3WS3A

Crystal structure of h-2d in complex with an insulin derived peptide
Total Genus 63
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
63
sequence length
273
structure length
266
Chain Sequence
PHSMRYFETAVSRPGLEEPRYISVGYVDNKEFVRFDSDAENPRYEPRAPWMEQEGPEYWERETQKAKGQEQWFRVSLRNLLGYYNQSAGGSHTLQQMSGCDLGSDWRLLRGYLQFAYEGRDYIALNEDLKTWTAADMAAQITRRKWEQSGAAEHYKAYLEGECVEWLHRYLKNGLLRTDSPKAHVTHHPRSEVTLRCWALGFYPADITLTWQGEELTQDMELVETRPAGDGTFQKWASVVVPLGKEQNYTCRVYHEGLPEPLTLRW
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system
molecule keywords H-2 class I histocompatibility antigen, D-B alpha chain
publication title Compensatory mechanisms allow undersized anchor-deficient class I MHC ligands to mediate pathogenic autoreactive T cell responses
pubmed doi rcsb
source organism Mus musculus
total genus 63
structure length 266
sequence length 273
chains with identical sequence C
ec nomenclature
pdb deposition date 2014-02-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3ws3A02
3.30.500.10 Alpha Beta 2-Layer Sandwich Murine Class I Major Histocompatibility Complex, H2-DB; Chain A, domain 1 MHC class I-like antigen recognition-like 3ws3A01
3DO7A 4ZQKA 4ENEC 2A73A 4BKLA 2BDNL 3OHXA 4O2CA 4XC3H 4GRLA 3VGAB 3MNZA 1YMMA 4IRJC 5FAAA 5IMKA 1U8QA 3X12B 2VDQL 2CK0H 4L4TB 3E8UL 5IHLB 3MRRA 4ETQB 4UZGA 4JZJB 4P59H 4IRJA 4GO6B 3VWJB 5AD0B 3CFEB 3DBXB 4NZUH 4PJAA 3PQYA 3RVUC 4L4VD 1NBQA 3VDBA 1E4WL 5DRZA 3HAEA 4LLAA 5EN2A 1TTUA 4CVXA 4ELKA 2EEBA 1X6LA 5E9DA 4XNMB 4QCIB 4ONFH 2CK2A 4PJ8A 3O3EA 4GKZA 4GBXB 3CH1A 3MCKA 5F9WB 2VZ1A 3MRJA 3QXVA 5ESQB 4NQCA 3S36H 4JM4H 1S9XA 2IQAB 2GJ6A 4HKBA 3RKDD 3RU8H 1A4JB 2XXCB 3MMEA 3CSPA 4MNQB 2AJXH 3U6RA 1BQLL 3O9WC 3DHMA 1WZLA 5E08H 3ULUD 1WCQA 4BUGA 3E6FA 2FGZA 1CD1A 3O9WA 1GVIA 5CILH 1PEWA 1CE6A 5J6HA 1VADB 3ARBC 3IFOB 3QIWA 5IW3A 4S10A 3VGBA 2XYCA 5EUKA 1QRNB 2ITCA 4IOSD 2CGRH 4KHTL 4DGVH 1OY3B 4LVEA 3BZEA 1ADQA 1SQ2N 3FQWB 3AS0A 1S9KC 1Z9SA 5C0JB 1Z2KA 5JPNA 4XPHH 3MGTB 3I6LE 4HHAA 2BVPA 1EUTA 3QXWA 1S9WA 2X4SA 2PXYB 4FMKA 4CVUA 5ILTH 4J3UA 2R1XA 3ARZA 2F19H 2DTMH 5BJTA 4FTVD 5SX4I 1CG9B 4V1DE 1P4BL 4JFHD 1OAXH 4KPHL 3E6HB 4XI5D 4O2EB 4YHMH 1DLFH 4TSAH 3RWEB 3A6BH 1YN7B 3TLRA 4OF5A 1BZ7B 5DI8B 4F8TA 2DYPA 3HAEH 3F7RA 3QNYA 4MJ5B 1F3DH 1TCMA 4DVBA 3QZWA 2OL3B 3QO1B 4I18C 5JXEC 3HC0A 2WV3A 5GSRB 3LS5L 5HPMA 4MHHG 3EHBC 2HTKC 4ZDHB 1IE5A 3FRPG 1CBVL 3C6LB 4LIQH 1XF4A 4MAYA 1DUYB 4WTWA 2F58L 1JHTB 3T0XA 1CGXA 1SYSA 3GGWA 3MBED 2PTVA 4ODSL 5CFHA 3BT2L 5IVZB 3H9SB 4GKNB 5D7SH 4M5YL 3BIKB 1N0XH 3C60B 3GM0A 5I1GH 3GMRA 1MWAL 1EDQA 2UWEE 1FN4B 1IC7L 4U1MA 1S7VB 1I1RA 2JCCB 5E00A 2UWEF 5C07B 3N9GH 3KAAA 4ISVB 2WIIA 4UTAH 3ULVC 3CFCH 2VTFA 3CK0L 3NIFE 4H0GA 1FLRL 3MRLB 3NIFF 4OCSL 4R7DA 1FVDA 2PO6C 3QG6A 4NBXB 1T2QH 3QJFA 4HUWB 3C2AL 3OKDA 2BX5A 1GOFA 2FNBA 3QPQC 2VWEE 1VERA 1QNZL 3QXDB 5FHBL 1YYMH 5L2JB 4UINL 1RK1A 4GT7A 2W60A 4DN4L 2YA0A 4HFUH 4DZ8B 4XCFH 1YYLH 5D72L 1KEML 5CBEB 1AP2A 4JFZL 3LEYL 5KVEH 2GJJA 4ZPVB 4JHWH 5C6PB 4EQ2A 1TENA 5L2KD 3IS0X 2B2XL 3B9VA 5I1LB 2O5YH 4ZNCD 4JFEE 8FABA 1N0LA 3S3JA 4IMLA 2J8UB 1JHLH 4PJ7E 5SV3A 1QSFA 4K8RH 3KPQB 2O61A 5IESL 4U1SB 3RUGA 4Z9KB 3BH9A 2DKMA 2ZUQC 4Z78A 1XGYH 5GJTH 1E4KC 2H2SC 2Z91A 2ICWJ 3GSVB 2KQNA 5E8EA 2HRPH 5MI0B 3FHQA 1FDLL 4IHOB 1JF1B 3UO1H 3HE7C 3U0TA 4OLZL 2X4RA 3RVWD 1E4KA 3UXFA 3QHZH 3NH7H 4AH2A 2P47B 2Z4QB 2LQRA 4HEME 4M6NH 1CFQA 3L7FB 3Q6GH 1IAII 2YRLA 3BDBA 1F4WL 3X13B 4LHUB 2L7UA 1LE5B 1UM5L 2HA1A 5A2FA 3VI4E 2R2CA 3T2NH 1N8ZB 3VI4F 4M7JH 4LEOA 4OF0A 4FZEL 1T5XB 4TNVK 1IGYA 2WANA 4KRLB 4R8WH 4Z95H 3LN5B 1XR8A 3U7AA 4FFWD 4NIKB 3BWAB 3L5WA 3GIZL 2W59A 1NBYA 4XP9L 2XACC 2YBRB 5CJ8A 4I0CC 2Q8BL 4FTVB 5E1AB 1NKOA 2ZCLH 3VXSA 1ZE3C 5HD8D 3ZSSA 2V5SA 3DVFA 5DQ9B 3FN0L 1LO0L 3TBYA 4LDEB 1J11A 3EOBA 5EOQH 5K9KA 3MLUH 3RTQD 2ZWLT 1DN0B 1FNSH 3FQRB 4FHBD 43CAB 4TOYH 1HH6A 4NHUB 2AV7A 1MH5B 3WIHA 5FO8B 4S1DD 1V7ML 1ZLVK 3UJJH 1LO2L 9CGTA 5IHZB 4O58L 5ANME 2R0KH 4WUUB 1MCSA 5F8RC 4Y1AA 2AP2A 2AJVH 2GK0A 5CHNA 4ZXBC 4ODHL 5DS8A 3BP7B 4C55A 2R69H 1PG7H 3MBEB 5IR1A 4PRDB 4R0LC 5DJXB 4OGYL 2P49B 3NPZB 4CADA 4OZGB 2AABH 3PWNB 3KJ6L 2OL3L 1GJIA 3MNVA 2DQGH 1OGAD 3VD9A 3MJ7A 1KGCD 3F58H 4OZIB 2IPKB 3OF6A 2HFTA 1I8IA 1TPXC 4IRSC 1NFDA 3VFVB 5DHVB 5H35B 2NXYD 1UJTA 4NQEE 4YFEA 3NBNA 3SDCC 3SKNA 3TA3C 1J0JA 3SDCA 3VDCA 3GK8H 2M26A 5AWNL 1RJCA 3GJFB 3U30C 3TA3A 2B1AL 4KXZI 4PJXB 2VITB 4WY7L 1TZGH 3UCRA 3IF1A 2R2BA 1ZT4A 2VOTA 3H8NA 1RUKL 3UYOD 5HHQB 1FH5L 4N5UA 3DXAB 5DVKA 4KKLC 2Y07H 4U6VL 2GW5A 4YC2B 1OW0C 3MSPA 5D8JL 3MRNA 1WT5C 1RZ8A 4GXUM 3KPMA 1F11B 5L2KB 5KANG 1WT5A 4NQDA 2X4PA 4Q2ZB 1RZJH 1WBXB 5DD1H 2VE6B 1I3VA 4DEPC 4JN2A 3IS1X 3CMGA 5C0EA 5KTEL 3ARYA 3KNBB 2JJVA 5JLZB 3QQ9D 3SGEI 5DO2C 5I15H 4XBGB 4FQJH 4TUKH 4NP4L 1G7JB 2NY5H 3CLEH 4NUJB 1EVUA 2YMXH 3FO1B 3WXWH 4KKBD 1XF3B 1VFOA 4TPRL 4Y2OA 3UYPA 4RIRA 2PW1B 2QHRH 4HIHA 4EOWH 1ACZA 3S37X 3H42L 1FZKB 1FAIL 3PWPB 4MNGB 1LO3H 3MLSH 1B6DA 5SV4A 4LSVL 1RZKH 2OR9L 1LD9B 1IM3A 3L5HA 4BM7A 3L3KB 4EVNB 1BBDH 4D0CB 4AENB 5BMFL 2Z35B 3QEQB 4XNUH 3KXFA 1HQRA 5EIIB 3CUPB 3RWJB 1K4CB 1I1AD 4ORZC 5C0BA 3RNQA 1OOAA 5ITFB 2Z31D 3V4VH 4JFXA 3ULUL 4BSJA 3R0NA 4LSUL 5HGBB 4YDKH 5DD6B 5I1JH 1LVEA 3IXTB 1MI5A 3ARGD 4CJ0A 4IDJL 2YUVA 3LKOB 4EI6A 4XNXL 4UTBH 3MOQA 4P4RB 5F6HJ 3SQOH 4M7KL 3AS2A 3O45A 3QDHA 2WBJC 1EEYA 5HDLA 2EE2A 3RTQB 1XGTB 1BQUA 5DD3H 5JOPE 2FGWL 3JBG7 2D7TH 3W0WD 2O5XL 4GJTB 4I5BA 5K9QG 3L3DB 2AEWA 5D7IE 3ZL4H 5JW3H 1X5KA 1G9MC 5D7IF 1BMGA 2DQUL 5KSVA 1BIIB 3KWWB 4QTIH 4JCLA 1OT2A 3G04A 5HHVH 5GS1C 1MSPA 1T80A 3MUY1 4YPGB 4K55A 4JFFD 4MLIA 5DUBA 3VGHA 4LCUA 3RVXD 5SWZA 1WIPA 5FUOL 4JJ5A 1T03L 5E6ZA 4WV1A 5ITBH 4OM1L 1T22A 2UVFA 2W9EH 2GITA 5H2BA 5E99L 2YOCA 5ACLA 1OGAB 5T1DH 3GFUA 4JKLA 1J0ZA 4PLKD 1XR9B 1UFUA 5BVJB 1NGXB 1TVBA 4M7ZB 1WZKA 2V7NA 4DFIA 1S78D 2NXYB 4IJ3B 2FHCA 3VFGL 5FDWA 4KK8D 4L9LA 5JTWA 5I8CA 4KGLA 1MCPL 2GSIB 4HXBL 3IKCB 4LPCA 3RBSA 1QVOB 1VCAA 5DDHA 3ZT5A 3CMOH 2V9QA 5DK0A 3ZKNC 4HF5H 1P7KA 4A2LA 3IDNB 4AIOA 2AJYL 3AB0C 4CNIA 4ZAKA 1VDGA 4QHNB 1M7DB 4EQ3A 3GSWA 5EFIB 1MHHB 1J8HA 3R1GH 3BW9B 1CLYH 1NJ9A 3VMNA 5IW1B 4L5FL 2OTWA 1GGBL 3CFJB 5I30L 3HCVB 3FO2A 4J6RH 1YEHH 2ESVD 2CLVA 4H20H 4X99B 3UPCA 5IROC 3A6CL 3L7EB 1HNFA 4HPYH 4R96B 4P5MB 2OLDA 4OGXL 1YJDH 1VKXB 1K8IB 5IROA 3PP4H 4P4KD 1U58A 2CDGB 1GL4B 2GTZA 1IGIH 2VZOA 3SDXB 3RGVC 1BPVA 1AO7D 4RSVA 5IF0A 4FFVD 1JUFB 1H5BC 3U9PL 4F3FA 3BP6A 4Z0XA 5A40E 4DOHB 5JOFA 3QQ3A 2CRYA 3ZDZE 5GGQL 5D2NE 4EDWL 2BOCB 3HNSL 4BJLA 4OIIH 3QUYC 3ZDZF 4MQXC 2DF3A 1IT9L 1W8OA 2FLBT 1I1AB 5F89B 1I85C 2A9NH 2JB6A 5GSVA 3VU2A 4I0PA 2Z31B 4LLQA 3BPOC 5DRXB 5IFJB 5GISH 1A3RL 2BNUA 1J5OL 4HZLB 1XGUA 4MS8D 3F7PC 4MZ3A 3ZKSD 5KVDL 2YS4A 1UCTA 5IGXH 1HXMB 3BVNA 1GC1L 4PJCA 5I75B 3ARGB 1BZ9B 1FC1A 4FXGB 4JQVC 2KDGA 3MV7E 2VAJA 1EA9C 3B3IB 4HH9B 4KJPC 5GS0D 3KJ4C 2X9XA 3QQ4A 2D03H 1ZHLA 1U8PA 1ZEAH 1NEZA 5GRVK 2WBWB 4F2MB 4RDQG 4MXWL 1QYGH 2VISB 1A5FH 3JV0A 5DJ0A 1GGIH 3DOSA 4DGYL 4HG4J 4LHQB 5KVMC 5GRWA 2IAMB 5SWSA 4PTTA 1X5GA 1ZK9A 1U91A 2YN3A 3T1FB 4HV8B 5L7XH 2YUXA 1R24B 1IZKA 1X5LA 1I7ZA 5IVOA 1UKQA 4YAQA 3TYGL 1HDMB 5L9DH 3ARXA 3LEVH 3NCJL 4MA8H 3FT4A 3WKML 4JFFB 2UV3A 2AK1L 2FSEB 7FABL 1YPZB 1A9EA 3ZKMD 2B20A 1AGBA 1F4YH 2AEPH 3IFLH 3SN6N 4U0RB 3GNML 1EEZB 4LEXH 3QRFM 3UJTH 4N0YL 2HT3C 4G6JL 2UUDH 2ATPB 3IDXL 4GMTH 1K3ZA 1CI5A 5FDYA 1W0VB 4JR9H 2R0WL 2ZSVB 2VXQL 2XKNA 3U2SB 2V5TA 4PJ5E 4CUCA 5E8NB 3MCLL 1WUNT 4XAWH 1MJJA 4AEIH 1A6VH 4BH8B 4Z7UA 4GAJL 3UBXA 1K5NB 4KI5D 4M03A 4O2FB 2XIDA 4ZSOA 2C3GA 3HRZA 1ZHNB 1DTUA 1I1CA 1G7PB 4W68A 4JFQA 5CBAB 4GSDH 1UXWB 5EORH 1T04B 5DRNB 3H2WA 2R9HC 3G5YA 1IJ9A 3W5MA 4YXHL 2DIAA 3HZMB 4PREA 1V7NH 4LFHD 5IUSA 1WWAX 2ARJQ 1QBAA 1J0KA 3NGBC 1IAIH 4XH2A 4QHUA 1PZ5A 3BKML 1FBIH 1CK0L 2HWZH 4MVBC 4OCMC 1JHKH 1NL0L 5IFAH 5KSBE 4B41A 2ESVB 1UT9A 2EYSA 5F7EH 3BRFA 1A47A 3SKJL 5DJ6B 1WWBX 2YD3A 5KSBF 2PYED 1F6LL 2WQ8A 4AEHL 5GRXG 4KVCH 1B2WL 1ZSDA 3WN5B 2WUCH 3MV9A 4DKEH 3ZE2E 4P4KB 2NR6C 3TJEL 5JNYB 1EMTL 3GRWL 3ZE2F 4JY5H 5J13B 1AO7B 1KXQE 4LLDB 3FHAA 2VLRA 2Z9TA 1ORSB 2NTFA 4Y89A 5FHAL 2YR3A 4Y16D 4R4NC 1SBSH 5JQ6H 4U1IB 3SE9L 1AGCA 3PQYE 4PJAE 5D1ZD 2W0FB 5DQJA 5CEXB 2ARWA 1IAIM 2AJ3A 4PJAF 3HHRB 4L3CB 5E94B 4OV5B 1NCCH 1CZ8L 5I17A 5ADOL 2ICWB 3W9DB 3CDYA 3FB8B 1AD0A 3AMLA 1IGTA 4HCRA 1TLKA 3RZCC 1HINH 2CIIB 3NAAH 5H37G 5GGUB 2Y36H 4NQCE 5B38G 1DDHB 3FB7A 1C5DB 5A2KH 3TBTB 1KJMA 2NLJA 1FE8H 4KRPD 4FQQA 4NQEB 3BISA 2X70A 5KVGL 2GAZB 2NY1C 2BNRA 1XCQA 1ZGLP 5TE6L 4LK4A 2VLJA 4KKCC 3LQMA 3C5JA 5FO7A 2LV4A 3P4MB 1HSAB 4YHYC 2VZSA 4JN1L 3SGKA 4OD1H 3BKJL 1LO5B 3V6FA 1P9MC 35C8L 4YHIB 5EC1B 4WO4D 4ZTPL 4G80A 1S9VA 3TFKC 4O9HH 4K9EC 1J05A 1YC7A 4Y19D 4YGVA 4KUZL 5FYKE 4QF1B 1MFCH 4LVHC 5CLTA 3LB6C 4JQIH 1XIWD 1U8MB 3IDGA 4KXZH 2HVJA 2JKXA 3BH8A 1A6WH 4FQ1H 2F5AH 4PGBA 4NNXA 2WSKA 5T3ZD 2V5RA 2NY2C 1JYNA 3T0DA 1KCSL 2X4OB 5IG7B 5DXWA 3MRMB 4QYOB 5C08A 3ZT6A 1G1YA 1UM4L 4JKPH 4MJIE 3KHOA 2XWJB 2QBWA 3UC0H 4K7PH 3S34H 2HP4A 3T1WA 2KBGA 1E6OL 4ODVL 3GZKA 1M6OB 1TQBB 5CSBA 4IOIA 3OAYK 3V5HB 2ATKB 5FYJD 5I1AB 1MJUL 4E9LA 4MD0A 2EYTA 3HB3C 3CXDH 1XGRA 4HCRH 5DUPL 1V3LA 3SGEH 5DFTA 1L9NA 4IM8A 1UVQA 1YNTA 3GSQA 5DC9B 3F12A 2ZOKA 3TO2B 4ZFFA 4AMKH 4HUMB 4JAMB 3DUUA 5ECJE 3CC5B 4P57A 2BY2A 2VDRH 5D93C 4XAKD 3WFBL 5EBLB 5E8PB 3I6GA 3HMXA 5C0CD 1FNGB 1KIQB 1K2DB 4OCYL 1MPAH 3RRQA 3BEVB 1NLBL 1D9KC 2C3WA 3BGMB 5F6IB 4Q9RH 4MMXC 4F7TB 1P2CA 5IM7B 3VRJB 1D9KA 1OAZH 2PYEB 2WUBL 5DLML 3UTZB 5K9JH 3S35X 4ALAH 1WZMA 5KZCD 3ULVE 1F2QA 4AT6B 3QUKA 3ULVF 5E0QA 3TT1L 2MTPA 1K9TA 4R7NA 5ENWA 3QFDA 2YRPA 5E1HB 4EN3C 2Q76A 4M7LT 5DHYB 2D4FA 15C8L 1MHEA 3ILQC 4IOFD 4J3TA 4H0HB 4Y16B 2VYRE 4EN3A 4N0CD 5D1ZB 4TVPH 3U0PA 5EU5A 3D2UD 1TMCB 1JGUL 4DW2H 1YNKH 3I50H 1Q9OA 1FFPB 4CU6A 3ZLQC 1NCAL 3RY5A 3TPUE 4G5ZL 3NFPB 5I6XC 1HHIB 3VFTA 5DR5H 1T83C 3WE6B 1L4IA 4MMZC 2VDKH 4G3YL 1AR2A 1S7RA 1OD7A 4U1JA 1Q0YH 3UTPD 2JIXD 5JORA 4BZ2H 5F8QC 3NACL 3PV7A 4MQ7B 1HILA 4NWTL 1MEXH 1QSFE 3ARPA 4KRPB 4X5LA 3OKEA 1TVHA 3I85A 2W07A 3KPTA 4K3EL 5T3XH 3RUGE 3ZO0A 3J8F7 1RJLB 2J8HA 3RUGF 4YHNB 1S7UB 4JDVB 2CRMA 4PRIA 3LKSA 2B4CH 3WHXB 3QFJE 2SEBB 5IEHA 4A6YB 3QO0A 2C9AA 2F5BH 3RWHA 4X9FA 1AGFB 4HK3N 4PJ9D 5I1DB 3GI9H 3UJIL 3AVEA 1JWUA 1CL7L 4Y5XA 4NN6C 1E28B 3FRUA 3P73B 4NM8H 2AI0L 3BE1L 3ME0A 3C9NB 3DRTA 4GS7C 5EA0H 3MJ6A 3M07A 1DCLA 1XIWB 4LCCB 5E8DH 4PJEB 1RURH 4BZ1H 4X4MA 1X7QA 1N5YL 3HZVB 2QQKH 2IADB 3MRIB 3MFFB 4X7TB 2QQLL 3OAUL 2GTWA 4JO3H 2W0KA 3HNVL 5GS0L 3VXSE 4ENED 4XRCB 2EH8H 2EEDA 4KKNA 3VMPA 3VJ6A 3GJFK 1L7TL 4OFYD 2FJGA 4OZ4B 1S3KH 4PJGA 1PJ9A 4JGUA 4XCNA 3HNTL 3LKNB 2D7MA 1KC5L 3STLB 4NO2B 5LWYL 3MACL 5TQ0L 4J4PC 5HHNB 4WWKA 1ERNA 4FFZH 2ZCKH 3QXUA 1AE6H 3O0RH 3QEHB 5JW4Q 4UT9L 5EU3B 3FL7A 5D96B 1IGCL 1V3MA 1G7LB 3RI5K 3TN0C 1BP3B 5DJZA 3TO4A 4Y1AE 1JN6A 3ALPA 2PETA 4WFGD 4R4BB 3RDTA 1AY1L 2O5ZL 3VXNA 3B2UD 5J11C 3D0VA 1FYTE 1TNNA 4PRHE 3UYRH 1B0GB 1OAYH 1OAUH 1WC7B 3GHEH 2XZQL 3S3PA 3SOBL 5C0CB 1OB1A 5JDJA 3IFNL 4QEGA 2EC9U 4U4BA 2W9LA 3BIAX 3B9KD 3U4EB 1J1OH 3M1BB 3GMMB 3MBXH 4MSWB 1RUAL 2WIMA 1I7RB 1NFDE 4XPFH 5I8OL 4G6KH 4U1HA 4HWZA 1NFDF 3ZSTA 3GBMH 5LQBL 1FFRA 3RWCB 1A6ZB 1IQDB 3IDJA 2EIZA 3OJVC 3ARBD 2DQHL 1YC8A 5E6IB 1IM9B 3PHQA 1L6XA 4KK5C 1J10A 1U93A 4HWNA 2XWBB 5JDSA 2EKJA 4HK0B 1G7HB 4ZO6A 4ZOAA 1LK3H 3HI1B 1G7MA 4LARH 1ZTXL 5C6TH 4E5XA 5C86A 4P99A 3O4LD 3Q5TA 3VCLB 4YK4B 3BRGC 5DZNA 3RL2B 4PJBF 1AQKH 3D2UB 4G7YL 3VRLE 2AJSL 4LLWB 3TIDB 2B1HL 4ZUTB 3MRHB 4UT6H 4EBQH 3LS4L 5ICXB 3EO9L 3I9GH 4NO3B 1Y6KR 1BLNA 4H88H 1KYOJ 3GSRB 3U4BL 1YUHB 3LDBB 1U92B 2BCKA 1H8NA 2N7BA 5AG9A 4Z8FH 5TH2A 1I9JH 4NQDE 2Z8SA 2H32A 2EDRA 5AZEH 1HHKA 2JIXB 2R23B 4NZDA 2NY7L 3V7AG 2P8PB 2Z92A 2LU4A 4DFHA 4RMUA 4X6EB 1FGVH 4RZCB 4R97C 3DETC 4WW2C 3QRGL 4C54A 2OZ4H 3D48R 4OZFG 3EW3B 3QYCA 5JXED 1IARB 2PW2A 4FRWA 1YY8A 4L29B 1Q9WA 3PGFL 5D2LA 3W9EA 3QIBA 3EHBD 3VWKD 4G9FA 5IB4B 3MJ9L 1JTPA 1SEQH 1N4XH 1TJHH 4RGMC 4I48A 5FECA 5DRWB 5DJ2A 2VIRA 3VE0A 3FT3A 4PJ9B 2VKXA 2I07A 1QLRA 3PABB 3B9AA 4JFYB 2G75A 2HJLB 3DLQR 3O2DA 3SE8L 3HUJA 1AXIB 3QCTL 5KVFH 5K59E 5C0BE 3MLYH 2BMKA 5DEZA 3WDJA 4WVRA 3TZVB 5K59F 4NJAH 4ONGH 1A8JH 1MCDA 4M61A 3S6CA 1OSZB 5BZWB 4BQCA 3MNZB 5JIIA 4X4ZA 3U9UA 1R5VA 4W6XB 1IGMH 4XX1E 1CXHA 5BQ7B 4A6YL 1CLOL 2PO6D 4UQ2B 3BJ91 2IBGA 4OBRA 3O8XC 3KHQA 1SJHB 4XPTL 4D2NA 3DURA 4PG9A 4HUXA 4M7LH 2HFFA 3MRKA 3GIVA 4AM0A 2XN9A 3V8CA 5TPWL 1FVEB 3LPGA 2EZ0D 2H32H 1Q72H 5F7FA 1F58H 1NCBL 2VLME 3ARDC 3CSYA 4GLRI 1ZVYA 2XWTB 2FL5A 3EOAB 1R3JA 1FPTH 3OPZH 2CRZA 1T1XA 3ARDA 5F3HA 1EHLL 1RMFL 4FABL 2QLVB 3DX8B 4NQCB 2OYPA 5KS9A 5EO9B 1HEZB 2GJZB 5SWZE 3X3FL 4KK6C 5LGJA 2X09A 4X8JB 2H3NA 1JFQL 4FQLH 1HHJA 5L88L 3B9KB 4G8EB 4MCZB 5D4QA 3EDDA 2YUWA 2XZZA 4P2YA 1NAKL 3JTCA 3O3BA 5D6CA 1PFCA 3WNMA 1D5BB 2Q1EA 25C8H 4PTUB 2G9HA 4POYA 1MVUB 4HS8H 3GUTA 3BP4A 3HE7D 5EUOA 4EZMA 3L1OH 1NBVL 3ARBB 1NCUA 2C3VB 4PG2C 3BOVA 1RY7B 2KH2B 4JY4A 5IHUL 4TQEH 1Q8MA 5E2WL 2FEDC 3AFLA 2R15A 5C0AD 3O4LB 1EXUA 5IB5A 4N8PA 1Z5LB 1LHZA 4PLJC 3RNKA 4HDIA 2P5WD 1DBJL 2ED7A 4PY8J 2NY6C 1HIML 4WFFE 3BO8B 4NKIH 4NBZB 3BSZL 3SE4C 3WFDL 3MLTB 5INCA 2IMMA 1LDSA 1EEQA 4X7FC 2EKSA 4MJIB 4KJYA 3GMLB 1Q1JH 4LSSL 2EDOA 3ABZA 2FX7H 4FOMA 2AJUL 1DVFC 2C4XA 4X6BA 4D0DA 3IAGC 4Y4KA 4N9GB 5IMMA 4IIQA 4NC2B 2RQ8A 4I18B 5F1NB 3BDYH 1BOGA 3EJYC 3L3OB 5HVWA 4HUVA 2XA8H 1SM3H 1J18A 4WDIB 3U46B 1QHOA 1AIFB 1G7IB 4FQ2H 2V2TA 1J9CT 1ETZA 4XVJH 1ES0A 5CKAA 4YQXH 1W0YT 3ARFC 3NFNA 4R2GC 1NC4D 3P0GB 4ZO9A 5HHOD 4ZXBD 3OKKB 3D0LB 1KIRA 1I7TB 3WFEL 5BS0A 5DJCA 3QH3B 1ROWA 4PRNA 3U7YH 4K23H 3HE6D 4ODWA 1YQ2A 1CFSA 1I8LC 4U1MB 3PWUB 4EI5A 5E00B 3ZTNH 4ZUUB 2A6JA 1U8NB 4PGEB 4LLYB 4AY0A 2R1WA 1KLGB 4X80L 4YX2H 3R0MA 3BXNB 3S96A 3H0TA 4LDLB 4IRSD 4NDMA 3WLBA 4PJCE 5CEZD 3H3PH 1OTSD 4YEEA 4K94L 1NBZB 2VDNH 4PJCF 3V6OC 2PO6B 1BD2A 3ERYA 1UWGL 3KLAA 3MRGA 4C59B 4MDJB 4NPYB 3TV3H 4YHLL 1X5HA 3FOMA 1RZIB 3UZEA 1T89A 3TPUB 3C8HA 4FNLL 5SWSE 5HYIA 4HUKB 2ITDA 1WBYA 4E41A 3LPWA 5DJAB 1SHMA 3SY0B 2BDNH 2FEEI 4RGNE 1KTLA 1TCRB 2I60L 3IFPB 3OR7B 5E7FA 2VDQH 1UCBL 4RWYL 2ZPKL 4MWFB 5IQ9A 4C83B 5C6WH 2D7PA 3VA2C 3OB8A 4JDZB 5KN5B 2RGSA 1T21A 1E4WH 3BFOA 1NCDL 3MRDA 4Z78B 3C5ZD 5DO2D 3HA0A 1CT8A 1QFUL 2XTJD 2BSTB 5EPMB 2F53D 2ZUQB 2GYSA 5IHBA 3IAQA 3SDDD 1EAPA 3FQNB 1EEUA 1QSVA 4WFED 3B5GA 3QFJB 2IGFL 2H45A 4GG6A 4Z7UE 1X5IA 3HE7B 1XH3A 1CFQB 4JKWA 4ZSOE 4Z7UF 4UIKH 2DMBA 3WSQL 3V5KB 1JPSL 1R0AL 4Q9CA 5C0AB 2ZOLA 3KGRA 4GW5A 3O4OB 2G60L 1BQLH 3GEWB 1FZOA 2VSDA 1XR8B 1ZS8A 2D0GA 1N3NB 3FZUD 4YR6B 4PRBB 2P5WB 1MWAA 5JW4R 1OAKL 3RQ3A 4G42B 2PTTB 2F54A 1R6VA 5DVLA 1NMAL 4KHTH 5EU7C 2VDPL 4WHYH 4LRNL 5C0ND 4Q9QL 1ADQL 4JGMA 3JTTA 3TJHD 5ID0B 4X8XA 1HCVA 2YEZA 5F7MC 3MV9E 5FYKL 1SJEA 3EYUL 2LAAA 1M7IA 2WBJD 5HGDA 3KPRA 4N8VA 3ZMRA 3VXQA 5CD5D 5T1LD 1ZGLB 2VLRE 3GSNB 1FJ1A 2BRRL 1NLDL 1F8TL 4KAQL 2VXTL 2ZCHL 3QNXA 1P4BH 5F96L 1QBML 1I9RH 5F72S 5A2LH 4UUJA 2GK0B 4GG8B 4KPHH 4KUCD 5DEFA 5FIEA 4U7SA 2YWYA 3GHBH 1NC4B 1FYTB 4ZXBB 5T33L 4PRHB 2NY3D 5EB9A 1MELA 4R0LB 1QSZA 1S7WB 3HE6B 3X12A 4L4TA 4ODBD 4XP4L 4ETQA 3LS5H 4JZJA 1PX4A 3REWB 3VWJA 1FNFA 4J8RB 5AD0A 4GW4B 4ORGA 3CFEA 1B3JA 5FM5O 5EBWA 3DBXA 2IANB 1CBVH 1YJDC 4IRSB 2BNRE 3UTSD 2F58H 4P23C 4JHBA 3RX5A 3TT3L 5BW7C 2E9JA 2RAMA 2VLJE 1BAFL 3BT2H 4QCIA 4N90E 3NN8B 5D1QC 4M5YH 4PJBB 1H3TA 1Q9LB 4GBXA 1MWAH 1ZLWK 1IC7H 4YO0B 5B8CC 4MA7L 5ESQA 3O6FD 2IBBA 3FT2B 3DV4B 2IQAA 4QWWC 3CK0H 3N1MC 1EO7A 2E3VA 1A4JA 1AI1L 3DO3A 3QCUL 5GGRB 1FLRH 4OCSH 2IEPA 3ULVL 1W72B 4ELME 4FP8L 3C2AH 4NQDB 5AYUL 4YUEL 4ELMF 5TJWK 5FO9B 2IH3A 2YD1A 3BUYB 4QRSB 1VADA 3MLVL 1QNZH 3BZFB 3IFOA 2FRGP 5FHBH 4UINH 2VN4A 1N64L 1QRNA 5C08E 3V0VB 4DEPB 1MFEH 5EU6D 3O6LL 1WICA 3WDIA 3DNKA 4DN4H 1ZA6B 3AXLA 3FQWA 1KEMH 5D72H 3G9AB 1ZKAA 5C0JA 3MGTA 4JFZH 1PYWB 3H6JA 1EBAA 3RGVD 3RWDB 1OTUC 2F53B 1OP5K 5J1AB 3C8DA 2ZUYA 3G5VB 1CQYA 4XB8A 4OCLC 2PXYA 4HC1A 2K1MA 3D85D 2B2XH 4G8FB 4OCWL 2EDHA 1JF6A 4QRRD 1OAQL 1IM3B 2E9IA 3WBDA 4KHXL 1UB6B 5BRZE 1KPRA 1CG9A 4LLVB 3VGDA 3KYNA 5DEGB 5DZOA 5HI4C 3E6HA 1O5DT 3QUYD 4O2EA 3RNQB 2G2RB 1EJOL 3UTQA 5IESH 3V6BR 3UPAA 1YN7A 5DI8A 1BZ7A 4PRPD 4MJ5A 3DVIA 3TBVB 1FDLH 2OL3A 1ZT1B 4AIXA 1K6QL 1EPFA 3EFFA 1IC4H 3QO1A 4GW1B 4OLZH 4QHMB 2MSPA 3TNMB 1X5JA 4F9LA 4PYHA 4MQTB 4POZC 5GSRA 5CZXD 4X7EC 1JGDB 1BFTA 1IGFL 2X2YA 4DAGL 3GSOA 2ZNXA 2DM7A 3EDJA 1F4WH 4CBPA 1BBJB 1R5IB 2VZVA 3O45B 4M6MH 1EEYB 4WNQB 5ICYB 4P3CL 1FQ9C 1DUYA 3MNWB 4ZOCA 2WBJB 5IBTL 4KJPD 5T1KD 2WWMC 4FZEH 3C60C 5T1LB 2CKBB 4LP4A 2IF7A 5IVZA 3E3QA 3GIZH 2I27N 3H9SA 4GKNA 4XP9H 5HHXL 1SBBA 1HK6A 3BIKA 2Q8BH 3C60A 1T7ZA 1FN4A 4P2RD 1S7VA 3KLDA 1KB5A 4GUPB 5C07A 4ISVA 4PJFB 3G04B 3FN0H 1LO0H 1AJ7L 4UV4L 3V7AE 1ITBB 3MRLA 1TZIB 3QDJD 4P2QD 5GS1B 1SJVA 4HUWA 5H2BB 3WUWG 5GGRY 4GLRH 5EO1B 1KCUL 1V7MH 3DJ9A 4RX4D 3WIHL 1TVBB 5FF6B 2H2PD 2VMFA 3GSNL 4OCXH 3QXDA 3ZTJH 4O58H 1AFVL 4NFBA 5L2JA 3E0GA 2HT3D 1KFAL 3OWEA 5I8CB 1U3HD 1NCWL 4ODHH 5D7JD 4DZ8A 4PJDB 3I75B 3NCYS 5CBEA 2FX8L 1FORL 4OGYH 4PBWD 4ZPVA 3H3BC 4PRIE 2RCSL 3KJ6H 1PGRB 1P84K 2OL3H 5DVMA 2AERT 5I1LA 5I9QC 2CD0A 3BGFB 3RAJL 3HC3H 4CW1A 2J8UA 3AB0B 3O6FB 2YD4A 4MD5B 2R9HD 2P46B 1DLHA 3KPQA 2FBOJ 4QO1A 1F3DJ 3P4OB 3L9RB 3BUTA 1LEKB 1K8DA 3WLWD 5JOEA 3GSVA 2UZXB 5AWNH 4D0BB 2XV6B 1JF1A 1CXKA 3QUXD 2XOTA 5F7WC 4WY7H 1F97A 1UB5B 4W81A 1RHHB 2Z4QA 4ZD3L 3BQUD 2UZIL 1M7XA 1RUKH 3O6ML 3L7FA 5EU6B 1A02N 3PGCA 1FH5H 3PL6C 4W4NA 4LHUA 2P24B 1LE5A 2NR6D 2QQNL 4PJGE 4U6VH 4OLXL 4Y7MA 4GAFB 3QT2A 3RGVB 5D8JH 1N8ZA 1ZANL 3R06B 1VA9A 1T5XA 2ZKHL 4R4ND 5JOFB 3LN5A 1W72L 4KKAC 3CDFA 1H5BB 3GKZA 4XHJC 5HI5C 4XI5C 2F74B 5B38B 4FTVA 4U7KA 1O0VA 5E1AA 5KTEH 4MZ2A 3LRHA 4WI8A 3N85L 2MPAL 4ONOA 3QUYB 1U8HB 2MWCA 4NP4H 4LSRL 3GSUA 5DQ9A 4LLQB 2B7DT 4S0TD 4Q74A 4YNYB 4TPRH 1ODAA 1DN0A 5AAMA 1FNEB 43CAA 4X98B 1MFAL 2G5RA 1K85A 3H42H 1FAIH 2F8VA 1MH5A 2DKUA 3BVNB 5FO8A 4PJCB 2MOVA 4LSVH 2OR9H 2QQQA 4HUUB 5ETUB 5IHZA 2BVYA 2NY1D 3WJJC 5BMFH 2NW2B 3WJLC 5FA3A 1U8PB 3BP7A 3MBEA 1KT2B 3KJ4B 4PRDA 2ARJB 5DJXA 1A7NL 3ULUH 3NFSL 4HBCL 1GZPB 4OZGA 1BQSA 4LSUH 3MOBL 2DIBA 3PWNA 4Z7NE 3TFKD 2J8OA 3EJZD 1UXSA 2Y72A 4P2RB 4Z7NF 4NJ9L 2DI8A 4CMMB 4YAQB 4OZIA 4IDJH 3K8MA 4XNXH 2KKQA 2P5EE 4HG4K 4XPGL 5ALBL 5DHVA 5H35A 3OMZA 1CQKA 1X5YA 3WUZA 3QDJB 4P2QB 3R8QA 2FGWH 2NY2D 4H8WC 2O5XH 4OB5L 3GJFA 2AGJL 5CP3H 4MA1B 5EU4B 3TH4T 4PJXA 2VITA 1OARL 1FP5A 2DQUH 1BX2B 2HJFA 3QI9C 5D7LD 3MREB 1UACL 1P69B 4YC2C 5HHQA 3B43A 1G9ML 3DXAA 5D7KD 2A38A 3GMPB 3ARVA 5D2LE 1FL6B 1W8NA 2I26N 4WW2F 5FUOH 1E4JA 1R3HB 1T03H 5D2LF 1F11A 5L2KA 2BFVL 4OM1H 5BXFB 2IQ9L 5E99H 4Q2ZA 1C5BH 2APWA 3EYQC 5B22A 1WBXA 2VE6A 1SY6L 4PREB 1FFOB 1WJ3A 3ORJA 4U3HA 3HUJE 5F1KC 4F7CB 3KNBA 4JG0L 3SKOB 5JLZA 4QHUB 4F58L 3HUJF 1ZLSH 3VFGH 4XBGA 1MCPH 5IKCA 1DJSA 1QSED 4HXBH 1CL7I 4NUJA 3NGBB 3OV6A 3V6ZB 3FO1A 1WIOA 4I1NB 5E95B 1G0XA 4OLEA 1XF3A 3EAKA 3JV5A 2PW1A 1DSFL 5L8JB 3FQTB 1FZKA 1XF1A 2AJYH 3PWPA 4MNGA 1A6TB 3DTXB 1LD9A 3GSXA 4OAWB 2YN5A 5DURD 1CN4A 3L3KA 3ULSA 2BXZA 4EVNA 3SBWA 4D0CA 2NTFB 5K9OB 1FVCB 2Z35A 3QEQA 5EIIA 2X1WL 2Q3AA 3CUPA 3LV3B 4FFWC 3RWJA 1S7SA 4L5FH 1GGBH 2HKHL 2XN9E 4WHTA 5I30H 2A9ML 5ITFA 4NCC1 3J7HA 5E5MB 1MCQA 3Q6FB 1A14L 1B88A 2CR6A 3A6CH 5HGBA 4P2CG 5DD6A 5HD8C 2B39A 2DM2A 4OGXH 2EE9A 1N6UA 3IXTA 4U05A 1IGTB 1QUNA 5CP7B 3LKOA 4YHPA 4P4RA 4DUWA 4S1RL 1MFBL 4YFLF 4JO2L 3RZCB 4J1UB 2OTPA 5E2TH 1KJMB 3RTQA 3F7QA 1XGTA 4S1DC 2NQCA 1C16B 5KSAD 3NCMA 3U9PH 3MV8D 4ESKA 3GMNB 1KELL 5BVPH 1RZGB 3BPLB 5GGQH 4EDWH 1PX3A 3HNSH 2BY3A 2NY1B 3V0WL 4OLUL 1LEGB 1BIIA 3ZYIA 4M48L 5EOCL 3TNNB 3KWWA 1EO5A 1IT9H 1G9NC 4U1LB 5EUOE 1Y0LB 4YHYB 5IEKA 3QDGD 4KTEL 4PB0L 5EUOF 4YPGA 2APVA 1PZUB 2X9YA 2ENSA 1A3RH 3OKLB 4HIEB 4NFCA 4JEGB 1Q9KB 4L8CB 1J5OH 3B83A 1JWMB 5IBUG 4N0UB 3D18B 4FQCL 4M7ZC 4FQHB 5KVDH 3FO9B 1U8OB 1OGAA 5I16B 1EHAA 4ELMB 1GC1H 2VH5L 1GPOL 1XR9A 2HG5B 4IJ3C 3Q5YA 4AQOA 5BVJA 1NGXA 4LVHB 5KJRL 1EVTC 4Q0XL 2VUYA 2BC4A 1AR1C 1NQBA 3RX7A 2CLZB 3LMJL 5MHSD 5HYJD 2GSIA 5JHLL 3IKCA 1LP9B 2D9QB 1QVOA 2NY2B 4LNRB 4RAVB 4WTZA 4MXWH 4EDXB 4ETYA 2ZUVA 4DGYH 1KPUA 4MA3B 2AXJA 4GAYB 3OR6B 5D7LB 2R4SL 2A77L 3TYGH 5LKNA 4QHNA 4MD0B 3NCJH 4J4PD 3AREC 4LVOC 3WKMH 5EFIA 1MHHA 1YEGL 4PB9L 1WCBB 1YNTB 5BRZB 7FABH 1MLBA 3BW9A 2YA1A 3RBGA 4PGCB 1F3RB 3IJYB 5IW1A 3CFJA 4FS0A 5EO0B 3HCVA 2O26U 3GNMH 4B7LA 3AU1B 4N0YH 4X99A 1EZVX 1KJ3L 4G6JH 1M71B 3L7EA 1URLA 4R96A 4P5MA 5BS0E 3IDXH 4GRLD 1YMMD 2V7HA 4XB7A 1VKXA 1K8IA 5D93B 2R0WH 2VXQH 1IBGL 4KKBC 2CDGA 2EDNA 5C0IA 2E6JA 1EGJL 4NZRL 1QSEB 3MCLH 3SDXA 2FJHB 1B9ZA 4TRPL 5F9JA 1F5WA 1T0NB 2H8PB 4G8GD 4ZNEE 4QRPD 4YHOL 1JUFA 5CSZB 1FZMB 3OJMB 3PQYD 1KUMA 43C9B 5CJBA 1XAUA 3IDUA 3KPNB 2FD6L 3LRGA 1MHCA 1J86A 4XBEL 5E9DD 2BOCA 4YXHH 1BD2E 2I9LB 1ZVSB 4OFPA 4PJ8D 3WNKA 1L6ZA 3O3DB 2Z31C 1C7SA 5GIRB 3BKMH 1N2RB 1I1AA 5F89A 2QR0A 3U0PB 5EU5B 5FKPB 2Z31A 1NL0H 3CU7A 5DRXA 4NKQB 2XZCL 2GJ6D 5F6HI 2G5BA 3WNNA 4Z7OE 3SKJH 4HZLA 3ZKQD 4QOKE 4E41E 4Z7OF 2YC1B 1GSMA 3K7UA 4RCAA 4JKMA 1B2WH 1QFWL 3DIFB 5I6XB 4PP8C 3ARGA 4QXTB 1BZ9A 4FXGA 3TJEH 3K4ZA 3GRWH 4OZFB 5KG9B 1MCIA 5CEYB 3OG6B 2DQDL 2CPCA 1A1OA 3B3IA 4HH9A 5FHAH 3QIWD 4DWHA 4OKVB 4JO1L 4D9RE 3QQNA 1AHWC 2AK4D 5KSAB 3AAZB 4F2MA 3DYPA 4K71C 5DMGC 3MV8B 4YLQT 4UDTB 5C0RH 2DQJL 3DETD 4N8CL 2IAMA 4R26L 3RVTD 4WEBL 5ADOH 4HV8A 5IP4A 4PRIB 3LKSB 1R24A 3BGAA 1GOHA 4D9QE 4GG6E 5IEHB 1LEIB 5F97E 3RVXC 1HDMA 4GG6F 3QDGB 1C12B 4JFFA 2FSEA 2BJML 1YPZA 1BWWA 2OJZL 4DK6A 4H5SB 1ORQA 5JR1L 2UYLB 2DDQH 5KVGH 1VFBB 3BZ4B 4NN6B 1EEZA 3KPOB 3P77B 1S78C 4GS7B 2ATPA 2GSGB 2E7MA 1W0VA 4FFYL 3NCCB 2ZSVA 2X44D 3CVHB 4C4KO 5HYJB 4JN1H 2F54E 3VRIB 5E8NA 2QSCL 3BKJH 4BH8A 1K5NA 1FLTX 4ZTPH 5DSCB 4O2FA 3WDHA 4K2UL 4X9HA 3ILPA 3VJ6B 4J3WA 2BXYA 3NOIA 1ZHNA 1T1WB 4XCNB 1G7PA 1HHGA 4UQ3B 2W92A 4LKXB 5CBAA 4G6ML 3VH8G 5C71A 4BA8A 4LPVA 4K9EL 1T04A 3KPRE 5DRNA 2ZUXA 3HZMA 4XBPB 5IV2B 2UZYB 4CKVX 2JB5L 3AROA 1BVKB 5JA8B 1FGNL 1A6UL 3WXVL 2CH8A 4WCYH 1KCSH 4G7VL 1JN6B 1RUQL 2HTLD 1L7IL 3UTTB 3SCMC 3OKMB 4CVWA 3IETB 3TN0B 4BSWB 1UM4H 4HMCA 4O5LL 4G6FD 5I2IB 5CMAB 1BGXL 2ESVA 5CGMA 3D0VB 1HYRC 5DJ6A 5HYSB 3N1FC 1P53A 3NCBB 1E6OH 3DUHA 5J11B 4ODVH 3WN5A 4C56D 2DOCA 4P4KA 1OB1B 5DD5L 5JNYA 4L4TE 1IQWH 4X7SL 2BNQD 4FFVC 1MJUH 2BOBB 1AO7A 4N1HB 4LLDA 5DUPH 2EC9T 1CTNA 1ORSA 4G8GB 3QA3B 4JZNB 2BVQB 4QRPB 3KLHD 4U1IA 3WIFB 4I3RL 2W0FA 5CEXA 5FCSH 2EIZB 4NN7C 3S4SG 1EHNA 4L3CA 5E94A 2X4UB 4OV5A 2MNUA 1FAKT 4ZFGH 1MAJA 5AEAA 4TTDD 3WFBH 1QACA 2ICWA 1JJUA 3W9DA 3FB8A 4I0KA 4WFHE 3HMXL 1PW3A 1UEMA 5I1CL 3SGJA 4OCYH 1NLBH 2CIIA 3NTCL 5GGUA 4MS8C 1DDHA 5IMLA 1C5DA 1P1ZA 2P5EB 3MJGX 4FZ8L 4NRYB 1QSFD 4PLJD 2WUBH 5DLMH 4WI9A 4MS8A 1DE4A 2ZUWA 5J89A 5FCUL 2GAZA 2P7TB 5B3JE 3TT1H 1VFAB 3KPPB 1KENL 5B3JF 3ZHDA 1WTLA 3P4MA 15C8H 1HSAA 3IXAB 3CSBA 1KYOK 1QRNE 1LO5A 2AK4B 3FFCD 1RV6X 5KAQF 4YHIA 1JGUH 1NCAH 4WW2B 5DQDL 4G5ZH 5D2LB 3W9EB 4QF1A 3BI9X 3VDAA 4G3YH 2EDLA 4TNWK 4I48B 3HG1D 2PR4H 2VIRB 1GGTA 3FTGB 2DLFL 3NACH 3ARFD 1T1YA 1G9EA 4NWTH 2X4OA 3VXSD 5IG7A 2W91A 4CVZB 2MCPL 4O00A 4QYOA 4NWUL 4PYGA 4K3EH 1J87A 4XVTL 4J3SA 1PSKL 4CL7A 2E6PA 3T4YB 1TITA 2LTQB 3RL1B 5C2BL 2E27L 5DGQA 3KDMB 1M6OA 4M61B 4KI5C 5J4MA 4U1NB 4AYFA 3ROOB 4PP1D 3P30L 3V5HA 2ATKA 5I1AA 2GEEA 3U9UB 2DQCL 4Z7WB 3VXOB 2NY0D 1MCWW 5EH1A 1Y6MR 3LSOA 3UJIH 2AJZB 1CL7H 2IH1A 4WUKL 2KQMA 4M6AA 4PG9B 2X6MA 3JSSA 2AI0H 3TO2A 4JAMA 1C5CL 3O8XB 5I76B 4LCWD 3CC5A 5CSGA 3MRKB 4ZYKB 1H8SA 3GIVB 3K74B 3PWLB 1U8KA 4P9HH 3S5LG 1N5YH 5TDNB 5E8PA 5EBLA 3E3QE 4BSVB 1F4XL 4Y4FD 4Z7VA 4ONFL 5F7NC 1FNGA 2QQLH 3QCVL 1KCRL 3UAJD 3X11B 3OAUH 1OL0A 1K2DA 3HNVH 3PWJB 3CVHL 5GS0H 2CQVA 5ACZB 3BGMA 1S5IL 5C07E 4G6FB 3IKKA 3LH2H 4F7TA 1QFPA 3RU8L 1L7TH 2HKFL 3VRJA 5IM7A 4BFIB 2PYEA 4H1LG 1U2HA 3UTZA 1HI6B 5F1SA 4GFTB 3HNTH 4AT6A 1S5HB 2VL5A 4C56B 5LWYH 3MACH 1T4KB 5TQ0H 5GZOC 4XPBL 2DL2A 3N06B 2BNQB 4Y16C 2OQJB 2D9CA 3KPSD 5TE7L 5DHYA 2BERA 4UT9H 1DBKL 4TULL 4Y16A 4JQXC 1IGCH 4LCYB 3O3BB 3HZKB 2CGRL 5D1ZA 4DGVL 4UOW0 2C3HA 4L4VE 1TMCA 1CGWA 5EUOB 1AY1H 2GK2A 1FFPA 4JRYB 2O5ZH 4H26B 4E42B 3NFPA 3RZWA 4JY4B 1HHIA 5F93C 3K2UL 3WE6A 2XQYK 2XZQH 3SOBH 3QWQB 1PQZB 4OCRL 3IFNH 2ZSWB 4X5XA 1Z6JT 2J8UE 2DTML 1MNUL 5L0QB 4MQ7A 1RUAH 4X6DB 5I8OH 1GOGA 5DWUL 1NGWB 1NUGA 2C1OB 5ID1B 3PNWB 3TCXA 3BJLA 1MF2L 3P11L 5LQBH 3VXRD 3ULUE 1RJLA 2DQHH 4YHNA 1S7UA 2GT9B 3ULUF 4UMGA 32C2B 4WO4C 2WWKT 4PGDB 1ZTXH 3WHXA 3T0EC 3QEUA 2SEBA 3RWFB 4A6YA 3FFCB 4KI1A 4LBEB 4K7FB 4WO4A 1AGFA 3CH8A 4G7YH 4LRIC 5I1DA 2CSPA 2AJSH 5C8JB 1DVFB 4QRQB 2ICES 2Q6WA 4Y19A 1T0MB 1E28A 3LS4H 4LCCC 3EO9H 3P73A 1KIPB 4LRIA 3KXFD 3C9NA 3U4BH 1TJIL 2WINB 5KANI 1XIWA 4LCCA 4PJEA 4DUXA 3HG1B 1DN2A 5T5FL 5CUSH 1YEIL 5D7SL 2IADA 4ODUB 3MFFA 2NY7H 3ARFB 3AY4C 3HMWL 4FTVE 4X7TA 4E0RB 2E8YA 4JFHE 4QXGL 1MI5D 3OKYA 4PRNB 3OAZH 3O3AB 5SWQB 4D8PB 2Y23A 3QRGH 5LBSL 4JRWA 4XRCA 1A9BB 2H6PB 2W38A 4S11A 5C09D 4OZ4A 1UZ6E 5B4MC 2A6JB 2EECA 1AQDB 4WGVB 2F9BT 1UWEL 1UZ6F 3LKNA 3PGFH 3STLA 4NO2A 1N26A 5HHNA 3MJ9H 3ARTA 2NY0B 1JPST 4F9PC 5IQ7L 5EU3A 2LE9A 1QTYT 1BD2B 4HT1H 1G7LA 1KEGL 3SE8H 5JQHC 4F9PA 3O2DL 4EIGB 4W70A 4NRXB 3QCTH 4R4BA 4LCWB 3FOMB 5HVHC 1RIUL 5DFWH 3UZQA 4ZPTA 1B0GA 4CJ1A 5KVEL 2EXWD 1WC7A 5J6GB 4Y4FB 3LQZB 3JVGC 5C0CA 4QOKB 4E41B 2PYFB 2EDTA 2VQUA 3RJQB 2O5YL 4LLUB 4QWWD 1S7TB 4KC3B 3JVGA 3QG7L 1OWRM 4OZIE 3DMMD 3TC9A 3QWOB 4HW6A 3U4EA 3M1BA 4DZBA 3GMMA 4A6YH 4MSWA 1CLOH 2BRQA 3DI2B 4OZIF 5CAYB 1I7RA 3V4PH 1JGVL 4XPTH 4RQQB 4ACPA 2QSTA 3RWCA 1A6ZA 3IYLW 2CDEB 4IOFC 3I3EA 1DR9A 1T21B 5FGBA 2HRPL 5BZDB 3ECBB 3KPSB 3UO1L 4MQSB 2K7QA 2FO1A 3T0VA 2XWBA 3P0YL 4N0FB 4HK0A 1G7HA 4N0CC 4PJXE 4KMLB 3CSGA 3FN9A 3HI1A 4EUPG 4PJXF 3Q6GL 4Z77B 4QY8B 4OI8A 2C4FT 3D2UA 4B53A 3M17B 2DQIL 1OVZA 4J2XA 4XP6L 3TIDA 2Z93B 4N5EC 4OLVL 1EHLH 4ZUTA 1RMFH 3FJTA 3MRHA 4FABH 5ICXA 1J8HD 1GCFA 1MFNA 4NO3A 2AS5M 1R3LB 3X3FH 3GSRA 1OP3H 1U92A 4R8WL 2VLKD 5L2KE 4FQXC 4GW5B 5F9AC 1JFQH 1FZOB 5HI4D 2JIXA 2R23A 5A2JH 1CDCA 4LAQH 5L88H 3IJSA 5FA4B 2P8PA 2H1PL 5HGAB 1NAKH 3FRPA 4X6EA 4RGOL 4RZCA 1JZ3A 4PGJA 2BVUA 1TQCC 2NYYC 4KQ4L 3VXRB 3P3YA 1NBVH 1AKJB 3CNKA 4L29A 3SJVD 3MZTA 3S36X 5IHUH 4LGRB 2VQTA 5E2WH 1QLEL 5IB4A 1MOEA 4PJ9C 4NZTL 5GRJL 1MCLA 2DAVA 2L4OA 5DRWA 1A7BA 4Y0GA 4PJ9A 4JFYA 1FFNB 2C1PB 2Q86A 5LXGL 2HJLA 1DBJH 1WLHA 3U48A 1HIMH 1G7QB 3BSZH 4XVUC 1RJZB 2NX5D 1TFHA 4NC1C 3D39D 3TZVA 3WUWB 4CDGC 5FKAB 5CWSB 1A7QL 2MQ0A 3LQAC 4LSSH 1P6AB 1OSZA 3R8BB 5FM8A 1KACB 5BZWA 1INQB 4AIZB 1UZ8B 1X5XA 2AJUH 5CZKA 4HUNB 5BQ7A 4YBLB 2NCMA 1MAML 4UQ2A 4OFYA 5C09B 3B2VL 3PIQB 4BQ9A 1J1XL 4ORGB 3QXAB 1SJHA 2FDBP 3WFCL 1SYVB 5EBWB 1MRDL 4LGPB 2X1XR 1FVEA 4ZFOB 1F6FB 3NZHL 3SDAD 3ZZ1A 1TZGL 4HIJB 3D9AL 1IFHL 2APXA 4P23B 3WFEH 1AXTH 6CGTA 3P9LB 3BHBB 3B2UC 2XWTA 3LKRB 4H0IA 3EOAA 5JW4M 4LGSB 2NZIA 4NYLB 5D1QB 3MXWH 3N0PB 3DX8A 5EO9A 1HEZA 1YECL 2GJZA 5B8CB 1RIHL 4O4YL 5IB2A 4MB3A 4XNQA 4X80H 3OB0H 3B9KC 1REIA 5JHDD 2HYMA 1XMWA 4X8JA 1FSKC 4NT6B 3EO0B 1OGAE 3D1MC 5EIQA 1KGCE 2X10A 3DMMB 3B9KA 4NNYB 3EKCA 4G8EA 4MCZA 4K94H 2WWKO 1UKSA 1XT5A 1GAFH 2IH3B 4G43B 4F57L 5FUCC 2X41A 4FQJL 1D5BA 4PTUA 1MVUA 3MFGB 2P8MA 4HJ0C 3ARBA 4KTDL 4YHLH 2C3VA 3C8KA 2HMIC 3HPLA 3AXLB 1E27B 5IBLC 4FNLH 3DYMA 1DZBA 3TVMC 1CGVA 3EYVA 3KYMB 3PL6D 4R90L 4TN9A 3O4LA 2C3XA 1I3RB 2FX9L 4L3ED 4NKOB 1Z5LA 2I60H 2Y06L 4M00A 1CFNB 4M43H 4RWYH 1QG3A 4HJGA 1X9QA 3I3BA 4MCYB 1KPRB 4KKAD 3BO8A 4YXLL 3KYNB 3D3VD 3MLTA 2GY5A 3STBA 4XHJD 2VLKB 5HI5D 2OP4L 3SGDI 4UILL 3UTQB 4P5TC 4W4OC 4MJIA 4G59A 2J88L 3GMLA 3W2DL 1H0DB 1NCDH 3HS0B 3RWIB 4HS6A 3REVB 2CRIA 1QFUH 3I2CH 5GGSB 3OL2A 1NDGB 5IB1B 3EFFB 3L3GB 4JJHA 4N9GA 3SDXE 1HH9B 2IGFH 4HEPG 4I18A 5JXEA 5F1NA 5FOBA 3GSOB 3N1QC 3SDXF 3VWKC 1FO0A 3SJVB 3L3OA 2EXYC 1O7VA 3U46A 4WDIA 3MUGA 1AIFA 3MLXL 3WSQH 1G7IA 1VEMA 4XP5L 2VJXA 4DOHE 1IEAA 3QB7C 1K4DB 4JE4B 3MRCB 3OKKA 1ZLUH 3D0LA 1G1CA 1I7TA 5IJKC 2CUHA 3FOLB 1D5XB 1LWRA 3QH3A 4UAOC 1QQDB 2X89D 5GJSH 1QBLL 4YXKL 3F5WB 4MNHB 5IJKA 3QWRD 1LO4H 3ZTJG 3V95A 3PWUA 2NX5B 1NMAH 1KB5B 3D39B 2DLTA 4ZUUA 1BFOB 2CIKB 2VDPH 4IEFB 1U8NA 1OTTC 4P46D 2CUIA 4LLYA 4LRNH 4PGEA 3TF7C 1ADQH 1KLGA 5ITBL 3S37L 4JG1L 3QBTB 3CPLB 3BXNA 5F88B 4RBPH 2DWDB 1KJVB 3TF7A 5FYKH 2F8OA 3EYUH 4U0QB 1UG9A 1NBZA 5GRVL 4NBYB 2PO6A 3NMEA 3HLAB 5CJQL 2RR3A 3OJDA 2BRRH 1NLDH 1A22B 1F8TH 1S8DB 3PE9A 3HPJB 4KAQH 4XMPH 2FHFA 2VXTH 4MDJA 2ZCHH 4NPYA 4R6UA 3Q5OA 1H3GA 4RRPG 1QBMH 5F96H 5FYLL 3L3HB 2EZ0C 3RY4A 3W0WE 4L4VB 1VFUA 1RZIA 4PV8B 1UWXH 3QI9D 3VXPB 3CX5K 4K3JL 3TPUA 1H15B 5T33H 4X4YB 5DJAA 2P8LB 3SY0A 4OLWL 2N7AA 2V9TA 4HWBA 1TCRA 4PFEA 1D5ZB 2LFGA 3ARQA 3TYFB 3IFPA 4HMDA 3OR7A 4MXVE 1A64A 3IRPX 4XP4H 4O51A 3RIFF 4CW1B 4MWFA 4JFFE 4MXVF 1ZAGA 4RISL 4TVPD 4C83A 5J3HD 1YPZE 3EYQD 4LASH 5I9QB 4BFGA 1IAMA 2P4AB 4CU7A 1WFOA 1V3JA 1TJGL 5DVOA 4JDZA 1DLHB 3ZE1E 4C57C 5KN5A 1YPZF 3QIUD 5JHDB 1GH7A 1YEHL 5I18L 4OD2B 3ZE1F 5T5NG 5CJXC 3RIAF 1PG7X 3DYOA 1K8DB 5MP6H 4ZFOL 5I74C 1YJDL 3S9DB 2BSTA 1BAFH 5EPMA 4U33A 5CJXA 2VRAA 4FG6D 1OSPH 3FQNA 3VXMD 5GGSY 3QFJA 3HE7A 2B0SL 4L8SC 1PY4A 3PGCB 3MA7B 4MA7H 1FNLA 3T2PA 3AGVA 5E24E 3LIZL 3O4OC 5T3XD 3V5KA 4AQ1B 3JWOC 5C0AA 3PL6B 5LVEA 2P44B 1AI1H 3QCUH 4L3EB 2BHUA 3ZDYE 1KULA 3ULVH 4QGYA 4FP8H 3L6FB 4U31A 5AYUH 3ZDYF 4YUEH 1N3NA 3FQXB 4YR6A 4PRBA 2P5WA 4CU8A 4XNZC 1CR9L 3MLVH 4G42A 5CINL 3D3VB 2PTTA 4PUBL 3VFUB 1ZLUK 2VLLB 1N64H 2AKRB 3O6LH 3MOAL 2ESVE 3GSUB 4APQD 3BD3A 1UC6A 3GBLA 5DUML 5ID0A 3JWNC 5IGXL 1P7QD 1QPXA 3LEXB 2VXUL 3OJ2C 4OCWH 1AO7E 2EDQA 1H3PL 4RBPK 1U3YA 1ZGLA 3GSNA 4HC1L 1FL3B 4MDIA 1ITCA 2FJFB 1CTOA 3CAFA 1EAJA 3E2HC 4P9ML 3WL9B 4GG8A 3KPLB 1A2YB 3TGXA 3UBXI 5IBUB 5FA3B 3JWDC 4JM2D 4U49A 4LSTL 1EJOH 3VGFA 5JA9A 4XTRD 1NC4A 2CKNA 1JI2A 3BEWB 1FRGL 1FYTA 4ZXBA 4PRHA 3HE6C 1EFQA 3RY6C 3JTSB 3FN3A 5TDPB 1K6QH 4R0LA 1S7WA 3HE6A 1I75A 4I2XE 2YD8A 1UXSB 2YZ1A 2M8XA 4KJWD 1SEBB 3DGGB 3REWA 1GHFL 1IGFH 3VA6A 4I77L 4J8RA 4DAGH 4GW4A 4P46B 1QKZL 1L0YA 4HMEA 1OTSC 2IANA 1D6EB 4WI4A 1N59B 4P2OD 4IRSA 4P3CH 2X4TB 4M9PA 5FOJA 1AR1D 5IBTH 5INDA 2VDOL 1J1PL 1G6RB 1QFWI 3NN8A 4HX1B 2AEQL 5HHXH 3D25B 1Q9LA 4PJBA 1CF8L 1A6VL 2HJFB 1ZHKB 3SHSA 3RFZC 4YO0A 1LK2B 1DUZB 4HS3B 2JE8A 3QI9B 1KB5L 2XG5A 2OS7A 3FT2A 3DV4A 5CGTA 1AJ7H 3LN4A 4UV4H 5GGRA 3BPNC 3ARED 1W72A 5TF1L 1OW0A 1A1NA 4YE4L 1QA9B 4B50A 3DX9B 3KYAA 2XZAH 5JPMB 1KCUH 3GBNL 5FO9A 4RA3A 3WIHH 3BUYA 4QRSA 1HKLL 4ZOEA 3BZFA 3VGGA 1XF5B 1AFVH 2R56L 4JZOA 4MGXA 1KFAH 3C5ZC 5GRYA 1VGEL 3V0VA 5IFAL 5J56B 5IKCB 1NCWH 2DBJA 2XTJC 5EIVA 4XMLL 4OT1H 3C5ZA 3NABL 1ZA6A 3SDDC 3LPFA 1MFDL 2FX8H 1FORH 1PYWA 3RWDA 1AGDB 2AW2A 2F53A 1A7RL 5J1AA 3G5VA 2RCSH 3VXMB 4G8FA 5HY9B 4KI5E 3RAJH 3GSXB 1UB6A 4PJIB 4KI5F 4LL9A 3ULSB 2J12B 4LLVA 5EZJB 5DEGA 2ZJSL 4S1QL 5BV7C 3RDTD 2OXGA 1CDJA 1S7SB 1KV3A 2G2RA 1LDPL 3FZUC 1BFSA 1E6JL 4WHTB 1A4KB 5C7XL 2LABA 5I8EB 4Z7VE 4YBQC 3TBVA 5DZLA 1ZT1A 4U6XB 4QHMA 4GW1A 4Z7VF 4D9LL 3EOYG 3TNMA 4QRUB 4GRMB 1HINL 5GGVY 4A2MA 1MAKA 5C0NC 2VC2L 4ZD3H 2UZIH 3VG0L 3O6MH 1JGDA 3TJHC 2ADGB 1NGZB 4YHPB 1BBJA 5ISZD 4APQB 4RMVA 1R5IA 2PYEE 2W65B 3TJHA 1AH1A 4OLXH 2HN7B 4WNQA 5ICYA 1A1MA 1P7QB 5CD5C 1ZANH 2I9TB 3MNWA 2LVEA 3GM8A 2WBJA 4TSBL 2ZKHH 3EYOB 1W72H 4LMQI 2FZ3A 5T1LA 2CKBA 4U1KB 1RAMA 1AD9B 5DMGD 3OX8B 4LQFL 3T09A 2H26B 4YGAB 3LY6A 4BFBD 2XXMB 1F2XK 1PEZA 3N85H 4GH7B 2MPAH 1MLCB 4GUPA 4JM2B 4WI2A 2NY3C 4PJFA 3I6KB 4LSRH 5SX5H 1WSST 2PNDA 4Y2DC 5IEKB 2ADIB 5C0DB 3JXAA 3VFMB 2IG2L 1TZIA 5GS1A 4V3EB 5IW6B 2VWEC 3VFRB 4AK1A 1RSFA 4LP5A 1MFAH 4Z0BH 5F9OL 1WBZB 5EO1A 4XCEB 3S8WA 4GQPH 1SY6A 5FF6A 4LLMB 1BIHA 2C7UB 4DN3H 2BC4B 1P84J 4RA0C 4P2OB 3UTSA 3UC0L 3VH8B 2YXMA 4LU5L 4WHCA 1KF9B 3FONB 4ONHB 3I75A 3L3JA 4PJDA 4NGHH 4W6YB 3G9VA 1A7NH 4Z76B 3NFSH 1KPUB 3QIBD 4HBCH 3RWGB 4G9FD 1JF5A 3BGFC 5GGVL 5C9KA 3MOBH 5CCKL 3O6FC 4PLNC 2EH7L 1MQKH 4F7PB 1MCOL 4NJ9H 4NSKB 4O02L 4YIQB 2BZDA 3O6FA 3NZ8B 4Y19E 4MD5A 1VEOA 4XPGH 2EEAA 5ALBH 1T20B 3DROB 3PDOB 1A6PA 1MLBB 2BVTA 4R3SB 1D5MB 2BVEA 1RU9L 3P4OA 3L9RA 1YN6B 3AREB 3U7WL 4LVOB 4PJEE 1NDMB 3VD4A 1LEKA 1GGYA 5MEPA 4PJEF 1IC1A 4D0BA 4OB5H 3SCMD 2AGJH 5T3ZE 1G6RL 1NC2D 2CJUL 4U6HB 2V7HB 1UB5A 4H8WL 1T1ZB 1RHHA 1E4XL 3OXRA 3N50A 5TE4L 5C0IB 2IFFL 5EU6A 5JXAL 1G9MH 3OZ9L 5EZOL 1OQOA 2P24A 4ALAL 5F9JB 3SGDH 3RGVA 5IK3B 1KLFA 2AXFB 1N6QL 3R06A 1I8KB 3JV4B 4YWGL 1CDHA 5FYJE 2BFVH 5E2UL 2IQ9H 1MHCB 1H5BA 3MLZH 3DHJA 4MAUH 1UADC 1BFVL 1OCWL 1DQJB 1SY6H 2F74A 2YZ8A 5B38A 3ZDXE 4KRMB 4TVPL 2Y4SA 4JG0H 3ZDXF 4F58H 1YNKL 3QUYA 1U8HA 1VPOL 4TUJB 2QR0B 3RPIB 1KCVL 3EGSA 4XAKE 3IJHB 1HXYB 2G5BB 1BOYA 1I85A 4YNYA 4XT1C 5JW5B 2GCYB 5CZXC 5C0CE 1FNEA 5SX5K 4X98A 4F80A 1F90L 2OSLA 3F7VB 1QR1B 3NCYP 4QHLB 4U1GC 4HUUA 1UQSB 1ZT7B 5ETUA 4MX7B 5L6YL 3NPSC 5ISZB 3QUZC 1A1OB 4JQVA 5T3XL 3BKYL 2NW2A 3VXTB 1HCFX 1JBJA 2IPTH 1JRHL 5T1KA 3W0WB 2HKHH 1KT2A 2DM4A 2ARJA 12E8L 1AHWB 1GZPA 1A14H 1ZHBB 4K71B 4P5KB 3GMOB 4P2RA 2OI9B 5JZ7D 4CMMA 1UEYA 3JUZA 4LSQL 3A6OA 2LVCA 4UOW1 2EDJA 3FB6A 3T77B 3S35L 1G0YR 4P9HC 4S1RH 1MFBH 4AG4L 3H7BA 4JO2H 2O93L 1AXSB 1CDUA 3MPCA 3QDJA 4P2QA 2NY4D 4JHAL 4X83A 1ORQB 2Y6SC 1OM3L 3LZFL 4MA1C 2CDFB 4RFOL 2X1OA 1JPGB 2H2PC 5HYEA 3UTPE 3SPVB 4UNUA 4RX4A 3F7YB 4QLRA 2RFXB 5EU4A 1M4KA 2NW3A 4OFKA 1U3HC 1FG2A 1MIEL 2DB8A 3V0WH 4OLUH 5D7JC 1BX2A 5DJDB 1P5UA 1EGJA 3MREA 2B5IC 4M48H 5EOCH 4H25B 5J1SC 4GXVH 2EH8L 2FB4L 3GMPA 4KTEH 3ILPB 2HH0L 5FXCH 3S5LB 4BFEA 1FL6A 1G9NL 4JFDD 4YDLB 5I19L 1HHGB 1R3HA 2ZCKL 2VSCA 5BXFA 3BZDA 4FQCH 1B90A 5C9JB 2VH5H 1IMHC 1GPOH 3LD8C 4FXKB 4JRXD 5KJRH 4R4FL 1RUML 1FFOA 4Q0XH 4F7CA 3SKOA 4H1LB 3LMJH 3Q3GA 2M2DA 3WLWC 2A0LC 1ZWIB 5JHLH 3V6ZA 4F37F 3QUXC 1CDGA 1I9EA 5A1AA 4I9WD 4DKAA 4MVBA 3SCMB 3BQUC 4F15B 1NC2B 3GKWL 3FQTA 1UA6L 4WU7B 1A6TA 1PY9A 3DTXA 2R4SH 3LKPB 2A77H 3U1SL 3OGCB 4OAWA 1U36A 3PP3H 4I4WB 5E4EB 3F8UB 5GZOD 5K9OA 1FVCA 1X6NA 1YEGH 4PB9H 4PS4L 1OT1A 3LV3A 1Y18B 1I3GL 4GQ9L 4Z6AT 5IMOA 1DL7L 5E5MA 3Q6FA 4F7MB 1LK3L 4UI2A 5D1XD 4LARL 1RK0B 1KJ3H 5B21A 4K7PX 1LE9B 4NN7B 3BESR 3F6IA 4WJ5B 1AQKL 4WFGE 5F1IB 5CP7A 1IBGH 4I2XB 5MEND 3HI5L 3BD5A 4OF6A 1EGJH 2AVGA 4NZRH 3U82B 4KJQD 2D7NA 4TRPH 1J7VR 5IMLB 1P1ZB 3RZCA 1GRWA 4J1UA 4YHOH 2IALB 2XQYG 1C16A 1DE4B 3BPLC 3GMNA 2FD6H 1S7XA 1RZGA 5CJ5A 4XBEH 1A3LL 1LEGA 3DSNA 1CICC 5E8OA 4HIIB 3OG4B 3TNNA 2N1KA 3TH2T 2UUDK 4U1LA 3A67L 4RFEB 5FUCE 1HNGA 1Y0LA 1I7UB 1KIUA 3T0ED 3TWCL 3OKLA 5H94B 2OK0L 2XZCH 3EJZC 1P9MA 4HIEA 2VAAB 1Q9KA 4L8CA 2XT1B 1JWMA 2C5DC 3TFKA 3O4LE 4NUGL 4N0UA 3D18A 4FQHA 5GS3A 5I73B 3FO9A 1QFWH 1U8OA 4M9OA 1VENA 5I16A 4LDOB 4ELMA 1BWMA 2N4IA 2HG5A 1I1FB 4NOFA 1TETH 8CGTA 1INDL 1I1YB 1JNLL 4OBSA 1BEYL 1MHPL 3NA9L 5DK3A 2CLZA 3DVGB 1T1YB 2NY4B 3H9HB 1LP9A 4YFLI 4LNRA 4RAVA 1B4JL 4EDXA 3K8KA 2DQJH 1TZHB 4N8CH 2BK8A 1NANI 4BELD 4R26H 4ZTOL 2AXGB 4WEBH 3S3SA 4MA3A 4GAYA 5B4MD 3OR6A 4KQ3L 4KGJA 5D7LA 5HHMD 1X5AA 3UZVB 3DWTA 3LSOB 2DI7A 1WCBA 5BRZA 5ICZA 3MLPA 2BJMH 2IH1B 3FAWA 4OF7A 1U2CA 4PGCA 3IJYA 2Q7NA 4YDJB 5JR1H 3BMVA 5EO0A 1HWHB 3AU1A 4NQXB 4QXUL 1Z9OA 1U8KB 1M71A 4JRXB 4DVRL 3T3ME 3CJJA 5F7YC 4Z7VB 3LRSB 5IT2L 3ROLB 1NUNB 4FFYH 3T3MF 2VZ3A 4NCDA 4AEEA 2QHLA 3VFNB 2JJTC 1QSEA 2QSCH 2FJHA 2E9WA 1ZA3B 4XCYB 1T0NA 3QULB 2H8PA 2M1KA 4K2UH 1XGQA 5TQ2L 1X4YA 5CSZA 1FZMA 1ZOXA 43C9A 4EUPB 1DEDA 2CXKA 5D2NC 5TF0A 2VL5B 2VABB 3KPNA 4G6MH 4HPOL 5I71C 1NSNL 5F9DC 4K9EH 2X9WA 3VGEA 2I9LA 1ZVSA 1QFHA 2X7LB 1FGNH 3O3DA 1C1EL 3SO3C 1A6UH 4HS8L 5GIRA 7CGTA 3O41A 1N2RA 1L7IH 5FKPA 4TSCL 1MVFA 4O5LH 1QPPA 1Q0XH 4PJHB 4WTXA 1BGXH 4DKFL 5D1XB 1NGYB 1KN2L 4QNPE 1CLZL 4K07A 4MNQD 2YC1A 1JMZA 5DVNA 2E8ZA 4N5ED 4QNPF 3DIFA 4PBVC 3H9YA 4QXTA 5MENB 5DD5H 1T83A 4X7SH 4X9BA 1MY7A 4X5XB 3G08B 4OZFA 5KG9A 1ND0B 5CEYA 4FQXD 5KSAC 1BQHB 5KSUB 1GIGH 1GZQB 5C1MB 2D31B 3CX2A 4OKVA 3PV6B 3VXUD 5KSAA 1YEEL 3AAZA 4I3RH 3UDWC 3MV8A 1JZ5A 4UDTA 4PBXA 4X4XB 2NYYD 1YY9C 4UU9B 1WWWX 1HKFA 3BP5B 3T2OA 3JUYA 1JK8B 1D5IL 3HMXH 3QEUB 3GO1L 5FK9B 3VD7A 3I02B 1LEIA 4LPUA 5I1CH 2PCPB 4WO4B 4J3OC 3QDGA 1C12A 3NTCH 4Y4HD 5D9SB 3T0EB 3BDXA 2A74B 2Q6WB 4FZ8H 4Y19B 4H5SA 5C0AE 4YQXL 2UYLA 1VFBA 1DEEB 3BZ4A 5FCUH 3W82A 3KPOA 3P77A 1KENH 5IWLC 4XVUD 2GSGA 2FH8A 2P5WE 1CDIA 3CVHA 1OLLA 4X5WB 5HYJA 3VRIA 3U0WL 1C08B 5DSCA 1VGKB 3F6LA 3U79A 2IFGA 2V9RA 5DQDH 5FV2A 4RMQA 1T1WA 5DF0A 3C6LD 1JPFB 1CU4L 1A7OL 4UQ3A 4LKXA 1RZ7H 5HHMB 1WEJL 4Q6IC 3U83A 2FECL 2YWZA 4XBPA 3H9SD 5FM4A 5IV2A 4J4PA 1BVKA 2DLFH 3WHE1 1A21A 1HWGB 3FCTB 5ESVB 1HZHL 4WENB 2YKLL 1HSBB 2BSSB 3QDMD 3UTTA 2B8OT 5L8KB 2MCPH 3OKMA 1EJ6A 3IETA 4NWUH 3TN0A 3QPXL 3U4AA 3IDYC 2NXZC 4BSWA 5I2IA 5CMAA 4GRLC 4XVTH 4NKMB 1PSKH 5HHOE 4JPWL 5HYSA 1ACYL 5IFHL 4ZPTB 5TDOB 3BAEL 4XWGL 1I9IL 5C0FB 3B9DA 1EV2E 3GB7B 2XI9A 5C2BH 2E27H 4ZG1A 5HVHB 3IDMB 3P30H 2BOBA 2DQCH 2DBLL 4DZBB 1SJXA 4G8GA 1IL1B 3QA3A 2BVQA 4JZNA 4QRPA 3VW3L 1V3KA 2IANE 4WUKH 1JV5B 3WIFA 5KZCB 4WEMB 3WS6C 4I3SL 2ERJB 3MXVL 1RD6A 5I0DA 1C5CH 5CEZE 1W0WB 1NGPL 1X44A 3WS6A 4PJ8C 2X4UA 2ID5A 3GJEB 4XCCL 4HJ0D 4NQUA 1F4XH 2HMID 4PJBE 2R0LL 1IKFH 3QCVH 3IVKB 1KCRH 4FXLA 3X3GH 1BM3L 5IBLD 3CVHH 5MERB 3TVMD 4UIKL 1S5IH 4ZS7H 2HVKB 1IRAY 4M93C 2P5EA 2J2ZA 3EDFA 4NRYA 2HKFH 4L8DB 3KR3L 2I5YL 1II4E 1YEFL 5HHPB 3QJHB 2P7TA 3V5DB 3HR5B 1VFAA 4XPBH 5LCVL 1QEWB 1F00I 1F3JB 3KPPA 3F65A 3L95B 3QIWC 1LGVA 5TE7H 1Y6NR 1DANU 4FQXB 1BJ1H 3IJSB 1DBKH 1T5WA 4OSUL 4P5TD 2MQ3A 4TULH 3IXAA 3QXTA 3VXUB 3HKFA 2AK4A 1DQLL 2Z8VC 4RAUA 3RVTC 5B39G 3V52L 2V2XB 4J23A 2DD8L 4LHUD 3G5ZB 4WW2A 1J0YA 4DGIL 2XTJE 1TQCB 4OD3H 4N1CA 2F53E 3OKOA 4KK9D 3PHOB 3K2UH 1JVKA 4M02A 1QR4A 4WFEE 2EXYD 3IGAB 2R0ZL 4DQOH 2FCBA 4OCRH 4WU5B 3FTGA 4Y4HB 4NO0D 1MNUH 2Q86B 5FYJU 1EFXD 1I9RL 1FIGL 4YHKL 4CVZA 1HN1A 5DWUH 1ED3B 1OGTB 3GHBL 1MF2H 3P11H 2LTQC 1T7YA 1NFIA 3TP4A 2ZP0T 3T4YA 5EBMB 1KCKA 4JKKA 1YNLL 3RL1A 4HWEH 3KDMA 4AEFA 2VXSL 4U1NA 1OTTD 4JFOB 3ROOA 1SMAA 1FHGA 4K8RC 4Z7WA 2XRAL 3VXOA 4HGWB 3BKCH 4JPIB 4MAYC 4WUUD 4RDQF 2AJZA 4U2YA 3TCLB 2X4QA 4M1CD 5DJYA 2FR4B 4KY1H 3SKUD 3O8XA 2R1YB 1TJIH 5I76A 4ZYKA 4QGTA 5MEOB 3PWLA 3CZJA 5T5FH 1YEIH 2QJDA 5TDNA 4BSVA 2HTLC 2EYRB 1I4FB 1MCJA 1NGQL 3HMWH 2XPGB 5T3ZL 3X11A 2ZUUA 3HI6L 3BYYA 3PWJA 3QDMB 4QXGH 1FV1B 2Y5TB 5ACZA 5DTFB 4DCQB 4MXQD 3B5HA 3CFKB 4PJFE 4KUCF 4XC1L 5LBSH 1L8JA 4TNWF 3BMWA 4PJFF 4BFIA 3MGOB 1ZLVH 1HI6A 4JCMA 2GFBB 1C8PA 1UWEH 2JK5B 5IB2B 1S5HA 4XNQB 4C56A 1T4KA 2BNQA 1MCBA 2OQJA 1LQSR 3KLHC 5FYJL 1WQVT 4F7EB 4G9DB 2WK2A 5IQ7H 1FSKB 1OWWA 4LCYA 1KEGH 1MCEA 3HZKA 3O2DH 1MFEL 2P8MB 3UTSE 3WD5L 3DXAD 4TTDC 3INUL 4PJDE 3C8KB 4JRYA 4H26A 4E42A 4NQSB 1RIUH 3ETBF 3HPLB 4PJDF 2IBZX 1D6VH 3LVEA 4BH7B 4PG2A 4RAHA 3EYVB 3MROB 1JNHB 5CJOL 1PQZA 3HAEG 5L0QC 3KS0H 1QZ1A 2ZSWA 3EUUA 5T1MB 3TVMB 3FQUB 3QG7H 1R3KB 4X6DA 4HJGB 5IB3A 3HRPA 4PJ7F 3TEUA 1TNMA 3QP3A 1JGVH 1NGWA 2C1OA 5ID1A 3PNWA 1NKRA 2R2EB 1KSRA 2YPLD 2QADC 4JY6A 2DLHA 3SE4A 4NRZB 2GT9A 3X14B 4ODXB 3P0YH 4HS6B 1IC4L 32C2A 4P5TB 4PGDA 2RJMA 3PWPD 2V5YA 3RWFA 1KG0B 3LKQB 3FFCA 4CMHB 4LBEA 4LSPL 5D71L 4K7FA 3FO0L 5EU6E 3R4DA 4JPVL 2DQIH 5C8JA 1DVFA 4KROC 4XP6H 4QRQA 5FOBB 2VN7A 4OLVH 4CRPA 1FO0B 2J7LA 4M6ML 1T0MA 2RIKA 1KIPA 3QEQD 3MUGB 3EYSL 1AGEB 3VWKB 4NHCL 2WINA 1NAMB 4OLYL 1JP5A 1IEAB 1NANH 3HG1A 4QRRE 2DQEL 4N9OB 4ODUA 4NO0B 3ARFA 3DV6B 2H1PH 1EFXB 2GIYA 3I3DA 4OCNC 4E0RA 2QSVA 4K3GA 5D5MB 3QHTC 3STZB 2AV1B 4RGOH 3O3AA 1NCTA 5SWQA 4D8PA 4UOJA 1A9BA 2H6PA 3CDCA 4UAOB 4KQ4H 2OMNA 3EZ8A 4PRPE 1AQDA 1RZJC 4PP1C 1JGEB 2WMPA 4NNPL 1I8LA 4ZNEA 3T04D 2EDKA 2BHYA 2NY0C 3MRPB 1QLEH 1PKQB 2XA3A 4OM0L 4NZTH 4JPKL 5GRJH 1MCFA 4UBDC 5LAXB 2VQ1B 2HFEB 2D0HA 2NY5C 2OR7A 2MCG1 1BHGA 3G6JB 4KWUA 4OCXL 1MREL 3QZWG 5LXGH 1P7HL 3OJDB 2OJEB 4OZHE 3V6OA 5FUZL 4NRXA 2V17L 4OZHF 5A2IH 5CIPB 1KPVB 4LCWA 4Y4FC 1G84A 1RZKC 4GRWE 3UAJC 5J6GA 3QEGL 1A7QH 1MUJB 1U3JA 3LQZA 4Y4FA 3VFWB 4J3VA 3CFBB 4GRWF 4QOKA 2PYFA 3MGAA 1VACB 2GI7A 4P2RE 5CD3B 4LLUA 1S7TA 3HC3L 3LQAL 4W6WB 3QWOA 1CDBA 3E8UH 1MAMH 4O51B 1I8MB 1N5AB 3D6GA 3B2VH 1J1XH 3WFCH 3QDJE 4P2QE 4L1DA 4RQQA 2J1KA 3QNZB 1MRDH 1VESA 2CDEA 1T2JA 1CD9B 5BZDA 3ECBA 3KPSA 4N0FA 3NZHH 4HIXL 3D9AH 1IFHH 3I6LD 3N1PC 3SKMA 2C4FU 4Z77A 4QY8A 2XG4A 3RHWK 1U42A 5I74B 4V3DB 3K2MC 4Z18A 3M17A 1F42A 2Z93A 3Q1SL 4QXWA 5HYQB 4V1DD 1YECH 1R3LA 4KDWA 4L8SB 1RIHH 4O4YH 4YH6A 2XFXB 3S88L 5DD0L 1KB9J 2MHAB 4OV6F 5C0GA 1EBPA 5FA4A 1AC0A 2ZUTA 4KVNL 5HGAA 3G6DL 4HWUA 4F57H 1KLUA 2J5LB 4PD4K 4YBQD 4RMTA 3VXRA 2YPLB 4KMTL 4XNZB 4KTDH 1AKJA 1KTDA 3AC0A 1B0RB 2DJ4A 5F7DB 1IEHA 4EJ1C 4R90H 3PGDA 2WNGA 4AL8L 5EWIL 2DLIA 2WLYA 2FX9H 3UPRB 3JV6B 4X6CE 5B3NA 3CCHB 4R9HA 1FNAA 2Y06H 2YK1L 1FFNA 2C1PA 2DKSA 4MDIB 1E4XI 4URTB 4X6CF 1G7QA 4YXLH 1GGCL 4HFWB 4PV9B 4YDIL 5MEQB 1RJZA 1EIBA 4XNYL 2OP4H 1Z3GL 4UILH 3WUWA 3E2HB 3NCEB 5FKAA 5D70L 2J88H 5CWSA 5LJYH 4P49A 3W2DH 4NQTA 5HHOB 1DQDL 2R39A 5JW4N 1QFOA 3TBSB 4YBLC 1INQA 4AIZA 2R29L 1UZ8A 1WFUA 4Y2DD 5DGRA 1A0QL 3VFPB 2A2QT 5C09A 3PIQA 3VG9C 4CN6A 3QXAA 1SYVA 1FO0L 4L3AA 4QHKI 1WFTA 1P4IL 2X4NB 3MLXH 3DVNB 5ERWB 4XP5H 3QHFL 3P4NB 1NAML 4XWOC 2FEEL 3MTRA 4ZFOA 3AS3A 5INDB 2IAMD 5EULV 5I1IL 4ODSH 4HIJA 4LCIL 5F44A 2A6DA 3QUMB 3ZKXC 4P23A 2D0FA 5BW7A 3P9LA 3G5XB 3BHBA 2VERN 1NMCB 3LKRA 1QBLH 4YXKH 4Y8AA 2EXWC 2XQBL 5HJ3B 2OR8A 4NYLA 4F33B 5D1QA 4YFDB 4JFED 4JLRB 1JWSB 4WV1C 5JO5B 4X7DC 1CVSC 3QSKB 5B8CA 1JRHI