGEH 1T03L 1JN6A 4R0LA 3WFHB 2B8OT 2CDEB 5IMMA 1YYLL 4LSSH 3DURA 2V7NA 3F7VA 1K5NA 3VXPA 1W72B 1RZIA 3DUSA 2XPGA 4TUOA 2CK2A 2BJMH 2ZCKL 4KK6D 1HILA 4YHYB 2NY3B 3TYGL 1QRKA 5DHYB 5ERWA 2DL2A 1FZKB 4JDVB 5CWSA 4JPVL 1IC4L 1KB9J 4KJYA 1P69B 1WIUA 2OL3B 3O0RL 2XA8H 1EAPB 2H1PL 3G5YB 2JE8A 4DZBB 2Q6WB 4F3FB 1NFKA 2EDOA 4KKBD 4EXPX 5IT2L 3SE8L 5T1DH 1QSEE 1XIWD 2NQCA 3DV4B 4UNUA 4D9QE 4C4KT 1JHLH 4X6EA 1ZHBA 3NZHH 1MFBL 1S9KC 4MJ5A 3LN4A 1CICA 1F11B 1AKJB 4FQXD 5C0CB 3MRNA 1G1CA 1YEDB 3NIGF 5EU6D 3MFGB 2DQCH 2HTKD 4QCIB 4ZFOL 3ROLA 2P8LA 5E9DE 4YDLC 3TN0C 1FVCB 2X9WA 3VFPA 2ZUQC 4UT9H 3MCLH 1J0HA 2CKBA 4WI2A 5HTSA 5C07D 3F58L 5ESAA 5LAXB 1QFWI 4WDIA 4CJ1A 3HZYB 5IHLB 1W0VB 2BNUB 5CKAA 3H2WA 3DGGA 3H7LA 3L5JA 4P5KB 3BESR 4HG4J 3ARGA 3N06B 3GSOA 3VG9C 1M71B 1DFBH 2BVQB 5CJOL 5C0JB 3RWFB 2IPKA 1OTUD 2X70B 3V4VH 4Z7OF 5K9JL 4LRNH 3FQXB 1YNKH 5GISH 1S8DB 3RL2A 3MV8D 1T1XA 1F5WA 5T1KA 5IF0B 1MQ8A 3TPKA 2DQJL 4QOKD 3ULUL 2XI9A 4WUKL 2M1KA 5DJ6B 5D6CB 2B1HH 2BDNL 4V1DA 4Y4FD 1LO4H 2NW2B 3O81A 1ORSB 2WV3A 2BSRB 4XB8A 2IAND 4I13B 3WXVL 1MCRA 3MO1A 4TULH 2OXGA 4HGMA 2P1YA 1ZKAA 5EIIA 3V9FA 2EDNA 1L4IA 2KUTA 4QTIH 4Y1AE 1JPTL 2KL6A 5JIIA 3U9PH 3QCUH 3T4YB 1GZPB 3BX7C 1TTUA 1YEKH 5DQDL 3T3PF 1L7TH 4NJAL 3OKDA 3QQ3A 2O5ZH 1T20B 1H5BA 2P43B 1K3IA 3OXSA 4HCRL 4Q9QH 43CAB 4XNZC 2BOCB 3CDYA 2LE9A 1UA6L 3QHFH 2Q86B 3VFVA 3VGAB 1J8KA 4APQA 1TETL 1Q94A 3SGDI 2VC2L 4HS3B 3F7YB 1AGFA 3H42L 3C87A 3LD8C 3Q3GB 1FZJB 2NY7H 5FYLE 4PRAB 1VKXB 5I18H 5C8JB 5JUEH 1DEEA 4O02H 2JB5H 4TNWK 3VJ6B 3U6RB 4XC3L 4Y2DB 1WZLA 4P3WA 4PJAE 1XT5A 1QBAA 3LSOA 3MLXL 3JWDH 4WU5A 2P42B 1WZ1L 5MEPB 3IFNH 1U2HA 2P49B 3CX2A 1CFNB 3RWHA 3CDCA 2VABA 3TT3H 1CS6A 1VSCA 1I9IL 2EYTB 2FB4H 3RDTB 5KSBF 2C7UB 2F5AL 2ESVD 2JF1A 4N1EA 3HG1E 4LSQL 2OTUB 4DK3A 1YEJH 5J7CC 3JV0A 4H0IA 4AM0B 4GAGH 5D72L 4OF5A 4YQXH 5BVJA 2ZG1A 3MOBH 4M8QA 2EKSA 2ICWI 3H3PL 4WHCA 5C0FA 5MENB 2CGRL 1CDJA 2QQKL 5LCVH 3WXWL 1D6EB 4ORGB 1S9WB 3NACH 1YN7B 2VTFA 1X5JA 4OLXH 3HA0A 1TVHA 1G7PA 3EOTL 1T04B 4XCCH 1BQLL 2AXFA 3WNLA 3UTSA 2XFXB 5IKCB 4GBXD 3HMXH 1UEMA 5CS7A 2R9HD 5GHWL 1JUFB 1WLHA 4GQ9L 2UWEF 1YJDL 4XT1C 3K2UH 5KSVB 3O3AB 2AJ3A 5D7SL 4M61A 4NO2A 4U1SA 2IALB 2YD6A 2CR6A 5E8OB 3S35X 3DYOA 2IAMA 3IDJA 1T89A 2FYYB 3PL6C 3QI9D 1OPGH 4XNQA 4ZSOE 4D0BA 1SBBA 5I0DA 1M05A 3ALPA 2VLRD 1B0RA 4UT6L 3CK0L 4OD3L 1D5BA 4HX1B 4FQJL 4HIIA 4PJ7A 1F02I 1J0JA 1K8DB 2G60H 4KTDL 3DX7B 2IGFH 1S78C 4HKZB 3MRRB 4RCAA 1JGDA 2HT4C 4MQ7B 43C9B 4N8VA 1MCQA 4HMEA 4OAWA 2E6PA 2XN9B 4JFYB 2YUXA 5HYSG 4J2XA 3OJVC 2DMCA 2KH2B 5DD0L 1T3FA 4R8WH 1PG7H 2NY2C 4PJFB 1TZGH 2FEEI 3U83A 1ZGLA 1KELL 2UVEA 3OF6D 3QDGE 3QUZC 5FO9B 3G5ZA 1J7VR 4JQXC 1O5DT 1LP9F 5E8NB 3S88H 3O8XD 2AKRA 4LVOB 4UUJA 4Y8AA 3ROOB 5A3ID 1S7XB 5HI5C 5EUKA 4GG8B 5LGJB 3QQ4B 3ZTJG 3EBAA 1L7IH 3UTPD 3S3SA 2YPKA 2WBJB 4NC1E 5F7HA 1IC7L 3P0YH 1DSFL 5F7DA 1QLFA 4KJWD 2AV7B 5L6YL 4P59L 4KAQL 1WBYB 5GGRB 2DMKA 2NTFB 2D7OA 1KULA 4Z7VB 3AS2A 4WW1A 2YK1H 3UJJH 1DE4A 4QRRD 5HGDB 3NFNA 2LU3A 3V5HB 4LCWB 1MVUA 4GRWF 3MA7A 5MI0B 4DGVL 4RISH 5IGXL 1BX2B 1OAZH 2MNUA 4OZ4B 1P2CB 2EIBA 2YPVL 5FYKD 4ZOAA 5ILTL 2FLBT 4L5FL 5IQ9A 1ED3B 1OF2A 1RJYA 3VXNB 3E2HA 3QWOA 4MAUH 1XGRA 3NMEA 3NOIA 2E27H 3VGBA 5MHSD 4KXZH 1MLCB 3C60C 3BPLB 3S36H 4OCWH 4NRZA 4EI5C 4LU5L 4WFHE 4W4OA 5FYKH 5HHMA 3DYMA 4X8XA 4HS6A 3OKEA 4PG9B 2EDKA 2ADIB 2F8OA 2G2RA 2YRZA 4OCSH 3SDAB 3QA3B 1XEDA 1INEH 1U8KB 3ARFC 2YPLA 3U2SB 3EDKA 4OGAC 4JEGB 1R24A 2ZNWA 3QNYA 1EO7A 1NL0H 1QSEA 4LCUB 3RFZC 1FL3B 3RWJB 5F6IB 4I4WB 5F6HI 5CP3H 1PZ5B 5IESH 4MQXD 3A6CL 2EH8L 5I76B 3TNMA 1AHWA 1U8OB 4OIIH 3P11L 1P84K 2WUBH 1SQ2N 3TNNA 1TENA 2FCBA 2HFFB 1OD7A 3QEUB 3TF7C 2CMRH 4MA1B 1ZT7B 1G0DA 2YD2A 4PFEA 4K7PX 1GHFH 2DLEA 3MLRH 4XBPB 3UPRA 1QBML 3IVKB 5IB5A 4HIJB 2GKIA 5EBGA 2B20A 4MMZC 1INQA 2QTEA 4H88L 3C5ZA 4MNQD 5DJAB 1EERB 3ME0A 4G8GD 3GRWL 4K94C 1DBMH 2Y07H 2O61B 1IGYB 1AR2A 4QHMA 1T22A 1RURH 3S4SA 4A6YA 1HSBA 1AP2B 1DBBL 2ICWJ 2ADGA 3ILPB 2VL4A 3T2PA 1CL7I 2VXVH 3QT2A 5JNYB 3MCKA 1NKRA 2OL3L 3RZWA 4U1LB 3MRKB 3QHZH 4U1IB 5ADOL 4F7TA 2R56H 4WNQB 3L9RA 4LQFL 1H3PL 4RGNE 4X7CC 3KLHD 4GRMB 1OP9A 1KTKE 1DVFC 2PW1A 2ATPA 3MFFB 1LMKA 4H5SB 3ZDZF 3OJDB 4NCC1 4X5WA 2AJUL 4JGJA 3QXWA 4PJXE 4FXGA 1NSNH 2IC2A 2FGZA 1MFDH 4NN7C 4P5MB 3EJZD 5LWYH 5K9OA 2AJVH 2QQNL 1ES0A 4R4BB 4Y1AA 3JSSA 1NGPL 2FBJL 5F8RC 3GUTB 3FO9A 2XA3A 3WNOA 3OX8B 2XZQL 3BKYL 2DBJA 4ERSH 1YYLH 3HLAB 3PGCB 4KDTA 1N26A 5C9JB 3ULVL 1KEML 5D1XD 3BKCH 5HVFB 3QXAA 1DQDH 1DQMH 3GSVA 3P4MA 1M1SA 4MMXC 5T3ZD 5HPOA 4OUUA 5CEZD 4Z0XA 4NRYA 3TYGH 1S9VB 1TMCA 1C12B 1DDHA 4I48A 4Z7NF 3LS4L 2ITCB 1IC4H 3CFKB 4TTGA 4CAGA 2VWEE 4ONFL 3VCLA 4M7LL 3EOAA 3CU7A 3BH8A 1A22B 4M8VA 5AZ2L 1XZ0B 4GKZA 3T1FA 4AMKH 4NQXB 5I1EL 1T7WA 2LAGB 1U3HD 4R2GC 1K4DA 3DPBA 4TUJB 1NKOA 3ORJA 1HEZA 1VGKA 4OV6F 4MXWH 2OK0H 4KROB 4XTRC 1XAUA 4KGLA 5DFTA 5F9AC 2OI9A 3TP4A 1NGQL 1KJ2H 1EO5A 1FZOA 4MAYD 1I8IA 3O4OB 3Q0HA 3B3IA 5EC1B 2W38A 3HG1A 4X83A 2HN7A 4PJCE 3SDDA 5JPNA 5T3XL 4KI5E 2A73B 3KYKL 4G6FB 1R3KB 1RMFL 4OQTA 3MLTB 4ZXBD 1DLHB 5DLMH 1T5XA 4O2FB 5EZLA 1KPUB 4YDIL 4ZOCA 5J12B 1UYWH 5F7EH 1UWXK 1VB9A 4YUEL 1S9YA 3E6FB 4D8PA 2D3VA 4M1DH 1AY1H 1OAQL 2W65B 3RTQD 1IEHA 3LH2L 1R3JB 1BJ1H 3IYLW 5GPRA 1G1YA 4O2CA 4PRHB 3BT2L 3ULUF 1KIPA 3KR3L 3VXTB 2ZWLT 4UIKL 4G43A 3C5SB 3V0VB 2AK4E 5B8CB 4H20L 3KPNB 4LIQH 4D9LL 4L8SA 3S6CA 3T4AA 4ZSOA 4WUKH 2F53A 4QTHB 1CLZL 3R1GH 4ELMB 1ORQB 4OM1L 4TSBH 5DS8B 5I16B 2CK0L 1J10A 3DOSA 3F12A 1P53A 3V7AG 4PJ8A 3TH3T 4NSKB 1A6TA 5DJ8A 2R4RL 3NAAH 2GJ6E 2Y06L 4HUKB 3KJ4B 2NNAA 2XKNB 4L4VD 1CF8L 1T2JA 3GMOA 4NZUH 2OJEB 1HXMA 1QFWL 3E6HA 3EDEA 2DLIA 2VKWA 2MSPA 5JIHA 3J8F7 3MUJA 4KU1A 3E3QA 1FO0A 3P73A 1YY8A 4WRLA 1PEZA 3STZA 5KW9L 3BXNB 3SQBA 2BOBA 5AZEL 3UJIL 1OLLA 1E4WL 2J88L 2Z35A 2R23B 5HHXL 4ZFOA 4NHUE 2BY0A 4O9HL 4X7TA 3PG2A 2FWOA 5FUCE 1WFUA 2ARJA 2D2OA 3LY6A 4XX1G 3T0EB 5JHLL 1CGUA 1OAYH 4CGTA 1T83A 2CO6B 1I7RB 3KPOB 3DUHA 3H42H 1EO8L 1YMMD 4YXLH 5FCUL 3TV3L 4P23D 4MX7B 4X9FA 3TO4D 3RZCB 1HHHB 3P9MA 5D96B 4FQ2L 1BGXH 1KF9B 1QYGL 2NXYC 1NC4D 5JXAL 4LARL 1Z9LA 2HMIC 1CFVL 1U6AL 1YA5A 4W81A 3EO1A 5AWNL 1VPOH 1BFOA 1BWMA 4KVCH 4EBQL 1UACL 5D2NB 1HOCA 3SGKC 4Y4KB 4U1HA 3IRPX 3QEGL 4LHQB 1OTSC 5I1AB 3IDIA 2K7QA 4MA8L 5CHNA 5C0CE 1RAMA 2VLME 3WN5C 4EVNA 5FM8A 1CGXA 3BDXA 3H3PH 3WKNA 5BXFA 3R06A 2QQKH 2R0LH 4DKDC 4RDQG 4NRXA 3H0TA 4LSPL 1F58H 5FUOH 3MRBB 3DYPA 1LDSA 1MLBB 3V6BR 4PY8J 1ZV5A 3FO0H 5GHWH 2FATH 3VWKD 1NCAH 1NLBL 3CPLA 4EDXA 4Z78A 5EIQA 4M7JH 1YEGH 6FABL 3ULVE 2YWZA 4FTVD 1KLGB 1F45A 2HJFA 4LLQA 3VXRD 4DGYL 3TA3A 2F19L 3L3KB 5T33H 3RKDD 2EE6A 1IILE 4L3CB 3QIBC 1V05A 5D5MB 3WYRA 5C6PB 2DRUA 2PTUA 2AEPL 1UZ6F 3MLUL 4HLZH 5E8PA 5KN5B 3MUZ1 5DT1L 1FSKB 5EWIH 3KYNB 1JJUA 2MKWA 4QYOA 4J3TA 1G9ML 5JO5B 1MREH 5FO8A 4HW6A 1FBIL 4K55A 5HYJB 4QY8B 4TSAH 1IM9B 1DBJH 1GGUA 2IADA 3KXFB 5E00A 5BS0B 3W9DA 3BUYB 3LKQA 4N9OB 2VDKH 1NGXA 2VZTA 4JZOB 3LN5B 1CXLA 3JV6A 3U79A 4POZD 4HUVB 3NZ8B 4XCYA 4EDWL 5KJRH 3MJGX 1DN0B 3LMJL 1FYTB 1MWAH 3NCYP 1BP3B 2FIKB 3IU3B 4JZNB 4OZFG 4LHUA 5D7JD 5GZOD 3HAEG 5DJYB 3TWCH 1UCTA 1B0WA 4Y5VA 4EI6A 1HYSC 1X5GA 1XCQA 4GXVL 4QRSB 3SOBL 4PJXA 3LKSA 5EBMA 4I5BA 1ZS8A 4ZFGL 1NFDB 1IC7H 1EHLL 3ZL4H 3VFNA 5L6YH 5SX5K 3SGEH 3X14A 5C0RL 5FKPB 5GGQL 3FN0L 1AIFB 1I1CA 2CDGA 1RFDH 4NKMA 4PP1D 2P8MB 4FQHB 4LCIH 3TIEB 2YD4A 4L8BA 2V7HA 3QXUA 2DQEH 4IOFD 1Y6MR 3RWIB 3S96A 1WWCA 4DGVH 4LEOA 1NC2A 1XF4B 1RZJL 2FL5A 5MP6L 2DL9A 4CN4A 4U6VH 2CIIA 1ND0A 3TBSB 2FEEL 3OB0K 1HCVA 4F58L 5MEOA 5TQ2L 2GY5A 5C7XL 1PQZB 1EEYA 5C0NC 1BIIB 1TZHA 5ISZD 4Q6IB 2ED9A 2EXYD 3CX5K 4LPYA 3MREA 4P5TA 3OJMB 1IRAY 3MJ9L 1U8PB 2ZG2A 4JGMA 5KVFL 1SJHB 1JGUL 5DJXB 2OS7A 4NQVA 1QTYT 4UV4L 1N59B 3W9EB 3VRIA 1MCHA 4FZEL 5MENE 1JWSB 2AJSL 2PYFB 1P4LB 2BC4A 2FZ3B 4XMLL 1ITBB 3FCTB 5JW5B 2YA2A 1R5VA 2X1WL 3O11B 4U3HA 4HHAA 4ETQA 5BV7C 2IFFL 1U8IB 1F4HA 4JRXA 3TYFB 3X3FL 3P11H 2Z93A 3EFDH 3KYMB 4UU9B 5BRZB 4OM0H 4PJCA 4X6CE 4FQCL 3BZFB 3VI3E 2BVPA 3VWJA 4ALAH 4YE4L 3NBNA 4KJPD 3DX9A 4B7IA 3BSZL 1OAXH 1KPRB 2HFTA 4NBXB 4BQCA 5DFVD 4BFBD 1BZ9B 4ZO6A 5SWZB 3VW3L 2DIJA 3CXDL 1OGAD 3W39A 5ALCH 2AXGB 3MGAA 4MNGE 5F9WB 3ARDA 2L7JA 1BOGB 1MCCA 4D0CB 4O51A 2QKIB 4MSWB 4BSWA 1DN2A 4E5XB 5C9KA 5ICXB 4ZFZA 2AP2A 3HI1B 4KMTL 3AS0A 2PYEE 1AQDB 3RGVA 3NABL 3JWNC 2XN9E 4KKBC 4XPHH 2YN3A 4MA7L 2VSDA 4JE4B 3JWOL 5CIPB 4Z5RA 3BKJH 4R97C 2CIKB 2HKFH 4OLUL 5H37H 4F37F 3LHPL 3FT3A 4ZPTB 4PJFE 5EPMA 1D5ZB 1KLFA 2Z4QA 5TDPA 4R90H 1TZIA 3NCFB 2V2WA 1W0WA 5F3HB 1MHHA 1JMZA 2X4OA 3WKML 1WAAE 1Q9KB 5DEFA 3RA7L 1CFBA 5K9QI 4WHTA 4FQXC 1JNLL 4LKXB 2GJ6A 3BGFB 5EU3A 3TFKC 3P9LB 3GMRA 4LQ1A 3TESA 5EU4A 4O5LL 1WTLA 2VN4A 1MIMH 1RZKL 2VH5H 2O5XH 5DVLA 3L5XH 1JWUB 3HNSL 2DQTL 1OP3H 1IAOA 4MDIA 3SKNA 3U1SH 4QLRA 1CL7L 4G9DB 4XPGH 4ZS6D 4OLZL 4NHUA 5D9SB 3O6MH 3L3HB 4GAYB 1AI1H 4NJ9H 4LCWE 3WFHA 1L8JA 1S7RB 1SEQL 4YWGH 1P1ZB 1P9MA 1UM6H 1OTUC 4EKXA 1W72A 1GSMA 4IJ3B 3GRWA 2IPUG 2B2XL 1BZ7B 4KHTL 4XBGB 4I77L 5HDBF 3KPPB 5HHNB 1N5AB 3CLEH 3E1F1 2BZDA 1FN4B 4JHWL 5DHYA 4Y4FC 3RKPA 1FZKA 4L4TD 4NZJA 3SQOL 4JDVA 4FFEX 2DDQL 2NY6B 5KTEL 1UQSA 2NX5B 2XT1B 4G7VH 4WCYL 1KC5H 3K7UA 2OL3A 1EAPA 3G5YA 4DZBA 2Q6WA 4F3FA 5HVHC 3DHJA 3K4ZA 5I17B 3QEQD 1QKZH 5KZCB 2XQBL 4OCRH 1ZE3C 5TFSH 4KK8D 3MLSL 4C56B 4WI3A 1YEEH 3V6OC 5E2VH 4PJDB 2ZUXA 3TCLB 4OLWL 3WE6B 1ZXQA 1F11A 1AKJA 5C0CA 1YEDA 4WWKB 4HQQH 4PYHA 1WITA 1F4YL 4PRBB 3G9AB 4ZG1A 4WW2B 5IBUG 4YUEH 1S7VB 1FVCA 4NO3B 3VXUB 3GSXB 1ZT1B 4XNMB 1FNAA 5EN2B 1BM3H