3VH8A

Kir3dl1 in complex with hla-b*5701
Total Genus 78
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
78
sequence length
275
structure length
275
Chain Sequence
GSHSMRYFYTAMSRPGRGEPRFIAVGYVDDTQFVRFDSDAASPRMAPRAPWIEQEGPEYWDGETRNMKASAQTYRENLRIALRYYNQSEAGSHIIQVMYGCDVGPDGRLLRGHDQSAYDGKDYIALNEDLSSWTAADTAAQITQRKWEAARVAEQLRAYLEGLCVEWLRRYLENGKETLQRADPPKTHVTHHPISDHEATLRCWALGFYPAEITLTWQRDGEDQTQDTELVETRPAGDRTFQKWAAVVVPSGEEQRYTCHVQHEGLPKPLTLRWE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Killer cell immunoglobulin-like receptor 3DL1-mediated recognition of human leukocyte antigen B
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
molecule keywords HLA class I histocompatibility antigen, B-57 alpha chain
total genus 78
structure length 275
sequence length 275
chains with identical sequence D
ec nomenclature
pdb deposition date 2011-08-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00129 MHC_I Class I Histocompatibility antigen, domains alpha 1 and 2
A PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3vh8A02
3.30.500.10 Alpha Beta 2-Layer Sandwich Murine Class I Major Histocompatibility Complex, H2-DB; Chain A, domain 1 MHC class I-like antigen recognition-like 3vh8A01
3GSVB 3L3KB 5BVJB 5KSUA 4I0PD 1U8KA 5JMRA 1UH2A 5T3ZH 5FHBL 1U3YA 1KCVL 4P2OC 5TDOA 2EDJA 1G9EA 1KT2B 2FX9H 3QZWB 3BN3B 2XN9B 3QG6A 1KIRA 5IB3B 4PJFF 1QLRA 2XZQH 12E8H 3MLXH 2BOCA 5ID1B 1RJLA 4DK3A 4NSKA 3SDXB 1S9VA 2Q76B 1BQUA 3MMEB 2AQ1A 2FB4H 3BDXA 4F37K 3O6MH 5L2KB 1IL1B 1ZA3B 1SBSL 4QRQB 4GBXD 1XFPA 4R26L 4O4YL 4MDJA 3LH2H 4D0CA 2GY7B 2P49B 3QI9A 2A6JB 4WHTA 3BE1H 5B22A 4EI5A 4ZPTA 1RZJH 1JWUA 1VFUA 4QWWC 4QRTB 3T3PE 2EDLA 4F7MA 4CGTA 3O4OB 1ZT4B 2YEZB 2APTA 5IW6B 5LJYH 5TQ2H 4BSVA 1MVUA 1G1CA 1G7JA 3ULVE 2NTFA 2HRPH 3ECBB 1A4KA 1F8TH 4ZUTA 3ARZA 2V7HB 3TF7A 1WAAE 1E28A 1T7YA 5I17B 1KULA 1T2JA 4HCRA 3EJYD 2EICA 1HK6A 3MRDB 1BVLB 4OCNC 3N85H 5BMFL 5MP6L 1UJ3A 4RRPG 5FKAA 2VXSL 1RUKH 5KSUB 5IROC 3U2SA 4PJDF 2RB8A 4KI5D 2CRIA 3L7EA 4MDIA 4W4OA 1KN2H 5E1AB 1X5AA 4X6DB 4PTTB 3G6JB 4R7NA 3TBYA 1R3JB 3EOTH 3TWCL 1LP9A 4MA7H 4U1JA 4CVZA 4X6FA 1ND0A 4G7VH 3QEGH 2FJGB 1A6TA 4X6DF 1IC4H 1NCDH 4U6YB 3CVIH 4Q2ZB 4D94A 1EGJL 1AGEB 4HJGA 4NQEE 4K3DL 4GKZA 4YDLC 1FNHA 1U92A 4RAUB 1CGVA 4WI5A 3U4AA 1WT5A 3L7FA 4ZO6A 5F7MC 4U3CA 3TYGH 3AGVA 4FQXB 15C8L 2Z93B 2GSIB 2CKBA 1HXYB 4BH8B 1PSKL 2NNAA 3BMWA 1H3PL 4F2MB 4P4KC 1JF1B 1H3XA 4IDJL 4Z95L 2CD0A 3HCVB 2FIRT 5GS0D 3GMRB 5IG7B 3D69A 4X7FC 5I8CA 1FLRH 3DI2B 2CLZB 4XMKL 1SEQL 3WO4C 5CWSA 2EKJA 1NGXA 2VYRE 2YBRA 3VFMA 1G6RH 4Y88A 4M43L 1JN6B 2J6EA 4M93C 3KLDA 3U9UA 2PETA 3CAFA 4R90H 4PLJD 1A6UL 5MEOA 4CRPA 1FC2D 5A3IC 1CFSB 1HH9A 1NCAL 5C0IA 3JWDH 2EE3A 1CFQB 2IF7A 5CZKA 4QGTA 4XCFL 3G5XB 3WDJA 1ETZB 3T65B 4L8SA 2H8PA 2ID5A 4S10A 1GYAA 1TJIL 3K1DA 2IAMC 5DC0A 4MSWA 3OB0H 4WV1A 4YXKL 1NQBA 2BVUA 2XY1A 5CLWA 1WBZA 1KYOK 4KRNA 4P5MB 4Q0XL 4UAOB 5GRJL 3O6LH 2R39A 3IS1X 2R2CA 1EO7A 4NKMB 2UUDK 3VXSD 3T4YB 3BQUC 4P4KA 5DZLA 2Y7QA 3CX5J 4LL9A 2Z93A 5JR1L 3BPCA 4M02A 1ONQB 1HYRC 3DV4B 3VXUD 4MA1C 4J3VA 3O6FA 5EFIA 4L4TB 5FYJU 1LEIB 3QEUA 1D5ZA 1U41A 2EC8A 2BY0A 4KKAD 2BRRH 3O8XB 3BIKA 4LGPB 2VZOA 1WC7B 5HYIA 4ZAKD 4P23B 5D7JA 3EJJX 5ESQB 2FJHB 1RHHA 4BQ6A 2IPTH 3QQ9C 3NIFF 4L8DA 4G9FE 4HGWA 4CU7A 1I7UB 3GBML 3S35X 5JPMB 3TO2A 3EJYC 4TRPL 3ARGD 2XWTA 1DEEB 5I1EL 5AYUL 4UNTA 2G9HA 1LO5B 1ZVSB 1MLBB 5GZOC 4LKCA 1IAMA 3EZJB 4MX7B 3SKOA 4Y4FC 2YC1A 4KVCL 5I19H 4FQ2H 1BVLA 1MJ7L 5T1DH 1NSNH 5IESL 3WNKA 2YPLB 3DUUB 4NQSB 1T2QL 5LCVL 4MA8H 1UH4A 2AV1A 1A4KB 4YHPB 4ZUTB 4FQHA 3SJVA 3V0AC 4YFEA 4B41A 5TDNA 1CXLA 1UB6B 1NC2A 2P8LA 5FGBC 3U46A 3L3GA 4IHOA 1RI8A 5DJXB 1ND0B 2B5IC 1FZJB 2A77L 2XACC 3BESR 1JMZA 2C1OA 2AJUH 3FONB 1WEJH 5CP3H 5IHZA 5AWNL 4U3XA 1RUAH 3SQOH 1RURL 4TUJB 4LMQE 3LEXA 3C2SA 1T0MB 4M6ML 1KB5B 5L2KA 3WV0A 1HQRB 4QRUB 2P8PA 5ANMB 3OSKA 4Z7VE 3VRJB 4PJDA 2FIKB 2ITDB 4FTVA 4LPTA 4XP5H 5D5MF 3T0EB 2VQUA 3IGAB 3IU4L 1YQ2A 5C08D 4JN1H 5JLZA 3TESA 4TNVF 2L4OA 3CCHA 1GAFL 3L9RA 1F00I 1NBZB 3CMGA 4U6XB 3QCUL 1J0HA 5C0EB 2BCKA 2MHAB 3IDGA 2UYLA 3FT2A 3IXAA 4PGDA 4MAYD 4Z8FH 4KQ4L 1AKJD 2O5YH 3ALPA 1TJHL 4HDIB 4D9LL 5ISZB 4DOHE 2WLZA 2VUYA 4H26B 3REWB 2YC1B 1O0VA 1QSVA 3UJIH 4WTZA 5FB8A 1CCZA 3SHSA 4P23D 1H8SA 1UCTA 1YMHB 5CGYD 1OQOA 3MLYL 2AV1B 4C57C 3PGCA 1NMAL 3VXPB 3T04D 2F53D 2GUOA 4O02L 3TN0C 3TBTA 4DN3L 4QCIB 1PEZA 5EWIL 5EN2A 5HHMD 2EE9A 3U7YH 3LKOA 4DGIL 3NIGF 2EDQA 4XI5D 2HTKD 1IGJB 3DUHA 1R3LB 3WS3B 1PZUB 1Q9LA 1A3LL 2W38A 4N0UA 1DP0A 4ZAKB 4CKVX 5TFSL 1FYTA 2Y9RT 2VR5A 3J7HA 4TUJA 5DFVD 4WV1B 5CP3A 4ERSL 3MRMB 4CNIB 4XXDB 4RWYL 5JORB 4WV1C 5C0AD 4PUBH 5JTWA 4ZUVB 3C2AH 4AK1A 5CZVL 3RNQA 5C2BH 1J12A 2H2SC 1YEEH 2M8XA 1OAQL 3P40A 4JFDD 5F8RC 2YA0A 1MRDH 1XGTB 2Y7QB 2C1PB 4ZNCD 3CXDH 3RDTD 2FX8L 3OXSA 4MXQD 1NCWH 3DUSA 3H2WA 3RY5A 3NCCB 5D1ZC 5J6GA 3V0VA 2GTWA 4QHUB 3IETA 5D1ZB 3QDMB 4MZ3A 4ELKA 1CXHA 3WN5C 5C9JB 3BKCL 1IAOA 1NDMA 2XNAB 5I75C 2ICEA 2H3NA 1D5ZB 4UTBL 1WGOA 1UWXH 4GAYB 2DN7A 4WO4D 2ADGB 5I1AA 2XTLA 2AI0L 1NGPH 1UCBH 4JHAL 5KVDH 2X1WL 3P4MA 4MQXC 4CVUA 2CR6A 2CGRL 3VWKC 3HI1A 1LWRA 4GFTB 3GSWB 3EYUH 3LN5A 1YPZE 2ZSWA 1JNLL 2AW2A 4PJ7A 5J89A 1K8DB 1UB5B 3UO1H 2MQCA 5DI8A 1T20B 4YAQA 2P7TA 2CKNA 2F8OA 3F12A 4KGJA 2EYRA 1LO2H 1BVZA 3CZFB 2BY2A 4QXUH 4XP9H 5DUMH 4GG8B 5KSAA 2H26A 1S78C 4HWNA 4DVRH 1TZHB 2OJZH 1Q1JH 1JZ6A 3DETC 5ICZB 5DQJA 3O4LD 5CGMA 4NWTH 4NM4H 4RFEB 5T1LA 3QIBB 2F53B 3W5NA 3L3OA 1F45A 2ZUWA 1ZLUH 1RZJC 1YDPB 1NEZA 3MODL 1AQKH 2BSSA 1QSZA 3FHQA 1KCSH 3SOBH 4HWEH 1XIWC 3AAZA 1IZKA 1Q0YH 4ELMF 4YK4C 2A9NL 3TPUE 3CLEH 3QDMA 2JIXD 4NWUL 4PTUA 5D6CA 4M6OL 2J2ZA 3DSFH 4U1SA 2EIEA 2R23B 3ZMRA 1MFBL 1X5HA 1DQQB 4NKOB 1YEDB 2R8SH 1LE5A 1VGKA 1ZVYA 3TBTB 4M7LT 4P3DA 3BMVA 3BDYH 4KU1A 4MDJB 3UP1A 1V7NL 1P53A 5DR5L 3G08B 1KN4H 1IGJA 3EDJA 5GRUL 3NVQA 5CBAB 2FL5A 2WY3A 2FWOB 4PRNB 2AJVH 3R06B 4HS6A 1OTTD 1FYTB 4WNQA 5KSBB 4YEFA 5JHDA 3VFNA 3ZDYE 5FYJD 5LAXA 5EIQA 4Z77A 1RFDL 2GTZB 3PL6C 2VB5A 4A6YL 1HYSD 2HT2D 4NHUA 4OUUA 3PL6B 1JYXA 5K9KB 4OCSH 3WNLA 1HXMA 2VL5A 3LIZL 4TNWK 3ARVA 4PRPB 1PKQE 3LQAH 4LHUG 5INCB 5HSFA 1T1ZA 4Y1AE 2GJ6A 5TE4H 4BUHA 4JPWH 4D9RE 1MAML 3EYVA 2R0ZL 4BFBD 4RA0C 1BZ9A 5JIKA 4MJ5B 2P45B 2OL3A 4X9GA 1IAOB 4FQ1L 2UWEA 4NC0B 2R15A 2J88L 4XWOC 3EYSH 4XZUB 5D4QA 5DJDA 5E4EC 5SWSE 2BC4B 4HPOH 4K3JL 2F5AH 4X80L 1GZQA 1QRND 4NCC2 1X5GA 3O3DB 4HQQH 1U3HB 2R0WL 4K94L 1U58A 3UYPA 4WHDA 4ETQA 4JJ5A 3RAJL 4N0UB 1X4XA 4KKCC 1QSEB 2XA8L 4FABH 2FIKA 3MRGA 4PJIE 5JHLL 7CGTA 2HFEA 4APQC 1P5UA 5FO9A 4PRNA 2BXZA 4Z18A 1O7SA 1F58L 5FYLL 4LOUD 1A7QH 5JLZB 4ZFOL 4NQVB 1R5WA 2E5EA 2PW2A 3GGWA 3VD4A 2BP3A 4URTB 4WEMB 4K8RD 2C3VB 5C0EA 3BZEB 1ZANH 1BD2A 4PBXA 3W11C 4QTIH 3QULB 4G6KL 5HHME 3VD3A 2GSGB 5BQ7B 4JFHD 3SO3C 4PG9B 3UZEA 3D85A 4JM4H 3VGHA 1MFEH 3MV9B 1XH3B 1JBJA 2BFVH 4NNPL 4GMTL 1KENL 4JKLA 3AAZB 5EO9B 2K7QA 1SEBA 4GW5B 3FO1A 2X4TA 2I60H 5KJRL 4JGJA 3RI5K 1NAKH 3H3BC 1U6AH 5FHAL 5CJ8A 4JFYB 1N8ZA 2B5IB 1AHWA 4QKXB 3P77A 3GB7A 1YJDH 3WHXB 5C0FA 2O93L 3PQYE 4F15B 2I07B 2F5BH 1IEAA 1U93A 5ESVB 1AP2A 2A1WH 4OV5A 3K2MC 4OCWH 2D9QB 25C8H 3RIAK 1GC1C 4JY4B 4P5KB 3U6RB 4RA3A 1OARL 1XIWD 1LO4H 1G7HA 5H2BA 5T1LB 5IVXA 1F4XH 3C9NB 1MCQA 4ZUWA 4UNVA 2HJKA 4XPAH 3MLVH 3PGDB 1RD6A 1ORQA 1KPRB 2XWJB 1HWHB 3GK8L 5BRZE 3H9ZA 5EUKA 1L6XA 2Y23A 3J8F7 4ZS7H 4BYHA 4PGCA 2AGJL 2ED7A 4GS7C 5FKPA 1OHQA 4XBGB 3TNNB 2XTJB 3HNSL 4MJIA 1YEDA 4NRZB 1LEIA 3MBEA 4IIQA 1S5IH 4LPUA 4K3EL 5HDQH 1PGRB 2JCCB 1NGWA 5GGTH 5E5RB 3S8WA 4KJPD 1EJOL 4CVXA 2XYCA 2HT2C 4PJ9C 1UZ6F 4X8XA 3V4PL 4L4TE 2FZ3A 4R3SB 1X7QA 3ARGA 1FYTD 5CILL 2G9HB 4G8GB 5IVZB 1T20A 4YAQB 1XF1A 3MJ9H 3GDBA 3QXUA 2YPLD 4YH6A 2VOTA 5TDPA 4DUWA 1ZA6B 1INQA 4HMEA 3BO8B 3UTZA 2VLME 3CFCH 4OCYL 5M94B 1TZGH 1GC1H 4G8GE 3QH3A 1DSFH 4XWOD 1IEBB 3MLRH 1RK0B 5JW4R 3B3IA 4R96B 1F6AA 3RNKB 4XNMB 2R29L 4G8EA 1HHIB 1YYLL 5JQ6L 2BOBB 5JNYB 5C92A 1YDPA 2HP4A 1A2YA 3VRLE 4GAGH 4IRZH 2VABA 1KACB 3RRQA 2YPLE 3V7MA 4NYLB 3I75B 1DVFB 1FVEB 4MAYA 4U7SA 1G6VK 1DR9A 2O5ZH 1QLEH 4IIQB 5JXAH 5CZXD 1RZGA 1KNOB 2EEDA 4AJ0A 3EJZC 1N6QH 3G5ZA 3VGFA 5IJVA 3HZMA 1NPUA 1FO0L 3SCMD 3MV8A 5C7XL 4G42B 5D7SL 3WJLC 1S8DB 4ODTH 4BZ2L 1CD9B 2BDNL 2EYSA 1E6JH 4JZOA 4HWBA 4LCWA 3RDTC 3ARFD 5IR1A 1QSEA 2I27N 3IDYB 4WUUE 2WIMA 3TJEL 1I7TB 4PJ8A 2B1AL 1G7HB 5H2BB 3BZFA 3Q2CA 3QBTB 3CUPA 4FHBD 3FOMB 1DE4A 2QADD 2AK1H 2QQLL 3H9YA 3WFEL 3ZE2E 1SMAA 4L3EA 5D7JD 1A5FL 4XAWH 1QR1A 3QCVL 1FNLA 2Y6SC 2AVGA 5FYKD 3JV4B 2MQ0A 1N6UA 2WK2A 4XPFH 1KEMH 3LKSA 4WO4A 3QUXC 3VXTA 2XWJA 3NZHL 5ICXA 4NBYB 1M6OB 4PG9A 2HWZL 1R3JA 1VB9A 3V52H 4XP4H 1RULL 3UTSB 1BBDH 1BZ9B 4AEIH 3QJHB 3F58H 3N50A 3HNTL 1S9YA 1JGVH 4YHML 3VD9A 3BJLA 4GRWH 4HK0A 2KDGA 2V2XA 4X4MA 2JB6B 1QBLH 5SX5K 3HUJE 2MPAL 4Z0BH 1GGBH 3O3UN 3VMOA 2EC9U 3RWGA 3SDDA 1BMGA 4N0YL 2H9GB 4JFDB 3QHFH 3MRMA 4PD4J 1JWUB 4XHJD 4GAJL 4X99B 5F1IA 3RX5A 3X11B 4FNLH 4W4NA 2VDOL 4FG6C 4NQED 3RUGF 1CFVL 4J12A 4JJ5B 4CAGA 4JKPL 1B90A 4J7RA 1KJVB 4D0CB 5F3HB 1V3LA 5ALCL 1CLZH 5K9OA 4X5XA 1AGCB 4JG0H 1R5VA 4GSDL 5FO9B 4LFHD 3NFNA 3OPZH 3L5WA 1U8KB 2J3SA 3C08H 1JF5A 2J4WL 4H20H 3Q1SH 4P0DA 1MFCH 3FJTA 1KFAL 1U8LB 1A7NL 3K2UL 2DBLL 5IQ9B 4EKXA 1S9XA 4NGHH 1QLRB 4DVBB 1C5BH 5I17A 4QNPE 1UQSA 1FL5B 5F6HJ 3EKCA 5A2KH 3W9DB 4H0GA 2W9DH 3ARPA 3LD8B 4YDVA 4NN5B 3BH9A 3MOBH 3WKMH 1RIHH 5ID1A 5IHUL 3DX7B 5EZJB 4EOWL 5HYSB 4KKAC 1X3DA 3P4NA 5GGUA 1EEUA 3MLZL 4WFHE 2ZUVA 2UV3A 4HC1A 4Z7OF 2ENSA 5T1MA 3V5KA 1SYVB 4GW1B 1QRKA 5HYJD 4HKBB 2BSRB 3FB8B 5ALBH 3LRSB 1F3DH 5D2NB 2VXUH 2XA3A 1A1OA 4AIXA 4RFEA 5GSRA 2P4AB 5DHYA 1FRGH 4G9FD 3E2HA 3RWJA 3SGDI 2DQJL 4TUKL 1JV5A 4KAQL 1QBAA 1IEBA 2NY5L 3I02A 3FOLB 1J1OH 2QHRH 4UB0H 1K3IA 2XPGA 3HRZB 1OSZA 1I8IB 2DM7A 3P9MA 2HKFL 1EO5A 1I4FB 4NKOA 2NQCA 2P5ED 3CFEB 5D2LA 2XZZA 3MCKA 5EOCL 4QYOA 1YN6B 3O6FC 2D31A 1XT5A 1WISA 4KHXL 3FO0L 1JPTL 4M1GL 1FYTE 4RGNC 3VE0A 4C83B 1IGIL 3VW3H 1T0NB 3TO2B 1RUPH 1FJ1B 1UXWA 2BRQA 2WBJC 4NN7B 4M61A 1FZOB 4C55A 1V3MA 4M7LH 2DQUH 2O5XL 1CDYA 1EVUA 3EDKA 5TDPB 1SYVA 4GW1A 1C5CH 1VADB 5D1XD 3IFOB 2XN9E 4HF5H 4TPRH 1KXTB 2DLIA 3HCVA 3OAUL 3MR9B 4G3YH 1C1EL 3A6BL 3C8KA 2OMNA 5GGRB 1IJ9A 2CKBB 1YEFL 1EUUA 2CLZA 3DX6A 2B7DT 1B6DA 1FFOA 3NZ8A 1LK2B 5TF1L 1MCIA 3RTQB 4I5BA 2X4RB 3L6FA 2O26U 1GXEA 5SWZD 2UZIL 4HKJB 1PQZB 3EHBD 1AGDB 1IGYB 1SJEA 2NY0B 1I8IA 4PJEA 2SEBB 1EZVX 4PREB 5BO1L 1D5IL 1F4YL 3H9SD 5E2WH 1MCRA 3GMPB 4PJIB 4U1NB 3D9AH 2RCSH 3MXVH 1T03H 1NMCB 5EZJA 4AIZA 1TVHB 4PV9A 3RPIA 3VXOA 2ICWA 1U8OA 4L8BB 4QRRA 5GGUB 2J7LA 4XCCH 4UOW0 2LTQC 1BQLH 2DWEA 1DJSA 2F9BT 1W72L 4ODSH 4FFYH 2E27L 5HHMB 4HFUL 2B0SL 1GGCL 5ITBH 5FM4A 4RNRB 5JO5A 4JRXB 2BMKB 4AG4H 3CH8A 1YYMH 2CLRA 4XP1H 4APQA 4XVSL 2DKUA 3ULUL 4IMKC 3VH8B 2YWYA 1NFDE 2FD6L 5L9DH 5DVLA 1A7OH 1UB6A 3ZDXE 4UIMA 3O2WL 3BGFC 4KK6C 4I13B 2D2OA 5E8OB 1ZT7B 5D8JL 4KJPC 1FNEA 2BSTB 4XPBH 2IQ9L 3RHWF 2WBJD 4ZS6D 1IM3B 1BVKB 2R56L 4UINH 4WTZG 4PJDB 1OTSD 2BOCB 2ED9A 3KPSA 4IMLA 5LQBH 1B0RB 2P47B 2PTVA 2QSCH 3VXRB 4DW2L 5BS0A 2UVEA 4NZTL 5KVFL 3HFML 4F9PA 2JELH 2ZCKL 3VWJA 2ED8A 2DQTL 3HMWL 3PIQA 4D0DA 1QSFA 4XNZB 2FX7H 4AQ1B 1HQRA 1BJ1J 2P8PB 3LDBC 3KDMA 3UBXA 1J8HE 5EZIH 5HDLA 5I8OL 1DBJH 4NJAL 5GRZA 3I50L 5D7IE 4JO3L 4OF6A 2EXYD 2Y36H 1IT9L 5GS1A 1WCBB 3RTQD 2NXYD 4LEXL 4PJCF 1XF5B 3I9GH 3IDGB 1AI1H 2D03H 2P8LB 4GKNB 4H26A 4F9LA 1WFTA 3TNMA 4OD1L 3O41A 5C08E 1W8NA 1XGRA 3KPOA 1EFXD 2Z91B 3X3FH 4E42B 3LHPL 5HGAA 5EU7E 4BQ9A 3TBVB 3OGOE 3LEXB 3FT4A 3BD3A 1E6OL 1GL4B 3D39E 4JPIB 4G8IB 5HHNB 1M71B 1L7IL 1MY5A 1MJJA 1ZOXA 3OL2A 4F15C 3GBNL 1SM3H 5B3NA 5DJ2B 4OLYH 1CICA 1G7PA 2B2XH 5EUOF 3PP3H 4P4RB 1OAZL 4PJIA 2X4UA 3DX9A 4JB9H 1BWWA 3MTRA 5CEZE 4M7KH 1T7XA 4KZDL 3UTZB 1F3DJ 1Q9KA 3EFDL 4OLEA 5DO2C 4ZTOH 3HE7B 2WMPA 1Z0NA 1W0VA 5CSBA 1S7WB 1FFPA 5HHMA 3TF7C 1U8JB 4OCMC 4XPGL 4WW1A 3CFIC 1H0DB 1YECH 4K3HA 3S34L 5DEGA 3SJVE 5I18L 1KCRH 1ACYL 4OQ1A 3CH1B 1I3RA 4OTXL 4PJAF 4GAFB 4J3OC 5IGXH 1MI5D 3LS4H 4P48A 3GIZL 5CKGA 1G9MH 5HD8C 3OJDA 3FO9A 1CYGA 5B4MC 2MKLC 3O9WD 4TSAH 1KPUA 3NZ8B 4LLDA 4M7ZB 2NY0D 5FUOH 3ARTA 3IJSA 4NHCL 3WUWG 3KS0J 3SPVB 1BEYH 2Q3AA 2VWEC 2APBA 2EYRB 5BW7A 4K9EL 4XHQA 1Q9WB 3A0OA 3FB6A 4NN6C 1BQSA 4FP8H 3RA7H 2H41A 1TVBA 2PR4H 1NBVL 4OF7A 4X9BA 3UJJL 3RIAF 43C9A 2DJ4A 3CXHJ 4EDWH 2WBWB 2YKLH 5IMMA 1T80A 1NFKA 5IBUB 5T1KB 3S4SA 2B8OT 4YNYA 1GGUA 2C9AA 3WJLA 1J10A 4D0BA 5F9DC 3RL2B 3WIFB 3IT8D 4HAFA 4J8RA 3RU8L 3IDXL 3MV01 3KJ4C 1CQYA 4IRJA 3NAAH 2VH5H 4DJMA 1IE5A 4X6BA 2EEAA 3LPWA 4GQ9L 4HUXA 5T3XH 1CGUA 4HLZH 2VDPH 3W11D 4DN4H 3IAGC 5FIEA 5DEGB 1G9NH 5TE7L 5MI0C 1IM9D 2R4RL 2QBWA 1R6VA 3KNBB 3D69B 5I76A 5F1KC 4XPHH 1FPTH 4LSPH 5ADPL 4HAGA 3BPLB 1WZ1L 5IQ7H 4PY8I 1JF6A 3V6OA 3PWPD 5DURD 1EV2E 1CIUA 4Y2DA 5C0AE 5FDWA 4X4XB 4PJ5B 3P0GB 4AENA 4DKFH 2ZCLH 3IJYB 1EEYB 3GSWA 1Z3GL 1UXSA 1P6AB 4O58L 3V8CA 5KW9L 1G7PB 1KIQA 5A16A 5HXMA 5D93B 3MV9D 4R97B 5MHSE 1YMMD 2FEEI 5FHBH 4TVPE 3EO9L 3AUVA 1JHLL 3DVNB 2XIDA 3N1GC 1BQHA 5B4MD 3FFCE 4M8QB 1CGXA 4S1DD 3C6LB 5J6GB 2YUVA 4X7SH 3C5JA 1T1WA 2JK5B 3A6CH 2H3NB 4HCRL 3NTCL 2V6HA 1JHTB 1KJ2B 1HIMH 2OJEB 1MVFA 1I3GL 2ZJSH 2VDRL 5MEPB 4S1RL 4Y2DC 5GJSL 3DSNA 5AZ2H 2F54B 1IBGH 2DIBA 5D1QB 3BP5B 4R26H 2H2PC 1QFUL 3BH9B 3JTSA 4RGND 5E8OA 4F3FB 3RVWD 1NCCH 3M17B 4LCYB 1N59A 2X44D 4I77H 1XGRB 1D6VL 4LLYB 5LWYL 1OWRM 3JWOC 3MSPA 1FL3A 4PJ5E 3EJZD 3FKUS 1CFNA 3K0WA 4EUPH 1KXQE 1H8NA 1QFWM 2PW2B 1ZLSL 4RGNE 4LSQH 3SCMC 1A02N 1IVLA 2AXFB 1KYOJ 1DEEA 1XCQB 2XI9A 5CSZA 5JIPA 3F7QA 1HILB 3DJ9A 1DQLL 5EC1A 4M3KB 5DRNB 4W68A 4ZSOA 2J8UF 4XT1C 3VI3F 1II4E 2WIIB 3SGJC 5DRZA 4PGDB 3EOTL 3Q6GL 3MRNA 4HHAA 1OAYH 4PRPA 1DQDH 4OZFH 4Z5RA 4FQJH 3QUXA 3S36L 3D39B 5GJTL 2DL2A 2R23A 1RK1B 4AQOA 5DLMH 2C7UA 3H3PH 3KLHC 1H9VA 4XZUA 1IC4L 3JUZA 2R1YA 5JDSB 3MV9E 4N8PA 1FDLL 1NMBH 3BRFA 1CDBA 1A1MA 1NJ9B 1RIUH 1ZHKB 2AEWA 4O9HH 5E4EB 4K3DH 5E9DB 1FIGH 2OTPA 2P5EE 4JR9L 4BSJA 5IHZB 3O2DA 4PJ5A 4L9LC 1SJXA 4NO3A 2XQBL 4Q9BA 3QNYB 4YPJA 1CGYA 3QIUA 5LAXB 5JHDE 3DV6B 15C8H 4LCCA 5I30L 1INQB 1I1AC 4XNYH 3VXRE 3E6FB 2X9YA 4YBHA 4P59H 2W0KA 3I6KB 5HVWA 2IH3B 1Y18B 2E7LA 2YZ8A 3VXSB 3S4SB 1SEQH 3CFBB 3ILQD 4D0BB 2VXTH 2BOBA 5C86A 3MZGB 2Z8SA 3L3DA 2HRLA 2VUOA 2VNCA 1GHFL 2C4FT 2CSPA 4P4KB 1FG2A 3DWTA 3MLWH 4I0CC 1UWGH 2ESVA 3LQMA 3L5XL 4OFPA 3L6FB 1B88A 2EZ0C 4L4VA 3KPTA 1RHFA 4M62H 1I9JL 3RUGA 1LK3L 5E6YA 3KS0H 5DFWH 4D8PA 3O6FB 5D9SA 1AE6L 5C6WH 3LZFH 4NRZA 3Q3GB 3G5ZB 4WWID 2BVTA 2OZ4L 4PGJA 4FQLH 1Z9LA 1I1AA 4MAYC 3R0NA 4YGAB 4LPVA 4LHUB 3GRWL 4PBWD 4U6VH 3D1MC 3HC4H 4NN7C 1S9KC 4Z6AT 2BNQD 3UEZA 1I8MB 5EBMB 1TIUA 1FNSH 3ESUF 3C9NA 4Y19B 4LSSH 4RBPH 4ZXBB 4LSRH 2VLRE 3BYTA 1WT5C 3U4EB 3ULVF 4NFDA 2VLJB 1NAMH 3TV3L 1CBVL 3E8UL 2NY3D 4UAOC 3UDWA 3F7RA 4M4PA 1WAAF 3ETBF 5KZCB 5HHOA 2X89D 5EC2A 3SBWC 3G5YA 2EE6A 3EO1A 5EBGA 4L4VE 1ORQB 1IRAY 3PHOB 4PRBB 2R0KL 2QQQA 1ULVA 3C6SB 1FVEA 4NUGH 4PJDE 4OD3H 4FTVE 5EO0A 5FKPB 4HH9B 1EHLL 2EKSB 1VENA 2VLKE 1GZPB 3RL1B 3ZHLA 1GSMA 1PFCA 5I1EH 5BS0B 1IEAB 3UTTB 2XXCB 2XZCL 5D9SB 2AJ3A 1X5JA 1LEGA 2ZSWB 4X6DE 3B9KC 4F7CA 3O3AA 4XP6L 4PRAB 4HJGB 4HGMA 1MJ7H 1INDH 4JFPB 5J3HD 3BO8A 3D6GA 2EECA 5IVXE 1IGCH 3HI6L 1NBQA 3MZTA 4WFEE 4MA8L 1DTUA 3M1BB 5ACMA 1ZMYA 3STZB 4LVOC 4LQFL 3TBSB 4LVOB 4YZFE 2OR9H 4L4JA 4PV8A 5C1MB 4PGCB 3QDJA 2BCKB 5GS2D 1UJ3B 1X5FA 2JE8A 3OKYA 3O9WC 4KWUA 1XEDA 2A77H 5DSCA 1B2WL 1BWMA 1NAMA 3BT2L 3T08A 4HK0B 1CF8L 1SVCP 3RZCD 1H5BB 3CFKA 1A1MB 4ODHH 4U31A 5E9DE 4GG6E 3QWRD 5JDJA 1JYNA 4J1UB 1GRWA 4FFZL 1FLTX 3BPLC 1DVFC 3S3JA 4JO2L 2OL3B 5JQHC 5E9DD 1DQML 3KJ6L 4HS3A 5KSVA 5LXGH 3GJFK 3EDEA 5MENE 5IB1A 4M9OA 4QT5B 5L7XH 3K80A 3O2DL 1B4JH 1I9RH 3SE4C 4Z8FL 2VLJD 4UMGA 1BFOB 1FSKB 4PJBF 4MVBC 3MBED 4E41A 3L7FB 3LOWA 5C09E 1CE1L 5E1HB 5I1CL 1OP5K 4XVJH 1CL7I 5CZXC 3X11A 1V7ML 2M26A 3HG1D 5F9WC 4JZOB 1NKRA 3IKKA 4OKDA 5TJWK 3LN4A 3MUY1 4LAJH 5BZDA 4NNYA 3Q0HA 2JJVA 3MLYH 1J1XL 2WNGA 3FMGH 4OT1L 5EC1B 4Y5XC 1U8MB 3MC0A 3UTPE 3GGWB 1RAMA 4IJ3B 5E6ZA 3INUL 3BZEA 5B21A 2YD5A 4OZGA 1A0QL 1EGJA 1HSBA 4LBEB 4P57A 3EYQD 5IQ9A 5IFHH 2H32B 3G6AA 3TZVA 1GPOH 2P44B 1FAIH 2XZAL 4NZRH 4OIAA 2CXKA 4G6ML 3BIBX 1M7DA 5IJVB 2VLKD 4W6YB 2UWEB 1TETH 3E1F1 3F7YB 1A6AA 3N1PC 1T3FB 5D70H 2BK8A 3RY6A 3MUGA 2BC4A 4B50A 1NLBH 2DMBA 3AC0A 4JO4L 1ETZA 4OGYL 3T1WA 1LE9A 3I3BA 2FYYB 3NIFE 5CIPH 1MCKA 3DRTA 4WUUB 5C09A 4LCWE 1CGWA 1BREA 3FQNA 2AJYL 4EI5C 4Y4HC 3UPRA 2FR4B 5ESAA 5LGHH 2Z4QA 4Y4HB 1X4ZA 1I1YB 3AS1A 3IKCA 5GSVA 2BVPB 4JFPA 3FTGA 5MHSD 3IFNL 3MXWH 4JFOA 4I8DA 3NIDF 4M6NL 4TTDC 4WI9A 3BKCH 3HB3C 4Y19A 3JV4A 5AZEL 1OSPL 3C8KB 4P2CG 1T83A 1A64A 4D2NA 2AXJA 3FT3A 5C0DA 1UFUA 1FFOB 4EI6A 3GHBL 1Q8MA 1Y6MR 3VDAA 3JTCA 1A3RH 1IC7H 2F53A 5JW4N 3MA7A 3SDXF 5B38A 5EFIB 2JIXB 4O5LL 1HH6A 4LCWD 1CXEA 3EUUA 1WQVT 3BIKB 4K23H 5GISH 1JRHH 3C6SA 1HI6B 1DZBA 4AENB 2XPGB 3C87A 1KTDA 4JDTL 3VA2C 4ELMB 1MREH 3B2VH 4UT7L 4WY7H 5I71B 1IGTA 4ZS6C 3CFEA 2ZOKB 3ZKNC 2WAHA 3FN0H 5IEKB 1MNUH 1QBMH 1YN6A 3QQNA 4JZJC 4XX1G 1CZ8H 4ZO9A 1DANU 4Z78A 2K7PA 4ODVL 4M7JL 3S88L 4ODBD 1YUHB 2J1KA 3VE0B 4C83A 5D71H 4EIGB 3CMOL 4RAVA 1TZIA 5ADOL 1PYWB 1BQHB 3BEVB 2ZPKH 3SKUD 1UKTA 3KXFB 5L2KD 2H32H 5ESAB 3ULSA 3WIHL 1BF2A 3PUCA 2ORBH 1DBAL 4KKLD 1FE8L 1JHKH 1P1ZB 4WUKL 1IAKA 5IWLC 2EDWA 4U2ZA 1P2CA 3E2HB 3I02B 3Q48A 5F88A 1MHHB 3RGVA 2R8SL 3P9MB 1AC6A 1OT1A 3TBYB 2FBJH 2C26A 3RY4A 1PY9A 1YZZA 1BZ7B 3RIFF 1MAJA 1I3VA 3WFBL 1RZIA 4M1DH 3WS3A 1F4WH 2NXYB 4X5LA 2IG2L 3NIGE 3KWWB 4RISH 4XRCA 3GMNB 3DOSA 4KJWD 1FGNH 3D87B 1BFOA 4YDJB 1A6PA 5CEZL 2X5PA 4F58H 1AQDA 4LIQH 1MHCA 4NKIH 5GPRA 1F02I 4GKZB 3SDDC 3LIZH 5KVGH 4AT6A 4MJID 1QHOA 4OFVA 1T1YA 3IDJB 1BLNA 3GSQB 3W5MA 4TVSa 2I26N 2EYTB 2WUBH 2UYLB 3FT2B 3S98A 5TE4L 1T7WA 4X98B 2FR4A 2Z4QB 4AEHH 1D9KD 3MGTA 3V4VL 4OJFH 1JF1A 1QFHA 4GRWB 4QRPA 4I18C 3BW9A 3EYOB 1I1FA 5EULV 2J88H 1VDGA 4PJBA 3D39A 1E4XH 2BNQE 2R1WB 5IBTL 1JWSB 2LAGB 3BSZL 1Z0MA 4KK5D 2GUOB 3RGVD 1R0AL 1JZ3A 1A6VH 1P4BL 1T1XB 1H3GA 4HJ0C 1XGYH 2ERJB 1G7IB 2B39A 2VJXA 1FZKA 2HLFC 4P57B 2YMXL 1PKQA 4G8IA 5HHNA 4MWFB 1JTOA 3L7EB 4OM1H 2ARWA 4J1UA 4NN5C 5LGKA 2HJLB 4KXZH 5DQDH 1MPAH 4M4RA 2K9UA 4RGOL 4K7PH 2IANB 4IRSC 3KXFD 1RZGB 1A7QL 3QRGH 2DD8H 3DO7A 5FGCE 1UYWL 1ZANL 1YA5A 2UWEE 1U93B 2IBZX 1UKQA 2VTFA 3VFPA 1S7WA 4YHLL 5FK9B 4QRTA 4C56E 1AY1H 4Y4HA 3HAEG 5F96L 4NNPH 4PJ8C 3L5IA 5KTEH 3FQWA 3LN4B 4PJ8B 3S97C 4R4BB 1WBYA 2Q7YB 3ZDZF 1I7RA 1E4KC 1T5XB 3LMJH 3E3QE 5GS0H 2P42B 2P24A 1HWGB 3F7VB 4PLNC 2VDKH 1HHJA 4I3RH 3LV3A 3ZE0E 3RVXD 2X2YA 3NBNA 2JKXA 3V5HB 1SJEB 1UWXK 5GRWA 3PWPE 5DWUL 3KPLB 5B3JE 3KPSB 4Y2DD 1OF2B 3ROOB 3CFJB 5EBLB 3SE4A 3VA6A 2OP4H 2X10A 2XQYK 2ZUSA 1LO4L 2YSSA 3I3EA 4IMLB 1FHGA 1QSFB 5DRWA 3T0AA 2UZYB 4OAWB 4OKVB 4ORGA 4ZDHA 3IVKB 1AQDB 4HV8B 4KTEH 4MXVE 5C07A 3W39A 3HPJB 2ZCHL 1DFBH 1DQJB 1OGAA 1DBBH 5TPWL 1MH5A 5JXED 2BMKA 4KUZL 5CD5C 2VLJA 2X70B 4P2QD 4ZPVA 1M05B 1M7IA 2VDMH 1C16A 4XTRD 5EC2B 4QO1A 3BPCB 4NQDE 4G7YH 3QH3B 5CINL 4Y5XB 1IAIM 2DJUA 2A6IB 4RQQB 3KNBA 5JZ7C 1GOFA 3H9SE 4IJ3C 4NKMA 4XNMA 3HZKA 4KDTC 2AQ3A 3PWLA 3ARDA 5SX5H 5A2JH 4KROD 4N1EA 4M1CC 1GZPA 2GKIA 4OB5L 1WC7A 5FUCC 4JDZA 4OZIA 5CGYC 4NP4L 4TQEL 4YDJA 1CLOL 2EH8L 1MCWW 3LEYH 4HZAA 5CILH 1TVBB 4M00A 5H94B 1I7UA 5EOQH 1FORH 4ODUB 4KPHH 3MCKB 3TT1H 3VH8G 4PRAA 5T1KA 3CFCL 4WI6A 1YMMA 4P23A 4KMTH 4MZ2A 1QLFB 1TZGL 3L3HA 3QIWC 1Z9SA 1Q9WA 1T0NA 5KOVC 3TH4T 4Z7QE 1PZ5B 1HHGB 1DDHA 4HWBL 1XR8B 2D0FA 4Z76B 1IFHL 3HAEB 4PJIF 4Y16B 2BVQB 2ICWJ 4U0RC 4JLRA 1YYLH 3ESVF 4ZDHB 3IVKA 2QKIA 1MLCB 4WGVB 3WFDH 4PG2C 3VFGH 1TZIB 2PKDA 4K94C 4LLUA 5J6HB 3CVHH 2HFTA 1MCOL 1QQDA 2HLFD 3DMMA 1IGFL 1BHGA 4YDKH 1E27B 5L0QB 3ARBA 4XXCA 2A2QT 4YGVA 1JNHA 4LASH 4GUPB 1IAKB 5JMOC 1QLEL 1F3JB 3RWHB 3PWUB 4YWGL 5E08H 2OTWA 4YK4B 4LLDB 4WU7A 1ED3B 2VE6A 4JPVL 4BZ1H 5MEOB 5GGSY 2NXZB 5C7XH 3PDDA 4N1CA 4OSUL 5GHWH 1IILE 1MCPH 3QISA 2X9XA 4YEEA 1FNFA 5HHVH 4MQXD 3QHZL 3TJHA 4YIQA 3RZCA 1NC2D 1RIVL 5LG1A 3TVMD 3BJ91 4HBCL 4OM0H 4BH7B 1DUYB 3O6KH 4ETYA 4V1DB 5CCKL 2XWBA 3THMH 1S7UB 2W0FA 3P9LA 4W6XB 2QSVA 3T3MF 5BZDB 3W39B 3QEQD 3IB4A 1NBYB 4RMUA 3T8XA 1T5XA 1H3WM 5IM7B 1TMCA 3FAXA 2PYFA 3DO3A 4TVPD 2ZKHL 4XP4L 1BBDL 3KJ4B 4IM8A 4W4OC 4AMKL 4AL8L 4JPKL 4BUGA 4UTAH 3KPRB 1HSBB 4LBEA 3EYOA 3VXPA 4XB7A 1B9ZA 4QCIA 4E0RB 1JMXA 1YPZB 3I6GB 2ADJB 5CJOL 3RVTC 3X3GH 5MENB 4DQOL 4PJCB 3HMXL 1F90L 3NACL 5J7CC 2NX5A 4NKDA 3QHFL 2D7PA 2D7TL 1T3FA 4L3EE 3PXHA 3GMOB 2YRZA 4N0FB 3SDXA 4P9HC 3CVHB 4S1QH 1OLZA 3ROOA 2DM2A 3PWNB 4NJ9L 3IAPA 4JFZL 4MAUL 5HYSA 1ZA3A 4ZUVA 4GSDH 5DUPH 3VXUA 5GIRA 5I1GL 4M5ZL 3IRZA 3MCLH 4L1DA 1MEXH 4CADA 4JFEB 1HZHL 1HILA 3VXOB 1L6ZA 2ITDA 4OIIH 3DGGA 4MNQE 3VXSA 4EI5B 2AEPL 2KZWA 5MEQB 4NGHL 4LP5A 3P30H 3LRSA 1ZT4A 1REIA 4JFFB 3QUYC 3GSNL 5FF6B 3SKJL 5CSZB 3SO3B 1TMCB 5IM7A 3D0LB 5FECB 1FVCA 4LHUD 3FO2A 2F58H 1OAXL 3VWKA 3I6LD 4EOWH 2P5EB 3GMMA 3UZVB 4F3FA 3VFUB 2W92A 4MQ7A 4JN2A 4X83A 3BAEL 5F7DB 4M7ZC 4KDWA 5MENA 5EA0H 2C7UB 5E6IA 1T66D 3SDCB 2QLVB 5DI8B 4J6RH 3SKNB 3EOBB 5DGQA 2OR8A 3PV7A 3RFZC 2AXHA 1FL3B 4FQPA 4NN6B 4E41E 1ZLVH 1BOYA 1HINH 4I2XE 1IC5H 2HVKA 4EVNB 1AXTL 3DVNA 5DMIL 4BH7A 3LQZA 5CIPB 4P9ML 1KXVC 3LAFA 3D0VA 3KPRD 4ZYKA 3WL9B 1WCQA 1OCWH 3B3IB 5D72L 1NC4A 1YNLL 2VC2H 4L5FL 1LD9B 1OAUL 3K8KA 5F1NB 3OKMA 4CN6A 5F9OL 1A9EA 1M7XA 2NLJA 2CDFA 3AU1B 2DQIH 1W0YT 3BP6B 3OB8A 3OZ9L 4XCNB 3EGSB 2B1HH 3S5LG 2I5YL 5JUEH 3L3OB 2MCPH 5CEXA 4HH9A 2W9LA 1HNGA 2UZXB 5BOZG 2WP3T 3WIIH 3Q3GA 3PJSA 4Y4KC 5DT1H 4UDTB 2JB6A 5D7LE 2RHEA 9CGTA 3UTTA 2X1OA 5E6IC 4HKZB 1QFWL 5BVPL 1IMHC 3T0ED 4PJ9B 3P4MB 3NFPB 3ZTJH 4G5ZL 3SE8H 1I7ZB 1ZTXL 1A6WH 4YQXH 4RGNB 4OLUL 2HFFA 3BISA 1CICB 3AREC 3LSOB 2A74A 4U6HA 4G43B 4ODWA 4AYFA 1I3UA 1NH6A 4ZXBA 1SY6H 7FABL 1VFAB 1TLKA 1QOKA 4NM8L 1XGTA 3KYKL 3L3HB 1L0YA 4PJGE 4X6CA 4KZEL 3M07A 1U95A 5L2JB 3QHTC 4WHYH 1Q9KB 1U91A 2CUHA 3ZYJA 5IEHA 2LV4A 4J23A 3WFHA 4X6CF 3MFGB 4XC1H 3L3DB 12E8L 2COQA 3BD5A 1QSFD 4NUJB 4QOKD 2XQYG 4MGXA 4WWKB 1GIGH 4N8CH 3O3EB 3FB5A 1VKXB 4WWKC 1KLFA 3IXTA 2BZDA 4JVUA 5HVFB 2ADGA 5LVEA 4DFHA 3LVEA 3QNZB 1P7QB 4I18A 4FTVD 4QNPF 4J4PD 1YNTA 1E4JA 3IS0X 1K8IA 4JFDE 3DVIA 2NYYC 4OLXL 5IIEB 5GXBB 2K1MA 4DEPC 2VO5A 3OKDB 4UIKH 3P4NB 4HIEA 2P7TB 3FZUC 2VZTA 1NGZA 5AG9A 4BKLA 3O3BB 4JFED 4GKSB 3VGBA 5CD5D 3WJJC 1HSAA 3ULUH 2X09A 5TE6H 4Q9RH 3CJJA 4PJEE 3MNZB 1T2XA 4L29B 3L5HA 5JW5A 3RWJB 4GLRH 4WRLA 1RUKL 3QUMB 2VZUA 3DLQR 3MRGB 1UM6H 2AXGB 4M3JA 5L6YH 1KN2L 2J12B 5DD3H 5GS1B 2X7LA 1VCAA 1NEZG 1FYHB 3H7BB 3TNNA 1JNNL 3UJTH 2OXGA 4RFOL 1AR1C 4M5YH 5ACZA 3MGOA 5IJKC 1HKLL 1PW3A 3B43A 3RIFK 3QEGL 1Z5LB 3CDGA 4WFFD 5JA9A 1G7QB 3FQTA 3HFMH 1NAMB 4HS8L 4I0KA 3BDBA 3BUYB 3WHXA 5C0FB 2IH1A 1FCCA 3VFUA 3MUGB 2DYPD 5EO9A 5L88L 3TT3L 4E42A 3TC9A 3R1GH 2D0GA 3O3AB 1KV3A 4OF5A 3SE9L 4JFHE 2HVJA 5CJQH 3QUMH 5I1LB 4UILL 2X4SA 4PRDB 4LMQI 4JY4A 2W0LA 5I8OH 2XTJD 3PABB 4KJWC 1WWWX 3P77B 4OZIF 4PGEB 2Y36L 2M2DA 5EU6A 3JV6A 1IT9H 4DCQB 4NOFA 2G5RA 4PJ7E 5CD3B 3O45A 1OTUC 4PJXF 5K9KA 4CU8A 3T0EA 1DANT 1KTLA 4IDJH 5DA4A 2NY3B 3HZYB 1TXKA 3TO4C 4HXAH 4UT9L 4F8TA 4Y4KD 1CD1B 3GSVA 3M1BA 4BQ8A 4U6XA 4F7MB 4JAMB 4PJXB 5E6ID 4D3CL 3S5LA 1TQCB 2YA1A 1CN4A 5J3HC 2JK5A 1HEZA 5F9JB 4PD4K 3MBXL 2H6PA 2UVFA 1J0ZA 3G5VA 3O9WB 3IYLW 1N64L 3MACH 5C0RL 1EMTH 1T7ZA 3O3EA 3SQBA 3BKJH 3D85B 1OPGH 3NCMA 3F7PC 3H7BA 1YNKL 3HI5H 4HKJA 3JWDL 3OAYH 4KK5C 3MMEA 2WV3A 4ZTPL 2IALA 2YWZA 5D1QA 3ZKXB 2WINB 2VISB 1UA6H 3MLUL 3TVMC 1E0OB 3KLSA 1J1PH 4L8SC 2DLGA 2H1PH 4G42A 3NA9H 4L3AA 4ZTOL 3RVUC 3FFCB 5C0CE 1FFNB 5FFLA 2ESVD 4P46B 4XX1E 3MCG1 3AROA 4Y1AB 1KCLA 4HUUB 4OTXH 2GY5A 2KUTA 1R3IL 4YR6A 2F19H 1OM3H 4R8WL 2NY2C 3CUPB 4N90E 1AKJA 1A6ZA 2Z8RA 3GIZH 3UCRA 1QKZH 2FHCA 5D1QD 2HJFB 3RVWC 4EQ3A 4YHZH 1U91B 3WFZA 3X12B 5IEHB 1NFDF 3MRHB 2AK4D 2V9RA 1KC5L 4XAKE 1WWBX 1EO8L 3FZUD 5T5FL 1BEYL 2X1XR 4K7PX 4XCNA 3PG2A 1PQZA 1HHIA 1ZWIA 5IFAH 2ADFL 4POUB 1Z9MA 4Y4FD 4HIEB 3RGVC 1U8IB 4NO5B 3UTQA 3BKMH 2F54D 1U3HD 1L0XA 1T22B 2DLHA 4QXTA 3WNMA 3KYMB 3U7AA 3U4BH 4JREB 3RUGB 3QXAA 2F8VA 1TVHA 4PRIE 3SDCC 3ZHDA 1TTGA 1CDGA 4HG4K 3OHXB 5ID0A 3A6OA 3LN9A 2E8ZA 1I8KB 3QJFA 4KK9D 3HNVL 2XV6B 4V1DA 5EORL 4RAVB 3KG5A 3IDIB 2P43B 2W1NA 1S7RB 5T1DL 4H1LA 2HFGH 2FZ3B 2ICCA 3LSOA 5DMYA 2XKNB 3NAAL 5DD1H 4GRWF 1OW0A 4RNRA 5JO5B 3PGDA 4KH2A 4EUPG 4FXGB 1P1ZA 1I8MA 4GRLC 2DYPA 3U30C 5F72S 5EUKB 5KSAB 4PIRF 2DLFL 4RWHA 1CT8B 5I15L 1YEKH 1CXKA 1CIDA 3H9SA 2HT4C 4NC1C 3U4EA 5IQ7L 1HN1A 4G80A 4QHMA 1OT2A 4YHNA 4MDIB 4NUJA 5D6DA 4UV7H 1WEJL 4HULB 2VITB 4OLZH 5I1KH 1JPSL 3HE7D 4LLQB 1S3KH 3SQOL 1RURH 4GBXC 3U0WL 5B38B 1TVDA 3S3SA 1B0GB 4L4VB 3ULVL 35C8L 1ZWIB 3WXVL 4TULH 5BW7C 4DZBB 2FYYA 2C3HA 4P4RA 1GAFH 1J8HB 3GMLB 4BFIA 3RWEA 4S0SD 1QNZH 4OIBA 5HJ3B 5EUOE 3TLRA 3X17A 3E6HA 3QCUH 3T0XA 3SDYL 1R3HB 1URLA 4JZJB 5E8PB 3GKWH 3VFPB 4D9LH 3BFOA 5HBBA 1FSKC 4OQTL 1Z2KA 4BFGA 3DMMC 2OCFD 3MYJB 1BOGB 1J87A 5ISZD 3UJIL 2HTKC 4HFWA 4JFFA 5CSGA 1HXYA 3FQWB 4RAHA 1OW0C 4JHZA 5J0BA 3MNVB 5CJ5A 3QO0B 2EDDA 4EI6B 1XCQA 4S1RH 4NBZB 1EIBA 2CK0H 2VXVH 2MCG1 5C0BE 3WFCL 5C71A 3EYFB 4Y16D 3QUYB 4ZUUB 1IBGL 2YD2A 3BQUB 5C0ND 1HH6B 4ZFOB 1UQSB 4DN3H 1MUJA 5K59E 2Y5TA 4Y5VA 2QL1A 2P5EA 3GMMB 1M4KA 3K1KC 4PJXA 3SDCD 2Z91A 1U8LA 2AV7A 2HH0H 4HD9A 1LO3H 2OR7A 4R2GC 3ES6B 3KPQA 4WTXA 5LWYH 3GMQA 1MRFL 1RK1A 3QDGD 4N5EC 2A73B 4NDMB 4CN1A 4PUBL 1BBJB 2NY4B 1OAQH 1MF2L 2R69L 1AFVL 1NGYA 4GXVH 3CXDL 4U1KA 1BECA 4S11A 1FV1B 4Y1AD 1KB5A 5DXWA 4YDLB 2CIIB 4UQ2A 3DNKA 4AT6B 3QWQB 2PO6D 1DE4B 1NGQL 1KJVA 5DJ0A 1ODAA 4YHOL 4ESKA 1I7RB 2AK4E 4HKBA 4Z0XA 1OL0A 4NO0B 4YUEH 4HWZB 1I75A 2XG5A 5SX4H 4J4PC 3SDAB 4PV8B 3QDJB 1NGPL 1UCBL 4JHAH 5KVDL 4JRXD 2OBGA 2R0LH 1FDLH 1NMBL 3VFSB 1QTYT 1HEZB 3BGMA 4PGBB 5H37G 5DJXA 2V2XB 4X9IA 1N4XH 3TFKD 1JWSA 1PKQB 4CW1A 1IGYA 3UO1L 5IOPA 4S2SB 4JG1L 3HTLX 1WITA 2DIJA 3P11H 4MD4B 4L9DA 3KPQB 5C0CB 1MQKL 5I30H 1BM3H 2P5WB 2VZ3A 1MFDH 5SV4A 1OGAD 1PG7L 1ZSDB 4QRUA 1FGVL 2VDQH 5DMKB 4AIOA 2ZUYA 3O0RH 1BLNB 4G6JH 4L8CA 4DVRL 4DKEH 1K5NB 4QHLA 3QFJE 5B39B 4YHIA 3RWEB 4NWTL 1M1SA 4YNYB 3QXDB 4LKCB 5DK0A 3CU7A 4YFLF 4JLRB 1CFTA 4OBSA 4MCYB 1U95B 2OL3L 1JIBA 5E99L 3UYRH 2OK0H 5A2LH 1GHFH 3H9SB 1IGMH 2Z31D 4XNXH 3VH8A 3CDYA 3JTTB 4X6BB 1ZXQA 4R2GD 3DX6B 2A9NH 4GUPA 1A1NB 4NWUH 4KK8C 2OJEA 2MSPA 2EDYA 4PS4H 3DSFL 5CLTA 1J0IA 2X05A 3U46B 2FO4A 5DDHB 4WU7B 4MHHG 3MO1B 3V6OC 5K9JL 3O11A 2BSTA 2OZ4H 3WDIA 3PHOA 5ISZE 5DR5H 4JZNA 4DZBA 5KS9A 2VZ1A 5H94A 1P9MC 3MJ7A 3TYFA 4FZEH 3MBEB 1BD2E 3TVMA 1EEYA 3IJYA 3CC5B 3RTQA 1BFTA 4NQXA 5KS9F 3OKLA 3IFPB 4F80A 4OI9A 2PYEB 1U8OB 8FABB 2VQ1A 4LPXA 1KIQB 4UUJA 5A16B 1L7TL 3TZVC 4JQIL 1A7RH 4E9LA 4JY5H 2NY6D 1XR8A 4Z76A 3E8UH 1TFHA 4LLMA 4Z78B 1K8DA 1UB5A 3SN6N 4L29A 1NCBL 1S7RA 5DHYB 1AIFB 1D5BB 4JHWL 1U8QB 2DDQH 4HH8A 4JQXA 3RDTA 4I0PC 3WS6C 1HE7A 4RX4A 3VXRD 4Y16A 3WD5H 4NUGL 1ZGLA 4AEEA 4RQQA 2R2BB 4WIQA 3ILPB 4KK6D 5HYSG 3WN5B 4NBXB 3JWOL 4K3JH 4RMSA 4S1SL 5D7LA 2B4CC 3KPLA 2HLAA 5I1AB 3MQIA 1MAKA 4XMLL 4XH2A 1LQVA 4RSVA 2IADB 2NTSP 2ZOLB 4ZAKA 4OZIB 1MIEH 5T1LD 2XA8H 4FABL 4KJQC 2FX9L 4GMSH 4G6FD 3ARFA 1GGTA 2QQKL 1QLFA 2AEQL 2DI7A 4KROC 3CC5A 2BHUA 1FH5L 4HXBH 4NQTA 3HPJA 2PYEA 3T0EC 5JW3L 1EFXB 3HE7A 2FB4L 2DS4A 4G6KH 1Y18A 1C16B 1D5XB 4FQXA 1SBSH 5E8DH 3OXSB 3MUZ1 4U0RB 1MFEL 1B2WH 3L95B 4I0PA 3WS6A 2CIKA 4X4YB 1A14L 2CIIA 3PHSA 2BHYA 1QA9A 5IG7A 1BPVA 1TTUA 4X4ME 2ATPA 2YHGA 5CMAB 1RZJL 5TQ0H 4HIXH 1FG2B 1JTTA 4FQIL 3AY4C 5IMKA 4FFZH 3UBXG 3W81A 4CN4A 1JUFB 4EDXB 4HWZA 2PYED 4U3HA 4MNGA 3NCYP 3ZKMD 4DUVA 2YPVH 5FM8A 4FFEX 2AABL 2WUCH 1CR9H 4M48L 4OZGB 5TF0A 1L9NA 4XNQB 4FQQA 2DQHH 4HLZG 1JVKA 3WKNA 2V9QA 3BGMB 2F5BL 5C0CD 2DTSA 3DI3B 3QDJE 3HG1E 3GMQB 4YHKH 4YPGB 3UTSA 3N85L 4X9HA 5MP6H 4MJ5A 1ORSB 5BMFH 4PTTA 1Z9OA 2IPKA 1TJGH 4WEBL 5D96C 3STBA 2NYYD 4KGLA 1FFRA 3UTOA 5D2LE 4OZGF 5FO8A 2Z0BA 4LSVH 3KAAA 4XWGL 4P2QE 4MD4A 4PPTA 4HPYH 3DGGB 2CXGA 5F6IC 4ENEC 1F6LL 4HUKB 1BIHA 4BK5A 1U58B 4MA7L 3QFDB 1KCUL 4U6YA 3B9DA 5I74B 3SY0A 2WW8A 5FCUH 2FDBP 2CLRB 3MRFB 1T7VA 5IB2B 1MCDA 4Y2OA 4G6AC 5GRYA 1TTFA 4WGWB 5LKNA 1MJUL 2LAAA 1A7PH 3DBXB 3AS3A 5F7YC 4POYA 1N7MH 5EIVA 1QYGL 2XXMB 1ZT7A 4QRPB 3RJDA 2ZG1A 3TZVD 4JFXB 4EEEA 4ELME 5EO0B 3WXWH 1LO0L 3QPQC 3BZDA 1Z6JT 1LILA 2IBBA 3V6ZA 4PRPD 4X4XA 4MNGB 1MCNA 4OLVH 3VXRA 3DTXA 1QR4A 1RHHB 2CDEB 2YZ1A 3VFRA 1UXSB 5LGHL 3QJFB 1VACA 4F7CB 1DUYA 1U3ZA 5EU6E 4LRIA 2NZ9C 4HS6B 3R06A 1ERNA 1JP5A 2YRPA 3O8XA 1FVDB 5SWQA 2JB5L 1G6RL 2IBGA 2NY4C 3ARGC 4M43H 4QLRA 4ZUSB 4ONGH 2IWGA 2YN5A 3PWNA 3V0WH 2R4SH 4R9HA 3QIWB 5SWSB 5GZOD 1DSFL 1A6UH 2R2EA 4L8DB 1NBYA 5IVXF 5INDB 4NQVA 5JQ6H 4F33B 3VRIA 1A3RL 1IC7L 1CLYH 2R9HC 4OZHF 2G2RB 3ILPA 3TO4A 5H35A 1OTUD 3JZ7A 3RX7A 3TGXA 4XCFH 4RZCA 2XZQL 4AEFA 4LEOA 1OD7A 1N5YL 2NY5C 3U0TA 5D7LB 4QHMB 4YHNB 3EOYG 4L4VD 4FFVC 4Y5YA 3HZVA 4YXKH 2JJSA 5GZNC 3WEXB 5BJTB 4Q0XH 5HDBE 1MHHA 3RGVB 4I3SH 4EDXA 2EDNA 5DJDB 1CL7L 3C5SA 4I3GA 1MNUL 4GBXB 4P2RB 3NFPA 1RPQA 3S88H 2NXZC 5I76B 1Q0XH 1ZHBB 1GOGA 2BNRA 5HGGS 1MCFA 3FQXB 1NUFA 2D31B 3UYOD 2HTLD 2VL4A 5DMGC 2HVKB 4EVNA 3FHAA 1CTNA 4O2FA 1BAFH 5ESQA 3K81A 3TJHC 1F8TL 1I7ZA 1UXWB 4PJBE 4HFWB 4ZUWB 2A74B 4S1DC 5FCSH 4XPFL 5DK2A 5HTSA 1IQWL 3B9EA 3MRLB 3FB5B 1VKXA 4QF1A 3WIFA 4QOKE 4QRSB 4AEIL 1JGDA 4LAQH 3X14B 4ZOBA 1UVQA 1QQDB 3T2NL 2FO1A 4XBGA 3ILQC 3LKPB 4HT1H 4KTDH 4JRXE 2KKQA 4P9HL 5EPMA 3PJSB 4HUNB 4KVCH 4HMDA 3T2OA 3IDNB 3IFLH 3QDMD 4HKXA 2GJ6D 4R7DB 4JFXA 3WEXA 1KGCD 1NCDL 4Y4KA 3RWCA 3NCFB 1EGJH 4UDTA 4KI5C 4M6AA 1CFVH 5DEFA 4KTYA 2X4SB 4PRDA 3QNYA 4Q74A 4R3SA 5JORA 2GHWB 1MRCH 3QT2A 1S9WA 5FYKU 3B8SA 4PB0H 3UPRB 1AH1A 3FN9A 3LS5L 1MCSA 3V4VH 2NMSA 4OJFL 4NFCA 3RVUD 4L3CB 4H20L 2AJUL 4RAUA 4WCYH 2DIAA 2HJKB 1F13A 4Z7VA 2KPNA 1OGTB 4PG2A 1A7NH 1VA9A 2DICA 3REVB 4Z95H 3DHJA 5IFJA 3DUSB 3SGEI 1F11B 4M1CD 3PGFH 4JAMA 3SY0B 1Y6NR 3EIFA 4XMKH 2WBKA 2W0PA 2UUDH 4IS6B 1OAKH 3SGJA 5IB4B 1NDMB 2H6PB 2XFXB 2XNAA 4P2RD 3MA7B 3ZKSD 4LEOB 2BHZA 4W70A 5DF0A 4R90L 3E0GA 4EBQL 4KKBD 3MOBL 4R6UA 1WSST 4YBQC 4KQ4H 1A47A 1BZQK 4GT7A 4QY8A 4Z5RB 3RI5F 2J5LC 4KFZC 5ACZB 4YXLL 3PGCB 3ALWA 4OZFA 1K4CA 1Z5LA 4JDVB 1ZT1B 3FQRB 1UZ6E 4YPGA 1DUZB 4NT6A 1R3LA 3NCEB 2AK4B 1TCMA 4N0FA 4IOSD 1AJ7L 4PGZA 4MCYA 5GRJH 3ABZA 3HR5B 3U7YL 4NO3B 4ZFGL 4TUKH 2Z92B 5E2VL 1EHXA 5EDXA 5GGSA 3QO1B 5F7HA 5EU6B 2VR4A 3JV6B 2W0FB 2DJSA 4LSUH 3FRPG 4Z7VB 4LGSB 4NKQB 2RFXA 5BZWB 2IAMD 4K71B 1KTLB 4QXWA 4OGAC 4RWYH 2HN7B 2WSKA 1P7QD 5CAYB 4QRRE 1R5VB 1EEZA 1K85A 1CVSC 1ZLVK 2DQGL 5FF6A 1H15A 3LKRA 1YEEL 4GS7B 2B4CH 2MQ3A 3WMSA 2OP4L 3L5JA 1G7QA 3FQTB 1AD9A 3M8OH 2V5TA 3M17A 4UT6L 1LE5B 3VW3L 5FA3A 4U7KA 4XRCB 2A83A 2OI9B 3RWGB 1UACL 5CBAA 5FOJA 3MV8B 4P2OD 4OZFB 3QP3A 1MHCB 4XC3H 5C0AA 3WLBB 4PLKD 4ZD3L 2EYSB 3L1OL 4NOBA 4P3DB 5DVOA 3FRUA 1C5CL 3TIDB 3WYRA 2GTZA 1S9WB 2NW2B 1JGUH 1I7TA 5F6IB 2BSED 4TVPH 2AK4A 2V5SA 1WZKA 4F7PB 1MFNA 1JNLH 1Q9OA 4K7PY 4MHHI 3O45B 3OAZK 1RJYB 5INCA 1JGDB 1QR1B 4FFWC 2X7LB 5A2IH 3S37H 1YY8A 4ALAL 5GGSB 4KRMB 4QTHB 1LO2L 4U1IA 2EE2A 4XGZB 1MFAH 4ISVA 1CXFA 4NP4H 3IDNA 5DUBA 4TQEH 4HKXB 5T33H 4AY0A 4KQ3H 5CJXC 5I1IH 1G7LB 3LEYL 1E4WH 4G9DA 2OJZL 3D3VD 1Q1JL 5F7EH 2QTEA 2BSSB 1UVQB 4RGMC 1JJUA 2Q8BH 3PWUA 3MXVL 1T03L 5D7IA 2FEDD 3GMNA 4TOYL 2DI9A 3CK0H 5CEXB 4KMTL 1P69B 1KEGL 2XKSA 4LU5L 4GBXA 3U1SL 1LEGB 2XOTA 3HUJF 3TFKC 4NRYA 5IW1A 1AD0B 5HVGB 1I4FA 4JN1L 2E27H 3RZWA 2HYMA 1EA9C 1G0DA 1KTRL 4XCYB 3WFDL 4KI5E 1HHHA 2DF3A 4TUOA 3QUZA 3MYJA 1MCOH 5E8NB 2AJ3B 2JCCE 1DLFL 3NH7H 2IH3A 3RWDB 5EIIB 2IFFH 1A7OL 1FJ1A 5I6XC 1V7NH 4X7TB 2VSDA 4K8RC 4KVNL 4JQVA 3O2WH 3D0VB 1VFMA 3U9PL 3AMKA 3QPXH 2PO6C 1OGTA 4LVHC 3REVA 3X12A 1LDPH 3NFSH 5LBSH 5FYKH 4DKAA 1NMAH 1NC4B 2FHBA 1KIUA 1VADA 1HHJB 5T3XD 4QWWD 2R56H 3QI9D 3AU1A 1CU4L 1W8OA 4KC3B 4DGIH 2X4TB 4KV5F 4OFYA 2N4IA 1NL0L 1VFBA 2IALB 3QHZH 1KJ2L 5D2LB 3QSKB 4LARL 1XH3A 4LHJB 4F7TB 2NXYC 1GH7A 4N0CD 2YD9A 4FZ8L 3B2UD 4GOSA 1J8KA 2CO7B 1G84A 1AO7D 4FQ1H 4XXDA 1KUMA 1U3HA 3GB7B 3P0YL 1IL1A 1OLLA 2PCPB 4Y89A 2YR3A 4LEXH 3TIDA 4HPOL 2ZKHH 5ETUA 4OFYD 4UU9B 2IANE 4HUWB 5F7FA 4ZPVB 1M05A 2C4FU 3V9FA 3G9AB 1ZGLM 3ME0A 4E41B 2Q7YA 2IGFL 2IAMA 4UOJA 2AAVA 1JWMB 1JV5B 1KF9B 3NMEA 4YJZL 3QO1A 4HUMB 3U30B 3NA4A 4X0KB 3GBLA 4Y5XA 1Q72L 5HPOA 3IETB 3LV3B 5HHXL 2V17L 2JIXA 2E6QA 1N0XH 1XIWB 5BVJA 1W0WA 4CW1B 2A83B 1ZLWH 1AR2A 4IRJD 5EBLA 1RJLB 2Y5TB 4Q9CA 1ZK9A 4PRHE 1OAZH 3VFRB 3VD5A 3HRPA 2VXQH 4MNQD 3UAJD 4I2XB 3U2SB 5F89B 4KKNA 1QPXA 2AJXL 5HJ3A 3WIHA 1YMME 1C5DB 1WTGT 3CLFL 4OIIL 1KBGH 4PJFB 5HI3D 4JGUA 4QXUL 3BUTA 4FFWD 4Q97A 4OCRH 1NMCC 3QYCA 3HC3L 1CDHA 3F62A 3U36B 5KJRH 4XPGH 5F71A 3KPPB 4NM4L 1JCKA 3SCMB 4L3ED 4YE4L 1YEJH 4PP2B 1RZFH 5H35B 4PFEA 2G60H 4U1KB 4UV4L 43CAB 1UZ8A 5IGXL 4APQB 5FXCH 2W9EH 3N06B 3EAKA 1OAXH 1Q0YL 3BH8B 2A1WL 3PWPA 4BSVB 4XCEB 2XN9A 3QG6B 2FH8A 4WJ5A 1NC4D 2KQMA 5I75B 1I85A 3CFKB 2APVA 1K9TA 5DRZB 1INEL 3QUKB 5HGHB 1MOEA 3MLVL 4NPYA 4UDUB 3ARDD 1LP9F 3QNXB 1KNOA 1NBVH 3GK8H 1ZE3C 4XNUL 1A2YB 4PJ9D 1GGIL 5IJKA 5HPMA 3MOAH 4NYLA 4PV9B 2E7LE 4L9LB 1UM4H 2Y07H 5BV7L 5DQ9A 3A67H 1P4IL 2N56A 5EZLA 4L5FH 3N1QC 4IEFB 4YHYB 4OFKA 2IQAA 1C8PA 1AO7B 3TM6A 2QKIB 3NABL 3NGBB 1P6FA 4P49A 4JFFE 5KANG 3HZMB 2NTFB 4NZDA 3HUJA 3OZ9H 1DN2A 4JPWL 3QUYA 2DQCL 4ZUUA 4DN4L 4A6YA 5F1SA 4ZG1A 2R2BA 2NW3B 2R4RH 3B83A 4MMXC 4TNVK 3QIBC 3U48A 5F88B 1JZ7A 2IPUK 3WIIL 3KPRA 1F3JA 1F3RB 3TEUA 3QDAA 3MJ9L 3WDHA 3OWEA 3EYVB 3ZDXF 4OCXL 5FV2A 5DD0L 1GJIA 2CJUL 4ISVB 4WW2A 3WSQL 5IMOB 2E7CA 4X80H 3B5TA 1GC1L 5JNYA 1EBPA 1PX3A 4OLWL 1ZTXH 3VXMD 3H0TB 2A6KA 2PNDA 1K8IB 2XT1B 4R4NC 1KLGA 3KHOA 1DL7L 1FBIH 1NGXB 1MJ8L 4WU5A 5IIEA 2CRYA 3KYKH 4MAYB 1J0YA 5JHLH 3QEUB 3FN3A 5HYJA 1TNNA 4LLMB 4F57H 2VRAA 1QRNB 3G9VA 2MOVA 3ULUC 4LRNH 3ARFC 5IEKA 4XCYA 1HHHB 1S5HB 3C09B 3A6CL 5JXAL 4KUCD 4HCRH 3GHEH 3CX2A 3MJ8A 1N6QL 3D39D 4XI5C 3T65A 3V7AE 3FT3B 5C0DB 5EIIA 3CNKA 2CRZA 4HUUA 2V9TA 1ZHLA 4WDIA 1L4IA 4KMLB 4X4ZA 4WW2C 3GSUA 5GGVL 4G6AD 4PJCE 2AERT 3TPUB 3JTTA 1A9BA 4ZODA 5DFTA 1QFUH 2E7MA 2HJFA 2VERN 4XTRC 3FB7A 3QG7H 3O11B 4GW4A 4Z7UF 3E2HC 5E94B 5JOFB 5IT2H 1NCCL 1NAKL 5FHAH 4NQDD 4UIKL 3G5YB 4IRJB 2B1AH 4MA1B 1JN6A 2YN3A 2IJ0C 4XBEH 2DOCA 3RHWK 2E6PA 3FO1B 3PP4L 1KTDB 1OF2A 5IV2A 4G8FA 2YXFA 1K3ZA 3QCVH 4JFYA 4KK8D 1CFSA 5DJZA 1P9MA 1WV7T 1KEML 3QNXA 4OUOA 1KB5H 3MJ7B 4TN9A 1EAPA 1GGYA 5IBUG 1ZLWK 3TYFB 4BFEA 5HYJE 5J56B 4QXTB 4OZHA 3NZHH 1XAUA 3GFUA 3EW3B 4P23C 1PBYA 1YEHH 5DRWB 1EVTC 5C08B 5I73B 5F6HI 1JFQH 1CFTB 5KVEH 4LQ1A 1LNUA 1F4XL 3ZTNL 8FABA 1I9IL 1JGVL 1UM6L 4YHMH 1QSED 3ZE1F 2CLVB 4NO2B 4MB3A 5KG9A 5HYEA 3VWJC 3OKEB 1T6WA 3VFOB 5GSRB 1AGFB 4H25B 1T5WA 2MWCA 4N0YH 5ILTH 2BNUA 1A1NA 4OZ4A 1CLCA 2W60A 4RFOH 5FA4B 3CH1A 1U8QA 5F8QC 2RAMA 5GJTH 1ZS8B 3HNSH 3BP6A 4V2CB 6CGTA 3VXNB 2A6IA 1I85C 3RJQB 5FUZH 3H42H 5I0ZA 2V5RA 1S5IL 5J11C 1CGSH 1T89C 1IC1A 5DVMA 4MB5A 5ISZA 4LCIH 1WBYB 1IAIL 5EOCJ 5ERWB 1PLGH 4WJ5B 2OS7A 3NN8B 1FIGL 1P7KB 3MRJB 3OPZL 3W2DL 3HE6B 5IK3A 2F53E 3UTTE 5DVNA 2PXYD 3OKLB 2IPKB 3Q1SL 1MFCL 2X89A 3BKYL 3V6FB 1PG7W 4KDVA 1G7IA 3EBAA 2YSSB 3ZHKA 3KHQA 1T0MA 4XNQA 1KG0B 2PN5A 3TA3A 1PX4A 4X6EA 1KELL 2KQNA 1VGEL 2NXZD 3MA9L 4MWFA 5GGQL 1T4KA 1NFIA 2C1OB 5EN2B 3R4DA 3CFJA 1ORSA 1C5DA 3LCYA 2EIBA 1MQ8A 3MOQA 1FC1A 4BA8A 4L9LA 2MNUA 2D4DA 3KYAA 4J3TA 1VPOH 5ANMA 3VWKD 1OB1B 1ZEAL 2ARJQ 3DURA 3LB6C 4PDCE 4K2UH 1RZ7H 2DM3A 4PJGF 3HE7C 4LHQB 3OAZH 2CLVA 1FV1A 3MBXH 4FOMA 4HV8A 3NCJH 1I1FB 5C07B 3T2PA 2PW1B 2OZ4A 5FK9A 5D5MB 3VCLA 3TPKA 3OR6B 4IRZL 5DJ0B 2W91A 1RJZA 2AEIT 5FYKE 2X4NB 5I0DA 1UA6L 3MLUH 4KDTA 1EEQA 4DGVL 4K8RH 1S78D 3BVNA 1JUFA 5IB5A 3GSOB 5C09D 2AV7B 2YD4A 3GRWH 3OKOA 4KKBC 1WTLA 1BGXL 4U6VL 4N5EA 1YQVH 1FO0H 3I2CL 4YX2L 4U1NA 5E0QA 3VWJD 1L9MA 1UEYA 2OLDA 4OV6F 2ICWB 1J1OL 2QHRL 4UB0L 4CL7A 1X5ZA 4GKSA 4P2RE 3TJEH 3WNNA 4QHNB 5C0NC 2PTTA 2YS4A 3BQUD 4MD0B 5C0JB 4U1LA 4PP1C 1NGYB 4QOKB 1CG9B 4YHZL 3HLAB 4JRXA 3GSUB 2IC2A 3C5JB 3K4ZA 4F7EA 2Y4SA 5T5FH 3GEWB 3T1FA 1PZ5A 2R0KH 1DEDA 4WWKA 3X14A 2DQFA 3V52L 5BJTA 5C0BD 3RWHA 3BKML 3QUYD 4LLUB 5MEPA 1ZHLB 5T3ZD 3VXQA 5C8JB 3OGCB 3MR9A 5F9AC 3L3KA 5IP4A 1QBLL 2MPAH 4Z0BL 5HY9A 2AQ2A 5JOFA 4Y4KB 1ZHBA 2FO4B 2F74B 3OAUH 4IDLA 1C1EH 3LD8C 3LN5B 4I4WA 5T3ZL 3QDME 1YEFH 3HHRB 1KCVH 5HHPB 1N3NA 1B0GA 4LVNB 3AMLA 3M45A 4BKLB 4PJ7B 4P2RA 3DROB 4PJEB 1CLZL 2DWDA 3GSNB 4NQXB 4NIKB 3MREA 3P0VH 4TSCL 4ZNEE 4NO0D 3RZCC 4WFHD 4OZIE 1I1AB 4OGXL 3GZKA 4PJ7F 3F12B 4PJXE 5CEYA 2G2RA 3QIUC 4HIJB 4O51B 3GI8H 1UM5H 1C5BL 1JPSH 4N8VA 5SX4I 5F70A 3LKPA 3U0WH 1QG3A 2H2PD 2X4QB 5K9QI 1BQLL 4N68A 3QUXB 2ESVB 1BFVL 1RUML 2JJSC 4ODSL 4MVBD 4GAYA 4LSTL 3GUTB 1MWAA 2P46B 1GGCH 3HAEH 1RIHL 2HRPL 3W9DA 5JDSA 1PEWA 4CU6A 5L7XL 3JWNC 3N9GL 4C54A 1MCWM 4Q9QL 4C56D 1Y0LB 4GH7B 3WUWB 2GJJA 2N7AA 3DX7A 1RMFL 4OQTH 2EIZA 1CE1H 2VXSH 4QGYA 3TIEB 1V7MH 5ALBL 4LCCB 3QIWA 5SWSA 3PWVA 2LU3A 3RP1A 3VG9B 5AYQA 5T1MB 3V5KB 4GG8A 1FRGL 1T0PB 3VFTB 1FN4A 3QUZC 4UINL 4PLOB 2PTTB 4BK4A 2X4UB 3DX9B 4G7VL 1A1OB 3OR6A 5DD5L 2VDLH 1QSFE 4NNXB 4PJHA 1U8HB 2LE9A 3BHBA 3N0PB 5IFHL 2PO6A 1XF2A 4TSBL 2HKFH 2VIRB 1FAIL 2BVOB 4NZRL 3VJ6A 5D5MA 2ARJB 3VCLB 4LDOB 5FYLD 4NPYB 4ZXBD 4HK3J 4WENB 3RKDC 3SDAA 1MHPL 5CMAA 3BP4A 2QSTA 3MLTA 1KTKE 2YK1H 2NY7H 3SGDH 1IGIH 2X4NA 2ESVE 4CMHC 3KPMB 5KZCD 1RUPL 3DVGA 1P7KA 1H3PH 3GSRA 3MRJA 4I9WD 1HDMB 2FECL 3T0EE 3DXAB 4OD2B 3U7WL 1FLRL 4Y8AA 2PXYA 2FATL 3BPNB 3FRUB 2DQUL 2O5XH 3VGGA 1KPVB 1HOCA 3N1FC 4M6NH 4YHOH 4CJ0A 3FQRA 1DBML 2IANA 2GAZB 5AZEH 1AHWC 4HF5L 5D1ZD 5A1AA 3E3QA 1JPGA 1SJHA 2CKBH 2VZSA 4HC1L 3QQ3B 3GHBH 4J3UA 4OLYL 5EU3B 3HR5A 4RX4D 3UC0H 2VDNH 1F4AA 4O5LH 3QULA 3ARXA 3BN9D 4ZQKA 2DMCA 4Y8DC 4H88H 3PWJB 4YDIL 5DSCB 5HD8D 2J6EH 5E2TL 3VGEA 2C5DC 3P3YA 1KIRB 3SDAC 5HYQB 3P11L 3QQ4A 2HN7A 5HI5C 1MREL 5IMKB 3KLAB 2GSGA 3LQAC 5BO1H 2A9ML 1D5IH 1F4YH 5E7FA 5E2WL 5CGTA 1FGVH 4OF8A 4V3DB 3L3JA 3P9WB 2RCSL 2RBLA 3JV0A 4O4YH 2D0HA 2Z9TA 4O00A 3LH2L 1OD9A 4WFED 3ZKXC 2J5LB 4M7JH 1KGCE 1DUZA 3MRPA 1VERA 4M93B 4B7LA 2VLMD 5IB1B 3VXUB 3K4AA 3WUWA 4NQCA 3CMOH 2BNQA 2ZPKL 3QI9B 4LPCA 4MNQB 4H8WL 2ATKB 5D7JB 1IGML 1HSAB 4MJ4A 4NQDA 5ECJE 3ZSSA 1ADQA 3HE6D 4HIJA 3N1MC 4O51A 5I66A 3LEVH 1FIEA 1U8NA 3V4UH 4WFFE 3C5ZD 4M8QA 3WFHB 4OF3A 3C6LA 4LKXA 1EK3A 4ZXBC 4EQ2A 2FSEA 3RA7L 3SGKA 2X4QA 1AIFA 1D5BA 4P5TA 4M9PA 1S7QA 2JJWA 1SY6A 1KOAA 1NDGB 4MYWB 4XXCC 1U8HA 2IQ9H 2JF1A 1YNTB 3DPBA 5SV3A 4NFBA 3VG0L 2KH2B 3LPGA 3MV7D 4UQ3A 4P99A 2ARJA 5GQBA 3MLSH 3PF2A 1I1RA 3LPFA 1NSNL 5DJZB 5HY9B 1A7RL 4F58L 4JY5L 1JGLL 1IKNA 2APXA 1P7QA 2W65B 1S7SA 4GQ9H 5T3XL 3TN0B 3C5SB 1R5IB 3MUHL 2VABB 2ZG2A 3LY6A 3B5GA 2FX7L 4MJ6A 3O3BA 3O8XC 5EU5B 4FQCL 2DAVA 4HUVA 3ARFB 5F1OB 1G9NC 5CHNA 1D6EA 4EN3A 2ZOKA 2ATKA 1LD9A 3QCTL 2ICES 3MLPA 2NW2A 2EDOA 5M95B 2GITA 3ZYOA 1Z3GH 2E9WA 2DQEH 3D18B 1XGYL 4F2MA 4OD1H 3IF1B 5DK2B 2DI8A 5KSBE 1AR1D 1EH9A 4HZLA 2YXMA 4D9QD 5DTFB 1NDGA 2CO6B 5EZOL 5J1TC 1EUTA 2R1YB 3UTPD 4R7NB 1L7IH 2GK0B 1BP3B 2QQKH 1NCAH 1ES0A 3HE6C 2I9TB 4KY1L 4JB9L 4FMKA 1JGEB 3WLBA 4APQD 1TJIH 2EH7L 5JHDD 4N8VG 2VLLA 3S96A 1SJHB 3BWAA 3IJHB 3VDCA 4U1JB 1TENA 4P46A 4JVPA 5FM5O 5CUSH 3EOAA 3GJFB 3I6KA 4ZFZB 3KVQA 1IKFH 1UZ8B 4I77L 4LPWA 1A3LH 3IDYC 3LMJL 1O5DT 4F9PC 4NO0A 3NIDE 2ZZUT 5JR1H 1N0LA 4Y7MA 3GM8A 3PWJA 5TFSH 3RNQB 3MRFA 2NY6B 4Z9KB 1WZMA 2EXWC 4KXZI 4N0CA 1E4KA 1JPFB 2HKHL 5IVNA 5I8EA 4PGBA 3C60D 1J5OL 3G6JF 4GLRI 1KJMB 4S0TD 3L3JB 3SDXE 3BVNB 1NLDH 3CFBA 4ZQKB 3DRQA 4IS6A 2FBOJ 4A2MA 3VFMB 1TJGL 4WEBH 4BH8A 2LVEA 4KI1A 5I1JH 5HYQA 1NCWL 1S9XB 4P3WA 3ULUE 1NFDB 3O2VL 5I8CB 3WLWD 5CEZD 1ZSDA 3WNPA 1AXSB 4QXGL 1N2RA 5ABDE 3QZWG 4MNQA 3GSRB 1BIIB 1S9YB 1U3JA 1K5NA 3DTXB 3ZL4L 1DBBL 4K7FB 5FCUL 5I66B 5D96B 5DK0B 1RUQL 4U1LB 2Q8AL 1LGVA 3SO5A 4ZAKC 3SDDB 2HVJB 4FQ2L 3JVGA 2CGRH 3RWFA 4GKOA 3P73A 2V7NA 5IESH 2FJFB 1FZMA 5C0BB 4N0CC 5LCVH 5SWZB 1MI5A 2NY1D 2QV2A 4XCEA 1EHAA 1CDIA 2XQBH 1WWAX 1G9NL 1IEHA 1LO0H 4EZMA 3I3DA 4HUXB 1LQSR 2LU7A 4KRPB 3OX8B 3QUKA 5HGHA 5GRXG 2I24N 5I1HL 4X0KA 2XKUA 2EH8H 4OLVL 5TDNB 5DK3A 1JPFA 1RSFA 5AWNH 3ZKND 3QEHA 5FOBB 1CD8A 1IKNC 5E5MA 4DOHB 5T3XE 4I2XA 2AJZB 3GJFH 3QDGE 4LLWB 3K3QA 2VXTL 1N5AA 2GK0A 1FL5A 4PJFA 4XP5L 2R4SL 1S7XB 2H9GA 4JFDA 4NCC1 3IU4H 5D6CB 5E8EA 2PXYC 1PVHA 4YFLI 5EBWA 3AM8C 4BFIB 4HWBH 2I9TA 4KK9C 4H8WC 2DQDL 1DQQA 4PGEA 3R8QA 5DZNA 3U36A 4F37F 1CLYL 1JYVA 3H9HB 4M62L 3V8OA 1EFXA 4UU9A 4M6OH 2O5YL 5KAQF 1TJHH 2D3VA 4PP2A 2IBZY 5JIHA 3QDHA 4IRSA 1N5YH 2FWOA 4XVTH 3JVGC 2WWKT 3KPPA 3NTCH 3QUXD 4KRLB 4PJAB 2ZUQC 1G0XA 1HIML 3T0DA 1FQ9C 4H1LG 5GRUH 3EYFA 2FJFA 3WHE1 4Z77B 3LB6D 2HMIC 2V2WB 4I3SL 4KMQA 2GITB 4JPVH 5E94A 3SKOB 1FNSL 4LLQA 4PB9L 3HC0A 4U1GC 2CR3A 5J1AB 1JRHI 1MIMH 2A6KB 3VXSE 8CGTA 3G6DH 4FQQB 1YEGL 4OCSL 1JGEA 3JTSB 4PJFE 2A38A 2A73A 3LQAL 3KR3H 1BD2D 4P3CL 4R7DA 4HW6A 1BAFL 3SDDD 3HRZA 1C7SA 4ERSH 5CCKH 4I5BB 3MFFB 1ES0B 1R3HA 3THML 2VLKA 1F2QA 5CZVH 4LSQL 5D2LF 1JI2A 1O7VA 2W59A 4OD3L 4OZGE 3QXAB 4LRIC 4PY7B 3K8MA 5IW1B 5KG9B 5BV7C 4CNIA 2J8UA 3RVTD 1DQLH 1JFMA 2VLRB 5D7JC 4HUVB 3MJ8B 3QRFM 1I8KA 2UWEF 3C60C 4DTGL 3S96B 4WI8A 2HFFB 2F5AL 3QR2A 3QUZB 4AL8H 1AO7A 4G59A 3Q6GH 2R0WH 4K94H 4HT1L 3TCXA 2XKNA 4HLJA 4UTBH 1RJYA 2BVQA 4A6YB 4PBVC 2Z31C 5GGRA 3H3PL 1INDL 2GTWB 3FOLA 1RZ8B 2AI0H 1IGCL 3HI6H 1F5WA 3PWLB 3ARDB 4I48A 1F58H 2H32A 3G6AB 5FYLH 5CJXA 2VWEE 4P2OB 3ZE0F 2HA1A 1C08B 3EYUL 4HZLB 5E00A 1V3KA 3FB7B