3WS3A

Crystal structure of h-2d in complex with an insulin derived peptide
Total Genus 63
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
63
sequence length
273
structure length
266
Chain Sequence
PHSMRYFETAVSRPGLEEPRYISVGYVDNKEFVRFDSDAENPRYEPRAPWMEQEGPEYWERETQKAKGQEQWFRVSLRNLLGYYNQSAGGSHTLQQMSGCDLGSDWRLLRGYLQFAYEGRDYIALNEDLKTWTAADMAAQITRRKWEQSGAAEHYKAYLEGECVEWLHRYLKNGLLRTDSPKAHVTHHPRSEVTLRCWALGFYPADITLTWQGEELTQDMELVETRPAGDGTFQKWASVVVPLGKEQNYTCRVYHEGLPEPLTLRW
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords H-2 class I histocompatibility antigen, D-B alpha chain
publication title Compensatory mechanisms allow undersized anchor-deficient class I MHC ligands to mediate pathogenic autoreactive T cell responses
pubmed doi rcsb
source organism Mus musculus
molecule tags Immune system
total genus 63
structure length 266
sequence length 273
chains with identical sequence C
ec nomenclature
pdb deposition date 2014-02-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3ws3A02
3.30.500.10 Alpha Beta 2-Layer Sandwich Murine Class I Major Histocompatibility Complex, H2-DB; Chain A, domain 1 MHC class I-like antigen recognition-like 3ws3A01
1K2DA 1INEL 4NOBA 3PDOB 2BHUA 2WBKA 4GUPB 2GSIB 1B3JA 5E8PB 1YDPB 1T5XA 2C3HA 4M7JL 4Y4FC 1K8IB 4PB0H 3WN5C 2YRPA 5B3JF 1YPZE 1JNJA 1NFDE 3MSPA 4FQIH 4I4WA 1D5XA 5ISZB 4LSVL 5GGRB 2D7PA 5E95B 3TO2B 3U6RB 4NUJA 2XIDA 1Z2KA 3RJQB 1MFCH 2DMBA 1L6ZA 3D6GA 3IFPB 4ZAKA 1TZGH 4NJ9L 4EKXA 4NFBA 4WEBL 3GSUB 3SE4C 3BKJH 4PTTA 4MB3A 4DWHA 1NBZA 4NKDA 3DO3A 4Q9QL 1AD9B 3HI5L 5C0GA 3DVFA 3QUKA 3GSNA 2R0LL 4RFOH 2ZCLH 5C3LD 1UWEH 1OAYH 4HHAA 4ZFZA 3AU1A 1TPXB 3HAEB 5KJRL 2BVTA 3O6FB 3QZWG 2J4WL 5FDWB 3SDCA 4K7PL 1HQ4A 1BD2E 3FOMA 5JW3H 4U6HA 3OG6B 1TVHB 4OD3L 5GJTH 4GBXB 4O2CB 3OSKA 3QXDA 1RZKL 1J0IA 5CILH 5DUPH 2VTFA 3BPNB 3F5WB 4XHJC 1Y18A 4OD2B 1HKFA 3MBEA 1NCAH 1M7XA 3UYRH 1AO7D 4DGYH 2Y4SA 4IRSB 1FLTX 3Q3GB 4FQ2L 3DMMA 4G7VH 4LDOB 5MEND 4FP8H 4Z7WE 4DVBB 3IXTA 5IQ7H 4XB8A 1XCQB 2K3TA 3BSZH 4HH9B 5CGTA 5JNYA 3SKJL 3QUXA 1AR1D 2A83A 4PR5A 5E94A 1GAFL 4H20H 3KPOB 4HS3A 3RAJL 2FX8L 1T83A 1EZVX 4G3YH 5IHZB 2AS5M 1RHHA 3ME0A 1CL7L 4LRIC 4Y4HD 5DFTA 3V95A 3LN4A 3TESA 5D7IB 2DM7A 2IBBA 2AABH 5L2JA 2G75A 3FB8A 2XTJD 3TN0A 4M43H 3TYFB 3MO1B 4HS6A 3BAEL 5HHMB 2D4DA 1ACZA 3P4LA 4TNWF 1NCBL 2HAZA 4IRJA 1OP5H 3WIHA 5JA8B 3BT2L 4YHMH 4F58H 3X12A 3GEWB 3QI9C 1A47A 3WJJC 1NGYA 4KJPD 3ISWA 3ES6B 1CDUA 3QDMA 4H88H 3VCLB 1NC2D 1GPOL 4RGND 4Y4KB 1E6JH 2AGJL 5DJYB 1I9IL 5DD0L 4GW1B 2IH3B 4X0KA 3KWWB 3IDGA 2AEPL 4QXGH 5AAWA 5HGAA 3HC3H 2VC2L 1G6RH 5IHUH 1AGBB 3SO3C 5T3XH 1KULA 3IETB 3L3HB 3P4OA 1S7RB 4P9ML 5IMKA 1QFUL 1ADQL 1YMMD 4O58H 5J4MA 4GAFB 2CIKB 4F37K 5BVJA 5C8JB 1QFWH 4PJ7F 3B8YA 1I1AC 3ROLB 2P5WE 3OKKB 5CGYD 4L3AA 4M1DH 5AUMA 5LGJB 4X99B 3P4MA 1MFNA 1IGIL 4RBPK 1JNLH 3FT4A 4MA1C 3MJ9L 4JQXA 1XCTB 4NQUA 3CFEA 4L8SA 4YX2L 2CKBL 5I17B 3CMGA 3O3EB 3LOWA 1HNFA 2BY0A 3IDJA 4XX1G 3MRIB 4S1DC 1NMCC 4WFED 3PG2A 1G7IB 2JJTA 1JWMA 5CMAA 1LILA 3MJGX 2EIDA 1UZ8A 1YNTB 5D2LF 4WWKA 2NY5H 2WBWB 3SDXF 3FN9A 5GRJH 5J9PB 5HYSA 3L6FB 1YEHL 1J8KA 4PJBB 2XZQL 2X4OA 4LFHD 1VFOA 3PWUB 5J6GB 1JGDA 4ODBD 1HYSD 4Z76A 4MD0A 4HIHA 3FRUB 2W9EL 4LIQE 5LGHH 3UTTA 1UXSA 5GXBB 2I9TB 1CD0A 4RNRA 4E41A 2FZ3B 3ARBA 3QHZL 3RA7H 3VWKD 1IQWH 4KMTL 3O2WL 4EN3D 4I4WB 3AXLB 1WWAX 1O5DT 4X5WB 4NUJB 1SJHA 1RZJC 3RDTB 2OR9L 1YA5A 3AFLA 5A3ID 4OLUL 4NSKB 3VXRE 4X5XA 1F02I 3GB7B 1KBGL 3QUKB 4PTUB 5ADPL 4ZUVB 2QQKH 2UZIL 2YPVL 4HHAB 1Z9SA 3RWHA 2V7NA 5IEHB 1IQDB 2AXJA 3FB5A 2APVA 5GGQH 3VXSA 3E6HB 3IT8D 2CIIA 1WC7A 3FOMB 3GI8H 3OV6A 3QBTB 4P3CL 2VSDA 2VDNL 3SY0B 3AVEA 4PRNB 1BM3H 5K9OA 3O8XC 3D87B 3HR5A 5SWSB 1OGAB 4NKIL 1QFPA 2WIIB 4PJCE 1LP9E 3I75A 4FNLH 5FUZH 1GZPA 3O2DL 3GBNL 4GSDL 4YBLC 1VFAB 5EO1A 4UTAL 5DURD 5DI8A 3RPKA 4Q74A 1J05A 3IF1A 4YHZH 4PR5B 2A83B 5D7JD 3P73B 1IM9D 5E94B 1BBDH 4M93B 4PB0L 4GXUN 1IM3A 3MUGA 4YK4C 4NKMA 4HAFA 4LHUA 3QYCA 1YY8B 2VLJA 4P46C 4LCWD 5JXED 2WAHA 1MFCL 3K1KC 32C2B 2NY1D 3IDIA 5HJ3B 2NY6C 4N5EA 3DRTB 2ARJQ 3EYUH 5B8CA 5L2JB 1OAUH 4QGYA 3ARFA 1CXEA 2AJ3B 4N68A 1V5JA 3T3ME 1CICA 4GW4B 5IJKC 1A7RH 1EUTA 3TCLA 4RFOL 3FQNB 2ZCLL 1OAYL 5EU6D 3QZWB 4IRJB 1WBXA 2W9LA 5CBAA 2GK0A 5EC2A 5JW3L 4GMTH 3Q6GH 4OCWH 5B38A 1T0MB 3ESVF 3HAEH 1WFUA 5GJTL 4X4YA 2FH8A 3C60D 5CILL 5SWZE 2XG4A 2NY4B 5FYJH 1OP3K 4OT1H 3X11B 2P42B 1FPTH 1T3FB 1FFPA 3MV8E 3UYRL 3D0VA 3FO0H 4DGYL 4Z7QF 1FFQA 2FHBA 4P4RA 1B0GA 3QDGB 3D18B 1U93A 4G7VL 3WJLC 4FP8L 2Z31D 4XH2B 4MXVE 3M17A 5IQ7L 1IBGH 3BSZL 2Z4QA 3OB8A 1IC4L 5E8OB 3TBWA 2BNUB 4DUWA 4H20L 3QHTC 3OKOA 1UQSA 1AGCB 3GMMA 4YHKH 2XN9E 3GK8H 2ITCB 4G3YL 5F9JA 5AZEL 5IMKB 3QDJB 4PP1C 3L9RA 2WIMA 3HNTH 3B2UC 1YNLH 1WEJL 4NUGL 5BVJB 4LLYB 3TFKA 1FL5A 4JFYB 4I0PA 2V7HA 3ULVE 1R24B 5IF0A 1XMWA 3PHQB 1DE4A 1Q9LA 4M43L 4HGMA 3FT4B 9CGTA 3SDCD 3UX9B 3WS6A 2DM3A 5IMLB 2RIKA 4PJGF 4ZFFA 3ULSB 1MI5A 1Y6KR 4YC2B 3FFCA 4U1IA 4YHML 2AK4E 4XT1C 4F58L 4OLYH 4LVEA 1AIFB 3KLAB 3VFSA 3SEPA 1SHMA 5TF0A 4JHWL 2E9WA 4OCLC 4WFHD 2IPUK 1S7UA 1I1FA 3DMMD 1GXEA 3WNMA 5FM4A 4MQ7B 4RDQF 4WWKB 1A7BA 2B1HH 1E6JL 3QRGH 1I8MA 5GGVL 3ULUL 1J10A 4JCMA 1L7IL 3QUXD 1U8OA 1TJIH 4XVSH 2KKQA 1YEDA 3TO4B 3RTQA 2UYLB 2EC8A 4WDIB 3ZYJA 1LE9A 4QXGL 4Z76B 4MD0B 1NDGB 5IHUL 5T3XL 4R7NB 5JXAL 2BOBB 4KDTC 2QSCH 2R2HB 3EYOA 4MXWH 1KXVC 4U49A 1HSBB 1I7TB 5EO9A 5GRVK 4MMZC 3PABB 5D1ZA 5FM5M 2DOCA 5CLWA 4O58L 5LBSL 3TN0D 1TNNA 4RISL 3Q0HA 4R4ND 5C0RL 1N5YL 2E8YA 4TNVK 3ZDYE 4KU1A 5IFHH 3HMXA 1P2CB 4EVNA 2UWEB 1BBJA 1HIML 1IC7H 4M1DL 3F12B 3P0VL 3MLRH 5IB1A 1JNLL 1ZMYA 2BK8A 1J18A 3P9MB 5FKPA 5EBWB 4QOKE 4FQJH 4PLNC 3CC5B 1F3DJ 3FFDA 1CBVL 2Q8BH 3DTXB 3FQUB 1DEEA 3DX9A 3QJHB 4Z6AT 4WUKL 3SPVB 4OLVH 3T8XB 3KPSA 2OJEB 3HE7A 3O9WB 2AK1H 4XBGB 3FQXB 5FB8A 1PG7H 3D39D 1YYLH 2PYEE 1JMZA 2NY5L 2GEEA 2HFGH 3OKDB 1T1XB 3NMEA 4KROD 1S7TB 5GGSA 3SJVE 3I75B 4TSBL 5BQ7B 3VA6A 1X5YA 1A4KB 5F88A 3TH4T 1JPSH 4AENB 4OCXL 4POZD 1TMCA 1NPUA 1J05B 4NM8L 1VEOA 4FQXC 5LGHL 4PPTA 4AYFA 4GRLC 5D5MF 3BMWA 1JUFB 5CZVH 3G5XB 5E8NA 5CSGA 4IEFB 4RAVB 4XC3L 2DTML 3HZYA 1X6LA 3RA7L 1IQWL 4YLQT 4TVPH 1TZHA 4U0QB 4UNVA 1T20B 3ZL4H 2XXCB 4HPOH 4XNMA 3RY6A 4EXKA 2EC9T 2AV1A 4PJFF 4EI5C 1VGEH 4HC1H 1T5WB 5EOCH 4YE4L 2QQKL 3UO1H 2B4CL 2A6IA 1BX2B 1U42A 2GSGA 4UQ3B 3NCJH 1KACB 5CBAB 2RCSH 3MROA 1RHFA 3IRPX 5C08E 3LKOB 5DDHA 5FUOH 4N0UB 4ZO8A 4J7RA 1H5BB 5ALBH 3L3OA 3GI8L 4WI3A 4GG6E 2VLME 4ZS6C 1IGJA 3SOBH 5E6IA 4PJHE 1HHHA 3ZKMC 5DK0A 4Y5XB 1G7MA 4ETQB 5BV7B 4G7YH 1OW0C 1FP5A 4R0LC 5EBLB 3D0VB 5GSRA 4FNLL 4OIBA 4KXZH 3E8UL 1U93B 5ICXB 4XVUD 2FB4L 3UTTD 1KN4H 3K0WA 4RMUA 2E7LA 2Z4QB 5FIEA 2VUOA 1JPGA 2IALA 4E41D 1FRGH 5CD3A 3O4OB 3ARBD 3QEHB 1BBDL 3FB6A 1UQSB 2PTTA 5DD6B 3GMMB 3QP3A 3K1DA 3FO2A 1GCFA 1CQKA 3DUUA 2VDML 1F4HA 4X7SH 2A9ML 1I85C 3S34L 3ULUF 3LHPL 1HZHH 1D9KC 4IDJH 3L9RB 2NW3A 3VRJA 4EZMA 4KJYB 1YJDH 2VIRB 4OLXL 1NEZB 1JYXA 2V7HB 5KS9A 1OAUL 5J11B 4HUKB 4M02A 4S1SL 1E0OB 4HWUA 2WQ8A 3PQYB 4PRPD 3RGVC 4O9HH 5GRUH 3VXSD 5JO5A 2YD5A 4HQQL 4OF0A 2VDOH 2AJZA 2XQYG 4CVXA 4MAYA 3S5LA 1DQDL 1A6VL 1R3LB 3UYPA 4GMTL 3Q6GL 4OCWL 2FATH 3EFFA 2OJZH 5HPMB 1JHTA 3WIHH 4JJ5A 3CX2A 1KCVH 5FO7A 4ZFOB 4U1NB 3F7RA 3HG1B 4OT1L 4P9HH 1S7UB 3ZE1E 5I1HH 5SX4H 1FPTL 2RGSA 4IIQC 3FO0L 4KDWA 3OWEA 1I8MB 1DDHB 1NSNL 3QISA 5HDLA 1TITA 2CK2A 3ZDZE 4RGMC 2EDWA 3NAAL 1FORH 1IBGL 1FC1A 3UAJC 3RTQB 4X9FA 2XZAH 4AT6A 4BQ9A 1BQLH 2J8UA 5E03A 2HTKD 2WBJA 4N8VG 4QY8A 1PD6A 4CVZB 2VLJD 3WE6B 5T3ZE 1SVCP 3GK8L 2DLFH 1T1ZA 1I3GH 4MJIB 5A2JH 4QRSB 3KPTA 4JZJA 5KN5B 1A5FL 2P1YA 3HNTL 2IEPA 1U36A 1YNLL 2DWEB 1C08A 3LKPB 5E4EB 2VLRD 4LVHC 3C09C 1CICD 3SE3A 3REVB 2R56L 3G5VB 1CU4H 4K8RH 4PRIB 3L3GA 3P3YA 1PZ5B 4LASL 1BD2B 3UJJH 2CDGB 5E24E 1TLKA 4GKNB 3NACH 4IRZH 2IH1B 3QAZC 4MLSA 3EGSB 3UTZB 2Y36H 4X6EA 3PHSA 4KKCD 3H42H 3ZYIA 3QH3B 4HXAH 3WHXB 1TCMA 3ULVC 5CSBA 3T1FB 5DC9B 3KPMB 2VH5H 2VL5B 4WGVB 2ERJB 5FAAA 5MEPB 1XIWC 1OPGL 5TQ0H 5EUOF 3T09A 4DGVH 5HPOA 3OBAA 5FB8B 4LSRH 1MWAB 4M48H 2FX7L 2YPLD 5KOMC 4APQB 3QRGL 5D7LA 5GGTA 2OX5A 2R1YA 1TJIL 4XVSL 4JFFA 3VI4F 4M5YH 2NY2C 2ADGA 1T4KA 3T2NL 3PV6B 2IG2L 1QLFA 2O26U 1F4YH 3MRCB 2C3XA 4FMKA 4PJAA 2QSCL 3LKQA 4MXWL 4Z9KB 2R69L 2V2XA 3IU3A 3KXFD 4I0PD 1E4JA 4FXGB 1VERA 4WU7A 2GQHA 5DYOA 5CIPA 3U9PL 5IFHL 1NCCH 1OVZA 2APXA 1IC7L 1B6DA 4OZHA 2IFFH 3OKLB 4K07A 3WO4B 1EAPA 3MLRL 2H45A 1S7XB 3BDYH 3OJVC 1MI5D 4K55A 3FFCD 3IXAA 3MLVH 2XQBH 1AGFB 4WHTB 2EH8H 5BRZA 3C8DA 4K94L 5DRWA 2Q8BL 4G59A 4M7LL 1A1NA 4YHYB 1LO3H 3TT3L 3QIBC 5DDHB 5F1KC 4GKZB 4OLVL 5HBBA 4TVSa 5JOEA 3BP5B 3STZB 2OL3A 4LPCA 3NGBC 1MCCA 2VAJA 5TE7H 2KBGA 4DVRH 3VFUA 3RP1A 3OAYH 5JUEH 4P2OC 3B9KC 2HFGL 1R3HA 1J5OL 5GSRB 1E4XI 2EXYC 2GTZB 2VITA 4DUVA 4XNUH 1JPSL 1TQBC 1CFNB 1CGXA 3ILPB 1AJ7H 4V2CB 4S1QH 5D1ZD 5EOQH 1NGZA 1I3VA 3K8KA 3EYSL 3FB6B 1CLYL 3RVTC 1DBAH 4LOUC 4JO3H 1H3XA 5C0BA 5JPMA 3C5JA 3DUUB 1QR1B 1T04B 1U0QA 2H41A 2CMRL 5DJ8B 5KANG 2AKRA 2DLIA 1XZ0A 4X9HA 3ZE0E 5IVNA 4X8JB 3PP3H 3VRJB 3C5ZB 5IVZA 4HPOL 4BKLB 2NYYD 2Z0BA 3M45A 4MGXA 1ZA3A 3H9HB 4G9DA 2P48B 4U6XB 3FQRA 4G9FA 3CX5K 5CEZH 4XI5D 4HC1L 3GJEA 3QB7C 5EOCL 1CE1L 4QCIA 5I8EB 4R4BB 1DVFA 1HSAB 4JAMB 1ZHLA 2FECI 3NCJL 3MRNB 1QG3A 2RCSL 3HE7D 3KPSD 3RBSA 3TA3A 3GSNL 5H37H 5FUOL 3BZ4A 3GO1H 5E2VL 4Z7UA 1F42A 3BZDA 2N1KA 3UTSD 4ETYA 2Y25A 4HKJA 4YDKL 3W0WA 4NO0A 1FYTE 3WFEH 3SCMA 5CCKH 4G7YL 4OI8A 5IK3A 1Q8MA 1DN2A 2VABA 3A6BL 4ZO9A 5HHVH 4HZAA 1NGWA 2DQDL 3IJSA 1DUZB 4LCIH 3LEXA 5BV7H 3AMKA 5DD1H 1KN4L 3MGTA 1IKNC 5FHAH 2VDLH 1FIGH 3X13A 4P5TC 1GVIA 5GQBA 4WI8A 5T5NG 2KZ1B 2VZVA 1FRGL 3BEVB 2X1WL 2J8UB 5C09A 1GC1C 1LNUB 4QY8B 5FECA 3TEUA 3ZT7A 2A6DA 1EFXD 2C4FT 5DVLA 4J3XA 2MPAH 4F9PA 1DSFH 1MIML 2NNAB 4LSUL 3OX8A 3X17A 3RL2A 1HZHL 3ZMRA 4IDJL 2NXZB 3AREC 1C08B 3B6SA 4CRPA 2PW1A 3CSPA 4GRWH 4PJDE 2IADA 2QADB 5JDJA 3WFCH 4G8GE 4GKSA 1DQLH 3L3GB 2P44B 2QSTA 3FB7B 4O9HL 5E9DA 5GRUL 5E6ZA 4F33B 1WCBB 3GGWA 3CH1B 1F11A 3OPZH 2VDOL 5SX5K 2NLJB 2XY1A 4WUUA 3LQZB 3UJTH 5FK9A 1OL0A 2W0FA 2VRAA 1S9YA 4I3RH 3CFCH 2FATL 1RIVH 1P4IL 5C92A 2OJZL 3WIHL 1XAUA 5F96H 1QA9B 4YHPA 1BZ9B 1G7LA 2KZWA 5F1NA 3SE9H 3VA2C 5C0AE 4EIZC 3DX6A 4L8DB 4GW5A 3S35L 1V3LA 4ZPTB 3OF6D 5D7LB 2A74B 1LEGB 1RMFH 2OP4H 2C3VB 1Y0LA 2ZUXA 1FORL 3VWJA 2R2BA 3T4YB 3VXNA 3AM8C 3RI5K 2XZAL 3MUY1 2ZUUA 4N8VB 3FJTA 1BQLL 1JZ5A 1MJJA 3H7BA 5J57B 1DTUA 2XFXB 3HPLB 3RY4A 4PJAB 1WZKA 2ICWA 4X6DE 3V6OE 2DLFL 1I3GL 1IC5H 1SM3H 1M7DB 3H9YA 4DK3A 1TCRA 2Q76B 3DYMA 1N5AB 1UH3A 4WU7B 1EGJA 4KVCH 3LRSB 5CIPB 4J4PA 1BP3B 1PX3A 2IANB 3Q6FB 4V2BA 2MKWA 1C16A 4K8RL 4OZHB 2F9BT 4AQOA 2OR7A 1E4XH 2DBJA 5C6TH 3OQ3B 3JV6B 4HZLB 4MAYD 1MHEA 3HMXH 4IRZL 2DIBA 3IAQA 4GXUM 2D4FA 2WK2A 4OUUA 2CD0A 4XWOD 2JB6A 4H26A 3E2HA 2R4SH 4QRPA 2Y36L 3MTRA 3H42L 4JRYE 2XWJA 2VWEE 2VH5L 3B2VH 2ZOKB 1X7QB 1TIUA 3ORJA 5C07A 5D1XC 4LVHB 5TQ0L 3NZ8A 4DGVL 4GS7B 4O51B 3VXPA 4LSRL 4ODUA 3NIFE 1FNGA 3B9AA 1JWUA 1ZVHA 1RK0B 2VKWA 4TPRH 1DUYA 4Y5YC 4V1DA 4XP6L 1P4LA 3PP3K 3WMSA 5KSVA 3NZHH 4NO3A 4HIIA 4WHYH 5D9SA 3FCTA 1MHCB 1MWAH 2WBJD 2VITB 4M5YL 4YDLB 5C9KA 3MV9A 3QG6A 5L2KB 3L3IA 4J3UA 2UVEA 4X9IA 2V5YA 5BO1H 1ZANH 1T1WB 5TDPA 1G7PB 4ZSOB 4HLJA 1JBJA 3R1GL 3GMLB 1K4DA 5GS0H 1I7RA 1NGZB 4RMQA 1N2RA 4YR6B 5C0EB 3MRJB 3K80A 4XCNA 4RAUA 5F21B 3C5JB 4ZNCD 3EHBC 3HZKB 4I77H 1P7KA 1W0YT 1XGPA 4P3WA 5FHBH 2RR3A 3KYMA 1N6VA 3MRLA 4U0RC 5DHVB 1CGVA 4R4FH 2FSEB 4QO1A 2R2EA 2IFFL 3EYVA 1KCKA 3GMPA 4WJ5B 4WW2C 1FN4A 1AE6H 2ZUQB 3BGFB 5HD8D 4XCEB 3BQUA 4G9DB 1OAXH 2NY2B 3BDYL 2GT9A 3CFBB 1RZGB 3FQRB 3QO1A 4G9FB 4I2XE 4Z95H 5E99L 4OM0H 5HYFA 2XQBL 3GJEB 4LQ1A 4KMQA 3L3KA 5INDA 2E6PA 1KN2H 4X4XA 1RVFL 4KI1A 1J88A 3M1BA 4D0DA 3IFLL 4HH8A 1RJLA 4PJ9D 3CK0H 5CP7B 5CS7A 4PJXE 5KZCD 4X7TA 3W5MA 5F9WB 1MCFA 4LMQI 3CPLA 4NQXA 5KSAB 3DURA 4ONHA 1NLDH 4NNXA 1PSKH 1CDJA 1UYWH 1I8KA 3VFOB 3KPLA 5DA4A 5FDYA 5TE7L 4MS8A 4DVRL 1X9QA 4JFFD 4Y2DB 3HR6A 3KJ4C 1W0WB 3U0WH 3QNZA 1QR4A 1X4YA 3JV4A 3ET9F 5FKAB 4TN9A 2VABB 3L3DA 3QQ3A 3IJSB 5DVKA 3HPJB 4MXQC 4Y4FA 4XNUL 4PJEA 3MGTB 3WN5A 5D8JH 5HGHB 3TBSA 2FWOA 3O4LE 1I8LC 5DZOA 5JHLH 3PF2A 4MVBD 4XHQA 1KIQB 4H8WL 4YDIL 3RWEA 1AJ7L 1A9BA 5IB3A 3RL1B 5C0JA 1AQDB 1A3RH 1EVTC 1MH5B 4JCLA 3BO8A 1VKXB 5D2NE 4GJTB 1N6QH 4XBEH 3NGBB 2WUBL 2YK1L 1ZT7B 1B9ZA 1RUKH 3SE4A 4O5LL 3RL2B 5DD3H 4OUOA 1G1CA 3MNVA 1W72B 2D7QA 1MIEL 4F8TA 1UEYA 2ZUSA 5IROA 1S9WB 4OF8A 3FONA 3BPLC 1FVCB 2XY2A 4NCDA 1HH9B 2VYRE 5BRZD 3NN8A 4YGAB 3TGXA 4YHLH 2X4QA 1UJ3B 3HI6L 3V52H 4NHCH 4NYLA 4JREC 4WNQB 5D7KE 3GGWB 1UVQB 2WZPD 3U82B 5ICZA 5FK9B 1LO4L 4OZFG 2W0FB 3GO1L 3D3VD 3D0LA 2CDFA 5JOPD 3CXHK 2AI0H 3H9ZA 43CAA 4HWBA 1ZWIB 5EORH 5BS0A 1J0ZA 1MAKA 5ADOL 3KPPB 4NOFA 3V5KB 4L1HA 2DJSA 2OTUA 3LS4H 4MJ5B 4LCIL 1FFNB 2A6JA 3VXMA 5DD1L 1J7VR 1MQKH 2DMCA 4GBXD 2VDLL 5KOVC 3DX8A 4JHZA 1RAMA 5C0BD 1KCRH 2FIKA 2YD9A 3OKNA 3G9AB 2IPKA 4H25A 4ZUSA 4UV7H 2BFVL 3MOAL 1MCRA 1T2JA 2MPAL 3CGTA 1DSFL 4NHUA 4P4KC 5I9QC 1TCRB 2DQHH 4HMEA 1M6OA 2FJGA 4CMMB 1M71B 3LSOA 4M8QA 4U7MA 1CLOH 2W0PA 4JPVH 5C08B 4I18C 1DQLL 1DVFD 1XT5A 1BQUA 5C6WH 2BSRB 3IU4H 3TA3D 1KNOA 4BQ6A 3P9LB 4QHLA 3SKNA 1GJIA 2BZDA 4OUUB 2CKNA 4H26B 3WJJA 4K3JH 1MJ8H 1RZ7H 3UJTL 3WUZA 1RUPL 3V5DA 3W0WD 4NO0D 5HDQH 4NC1E 4YXHH 3CFCL 4IBLT 1RIVL 3PL6C 4FTVB 2VDQH 1MELA 3I50H 5F96L 1CXHA 4F7MB 1YC7A 3F62A 3SE9L 3TZVC 3NZ8B 2R2CA 3VXPB 4PGEA 4FA8A 3T08A 1VFBA 4GG8B 2X7LB 1FNGB 4C58B 3RVWC 4YNYA 1KELL 1SEBA 2NXYD 2YD6A 1P4LB 4NQDB 1KJ3H 2H2PD 2D0HA 4NN6C 2YS4A 5CINH 5C09D 1OB1A 5DA0B 3MV9B 4Z0XA 2E6QA 3L3IB 1OLZA 4ODXB 5GGTH 3VXUA 3AS2A 2CR3A 2X4RA 2YZ1A 1WF5A 3VGAC 1I9JL 3MZGB 1A9EA 5C70A 4WHDA 1I7RB 3FHQA 4FQHB 1CG9B 3VRIB 1I1AA 1A1OA 4XCFH 2J12B 3HKFA 4K71B 1FYHB 1N0XL 1KB9J 3PHOA 3QCUH 4MAUH 1RZIA 3EYFB 1MLCB 3K8LA 3KYMB 4AM0B 1WK0A 1ZHKA 3LQAH 3QQ9D 3L5JA 2R2EB 2KH2B 1P5VA 3MLSL 1E4XL 5EUKA 1X5FA 3WFBH 3BQUB 5CIPH 3QO1B 4WUUD 1EEYB 1DCLA 3V6OC 3C6LB 3HMXL 4ONOA 4LCUA 5LAXB 4RMTA 1I9EA 3WNKA 3L3KB 1N59A 3SKUD 2MHAA 3NCEB 1HHIA 1PDKA 4ELME 2A9NL 1T6WA 3NH7H 3OL2A 4NN5B 5D2LE 1ACYH 1H8OA 4P23C 3PP4H 4JFXB 3SDXE 4ONHB 4JY5H 4MB4A 2DIAA 1I8KB 3LV3A 4Q9RL 2FO4A 4GQ9L 5DRXA 1ED3A 5FUCE 4D9LH 5IP4A 2ICWI 3H6JA 3MOBL 3VWJD 3TNNA 3QUYC 2OL3H 2PO6C 5EZLA 2VN4A 3HC0A 4F7CB 1IGFH 5FOBA 4Z78B 3KPRA 1E27A 4NZRL 1HI6A 4DFIA 5F1IB 2VWEC 4PJEB 2EXWC 5BO1L 1I4FB 3BP7A 2FECL 3ECBA 1CVSC 2WQRA 1OT2A 2AXFA 4DKDC 5GS0L 1A9BB 5C0JB 3L1OL 4WFFE 2BNRD 1KIPB 1LO0H 2NQCA 4J4PD 2NR6D 2H3NB 1QEWB 4I77L 3RVUD 2BOCB 5EU4B 2FEDC 1FZMA 5F72S 1RJZB 4JFHD 3ARGC 1GZQB 2ESVE 5ICYA 2BVPB 3MNVB 1T1YA 3H9SE 4CW1B 3UEZA 2VZSA 1OAXL 5ESVB 5D7JC 1ZHBA 4OM0L 4HWZA 3Q1SL 3NCBB 1HQRB 4P5KA 4CJ1A 2BNQA 1U8NB 5IOPB 4A2LA 3CFDB 3AC0A 3QG7H 2ZOLA 3CK0L 5C07D 1OAZH 5FA4B 3O8XA 5GISH 5ICZB 5LXGH 2EO1A 4YUEH 5BJTA 3QEQD 4M4PA 3WNNA 2Y7QB 1EO7A 1PSKL 4V1DD 4BELD 3U1SH 3WFHA 3BDBA 4Y19E 2B1AH 2VQTA 4H1LG 3MLXL 5I73C 1A7PH 5ID1A 4PJ5E 2WANA 2PETA 4I48A 4HUVB 1KFAH 2HKFL 2VO5A 3JTTA 1JGVH 2EDJA 4PP2A 4UILH 4FFEX 1JNHB 2QQLL 2OTUB 1HH6B 2X40A 4P2QB 2UUDH 1ZTXH 4F3FB 4OLWL 5D8JL 1JZ4A 3BYYA 1NBYA 4MHHI 4GLRI 4XAWH 4N0CC 5MERB 3EDDA 2D7OA 4M1CD 3MRHB 4RCAA 5DJ2A 5AD0B 1J8HE 4P46A 1A0QH 3QIUC 1KB9K 5DZLA 5C0FA 4XBEL 1BJ8A 3RWFA 1N6QL 2DL2A 1S78D 2EYRA 1G0XA 2HWZH 1ZEAL 2XQYK 4HLZG 4L3EE 1KC5L 4JGMA 2JJVA 1QSEA 2ATPA 2P8LB 5DD3L 4EEEA 4RA3A 5IJKA 4CNIB 4Z7VE 3UDWA 4MNQB 1DP0A 4PRAA 1NFDA 4R6UA 5DFWH 4PDCE 4ZD3L 5JHDA 4F37F 4YHLL 1W72H 5D2NC 5FXCH 4ZMAT 2PKDA 1KNOB 1WV7T 2ZWLT 4NHCL 4PUBH 5IESL 1NMAL 4BK5A 5IB4A 3FO9B 2ZJSH 3IJYA 4ONFL 4U7SA 4MS8D 3MNZB 4NRYA 1CT8A 2AI0L 3G6JA 5FEBA 2AEWA 3HFMH 4KK6C 1KCGC 1OP9A 3TIDB 1XF5B 5FYKE 4BH7A 3S96B 4Y4FD 4F7EA 2Z35A 4OZ4A 4YHIA 2MCPL 2X41A 3UZQA 1MAML 2VAAA 2EDXA 3P11H 4X6CE 3GJFA 3BWAA 2YUXA 2DS4A 1NBQA 1M1SA 1EJ6A 2XA8H 1Q38A 1MQKL 4PGBB 5I66A 2P5EB 1OB1B 4JVWA 4LLWB 5GHWH 2V2WB 1X5KA 3CUPB 2P46B 3G08A 1MSPA 1XEDA 1VACA 3HNVH 1KCRL 5BZDA 5MEOA 1FSKB 3IFOA 3KYNB 4Z7WA 2BY2A 5KSBF 2FBJL 3UBXG 2Q87A 2JK5A 4LPUA 3QXTA 1JF1B 2FL5A 2DQHL 2ZG1A 2DYPA 3S37L 2HJFA 1NANH 2F19H 3HE6B 5F9DC 2F53B 1NGXB 4HJ0C 4JPVL 1ES0A 5E5RB 3QNYA 3VW3H 2HKHH 2J2ZA 5MI0B 4HUUA 1EGJH 1I9RH 4LPYA 3PGFL 1TTGA 5FFLA 2HJKA 4XHJD 1WIUA 4KV5E 2EC9U 5FYLD 2NY7H 5HGDB 4LLMA 5JZ7C 1G9MH 4OZGA 2X10A 5HYJB 4K3JL 1MJ8L 1RZ7L 3EO0A 3P0YH 1LD9B 1RULH 5BS0D 4N0YH 5KBNC 2AXHA 3RZCC 5J6HA 5K9JL 1A7OH 4KRMB 1DQTA 3BOVA 3I50L 3T04D 4OGYL 4JFED 4Y7MA 5E56A 5EWIH 4BSVA 5FGBC 4UMGA 4NN7C 4A6YB 1PJ9A 2IAMB 3HMWH 5C2BH 3LKNA 4NNPH 5L6YL 1VEMA 2BDNH 1DQQA 4JZNA 3SDDB 3VXMD 1J1XH 1Q9WB 2Y06H 3T2OA 1ED3B 3AY4C 5J1SC 3TVMC 1BPVA 1BVLB 5EZLB 1WICA 4NRXB 5CINL 4LP5A 1FNHA 4NC1C 4UDTA 4QRRA 1OQOA 1XGTA 4U1MB 1C12B 4KDTA 5GGTL 2A1WH 3B8SA 3ECBB 4BZ1L 3INUH 5K59F 4HV8B 1KLUB 1KJ2B 4NQCE 5IVOA 4KGLA 5ACMA 4XCFL 2FBOJ 3MRGB 1PY9A 1HINH 3TO4D 3QCUL 4L9LB 4HUWB 3UJIH 4HIEA 4KAQH 4RFNB 2G60H 1ZA6A 4E42B 3WLBA 2HVKB 5GPRA 2QEJA 4KTEH 3WFBL 3MGOA 3QI9D 5F7MC 4D9RD 4YZFF 5DJCA 1A2YA 1T7VA 4HWZB 2P5WA 2VSCA 3FOLA 5B39A 2ITDB 4NKQB 5HHOE 2BX5A 1D5BA 1RIHH 3NH7L 2ZOLB 3I02B 3MV7E 5I19L 1I1YA 4OM1H 3BHBB 1ACYL 4GH7B 1NBVL 3PP4L 4LPXA 4JY5L 5E2UL 3OR6A 4XBPA 1IEAB 1FV1B 2I27N 4D9LL 3ALPA 3ARSA 2OL3L 1HXMA 5KS9F 2PW2B 1H15A 3V9FA 1IGFL 2EYSB 4KRPB 4PP2B 1OY3B 4N9OB 4FQXA 3HI1B 5F3BA 4KFZC 1QACA 3ERYA 5T1LB 3A0OA 2I07A 4HBCH 2VE6A 4XXCA 1AR2A 5HDBF 1I1AD 3TBVA 3EO9H 3QCVH 3NABH 4M6MH 3BKCH 3W82A 3QEUA 5FUCC 4WY7H 3RX8A 4QWWC 1G9NH 3LRHA 5ERWB 4QHNB 5C0FB 5E00B 1AKJA 3QA3B 3VFWA 5L8LB 2QKIA 3NPSC 1HHGA 3PXHA 5EC1A 4PRHE 1QFHA 4NO2A 2O5XH 4C56A 4YEFA 4JPIA 4EI5A 2L0DA 5C0CE 3OXRA 2FIRT 2YSSB 5TE6H 4W81A 3BIAX 1D3CA 4PRAB 4S1DD 5LCVH 4BSJA 2Q86A 3NCYS 4WV1C 3WDJA 5ALCL 5JHDB 4LLVB 4QRTA 4RQQB 2L7UA 2IQAA 5CBEB 1I7UB 3QG7L 4M9OA 2XWBB 3VXRA 4D9QD 1Q9OB 4UNUA 1OAZL 1BOYA 2FD6H 5LXGL 4LLDB 4YUEL 4ORGB 3WKNA 4E0RA 2I60H 3PIQB 4YDJB 4WCYL 1OW0A 2APBA 3F6IA 3QIWA 4AG4H 4R0LA 4OZIB 5D1QC 3U1SL 4H1LB 4TRPL 2WLZA 5DWUH 3MLUL 3BVNA 4MLIA 4F15B 2VLKB 1K3IA 3KPRD 1MFEL 3OJMB 2AP2A 1U8LA 3RGHA 1K3ZA 2Z35B 2W91A 1KFAL 1KIUA 1R0AH 3FN0H 1U9KA 4HWBH 1JGVL 4HGWB 4PYHA 2AJXH 3GJFB 1H3WM 3DRQB 2V2TA 5KSUB 1IT9L 4R2GC 2EDQA 1ZTXL 2JCCB 3WNOA 4U3HA 4ODVH 2C1OA 5I1EH 5I66B 5DLMH 4XAWL 8CGTA 4PJCA 1LP9A 3C87A 1I85A 5BZDB 1KTDB 3L7FB 1HWHB 3B5HA 2XPGB 1D9KA 5EPMB 3RIFK 4L3CB 3WDIA 3RUGB 4NO5A 3BJLA 2E9BA 3Q5YA 4IMKC 5IWLC 4GXVH 4WO4C 4L4VB 3S9DB 4RWYL 2DYPB 4FZ8H 1C1EL 4RZCA 1I3UA 5T3XE 4OCMC 3RGVA 3N06B 2GUOA 5DJ0B 2P24A 3ZE2E 1EK3A 3WCYA 1QSFA 3MYJB 4HT1H 2HTKC 5F89B 3KLHC 3O8XD 1K6QL 4TNVF 5IBTH 4PUBL 5DGQA 2NX5E 4HUXA 1YN6B 5HYQA 4XMKH 1X4XA 1IGML 1U91A 4PREA 3EO1A 5KVDH 2HJLA 1F5WA 3IDYC 2ZUTA 4K7FA 4GFTB 1H0DA 4IIQA 4G6JL 4ZUUA 3PQYD 5J89A 4KRLB 4DZBA 3ROOB 3DXAE 1VCAA 4P57A 3LKNB 4N1CA 3F65A 3LKRB 4JZNB 3GSWB 1KPUA 4OKDA 1V3MA 3LAFA 4JDZA 2X1PA 3S4SG 3P11L 3PWPE 3IVKB 4X9GA 5SWZA 3K81A 1ZV5A 4LAQH 2AJVH 3MR9B 5GHWL 2ZUWA 4HK0A 4P46D 3PGDB 3MV8A 1RZ8B 5HHXH 2YWZA 4HKXB 3QFJE 3MA7A 2NY6D 2PYFB 1XGQA 1OWWA 4NM4H 3S35X 4JFDA 1EPFA 1F4XH 1ZLSH 4LARH 3DROA 2JJUA 5DMKA 4OTXL 4S0UC 1JP5A 1RD6A 4PJ8C 1KGCE 3KDMB 4RMRA 4HKZB 2AAVA 4WI9A 5DD5L 1QBAA 4MZ2A 1EGJL 1I9RL 4F2MB 2BC4A 5EDXA 5DJCB 3VD9A 5I2IB 1A14L 1EIBA 4KUZH 2G5BB 1UA6H 3GKZA 1R3IH 4G5ZH 1D5BB 1XIWA 5J56B 3HUJF 1NGQH 3P0YL 3HS0A 3C8KB 1RULL 3R8QA 4N0YL 2X4PB 1BD2D 2VZ1A 4YXLH 5EWIL 1KLGB 2HVJA 4XZUA 4K23H 1BFOA 3HMWL 4NNPL 2QSVA 1GOHA 4NCC1 1J1XL 1QSVA 3MJ8B 3HLAA 3OGCA 3O6ML 1H15B 3KS0H 4DW2H 4PP1D 2BVEA 3RU8H 4EUPA 5F3BB 3B2UD 5CAYB 4M7ZC 4Y1AE 2I07B 5F7WC 2CO6B 5DMIH 1PKQB 2A1WL 2P8PA 2R15A 4HEME 3ZTNL 3MBXH 1CE6B 2YKLL 2JELL 3DUSB 3INUL 3OJDB 2ENYA 2FO1A 5JPNA 1X5HA 4NGHL 3OKMA 4Z7UF 5JDSA 5T5FH 1EX0A 5IM7A 4NN7B 1AKJB 1QYGH 3VFWB 1YYMH 2Z8WC 1LEKB 5HGGS 3UJIL 4LEOA 2EEBA 1V7ML 4LK4A 5BZWA 4JPIB 1GL4B 3OXRB 2JJSA 3WSQH 3T2PA 1PBYA 1P7QB 1SJXA 3VH8G 3W5NA 1IAOB 1R3KA 4EXPX 5EULV 4RDQG 5JORA 4UQ2B 2R8SL 4QRTB 4R97C 5KTEH 4LSSH 3WFZA 3MRPA 3KS0J 1MVUA 5ISZE 1BIIB 1JJUA 1U2HA 3MLYH 4ZTPH 4NWUH 1ITBB 3GSRA 2WWMC 5ETUA 1NDMB 1FZOB 4OM1L 4QOKA 2MWCA 4E0RB 4P2OA 1C5DB 1EEZB 2ATKA 2X09A 3B9KA 3K7UA 4MJ4A 1BVZA 3QIWB 2GFBB 2QLVB 3GUTA 1FO0B 3K2MC 4WTZA 3BP6B 1K4CA 5I1KH 5IMMB 3LD8C 5AG8A 3DIFA 3ARDB 3U9UA 1JZ7A 4URTB 1OD7A 3NTCL 1F8TL 1T0NA 4JR9H 2ADJA 3V0WH 2Y9RT 4PJ7B 2NY0C 3CDGB 5AAMA 3VFPB 5FYJE 1NLBL 2PYEA 3DBXA 3QFDA 4K7PY 3RWGA 3Q48A 1YEKL 4PJIE 2V9QA 1Z5LB 2IBZY 5BXFA 2YA0A 3EO9L 2GJ6A 3QCVL 4M6ML 3BKCL 3THMH 5F8QC 4WY7L 1RUQH 5FCSH 1G9NL 2XKSA 4M61B 3GIVB 2C5DC 2EDDA 3IDXH 4R90H 5DZNA 3BZFA 5CFHA 3T3PF 1PW3A 2O5XL 4EDXB 5ILTH 4JM2C 4BFIB 3WXVH 1PY4A 5I8OH 4JDTL 4RA0C 2GUOB 2P5WD 5EIVA 5B3NA 1CXFA 5TE6L 3BPCB 3DV4A 1H9VA 2F54A 4HCRH 5D2LB 2NY3B 3OKEA 2X4TB 3MJ7B 1QSFB 4G6MH 4QHUA 5IB5B 3SDXB 3T77B 3LKSA 5I6XC 3A6CL 1JRHI 4HUXB 4O2FB 5HYQB 4UT6H 2X4NA 4Q6YA 5D7IE 1U91B 3MGAA 4PREB 2FD6L 3PDDA 15C8H 1HWGB 3ALXA 1BFVL 4XCYA 2XWTB 1EXUA 4PGDA 4NKOA 5HHME 2QQNH 3PWVB 4FQXD 3SDAB 1IKNA 4GG6A 4GRLD 4F7TA 1G84A 1X5LA 1JPST 4JDZB 1LGVA 4IS6B 3FN0L 4P5TA 4H1LH 4HWBL 5F6IC 3MNWB 4PJHA 2AJXL 3VFTB 1U8KB 1SY6H 4JPWL 3STLA 1FL3A 4ODVL 5I1EL 4HK0B 4RIRA 4FQLL 3GJFH 4JRXA 4Q6IB 4XWGH 3MA7B 2IPTH 4IDLA 4XB7A 3AB0C 2VZUA 1CFQB 4W68A 4JFDB 2BY1A 3H9SB 1KENL 3K4AA 2FYYB 4KI5E 4EI5D 1HE7A 4X4ZA 43C9B 1U3ZA 1JHKL 1Z6JT 3BI9X 4H0IA 4R9HA 5DMKB 3MXVL 1DBJH 1AGDB 1A4JB 2ZUVA 1UJTA 4JKLA 1ULVA 2VDRH 5EIIB 3TJHC 2PXYC 1QRNB 2A6KB 3C2AH 2DQJL 1NAKH 1A6AB 4ZS6D 5IQ9A 3VXRD 4OIIH 2F8XC 1LO2H 4MB5A 4IHOB 5IBTL 3ZKMD 4ACPA 4KTYA 3MMEB 4PGZA 3GSOA 4NPYA 3T65B 4XMKL 4LVNB 5C71A 5KVDL 2QADD 4P2RE 4D94A 3CZFA 1U58A 5IVXE 1P1ZA 3CDCA 4JFQA 3VG9B 4F7PA 3GKWH 2X9YA 5C1MB 12E8L 1BWWA 3ZKQD 2VMFA 4K9EH 4QNPE 1A6PA 4R7DA 3S4SB 3C9NA 1RU9L 5C7XH 1U3HA 4MCZA 3AM8A 2AEIT 4XNZC 3CFKB 2DQCH 2G9HA 4BUHA 4N8CH 2Z93A 3IDMA 4BFGA 1CGUA 4LAQL 2FGWL 1R5VA 2Y5TB 1D9KD 4L29A 3WD5L 4NNYA 5HHXL 1QLRB 4PJFA 3D2UA 1WAAE 1A6WH 2J8HA 4NM4L 1A1MA 3ZKNC 3QWOA 5JQHC 3IDYB 2G5RA 4OQTA 4R8WH 3AS1A 5DK2A 3ZT5A 4U1JB 1DN0B 1T7XA 3O45B 4LHQB 4HXBH 1UACL 1ZLSL 3U0TA 3RGVD 1C7TA 4L4TA 4R96A 1MJUL 5AWNL 4UAOB 4RX4A 2I9LA 4Z7NF 4PJBE 3D85B 4HIJB 3EKCA 1W0VA 1VADB 2DQEH 1MCEA 3FQTA 2NY5C 5T1KA 1JHLH 5IJVA 3UXFA 4LKCB 4ZDHB 1F4AA 4TVPE 2CXGA 4CDHA 4FS0A 4RMSA 5MEQB 3F7VA 2VXVH 2CKBB 4KUZL 5M7QA 3AGVA 5JIIA 1R3IL 1I7ZB 1GIGH 2JTDA 2W60A 5DRNB 5D1XA 3EDKA 1NGQL 3JV5A 3RWIB 5DJ6A 1UXWA 3RWDB 1QKZL 4M3JA 4PRBA 4YHNA 4B50A 3U2SB 5L8KB 4LLQA 5ANMB 3UAJD 4ZQKA 1FH5H 2LV4A 5HD8C 5JMRA 3TBTB 1WFNA 1CD1A 2BVQA 4MD4A 1IC1A 3IDNA 3MV8D 1T0NB 1KEMH 2ADJB 4JN2B 1P9MC 3ZHKA 3OHXB 4DW2L 3GI9H 3T0EB 1X5ZA 3HRZB 3M8OH 1LDPH 3DBXB 3RWGB 5DMIL 4TUOA 2OBGA 1MCBA 1JRHH 1UGNA 4X6FB 5BXFB 5FGSA 1Q72H 4C59B 4OB5H 1G7HB 2GJ6B 3RVVC 3N50A 5IG7B 3Q5OA 5SWSE 4PJGB 5BOZG 3LDBC 4KQ3H 1OGAE 1SJEB 1GOGA 1YN7B 1UWXK 2XN9D 3MRDA 4LVOC 2J6EA 4RAHA 1FNFA 1MUJB 1YQ2A 4WW2A 3JUYA 3ZKXC 1EMTH 4NQSA 2X9WA 1OGTA 3ARQA 5IT2L 4QHKI 3CFIC 1RZJL 2W59A 2OS7A 1QLEL 1PYWA 2YD8A 3ULVD 3WSQL 2XACC 3O3AA 3VH8B 4YBQC 1AHWB 1JYWA 1OF2B 2HLAB 4N5UA 1XIWD 1RK1A 3BIKA 2EO9A 3EJYC 4M6OL 5DJDA 2UV3A 5KTEL 2L4OA 4LSSL 3MCLH 5HY9A 3I6LE 1LDSA 4MDIA 1WBYA 4X6BA 4ZTPL 3G5YA 3BW9B 5D93B 4AL8H 2Z92A 2AK4D 2ZCHL 2NY2D 3KGRA 4QRQB 2E3VA 4XCYB 2ARJB 5I1KL 1HCVA 4MXQA 4PLJC 3FTGB 4JR9L 3IFNL 1CS6A 1FO0H 1PFCA 1Q9KB 4J3WA 5HHQA 4NQCB 3H2WA 1OHQA 1KUMA 4TUJB 5L9DL 1XF2B 3STLB 4OCYL 4OZFA 1L6XA 3ZDXE 5ECJE 1C7SA 1F6AA 1F2QA 5GS2D 4DK6A 4ZODA 4JRXB 2AV7A 4QHMA 2ILLA 3QDME 3G6AA 5EU5B 4CADA 1FNLA 3W9DA 1TPXC 3RWCB 3JTCA 3QDGE 3O6FC 2BRQA 4JPKH 1U2CA 2Z91B 4JDVA 2HH0H 4PY8J 1XF3B 2NW2B 5ILTL 1D5ZB 3WXVL 4ZXBB 5I8OL 4GBXC 1KYOJ 4XNQA 2FR4A 3EOBB 2CJUH 2R1XA 3QIBD 4J8RA 3BPNC 4NJ9H 4Z77A 4WEBH 1ZLUK 2D31A 4KKBC 4G6ML 2ADFL 5J12B 5KVGH 1IAIM 3BGAA 4H5SB 3BH9B 2WMPA 4IRSC 3HI5H 4NQEB 4QOKD 3QDJE 2NTFA 2CLVB 3B9KD 2R0LH 4M00A 2E7CA 1HDMB 4KC3B 1ZGLB 5DRZA 3U0PB 1G7JB 1NEUA 5E7FA 3QSKB 4JQVC 2EXYD 1P1ZB 4FG6C 3VG0H 4OSUH 4P5MA 4JFQB 1NC4A 4RGOH 5D5MB 3S3PA 1AC6A 1A6TA 1RZKH 2PYED 3C9NB 1T66C 1U3HB 3KPQA 4UINH 3MLTB 3NFPA 4LOUD 2G9HB 4ZOAA 2Z93B 3AUVA 1SJVA 3SJVD 4CBPA 4JKKA 3BUTA 1S9KC 4FQ2H 5AEAA 3BDXA 1FFRA 7CGTA 5CJ5A 2E6JA 4PJFB 3BKYH 4AIOA 1B4JL 4P4KA 2IPTL 4X7FC 5I1AB 5IR1A 5B22A 4ZO6A 1YEFH 1FBIH 4FMFA 2ZZUT 3WHE0 2Q6WA 3PUCA 5HI3C 4DN4H 2AXGA 3U4EB 3QUZB 3MCKB 4L4TB 4R96B 4I18A 1QVOB 3UP1A 2FX8H 4LFHG 3E6FB 1DBJL 4YGVA 1XR8B 4PS4H 4UTBL 1AXSB 2VDRL 3CVIL 4WTWA 5DEFB 2AJSH 4JO2H 4UOW0 4Q2ZA 4OIIL 4W4OC 4PV8B 4QF1B 4KI5C 4DKEL 4PJDA 2EKSB 3C5SB 4Y4KC 1CDYA 4G8GA 3BAEH 4PLOB 3PL6A 3S37X 5FYKU 4LF3A 1WBZB 2NZIA 4FHBD 2W60B 4LAJH 1NCBH 4ZPVA 4DQOL 5ACZB 2DQIL 1T21A 5C08D 2GAZA 2D7MA 2UWEE 1U8HB 5FA3B 5FM5O 4YPGB 3T4AB 2VLMD 4P5TD 1KIRB 2X89A 4ZQKB 2LABA 4HJGA 2J7LA 2COQA 4K9EL 4NWTL 2C7UA 4U1GB 4PG9B 5C7XL 3RWJA 4S0TD 2ZUYA 2Y5EA 1I8IA 4MD4B 3V0VB 4IOIB 2OQJB 1Z3GH 5HHPB 1SBSL 5C0AA 4XX1E 4U1SA 2AGJH 4ZNEA 3OXSB 1IZKA 3ARED 4KWUA 1E4KC 3SKMB 4D8PA 1J0HA 5A16A 1A6WL 4PV9A 2BVUA 4KTDH 2GTWB 3B9VA 1MRFH 1Q94B 4R8WL 3SQOL 3FAXA 4WFGE 1XH3A 4I9WE 3MRDB 5ITFA 1IEBA 4Q7DA 1KYOK 3VFVB 5IFJB 2XI9A 4NQSB 5I76A 1VGKA 2DQEL 3TM6A 3FHAA 4X6DA 3V6OA 1JHLL 3HCVA 2BMKB 4RRPG 3S88H 1PYWB 4OKVA 1IE5A 1RPQA 1IL1A 1UZ6F 3VD3A 3O3AB 4ZFGL 4YXKL 2KPNA 1KT2B 1MJ7H 4EN3A 4ZUWB 1RK1B 1WT5C 1UKSA 1V3JA 1ZVSA 1IGIH 3P4NB 5DJDB 3QXAA 8FABB 4LSPH 4P23A 4KJWC 3MJ9H 3PJSA 1ETZB 1NUNB 5CEZE 4M7KL 3WO3B 1N64L 4TTGA 1T2QL 2CKBH 3DHJA 5L7XH 3G04A 2WY3A 4U1LB 2FJFA 2Z8VC 4BH8A 2DKMA 3O3UN 3QUYA 2PO6A 2B0SH 1FVDB 5C0NC 1VHPA 1XGUA 4JRYA 4JFZH 2DM4A 3DVIA 4E5XA 4QGTA 3C08L 1YPZF 1A3LH 2IWGA 3N85H 2A77H 1NFDF 5GIRA 5DHYA 3D2UD 1JN6A 4N9GB 3GI9L 3RDTC 4N0UE 1LDPL 2EICA 4HDIB 4LGRB 1JRHL 2VQ1A 5T1MB 4I1NB 2XZQH 3QXWA 1F6AB 1Q72L 4N90E 5CSZA 3GRWA 1AO7B 4RX4D 3JSSA 1U8JA 3G6AB 2Q7NA 4KQ3L 1AD0A 3GMNB 5MENB 3ARGA 5T3ZD 2W9EH 4JY4B 3ARTA 3FRPA 3G6JF 5T1KD 2P47B 3GZKA 4IMLA 4Z7OE 1DLHA 1YEEL 4LP4A 3FT3B 5D7JA 4ZUTA 3HZMB 1IGYA 4NT6A 3ZT6A 4KMTH 3O2WH 5EUOB 5INCA 4DEPB 1OTTC 1IZJA 3U36A 2V5SA 3UPRB 4LIQL 5D6DC 1PQZB 1ZT4A 5D6CA 5D1XD 4D0BA 4JGUA 4Y4HB 4GRWE 5DVOA 2C1PB 1HN1A 1KBGH 1T6VN 4HKBA 5ADPH 1QTYT 2HG5A 2X44D 4LSTH 4Z7WF 1A6UH 2UZIH 2XTJB 2YPVH 5K9QI 2ZSWA 3RIAF 1FNEA 1S9VA 5JW4M 3RJDA 5TQ2H 3BISA 3LN5A 4M93C 2X4SA 4Y1AB 5BOPA 4P3CH 4TSAL 4M6NH 1KXTB 1YJDC 5CEXA 1A6TB 2ICEB 2VDNH 5DJXB 1TVBA 3V4VL 4U05A 5EFIB 1TTUA 4XTRC 3EYQC 1K5NB 4AIZB 4CAGA 4N0CA 5DJAA 4RMVA 3MOQA 3EHBD 1YY9D 3GHBL 2EYTB 3O2DH 1NC2B 4OZGF 5TDOA 3GM0A 4RGNB 3HG1E 3RNQB 5I1JL 3OJ2C 3BN9C 3GMQB 4Y16B 5TDNA 3GSQB 4IRJC 2Z31A 1K8DA 4XPAL 3VXOB 3O4LA 4JPKL 1SYSB 2HH0L 1KJVB 4P9HC 3HNSH 1JZ6A 1R5WB 3NFNA 2F5BL 5D2NA 5I15H 2CJUL 1MFAL 1U3JA 4FQPA 1V05A 2NY4C 1INDH 4U1HA 4HUMB 1OARL 5KVGL 4Q2ZB 5F7UA 1MCPL 5CGMA 1YMMB 4X98A 3BD3A 3UBXA 4MJIE 2OSLA 4JLRA 3QULA 1K9TA 4ZPVB 2HT3C 3MYZA 4MNQD 2DKSA 1FJ1B 2FJHB 4MXQD 4M03A 3QR2A 4KVNL 4U6YA 4JFPA 4OSUL 3VG0L 4PRIE 1HEZB 4RGOL 3K3QA 5I1LA 4JANA 2B5IB 4PJIB 5IKCA 4HJGB 5CWSA 5I74B 2X6MA 3UC0L 1J1PH 2MCG1 3VGDA 4DOHB 2C7UB 5FO8B 1OAQH 3MRQA 3DO7A 4UINL 4X80L 4K8RC 4UIMB 5H2BB 1A6ZB 2R1WA 5EO0A 2BSSB 4PRDA 4F8QA 4LDEB 3BKYL 3VXTB 1ZAGA 2YEZB 1YEFL 1H3PH 5GGUB 3IB4A 4NFDA 1FBIL 3CCHB 3WEXB 1JGUH 1IC4H 5I71C 4DN4L 1OTUD 5IGXL 4NQVA 4YC2C 5C0DA 4OQTH 4YAQB 4LDLB 4PS4L 3CFJA 3D69A 5AZEH 3JWNC 5F6HI 3KR3H 1WEJH 4N0FB 4M3KB 1S7SB 4NUGH 2JJTC 2NZ9C 3FQWA 1IJ9A 2AJSL 1D6EA 4OKVB 4XGZA 5C2UB 1IL1B 5FF6A 4JO2L 2O61B 5I8CB 3H3PL 3VWKB 4JZOA 4WWKC 5C9JB 1BFSA 2X70B 1ZOXA 3RZCA 1A7QL 1C5CH 3QXAB 5TFSH 1NC4D 2KQMA 4UNTA 1M05B 3TO4C 1FE8L 2IGFL 4P3DA 1JPFA 2EDEA 3ULVL 2DWDB 3BGMA 3LEYL 3AY4A 3G04B 2H6PA 2FJFB 3TVMA 1XFPA 2B2XH 4KHTH 3PWNA 4MWFA 4I3GA 4MJ2A 1U92A 2YBRA 1Y6NR 1FYTD 2IFGA 3TIEA 1XGUB 1CYGA 4JHWH 1ZGLP 5IIEB 2Q8AL 3QPQC 1Z3GL 5GIRB 5IW6A 1CGYA 4NC2B 3MRFA 4P4KD 5DQDL 1CGTA 5GGVH 3ULUH 1QQDA 3D39A 1L7IH 1MCJA 3B9DA 3KPNA 1NJ9B 3PWJB 3TBYB 3BH8A 1FFOA 2OYPA 3VGGA 4NRZB 4KTDL 2QQQA 5HYSG 4NBXB 1EHLL 1MRFL 4RFEA 2N4IA 5CSZB 1NMBL 2ZP0T 5ID0A 1U8JB 2PCPA 1AD0B 1ONQA 3TH3T 1XGYL 3H0TB 5TGBB 2DQFB 1FGNL 4M9PA 1JV5B 5JXAH 5DURB 5JLZA 4IMLB 1DLHB 4F9LC 1IM9B 5LBSH 2E7LE 3O9WC 3V5HA 2J6EH 4Z5RA 1CFBA 4P2RB 4RISH 5INCB 5C0RH 3S88L 2IF7A 1N5YH 4G8GD 3PL6D 1HKLH 5IVXB 1INQA 3JWOH 1HIMH 5EU3A 3VFMB 4G80B 1FZKB 1MJ7L 1A64A 1P5UA 3P0VH 3TZVD 4LCWB 3BRFA 3TNMA 1KCUH 3BN3B 4MD5B 1PAMA 1LP9F 1BOGA 4PJCF 3DJ9A 2NY1B 4LSPL 3RVWD 3O2VL 2CLRA 4HKBB 1CD9B 2EDHA 2X89D 4XPFL 5L7XL 4JFOA 4GAYB 2BCKA 1CBVH 1FNEB 2OCFD 5E0QA 1X44A 5LGKA 1KCSH 1O7VA 2X1QA 4ELMA 2B0SL 5IW1A 4WUKH 3TPUA 5EU6B 3SKOA 1KPVB 4UU9A 3X3FL 5C0AD 4JFZL 1SYVB 4PY7A 3VU2A 5JOFB 1TVBB 1A3LL 3KLDA 3B4NA 4MNHA 3N85L 2A77L 2YHGA 5FCUH 5ENWB 4QYOB 1UB5B 2MQCA 1FG2B 4OGXH 5DJAB 1XF4B 3C60B 3N0PB 1ZK9A 3HZVA 4N5EC 4TSBH 3V6BR 5L0QB 1RJYA 3N1QC 3VXQB 2HFFA 1JGLH 3VGEA 2H8PB 1K2DB 1YEGL 1PX4A 2QHRH 4OCXH 1GGIH 4FFZH 4GT7A 4NM8H 5DFVC 2WNGA 2YZ8A 1T5XB 2Z31B 4KHXH 1NKOA 1BWMA 5IB2A 2XRAH 2DTSA 3UTQA 3BP4A 1T7YA 1H5BC 1QNZH 3HB3C 2OXGA 4XC3H 2DTMH 4QLRA 3QQ4A 4WV1A 4LHUG 1D5XB 4BSWA 3QNXA 2J8UE 3WXWL 1G6VK 4ZAKB 4Y5XC 4P23D 1DANU 3LN9A 5BV7C 1EA9C 2VUYA 1S3KH 4PTTB 2ESVA 4JJHA 1NBZB 4NKDB 3EOAA 2OSLB 2JIXA 5C0GB 1CGWA 3GSNB 4YE4H 3QUYD 5D1QA 1J0KA 2PO6D 1X5AA 3F7PC 4LSTL 2B4CH 5H37G 5JW5A 1A6UL 1I75A 4MXVF 1H3VA 3NIGE 2VLLA 3AU1B 4ZFZB 4JRYD 4P2CG 1L8JA 4PRPA 1JK8A 4JFPB 2DI7A 5ACLA 3O4OC 2EXWD 5FYJU 5TQ2L 3SDCB 1HQ4B 5DR5L 4U6HB 5I1LB 2BRRL 2DI9A 4M6NL 4DKFH 3QXDB 5B38G 2H9GA 1A22B 1Y18B 2R1WB 3MBEB 4OIAA 4Y19A 1BQHA 3GNML 2NMSA 3E3QE 4PJ5A 5F7DA 2BSTA 1PEWA 2FEDD 3QO0A 2J88L 5J11C 3DMMB 3E8UH 3V6FA 3ULVF 3ARGD 5DJZA 2FB4H 3U4AA 3W81A 3IXTB 1S7WA 1P4BH 3JVGC 4IMKA 5IWLA 1MCHA 4WO4A 5JNYB 3QUXB 5FGCB 2JB5L 3C6SA 1YZZA 4OFKA 1OP5K 1XGRA 5D72H 5D7LE 5CZXC 1WUNT 4HS3B 1O7SA 3CIQA 3K4ZA 2VDMH 3HNSL 1J8HA 2A9MH 3MLZH 3S34H 1RHHB 3LHPH 4LMQE 5I15L 4U2ZA 1U8PA 3LN4B 1QFWM 1CQYA 3L5WA 4J3VA 1INDL 1RFDL 2AEQH 4L3EA 1T7WA 4OLXH 1NAMA 4XGZB 3WUWA 3L7EA 4HJJH 3ZTJG 3WS3A 3SDYH 2G75B 4PJAE 1NEZG 4HD9A 3FB8B 4JZOB 4S1SH 2VLRA 3TN0B 4TQEH 2FHCA 4HS6B 4Z7VA 4HQQH 4HBQA 3B43A 4YIQA 3RTQC 4LU5H 5DQ9A 2IANE 2MNUA 3VD4A 1JVKA 4WU5A 4OZHE 3BGMB 1DQDH 1A6VH 2XXMB 1R5IA 3PWNB 4N0CD 1JWSA 3X12B 1U92B 2YBRB 2DDQH 4KKAC 1J1PL 4XPHH 3TIEB 1NGYB 4XP1H 1A3QA 1OAQL 3CLFL 4QTIH 4CGTA 3QIUD 2QR0A 2RFXA 3QDMB 4PIRF 4LCCA 1C5BH 4HG4J 5E4EC 5IW3A 4DJMA 5AZ2H 2B7DT 5IW6B 2A0LC 3MRFB 1QBML 4OLZL 2BJMH 3ZDYF 1NSNH 3Q2CA 3D39B 5GZOC 3MJ6A 3VFRA 4Y88A 2EDTA 2YPLA 3NAAH 3PXJA 4LGSB 3O4LD 4X0KB 1JI2A 1H3PL 4KROB 4RFEB 1JGUL 3IDGB 4PJ8A 3W2DL 3UBXI 5HGAB 4G8FA 5KG9A 3BRGC 3WFDH 4HEPG 4OQTL 3P4OB 2YA1A 5JLZB 5L2KE 3VFGH 1A5FH 3KR3L 2ERJC 4OCSL 1VESA 4ZSOE 3U30B 1IAII 2R56H 3KXFA 4YO0A 5T3ZL 4KK6D 4APQC 2M1KA 4LASH 5F7YC 5AUMB 2C3WA 3HC4L 3P4MB 2H2SC 1C5CL 3BD5A 3TNMB 4LBEA 5MP6L 5TFSL 5D7KD 5GS0C 2CLRB 5I71B 3W39A 3CFEB 4L8SB 4XXDA 3CSYA 1YUHA 5H94A 1P6AB 4B53A 1SMAA 2B2XL 4KHTL 1CIUA 3KYKL 3IDJB 4G9FE 3TPUB 2MKLC 4UU9B 1HHKA 1OPGH 4NZDA 1JWMB 5E5MA 1EVUA 2ZCKH 5CMAB 1QHOA 5T5NF 4MNHB 2FX7H 3OR7A 4WHYG 1UZ8B 1TTFA 4D2NA 1FDLH 4MJ6A 1N26A 3WIIL 2P8MA 3SN6N 4GOSA 3JTSA 3RY6C 5HYSB 3WO4C 4KK9C 4IJ3B 4DKAA 1DBBL 4HJ0D 3L3JA 2X4OB 5D7SH 1JGDB 2ADIA 3T2NH 2IG2H 5ITBH 3CVHA 4HIHB 2B8OT 3UTTB 3IS1X 1UXSB 2KDGA 4ALAH 2OZ4A 4YHYC 5IB2B 4OAWA 5JZ7D 2R69H 3TH2T 4RNRB 4E41B 2G2RA 4J3TA 3ARBB 5HVGB 4GG6F 2J6EL 3SGEI 4BSWB 4FQCH 4PJHF 3RZCD 1HKLL 3U9PH 1SJHB 3LEVL 3JWOL 3T0AA 4KY1H 1KCUL 1QO3A 4X5XB 2DQGH 1FZJA 4U3CA 5TPWL 3K8MA 3TVMD 4D0CA 5IBLC 4R26H 2HMIC 4K94H 1BIHA 3RWHB 2V7NB 3FB5B 2V5MA 4M7LH 3B83A 4PRPB 5HHOA 1P7QD 3TT3H 5KSBA 1JK8B 1KCSL 1ZSDA 3VXSB 2CIIB 4LLUA 1OOAA 1WC7B 2WP3O 4HG4K 1ROWA 5E9DE 3MV7A 1VSCA 4ELKA 5K9OB 3O3DA 5FCUL 3P40A 2YR3A 3HR5B 3UTSA 4OGXL 3C5ZC 2XT1B 2WINA 1E4WL 4G6FD 5JMOC 1MLBA 3X14A 2ENSA 1J5OH 5A2LH 5F7DB 4X7DC 1OAKL 3VRLE 1CFTA 1GZPB 1EERB 4XPGL 1VENA 1JGLL 5EO1B 1ORSA 1IAKA 5DI8B 2QHRL 1GGIL 4FFZL 1WJ3A 3IF1B 4JM2A 5M94B 3SHSA 4KHXL 3UTOA 1B4RA 3EYSH 4FQ1H 1CLYH 2XRAL 4I13B 1IM3B 3MUGB 4NKMB 4AZ8A 1P6FA 2YRZA 1E6OH 1QNZL 1U8IA 3QXUA 1H3TA 1JNNH 4LHUB 2CMRH 4D3CL 2DICA 3GSVA 4L1DA 1AH1A 1DQJA 2VLJB 1EFXA 4MQXC 4PRHA 3IDIB 3ZE1F 1S3KL 2V17L 5I1CH 4P59L 4OF5A 5B8CB 3ARFB 5C0CA 2OK0H 2I24N 1TENA 1CICB 3TCLB 1CE1H 3ZDZF 4S1RH 4Y5VA 1EEQA 3VJ6A 3ILQC 2OM5A 4YIQB 4KDVA 1WBXB 1ZLVH 3O11A 2GK0B 3UZEA 3F7YA 3QJFA 3GSNH 4G8IA 4NDMA 2FLRT 5EC2B 4CN4A 5E2VH 3S5LG 1CCZA 2CLZA 5B38B 2OTWA 3BEWA 5CJOH 4DKFL 4YDKH 4FXKA 4X4YB 1ORQA 1Z9OA 3R0MA 2V9TA 4QWWD 3WLWC 2RFXB 2NXZC 4QRPE 1FFPB 4OBRA 3A6BH 2DQUH 2QADC 1S8DA 1B0GB 2DQDH 3O41A 4P4RB 1FAKT 4JKPH 4FTVE 3V6ZA 3GIZH 2YPLB 5DS8A 3T0VA 5I1DA 1NCWH 4LHJB 3S36H 3WIFA 2ZG3A 3M17B 1P4BL 4MCYA 5J3HC 3OF6A 1YNKL 2BHZA 3REWA 4WFFD 3TBWB 3A6OA 2Z8SA 2DBLH 3OKOB 5D72L 4NQDE 4QT5A 5EOTA 5EOCJ 3TJHA 2PXYA 2GIYA 3DV6A 4FQQA 4GRWB 4EOWH 3E3QC 3WL9A 3MLZL 1MIMH 3CU1A 4LSUH 2KQNA 5F9JB 3MV9E 4ISVA 5EZJA 5CHNA 3I6GA 4HFUH 2CRYA 4LKXA 4FZEL 5D96B 3TV3H 2ESVD 1CLCA 2Q1EA 2FX9H 3UPCA 2AEQL 2JIXD 5JQ6L 3H9SD 1FL5B 4X83A 4HJJL 5F44A 5DVMA 1G6RA 4I0PB 5D1QD 3SDYL 1WWCA 4U31A 5IF0B 1DE4B 5K9KA 1Q9LB 3U7WH 4J3OC 4TQEL 3RHWK 1NFIA 2FCBA 3MC0A 3DETC 4LU5L 3N1PC 4ZFFB 4R2GD 1MI5B 2NX5A 3FFCB 4U1IB 4WW2F 1YC8A 1P4IH 5F9AC 2DDQL 2YD3A 3GSXA 4Y19D 4XPHL 1QOKA 4XP1L 3VFSB 3LQAC 4QTIL 4PJ5D 3SGEH 1QZ1A 1C5BL 1I1FB 2GYSA 3S35H 3OR7B 5AZ2L 3DXAA 3FO1A 4U1KA 4FABH 2BJML 3KYOA 2X2YA 4WO4D 4NC0B 1J0JA 6FABH 1U8OB 2W0KA 2D3VA 3JTSB 1HXYA 3PWPA 1YEDB 2HFEA 5I30H 3L3JB 3I9GL 3F58H 3O6KL 1LE9B 2RAMA 1J8HD 4PP8C 3KLHD 3QFJA 5KVMC 3WFDL 2R29H 2ZSVA 4AH2A 3GMOA 4JN1H 4L3ED 2ORBH 3EYOB 1WGOA 1O0VA 3LCYA 4OAWB 3VFGL 2H32A 4PJEE 5EO9B 4B0MM 2G2RB 5DC4B 5D1ZB 3LQMA 2I25N 4NFCA 3R8BB 3PNWA 2H26A 3LPGA 4GS7C 5GGSY 2V6HA 4HIXH 4EVNB 1BBJB 1OM3H 1U95A 1HCFX 1RUAL 3AAZA 5F7LB 3RPIA 4W4NA 4XP9H 3O0RL 3IKCA 5IB1B 1BVKA 1QO3B 4ZTOL 4YDLC 5FKPB 2V5RA 5E8EA 5I16A 5K33A 2M26A 5HYEA 2CO7B 3FFDB 5ELIA 1BZ7A 3ZYZA 1WTLA 1G7QA 5KSBB 1DEEB 3DX9B 2XZZA 4EQ2A 3D5OF 4NBZB 5MHSE 1P9MA 4WI2A 4KZDL 1Q0XL 4PJ9A 5FYKD 3KPSB 3HE7B 3RNKA 1X5IA 4FXLA 2ZCKL 4ZYKA 1UKQA 4HS8H 1UEMA 4KK5C 3ZE0F 4JY6A 1M7IA 1FDLL 1FVEA 3UTSB 4XP6H 2WINB 5GGSB 4M62L 4XPTH 2D0FA 2R23A 4MDJA 4PJ8D 1OQXA 2ZUQC 3BGFC 4ZO7A 5D7SL 5F88B 3L5HA 5C0IA 1TMCB 4XP5L 5ITBL 1IEHA 3R1GH 1KJMA 1CI5A 2YUZA 4J23A 4O2EA 5HGBA 4ALAL 3GRWL 3G6DL 5E8NB 4LLAA 4P2QE 5F9WC 4MVBA 4XAKE 5KSAC 4N1EA 3HZYB 4HX1A 5LQBL 1EUUA 1N3NA 2W65A 1TZHB 2VR9A 1FAIH 4FQCL 1BLNA 3I85A 1XR9A 4Y2DC 1VPOL 4XNMB 4KY1L 1UM6L 5J13C 5F7FA 5E99H 2DQGL 4GUPA 2GSIA 3QWRA 2AV1B 5E8PA 1YDPA 1K8IA 1LK2A 4KKLC 2VDPL 4R26L 1IRAY 3F8UB 1RVFH 3EUUA 2A6IB 2GSGB 2VOTA 3FZUD 3IFLH 2X05A 3MROB 4MNQE 4YHOL 1MF2L 2R9HC 5ISZA 5GGRA 3TO2A 3U6RA 3L3OB 4U4BA 4CDGC 4DUXA 2MTPA 3IFPA 1IGJB 5E6IB 4FXKB 1IGCH 3GSUA 1ORQB 4F9PC 1HHHB 1JFQH 3TC9A 1JE6A 5DK0B 3D3VA 1G7MB 1AD9A 1PKOA 3AMLA 3CDFA 4WTXA 4V3EB 3BKML 1MOEA 3K2UH 4PJDF 1ZHNA 1WQVT 3V6ZB 3HAEA 3O6FA 1QRKA 4OGAC 4IOFC 5CD5C 5CJXC 3IKKA 4UT7L 1UJ3C 1JPGB 2IALB 1F4WH 4H8WH 4YDIH 3REWB 5CD3B 3BWUC 2CK0H 1TVHA 3HUJA 4NQCD 4GBXA 1DL7L 1EJOH 4FQ1L 1B90A 2PTTB 4XRCA 3F5WA 3STBA 3EDFA 4OD2A 1E6OL 4OCRL 3FO2B 1JNNL 2WUBH 2P5EE 2YK1H 4O5LH 4ISVB 5CHNB 3I6GB 5EB9A 2WWMD 4IRSA 1ERNA 2NW3B 1F3RB 3Q3GA 3VXUE 3MCG1 4LRNL 4LSQH 4UV4H 2MMXA 1MIEH 3FKUS 4DVBA 5I1CL 5KS9B 3NCMA 1XCQA 4HH9A 2OK0L 2DLHA 5C6PB 2EH7L 2ED8A 5HHOD 3KPOA 3DLQR 4S1RL 4ZXBD 3HI6H 5JO5B 3N1MC 2F53E 2NY0D 1L9NA 3FAWA 2AJZB 3MV7D 4CVXB 4MAYB 3S5LB 5KW9H 1LO4H 2UY7A 2VR4A 3PGCA 2EDOA 2EIBA 5CJOL 3EFFB 5D7IA 4NQED 1JHTB 3GSXB 4JJ5B 4X6DF 5FO7B 4ONGL 4LCYA 2LU3A 3QEGL 1IAIL 5HYJE 3MO1A 5ADOH 1NUGA 4W70A 5HHMA 2E27L 2DQUL 2X1XR 4JKPL 5DUBA 3KYOB 5F9OH 5IEKA 4JM2D 1FHGA 3RKDD 1G9MC 3GIZL 2O5ZL 1NCWL 4FFYH 3S36L 3BPOB 5FYKH 4AT6B 5I75B 3TF7C 2DBLL 2WBJB 1HK6A 2GY7B 5EBGA 2BFVH 3ES6A 2ZSVB 4EOWL 4Q0XL 3MOAH 3GMOB 4PRHD 1T1ZB 3VCLA 4JZJB 4W4OA 4HFUL 2H32B 3TV3L 5F1SA 4Y4KA 4Z18A 4M6AA 5DJYA 4QXUH 2FX9L 5C0CD 4KH2A 1UT9A 2H26B 5JIPA 1OD9A 1RV6X 4GW1A 3NIFF 2IH3A 1LMKA 3D48R 3U7WL 2Y6SC 3KWWA 4LL9A 3ZTJH 1KV3A 1AGBA 4MQSB 2WP3T 2IMMA 2VXQL 3IETA 3L3HA 1S7RA 3B5TA 5I1GL 4X6EB 1RUPH 2W38A 1A02N 3VI3E 3SGDI 4HF5H 1G7QB 4JQIH 4I8DA 5C8JA 2CIKA 2WUCL 3DVGA 4OFVA 3ROLA 4PJ9B 2VN7A 3I84A 4K71C 1MPAL 4C83A 5T1DH 2BNQE 5KZCB 5LGJA 1E4KA 1BAFL 3MXWL 3MRKA 1F00I 2YUVA 4JGJA 4HPYH 1D5IH 4YFEA 1KELH 4FABL 1UM5H 2RBLA 1X3DA 1XCTA 2R1YB 6FABL 4O02H 4JFFB 4X5LA 2R23B 3BQUC 1L0QA 4X7CC 2ADGB 2LAAA 5I30L 3TJHD 3F58L 4KK8C 1T4KB 2PXYD 3C6LC 3O3EA 4OD1H 2MSPA 4G42A 4CMHB 4CVUA 4WEUD 3MRIA 1I9JH 1JF6A 1QLFB 3VD5A 2ZNWA 1G7IA 1WAAA 2R29L 2VQUA 1LO5A 2VXUH 4JN1L 2ORBL 2PR4L 3LKQB 4PJXF 2V2XB 4NN5C 3IU3B 1YNTA 2ED9A 1QFWI 3CVHH 1N0XH 3MA9H 2BNRA 5T3XD 1L0XA 3P77A 4RBPH 4OJFH 5DYOB 4PG2A 4HIXL 3L6FA 1QD0A 1SBBA 1OM3L 4PJBA 3OAYK 1UH2A 2DKUA 3MLSH 1A8JH 4MHHG 3PWUA 5J6GA 1DLFL 4XP9L 1EAPB 4PBWD 5HYIA 2NX5D 3FRUA 3ARWA 3IXAB 2I9TA 5BRZB 1LK2B 3ARXA 1QSEE 4KPHH 1G9NC 2A9NH 2FZ3A 5DRWB 1A1NB 5F71A 3KHQA 3MLPA 3AXLA 4X5WA 5JHDE 3DXAD 3ZKND 3NIDE 2OL3B 3RDTA 4HC1A 5GS1A 4G43A 4HS8L 4Q9RH 4NSKA 1HNGA 2K7PA 3QEQA 1F58L 4GQ9H 2P43B 3D3VB 3VFUB 3H8NA 3PWPD 1NFKA 3MOBH 3GB7A 4ODTH 4PTUA 3CJJA 4ZUVA 1R3HB 2BXYA 2YD1A 4XPTL 1DQMH 5IROC 4NZRH 1ZHNB 2APTA 3G6JE 4OZIE 1U8QA 1IQDA 5IEHA 3QFJD 2VLKE 3KJ6H 3E6HA 1X5GA 2D03H 1IFHH 1WSST 3HUJB 3L1OH 3MODH 4TULL 3SY0A 4CJ0A 4PRNA 4XRCB 3SQBA 4UB0H 5D6DA 5C0BB 5JPMB 2JCCE 2YN5A 5SWSA 1OGAA 2FRGP 4G6KL 2AKRB 1XZ0B 1YY9C 2WIIA 1KGCD 1FAIL 5IVZB 2E9JA 3KVQA 2L7JA 1VFAA 1ZA3B 3RUGE 3MFFA 1RQ5A 1RI8A 1NCUA 4JEGB 1GHFL 3P73A 3Q1SH 4QCIB 4L4VE 2OI9A 4K3HA 1DVFB 4BYHA 1ZHLB 3TA3B 1YY8A 3BZ4B 4ODWA 1NCTA 3LMJL 3PGCB 4Z7UB 2NPLX 32C2A 3UCRA 5HJ3A 4HKJB 1FNAA 1IGCL 3W0WB 3DRTA 3RVVD 4NO0B 1JFQL 4LCYB 3U48A 3MLXH 4F80A 2AJ3A 4OZGE 3SCMB 5F7EL 3KAAA 4GW4A 5HVHB 5IK3B 5J13B 2R0ZL 3K2UL 2GCYA 2HKFH 3FQNA 4CVWA 1NGWB 1FC2D 2QQLH 1MEXL 5DUBB 3QZWA 4Y1AD 3LEXB 5IEKB 4FFWC 4OLWH 5DVNA 2NXYB 3X13B 3NOIA 5B3JE 1IKFL 4YBQD 1F4WL 2CK0L 1T0MA 3MACH 5C09B 1EJOL 3SGDH 3EAKA 5FECB 3EJYD 2A6DB 3RZWA 3X11A 4QRRE 1ZEAH 5I0DA 1YQVL 3OX8B 1T3FA 5IMOA 1KC5H 3LS5H 1EZVY 4YH6A 4UT9L 3QDGA 2EE3A 3B6SB 2DD8H 2PW1B 3D18A 3QWRD 4LQFH 4LSQL 4UV4L 1RIUL 2IADB 4Y16D 3ARPA 4XH2A 4GKSB 4P2YA 4ZD3H 1B88A 1OTUC 3N1GC 5E8OA 4PLJD 3LB6C 2BNUA 5E4IA 3K74B 1NAML 5E9DB 1AGCA 2OTPA 3GM8A 5ISZD 5IESH 1NMAH 1F11B 3MQIA 2ITCA 2JLLA 4CU6A 2J5LB 4PGJA 5JW4Q 1FSKC 4FN0A 4WUUB 3QDJA 4ONFH 5KW9L 2PN5A 4JHAH 1OP3H 5HHNA 3HN3A 5CJ8A 1S9YB 2EE6A 5ESQA 4LLYA 3DVGB 4XVJH 1CZ8H 4JFYA 4YHPB 1G7LB 1R24A 5F1NB 3PHQA 4KZEH 4C83B 2F8OA 4U6TA 1N6UA 1W8OA 3DX6B 3MRKB 4GW5B 2MCPH 3HE6C 3O6FD 4JFEA 2PTVA 4BJLA 1HOCA 1MAMH 4MA3A 1JGEA 4B5EA 2HLFC 5FYJD 5F9OL 4HK3N 5IMLA 4M1GH 5MI0C 1Y0LB 4FFYL 3ULSA 35C8H 3LIZL 3VWJB 2R2BB 3VXNB 3DWTA 5FYKL 3MRBA 4G42B 1MJJB 5DUML 1AIFA 3H7BB 4KKBD 4LRIA 3KLAA 5A2IH 2LU7A 2QHLA 4PBVC 4IRSD 1WFTA 4ELMF 2RHEA 2FBJH 1EBAA 1LO5B 2ICWB 4MQ7A 5EBMA 4WI5A 1NGPH 1PKQE 2BNRB 4L8BA 4QXUL 3S37H 3P77B 1TNMA 2IAMC 4FG6D 1CD8A 3SDDC 3DECA 1C16B 2H32H 3TO4A 2UYLA 1CXKA 5GZNC 4WDIA 3PGFH 4HULB 1BMGA 1T66D 5F7NC 2X42A 1NDGA 1MHEB 3V8OA 4GAJL 4R7NA 4C56E 2BOBA 2JB6B 3QI9A 3E2HB 2R2HA 2AVGA 4QRPB 1DR9A 4TUKH 1HSBA 1I7TA 3PABA 4HF5L 4JQIL 5GRYA 1H8NA 2HT2C 2XWJB 3IDUA 1JYVA 5K9JH 2UY6A 1ZE3C 1S5HA 5HHMD 5L88H 4OGYH 3P9WB 1P2CA 2UWEA 5C07B 5T1DL 1OWRM 5L6YH 3F12A 4ODUB 5GS1B 4G43B 4L9LC 5HI3D 1JWUB 3QEQB 4HPYL 1D5IL 5F1OB 1UM5L 1DUYB 4V1DB 4O00A 5KSVB 3VFNA 3P9MA 4RFNC 5EBWA 5HI5C 4NO3B 4WW1A 2D7TH 4HIIB 3CC5A 3TCXA 4O02L 5D9SB 3FCTB 1JZ2A 1TQCB 1OSPH 3QG6B 2CDEA 1U8QB 3DTXA 3FQUA 4OD1L 1OTSD 5KAQG 5TDPB 3QJHA 4TSCH 2GITA 3SPVA 4BZ1H 3U79A 4F9LA 1K4DB 3TJEL 4KI5D 3T8XA 2OJEA 3O9WA 3LH2H 4Y4KD 4YBHA 4PJ7E 4UBDC 4XBGA 2VXUL 1N2RB 3FQXA 4MNGA 5FV2A 4CU8A 4Q9CA 2ID5A 3I2CL 4XCNB 4RAUB 3CVHL 3MA9L 2GKIA 1P7KB 1XGPB 3OKDA 1T1XA 1FQ9C 1S7TA 2OZ4L 5CLTA 3MRLB 4OJFL 1Z9LA 5BQ7A 1AGEA 1VDGA 1A4KA 2XNAA 3GMPB 3EYVB 1SEQL 1FN4B 3MFFB 4AENA 2GHWB 2C3GA 1JFMA 2GT9B 4KRPC 1QP1A 1CFVH 5EU7E 2ICCA 2EE9A 4POUB 2OI9B 5INDB 1JUFA 4KPHL 4P2RD 3G5XA 4X4XB 3M1BB 4D0DB 1UCBH 1RJLB 1RY7B 4RAVA 4ZOBA 1NL0H 4FQIL 4X7TB 5I19H 4ODWB 5FV1L 1T20A 3CPLB 1QSFE 1NBVH 4NQXB 3DURB 4NNXB 5E2UH 1M4KA 1TZGL 3OAUH 2F58H 3KPLB 1MNUH 3BKJL 3V79C 4HWNA 3QNZB 1HYRC 4J3SA 4YWGH 3JV4B 4ODTL 1T5WA 3GBMH 3L3DB 2GCYB 3QQ3B 4FRWA 4MX7A 1DQML 3UDWC 1UWEL 4Z7VF 4QXTA 1BX2A 4UQ3A 3JWDH 4Y4FB 5J7CC 3LKOA 3QCTH 3WN5B 3TBSB 3KJ6L 4N0UA 2FWOB 1H5BA 1WZMA 4BFBD 1TJGH 5IFAH 3RWEB 3TYGH 4L4JA 2D03L 1IFHL 5IB3B 2HTLC 3MODL 1REIA 3S97C 5DUPL 3BO8B 4UB0L 4POYA 3T0BA 4Y5XA 4ETQA 4KJWD 1NCAL 2IBGA 5IMOB 5EBLA 5TF1H 2CSPA 4F15C 3KNBA 5ICXA 1C8PA 4JFDE 5HI4C 4TVPD 3FONB 5C0ND 3NN8B 4FFVC 4X6CF 4WI7A 3WYRA 5BW7C 5ALCH 3E1F1 2X4QB 3QEHA 5B21A 5DD6A 4NYLB 3V7AE 5CKAA 3S3JA 3RDTD 4ZAKD 1QRNE 5HHNB 4OI9A 5ESQB 4KJYA 3D0LB 4WCYH 2CDFB 1ZXQA 2B39A 43CAB 2VIRA 1WZ1H 1NEZA 4TRPH 2AABL 3MLUH 5BS0B 1MFEH 1CWVA 4A2MA 3QUMA 3PQYA 4KXZI 4JFEB 1MCWM 3JVGA 5D70H 1HOCB 1WITA 4MA3B 1JGEB 2A6JB 3VXMB 1IT9H 1NUFA 4KRNA 4UIKH 2NCMA 4YJZL