1JPGA

Crystal structure of the lcmv peptidic epitope np396 in complex with the murine class i mhc molecule h-2db
Total Genus 64
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
64
sequence length
275
structure length
275
Chain Sequence
PHSMRYFETAVSRPGLEEPRYISVGYVDNKEFVRFDSDAENPRYEPRAPWMEQEGPEYWERETQKAKGQEQWFRVSLRNLLGYYNQSAGGSHTLQQMSGCDLGSDWRLLRGYLQFAYEGRDYIALNEDLKTWTAADMAAQITRRKWEQSGAAEHYKAYLEGECVEWLHRYLKNGNATLLRTDSPKAHVTHHPRSKGEVTLRCWALGFYPADITLTWQLNGEELTQDMELVETRPAGDGTFQKWASVVVPLGKEQNYTCRVYHEGLPEPLTLRWEP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords H-2 CLASS I HISTOCOMPATIBILITY ANTIGEN, D-B ALPHA CHAIN
publication title Zooming in on the hydrophobic ridge of H-2D(b): implications for the conformational variability of bound peptides.
pubmed doi rcsb
source organism Mus musculus
molecule tags Immune system
total genus 64
structure length 275
sequence length 275
ec nomenclature
pdb deposition date 2001-08-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00129 MHC_I Class I Histocompatibility antigen, domains alpha 1 and 2
A PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1jpgA02
3.30.500.10 Alpha Beta 2-Layer Sandwich Murine Class I Major Histocompatibility Complex, H2-DB; Chain A, domain 1 MHC class I-like antigen recognition-like 1jpgA01
5HHPB 2B0SL 4TNVK 5EU6E 4JJ5B 2XPGB 1T21A 1SEQH 4XB7A 3IVKB 3CLFH 4OCMC 3HRPA 2V2XB 3IU3B 1YDPB 3T0EE 1MCIA 4LRIC 2OYPA 1HHKB 5E2TL 5I1HL 5ADPH 1HSBA 4W6YB 4PJBE 3KWWA 5CHNA 2HT4C 4OZGB 3TO4C 4JHWH 5F6IC 4G8GB 1J5OH 3MA9H 5EU7C 1RVFL 5C9JB 1DQLH 2UVFA 3HAEG 3LN9A 5D71H 1FNGA 5FYLE 1UCBL 4NUGH 4DGVL 3HNSH 1FO0B 1OD7A 1B0GA 1BVKB 3FRUB 5C09D 4M9PA 1CL7H 3T3ME 2DOCA 3U4EB 4M4RA 3WIFB 1QFWI 5JQHC 2VLRA 4PJDF 4OCNC 4HAGA 3R1GH 4OCXH 4XP9L 2QSCL 5JLZA 3L3OB 4YNYB 1BFOA 3VDAA 1DQDH 2YA1A 2V2TB 3CXDH 4OCWH 4F7CB 1TMCB 1UKSA 4HBCH 2NW3A 5CEZH 5D6DA 4N8VA 4L3EE 4NWTH 3O81A 1F4AA 1T1WB 1WLHA 2JCCB 4MJ5A 4P46D 5D5MA 4Z76A 1TENA 4XVSH 2K7QA 4JY6B 5C0FB 5MEPB 3IETB 2DIBA 4MQXC 1XGRB 4K7PX 2DI7A 2MSPA 1R5IA 5SWZB 3SGKC 1DBMH 3EYQC 3IDNB 4K3GA 3CSPA 5F7FA 3GRWA 2X4SB 2HG5B 4WHYG 1FYTB 1KGCD 5FYJL 5C0IA 2ADFL 2HKFL 5DZNA 1MJJB 1EHNA 4ZXBD 4C4KO 3E2HB 3L95B 5KN5B 2Q76B 1SY6L 5J0BA 4HMDA 3AROA 1Y0LA 3WNPA 3D39D 2E7LE 2PYEA 5HHPA 1E4XI 1NGYB 3WMSA 1W72L 1ZMYA 4XPAH 1WTGT 3RGVC 1MCHA 4U1MB 3IVKA 2K9UA 2V2XA 2I07A 1YDPA 3IU3A 3KPRB 4PGJA 4LSSL 3AU1A 2X42A 1PFCA 5EO0B 3W9DB 2V5YA 5F93C 2BFVL 3QNZB 4OZGA 4KFZC 1J87A 4W70A 1MFBH 1X7QB 3TV3L 4G8GA 3VD5A 1UCTA 3IDXL 1GOGA 1DN2A 1V3MA 2ATPB 3TO4D 2R0KL 3E6HB 5E5MA 4HJ0C 2FH6A 1NGPL 3EIFA 1OGAD 1FO0A 3INUH 1BVKA 3MMEB 4WHCA 1DN0B 3IT8D 2J6EL 1F4YH 5FO8B 2UYLB 4LU5H 3U4EA 3WIFA 3EOAB 3DGCR 2AEIT 2GK0A 1CE1H 5C92A 2C4FU 4GXUN 3L3OA 3MLUL 4NZJA 4YNYA 2V2TA 1AR1D 1G0YR 1FC2D 4G9FB 2VH5L 3N06B 4Y1AD 3X17A 5JOFA 4H1LB 5F8RC 1HQ4B 2WY3A 3MRGA 3S37X 1M05B 3ARPA 1T1WA 2DWDB 4PP2B 2JCCA 5T33L 5DQDH 1OTSC 5ITFB 5FYJU 5HVWA 4C55A 4ODWB 1JYNA 4LLWA 3ULVE 2J12B 5MEPA 3HB3D 3IETA 5DRXB 4X6CE 1XGPB 2ZG3A 1LP9E 1MELA 4TN9A 3QUXB 1IZJA 1SMAA 4YXLH 3OKKB 5SWZA 2WWMC 4X7SH 4NNXB 4FZ8H 1R3IH 3MA7B 4N1EA 2X4NB 3WIIH 1HWHB 3WYRA 3IDNA 2YK1H 3EZ8A 2X4SA 2HG5A 4YHLL 1FYTA 1MCNA 3IDMA 3DUHA 4QKXB 5KSUB 3G6JF 3QNXB 1MJJA 4CN6A 1EO8H 4DKFH 4OB5H 3E2HA 3L95A 4EJ1C 2Q76A 1WZMA 5IMMB 1MFCL 3ZTJH 5CIPH 4LPTA 1MVFA 4KDTA 5EB9A 3LQZB 2PTTB 3DRQB 3FO2B 4U1MA 3U0TB 3O6FC 2PXYD 5HYQB 2YPLB 3KPRA 5EIQA 4YFEA 5KVDH 4L3AA 3SDCD 2QBWA 3QEQA 5EO0A 3W9DA 4LVOC 5L0QB 2E6PA 3QNZA 4NN5C 1FNSL 4KHTH 3KVQA 3TWCH 1CBVH 3BDBA 1MHEB 3DJ9A 3P9MB 1K8IB 1OAUH 1Z5LB 2ATPA 1LK3H 4HS3B 1KELL 4I4WA 1A7PH 1YQVL 3FQUB 3ZE0E 1PGRB 2F8OA 2FECI 3BGFC 3GSUB 1DN0A 4HJ0D 4NC1E 4YE4L 1B4JH 4J12A 5FO8A 4OGAD 2F53D 1IGYB 5C6WH 5I66A 3B5HA 4OJFL 2VDQH 3MRMA 4D9LL 2H26B 4CMMA 3OAUH 3IFOB 4TVPL 3REVA 3QAZB 1RZ7H 4OCSH 5HYEA 4LPVA 1QSZA 4QHNA 3TFKC 2WIIA 4A6YB 1BD2B 2IG2H 5DYOB 2X1PA 1MIEL 4H1LA 3EHBD 1HQ4A 4N0UB 5B39G 1NMBH 1BEYL 1X3DA 3T0XA 1S78D 1M05A 4PP2A 3HR5B 4FQHA 3QRFM 5ITFA 3QJHB 4Y16A 3BYYA 1CIDA 1KXVC 4RGNC 3EO1B 3VFSB 3QFDB 1HSAB 3U36B 2LAGB 1XGPA 1TTFA 1YMME 4F9LA 2EEDA 3VA6A 1CDHA 1JE6A 1JZ6A 3WFDL 2Z35B 4QOKB 1DE4B 4NNXA 5I8EB 2X4NA 1ACZA 1G7LB 4ELKB 4GOSA 5DLMH 2J2ZA 2WWMD 4N0YL 3VWJC 1N2RB 3B4NA 1DUZA 1IBGL 4FQXB 3QH3A 4NUJA 3QT2A 3QNXA 1DP0A 2BNQE 3IDYB 4HPOH 3CLEH 5IMMA 2BOBB 4JPKH 5C07E 3H6JA 4XPGH 4FMFA 3OKMB 4G5ZL 1J0JA 1NCBH 4RFOL 3UTSB 3LQZA 2EZ0C 1CFBA 3CX5K 1CGYA 4RWYH 3DRQA 3WE6B 1OGTB 3FO2A 3U0TA 1KPRA 4NRZB 4LASL 4R96B 5HYQA 2A77L 2CDGB 12E8L 2NY6D 1NJ9B 2EDTA 3I85A 3GRWH 3WNLA 4TVPD 3SQBA 3WUWB 2HLAB 4KJYB 1ADQL 1S8DB 3VI3F 1MHEA 2I5YH 3GZKA 3P9MA 1G1YA 1K8IA 5CSGA 3D69B 3WNOA 2R69L 2R39A 4N68A 1N5YL 3DI3B 1CTNA 3FTGB 5DR5L 1BX2B 4D9RD 3GDBA 3FQUA 1X4YA 5I8KL 2XWBA 1N8ZB 3GSUA 4KK8C 5D7IE 2EH7L 4MXVF 1JPTL 1REIA 4WWKA 5FGRA 1NC4D 4L4VB 1UG9A 5F96H 5INCA 3SKMB 4WW2C 5C0CB 3DNKA 3KPTA 5C0AB 2D31B 1Z3GH 4OLWH 4UDUB 1Q72L 5DRWB 3TYGH 2VLMD 4LRNH 4A6YA 1BD2A 5DYOA 2H9GB 4N0UA 4LAQH 1FCCA 3KPSD 4IJ3B 1AGEB 3ZKSD 5ADOH 5D93C 1AD9B 5GS3A 1FO0H 4MXWL 3K74B 4HJJL 4JHBA 3HR5A 5FUCE 3U48A 1URLA 4YAQB 2AERT 1YJDL 2EEAA 4Z9KB 2A0LC 3EO1A 4XP6L 3VFSA 3V0VB 4JG1H 3QFDA 4UT9L 4P2QE 1I3GL 4LHQB 5D1QA 1O0VA 4BSVB 4PRIB 1BBDH 5IESL 2PO6C 2Z35A 4HWZB 4GSDL 2EYTB 3MRIB 1DE4A 3QQ9D 1V3LA 5I8EA 1WC7A 3OPZH 1G7LA 3U82B 4ELKA 1MCBA 3QEHB 4EN3B 3BDYL 2UZYB 2XQBH 4M7JH 4PJFE 2Z8SA 5D72H 4FQXA 3R0MA 3IDIB 4MNGE 4N0CC 1KXQE 1FNEB 2VLKE 5LVEA 4WI2A 5ALBL 4ODHL 2BNUA 4M93B 1OAKL 5F1SA 3BI9X 1Q0YL 5JQ6H 3ZSTA 1MI5B 1FFPB 1OGTA 3WE6A 5FA4A 3TZVB 4NRZA 4XXDB 3OJ2C 2XY2A 4P48A 2CDGA 1NJ9A 2B1HL 3O9WC 1EV2E 5HBBA 1VEMA 4KJYA 2NPLX 1RV6X 4XHJD 2LE9A 1KNOA 3HS0B 1OP5H 1TVBA 1QHOA 3FTGA 2HKHL 4JRYD 1ZSDB 5DRNB 1QKZL 2XQYK 4QLRA 1N8ZA 2C1PB 1KCLA 3IJSB 3MUJA 1DQMH 5D7LE 2V9RA 4L4VA 3SKMA 2WZPD 2MPAH 4ZOEA 3F7YA 3U30C 1I8LA 2ZUXA 1QSEB 1I7RB 5I73C 1F58H 5C0AA 2D31A 3WKNA 1ND0A 4HWBA 2YXFA 1K4DA 2DM2A 2JLLA 3KLDA 3H42H 3M1BB 1HHHB 2DQIH 1RAMA 3RWFA 1LDPL 2BXYA 3PDOB 3O2DL 2ICWJ 3FQNB 5KSAB 3IFNH 2ERJB 3BIKA 2X4UB 5JZ7D 3SCMC 1LEGA 1EPFA 4NO2A 3MRNB 4ZTOH 1AD9A 1S7TA 5FK9B 4YAQA 3SGEI 5EA0H 4LVNB 5E2WL 4PRHD 4ODVL 3V0VA 3BQUB 5EBGA 3U7WL 1FFQA 1RUML 3QXAB 1G7MB 4PRIA 4BSVA 3SGJA 5L0QC 5ERWA 4C83B 3WO4B 1VPOL 4HWZA 4YX2L 1IL1B 3DURB 3Q5TA 3DXAA 1TJIH 1T5WA 2DYPD 2ADJB 5L2KB 1YEKH 4P2OD 3IU4L 3CAFA 1P2CB 3UYRL 5DD3H 4H1LH 5T5FL 2PKDA 4YDKH 4M62L 4F57H 3KJ6H 2R8SH 2EDRA 1I3RA 3RKPA 2FLRT 4BFIB 4IS6B 2X44D 4N0CD 3GSNB 1MSPA 4YJZL 2B1AL 1MI5A 1E4KA 4NCC1 4H8WH 1FFPA 5MEOB 4XXDA 3QAZC 5F9OH 3RWEB 4XHQA 4D8PA 3H9SA 4TSCL 2UV3A 3B83A 4PJAF 1K4CB 3RIFF 1WAAE 2BVEA 1GIGH 2FYYB 2V17H 5DWUL 2R2BB 1MY5A 3GHEL 2OTUB 5T3ZD 3X3GH 3HS0A 1KGCE 2XZCH 4WEMB 4KXZH 1U8KB 2AXGB 3WIHL 3VXMD 1FZKB 4YHMH 5D1ZC 1ZSDA 2DTSA 4H20L 5DRNA 2WSKA 1J0IA 5FO9B 1RURH 3D39E 2XN9B 3O0RL 2Z91B 1FL5B 3LS5H 4URTB 2IANB 3STBA 3LVEA 2NY4D 2ZSWB 1JFQH 1ZLUH 3EDJA 4Y2DC 3DETC 3VMPA 1MEXH 1N6VA 1IEHA 5TE7H 2BC4A 2DJ4A 3I75A 1WFTA 1D6EB 2KZWA 4KRMB 5IR1A 2CLVB 2UZIL 3LY6A 1MHHB 1FHGA 3O4OC 3M1BA 1HHHA 2YWYA 4OLVL 2APTA 3IDYC 4MXVE 1BOGB 3NCEB 1UWXK 4UINL 4WI6A 4LCWE 5E0QA 1WUNT 2X4UA 1M1SA 1OB1A 1RZGB 3PHQB 1B4RA 2PN5A 4JPWH 1OM3L 3A6OA 3G08B 5KJRL 4XVTL 4JRXD 3FMGL 3DBXB 4D9QD 2APFA 4PB0H 5K9KB 3BQUA 5INDA 1G7MA 2J5LB 5EFIB 4DQOH 2X1OA 3BEWB 1B88A 1IL1A 1FBIH 3DURA 3RZCC 1LO5A 1KCVH 1VDGA 2EYRB 5D6CA 3UC0L 3IJHB 4LSUH 5E8PB 2ADJA 1I1FB 5L2KA 5F70A 3P4NB 4M7KH 4L4JA 4A6YH 1A7QL 3QDJD 4Y1AE 1CVRA 1VEOA 3MJ7B 3ZYOA 5HDOA 3E3QE 2ENYA 4PUBL 3QG7H 1G7JB 4IDJH 4BFIA 2VO5A 3JWOL 4ZTPL 2H45A 4BQ6A 4K23H 4KRNA 3QHZH 3GSNA 4OF7A 4PB9H 5EORL 3C5ZD 3MXVH 1WQVT 5E1HB 5IVXB 1C5CH 3ELAT 2ESVB 5BRZB 1WICA 5F1KC 3WNNA 4MLSA 5MEOA 5CMAB 5FYKD 3RWEA 4LLAA 2F19L 1EVTC 4U3HA 3B5GA 1H3PH 4WEBH 5FOBA 2VE6A 3F12A 3EW3B 2XTLA 2E27H 1PW3A 5D8JL 5IB4B 2FYYA 5TPWH 4IMLB 2R2BA 3RFZC 5BQ7A 4HV8A 1U8KA 2R1XB 1GGIL 4LMQE 1ZK9A 3KS0H 2OLDA 1FZKA 1NMAL 1XEDA 3NIDF 4UQ3B 2QL1A 3BP7A 1NFKA 2BSED 2RCSL 4K07A 5I1LB 1L0YA 4G7VL 5FO9A 3ULUH 1AQDB 2XN9A 3Q2CA 2I9TB 1NANH 2GCYB 2JK5B 4OFYD 2Z91A 1FL5A 1DQQB 2G5RA 2IANA 4ELMF 3BW9B 3FFCD 3RNKA 3LB6C 1I1YB 4B53A 4DWHA 4PJ8C 4U6HA 2J8UB 1CLOL 2YSSB 2FBOJ 4EN3C 1D6EA 4XBPB 2FEEI 2R2EB 4LSPL 5DJAB 1UM5H 3LZFL 1D5IH 1QBLH 3CVHA 5F7NC 2VLLB 3TN0C 1I85A 4HKZB 1H3GA 1BOGA 3QA3B 1G6RL 1WBYB 2D4DA 3V7AG 3VXOB 2E7MA 4X6DB 4HWEH 3QZWB 1DQJB 1IAOB 4MNHA 4A2LA 1CI5A 1RZGA 3PHQA 4CUCA 5T3XD 5T1LB 4V3EB 1PX3A 4EUPH 4AEHL 1U93A 2QHLA 2BHYA 3TZVC 1MWAB 1E6JH 3DBXA 3BPNC 4ZFGL 3S5LB 1ETZB 5IMLA 1XAUA 3IF1B 5K9KA 3KXFD 5EBLB 1ZLWK 5BZDB 1CDUA 3I02A 2XZAH 3WN5C 2F53E 3KJ4B 4OZIB 1MQ8A 3TESA 5EFIA 3BEWA 1F6AB 4L5FL 4HWBH 1Q9KB 3T09A 3ZDYF 4GG6B 1XCQA 3VD4A 3IJHA 5E8PA 2ED9A 3OBAA 4MZ2A 1I1AA 43C9A 3MNVA 1OSPL 5JDJA 4KTYA 3MJ7A 4Q2ZB 5GPRA 1R5WA 3BPLC 4E0RB 3B3IB 1A14H 3GBNL 2ICWI 3CK0H 5C86A 4MJID 4O2CB 4MX7B 2Y07L 4N5EA 4E9LA 2H41A 5IVXA 1T7WA 1KJ3L 5BRZA 5CBAB 4G80B 5JXEC 1L8JA 1PG7H 5CMAA 4YDLB 1PLGH 2FBJH 3DSFH 4R26L 1EAPB 4F37F 3KG5A 1JRHL 1UZ6F 2VXTL 5I0DA 4FQLL 3DYMA 3GBMH 4P5TB 1VACB 1FP5A 3AB0B 5KSAC 2ERJC 1AR2A 1RMFL 1U8NB 1J1XL 3BRDA 4IMLA 4JN1H 3CC5B 4GRLB 3AY4C 1HHGB 2R1XA 3BPCB 4LVNC 4PJ9B 1T4KB 2EC9T 4UQ3A 2NZ9C 3RI5K 1VGEL 1AQDA 3ARQA 4I48B 1Z9SA 4TRPL 3TA3C 4EDWL 2JK5A 2GCYA 4L8SB 1DQQA 3P73B 3L3JB 4MA8L 5HHOB 2J8UA 1H8SA 1Q1JH 4Z7WB 1PVHA 3LB6D 4YXHH 5H37G 1K5NB 4XBPA 2R2EA 5DJAA 3U7YL 4KKAD 4PJ8D 3X11A 5CINL 3E6FB 4S1RL 2VLLA 4G8IB 5E9DB 4TVPE 1WZ1L 5FO7B 2YD2A 1CU4L 2H32B 1WBYA 3VXOA 3D18A 4X6DA 3TN0D 2A74A 2AQ1A 1DQJA 1IAOA 3QZWA 3WFBH 2XZQL 2D7TH 4HSQA 4BYHA 2EIZB 2EXWD 4D9RE 5D7KD 3ARBC 5IROA 1FGVL 5B21A 3TYFA 3WXVL 4OKDA 4M1DL 1WT5C 4NYLB 4R4BB 3S5LA 3V5HB 3FB7A 1V7MH 3OKYA 4I0CC 4AIOA 3CNKA 1S7RB 3C6SA 2NW2B 5LGJB 4OZIA 4B0MM 4DN4L 3KYNB 2CK0H 1F6AA 4QYOB 1F6FB 1C5DA 2DF3A 1Q9KA 3V52L 4M9OA 1LILA 4X80L 2VLME 1YNKL 3NA9H 5SX4I 1T20B 4NZRL 4Q2ZA 1GGBL 3F65A 3RA7L 4E0RA 2VDLL 3B3IA 3KPSE 4ODSL 2C9AA 3ARED 2IWGA 4WNQB 2R9HD 2VC2L 4HX1B 3CIQA 4O2CA 5HXMA 1KXTB 4LCYB 5TFSL 3TT1H 4WWID 2DL2A 5IVOA 3RDTA 1X5XA 1J0KA 1FFOB 3L5WB 4QTIH 1NBZB 3C87A 3ILQC 2VR5A 1PQZB 4G80A 5CBAA 4GKSB 5IQ9B 5GGQL 1ES0B 4LPXA 1EAPA 4P23D 3UJIH 2CGRL 4NBZB 3KPNB 4QXTB 4OCYL 2GT9A 4HHAB 4ZNCD 4P5TA 3WEXA 1VACA 3C5SB 2I9LB 1ZT1A 3PWPB 4FQ2L 2FATH 3T1FA 2ZCLL 3CXHJ 4KAQH 1GXEA 4W4OC 4XP1H 2OL3B 5HTSA 1GPOL 1GAFH 2AXHA 5F89A 1ZWIB 4PJ9A 4YHIB 4OLUH 4PJDB 3BX7C 1CZ8H 4I48A 4IRJA 1WV7T 3SJVE 4L8SA 3GSNH 1C12B 3MOBL 3UZEA 2AVGA 1A9BB 4YBHA 3VE0B 4LK4A 4HPYH 5HHOA 3TPUE 4Z7WA 2G5BB 5MHSD 3UX9B 5HHMB 3L3KA 1F8TH 1UXSA 3NIDE 4HS6B 4UB0L 1G9MC 3CPLB 5F3HA 2OK0H 1H15B 4J4PC 4G8IA 2VXVH 5E9DA 4JVWA 2IFFH 5FO7A 4ELME 2P8MA 5FAAA 5D7SH 3I50L 4U1KB 4ODTL 3VXQB 5I15L 1X5AA 2EIZA 4JRYE 4ZAKC 1SEQL 3HZYA 3CH1B 4JHAH 1A7RH 1XF2B 3P30H 4NYLA 2HTLC 1G7HB 1BFSA 3V5HA 1LDSA 1DQTA 1UWXH 4OIIH 2FLBT 5C3TA 6FABL 2ZUWA 4JQXA 1S7RA 3PWJB 4JHWL 5LGJA 5EO9B 2APBA 4DZBA 1TJGL 3KYNA 1IC5H 1BAFL 1DQLL 4L29A 3CVHH 3JWDL 4ZYKB 5DUML 2BSRA 1OVZA 3TBSA 3G9AB 5E08H 1PKQE 1A22B 3HNSL 4TULH 4I3SL 5T5NG 1K6QL 3ARGC 4M6NH 4PGEB 3QCTH 3DV4B 1D6VH 4GRWH 1CL7L 5FUOL 3JTTB 1CFQB 2NTSP 4XI5C 2DN7A 3U4BH 3MLTB 3NCYS 1CXKA 1ZLVH 2R2CA 3QUYC 4MJ2A 1E6OH 1MCSA 4WNQA 3U46B 4BQ8A 5GISL 3GHBH 3R1GL 4NFCA 4PRHE 1GGCH 1XGTB 3HNVH 1FFOA 5T5NF 1DQDL 2YUZA 3L5WA 4KQ4H 1PQZA 2J88H 4GKSA 3VXRD 4R0LA 4TQEL 4QXTA 4BK4A 3EDDA 3JSSA 3LOWA 4CDGC 5C08B 5IUSA 3PWPA 5CEZL 4TTGA 3D0VB 3DMMD 3JV6B 3PDDA 3LN5B 4I0PC 1ZEAL 2ZUTA 4AY0A 4C58B 1EK3A 4LSVH 2ARWA 4O58H 4XVSL 2ZUUA 2YD1A 2ED7A 1BBJB 5M7QA 1ONQA 4YHIA 1MFAL 3M8OH 4GAJL 1I1CA 4PJDA 1JTTA 1UZ6E 3ZLQC 5IHLB 1T1YB 3TJHA 5EU3A 5MI0B 5EIIA 1DBML 1A9BA 3MGOA 3C2AL 1SVCP 2JKXA 2G5BA 3A6BL 4S1SL 4TOYH 4R3SA 1QRKA 1ZT7B 3CSYB 4E41E 3ZL4H 1TITA 1RJLB 4OUOA 1Z2KA 3P11H 4HGWA 1MHPH 1PDKA 2EH8H 5D7JD 1H15A 3CVIH 4PDCE 4MMXC 4JFEE 4LFHD 5I0ZA 3PDGA 5C7XL 5GZND 5E6ZA 5T3ZE 5EU4B 4U1KA 1FNAA 4KC3B 2JB5H 2B4CH 5I1CH 4XPAL 2QQNH 3VXME 5HGBB 3FT4A 3H7BB 3RU8H 1F3DJ 1NKOA 3BISA 4J8RA 4MDIB 4QTHB 3HR6A 3NPSC 5EOQL 3P3YA 5AWNL 4XXCA 3W2DL 4X7CC 2P8LB 3U0WL 3PQYD 1G7HA 1DL7H 4X9GA 3PWJA 3G6JB 3DLQR 4KKLC 3SQOL 3VWKA 4GRLC 2FHFA 1A1OB 5KVFH 5LBSL 1N0LA 2BSSA 3O6ML 1FZJA 3I84A 1A3RH 4NQEE 3MRPB 3H9YA 3FQXB 1ZLWH 4LGPB 2UVEA 2AJUH 4WTWA 2W9LA 3CMGA 3DV4A 4PRPA 3JTTA 1CFQA 4LU5L 1JHKH 2HA1A 4GS7B 5I1JH 2R0WH 3UTQB 4Q74A 3U46A 1QRNB 4FZEL 4X7EC 1CE1L 5GRZA 4XI5D 4JRXE 2H1PL 4JFDD 2AKRB 4OBRA 3PWNB 3DX6A 4KV5F 1XGTA 4D9QE 1KN2H 3FT2B 4UNTA 1QR1A 2HFGH 4XMLH 1BFVH 3LDBB 2W1NA 1S9WB 2X4PB 3ZYZA 3HG1B 5MEND 3HUJF 5LJYH 5C08A 1F13A 4Y19B 4P2CG 3JXAA 3D0VA 1HIMH 1SBBA 3OMZA 1E4WH 2L0DA 3JV6A 2XTJD 4YHZH 4RAVB 5DQDL 3QDJE 5H2BB 3GJEA 1DDHB 1JHLH 4JEGB 3QIWC 2WINB 4HXAH 4OI9A 3LEYH 3MX0A 4I0PD 2EDXA 1WEJH 2BVOA 1OP3K 3H9HB 4NN6B 4HD9A 2NY5H 4PJCE 1C8PA 2Q3AA 4R7DA 3WIIL 3HPLB 4PJ7E 2XG5A 5GRUL 4YHKL 2W9DL 4OM1L 2D7MA 4QEGA 1A6ZA 4DKFL 2OP4L 4TSAH 4I0KA 4XGZA 3RVUC 4GBXD 1XIWC 1P4LA 5F7WC 2FIRT 2ICES 5J11B 4Z8FL 2APXA 5EU4A 4OAWB 3HI5L 3BKCH 1JRHI 1RK1B 5EOTB 4MB3A 1WJ3A 4R4NC 5AYQA 4LP5A 4BSWB 2VXSL 3FZUD 4MDIA 4Q6IC 4XWOC 1MFEL 3RAJL 2P8LA 5E99H 5JXAH 3MBXL 3OB0H 2CR3A 4X8JB 4JR9H 4EOWH 1JUFA 1RUAH 4U6YB 5J12C 5GRVK 4KHTL 3G6JA 4KUZH 4HIXL 5E7FA 1QVOA 5HYJD 4LEOB 4QXUL 2OQJB 1BZ9B 3MRJB 1A1OA 3GM0A 4UIKH 1VSCA 3V0WH 1JK8A 4GXUM 4K94H 3MRPA 3FQXA 4KI5F 3QXUA 4UAOB 4X4MA 1JYWA 4XCEB 2MCPH 5CGTA 5J13C 3UTQA 2F54D 5T3XE 1QRNA 4Y89A 1D9KB 5F1IB 1JMZA 4FQ1L 3PIQB 2AKRA 3P9WB 3PWNA 3L5IA 3OAUL 1IC7H 3KXFE 3QCVL 3QCUL 4PD4J 1BF8A 4U0RB 2AS5M 2VAJA 2ZKHH 2IG2L 2X4PA 5CAYB 3VFGL 3I2CH 2WWKT 4NO0D 1NMBL 3OXRA 4ZYKA 3RIAK 3K8MA 2MHAB 3CCHB 4Y5YC 3S88H 4DKEL 3O3AB 5MEQA 5F9WB 3EYSL 1NKRA 1JNHB 1QSVA 4ODUA 2WINA 2XI9A 2FR4A 4I5BB 1CWVA 1AI1H 2NYYD 1JZ7A 3CMOL 3QUZA 2QQQA 3QIWD 4W6XB 4MJIE 3JVGC 1MCPL 4IBLT 5BOZG 2DD8H 3HPLA 4TSBH 3P0GB 4OD1H 3K2UH 1WWWX 4HUNB 2R1WB 4Z7UE 3S96B 5J6GB 5KOMC 4JKLA 5FA3B 1H5BB 5LXGH 3HNTL 4ZUWB 3P9LA 4JY4B 4POZC 5FGBC 1BLNB 3GIZH 4NJAH 4APQD 5ESVA 1XIWD 5IBUG 4HKXA 4XPGL 5B39A 3L1OL 1RK1A 5KZCB 1E4XH 1NCBL 1TCMA 3RPIA 1P7QA 5FF6A 4BSWA 3TO2B 5TDOB 4OF6A 3RWJB 1GH7A 3BDXA 3MLZL 3C6LA 1JGDB 1QBBA 4XRCB 2C3VB 1KTRL 5ANME 1KV3A 2DI9A 2Y6SD 3QUML 4X8JA 1MCQA 3GRWL 4U6YA 1OSZB 4QRUB 2A1WL 3HKFA 5ID1B 1QBMH 3CFEB 5FM5M 4G7YH 2DB8A 2N7AA 2ZOKB 4LEOA 2AEQL 2OQJA 2F58H 1BZ9A 1FVDB 3MRJA 4HDIB 4K7FB 3NIGE 1T03L 1LE9B 1H3VA 4O00A 4UT6H 3ESUF 2HT3C 4W68A 4JG0L 3MCLH 2F5BH 3DECA 2VAAA 2BVUA 3GI8L 1OAXH 3MUZ1 1B90A 5I76B 3MFFA 1A7NH 1QPPA 4XCEA 1J10A 3V6ZA 4KRPB 4LLQB 4JM2B 4JKMA 2VLRD 2AI0H 1T66C 2AABL 5AZEH 4DK6A 3UJTL 1AXIB 3CH8A 1KJMA 1JF1B 5DJYB 2CXKA 1N7ML 2Q7NA 3RVWC 4LBEB 2C5DC 3EJJX 2BERA 5GS0C 3TYGL 2UWEE 4LRNL 1AQKL 3DX9A 1OLLA 3VI4F 2OI9C 2VWEC 3HTLX 4NQCB 5J7CC 4M1CD 3SKJH 4JDZB 2MHAA 1RZKC 3CCHA 4WHYH 1FO0L 1XZ0A 2BY3A 4Q0XL 1EJOL 3MGTA 2NY3B 2HWZH 4X83A 1JNHA 4LCWA 4KZDL 3BVNB 1UYWL 2CMRH 1ORQB 4Z0BL 4P3DA 1XF4B 5CILL 3TJEL 1BBDL 3HUJE 2DQFB 1NLDH 3MOAL 4LCIH 3HE6B 3RVTC 1BGXH 3ECBB 5KS9F 4RNRA 3TBVB 1Q9LB 1AXSB 2EIBA 1K3ZA 2NNAB 5CP3A 3S96A 2QKIB 4M7JL 5KSVB 3MLPA 4X5WA 1UWEH 5DK0B 5D72L 1UC6A 1H5BA 2ZCHH 4F58H 2Q8AL 1LWRA 2GYSA 2WBJB 4JFHD 1EUUA 4H25B 3P0YL 3MLXH 4M7LL 4WTZG 4FP8H 4HIHB 2PYED 1VADB 5DA4A 4TUKL 4WHDA 3E3QA 4ONFH 4GW1B 3TO2A 3KGRA 3OL2A 5TDOA 1QR4A 1KBGH 5E70A 1MUJA 4GAGH 4O51B 3RWJA 3VRJB 1U8OB 4HFUH 1JGDA 3DO7B 1Z0MA 5TQ2H 5CEXB 2VZTA 1VENA 2NXZC 3LDBC 5GGVH 1HXMA 1OSZA 1W72A 3GKZA 5JUEH 3RWHA 2BP3A 2N7BA 5ID1A 2VITB 4JAMB 5MHSE 3BOVA 3CFEA 2ZWLT 3KPQB 1X5JA 5EZOH 2ZOKA 2DL9A 3RBGA 1R3JB 4HDIA 5F71A 1FVDA 1LE9A 1C16B 1E28B 2PW2B 2UUDH 3MROB 5CLWA 2ZUYA 3MRLB 5DD5L 4DEPB 3VDBA 1UA6L 4YXKH 1FVEB 2HT3D 3ET9F 4QHUA 4NN6C 5I76A 4QT5A 4X6BB 3RTQA 2DWEB 3QXVA 2VDMH 1EEZB 4JM2A 5EPMB 5HD8C 3NACH 4PJAB 4D0DB 1F58L 1TCRB 3VXUE 3QPXH 3G5XB 3FB5B 4P2RD 2J6EA 2DMKA 1T66D 4L9DA 4XCNB 3HLAB 4KI5E 5CJQL 2DQIL 4JPVH 4WY7L 3MBEB 5D70L 3WNKA 1I1RA 3MRRB 1FL3B 5SWSB 1F4WH 3IDJA 4NQCA 1VFAB 5JDSB 4V2CB 5IJKC 4XCCH 2PR4L 3MCKB 1L9NA 1W0VB 1YEJH 3GKWL 5J06A 3ZTJG 4H8WC 3OV6A 4U33A 5EA0L 1CXLA 4N0RA 2BRRH 3LKPA 1D5XA 3BVNA 4NT6A 1ORQA 2HTKC 2Y4SA 1KCRL 1XF4A 3TC9A 2JIXB 5TDPA 1MJ8L 2DQFA 1CQYA 3ZKNC 3MJ9L 2P48B 4J6RH 3RGHA 4XX1G 2LAAA 1PAMA 4QHKJ 8CGTA 5L6YL 1SBSH 4C56B 1PEZA 1TJIL 4PJHF 5C0BB 1Q9LA 1Q8MA 2NNAA 1MQKL 3PL6C 5KSVA 1FYTD 5I6XC 3VXRE 3S7GA 4PG2A 5A40E 4S0SD 4RFEA 1A3QA 2CO6B 4UAOC 3SDDA 2WBJA 3W9EB 4M6ML 4NWUH 2E7BA 4H25A 4KZEL 1J18A 5L9DH 1XT5A 1A0QL 1PZ5B 3MODL 4IMKC 1A6AB 3B9KB 2AJSL 1WBXA 1VADA 3BE1H 5E1AB 4FQIH 4NIKB 1OW0C 5FM8A 3VRJA 4JO2H 2K3TA 3KPRD 2DQUH 2NR6C 3QEQD 3DO7A 3LD8B 2BZDA 1OTUD 3TF7C 5LAXB 1GIGL 3BT2L 2R23B 5FHBL 5JR1L 1NLBH 2V17L 3NAAH 2VITA 4JAMA 1YN7A 1U8JB 1MJ7L 3X3GL 2NXZD 4RMQA 4NZTL 2XZCL 3TEUA 3MRBB 1R3JA 5F9WC 5DMIH 4AYFA 1EO5A 5HGGS 1F02I 1XGUB 4KWUA 2Z8WC 5F3BB 1KB9J 1YC8A 5DSCB 3MRLA 1UM4L 3CX2A 1FVEA 4KVNH 5DT1L 5CKGA 4XP4L 3RWDB 5EU5B 4PTUB 1MEXL 3DTXB 3IFLL 1T80A 1YEGL 2DWEA 3DPBA 1EEZA 4PJAA 3X3FH 2AV7B 4BH8B 1TCRA 3O8XB 3ZE2E 1IFHH 2X05A 1P7KB 3FB5A 4LVEA 1EUTA 3OKOB 4EXPX 3D0LB 2B0SH 5HD8D 4RRPG 3T0BA 1R3KB 3BHBB 4XCNA 3HLAA 2R2HB 3TIDB 1VFMA 5GJSL 1FL3A 5SWSA 3FQRB 1VFAA 5JDSA 3UTPD 5E2TH 1B6UA 5CEZE 5IIEB 3REWB 3FN9A 4MAYB 3HC4L 43CAB 4Y16D 3B8YA 1RVFH 3BH9B 3HCVB 1F2QA 4WI7A 4MVBA 3B2UC 1DLFL 1HCFX 1A3LH 5HYSB 2IBBA 3VI4E 1NGWA 4DGVH 1MLCB 3WLBB 1S9XB 4V1DB 2HTKD 1JL8A 4HUUB 1MNUL 4JFDE 3H3KA 2D7NA 4LCUA 4GMTL 2X9YA 5HVFB 4M7KL 1ITBB 5IEKA 4A6YL 5DJCB 3IXTB 3JV4B 1IGTB 3TLRA 1JHTB 4XP9H 2QSCH 5J57B 3W9EA 1CR9L 1HILA 3VDCA 4IDJL 3IKKA 2XTJE 3G5ZB 3QHZL 5H35A 4L1DA 1TPXB 4PYHA 1PBYA 5BS0D 1P5VA 5LGKA 1NCUA 1XCTB 1YY9C 1FRGL 1ZT4B 5EU6B 1NGQL 5A43C 4D0BB 2EDEA 4P4RB 5T1MB 1H3PL 5FDYA 2AJYL 4LL9A 5LAXA 5CP3H 4CW1B 4PLNC 1U8JA 3HA0A 2DBLH 1TZIB 2ZPKL 2NY3C 3PGCB 1JYVA 4M43L 3EBAA 3P0VH 1XGUA 5ICXA 4X0KB 5GGRB 5DSCA 3THML 1ADQA 1BM3L 4LSDA 4C57C 4OZGF 5FYJH 2ADFH 2HKFH 5IBTH 4WWKD 2P5EB 4JFPB 1FNLA 5EU5A 2IPTH 1MFNA 5F6HJ 3B2VL 1IGCL 4QGYA 4NNPL 2AV7A 5FCSH 3O8XA 4K3JL 1P7KA 1QBLL 1F90L 3QDGB 1NC2A 3OJVC 4G8EB 1NQBA 4NQTA 3T4YB 2A6IB 1W72H 2LU3A 3ZT7A 3TIDA 2R2HA 4HK3N 2IBGA 3OR7B 4TNWF 4UT7L 5E6IB 4WI3A 3WS6A 1BD2D 5GHWL 5E00A 4KDWA 2D4FA 4LSSH 3W0WA 5HYJE 3C09B 5I8OL 1UJTA 2BFVH 5A3ID 3REWA 5D2LE 2ICWA 3VD7A 1M7DB 4MAYA 5E8OB 5F7HA 5JW3L 3TV3H 1A4KB 4GXVL 5DD0H 3IDXH 3SGEH 1FE8H 4LARH 1OCWH 3BH9A 2JELL 2R0KH 4U1IB 5HYSA 5D1QD 3QQ3A 3FOLB 1NGPH 1MLCA 4G6FD 1K3IA 3WLBA 1S9XA 3RPKA 2JB6B 2LU7A 4FXKB 5B38B 1JJUA 2JCCF 2Z31A 2J6EH 1SYSA 2SEBB 3L5JA 3C8HA 1BZ7B 4PJ5B 4F2MB 5IQ7H 4R97C 3BO8B 4RMWA 1MREL 1T04B 5ILTL 1B6DA 4FQXD 1T5XB 3DX8B 1V7NL 3JV4A 1IGTA 5CGYC 4MQ7B 3EOYG 4DEPC 3LQAC 1JHTA 4UNVA 5JMOC 4JFQB 3MLUH 3ARFB 1D3CA 5DUPL 3CK0L 4ZUUB 2VH5H 2BOCA 5JO5B 3ULUD 4I2XE 3ZKXC 1U91B 3QISA 4XNYH 1J0HA 2R1YB 2HVJB 2WNGA 1XCTA 1I7TA 5IG7B 1CFVL 4ETYA 1KLUB 3ZKMD 4P4RA 3KLHC 1PLGL 5E8EB 2FCBA 2C1OB 3ARDA 3QPQC 5T33H 1YY9D 3VXSB 3GBML 5IV2B 3NFNA 5AD0A 4Y7MA 3KPLB 4LDOB 2AK4E 2IAMC 4CW1A 4FQCL 3OR6B 5JOPD 1EZVY 1NDGA 1PG7X 2P45B 1TZIA 3IAQA 1QEWB 4LP4A 4DZ8A 4FG6C 3PGCA 2CKBB 3O41B 1AHWB 3VFRA 3CX5J 1HYSC 5GGRA 3ZSSA 4YHLH 4MDJB 1KPVB 4AH2B 1JWSA 4JFPA 1V3KA 4L4VD 4GAYA 2OR9L 1Q1JL 5C0NC 1MFCH 4S1DC 2MKLC 4LVHC 5FV1L 5IK3A 4HKBA 5C0AD 4JFZH 3NCYP 1BQUA 4NQSB 3FB6B 1EBAA 4G8EA 2A6IA 2ATKB 3MRCB 4HGKC 4MD4B 1R3LA 3OR7A 3E1F1 3UJJL 3R06B 4E41A 4UOW0 3MV9E 2D7TL 1KEGL 4BM7A 4JFEA 1FNSH 3V6FA 5E8OA 2W65B 4IOIB 3ARVA 4I13B 5C70A 2Y1VA 5KTEL 5B4MC 4AG4L 3LRSB 3ME0A 3ARZA 5T1DL 1V7ML 3LD8C 4KK5C 3S35X 3C9NA 3T3PF 4X6CB 4PRID 1RJYA 3UPRB 2AXFA 2JB6A 1QTYT 2VLRE 3D1MC 4FXKA 4G43A 3R0NA 3DXAD 3MRHB 4YE4H 4DVRL 4K8RC 4PJ5A 4WENB 3MV11 3VFUB 1GZPA 3WFEL 1T04A 2PNDA 4OJFH 3QEUA 1T5XA 3DX8A 4MQ7A 3ROOB 4EIZC 3GB7A 4D9LH 2E7HA 4WUUD 3SE9H 4R4FH 3ARFA 4NQEA 5K59F 4PV9B 3ES6A 4XVUD 2V9TA 1MIEH 4NN7B 4QXGL 3IXAA 1MI5D 1OTTC 3LIZL 1BEYH 4DOHB 1FG9C 1KLUA 3GSVB 4BJLA 5CWSB 5E8EA 3H9SD 2J8OA 3VXSA 4P4KB 4MXQA 4M8QB 4B7IA 3OKEB 2FATL 4X7DC 3BZEB 4KROC 4OLEA 3OR6A 3NCFB 1YN6A 3WFDH 1AXTL 5A1AA 3GGWA 4OBSA 4FQJL 3O41A 1AHWA 4JFHE 4ETQB 1CZ8L 3EO0B 2NY1B 2VUYA 4FG6D 3U4AA 1TZGH 4NP4H 1GGTA 2DQGH 1HYSD 5JHDB 3TVMB 2KKQA 4F9PC 2PYEE 3WIHA 5A2FA 4OT1H 1A02N 4LNVA 3IYLW 5EC1B 3VA2C 4EI5A 5IJVA 1DANU 4DKDC 1WK0A 4IRSB 2XIDA 4ZD3L 5IOPB 4LHJB 2OK0L 4G5ZH 4RFOH 4HF5L 2GIYA 3MRCA 5EC2A 4MD4A 4OZGE 5DQJA 5BVJA 4G8GE 4Y5XA 1NUDA 4LASH 4NQVB 1U3JA 2A77H 12E8H 4IIQA 2QSTA 4NOFA 1MCFA 5FGCB 4M6AA 5DFVD 5EZJB 1TPXC 3CFJA 3TPKA 3NCMA 1ADQH 5M94B 4NNYB 4IOIA 1A7RL 1G6RB 3SPVB 4JQVC 1T1XA 3LRSA 3BQUD 3T0EC 1N5YH 3AS2A 4OIIL 1YMMB 1ROWA 5I8KH 1I9EA 4RIRB 5F6HI 4XPHL 3NGBB 1I1AC 2EH7H 1G84A 1AE6H 5E6YA 5L2KD 2X4QB 2Z4QA 5E08L 1S7SB 3WDIA 2EE6A 1EEUA 3CDFA 3HMWL 5J6HB 3JBG7 5K9JL 3ROOA 5F7DB 5F7UA 1Q72H 1KG0B 3KLAB 2NXYC 3MCG1 2JCCE 4PV9A 4YPGA 3WNMA 5CGMA 4QCIA 2BVQB 3OSKA 2P49B 1U3HB 2AEPL 5L2JB 4QRTB 3RKDD 1T0MB 5HHXL 3JV0A 3HNVL 2X7LB 3T77B 4KQ4L 1VA9A 3BESR 3GSVA 3H0TB 4G6AD 4MXWH 3T1WA 4HJJH 3SO3C 3OKDB 5JW5B 4CU7A 2FEDC 1J8HB 4GG8B 2O93L 5SWZE 4P4KA 5E6IC 5FV2A 3SKOA 2MQ0A 4EBQL 5IB3B 1BHGA 4U1GB 4UT9H 2VLJB 3BZEA 3BP6B 2QADB 4EKXA 4JKPH 3WUWG 1FYTE 3ZO0A 5GJTH 1LQVA 4LSVL 1U9KA 4X99B 1U2HA 2YPKB 1C5BL 4IHOB 1DBKH 3PV6B 2VB5A 4LHUB 3KHOA 1ZHNB 2XN9D 5C0GA 5EUOB 3VH8G 3QXWA 4NC0B 2I60L 2IAND 3SDAB 5JHDA 5D2NB 3EZJB 4Y4HC 3FOMB 2E3VA 2IJ0C 5EC1A 5ALBH 3PWUB 5AAMA 4NRXA 4ZS7L 4IRSA 5GRYA 3KPRE 1G7QB 1OAKH 2R4RH 5HGAB 3P11L 5IOPA 1IRAY 2OJZL 3CVIL 4FTVB 5E7BA 3RX8A 4R2GC 1NCDL 3NCJH 4NQVA 4DK3A 1MFDL 3QULB 1JWMA 2B1HH 2JB5L 2B4CL 2YZ8A 3M45A 4XNQB 3RX7A 1JNJA 1VGKB 2E7LC 1CICB 4HCRL 2EDYA 4CVWA 5EZJA 5I1GL 4ENED 4PJGB 1G6RA 1OARH 3SPVA 1WFUA 3SN6N 3OAZH 3BMWA 4WU7B 4PY8I 4P2QB 2HKHH 1RUPL 2Q86A 3V0AC 2IEPA 2WM0A 3QG6B 2DQDL 3T0ED 1CDYA 4RIRA 2FSEA 5ANMA 5E24E 4CVXA 1U41A 1XH3B 1MRDH 4PGCB 3VG0L 1AJ7L 4Y5VA 4XNXH 2X4QA 4G9FE 1S7SA 1I1AD 1FZMB 3GMMB 1BJ1J 3QWRA 1JN6A 2G9HA 5SX4H 3T3PE 2AJUL 3CFBB 2AGJL 2X4RB 3UTPE 1JHKL 5CCKL 2R0WL 1KG0A 3KLAA 2IGFH 5GRXG 2BVQA 3GK8H 3MRQB 4N5ED 1MWAL 3S36X 1U3HA 4QRTA 1T0MA 2HFFA 4QWWD 4HIIB 3T77A 3O3UN 3H0TA 4PY7A 1KN2L 4MSWA 3OKDA 2HFGL 4XMLL 1J8HA 4KU1A 4GG8A 1T89C 1IKNA 5E2WH 4JHZA 5L88L 4L8CB 1HIML 2AXJA 2VLJA 2EDJA 3U7WH 3OAYH 4PJEB 5H37H 1NL0L 1CT8B 2VKWA 3OJMB 3QIBB 5E8NB 3SBWA 1AGBA 1WTLA 2MFNA 3AS1A 4YX2H 4X99A 4IRJC 2BHUA 2VXQL 2YPKA 4WFHD 4IHOA 4FNLL 2NX5B 1MCDA 3ULVC 1RPQA 2VN7A 2FJHB 3V6OA 5DURD 5EUOA 3UYRH 1JGLL 4NO5B 1JBJA 2FZ3B 3SDAA 3W11C 5KG9B 3L7EB 1I75A 5D2NA 5T5FH 3W5MA 4M62H 5CJXC 1MCWW 2OZ4A 5I1KL 3PWUA 1J0YA 1UJ3A 3HUJA 1XR8B 4WGWB 4XNUH 1G7QA 2GITB 2EO1A 4TUJB 2BVYA 1A6TA 4FTVA 1Q9OB 4WFEE 3T8XB 3VGBA 2B1AH 2RFXB 4ISVB 4JKWA 2N1KA 5IVZB 3QWOB 4F8QA 1AGCB 1AP2B 3QULA 3DHMA 3E8UL 3LMJL 1P4BH 4TSCH 4XNQA 1P53A 4H0IA 3G6DL 1CICA 4NKQB 2LU4A 4LOUC 2DKMA 5HPMA 2P7TB 1H0DA 3IGAB 4PJGA 3GMNB 2YRLA 3IRPX 5IEHB 2VL5B 1PX4A 5FB8B 5E99L 3VD9A 1BQSA 5C09B 5H8DA 5E4EB 4UTAL 3WIHH 9CGTA 4WU7A 1RUAL 3VXTA 1QSFA 4ZOCA 5L8JB 1SYVB 5HI3C 5DJDB 4H20H 2IFGA 1HDMB 2QJDA 4RBPH 4UU9A 4RFNC 3WS3B 3O0RH 1XH3A 2XWTB 3WO3B 1OT2A 2YUXA 3UTTB 3X14B 5CD3A 2B2XL 1I7ZA 3O4LB 1D5ZA 3ESVF 1KJ2B 1FZMA 3GMMA 5A16B 1BD2E 3CFBA 4AIZA 1FSKB 3MREB 3T0AA 2X4RA 4N0UE 4AENA 2UZIH 4MCZB 4NC1C 1JIBA 3V95A 4U7KA 4OLVH 1KYOK 3QFJB 4JY5L 1U58A 3MRQA 5IBUB 3OG4B 4P46B 5DMYA 4UINH 1MCOL 1O5DT 3GMRB 3RDTD 3ZE1F 4JFFB 4R0LC 1PEWA 1JGEB 1IC7L 4HIIA 4XNMB 3VCLB 1SJHB 4HZAA 1IGIH 5TGBB 5IBLD 5KJRH 2ZKHL 4XVTH 3VXUA 3EFFB 4QOKE 3FMGH 1TNMA 4PBXA 1HYRC 2CUHA 4ZS6D 5TJWK 4CGTA 3TIEA 5HYFA 2BJMH 4PJEA 3V9FA 4FFYH 1CT8A 2JJUA 3PP3H 3C5JA 2Q6WB 5EULV 1I7UB 3KPPB 5CBEB 4PLJC 3TJHC 4ZXBB 4YBQC 2NX5A 5I1DB 2FJHA 4IRJD 3D39B 1F2XK 1A7QH 3ULUE 1T83A 3LCYA 5GS1C 1Y18B 4KVCH 2DD8L 3BXNB 5HHOD 3UTSE 5E2UL 1PZUB 4PUBH 3W11D 3MLSL 5IF0A 3JWOH 4ZTPH 1SJEA 5E5RB 3VRIB 3VFTA 2GITA 4TUJA 1RJZB 5LXGL 2F74B 5EORH 1Q9OA 3T8XA 4N8PA 2RFXA 1OAQL 1H3XA 4ISVA 3QWOA 5DMKB 4NZDA 2Q3ZA 2X89A 5DC9B 3STLB 5LKNA 1F3JA 1AP2A 2CRMA 2OL3L 1UB5B 3T2NH 2ZP0T 5DD6B 3TO4B 4OZFG 1H3UA 1QACA 2CD0A 3U79A 5D8JH 2P7TA 1OGAB 3MUGB 4KJWC 3GMNA 4K71B 5IEHA 2VL5A 5KS9B 4Z7VF 2GI7A 1CQKA 3B9DA 3GI9L 4L4VE 1F3RB 1ZGLB 2FO4B 1NMAH 3PV7A 1SYVA 4XPTL 3PHSA 3HC0B 1KTKE 1QBML 3B6SB 4U1GC 4ZQKB 4G7VH 4KJPC 4F33B 3WS3A 1ZS8B 5C0AE 3ZTNH 1YUHB 1J11A 3ULSB 1C08B 1EHLL 5HI3D 2F58L 2OJEA 1FIEA 3UTTA 3X14A 1DBAH 1Q0XH 1X5GA 3O4LA 1A47A 1AC6A 3BEVA 1KJ2A 3MCLL 5HDQL 5A16A 3N1PC 1S7VB 1MY7A 1NFIB 2L4OA 4U6XB 3LZFH 5EN2A 3MREA 3EYFB 1OAXL 1MVUB 2E7CA 5JIIA 4GW4B 3LPWA 3QFJA 2AI0L 1IQDA 1G6RH 5C9KA 4KMQA 5DJ0A 5E56A 2NY0C 2VL4A 1A6VL 4JFFA 4NKDA 1JGEA 2ADGB 2ZG2A 1EA9C 3RL2A 3AM8C 2DJUA 1F42A 4PRIE 5ETUA 4DAGL 5CZXC 4WHTA 4MS8A 3C8DA 2A9ML 3EFFA 2MMXA 4ZFGH 4PJXB 3PWPD 3OKNA 4ZUTB 3PWVB 4U4BA 4B7LA 1RFDH 4LIQL 1HINL 1U8MB 2ITDB 5IVXF 3G5YB 2Q6WA 5FUCC 3KPPA 5CBEA 4L5FH 5K9QG 2CMRL 1FYHB 1I9RL 4X5XB 2BSTB 5I1DA 4PLJD 4RMRA 3TJHD 1NLDL 3K7UA 5DUBA 1OSPH 3F7VB 4OGYL 2AK1L 4QHLB 3P77B 4LCIL 2HYMA 1BGXL 4QRQA 3UO1L 5JPNA 1UZ8A 4RMUA 1JI2A 2FGZA 1MI5E 1TLKA 3FB8A 4NQXA 3GSQA 5ACMA 3GBNH 3VRIA 2PCPB 4CVUA 2PXYB 3D5OF 1RJZA 2Y07H 4C59B 3QUKB 3VW3H 4F8TA 4F58L 2F74A 2VERN 3RGVB 4S1QL 3AC0A 4UTBH 5DMKA 1FQ9C 3EJYC 3QIUC 6CGTA 4LRIA 4WW1B 3F62A 4R26H 5DK2B 4LKCB 1UB5A 3MRKB 1JPST 5DD6A 1JRHH 1X44A 2A38A 2VXTH 4FQLH 2LVEA 3TO4A 4H5SB 1QFPA 3QZWG 1KBGL 1RMFH 3MLYL 4GAGL 3MR9B 4M5YL 3MUGA 1A2YB 5KS9A 3V2AR 1JP5A 4MA1C 1P5UA 4BSJA 2EEBA 4PJHB 1RZFL 1DLHB 1FL6B 4GUPB 3S5LG 4W6WB 2FO4A 1ZGLA 3B8SA 4KJWD 2OZ4H 1YYMH 2DQCL 4UUJB 3HC0A 2AJXL 1GC1C 4CNIA 1VGEH 4EDWH 5D9SA 4TRPH 5EZOL 5GS0L 1D5MA 1YUHA 3ULSA 2EDOA 2Y36H 1C08A 3VWKD 4PGDB 5FECB 4CU8A 3QIBC 1JWUB 1AO7B 3HZVB 4KJPD 4MA8H 4LF3B 4DN3L 1CLZL 4L4TA 3QNYB 1S7VA 2FECL 2ARJB 1NFIA 4U6XA 2QHRH 1RZKL 5FOJA 3U7YH 5KVGH 4FHBD 4PRPD 5CINH 4S1RH 3SOBH 1JZ2A 5BW7C 4GW4A 2OSLB 4CDHA 3VMNA 2FX8L 1I8MB 4GG6F 3MUY1 2I9TA 3NACL 3LN4B 5K9QI 3QPXL 4OV5B 1A7OH 4M48H 2ADGA 3GJFB 2XZQH 2R29L 1RD6A 1M7XA 2NY0D 3L9RB 3O3BB 4JPVL 1FGVH 4ZG1A 4O2EB 2VNCA 4XAWL 1MIML 1F4WL 3GSOB 3NH7H 4PJXA 5C08D 3BP4A 4ZUTA 5CZXD 3PWVA 4M5ZL 5L2KE 3Q5OA 1TVHB 3AVEA 5ACLA 4RCAA 3SGKA 4XNZC 5LQBL 2EDKA 2BRRL 4LGSB 4WFGE 4JVPA 2GQHA 4KY1L 3V52H 1LK2B 4OD3L 5I74C 3MGAA 4MWFB 1LQSR 1X5HA 4X80H 4JLRB 3RI5F 1YNKH 1ERNA 4FFVC 4XPFL 3F7VA 3NZ8B 4NKOA 1SBSL 1S5HA 3RA7H 2DDQL 3A6CH 4ODSH 3K2MC 5FHAH 4U1LB 2VC2H 2PCPA 2VISA 3UZVB 1UVQA 5TFSH 4M7LT 2LTQB 2NY6B 3RGVA 1AC0A 2G2RB 3O6FB 4NWUL 4U49A 1YECL 3PWLB 4WW1A 5GGQH 4YPJA 5TH2A 5DK2A 4MGXA 4K2UL 4Z7WF 2CGRH 2R0ZL 4NN5B 3EJYD 4OCYH 5ALCL 1XMWA 3QIUD 4CMHC 3BE1L 5DHXB 4FQ2H 3BMVA 4FQIL 2GK2A 4L9LB 3WJJC 2ZCLH 4OF5A 2YWZA 3PGFL 2A6JB 3V7MA 2X2YA 4JO2L 1A2YA 2XN9E 4IRZL 4HUWA 1LEIB 1JTOA 2IANE 5J8OA 1GPOH 4PJHA 3FT3A 1DLHA 1FL6A 4GUPA 2X1XR 1RSFA 3SE3C 3G04B 3EOTL 4UUJA 1UACH 3NAAL 3SGDI 3BGFB 5BXFA 4U1JA 4KK6C 2OX5A 3MOBH 4XTRC 5H94B 1JWUA 5DMIL 4TUOB 1AO7A 4RMSA 4LF3A 3MACH 4ZXBC 2AK4A 5DZLA 3QNYA 1FNHA 5I19L 5GRVL 5LCVH 4UB0H 4GRWE 1RZ8B 2OSLA 4Q9RL 1Z9MA 1I8MA 1QRND 2F8VA 4WFFE 3LN4A 2CIKA 4EQ2A 4Z7NF 3I50H 4OV5A 4HZLB 1VFUA 4ODTH 3S3SA 5I15H 3GJFA 3WV0A 3D9AL 3EDEA 2R15A 3EYOB 3L9RA 1K2DB 1FIGH 3O3BA 5D1XA 2W91A 1H3TA 4O2EA 4LNRB 3OX8A 4YIQB 4RGNB 5DVLA 1GCFA 3GM8A 3P2TA 1WGOA 1A6WL 2A73A 1AKJA 3N85L 2Q8BL 1Q38A 1KJ2H 3C60A 6FABH 4IOFD 1TVHA 4HGMA 1I8KA 2GJ6B 2CO7B 2JJSC 1TJGH 3F7QA 5I17A 3D6GA 3LEVL 5DJXB 1BAFH 4OLYL 4K71C 3JWDH 1RUKH 3IDGB 3MV9A 2XRAL 1A3LL 3DIFB 5DUMH 3VWJB 1UWGL 3QUZD 4MWFA 2XV6B 4RQQA 2QEJA 4JLRA 3HPJB 5C3LD 1DEEB 4HT1L 2HFTA 4I3SH 3MRFB 5FCUL 1K6QH 3VGHA 3QHTC 3UPCA 2Y72A 1S9VB 5FUOH 2C7UB 5IVXE 2ESVE 4FFVD 5BRZE 4OLXH 1AR1C 1IEBA 2ZJSL 5GISH 4RRPA 4ZDHB 5KANG 3GO1L 1SMOA 2G2RA 3ABZA 3O6FA 5GZOC 4P9HC 2B7DT 3E3QC 3PWLA 3PGDB 1DEDA 3VG9C 5CJBA 4TQEH 1JPGA 3RVXD 2BMKA 2ADIA 1P7QD 3ETBF 4WFHE 2AJ3B 1K9TA 4Q9CA 4AM0B 1CGTA 4MAUL 2A6JA 4ZUSB 1LO2L 2X9XA 2W07A 3HMXA 3C6LD 4GKZB 5DTFA 3HB3C 1ZEAH 1IAII 5I2IB 1LEIA 5JW4Q 3RUGB 2YN3A 5E95B 3C8KB 3WL9B 5IVNA 4OLZL 2J8UE 1MFAH 4YHOH 2X4TB 4GAJH 3M17B 1DFBL 2HT2C 2WLZA 2DBLL 1J0ZA 4HJGB 4WW2B 5H94A 4RA0C 4TUOA 4L8DB 1X4XA 4ZFFB 3P0VL 3QUMA 4PLOB 3C2AH 4KK6D 3DWTA 3A6BH 4S1SH 4XTRD 1SM3L 4YZFF 1U95B 3MO1B 5IBTL 4L3CB 4X6DE 4MA3A 2ENSA 1GSMA 4NGHL 1X5ZA 2YOCA 2IPTL 1RZ8A 3TFKA 2VQTA 1BQHB 1MHCB 1KT2B 1ZANL 2UY6A 5C7XH 4X9FA 3V4VH 4S11A 1YNTB 4LLYA 5D93B 5C0JB 4PRHB 2PXYC 3T2OA 3BKJH 4YBLB 4JJ5A 3SDCC 2YBRB 3EYOA 3ILPB 1QO3B 2XPGA 3BUTA 1KB9K 4QRRB 5EOQH 4LNRA 1Q9WB 4OZIE 1WISA 5AWNH 1F5WA 3W2DH 3MNZB 2DLHA 3U0WH 1TQBB 1HHKA 4UOJA 2DYPB 2PO6B 4GW5B 4P2OB 2GJ6A 5DD0L 2VDPH 3R4DA 4LCWD 3ZDZF 5KANI 1FE8L 3SQOH 4LARL 1OCWL 5C9JA 5F72S 2XWJB 4F15C 1EFXD 3VWJA 5LBSH 3DIFA 3LKOB 1C7TA 3IDUA 3O6MH 5ICZB 3P4OB 4QGTA 3UBXB 1M7IB 3HPJA 4OGAC 1DEEA 5HVGB 3FRUA 4PRDB 1Z9OA 4K55A 1S9VA 4LSRL 1K85A 5FUZL 3P4LA 4S0UC 4YFLF 2EKJA 5IQ7L 4GRMB 4NFDA 2DMCA 3WSQH 3J7HA 4FZEH 4W81A 4OZHF 1CG9B 2H1PH 4ZDHA 1L6XA 1MRCL 3HZKB 2NLJB 3QDMB 4P59L 2F8XC 3EHBC 4JN2B 4F7CA 3O9WB 1TMCA 1S78C 4BA8A 4XNYL 1OT1A 4LPWA 5FYJD 5GZOD 4AQ1B 2AJ3A 3VXMB 4OIAA 2XKUA 4NDMB 2BNRB 4ZUSA 1P84K 5I2IA 5DC0A 3F7PC 2IPKB 3RUGA 4JY6A 3C8KA 4X6FB 3WL9A 5HHOE 1YEFH 5C0FA 1IVLA 2GTZB 4Z7WE 2DQJL 1EIBA 1XGRA 2IH1B 2KQNA 1QFWM 2GAZB 2YHGA 4ESKA 3U30B 4ZFFA 2HT2D 1YEEL 5E9DE 5GRUH 3H7LA 5I73B 3UTZB 4YHKH 5DVKA 1U95A 1IEAB 2W9DH 4LLUB 3MO1A 4OM1H 2NTFB 1YEIL 2OP4H 3RTQD 5KN5A 1EH9A 1BQHA 1V3JA 3SDYL 1KT2A 1IC4H 3VRLF 1U8LB 1NUNB 5B22A 5BV7C 4JO3L 4Z8FH 4JFZL 3SCMB 1YNTA 2VYRE 3HI5H 4JRXB 5C0JA 4YFLI 1K8DB 3FRPA 1NGYA 5CZVH 2LTQC 2NY6C 2QQLL 2VXSH 2O5XL 1YC7A 1P4IL 4R90H 4QRRA 1MFEH 1RZJC 3QI9C 1Q9WA 1LVEA 3RAJH 3HC3L 3NIFF 4NQCD 3MNZA 2ILLA 1OY3B 3MBXH 2DM7A 2XA8H 1NEZG 7FABH 5E94B 2PO6A 2V7HB 4Z7NE 4MVBC 3LQAL 5EOCJ 1X7QA 4HIXH 4L9LC 4JZJC 1Y6KR 3QJFB 4QXUH 3E6HA 2FGWL 3AAZB 3LKOA 3UAJC 1JPFB 5ICZA 3P4OA 3F6LA 4RZCB 1M7IA 5DRZB 1UKQA 1YZZA 4N0CA 3MMEA 1D7FA 1FLTX 5GRJL 4ALAL 1S7QB 3GJFH 4PJCB 4PTTB 3C5ZB 2UYLA 4U6VL 1KIPB 4BQCA 4HWUA 3EOAA 1N5AB 3FHAA 1SJVA 4OFIA 5SV4A 2Y06L 3MJ9A 4FQ1H 1CG9A 2W0LA 3SDDD 3PWPE 4R4FL 3SE9L 3HZKA 3QDMA 3QCVH 3QCUH 4G9FA 4JN2A 3O9WA 3UMTA 3N9GL 3LSOB 3VFGH 4JQIH 4LPUA 1A1MB 4NDMA 2BNRA 2J7LA 1MF2L 4PJDE 4DKEH 2DWDA 5HSFA 3EYSH 4HUMB 2P8PB 2IPKA 2VIRB 1LD9B 4ODWA 5D1ZB 3OJDB 3FFCB 3RWGB 3NTCL 3EDKA 5DRXA 3QQ9C 3CMOH 5HHME 4I9WD 2IH1A 4HC1A 4JANB 3BIBX 3QUXA 2GAZA 3OKKA 1MCPH 4GLRI 4Y2DB 1MCEA 4YQXL 3UP1A 3MA7A 3LPGA 5F7MC 1XF1A 5DA0B 1KLFA 1J8KA 4MB5A 3UTZA 1IEAA 4LLUA 1TZGL 4NP4L 2NTFA 5KSUA 2DQGL 3O4OB 3NBNA 3HNTH 3LKNB 5GGRY 4OT1L 1DUYB 1L6ZA 4P5MB 4LLMB 3V6BR 3HMXH 4NCC2 1JYXA 4UDTB 2FEEL 3SCMA 2BRQA 2WUCL 4OSUH 5TF1H 3OZ9L 3MQIA 1KENH 2A83B 3L1OH 2H3NB 2O61B 4YZFE 4N8CL 2PTTA 5SWSD 1DANT 1U6AL 3MLZH 1JGUL 4K8RL 2YPLA 5F1NB 4GMSH 5MP6L 4XHJC 4FFWD 4DCQB 3QUMH 3QYCA 5IMOB 4KH2A 3QI9D 4QRPB 5E94A 2V7HA 3DUSB 2A1WH 2WQ8A 1S7UB 4Z7OF 3RZCB 3G9VA 1AGFB 1Z5LA 2AEQH 3L7FB 4JDTL 3QJFA 4BZ2L 4MVBD 4HS3A 4PRPE 4U7MA 1T03H 3RHWK 3AAZA 1YJDC 2Z31C 4JG0H 2D7QA 5HDBF 1N59B 3X13B 2CJUH 3GSXB 4RZCA 3VH8B 5DRZA 4EIGB 3TT3L 1V05A 4KTDL 5FKAB 3UAJD 3GI8H 1AE6L 1WZKA 1S7QA 2H2SD 4PTTA 1KUMA 5JNYB 3SE8L 1ZA6B 1IGYA 1KIPA 3T08A 3ZDZE 3PF2A 4RISH 1HK6A 1N5AA 1DZBA 2AABH 1JTPA 3UJTH 1OD9A 5TDNB 1N7MH 2H26A 5C08E 1EFQA 5CSBA 2EICA 3IFOA 5JZ7C 3TBTB 3RNQB 1AQKH 3LH2L 4JFXB 3ARDC 3LSOA 1LE5B 2VDOL 4JZNB 4WEUD 1A1MA 1NCNA 1BVZA 3LQMA 4Q0XH 4YBLC 5F9DC 1EJOH 2IADB 2P8PA 3EGSB 2E9WA 3QJHA 4KZDH 2VIRA 4P99A 5D1ZA 3OJDA 3FFCA 2UY7A 1BVLB 1UYWH 1HSAA 4Z0BH 3U36A 1TQBC 3ORJA 5CILH 2D7OA 3TJEH 4JKPL 1DR9A 3EO9L 3F58L 5ESAB 5F7KC 4JANA 5GJTL 4P2OC 1HEZB 3L6FB 3JWNC 3MOAH 4QOKA 4PJ8B 4Y2DA 3WHE0 1FJ1B 2PYFB 1DBKL 4CJ1A 2ZG1A 1N2RA 2DIJA 1S9KC 5HY9B 2EYSB 5GSRB 3TN0B 5ECJE 3SE4C 2Q8AH 3FN3A 1DUYA 5KSBB 2BOBA 1OF2B 4GH7B 3P0YH 4UDTA 3SJVD 2IMNA 4M7LH 1I9IL 2R4RL 5C0EB 4Z5RB 4UBDC 1NC2D 3OKMA 1KJVB 2G75B 2H3NA 3NCCB 4GT7A 4TUKH 3UTSA 2O61A 1MJUL 2UWEB 3NCJL 3G6JE 3BPNB 4R96A 3VXPB 4X98B 1TETH 4JM2F 3W0WD 1SEBB 5C0DB 3WN5B 4DCQA 5FYLL 1W0YT 4U3XA 4QRPA 3KYKH 4UV7L 4WUKH 4WGVB 3WUWA 2HLAA 4LCCB 1S8DA 1S7UA 2CH8A 3RZCA 1OARL 1M6OB 3D69A 3OKLB 3S6CA 4X4ME 1M4KA 4AT6B 1JZ5A 4CADB 1BX2A 3NIFE 1N59A 2NY4C 1HKFA 3GSXA 3VH8A 3X13A 5DD5H 1QRNE 1UA6H 5FKAA 3BPLB 1OPGL 2Z31D 1MRDL 5JNYA 1ZA6A 3K1KC 4XNXL 3D25B 5C0CA 4NBXB 1LO4L 2DLTA 1QFUL 1FN4B 2CDEB 4Y19E 2K7PA 4XZUB 4UDUA 3SO5A 4OGZA 5EZIL 2WMPA 4KJQD 3PE9A 4P9MH 5CJQH 5DRWA 2IGFL 5IKCB 3EJZC 4WY7H 1EXUB 5D70H 3GK8L 1UXWB 1G9NC 3JZ7A 4YK4B 1PY4A 1WIUA 1ZHKB 4JFXA 2H9GA 4ZO9A 1CFSB 2ZSVB 2PR4H 4JZNA 1AGEA 4PLKD 1RUQL 3GSWB 3GMOB 3ARDD 3GKWH 4ZSOB 1LGVA 2IBZX 5JPMB 4PRAB 2IADA 1FCGA 3EGSA 5L7XL 5AEAA 5BMFL 2DRUA 1ZOXA 1BVLA 4H0HB 5DS8B 4N90D 5IB2B 1KCRH 5JA9A 3TA3B 1LEKB 4PJIB 1MJ8H 3H3PL 3MJ9H 1HEZA 2EYTA 3JV5A 3MRIA 5T1KB 1FJ1A 5L6YH 5E4IA 2BDNH 3TNNB 3QEHA 4EN3A 1RHHB 4FQQB 4MA7H 1MQKH 1KC5L 1UQSB 1YEHL 2GTWB 2EYSA 3RL1B 4YGVB 1I9JH 5JMRA 3TN0A 3IDIA 4G3YL 1FFNB 1FNEA 5TE4L 4M6MH 4KZEH 3C5ZC 1OF2A 4O2FB 4HBQA 1A0QH 1HZHL 4XNUL 4O4YL 3MODH 1L7IL 3QQ4B 4Z5RA 2AJSH 4YC2C 2G75A 3VFMB 3ARBB 1N26A 4BQBA 4UBDD 3TZVA 1RIUL 4HC1H 4E41D 5CD5D 3VXPA 4MCYB 4X98A 1P4BL 2YC1B 2CKBL 4K9EC 3IKCB 4JFED 3BT2H 5FHBH 5JR1H 1TNNA 4HMCA 1MJ7H 1CXHA 3DUUB 4U1HB 4FFZL 4NZTH 1M6OA 3K80A 3OKLA 2GY5A 3R8QA 4BKLB 2M1KA 5C71A 2VZ1A 1UEYA 4Y0GA 1CDJA 5B8CB 1BIIB 1UM4H 5C2UB 2C1PA 4F7EB 1U8HB 3IJSA 5DT1H 4XP4H 4NPYB 4PJ5D 4PGBB 1ZVHA 3VI3E 3D25A 3IFLH 1YEGH 1TTGA 3DVGB 1FVCB 1QSEA 1I7RA 1MH5B 1JZ4A 4OFPA 4E42B 1EEQA 4X4XB 1FN4A 3V4UL 1XR9B 2IALB 5HDBE 5JXEA 2CDEA 3ARFD 1FLRH 4XZUA 4NQED 5DD1H 1INQB 4Z7VB 2KUTA 5IKCA 3PDOA 5GJSH 1UXWA 5TE6L 2W0FB 3FQNA 5KSAA 4OZFB 1S5IL 2V5RA 1CFSA 2ZSVA 4D2NA 3ULVL 4WCYH 3EJZD 1VERA 3MRNA 2WW8A 1IGIL 4P57B 4MYWB 3GMOA 4F3FB 4ZSOA 3AY4A 3IRZA 5JPMA 3CDGB 3HC4H 5FK9A 4MXQD 5I18L 5DS8A 1DLFH 5IB2A 2BJML 3TA3A 1HHJB 3QXAA 4ZO7A 4FFYL 5C1MB 5B3NA 4C83A 4LSTH 5T1KA 3ZZ1A 1MNUH 3TNNA 1TJHL 4GMTH 1RHHA 4FQQA 1P2CA 5BVPL 1UQSA 2VXUL 1FG2B 4OI7A 2GTWA 4ZUVB 5FYJE 3DGGB 1CLYL 4KVCL 3DVIA 3H8NA 4FMKA 1CR9H 2GHWB 1A1NB 1OAZL 2OTPA 4EI5D 3GMQB 4E5XB 2D9CA 4IS6A 4KK9D 4MB4A 3I6KB 4LLDB 3PQYB 4ZAKB 2KBGA 3ARBA 5DGRA 1FRGH 3WJLC 1NGQH 1PD6A 1UH2A 1WT5A 1BWWA 4MCYA 4WV1B 3T2NL 1CXIA 1EGJL 1Q94B 2YC1A 4DW2L 1MPAL 1K4CA 1QUNA 2AJYH 5B3JF 4PREB 2AAVA 2OXHA 4B41A 2OTUA 3DUUA 4K3EL 3QR2A 2ZPKH 3D85B 3WDHA 2AXGA 5HHVH 1A6UL 5AG9A 4KTEL 4M43H 4BKLA 4ERSL 5HYSG 1HI6B 2Q7YB 3ARGB 3THMH 4GQPH 3KYAA 1BM3H 4F7EA 3ZTNL 2P1YA 4JDVB 5AYUL 2D7PA 4NPYA 1Y6NR 2ZSWA 3QUYB 1WVZA 4PGBA 4KKAC 1DBAL 1Q0XL 3B2VH 5E8DL 1IGCH 4DJMA 5CKAA 3DVGA 4G6JL 4RGOL 3I6LD 4NNPH 5BO1H 4JGJA 2Y7QB 3DV6B 4K3JH 3BRGC 4X4XA 4NQCE 4JJHA 2IALA 1F90H 5MENB 2CLVA 1CE6B 1MHHA 1I4FB 4D3CL 3DYPA 4MNQB 3NVQA 1FH5L 3G5VB 4Z7VA 4UT7H 2QV2A 5GXBB 5GHWH 2W0FA 2WK2A 2EXWC 5J1AB 4OZFA 4YDJB 5LWYL 5IWLA 4H26B 5I8OH 1IKNC 1R0AL 4I0PB 2LVCA 4P57A 3G08A 4W4OA 4F3FA 5JW3H 2VOTA 3CDGA 1N64L 4GXVH 3BKMH 1PKOA 3SBWC 2RJMA 2JELH 1CVSC 1HHJA 1RFDL 2EXYC 4LCCC 3GMPB 4WIQA 2N4IA 3LEXB 2GSIB 2EYRA 4I18C 8FABB 4GBXB 1I1FA 2VZOA 3P4NA 1I3UA 2NY1D 2V5SA 1FG2A 4PJBF 1MREH 5ILTH 4ZUVA 3LRGA 4J4PA 1V7NH 3DGGA 1CDBA 3AREC 2R9HC 2YEZB 3KNBB 1UH3A 4Z0XB 5DUPH 1G7JA 5BOPA 3GMQA 4IRSD 3EAKA 3I6KA 3VW3L 4LLDA 2M26A 4ZAKA 3Q5YA 4P23C 4UTBL 3NPSB 1CFVH 2ESVA 2ZUVA 5I71B 1B9ZA 5IHUL 4I9WE 3QB7C 5BZWB 3MPCA 4BUHA 5EZLB 4YK4C 5AZ2L 5EWIL 5IB4A 3WLWD 1NBYB 2IQAB 1IKFL 4FQCH 4XC1H 3D85A 1OOAA 2OZ4L 1YYML 4HCRA 5HJ3B 4H88H 4JB9L 2F54B 1HI6A 2Q7YA 3ARGA 5I1LA 4PJAE 2ZUQC 1FFRA 2Y36L 3BW9A 1NGXB 4RGMC 5B38G 3OTTA 1I1YA 1W8OA 3QUYA 5DHVB 2IPUK 4NO3B 2OR9H 4XP5L 5C0RL 4QRSB 2YSSA 3BZ4B 3BN9D 1LNUB 4DGIH 5SWSE 1WSST 5J9PB 2QHRL 5KVGL 3DARA 1XGQB 2Y25A 4HUKB 1MCJA 1CE6A 4NO0B 1I4FA 4J3WA 3SOBL 4HKZA 1A4JB 4MNQA 3G5VA 2HJKB 3QA3A 4U2ZA 3H3BC 3UJJH 1NH6A 1U3HD 5JW4M 2WP3T 5J1AA 4OM0L 1A7OL 4M48L 4YDJA 1N6QL 4M7ZC 3GEWB 4H26A 1KEGH 1HKLL 3VGAC 4I0PA 1CD9B 5T1LA 4WTXA 1ZAGA 1J8HD 3QIWB 4KI5C 1BF2A 1MWAA 2Z92B 5KTEH 3NH7L 3VFVB 4AG4H 1ETZA 3IF1A 4C56E 5EBLA 1J9CT 2VLJD 5T1DH 5BZDA 2D0HA 5C0BE 1GL4B 4J3SA 4NKMB 2IQ9L 4R7NB 5A2IH 1T83C 4DVRH 4GG6A 2EXYD 1NFDB 2FL5B 8FABA 2FIKB 1HH9B 3RWCB 2E5EA 3WFEH 1ZA3B 3NZHL 4OI8A 1XIWB 5B8CC 2YEZA 4Q58C 3A6CL 2EDDA 5FHAL 5FDWB 1DVFC 4MX7A 1EO7A 4DKAA 4BFGA 4FTVD 4QXGH 1HNFA 3OXSB 5HVHC 4Q6IB 3LIZH 4JKKA 4AEFA 4FXLA 2I26N 3FQWB 3DMMC 1UADC 5BZWA 5J12B 1NAKL 4HG4J 5KVMC 1S7XB 1WBZB 4PIRF 1FNGB 3VGDA 1G6VK 4RAUB 1U8NA 2W38A 3CC5A 1T0NB 4GRLA 3K81A 5DEFB 1AXTH 4X7TB 1X4ZA 5IP4A 1HHGA 3BPCA 1BJ8A 1QSFD 1PY9A 4K7PY 4FQJH 1C7SA 1W2KT 1T4KA 1UACL 2APVA 3MLRH 2BY2A 4XMKH 5DDHB 5B3JE 4DUVA 4Y2OA 1NGXA 3P73A 4NHCL 5J13B 5JLZB 3L3JA 3SDXB 1BFOB 1T2QL 5DHVA 4NO3A 3MACL 3ULVF 4QRSA 5D7JC 4QY8B 1G7PB 4R8WH 4X6CF 1K5NA 2ITCB 3ARXA 5LCVL 1LP9F 3W0WE 5GZNC 4ZD3H 3E6FA 4NO0A 2NW3B 4HF5H 4N8VB 5HGHB 4CBPA 1A4JA 2B39A 3HE7C 2HJKA 5D5MB 2H32A 4EI6B 2VDRL 1FGNL 4Y5YB 3UTOA 3BJ91 2AEWA 3MOQA 5HDLA 1T7YA 1FIGL 4V1DE 2QSVA 3VXUD 1R5IB 2JTDA 2Z92A 3CGTA 3VFVA 4R4BA 1IAMA 2IF7A 2JE8A 1L7TL 4WV1C 5DEZA 4FXGB 4KI5D 1KJ2L 4R7NA 2NW2A 2KQMA 4XPHH 5I75C 4QYOA 3E0GA 2RAMA 1RUKL 1BJ1H 1NFDA 2FL5A 2NX5D 3MV8B 1NUFA 4JM4L 3RY6C 4M4PA 2FIKA 4WI8A 3V7AE 3HMWH 1IGMH 1T20A 4OZFH 5K9JH 2PYEB 1OAYL 2VKXA 2RGSA 2YPVH 4JREC 5KBNC 4OLXL 2QLVB 4HX1A 2I07B 5FDWA 3ZDYE 4LCYA 3ZE0F 3AU1B 2AEPH 2DQTL 3T0WA 3OXSA 5HHXH 4KPHH 4Q6IA 2GJJA 2MWCA 1NBZA 1DVFD 4N90E 5F97E 2X89D 3FQWA 5IQ9A 2PTUA 4WO4C 5GGTL 1ES0A 4BFBD 3L3GB 3MLWL 3KPNA 4JCLA 15C8L 2XTJC 1NAML 4HHAA 1S7XA 1WBZA 4EBQH 5I9QB 5E5MB 3C5SA 2I9LA 4RAUA 3RRQA 1G9MH 1T0NA 4O02L 5DEFA 2P5EE 2OL3A 4X7TA 2HVKB 5JW4R 1C5BH 1ZWIA 5HI5D 2NY2C 4YHOL 3S9DB 2CUIA 1QG3A 4OZHB 3BD3A 4NHUB 2GK0B 5DDHA 1C12A 2I60H 1MCCA 3QDGE 1IM9B 3UTTD 1T7VA 3SDXA 4P2RB 2RBLA 3VE0A 3P40A 3O4LD 1FAIL 1KB5L 4HLZG 3AUVA 5D96C 4DUXA 4TNWK 5HHMA 2NY7H 4QY8A 1G7PA 1PJ9A 4GBXC 2ITCA 4LSQL 4ZS7H 4POYA 2F15A 4OV6F 5JOFB 4HS6A 3CPLA 2OJZH 3O6LL 3BZDA 4K7PL 3MRGB 3K46A 3QFJD 2OI9B 5HGHA 2BHZA 1NCDH 3V4VL 1MFDH 1U8PB 3FZUC 4HH8A 4JFFD 4EI6A 3QRGH 3VXQA 4Y5YA 3HE7D 4LLWB 1FAKT 3BKJL 4HCRH 5ACZB 4QHMB 3WKMH 5I1GH 4R9HA 4MS8D 3CH1A 2FJGB 1XF2A 4YDVB 5I71C 1A9EB 4KKCC 3MZGB 3WBDA 3G6AB 4OCRH 4FXGA 4PJ5E 5GSVB 5LG1A 1J1PL 1RUPH 3JVGA 1KYOJ 4HIJB 4Y4KC 2DQDH 3IDMB 5EO9A 2VDPL 4NKIL 3NFSL 3Q1SH 4O5LL 4P9HL 2EC8A 1CF8L 2W9EL 3VG0H 1AJ7H 3MV8A 5CEZD 3O2VH 4U05A 4KKBD 4LHUG 2D9QB 1U2CA 4QF1B 4PGEA 2AGJH 5FGBA 5E5UB 1OP5K 5CCKH 3MLTA 2WWKO 3BPOC 3WSQL 1MWAH 1R3HB 4Z95L 3VXSE 3QEQB 5EBWB 5EUOF 1U8QB 2YUWA 2MOVA 5D7IF 2HAZA 4BZ1L 4Z7QF 4JRWA 3UDWA 3L3GA 1DSFH 2I25N 2NXZB 1KEML 2GJZB 5DMJB 2HT4D 3DVFA 1BQLL 1NEZB 5L88H 4G42B 4I4WB 4WO4D 2JJWA 4J3XA 2P5WB 3LN5A 1NL0H 2NYYC 4ONHB 1ZLSL 3CFIC 2VXQH 2HVKA 4K3DL 1BBJA 2YA0A 3NFPB 1YEFL 3NABH 4FNLH 1KN4L 5I66B 3FO1B 3SGDH 3EFDL 4OZHA 3VFWB 1T1YA 3DX7B 2I27N 4NHUA 4Y4FC 1JGLH 2ZCKL 3MRMB 1RY7B 2FB4L 1IM9A 2NY2D 3S37L 1LO0L 4PJGF 4CMMB 4P2RA 3REVB 1T6WA 2P4AB 2VJXA 4OFVA 4L4TD 4QHNB 5I1KH 1LO3L 1ZT7A 2VR4A 2WIIB 3CSYA 1RJLA 4APQC 4UIMB 3VFNB 3UZQA 5E2VL 2GKIA 5IFJB 1IC4L 2OI9A 2R56H 5JIHA 1CGXA 4FQHB 2WIMA 2D0FA 1INEL 1U8PA 5D1XC 3E8UH 4Y16B 4PJFF 3LMJH 2APWA 4N9GB 5CZVL 2J3SA 3G6DH 3UROR 5ACZA 5HGBA 3H7BA 4QHMA 3RJDA 1GHFL 5DGQA 2Y6SC 4QTHA 4R90L 3C60C 2FJGA 4YDVA 1D5BB 1A9EA 4UTAH 4MQXD 2XA8L 1WWBX 5DHVH 7FABL 3G6AA 1EHAA 1T3FB 4NM4L 5GSVA 1S7WB 4HIJA 4KKCD 3I6LE 3EYQD 1DUZB 3QH3B 4NUJB 1GVIA 2ICCA 4Y4KD 3PL6B 2VABB 2B2XH 5I6XB 2YXMA 3BRFA 2ORBL 2H32H 4PJEF 3VXNB 4QF1A 1NCTA 5C6TH 5BS0B 1GJIA 4DOHE 3DO3A 4ZMAT 4JY5H 1KPRB 4C4KT 4U1SB 2DQEL 3BSZH 1R3HA 3JTSB 1MCOH 4ZO6A 3QBTB 3RGVD 2MTPA 4ZOBA 1DBBL 5EBWA 1U8QA 1M71B 3SHSA 4M1CC 3ZYJA 3FT2A 1ZLUK 5D6DC 1CD8A 1QYGL 3P4MB 2GJZA 3BKYL 1S9WA 3HG1A 1NEZA 4JQIL 4G42A 5KOVC 4XMPL 4Y19A 1EHXA 2P5WA 4W4NA 1JZ8A 1NCAL 1PSKL 2OMBA 4M1GL 2XWBB 3B9EA 4RAVA 3HHRB 4ONHA 1VEPA 1IAIH 5H2BA 3T04D 4WWKB 1DDHA 5JHDE 5BV7L 5CZKA 3O3DB 5INCB 3NFPA 3FO1A 4LGRB 5F44A 3VFWA 1A5FL 3DX7A 2YD7A 3CFCH 3H9HA 1XGYL 1U92B 5D4QA 2D0GA 1AO7D 1RZJL 3D2UB 3UPAA 5E2UH 4Y4FD 2AK4D 3FHQA 4HH9B 3MLSH 2EIDA 5DHYB 3GNML 3LKSB 3KYOB 4UIMA 3VFNA 2AV1B 4XH2B 5FGCE 1CIUA 1OAQH 3QDAA 3W39B 5IFJA 1BZQK 3A67L 3HMXL 3MTRA 2K1MA 2LABA 2OL3H 5IJKA 1MCWM 4OAWA 4OSUL 5TF1L 1KENL 4N9GA 5EOTA 4OTXL 1OTSD 2CUMA 4TTDC 2PETA 1VHPA 5D1XD 5D1QB 2MCG1 4G6FB 1ZVYA 4JGMA 5IW3A 1D5BA 1JPSL 5FEBA 4GMSL 3NA4A 1WC7B 2HLFC 3GI9H 1AKJD 4WDIB 4NQDB 3C60D 1T3FA 1S7WA 4J3VA 4XPTH 1HXYB 5I9QC 1KIQB 1BOYA 2E8YA 4N0FB 1EHLH 3MV9D 2L7UA 3PL6A 2VABA 2V2WB 2CJUL 1WAAF 2DLFL 5HDQH 2BNUB 4KMLB 3WDJA 3VXNA 3JUYA 4HW6A 2H8PB 3HI6L 5BS0A 1YNLH 4DTGL 3FAWA 5GGSY 4IMKA 4RISL 5FA4B 3D3VB 4U1SA 1J8HE 1D9KA 5F1IA 3JTSA 3S8WA 1A6VH 3PIQA 3O6FD 1OW0A 3C08H 2VLJE 1M71A 1KCUH 4DAGH 1TDQA 1CXEA 1W8NA 2VZUA 1KNOB 3P4MA 3U0PB 3TF7A 2A9MH 1IZKA 5SV3A 1O7SA 1TVBB 3FFDB 3L5XH 2PW1B 1NSNL 2IBZY 3PUCA 3ZHDA 5ISZB 1Z9LA 2EKSB 3O3AA 4POUB 3V6OE 4LIQH 1HINH 4EUPB 5EUOE 4KV5E 2M8XA 4M3JA 5GS2H 2F5AL 3O3DA 2B5IB 5D2NE 4I5BA 4Z7QE 3N50A 3F7YB 1I9RH 3AFLA 2NCMA 2VDKL 4ZPVB 3WXWL