3WS3A

Crystal structure of h-2d in complex with an insulin derived peptide
Total Genus 63
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
63
sequence length
273
structure length
266
Chain Sequence
b'PHSMRYFETAVSRPGLEEPRYISVGYVDNKEFVRFDSDAENPRYEPRAPWMEQEGPEYWERETQKAKGQEQWFRVSLRNLLGYYNQSAGGSHTLQQMSGCDLGSDWRLLRGYLQFAYEGRDYIALNEDLKTWTAADMAAQITRRKWEQSGAAEHYKAYLEGECVEWLHRYLKNGLLRTDSPKAHVTHHPRSEVTLRCWALGFYPADITLTWQGEELTQDMELVETRPAGDGTFQKWASVVVPLGKEQNYTCRVYHEGLPEPLTLRW'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords H-2 class I histocompatibility antigen, D-B alpha chain
publication title Compensatory mechanisms allow undersized anchor-deficient class I MHC ligands to mediate pathogenic autoreactive T cell responses
pubmed doi rcsb
source organism Mus musculus
molecule tags Immune system
total genus 63
structure length 266
sequence length 273
chains with identical sequence C
ec nomenclature
pdb deposition date 2014-02-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3ws3A02
3.30.500.10 Alpha Beta 2-Layer Sandwich Murine Class I Major Histocompatibility Complex, H2-DB; Chain A, domain 1 MHC class I-like antigen recognition-like 3ws3A01
1T1WB 3ZDXF 4JAMA 3GMQB 5FKAA 1UXSA 2XZCH 1AO7D 1B9ZA 4KV5E 4I0PB 5I8OH 1FH5H 4H1LB 4PR5A 4HXBH 5ETUB 4MJIB 4MA7L 1W2KT 2ZG1A 1NBQA 3KJ6L 5IB2A 4GQ9H 3L3GB 1OP3H 1RZ8A 2CKBB 1H8SA 5HGDB 4NQEA 3LKPB 4BFIB 2V2TA 1J87A 1JRHH 3RNQB 3TA3D 1BVZA 2A6DB 1DBKL 5C0GA 4MD5B 4LSTL 3STZB 4BQBA 2XPGB 2ATKB 3AFLA 2HMID 4HCRL 3QCVH 2ZCHL 4PG2A 1S7TA 2YPLA 2WP3O 1GH7A 3GMNA 1FNEB 4YHNA 2NW3A 3NIFE 4PS4L 5LJYH 3P0YH 2JJSC 3RVTC 5I6XB 3ARFA 1G6RB 4S0TD 4L29B 4FXLA 4X6FA 5I17A 4POYA 1N0XL 4X0KB 5FV1L 2YD3A 5DFVD 2DLFL 2J1KA 3IFNL 4CUCA 3VFWB 2DIJA 3WEXB 3S36L 1AI1H 4M1GH 3HUJE 4ZFGL 4JPWL 4NPYA 1RK0B 3RWCA 3PWPB 3PWVB 4WEMB 3TYFA 1WVZA 3TZVD 3WHXB 3NMEA 1EAJA 3L1OH 4RSVA 1BVLA 4JG1H 1ZXQA 3QDGE 1JK8B 4Y4KB 5T5FL 3SKJL 2O93L 5TDPB 1TMCB 4LDLB 5LXGL 4TTDC 5GGTA 3SPVA 4YIQA 2A1WL 1QFPA 2VAAB 4X6DA 3LIZL 5F7NC 4G6KH 4JRXA 2WWMD 1JYVA 1D3CA 4Q7DA 3K4ZA 1DQDL 3N50A 1G7JB 5HDQL 2V5RA 3WLBA 3GK8H 5IB3B 1NKRA 4BSWB 1I8KA 4PJXF 1N2RA 3ZHLA 3L5WB 1MCOL 3KPQA 4KQ4H 4UDUB 4YK4C 1KC5L 1O0VA 1NMAL 4UDTB 4PRHB 4OLZH 1QKZH 4XB7A 5LWYH 4IJ3B 3TYGH 1CG9A 4UILL 3VGAC 2APFA 2BDNH 5DVOA 3GBML 2HVJB 1P4IL 5HI4C 5F44A 5E2JA 4PJDA 4UIKH 4Z8FL 4JM2C 2X10A 5D2LF 5HTSA 4O00A 5TE4L 2D7TH 4CDHA 1FFRA 1H3VA 4XHJD 1C1EL 3MUZ1 1RVFL 1LO2H 2Y36H 4CADA 5IMKB 4JHAH 4U6YA 4XPBL 3RGVC 4NBYB 5L2KE 4U1GC 2Z0BA 4POUB 5C6TL 1FE8H 1WEJL 2HG5A 4LHJB 5E8EB 4XPGH 1MCWW 2EIZB 4GKNB 4YDVA 1X7QB 4E42B 2ESVE 4KH2A 32C2A 5C70A 1EDQA 2W9EL 4G9DB 4PJEE 4PUBH 5E2TH 3ARFC 1WICA 3C6LB 1J9CT 4YUEH 5GJSH 2GK2A 2Z35A 3PNWB 5DZOA 3D3VA 5DQJA 1B0WA 2VJXA 1DQLL 5HHMB 1MWAA 3QI9D 4ALAH 1J0JA 2FBJL 3VFTB 4XWGH 5LCVH 1FNGB 4ZTPL 5C07A 2AXFB 3HRZB 3GB7A 2FO4A 3FFCB 5ESQB 2CUHA 5CWSB 1CYGA 2Z8RA 2DQEH 1BQLL 4H5SB 1KXQE 5DMJB 1S7QB 4F37F 5BVPL 4JB9L 5DUML 3ARQA 3GSQB 3TPUA 4KJYA 1U0QA 2XTJB 5T1KA 2BSTB 3JUYA 3Q6FB 3VD5A 1JHTB 3R4DA 5E94A 1AGFB 4M6NL 1BF2A 4WU7B 4HFWB 5GS0D 1E6OL 3QQ9C 5GS1B 1CT8B 3WNKA 1FLRH 3LD8C 3BP4B 3RVXD 1XGYH 4NZUL 5GGQL 4KHTL 3VMOA 1N5YH 2I5YH 1NJ9B 1G7MA 4M7LH 4KVCL 5CEYB 1MCDA 3LSOA 3V6OA 1JRHI 3ARBA 3PGFH 1W72A 2H2SC 1IGJB 2X4TB 2ICEB 3ZHDA 3QPXH 4TVPE 2EDQA 4NKQB 1DEEB 4U6VH 1B2WL 4JFHE 5LAXB 1SY6H 1DLFH 1XF1A 1VFBB 2VIRA 2RAMA 1KJ3H 2VR4A 1PJ9A 1IQWL 1FL6B 1N5AA 1WWCA 5K9OA 1DUZB 2IBZY 4PRIB 3RY6A 2IADA 4PRDB 4JKLA 3RWGB 1FVCB 3PWJA 1UM5L 4BKLA 1I9IL 3BH9B 5DJYA 5L0QB 5IUSA 2FDBP 1M7DB 1CZ8H 3DMMA 3QDJB 1G7QA 3MRPB 4U2YA 4L8CB 3QAZB 3JBG7 3ZKMD 5JUEL 2X4PA 2DWEB 4LKCA 2HT3C 3DVIA 5HYJA 1DFBL 4WFFE 2R4RH 3SE3A 5TFSL 3F5WA 1AC0A 3LS4H 3PV6A 5I76A 3PG2A 3CUPA 2FEDD 2WLZA 4EQ2A 1OGAB 4R6UA 5DFWH 5BVJA 3VG0H 4XAWL 2VDQH 2Q76A 4OCSH 3BAEH 5D6CB 4AIZB 3O3BA 1NAMA 3WL9B 4OM0L 3MR9B 3MREA 3ECBA 5IVZA 3V5KA 3HE7A 5FYJU 1WWWX 4M6ML 3MV9A 4YHMH 5IFAH 2R2EA 4N68A 4UI2A 3T0EA 4OF6A 4L4VE 1WV7T 2UY6A 5D7SH 3RKDD 3LH2H 4OGAC 5T3ZE 1U8LB 3SKOA 1D6VL 4O9HH 4U2ZA 1KIPB 4FS0A 3ZT7A 2OXGA 4HUXA 1CGVA 1JGUH 1JPTH 3T0BA 3T65B 3CK0H 4RQQA 2DQFA 4QTIH 4NRZA 1QRND 3SDXB 5J11C 2Z91B 3T0ED 4JO3L 4TUOA 5DD6B 3S4SB 2C1OB 4N0UE 3QFJA 2EYSA 2VR5A 5E8DL 3QP3A 1ZEAL 2ICWB 3U36B 1UWGL 4G5ZL 4IBLT 1S3KL 2OI9A 1U8QA 3QQ3B 4YZFE 4OZIB 2VZSA 2PTUA 4K7PL 1JNJA 4YHLL 2XI9A 2CUIA 3OKMA 3IRZA 5C0AA 4LCWD 3H7BA 4NUGL 5IESH 3DETD 3AY4C 4G3YL 4N90D 4MAYB 1B0GA 1U3ZA 1Y6MR 1HSBA 3EYQD 1WQVT 5BV7H 3D85D 4LLUB 2V9TA 2YA1A 3MUGB 5ACLA 4EDXB 3HC4L 1IKFL 3EZ8A 4X83A 4KDTA 1XGQA 1RQ5A 2AEIT 3UCRA 5T33H 3PE9A 3ETBF 5JHDA 2HFGL 4JFEB 3VG9B 2H6PA 2HFFB 4WI6A 1ZHKA 4Y5XA 4WUKL 2A0LD 3L7FB 3PL6D 1NFDA 4N8CL 5DGRA 3C8KA 5C0BB 4ACPA 4DQOH 5D7JD 1JGLH 1MSPA 3E8UL 1G9NH 4ZNEA 5CLWA 3KLAA 2YBRA 2QLVB 4QT5A 1KSRA 3U0PB 3MGTB 2CPCA 4NO2B 2F5BH 3LY6A 5C2UB 3A67H 1WFTA 3MNWB 5DJDB 2XWJB 5T5NG 2W0PA 5MEND 1HYSC 2ORBH 4K7PY 3RTQA 5F1KC 1YQVH 3MXVL 4MSWB 4N0FB 2OJZL 3JTTB 4RAVA 1NBZA 4BH7A 1KB5H 5GGVH 4U49A 1YJDH 4J3OC 3FB8A 2CRYA 2DQHL 3VD3A 2WIIB 3BMVA 3BDYH 2AXGB 4X80H 3Q5TA 1KYOJ 1I7UA 1KIRA 3UBXI 5IMOA 1IC7H 1YECL 1Z0NA 2P5WE 4JFDE 4ELMB 4HK3J 4H26B 3UEZA 3ULUD 2GITA 4I0KA 4LASL 3NH7L 3X17A 3PHSA 2OZ4L 3QG6B 4KK6C 1D5MA 2R0WL 2GCYA 4NWTL 4O4YL 3WMSA 3F58H 2R1WA 5CBAA 5AWNH 2ZSWA 5LGJB 2F58L 4PLJC 4NO3A 5DMGD 3EYOA 5FGSA 1GIGL 2AGJH 4N8VB 2XRAL 1AR2A 5C0IA 3C6SA 4Q0XL 2B7DT 1ZVSB 4HUKB 4C55A 3QRGH 4YDKH 3KYOB 5T1DL 2PYFB 4YHZH 4JJ5B 1EGJL 4RWYH 4BH8B 4JFXA 1HH9A 4NN5B 1DR9A 3VFGH 1IGCL 2YS4A 3QA3B 4G6AC 3GMPA 3T77A 2M2DA 4W4OA 3N1MC 4GW5A 5ENWA 1GGBL 4R2GD 4O5LL 5EO9B 2AAVA 3ILPA 1I3VA 4TQEH 4POZC 3X13B 1DQMH 4IDJL 1Z6JT 4PRPB 2EEDA 2YK1H 4NC0B 4OD2A 5INDB 1CFQB 3BH8B 3D1MC 2D03L 2A38A 1EHLH 4M6AA 1JZ8A 3T8XB 1BLNA 5DC0A 4DUXA 2HN7A 4MXVF 2VZUA 5MEPB 5CP7B 1SBSH 2VZ3A 1K8IB 4XBPA 3RWIB 4X6CE 3VGGA 2O5ZH 1QFUL 4ODTL 3DIFB 1FO0H 3HZVB 5M94B 5FB8A 3SDCA 1JZ7A 3S3JA 3OXRA 2VUOA 3T0XA 5A3IC 1BEYH 3EO9L 1M6OA 3GMMB 3VD4A 3O81A 5EDXA 1QFOA 5I9QB 2APTA 2IFFH 5HVHC 3EYSH 3UTPE 5JXEC 2IH1B 2B1AL 3DO3A 4XPHH 3RTQC 5D2NB 5J3HC 3S37X 5TQ2H 2DWDA 5I71B 3MV8B 1OCWH 4U1JB 3AREC 3EW3B 4K2UH 3MOQA 4PJCA 4GUPA 2APXA 1FNLA 4NT6B 1YMME 3UTSE 3OKLA 2OR7A 1Q1JL 2LTQC 1BGXH 1JHLL 4HIEA 4LSDA 5L6YH 4XP5L 4Y4HC 4KI5C 1T2QL 2R9HC 1INQA 1NGQH 1ACYL 5DJZA 5BRZB 3IF1B 5I73C 1BFVL 2GAZB 5CGTA 1AD0B 1NDGB 4QRPB 4FXKA 3P30H 4RA3A 4H8WL 2PW1A 3K7UA 1F4AA 4PDCE 4RZCB 1H3PL 4DGYL 3ARYA 3KGRA 5F7DA 5KSUB 1YN7B 4PJAB 3STLA 1C7SA 4OLWL 2FRGP 2MKWA 3ZKNC 2BVPA 2NR6D 4MAYD 3QUXD 1PGRB 2DLEA 5CIPH 4XAKD 4RISL 2DJSA 5HVWA 5ABDE 5D7IE 43C9B 5IFHL 2IWGA 5H8DA 4OGYH 2VC2L 2FH6A 2AS5M 4XZUA 2YRPA 4GBXD 2L7UA 2VLJE 1Q72H 4NM4H 1VHPA 1CXHA 2EDLA 5CBEA 3DX9A 1REIA 4ZUUA 1VA9A 4JPIB 3ZTNH 1JZ6A 3FMGL 4FQCH 2HVKB 4ESKA 3ISWA 1JN6A 3E3QC 2AJSL 2IAMA 4RFEB 4UZGA 2HKHH 3NIGF 1A7PL 5CGMA 1JTOA 2YC1A 3SKNB 4WTZG 1SY6A 1T1XB 2IC2A 4JFFE 2PNDA 1CE6A 4NQVA 4EUPG 3K2MC 1UCTA 2BNQE 3R06A 5EIQA 4L3EB 1F11A 1X5GA 1AKJA 3QXAB 3OZ9H 3SDCC 1I1AA 5E0QA 5ALBH 4LLYA 1WSST 3VRJB 2X4QA 5ITFB 3RA7L 3JVGC 3TT1L 3K80A 1E6JH 3UJJH 3BN9D 3CU1A 3VXSB 1FRGL 4QHNA 4R3SA 1QSFB 4QYOA 4NO5B 3SDAB 2FIKB 3MRIB 3GEWB 8FABA 3T0DA 4OF7A 4NSKB 4DK6A 3LDBB 1V7NH 5KS9E 1NCDL 1ZWIA 3KPSD 1MCPH 1S7RA 3LQAC 5F7EH 3WFCH 4XMPH 1PG7X 4FTVD 4GAYA 1IEBB 4QRRE 2J3SA 1UWEH 4NQDD 2X1PA 4JZOB 2I24N 3O6FC 3F7YB 2GSIB 2GYSA 2JJTA 4QOKE 1CFSA 2P8PB 5EWIL 1T20B 4XCCL 3SE4A 3VFMB 5IWLC 3WDIA 1G7LA 1D5BA 1FNHA 3MGAA 4P2QD 4R4BA 3SCMC 3FQXB 4X7EC 4EBQL 2YD4A 4JG0H 4Z7VB 1P5VA 4WW2A 4QLRA 3MSPA 1EEQA 3BPCB 4DVRH 4DZ8B 3I2CL 2XOTA 1Q94A 1AR1C 3EBAA 2EDNA 1ZT7A 2YPLE 4NKIL 2ARJB 4ZAKC 4UT9L 3DURB 1OT1A 4E41A 1RFDH 2FHCA 4PJ9A 5A2IH 5AEAA 1KCLA 5IV2A 4PJHB 5L9DL 4FXGA 3TVMD 4PRPD 1JVKA 3UTZA 5K93A 3MCKB 3O9WB 1LO4H 4PJFF 3BD4A 1RJZB 4XP1H 4S1DC 3GGWA 2C26A 4PJIA 2H2PD 4JANA 1DBJH 4LLVB 4HBCH 1F58H 2GT9A 2MQ0A 1UZ8B 5TGBB 4YNYA 1T80A 4PTUA 3ZSTA 5KSBB 4MD0A 3BZFA 2EEBA 3U4EA 3SDYH 1I7TA 1P7QA 3MLVH 3O2VL 4FQQA 2X4SA 3LKOA 3WNPA 1OB1A 4WIQA 4R0LA 5A43C 4ENED 1UA6H 4EN3B 1K85A 3UMTA 1XF4A 4I3RL 1YNTB 3KPOB 5IHLB 1MVFA 4JRXE 1UM4H 2Z4QB 5EC1A 4DZBB 1T03L 4Z7NE 4U1LB 3Q6GL 5E2WH 4XPTL 1S9YA 1KBGH 5ID1B 1AXTL 3CSGA 3MJ9A 4IIQB 2JB6B 2E7LC 3FB5A 3ZTJG 1FN4A 5CMAB 1RURL 4F2MB 1DSFH 5C08B 5D7LB 5J1SC 3PGDB 1O7VA 1IBGL 3WFZA 2FATH 3B4NA 3V8CA 3BKYL 4ORGB 3OMZA 5DEGA 1UQSA 3HG1A 1MRCL 1I3GL 2APBA 4PJDE 5EZOL 4PB9H 2X4OA 4QGTA 3P9MB 4WWKA 2MPAH 3Q1SH 3FN0L 3STBA 4C56A 4HS8L 5FYKL 1YEIL 2EH7L 2OK0L 2ZZUT 1PKQA 1AJ7L 4HF5L 3QO1A 4LHUA 3L5XH 4NZTH 5J4MA 3KYAA 2VDLH 4MS8C 2NXZB 3LEVH 2R69H 1LHZA 1QQDA 1J1PL 2BNRA 4HKJB 3QR2A 1PDKA 4NQCA 3C08L 3LKQA 4DTGL 1QACA 4X9IA 3HPLA 4YFLF 4Q6IA 4WWKD 5F7MC 1A7OL 1JV5B 4K3DL 5K59F 4JPVH 1UVQA 3EYVB 4PJ7F 3H9ZA 7FABH 3N9GH 1EH9A 5T1LB 5EU5B 1EV2E 4PYHA 5CEZE 5KSAB 1UH4A 3ULVE 4ZMAT 2BVOA 3NA9L 3U2SB 2X1OA 4P5MA 3O0RL 3VMNA 2IANA 1QR4A 4JFPB 4HW6A 5HYQB 4XCEB 4JZNB 4ZUVA 5IB4B 1HXMB 1S9WB 3GBNH 5DJCA 4G7YL 1C5DA 5HI5C 4OB5H 3A6BL 3CDGB 4N1CA 5E8PA 12E8L 2XZQL 1U42A 1IQDA 1PYWB 2H26B 5F96L 4F7TA 4BK4A 4OF8A 1AD9A 4Y7MA 2J88L 1EEZA 4L9LC 1I85A 5DURD 5JZ7C 1D5ZB 4J2XA 3CX2A 1MPAL 5IMLA 4M5ZH 4AEHL 5ESVA 3K8LA 1R6VA 1XGPA 3GJFH 5FIEA 2DDQH 1IGMH 4TOYH 3QULB 3DUSA 1S5IL 5C86A 1A4KA 1D9KA 1P9MC 3ET9F 1ZTXH 4LVHC 4AEIH 4BSVA 4HMEA 4LBEA 1JP5A 4U1NB 2ITCB 4TULH 1F90H 3O6ML 4UV4H 4X7FC 5EU6A 3VWKB 5EUOB 1NCWH 3IDJB 2VSCA 5EIIB 4J6RH 3KJ4C 2F54D 4ZUWB 4XMKH 1JNLH 1Z9OA 5J12B 4LARH 2GY5A 5IB5B 3BUYB 3BN3B 5E00B 3QO0A 1R24B 1BD2D 1D5XB 1S5HB 1S9VA 2XNAA 5DR5H 1BIIB 3OKDA 3UTTA 1A6PA 2WWKT 4K8RC 2W9DL 1KCRH 3LRSB 3PHOA 4NRYB 5SX5K 5DJ6B 5I1LA 4WNQA 4XWOC 5I66A 4ONHA 4FP8L 2Y1VA 4LCIL 5CJ8A 3PJSB 1P53A 4PGBB 1DANU 1UM6H 3BRFA 3GMRA 1IE5A 5KN5B 3V0VB 1MRDH 1YEDA 4JO4L 5HYJE 5IVNA 5L88H 4OUUA 5B22A 4XNZC 4HK0A 3MQIA 4CU7A 2XN9E 1MJUH 2NW2B 4NIKB 5HHVL 1MJ8L 1S7UB 2CGRH 2Q1EA 3DX8B 1TTGA 2JF1A 5GGTL 3ERYA 2XKNB 2BFVH 1ZVYA 1FGVH 1HI6A 1G7HB 3DTXA 5B38B 2XWTB 2FWOA 4M43L 4LKXA 5AYQA 5CIPA 3AAZB 5CGYD 3OR7B 3LN5A 4ONFH 4XNUH 1BJ1J 5D5MF 5EN2B 1VACB 1CXIA 1FL5A 1KCSH 3NPSC 2I9TB 5DI8A 5CZXD 5F97E 1MJJB 4X7TB 3GI9L 3UJIL 3M17A 2ADJB 1RAMA 4NN7C 2FX8H 4HIJA 1PVHA 4HJ0D 1ZS8A 4MA1C 3ES6B 3TO2B 1KPVA 3EO0A 3ARGB 3BZ4B 2ZSVA 5DA4A 1KB9J 5IB1A 5TDOA 2UZXB 3ZE0F 4LPYA 2DLIA 4N0CC 1LP9E 4O58H 2ZUQC 3QFJE 1PSKL 1BQHA 3G04B 3JV0A 4IRJD 5J56B 1D9KC 4LCCC 5EC2A 2PO6D 4RGNC 2VLKE 3T3PE 3L3KB 4P23A 1YDPA 5K9KB 1KG0B 3MLRH 4Y4FB 2P8MB 4U3HA 1Y18A 4MNQD 4UAOC 2X7LB 1I75A 5IGXL 5JLZA 3IDNA 1RZKL 5F9OL 3TBTB 3LOWA 3VCLB 4QTHB 4Q97A 3I6LE 5CJ5A 4IHOB 2BMKB 5FYLE 5ILTL 4YBQC 3BEWB 3IVKB 3TIDB 5JW3H 4YBLB 3MV7E 4QXTB 5ISZD 3UO1L 2PR4L 1MAMH 1YN6A 4MWFA 2IALA 1M7IA 1KT2A 1UC6A 5CEZL 3ULVL 1M71A 5LVEA 5JHDE 3TO4D 2WUBL 1VADA 1EO8H 2A6JA 5J6GB 1IGIL 4LLQB 1ACZA 1T7VA 2DQIH 4PTTB 2A73A 1MWAL 3UBXG 3THML 3HTLX 1XGRB 2DLTA 2P4AB 4ZS7H 1CR9H 5E5UB 1R5IB 3MLWL 1FFPB 1ZHBB 2E6PA 1RI8A 5GS0L 3E0GA 4YHYC 4HKBA 1UB5B 4ZNEE 2I9LA 4BQ9A 5JPNB 4F7PB 2AK4D 1IAKA 4P2OB 5J89A 3QIBA 1CDUA 1FZKA 1S7SB 4B41A 4LSSL 1DVFB 1YPZE 1B4RA 3MOAH 2HFEB 3LKNB 3RWJA 3HR6A 5C0FB 1Q0XL 4O2CB 1GVIA 4DW2H 4YDIH 4UMGA 1KGCD 2OTPA 4K3JH 1EFQA 3SQBA 2AJZB 3MRHB 4FQXC 4LF3B 1FVEA 3C5SA 5CEXA 3LEYL 2NY3D 3FQRB 3NN8A 2ZOKB 1AY1H 1MQKH 1LO5A 4JKPH 3NCYS 4XP9H 1URLA 4U0QB 1W72L 4Y16C 3ZE1F 5BS0B 5EG6C 1CE1H 2V5TA 3ZYIA 2IMMA 1MREL 3KYMA 3T2OA 4B7IA 4G8GB 1BQUA 3FT2B 4KFZC 4KI5E 5DJ0B 4E5XA 5E2UL 1U9KA 2W91A 3GDBA 3B5GA 4KRPC 3TT3H 4MB4A 5BJTB 2R56H 5DHYB 1J18A 4N0UB 2F8OA 3TN0D 3MLTA 1L0XA 4WI4A 3KYKL 3U48A 1J1XL 1QG3A 2XFXB 1RZJC 1U3HA 3IXAB 2FECI 4KWUA 3LKSA 1YNKL 4LGPB 4GW4B 5FYJD 4PV8B 4IS6B 4Y19D 3D2UB 2VDMH 3HA0A 2EE6A 5GGSY 3MCLL 3P9LA 2O5YL 4LVNB 5EULV 4WO4B 4WV1C 1S9KC 2VDRH 3ARRA 3TH2T 4KJQC 5TF1L 4I3SL 1A7QH 4KZDL 5TJWK 3OL2A 4EI5C 3FQTB 1RIUH 1GGCL 1MFAH 4JRYA 5A2KH 3O4LD 4D9RE 1FIEA 3LQZB 4WEBH 5FO8A 4V1DB 4YDJA 2R0ZL 1Z5LA 3ZKXB 5HHOD 3E3QE 5E6ID 1N6QH 1NAML 4YXHL 3B9DA 1I8IA 1OAZL 2ZPKH 3PUCA 5KVFH 3GSRB 3I75B 1SHMA 3NACL 1T1YB 4XNMA 1JF6A 3BRGC 1JUFB 4JRYD 4OLXL 3AMLA 4ZUSB 3D69B 3KXFA 2Z31A 4S0SD 3SDDD 3QNXA 1KN2H 3RDTA 2X1QA 1INEL 1OSZA 1RIHH 4Z7OF 3MJ8A 2B20A 4HH8A 4LEXH 3V7MA 3ZZ1A 4LP4A 1FL3A 4LPCA 1AHWB 5I2IA 2DMCA 4HEME 4FZ8L 1WITA 4O51A 2H3NA 2W92A 4P4RB 3IDMA 4JCLA 2VXSL 4GMSH 4HKXA 4MVBA 5HI3D 4F80A 4PJCE 2HMIC 1ETZB 1ZT1A 3MODH 1QSEE 1ITBB 4OCRH 4ZFZB 5C8JA 1FFOA 2YUVA 4P2RE 5IHZB 1SJEA 1NBVL 4HT1L 3QUMB 5C0EA 4JO2H 4NNXB 4JFDB 3VE0B 5LGHH 3TNMB 5DFVC 2APWA 2FX9H 3BEVA 5ADPL 4MAUL 3WN5B 4XNXH 2YPKA 1IC5H 3QUKA 3TJHD 5J6HB 2GY7B 5JW4N 3MRGA 4HUWA 2Q7YB 2V2WB 2E6QA 4PB0H 1EEYA 3PQYA 1JNHB 4PIRF 1KLUB 4TNWF 4NHCH 1NC2D 4PYGA 4R7DB 4AG4L 4J1UA 3L7EB 4RIRB 3OAUH 2VO5A 2BC4A 2R2BA 3LQMA 4NZRH 5JW4R 2DQUH 3ZDYF 2NY0D 3CGTA 3GJFA 5HD8D 1FH5L 3T1WA 4NQUA 2WWMC 1U58B 4HXBL 2EDKA 3FO9B 1R3KA 4GQ9L 5J1AA 3U0TA 4MGXA 4DFIA 1YC7A 4F33B 1U8KA 4F58L 3V5HA 1JRHL 4GO6B 5INCB 1H5BA 5I1AB 1NGXA 3U4AA 3N85L 4MJ6A 1YQ2A 4YGVB 3MA7A 2FR4B 3KHOA 1FGNH 3LPFA 1FYTB 3CCHB 4HUVA 5A2LH 1T1WA 2HJKB 3GMQA 1N3NB 3H0TB 5E1AB 3VXMB 1FAIH 2DI7A 3P0YL 4R97C 2YRLA 1CLYL 4I0PA 2J6EH 5EOQL 3DV4B 2RBLA 1TZHB 4XCNB 5ETUA 1SM3H 2AXJA 4MJIA 4M7ZC 4TUJB 3L3GA 1CN4A 1IAOB 2VZTA 5HGDA 1AI1L 3LKPA 4ZXBD 5IKCB 4XHJC 4BFIA 3NGBB 1P4BH 3RNQA 3FO2B 1QSZA 3HNTL 1Q9WB 1CLCA 1VFUA 3VU2A 2A6DA 4MD5A 3MNVB 5CD5D 3STZA 2XPGA 4ZTOH 4JG1L 2ATKA 4DGIH 2E7LE 1A6ZB 5I30H 2H45A 1FNEA 3C5ZD 5EOCH 2OSLB 4QHUB 5GRZA 5KJRH 1G6RA 3H9SE 4L29A 4MZ2A 2PW2B 4X0KA 4G6KL 3UTSB 4TSCH 3G5VB 4MQSB 3VFWA 3WEXA 4Z7VF 3FQWB 3DX7B 2RCSL 4X98B 5ADOL 1RK0A 1F6LL 5ACZB 3HCVB 3IFPB 3PWPA 3PWVA 3QI9C 5EBGA 5BMFH 3WHXA 1KTDB 3CVIH 2ARWA 3MX0A 1JK8A 4JKKA 4KQ4L 4Y4KA 1VCAA 3O6LH 2VDNH 1TZGH 1U36A 2K7PA 4XBGA 5TDPA 1CGXA 1LD9B 4M7LT 4Q9QH 3HZMB 1KUMA 2FB4L 4CJ1A 2FEEL 1TMCA 1QKZL 5LWYL 3TYGL 3FONA 3UZQA 2VAAA 5JW4Q 3VW3H 1YZZA 4JN2B 2GFBB 4OZGE 1F2QA 1BAFL 1SJHB 1R3HB 1G7JA 2IQ9H 4JFZH 3FOLB 5GS0C 5D7IB 2CRMA 1HOCB 4GT7A 3QQNA 4J4PD 2IPUK 5HVGB 3WD5H 5IB3A 4JRWA 1FG2B 2R29L 5D1ZB 3RVXC 2VDOH 4BSWA 1BVKB 1LO2L 4NNYB 3L5WA 1GOGA 1KN4H 3FAWA 4UDUA 4JHAL 4PJIE 4OV5B 1B4JH 5IVXF 1RULH 3SE9H 1U8NB 4UDTA 4PRHA 5HGAB 1NC4B 5K33A 2WZPD 1T21B 1VEOA 4XPGL 3MFFB 2BXYA 5FGCB 2DICA 4IMLB 2HVJA 1CQKA 4MXQA 4I0PC 4PUBL 5E2TL 1HH6B 5I8KL 4PJGB 4YUEL 5GJSL 1KNOB 3G9AB 2EDXA 2P5EB 4ALAL 4HWBH 1E28B 1EFXD 3SGDH 4XWGL 3WKMH 3T1FB 1VSCA 2HTLD 5LCVL 2D3VA 4ODWB 4L8SC 5IMKA 1IAII 3ZKMC 5I1KH 3CFBB 2DQEL 2PETA 2FNBA 5E8EA 2ICWI 1DBML 2ZP0T 4RDQF 2EIZA 4GKNA 4JFOB 1X7QA 4E42A 4GXUM 2MQ3A 2F53D 4UT6H 4G9DA 4YK4B 4KV5F 2FEDC 3C6LA 2V17H 3PNWA 5CHNB 4G80B 3OKEA 4L8BB 3VXRB 4Z7WE 4QRRB 3VGAB 5HHMA 3RUGB 4LSUH 3VFTA 1MH5B 1FLRL 1NGWB 4OQTH 4MXWH 1XGYL 3CSBA 4JHBA 3T4YB 3T2QA 1N5YL 1ZK9A 1FNGA 2I5YL 3OQ3B 2AXFA 3HRZA 2OJEA 1CDCA 4C56E 2XZZA 1BMGA 4JM2B 2KDGA 1UJ3A 5CWSA 1E27B 4QOKB 4TSBH 2YXFA 4H5SA 3MBXH 1S7QA 3PGFL 1MHPH 1F3RB 5GRVK 1HDMB 3IFOB 3GSQA 3QPXL 2QQQA 4Z78B 3NIFF 5E5MB 1OPGH 4EXKA 4U6VL 3OAZH 4NQCE 4HMDA 5ID0B 2BSTA 4RFNB 4KGJA 3NFPB 1WBYB 2PCPB 3RGVB 1MOEA 3Q6FA 1SY6L 1DLFL 1JHTA 3ESVF 4XXDB 1AGFA 3LN4B 1KJ3L 4XTRD 4WU7A 4HFWA 1VB9A 4KY1H 5FO7B 5GS1A 1CT8A 3IDGB 4ZSOE 1SVCP 5DRWB 3HUJF 4LLWB 3BP4A 4XP6H 5DC9B 3IGAB 2EEAA 1EVTC 1WISA 1CZ8L 3WS6C 4MA7H 5CEYA 3KJ6H 3DVGB 3IU3A 2E7HA 1PZ5B 4OZHE 3U0WL 2DOCA 1QO3B 3VA6A 4HLZG 1IGJA 2X4TA 2ICEA 2LU7A 4KXZH 1DEEA 5FGBA 3LS4L 1EJOH 3VXUD 4G8EB 1MI5D 2G75B 4GRWB 4A6YB 1FL6A 1S8DA 3I3BA 2A9MH 3EYQC 4RGOL 4KK9D 1DUZA 4PRIA 2X4NB 4PRDA 3RWGA 4M7JL 1B88A 1FVCA 2VDQL 4OCSL 1MCHA 3BAEL 4PS4H 3BH9A 1M7DA 3UC0L 1Q9KB 3FFDB 1N4XH 4PGDB 1RUMH 1L0YA 3QDJA 2WQ8A 3MRPA 3UPAA 1A1MB 5D1QD 4YHML 2OMBA 2DWEA 5IFAL 4JDVB 4Z9KB 4ZFGH 5EU6E 5KANI 3EHBD 2A0LC 2J8UE 3LD8B 5D7SL 3VA2C 2YUXA 3L3DB 3LH2L 3LRGA 3PL6C 4CVUA 3N1GC 4O9HL 3DLQR 2VOTA 1ZSDB 1LNUB 5BQ7B 2DKUA 3FL7A 1I9JH 2UVEA 5D7JC 1WGOA 3VWJA 4KTEL 1OGAA 5T5FH 1JGUL 1JPTL 2BNUB 3C6LC 1UZ6E 4WTWA 3SKJH 1TXKA 4R90H 3BXNB 3W9DA 5IFJB 2D4DA 4QTIL 4AIZA 3NTCH 3WL9A 4KDVA 2DI9A 1FCCA 4KKLC 3UTTE 3MR9A 4LIQE 2Y5TB 3D6GA 3I6GB 4OZFH 5HDBE 4R26L 1DQDH 1EXUB 3FTGA 2DF3A 3RX7A 2GJZB 5EO0B 4NO0B 5MEOB 2JK5B 2RJMA 5EU3B 4I13B 4EIZC 1KIPA 3DHJA 3S35X 3VXPB 2E9JA 4G9FE 4X7SH 2XTJC 3T65A 4PJEF 3QBTB 1NMAH 5BV7L 3SDXA 2Z91A 1JWSB 4M62H 5DD6A 3ULUC 5GS1C 3OKOB 1X5AA 3S4SA 1Y6NR 2C1OA 2OR8A 5FM5M 4AH2B 2E7MA 3DBXB 3GBMH 5T33L 1JNNL 2ICWA 4P46B 1KIQB 4RMUA 3U36A 5IROC 5CP3H 3L6FB 3QQ3A 1J11A 5DD3H 2Q3ZA 4OV6F 4OZIA 4WENB 1U92B 2ZG3A 3SGDI 1C1EH 4Z0XB 1YMHB 5DMGC 3HZYB 2QV2A 4YFEA 3F6IA 3BGAA 4M48L 4DQOL 5CUSH 1JGLL 4MLIA 1G9NL 5ERWB 1A7NH 3REWB 4BZ2H 4PJ5D 4EUPB 5C6TH 4LLUA 3ULSB 3QDMB 3CX5J 3MUGA 3SBWA 4EDXA 5ICYB 1X4XA 4OI9A 3N06B 2F5BL 3A67L 3HAEG 4R2GC 5FUZH 1J8HB 2W9EH 3ZYJA 5H2BB 1OTTD 5L0QC 1JGEB 1IKNA 4HGWB 4OFPA 1JZ3A 1P6FA 1OAYH 4CBPA 2IQAB 1JHKH 1YQVL 2H32B 5J11B 5C09D 4M3JA 1DQLH 3L7FA 2A77L 6FABL 5GGVL 3RWEB 1M05B 1YJDL 5C0BA 2J6EA 5B3NA 1AP2B 4ZTPH 4X80L 4MNHB 4WGVB 2ADFL 5HYFA 1BQLH 4X8JB 3KDMB 3VGBA 3DROB 3U0PA 4NO2A 2Q8BL 3KS0H 1P1ZB 4GKSB 3MNWA 2DIBA 3E1F1 2XWJA 5DJDA 2VERN 4V2BA 4RRPG 4M6NH 1H0DB 1RZFL 1EA9C 1E6OH 4MSWA 3F58L 4MNGB 4P48A 4N0FA 5AWNL 1MFNA 3VFSB 5DD0H 3JTTA 5EFIB 2W0KA 4V3EB 4KHTH 2WBJD 2WIIA 1K5NB 4YDKL 1UWXK 3V4UL 2AXGA 2EE9A 4YHZL 4XHQA 4HMCA 4RWYL 3ARDA 2WM0A 4LSRL 4W6YB 3P4LA 4ELMA 1AFVL 5KZCD 1UACH 5KVEH 3VFGL 5DJ8B 2XYCA 2XN9B 3GNML 3J7HA 5HY9B 2EDYA 4H1LG 4TQEL 2WV3A 2GTWB 3FZUD 1WFOA 1DUYB 5LGJA 4NGHL 5GGVY 2YK1L 1NKOA 3ARDD 1EHLL 4XVJH 4N8VA 3I84A 2AEPL 5E7BA 3KYOA 1JPSL 3QSKB 2PYFA 1CXEA 4JJ5A 1ZLUK 1SBSL 4BH8A 1K2DB 4MAYC 3QUXC 3DOSA 4HKZB 3UYRH 3OJVC 2O5ZL 1FO0L 2CLRB 4DVBB 3QA3A 1QPXA 3IKCB 3CSYB 1BEYL 4GBXC 4D9QD 5DVKA 2EO9A 4IRSD 3BQUD 5EO9A 5JIHA 1N8ZB 2IFFL 3X13A 3EYSL 1L0QA 3F7PC 4XAWH 5INDA 1CFQA 3BH8A 1Z9SA 4YZFF 4PGCB 2EYRB 5TQ2L 4AIXA 4LIQL 1A6UL 5TPWL 2DYPD 3T8XA 1LP9B 1A5FH 1Q9OB 4JO1H 1R3LB 2G5BB 4K2UL 4M6MH 5CP7A 3HR5B 4WUUD 1K8IA 4B7LA 2VLKB 1GHFH 2OMNA 3RWIA 1C8PA 3DIFA 1YEKH 3N1PC 3HZVA 1BGXL 1D6VH 4XXCC 3JWDL 4FRWA 4JR9L 4HWBA 1IGFH 4YH6A 4HS3B 3GMMA 1W8OA 2QQKH 5FM4A 3DSFH 1NGQL 4ZODA 2IH1A 3AS3A 3BN9C 5D2NA 2CMRL 3P30L 2NY6B 3VFUB 2F8XC 3MV8A 4U1JA 5E8DH 1JPGB 1HZHH 1UWGH 4XPFH 3A6OA 4JJHA 3K81A 4NT6A 4WHTB 4ODXB 5DDHA 4JM4H 5CJQL 2ATPB 1QA9B 2Y07H 2HTKD 4QRQB 4I18B 4OGYL 4OQTA 4UT7H 2OX5A 2XT1B 1MRFH 2YSSB 5LGKA 1ZAGA 3FQUB 4K94L 4Y88A 5BRZA 1HNGA 3KXFE 3ZTNL 3O3EA 4FQCL 1AD0A 1NDGA 4QRPA 1SMOA 6CGTA 3LMJL 4WY7L 4RZCA 1IGYB 1U95B 4GG6E 1BFOB 3PV7A 5KSUA 3IAGC 1H8NA 4Y1AD 2VQTA 1YPZB 1RZGB 5HVHB 2GUOA 4PJAA 3NCMA 5FYKU 3VFOB 4QCIB 5B39G 5JHLH 4GAGH 5IF0B 1SQ2N 5FHBH 1B6DA 4G42B 43C9A 1NANI 1P2CB 2YD7A 3FN3A 3OZ9L 3HPJB 5TDNB 4PGZA 2KUTA 3E8UH 3BJLA 5ALBL 4JPIA 1J8HD 4R9HA 5F21B 1CTOA 3KR3L 1T3FA 1T5XB 2E9IA 2LTQB 3CXDL 2C4XA 3EDDA 3WUWG 3TVMC 1XGUB 4RFEA 4Y4HB 2E5EA 2XTLA 5BW7A 1I3UA 3AU1A 5I73B 3O41B 3SKNA 1R5VB 1AE6H 1T1XA 3EOTL 3PQYE 4CNIB 4HZAA 2F9BT 3OF6D 5D9SA 4RX4D 2OLDA 4L3EA 5F7EL 5IBUG 3WFCL 3QXAA 4XMPL 4PV9B 2Y25A 4ENEC 1CTNA 3DRTB 2DQHH 3QUZB 1UWEL 2GJ6A 3VRJA 5ICZB 5ITFA 1JCKA 3FAXA 4P4KD 3VXSA 5ICXB 2Y6SD 4TVPH 3RWFA 1QSFA 4NO5A 3SDAA 4OCMC 4ZNCD 2FIKA 1YEFL 4BELD 3MRIA 5F9DC 2OZ4H 4NSKA 4JFYB 1WZ1L 1FCGA 2ILLA 4PJBF 4ZYKB 3IJHB 4X6CF 4ONOA 1IZJA 3QWQB 1IEBA 4Y2OA 5FECB 3DRQB 5J9PB 5T1DH 3P4MB 1U2HA 4OZFA 4JZOA 1RFDL 1EGJH 1LO0L 1WCQA 1KYOK 3F7YA 1CU4H 1UEYA 2GSIA 3OKKB 3NABH 4UOJA 4MJIE 4QF1B 2P8PA 3CD4A 1T20A 1ZANH 2DB8A 3VFMA 1IGCH 3ROOB 3DV6A 4PP1D 2LVEA 3KPPB 3FQXA 4APQD 3P40A 1ORSB 2A6KB 3IXTB 4O5LH 4Z7VA 1NBYA 2AW2A 1DBJL 4HBCL 2DQJL 1F58L 2VL4A 4E9LA 2A6IB 4I48A 3BPCA 3QIWD 5F7YC 4DZ8A 3FN9A 4N0RA 3SDYL 3MLVL 2D03H 2VYRE 5I74C 1JF1B 1XF2A 2ARJA 1F6AB 3IDYB 1XIWB 2A74B 3PP3H 5IVOA 3DURA 3RZCA 4CN6A 3Q5OA 1W8NA 2XWBB 5CP3A 3JWOC 5F9WC 5FF6B 1T0PB 2PF6A 3PXHA 1UM4L 4NN6C 5T3ZH 4PJHA 4D94A 3DXAD 3K74B 3RU8H 3HKFA 1G9ML 3MCKA 3O9WA 4P2RB 1F8TL 1RJZA 3EO9H 3KPRB 5AD0B 3T09A 3PWPE 3O6FB 4LLVA 5TGBA 1UZ8A 1A0QH 1MHHB 5GGRY 4X6BB 3RIAF 5KSBA 3RZCD 2B1AH 2NX5D 3OWEA 3K1DA 3SCMB 1OP9A 3D39B 3DX6B 1DSFL 3BGFC 4EN3A 3RI5F 5A2FA 3QEQB 1YNTA 3ME0A 3KPOA 5IW3A 1ZLVH 3CFKB 2FATL 4YE4H 4YQXL 4DGVL 1WTLA 2Z4QA 2FHBA 1Q1JH 3FJTA 1QRNE 3KPTA 4PB9L 5I15L 2NY6D 2MPAL 5ID1A 3Q1SL 1QFWH 3DYPA 1T2QH 5DD5H 1ACYH 5C9JB 4KJPD 3LV3B 4IIQA 1BFVH 2JB6A 2HAZA 2DM4A 2BY1A 3HE6D 3L5XL 4H8WH 2VDLL 3E2HC 1NEUA 3LEVL 2R69L 5CMAA 1M4KA 1H3PH 1X6LA 3GMLB 4L4TB 4PRHE 5C08A 5D7LA 3EDEA 3PGDA 3W5NA 4GRMB 4FFYL 5GHWH 2H8PB 4JPVL 1MCKA 4ORGA 2DJUA 3N9GL 7FABL 4FG6D 5T5NF 3RNKB 3W0WB 5IFHH 1TIUA 3P9MA 5H94B 1J0ZA 2VC2H 1VESA 3AB0C 2EKJA 1FNSH 3GBNL 1T66D 3V0WH 5C0CB 4OCXL 3RJQB 1RZ7L 4OB5L 5KS9F 2X40A 1CICD 3DYOA 3X3FH 1FZJB 4HKJA 4P5TD 2R1XB 3G5ZB 3AVEA 1JI2A 1J0IA 2MJWA 4FQIL 4RAUB 1JV5A 3TIEB 1P84J 3TF7A 3EYVA 3CMGA 5T1LA 5EU5A 4LSVH 4KK5D 5KSAA 1MFEL 5A16B 3U2SA 3H9SB 4P9HL 1PAMA 4JFPA 5HHME 3C60D 5HYQA 3QUMH 4XCEA 2DDQL 4JZNA 4MHHI 5E99H 2BSSA 1HXMA 1S9WA 5IB4A 2D0GA 1DN0A 1QBBA 2HT2D 3QHFH 4TULL 1C5CL 1F90L 3FFCE 2AVGA 1FRGH 5CGYC 5D4QA 5CFHA 2GKIA 5MP6L 4J6RL 2H26A 3T4AB 4YHIA 3B9KA 5IEKB 4XMKL 1JNLL 1F13A 5CZXC 3T2NH 4LARL 1TENA 4WI5A 4NKMB 1OP5K 1NCDH 2XTJE 1HE7A 1I4FA 3C5JB 4HJ0C 4I8DA 1PQZB 1D5ZA 1BZ7B 1J1OH 5HSFA 1KCRL 3ULUE 2P8LB 4JDZB 2VR9A 2CO6B 3QULA 4JLRB 4OZGB 4C83B 4AEEA 4PLKD 3EYUL 3OHXA 3BKML 5GGUB 1RSFA 4U1NA 2ITCA 3QDGD 1OARH 2PO6C 3VWKA 5EUOA 4IIQC 3IDJA 1UM6L 5EIIA 1RV6X 2FECL 4WDIB 3S37L 3PABB 4ZUWA 3K8MA 3F7RA 4XC3H 5FA4B 5IB5A 3BUYA 4I2XB 3OPZH 5E00A 5DS8B 1MJUL 1R24A 4N9GB 1D5XA 1S5HA 4KKCD 4X6DF 1BIIA 1BPVA 3I2CH 1K3ZA 4LRIA 2CGRL 2UUDH 3LRSA 4PRIE 2ZUTA 4NRYA 1TVBB 5DJ6A 2OP4L 2BFVL 2VWEC 4OT1L 1FGVL 1G6RL 1FVDA 1A6TB 3EIFA 1T89A 5EORH 4L9LB 4OLYL 3DI3B 1ED3B 3PJSA 4PGBA 4JQIH 3GIVB 3TO4C 2B4CC 3MPCA 1VDGA 5D8JL 5KN5A 4ONFL 4XNUL 1S7VB 4DAGH 5F7HA 3IETB 1KCSL 1IFHL 3TEUA 2L7JA 4N5ED 2YZ1A 4LVHB 2NW2A 2NY4D 2X4RB 5I1CH 3MRNB 2FX8L 3S36X 3O2VH 4RMTA 1HHKB 1OGAE 1S7UA 4JVPA 4F7CB 3KJ4B 4JEGB 4PJDF 5KSAC 2G2RB 1P69B 2IPKB 5FM5O 2XKNA 5SWZB 3ESUF 2EKSB 1G7HA 5B38A 4I3RH 4NOFA 3V4PH 2QSCH 3O8XB 2XWTA 5H37G 2YRZA 4AK1A 4O58L 1IM9B 2XG5A 2EDRA 1N7MH 5E6YA 4Z7WB 4GXUN 3AAZA 3ELAT 5L2KD 4Z95H 3OR7A 3Q6GH 4GLRH 5AAWA 2QHRH 1WAAA 3ZO0A 2XA8H 4WEUD 5EN2A 1VACA 4ZDHB 1KIUA 2I9TA 4HWEH 3MLRL 4OCYH 3N1FC 4QRSB 2ESVD 2YN3A 3BE1H 4YR6B 3WJLC 1MJJA 4X7TA 2VAJA 2XXCB 3OB0K 2ADJA 2NY3C 5C6WH 1P4LB 3ES6A 3TO2A 5SV4A 3FT4B 1WBZB 2LU4A 3ARGA 3BZ4A 5E9DD 3ULVF 5JW3L 4Z18A 4LU5L 4P49A 3G04A 5DUPL 3DGGB 4ZSOB 1MRCH 2D7PA 1CDGA 1RUQL 3L3KA 3TN0C 4OZIE 5K9KA 4JQXA 1KG0A 4Y4FA 2DQIL 3FN0H 3SJVB 2P8MA 4ZS7L 2HJLA 2X7LA 3MJ7B 3VCLA 3TBTA 5J12C 4QTHA 1B3JA 4OZHB 5GIRB 4IHOA 2BMKA 1BBJB 1EUUA 1S78D 3PXJA 3BEWA 4W6WB 3QJFB 3IVKA 1MCFA 3HC3H 3EJZD 3L3HB 2QSTA 3QWRD 1XMWA 3NPSB 3TIDA 4JY5H 4QXTA 1F97A 2HYMA 3UPCA 1CWVA 2FGWH 4M9PA 4NYLB 1YNLH 1A9EB 2FLRT 4K3DH 3B8YA 4AJ0A 4NN7B 5CSBA 1CDIA 4MA1B 3MOAL 4KUCF 4RAHA 1T89C 4JFEE 5C0CD 3JV6B 5F3BB 5J6GA 1EMTL 3NA9H 4LLQA 4DW2L 4PTTA 4YDIL 5FFLA 5D1XA 5E6IC 4K3JL 1XGRA 3O0RH 3WDJA 3MBED 2HLAB 1R5IA 2AJYL 1FFPA 1ZHBA 5E24E 3O6KH 3ALXA 4G7YH 4RGNB 5IBLD 1PKOA 4YJZL 5HYSG 3SY0B 3BISA 1AY1L 1MQKL 2J8UB 2ZNWA 4JKPL 3BZEB 5F6IB 5TE7H 1CE1L 5JPNA 4Y2DD 2IBZX 4F7PA 2KPNA 4P2OA 2GEEA 3SDDC 3INUH 2M8XA 5D1XD 2ENSA 1KJMB 1NCAH 1S7SA 1DVFA 3QWOB 3D5OF 2HFEA 4R7NB 4TN9A 3WIIH 3LKNA 1MCWM 5IHUL 2AJXH 5C0FA 4O2CA 2UWEB 2OQJB 2AJZA 3MRHA 4XNYH 2N1KA 4LF3A 1UENA 1CXLA 3CLEH 3D48R 3FQRA 3O6MH 5HI3C 4MMZC 4EOWL 4HUNB 5BS0A 4RCAA 1U8MA 3RPIB 1NMCB 2Z8VC 5EH1A 2VDRL 4G9FB 1F4HA 3FT2A 1PZUB 5DJ0A 2VLLB 3CXHJ 4YHYB 2J5LC 1A7QL 1RIUL 4UB0H 4X8XA 1MFAL 1JWUB 5BJTA 3WNLA 5DHYA 1PW3A 4Z5RA 4L4VD 4QHLB 5E03A 1XF5B 4N0UA 3VXTB 4P2QE 25C8H 1G0XA 2LFGA 4Y4FC 2ZPKL 1UFUA 3IXAA 4FP8H 4GW4A 4PV8A 4IS6A 4LCIH 3D2UA 3S9DB 1FNAA 3RJDA 4K9EC 1CLOH 4WO4A 2ADIA 1CDJA 5FXCH 4LFHD 4FQXB 5SWSD 1OAQH 1GZPB 4YBLC 2JCCB 2NY0C 5HD8C 1RIHL 5DK2B 2G5RA 4OQ1A 1CGYA 3FQNB 3FQTA 5HHVH 4LEXL 1NLDL 4XB8A 3LQZA 4S10A 4V1DA 4Y16B 4F7EB 2HJFB 4PRPE 3T3PF 5GGTH 5I18H 5L8JB 4HUUB 5DWUH 3ROLB 3GJEB 1MLBB 3GSRA 2SEBB 3TM6A 4GLRI 3I75A 4GMSL 4KRPB 1KOAA 4GRLD 1T1YA 2VN4A 1E4KC 5IR1B 2FJHB 2KQMA 4ZUSA 5EPMB 3D69A 1QZ1A 1ODAA 3LHPH 3GI9H 3UJIH 2WIMA 3O8XD 4JO2L 1N59B 1GC1C 5LGHL 1DVFC 3BD3A 1AHWA 4WV1B 4ETYA 3D25B 1MCCA 4CVZB 4F15B 5T3XE 5KAQG 4XNXL 5D2NE 5CZVH 2QADD 1NUFA 4P4RA 1S7XB 5DD1L 1I1CA 2YOCA 4EI5B 5CD5C 1NFDF 1I8LC 2VB5A 4NHCL 1TJIL 1ETZA 3OAUL 4ZFZA 3U9UB 1DANT 2DQUL 3QFDB 5IHZA 3ABZA 3QIUA 4MDJB 3QUMA 3VXNB 3PHQB 2DTMH 4NNXA 4JFDA 4U7KA 3VE0A 3TNMA 1YPZF 5E8OB 5ILTH 3WN5A 5FHAH 4K7PX 2YXMA 4QRPE 1OW0A 2JJVA 5J6HA 2N7AA 4N0YH 3S3SA 1AO7B 1G0YR 2PR4H 2Q7YA 2V2WA 1UCBL 2B5IC 1KXTB 3TJEH 1JNHA 1KLUA 4G43B 3QIUD 4R7DA 4JREC 4EJ1C 5CEZH 3ULVH 1FGNL 1G84A 3L7EA 4PJAE 2O26U 4RIRA 3SO3C 3K3QA 2P5WD 3TA3B 43CAA 4UV7H 2R0KH 1FAIL 5FKAB 3MLWH 1RHFA 2J6EL 4U1HB 5C9KA 2EH8H 3TCLB 3P4OB 1U58A 1SM3L 4PJ8D 3FO9A 4EUPH 4DFHA 5C0ND 4MJ5A 3WJJA 3RHWF 1UGNA 5FEBA 4J4PC 4F33A 2PYED 5INCA 5I1AA 1WT5A 4YGVA 3V6FB 1ZLWK 2FR4A 4NCC1 2YPVL 1FYTA 3H9HB 3CCHA 4ZTOL 1J7VR 5KVDL 3LS5H 1KLGB 2HJKA 1N3NA 3H0TA 5E1AA 5GRWA 5EOCJ 3VXMA 3TZVB 3GFUA 5E6ZA 4WHDA 4L3EE 1DQJB 4HDIB 2HLFD 3BP7B 1JTTA 3FKUS 1TZHA 4XCNA 2CR3A 1ES0B 1SEBB 4TUJA 4DEPC 4TSCL 2AP2A 1IAOA 1UXWA 5IKCA 2X09A 1AHWC 3FO2A 1R3JB 1Q9WA 4L4JA 4NPYB 4MQ7B 3T08A 1QSFE 3NIDE 3CAFA 3MNVA 2K9UA 3SGEH 2HTLC 4MCZB 1CFNB 1OY3B 4MQXD 4PY8I 4B50A 4OGXH 5B3JE 5BOPA 1A6ZA 1HILB 1H3XA 2YZ8A 5I0DA 3O6LL 1TZGL 4U05A 4Q9QL 3CVHB 2OSLA 1HN1A 4QHUA 1J1XH 4YFDB 2WAHA 1IEHA 1RUPH 2NY2D 3VW3L 5DGQA 3BP5B 3REVB 1QVOB 3UTSA 3G5VA 4I3GA 4FQ2H 5DJXB 3UTPD 1HWGB 1BD2E 2IQ9L 4JFZL 3FQWA 4NJAH 3DX7A 1DTUA 1BECA 1A6WH 5D93C 4X98A 5ESAB 4LOUC 4F8QA 5ACZA 3HCVA 3IFPA 4R97B 3WD5L 4YO0B 4K7FB 3WFDH 4KQ3H 1KTDA 1OW0C 1MEXH 2VDOL 3BGMA 2X42A 4KZDH 4M7ZB 1GGCH 1KN4L 3UROR 2VLRD 1IGTB 4OFYD 1RULL 1WZMA 2R0ZH 4S1SL 1YMMD 4W81A 3FB7A 3WXVH 4PJCF 1LD9A 3HZMA 4Z76B 1JPFB 5L8LB 4XPAH 3AM8C 1NAMH 4HPYH 4IOSD 1M7XA 1CG9B 4UUJA 2MNUA 4JN2A 2GFBA 4YXKH 3QUYD 4DJMA 1SJHA 1KACB 1R3HA 4HH9B 3FOLA 5D7IA 4M03A 1HOCA 3M45A 1FFQA 1U8IA 2JJSA 3L3IB 4PJHE 4U6HB 4HD9A 5D1ZA 4GSDH 4HWBL 3ZSSA 3QZWG 1BVKA 3HAEB 4NNYA 4MMXC 3WKML 3TFKA 2B1HH 3RVWC 2AQ2A 4OV5A 5C0DB 5I1HH 5I1KL 1U8NA 3BO8B 1NH6A 4K3GA 5KSBE 5HGAA 1NC4A 4L8DB 1UEMA 3QI9B 1T21A 3ZE2E 2I60H 3MFFA 4IMLA 1FLTX 2VLJD 1CGUA 3RVTD 4UT6L 1HH6A 2WQRA 5FYKD 4PJGA 1KNOA 2V17L 3BVNB 4KK9C 3ZDZE 3ZTJH 4Y0GA 4ZO7A 3ZYOA 4EI6B 3N1QC 1TQBC 2C7UB 2P5EA 2IH3B 3CC5B 2YD1A 4LSUL 4OQTL 4MXWL 3Q3GB 3T1FA 2JIXD 4FZEL 5FYLH 4ODWA 3H42H 4NNPL 3KLHD 5DK0B 5F7FA 2R0LL 4IM8A 3I9GH 1HIML 4JFFD 4TSBL 2P46B 4MAUH 3MBXL 2BNQD 2PXYD 1MHPL 3EHBC 2VQ1B 1VGEH 1N26A 3MLUH 2NTSP 4JFOA 1X5HA 4TTDD 5GGSB 3NCFB 3KYNB 3CPLA 4R8WH 3K4AA 1OPGL 2LU3A 1TCMA 5C08E 3QCTH 4ONGL 2WSKA 2YN5A 4OCNC 3W39B 3C2AH 5CHNA 5HHQB 4L8BA 3VXRA 4KY1L 4R4NC 4QRRA 3RUGA 1MH5A 1NGWA 4HG4J 2OS7A 4QHKI 4XP6L 3T4YA 5ISZE 2VWEE 4JM2A 3CMOH 1E27A 4QOKA 1VGKB 5I1IH 1TJGH 2F5AH 2OL3B 5C0RH 1HDMA 3IFOA 4WFGE 5DRXB 4F58H 5J7CC 4Z78A 3WNMA 5E5MA 4HX1B 3N85H 2FX7H 1EJOL 4L8SB 5ID0A 2D7OA 3WYRA 3NFPA 3RGVA 4XXDA 3V7AG 4LQFL 3LN4A 1A64A 1MHCB 4FQHB 4NHUE 5FO7A 2A9ML 2E6JA 3IDGA 3SKMB 2BY3A 5DRWA 4LLWA 1CLYH 3DVNB 4NQED 3IGAA 2MHAB 5EOQH 1T83C 5D1ZC 4GAFB 4IEFB 1N4XL 1RUML 3DVGA 2EXYD 5K9JH 3TFKC 4ZG1A 4S2SB 1TTUA 2DM3A 1PZ5A 1QO3A 1OP3K 2X4PB 1NLBH 1FFNB 5KVMC 3SGEI 1WWBX 3H3KA 2YPLD 1KGCE 3HNTH 4WW2F 1AGBB 4D0DB 5DEFB 4G8EA 2G75A 5I76B 4A6YA 1I9JL 5EZLB 3GBLA 3ARFD 1U6AH 4Z0BH 4ZPTB 4R90L 5JOFB 5F7LB 4HIIB 2Q76B 4LPXA 3NTCL 4BJLA 5B21A 1Q9KA 4PGDA 3ECBB 2CXGA 1OTTC 5IVZB 1RJCA 2E27L 3BX7C 1RJYB 3V95A 1QRNB 4PJIF 3T0EB 2RCSH 5ADOH 2X1WL 3L3DA 5EUOE 3MROB 1LO3H 1L6ZA 4FQLH 3ARXA 1ZSDA 1LNUA 5BQ7A 4PBXA 3ARSA 4RWHA 3OX8A 4XCFL 4QWWD 2AJVH 3AXLB 4X7SL 1NCUA 4N8PA 5FYJE 4HUXB 1ZHLB 4Y19E 4JRXD 1FBIH 4X4YB 3O11B 3BXNA 5IFJA 1ZGLM 1DBAH 2FB4H 4M62L 4LCWB 1S7WB 3G6DH 3QXUA 2Y5TA 5F8QC 3I6GA 4O02H 1CK0H 1JFMA 4BFEA 1ADQH 5DMIL 1BAFH 4UIMB 1EXUA 3D85B 4KPHH 3IFLL 3U7YH 2JLLA 5DD3L 3O4LE 1U8QB 2GJZA 4NO0A 5EO0A 1IMHC 3NZ8B 3ALPA 1IARB 3S8WA 2JK5A 5HHOE 5EU3A 2R29H 3TNNB 3OKMB 3VXPA 4TRPL 2WBJC 2CDEA 5MHSE 3C09C 5CUSL 3X14B 1ZOXA 4RFNC 5B39B 1MLCB 1A7NL 4BZ2L 2VDKL 4AQOA 5KW9H 5DUBB 3PL6B 1JWSA 4Y5YC 5K9QI 3OKOA 2NY5L 4Y5VC 1F4YL 3C87A 3D0LB 1TITA 3HI6H 1KCGC 3HC0B 1TQCC 5D7JB 3ZLQC 4AH2A 3DBXA 3ZKSD 4P46A 1KIQA 5FUZL 1KELH 1A3QA 1GAFH 2NXYD 5I8KH 1OAYL 3L6FA 3LQAH 3A0OA 1JHKL 1K4DB 3FZUC 1U92A 3WUWB 4MDIB 4Z0XA 3HZYA 1AH1A 1WAAE 2Q6WB 2BSED 5MENB 4WTZA 5ERWA 4WW1A 3REWA 4NCC2 4TNVF 1GOHA 4EUPA 1DQQB 4BQCA 3ULSA 3QDMA 3HMXH 5ICYA 5CEZD 3ULVD 5IBUB 1DBMH 2AJ3A 3D3VD 3KS0J 4ZD3H 4U1KB 1BJMA 4HHAB 4AM0A 1LE5B 4IRSC 3BQUC 5H2BA 1JGEA 4HGWA 3WHE0 4TPRH 2I26N 2IQAA 4X4ZA 3V2AR 2IF7A 4G6FD 4NP4H 3W2DL 2H32A 5C07D 4BYHA 2X41A 2CLVB 2IGFH 2CQVA 2ERJC 2VDPL 4OZHF 5DD0L 2XKSA 5I1DB 5IOPB 3RWEA 2Z9TA 4DKFL 2NCMA 1M05A 1JZ2A 3DARA 2D7QA 4BH7B 5JW5B 1AP2A 1KENL 5MERB 4ZFFB 4J3XA 4MNHA 3GHEH 3ZKQD 5JIKA 5T1KD 3KDMA 3DROA 1AIFB 3KPLB 2JJUA 4R4FH 2Y23A 1UACL 5KVEL 1P1ZA 4KJWD 3AY4A 5JQHC 1JYXA 3WXWH 4PY7B 4L5FH 2RHEA 4U33A 4KUCD 4YPGB 2GCYB 4Z7UB 4WI3A 3HB3D 3VFSA 4OAWB 2R1WB 5CBAB 3ARBD 3OV6A 4NO3B 5EFIA 4XVJL 5JMRA 1DZBA 3LB6D 4HPOH 2CK0H 4R2GB 3V6BR 4F9PA 3EOAB 5AUMB 3FB6A 2ENYA 1Z9LA 2EE3A 3U0WH 3UYRL 3W82A 5DJ8A 1BHGA 4IRZH 4W4NA 2XN9A 5HY9A 3NCEB 2NLJB 4FFVC 4X5LA 4ERSH 4L3CB 2ARJQ 5HDBF 4P46C 3DMMD 1EHNA 2CH8A 4RGOH 1DUYA 4M7JH 2W60B 5CJBA 1U8OB 5HYJD 2EE2A 4WI2A 1A5FL 3UC0H 4U31A 4JO1L 3IDIB 3CFEB 1NFKA 5IG7B 5F1IB 3WO4C 1K2DA 1GHFL 3P3YA 5KVGL 1YEKL 4OLEA 4DVBA 4JGMA 1L9NA 4YGAB 3IKCA 5BS0E 3CSYA 1IGFL 1KEMH 1PY9A 2QQKL 4OFKA 1GGYA 3DSFL 4KTEH 7CGTA 3IAPA 4G8GE 3ARWA 4JN1H 1N8ZA 3HE7D 3WFBH 3MV9D 4X99B 1NSNL 4PGCA 2EYRA 3IKKA 3P4NB 3BWUC 4JKMA 3KPNB 1LP9A 5TE6H 1Q9OA 1R3LA 2G5BA 4OLUL 3HR5A 3VJ6B 1HZHL 2VLKA 4R26H 3U4BL 3FOMB 3QG7H 4XPFL 5A1AA 1YUHB 5DXWA 5F71A 2EDFA 3H8NA 4FMKA 4JM4L 3G6JB 4HFUL 2Y07L 2DL9A 4HS3A 4KUZL 4F9LC 4UT7L 4S11A 1MRFL 3QFJD 3QUXB 5DFTA 1INQB 5DZNA 2M1KA 3HZKB 1LDPH 1OAKL 4P4KC 3MV7A 4QY8B 2Y6SC 3MXWL 2QKIB 1LK2B 1MELA 4V1DE 3VFUA 1Z9MA 3P9WB 4GBXB 1NGZB 1JPGA 4N5UA 5IJKA 1JNNH 1FPTH 5C0AD 4F9PC 1FV1B 4FNLH 4H88H 2X6MA 3MRCB 4WHTA 4XCYB 5FYLD 4WJ5B 4PBWD 5JHLL 4GAGL 2ED7A 4ODXA 2AABL 5FHBL 2ATPA 1QA9A 3EFDH 2YD6A 3MV7D 4QRQA 2DLGA 4QNPE 5HHXH 2CRZA 4M48H 4V2CB 1AGDB 2YSSA 3FQUA 3MJ9H 3B43A 3R8QA 5CBEB 3T04D 4C54A 5JHDD 2IPTH 3MRDB 1ZA6B 3FRUB 1CDHA 5FOJA 4H0GA 4PP1C 4I1NB 1U95A 4NFDA 4APQC 1BFOA 3MNZB 1EEUA 3T3ME 3VFVB 1YPZA 3BPLC 3U82B 2ZUYA 3VFOA 2AK1H 3BOVA 5JXEA 4QCIA 4LRNL 1CBVL 1AE6L 1PG7W 4L1HA 4K8RH 3QIWC 1L9MA 4G42A 2A77H 5FOBA 4G8IB 3AREA 4CW1B 1F11B 1L7IH 1P2CA 6FABH 4X6EB 3HPJA 5TDNA 4AY0A 1PFCA 1D7FA 1V05A 3PWUB 5EBWA 3OBAA 3KPSB 2ADFH 5JPMB 1T5XA 4XRCB 3RTQD 5CILH 4TVPL 3CX5K 3H3PH 2IFGA 1XGUA 4FTVB 2Q8BH 4Y4HA 3HI1B 4U6TA 1NCCH 4NQDB 4MA8H 2EICA 3O41A 4IMKC 2ZOLB 4GG8B 1R5VA 1DBBH 8FABB 1RZFH 5EBLB 4CNIA 4S1QL 1ZWIB 4UOW0 4P2QB 5ITBH 1VPOH 2ZUWA 4PV9A 4DN3H 3P11H 1MY7A 3DRTA 5GS2H 3PDDA 3QUZA 2VLMD 5D6DC 3V4UH 2CDGB 2XXMB 4LEOB 5ICZA 5J06A 4D0CB 2ICES 2JTDA 1BP3B 4LSRH 1CU4L 2E8YA 3NABL 5ICXA 1AFVH 3GSVB 1ZANL 5ECJE 1HINH 2NY6C 1G7LB 3GNMH 4OF3A 4HV8B 4R4BB 4TNVK 5IJKC 3CJJA 4KJPC 3I3EA 4JFYA 5C3TA 3WE6B 1V8HA 2DTSA 4F37K 1SJXA 2P24B 4ZYKA 2BJML 3IJHA 3TVMB 4NGHH 3E3QA 1FYTE 2IPUG 2AEPH 5FECA 3DRQA 3VXME 1JPSH 1A02N 4I18C 3VXUE 1S9XB 4E41B 1MI5E 1ADQA 4HWZB 4MA3B 3WNOA 2I27N 3OKKA 1X5LA 2QL1A 2NY1D 4FG6C 4QF1A 4LAJH 4D9RD 5T3ZL 4FABH 4OD3L 3RU8L 3ROOA 1INDH 4YHKH 4FXGB 3KPPA 4X5XB 2Y7QB 2D2OA 3UTZB 3FHQA 1ORSA 2A6KA 1Q38A 3IXTA 1PX3A 1MCEA 3JVGA 3UYPA 3FT3A 3GGWB 3VRIA 1A0QL 1T2JA 5IK3B 2E7BA 1N6UA 1T66C 2A6IA 2RIKA 3GM0A 4MD4B 3RAJH 1CICC 1JFQL 1JF1A 5BV7B 4LIQH 1F6AA 4P5TC 3DUHA 1A6UH 5TPWH 4PJXB 4LNRB 2A74A 4R0LB 5IT2H 3SDCD 1KPUB 4OSUL 3L3OB 1JGDB 1XF4B 2XWBA 5F72S 1QSEA 5FF6A 2J7LA 4D3CL 2D7MA 4YE4L 3AS0A 5BO1L 2BVTA 3BZDA 4P2RA 4RMSA 5M7QA 3JWDH 4JR9H 2X44D 4PRAB 3KPRA 1WF5A 4YLQT 5AD0A 1QFWL 2H9GB 3C60C 3BIKB 3O6FA 4GG6F 4LHQB 3DUUB 5D2LB 1MHHA 5DD5L 4X6BA 4G6JL 2HT2C 5DZLA 5EOTA 1AQDB 2DRUA 5IWLA 2CMRH 3HMXA 3MFGB 3SCMA 3FB5B 5DMKB 3D39A 3DX6A 4JVWA 3BHBB 4X7CC 3QEQA 4I77L 3CFKA 5GHWL 3WUZA 3QUZC 4PRNB 4AIOA 4A2MA 2QHLA 4AYFA 1CVSC 5I74B 5C2BH 5TQ0L 2JB5L 5CJQH 3TC9A 3CFIC 4Y89A 4ZAKA 4WWKB 5IW1B 1KB5B 4BQ6A 4OKVB 1C5BH 2VXVH 3QXVA 4K94H 4PLKC 5F9WB 5C9JA 3T0AA 3NCYP 3LV3A 1QLRB 1FNSL 4NN6B 2MFNA 3V0WL 3LMJH 4WY7H 3X3FL 3OAYH 3UBXA 4L4TA 3GMLA 2BNRB 3B2VH 5TH2B 4ZAKD 4DKEH 4GRMA 2FSEB 1IEAB 1NEZG 5FGCE 5HYSB 1T7ZA 3JTCA 4LSVL 4KKCC 3RNKA 3B9AA 4OF0A 4PJGE 3W0WA 3L95B 5H35B 1RZJH 3BGFB 3ZE0E 4XI5C 3X12A 2P5EE 2IAMD 3G5XB 3QJHB 3RWDB 3DSNA 3QUML 5E99L 3D18B 3UTOA 1I1FB 4ZUVB 5DURB 3QHFL 3KR3H 4BSJA 4CMMB 1XGTB 3CXDH 5I8CB 1FZJA 2EYTB 2R1XA 4KTYA 3B3IB 3G5ZA 2ZCLH 3SKUD 3IDYC 3TIEA 1HEZB 1XIWC 1AKJD 4N5EC 2EO1A 3T2NL 4OZ4B 2E7LA 1I1AD 4GXVL 3GO1L 3EOTH 1CD8A 3E2HB 9CGTA 2VN7A 3GI8H 5AZEH 1AQKH 5A16A 1T7WA 3ZT5A 3TWCL 1J1OL 1H15B 2F54B 3H9SA 3QEHB 3VXRE 1HQ4B 4XBEH 3RUGE 4C59B 5FDWB 1XGPB 1BD2B 4W6XB 1NUGA 3HFMH 4KVNH 4LBEB 1OARL 4P5KB 4NM8H 1SYSB 4X4MA 3O3DB 2DM2A 4N9OB 1FO0B 2CKNA 3ARZA 4P3CL 3AB0B 3T4AA 1YEFH 1U8JB 5IEKA 4XC3L 3WSQH 3OG4B 2QEJA 4Z77B 1U93B 3OPZL 4NKMA 2NTFB 4MS8A 1WZ1H 3I6KB 3QO0B 5JOPE 4RA0C 1MIMH 1PQZA 3JSSA 2W07A 3MRRA 4HLZH 5EB9A 2HRLA 3Q5YA 3OKDB 1YY8B 4JDZA 2X9XA 1U41A 5HHPB 4C83A 4JLRA 4OZGA 1LO0H 5GGUA 5EORL 4YPJA 1J05B 2R23B 1E0OB 4JQIL 4PREB 4WDIA 1OTSC 5DRZB 3PABA 2P49B 4DAGL 5FA4A 4TSAL 2O61A 4I2XA 4PGJA 4S0UC 2DQJH 5DS8A 1ONQB 4HK0B 4N9GA 2Q86B 2VUYA 3QEGL 4GRWE 4E41D 5I1CL 3AC0A 1S78C 4PJ9D 2OCFD 4JQVA 4OBSA 4JCMA 3K0WA 1X5JA 4PP2B 1GCFA 1V3LA 1TVBA 3D9AH 3VI4E 4C4KT 2VTFA 1DCLA 2CIIB 4WFED 3CLFL 1A6TA 2QSCL 3V4PL 3DI2B 5DMYA 4WFHE 4L9LA 2HH0H 1N7ML 4D8PB 3BDBA 3GIVA 3M8OH 2VABB 1F02I 3NZHL 4Z95L 1CXFA 1G9MH 1TJHL 5CIPB 1L8JA 2QHRL 2EDBA 1S7VA 3ZMRA 2XA8L 1DP0A 1P7QD 2P44B 1F8TH 1ND0B 1QPPA 3IETA 1OLLA 1P9MA 4HWEL 3V79C 3MBEC 1ZT4B 4OCYL 3BE1L 4IRJB 5K9QG 2X4RA 5JNYB 2PO6B 4WUUE 3MRNA 4LLAA 5IBLC 2Q87A 4F7MA 2DBJA 3E6HA 4DN4L 1HHKA 2Z92B 4I9WD 4F7CA 3CVHH 3EO0B 2G2RA 2IPKA 3MRQB 4Y2DC 4MNQB 2QR0B 5SWZA 2EKSA 1T0NB 1IM9A 4YQXH 4DGVH 4Z7WA 1A9BB 4DKAA 1CFBA 5DRNB 2FHFA 3GSWB 4R96B 1D6EB 1WIOA 4OD1H 5I15H 5ISZB 2D9CA 4ZDHA 2MOVA 3W5MA 3SO5A 4QRSA 4MQTB 1Y18B 1XT5A 4KAQH 3BWAB 2GSGB 3TO4B 1UKQA 1P4LA 3C8DA 4EVNA 3FT4A 2FL5A 1WBZA 3MACL 3HC3L 4JY5L 3HG1D 4JDTH 1G1CA 4ZS6D 1WK0A 2FGWL 4FFYH 5HDOA 1SJVA 1YNLL 1J0HA 3CZJA 4NHUB 4C56D 3DGGA 4ZSOA 1T6WA 5F6HI 2DKSA 3QH3B 3GSOB 2BY2A 3VXQB 2W38A 4LHUD 2AK4B 5HHNB 3SJVA 4BM7A 2W0FB 3HAEH 3WIFB 2BNRD 3MJ7A 4Y1AE 2ZUSA 4NQCD 5C3LD 3O6KL 4OZHA 5GIRA 1BBJA 3U83A 1V3MA 2XIDA 4OCXH 15C8H 3UXFA 1RZ7H 5KTEH 2CIKB 1CFTB 4CJ0A 3L3HA 1NDMB 4YWGL 1CD1B 3C2SA 3QDME 5TE7L 4JQVC 5HGHB 4UU9B 1Z2KA 2ZCKH 4M5YH 3MV11 4J3TA 1MJ7H 5FKPB 1XAUA 1QFWM 4FQIH 1A9EA 3INUL 2NY3B 1IL1B 1NCAL 2BZDA 4K71C 5GS2D 2IAND 4MCYB 2D9QB 1J8HE 3WIIL 2UZIH 1VFMA 3JV6A 5F3BA 1LDSA 2AJXL 1MFEH 5D7KE 5FDYA 4OIIL 5GGRB 2Z8SA 4P9HH 4RBPH 5GISH 3KPMA 4N0CA 1CIDA 1HQRB 2HLAA 4KDWA 4XNYL 1MCRA 3B2UD 4LCCA 3GRWH 3CLEL 3IAQA 3TBSB 3CFCH 4GRLC 1H3GA 1C5CH 3SY0A 2J8UA 3G5YB 4UQ3B 3TN0B 5MP6H 4JZJC 3BZEA 1FP5A 3ZDYE 1KULA 3OGOE 4H8WC 4NQXA 5DC4B 3ZYZA 2Q8AH 1KJMA 3QQ4B 1EK3A 4Y19B 3QWOA 3LRHA 5F7WC 1P84K 3EOBB 3O8XC 4R7NA 2ZJSH 1RY7B 2DS4A 4UB0L 1D9KD 5DT1H 3EYFB 4PY8J 5EU6D 2EZ0D 4MNGE 2UWEA 3U1SH 2QADC 2OQJA 25C8L 3GJFK 4H1LH 2H41A 1FNFA 3EYUH 3GUTB 1U3HB 3BKMH 3O4LB 4O2FB 3LVEA 4UNTA 4NKDA 2CKBH 5HHOB 1WBXB 5E6IB 1CLOL 3W11D 1EZVY 3S37H 3RPIA 2C3HA 3UTTD 4G9FA 1OAQL 2NNAB 2VLLA 5IJVB 3UJTH 1ZE3C 4A6YL 4MZ3A 4AMKH 3PWNB 1JWUA 4JRYB 2EDEA 4QHLA 1XF5A 1C08B 5DQDL 5EO1B 5I18L 3SDDB 2KL6A 5EU4B 3IDUA 3QZWB 2OP4H 4OT1H 1LEKA 1G6RH 1G7PB 5DWUL 2R4SH 4F8TA 4OLYH 1QYGH 2I25N 1XH3B 5D8JH 3EJYD 3MRBB 2IJ0C 4EDWH 4FQXA 3P0VH 1GZPA 1IFHH 2JCCA 4OCLC 3SDXF 3LHPL 4P59H 3FQNA 5IW6B 4PJ8C 4WU5B 3GKWH 3MJ8B 4M1CD 1KEGH 5C0NC 4Y16A 4F7EA 3OKNB 2HJFA 5SWQB 1TCRB 2HFTA 4HUUA 4OZIF 3SGJA 3ROLA 5CZVL 3GJEA 2J5LB 1JBJA 2H3NB 2SEBA 5JR1H 1A22B 2VXQL 2GK0B 4HKXB 5IR1A 4MJ2A 2FJHA 4BUGA 2NX5E 3OTTA 5EPMA 2FD6H 5F6IC 4Z7QE 3MA9L 2HLFC 5EUKB 1HYRC 3EGSB 1NC2B 3G6AB 3ORJA 5CD3B 1N59A 2DTML 4NZDA 4CL7A 1V5JA 4X7DC 4P3DB 1GSMA 4WV1A 3D25A 5BXFB 2AERT 5FHAL 4CVZA 3W81A 2I07B 1CL7I 2NY0B 2NZ9C 4N0YL 1S7XA 4LU5H 2BOCB 4EI5A 5I8EB 4P23D 1X4ZA 1WWAX 3TJEL 4BA8A 5DUPH 2NY7H 5IMMB 3SQOH 1Q9LA 4AL8H 1RUQH 1DLHB 4U1IA 4NUJB 3JTSB 3A6CL 2X9YA 3QFDA 4RNRB 4HZLB 4MJ4A 4UV7L 2R0KL 5F9JA 4MDJA 3S34L 1NMCC 2NY2C 3VXNA 3PHQA 5KBNC 2EH8L 5L2JB 4YBHA 4QHKJ 4ZO8A 5E8OA 1H9VA 5HBBA 1HXYB 1AO7A 3O2WH 4YHPB 1PG7H 4XC1H 3KNBB 4BQ8A 4OTXH 4BK5A 3VDCA 4G43A 4QRUA 4MJ6B 3EZJB 1CD9B 2L0DA 5KSVB 4UQ2B 4XH2B 4JVUA 1TNMA 4ZXBB 2AQ3A 1EMTH 3LS5L 3TA3A 4K07A 3U79A 2BY0A 2KKQA 4ELMF 2ADGB 2AJYH 1G7IA 4U1HA 3VXOB 3TCLA 3KLDA 3P4OA 3QUYC 3QIBD 3MZGB 5GSRB 3C5ZB 1AGCB 3P73B 2CK2A 5GSVB 1BIHA 3RWHB 4JGUA 2DQTH 1A14H 3V6FA 3SGJC 5HXMA 3H9HA 1YEGH 4Q58C 4OGXL 4PD4K 5IHUH 3ULUH 4U3XA 1KLGA 2Z93B 2J8OA 3TZVA 1DQJA 4HWNA 2B5IB 4HDIA 4UOW1 3BP7A 4DKDC 3UTQB 2BHYA 1RUPL 4JREB 3VRLE 1ES0A 1SEBA 3SO3B 3LZFH 3MGOB 1CGSL 4FQ2L 2AI0H 3BKCH 2EDJA 4EOWH 4NJAL 1OM3H 2B2XH 1IC1A 1A6WL 1YYLL 1LE9B 1R3JA 4F15C 4MQ7A 2QSVA 1RUKH 3UDWC 3WFDL 3RL2B 4KQ3L 4RGMC 3MLSH 1BM3H 1MEXL 4MCZA 3IRPX 1J86A 1CFNA 1EERB 4CAGA 3KLHC 1U3HD 1HILA 5B8CC 3WXVL 3F12B 4PJFB 2PXYC 4OIBA 4XBGB 4UNVA 3CVHA 5DVLA 4XPAL 5DO2D 1BF8A 4HPYL 3FONB 1QUNA 3BP5A 3REVA 4YXKL 1QVOA 5FA3B 5DJXA 3VD9A 1T0MB 4G6ML 2FH8A 1J5OH 5ESAA 4LFHG 2CDFB 4KHXL 4YO0A 4K7FA 4FQJH 1VKXB 4GSDL 3V5DB 2AV7B 4DEPB 3CXHK 5DVNA 1NLDH 2B1HL 2BVQA 1IGTA 5I1HL 4Z76A 1JMXA 1JPFA 4GG6A 2HKFH 4KRMB 2I60L 4PP8C 1EFXB 3S88L 3TA3C 3PP4L 3F65A 2C4FU 3N0PB 2P1YA 3KXFD 2Z31D 4HH9A 1ERNA 1NGYB 1ZV5A 3RDTD 2WUCH 3WBDA 2F74B 3B6SB 1OGTB 1U8PB 2DQDH 5GRXG 3L3IA 4U6HA 2F53B 4KZEL 2AEQH 3HAEA 4OLVL 4XVUD 4KKAD 3KPRE 5FYLL 2YEZB 1I7RB 3H42L 5C0DA 2EXYC 4ZO9A 5D93B 1FHGA 4LAQH 2K7QA 3BO8A 3O2DH 3I9GL 4PJAF 1JWMB 3QB7C 4L8DA 3QI9A 4MVBD 1IAIH 2DN7A 3HS0B 1QBLH 4PG2C 1VGEL 3MLUL 1HHIB 5DD1H 3TZVC 4H20L 1MFBH 4R8WL 1LEIA 3D39E 3QCTL 1C16B 4NBXB 3CH1B 3C2AL 3QEQE 4NJ9L 1XEDA 4ORZC 5EZJB 1TJIH 1X5KA 3CZFB 3BVNA 5E5RB 2VNCA 1PD6A 3OKEB 4EI6A 2C7UA 1KJ2B 2IH3A 3CC5A 4YHOH 5E9DE 3RQ3A 4I4WA 3Q3GA 4PJ7B 3MJ6A 4JFQB 4RRPA 1FIGL 1E4XH 1Z3GL 3GRWA 5DK0A 2OJEB 3CMOL 4LGSB 5I1IL 2YR3A 1UJ3B 3PQYD 5BOZG 1DE4B 4X9GA 1TJGL 2BVUA 3QEUB 2F5AL 1BJ8A 4KU1A 5C0RL 2EDDA 2VQ1A 1F45A 5GGSA 3KYNA 1R0AH 1CQYA 1UCBH 5DSCA 4L4TE 2HRPL 2FX7L 3W39A 4QWWC 1PLGH 5DVMA 2PUQT 5HHQA 4LPTA 5GZOD 3OGCB 1QNZH 1TLKA 2X4UB 3W0WE 3VXUB 3ARPA 3VGDA 1MI5B 4DOHB 2VXTH 4ODVH 4YDLC 2D4FA 3NIDF 3S97C 4H1LA 3S6CA 3G08B 1VGKA 5K9JL 4Y8AA 4ZOAA 5B3JF 2OL3A 2CKBA 1MFCL 3IU3B 1TQBB 1KJVB 5C0CE 1NLBL 4UTAH 1A3RH 5DRXA 1IRAY 4U1SB 4HX1A 2IEPA 4L8SA 2D0HA 5D1QB 2YPVH 4I0PD 1MHCA 5FO9B 4FQHA 5KVDH 1S8DB 1U6AL 4KROB 1GYAA 4MJID 3SKMA 4Z0BL 1OQOA 3OJMB 3DVNA 4D9LH 2MHAA 1NGPL 4K3HA 2DBLH 4HIXH 3MO1B 1X3DA 3UPRB 4CRPA 2NXYC 4S2SA 5B4MD 3F6LA 4NDMB 1RZKC 1MCLA 3MC0A 1FFNA 2NYYD 4X4ME 1AGBA 4D0DA 5DEFA 1LO3L 4XP4H 4FQLL 2YD9A 4XT1C 3RX8A 5EZLA 1CFVL 2AJVL 3OJDB 3VWJB 5D72H 4E0RB 4LCYB 4QXWA 4ZPTA 3L9RB 5ANMB 1FBIL 4UINH 3X3GL 5JOFA 5CSZB 4P57B 3W9DB 1A6VL 1DBAL 5I16B 3ULVC 5DF0A 4HIIA 3LN9A 3G6DL 1PEWA 4PJHF 5TF0A 1X4YA 1IAMA 3PWPD 1Y0LB 2EXWD 3VFRB 4O02L 1CK0L 1ADQL 4NZJA 1GOFA 1RJYA 3R0NA 1BZ9B 1QRNA 2HA1A 3VH8G 4KPHL 3FTGB 3U7YL 4KK8D 4Y4KD 5KSBF 3MROA 3QNYB 3ZE2F 5E4EC 3WS6A 3H7LA 3LKRB 1RJLB 4HSQA 3AXLA 1OTUD 4N1EA 4I2XE 1ZHLA 2FEEI 4X4YA 3O11A 4S1SH 5D5MB 4X9HA 3S5LG 2JELH 4ZOEA 5KW9L 2Q3AA 3ZDZF 1XF3B 4LCWA 1S7WA 3CSPA 3SGKA 1FJ1B 4KJWC 3HI6L 4O2EB 5SWSE 5KAQF 3MLXH 4KRNA 1KELL 3IB4A 4PJ5B 1GAFL 4UIMA 3D85A 3LQAL 3QXDB 4PG9B 3HB3C 3NZ8A 3CDCA 3V6OC 1FG9C 3ARBC 1SYVB 2XACC 4NKOB 2R2HB 3TNNA 4PFEA 4PRHD 5C7XH 3LB6C 2VE6B 5EZIL 1E4WL 3BIBX 5H37H 4M8QB 3X14A 4UTBH 5B39A 1YYML 1MLCA 4HC1A 1HKLH 5T3XH 5C09B 4MXQD 5DUBA 3PL6A 3HMXL 3P2TA 3RP1A 2A9NH 3D0LA 5F89B 3HC0A 4M7KH 5D7JA 4ZD3L 3RY6C 2PTVA 5GJTL 5SWZE 3QISA 4BZ1H 4TPRL 3DMMC 1F3DH 4NP4L 1K4DA 4OIAA 3R1GL 4K23H 5AZ2L 3WUWA 4MDIA 3GSNB 2IGFL 1E4XI 4FZEH 2Q6WA 2DIAA 5MENA 3SE3C 4YXLL 4NNPH 3BDXA 2MSPA 1F4WL 2VH5H 1K4CB 2R0LH 3FFCA 5ESQA 3GHEL 5DJAB 1DQQA 1HIMH 3H3BC 4ZFOB 2J2ZA 5FK9B 3C6LD 1RZIB 1I8MB 1ZGLB 3RKDC 5GPRA 5GRJH 4F3FB 2DKMA 4R4FL 4U1KA 2WBJB 1GGTA 4KKLD 1B6UA 4HHAA 2BK8A 4NC1C 3C09B 1LE5A 5HHMD 2DD8L 5DTFB 1K8DB 4ONGH 3WXWL 1A2YB 4L5FL 4HAFA 5KG9B 1J0YA 2W9LA 3HE7C 4M3KB 4Y5YB 1W0VB 2CLVA 5KZCB 3FFCD 4Y5VB 2VMFA 1KCUH 2X2YA 3T0EC 5I1DA 1TQCB 5IOPA 5HVFB 5JW5A 4HPOL 3BJ91 2CK0L 5IROA 5MERA 1NJ9A 3JWOH 4M93B 3GMOB 3SJVE 4ZFFA 1SEQH 3IJYB 1DDHB 2D31B 2XTJD 2Y06L 1UADC 1X5IA 5JW4M 4RMWA 2FZ3B 3ARDB 1AIFA 3KPLA 2B0SL 5D96C 3TBWB