3FT2A

Crystal structure of a citrulline peptide variant of the minor histocompatibility peptide ha-1 in complex with hla-a2
Total Genus 83
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
83
sequence length
275
structure length
275
Chain Sequence
GSHSMRYFFTSVSRPGRGEPRFIAVGYVDDTQFVRFDSDAASQRMEPRAPWIEQEGPEYWDGETRKVKAHSQTHRVDLGTLRGYYNQSEAGSHTVQRMYGCDVGSDWRFLRGYHQYAYDGKDYIALKEDLRSWTAADMAAQTTKHKWEAAHVAEQLRAYLEGTCVEWLRRYLENGKETLQRTDAPKTHMTHHAVSDHEATLRCWALSFYPAEITLTWQRDGEDQTQDTELVETRPAGDGTFQKWVAVVVPSGQEQRYTCHVQHEGLPKPLTLRWE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HLA class I histocompatibility antigen, A-2 alpha chain
publication title Steric hindrance and fast dissociation explain the lack of immunogenicity of the minor histocompatibility HA-1Arg Null allele.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
total genus 83
structure length 275
sequence length 275
ec nomenclature
pdb deposition date 2009-01-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00129 MHC_I Class I Histocompatibility antigen, domains alpha 1 and 2
A PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3ft2A02
3.30.500.10 Alpha Beta 2-Layer Sandwich Murine Class I Major Histocompatibility Complex, H2-DB; Chain A, domain 1 MHC class I-like antigen recognition-like 3ft2A01
5LCVL 1R0AH 2QADD 4TTGA 1QRNA 1Z9LA 2YWZA 5IR1A 3IDGB 1DUYA 1OHQA 4JRYB 4O51B 1A0QL 3EDEA 4ZQKB 5IB1B 5IVNA 2UY7A 4PJAE 2XV6B 2R2BB 1IJ9A 3O6ML 3M1BA 3TN0A 1AHWB 2AJSH 3WLWC 1C08A 1SEQH 1JNJA 3H3PL 3MO1A 4G8EA 1QHOA 4J4PC 3SDXA 5I15L 2ZPKL 4QXUH 5C2BH 1KEML 3NN8B 4ZG1A 1I4FB 3MRDB 1ZVSA 3HNSL 5F7WC 5DFWH 5FYLE 1B4RA 1MRCH 1NCDL 4WEBH 5IBTL 4OLXL 4D9QD 5IFHH 1U8QA 4DN4L 1HIMH 2ICEA 1YEGH 3DSNA 4WWKC 1R5VB 5A2JH 1M1SA 4ZMAT 5F6IC 3GJFA 4W6XB 5L9DH 3KLSA 3T0ED 5E2TH 1CFQA 3OR6B 2Z31A 3QIBA 3ARBB 3MJ9H 4CL7A 1KLUB 1JGUH 3G04A 1NKRA 5GHWH 3WN5B 3L3IB 3MNVA 3B2VL 1J8HD 4OB5L 4XWOC 4JE4B 4OQ1A 3V6ZA 4XNQA 4OKVA 3IDIB 3SHSA 5K9KB 4LHQB 3DX8A 1J0IA 1KOAA 4LLMB 1A3LH 5IHZB 1NDGB 4QY8A 2BCKB 2IH1B 3NA9L 1BFVH 4I3SH 5CEZH 4P5KB 4LSPL 4EZMA 4NHCL 1LK2B 4S1QL 1RZFL 3CDGB 1C16B 3D0VA 4LSSH 3RTQA 3MUJA 3SE8H 2ZWLT 1BVLB 5D71L 2NY6D 3FB5A 5KSBA 5AZEH 4XCNB 3A67L 5L2KB 1IEAA 5B8CC 5ESAA 5HYJA 1FNGA 4C4KO 1UZ6E 4PV9A 4UBDD 3FQRB 5KOVC 2HKHH 4BSJA 2J8UE 3W5MA 3QI9C 4OFYA 2Y36H 4ENEC 4Y2DD 4P9MH 5EOQH 2ZCKH 5FO9B 4M7JH 3WFDH 3TJHD 4S10A 4P23C 1HK6A 2C4FT 2BY3A 3AVEA 4TVPE 2ARJQ 3C8HA 1IGJB 1H8SA 4Y7MA 3W5NA 2Y06H 5TE7H 3MMEB 3MCKB 1NCAH 1DEEB 4PJEA 5FYKL 4I48A 1IE5A 3J7HA 3WLBB 3K8MA 1GGCL 3EOYG 2WWKT 1J1OH 3SQOL 5L2JA 3C5SB 1NFIB 4J3SA 4XNXH 1UYWH 3CX5J 3CK0L 3L3DA 1EAPA 4OD2A 4HXAL 2DTSA 4NO3B 2WM0A 4O58L 1RK0A 4FQLL 3V79C 2R2EB 3PHSA 3G5VB 4QWWD 4O2CB 2VLRB 3NVQA 4DTGH 4NSKB 2E3VA 2FJFA 2X4QB 5FGRA 2VLLA 3MV11 1PG7H 2BY2A 5ENWB 4FQCH 2E6QA 3BIBX 2J6EA 1OLLA 2YXFA 4UTBH 5HVWA 2BRRH 1TITA 3AB0C 3PHOA 1CZ8H 3QCVL 4Z7UB 1FL3B 1UWXH 1XF4B 3PGFL 3T09A 3LIZL 1CL7H 2VZOA 1CLYL 1F00I 3QR2A 4JRXD 1J0ZA 4D8PB 4F8QA 1RMFL 1FV1B 3OKOA 3JUYA 5J6HB 1GGIH 1HI6A 1WZMA 3SO3C 2QQNL 4CDGC 4WO4B 1Q9WA 3ELAT 3U6RB 3NTCH 4L29B 3IDYB 5H35B 1FNEB 3CLFH 4MAYC 5D1ZA 4IIQC 4MVBC 4OLEA 3BZFB 1ZT4A 3LPFA 3PF2A 4YFLI 1SEBA 4PD4J 3B2UD 5IROC 2NX5E 2HT3D 4OM1L 1HHKA 3D0LA 4J8RB 1N0XL 1U58B 1B4JH 4JGMA 3STZA 3IDMA 4OCXL 4JFEA 4MJ2A 4G43A 1P4IH 3QDGB 5T3ZL 3HLAA 3P9LB 3VXUB 2GW5A 2ORBH 4XAKD 1PG7W 1TNMA 2CIIB 1M7DA 4ODBD 1CDBA 3B6SA 1KYOJ 3MNZA 3FFCB 3D3VB 1CIUA 4J3XA 3DUSB 2BOCA 2HTLD 4N1HB 5HGBB 3T2NH 1FO0B 2R4RH 4NHUA 3VXQA 5ICZA 1U8IA 4K94C 3GI8H 2PN5A 2Y5TA 3MJ9A 5HHMD 4WW2B 4MJIB 5INDB 2IBZY 4WTWA 3IFLL 4F7TA 2B8OT 4Z76A 1EAJA 3KR3L 4ORGA 1YQVL 5TF0A 3SE4A 3JZ7A 1BEYL 4JN1H 3DXAB 5F7KC 4WEMB 4F37K 5HD8C 4W6YB 4EBQH 1CGSL 5F3BA 4Z77A 3KPOB 2FHCA 2EKSA 4XB7A 1MVFA 3W11C 4PJ9D 3WUWA 4G6KH 5TGBA 1JPTL 4MA7H 5CGYC 5BO1L 1NH6A 2JB5L 3UPRA 2QQQA 1FZJB 4KY1L 5DRNB 2VXSL 4R4NC 1SJHB 3TCLB 4GQ9L 4LDLB 4N8CH 1CICD 3DIFB 4XPGL 1T2JA 2JCCB 4HMCA 5I30H 4NQDD 1G1YA 5FA3B 1UXSA 4PB0H 3SKNB 2IQ9L 3OB0K 3JTCA 4S0TD 1GZQB 3NFSL 4C54A 3QNYB 4U1LB 5DK2A 1JTOA 5GGRY 2EDDA 1KN4L 2GI7A 5FYLL 2EECA 4PJAF 4V3EB 4R0LA 4LGRB 1BZ9B 1N8ZB 3L1OL 1XIWA 3RJDA 4NQSA 1JHTA 2DQDL 4K7FB 4XPFL 3WV0A 1R24B 2X05A 1QBAA 3WFCL 3Q3GA 3PP3H 2BJML 4YEFA 4RAVB 3MROB 3PQYA 5D8JL 1OGTB 3QPXL 1JMZA 1Q8MA 3UJTL 4DKFH 4LLYA 4U7SA 1H3VA 1A7NH 3QUXD 2HT4D 3V0VA 1CR9L 5T1DH 1DE4B 3LS5L 1T21A 1AGBA 2EZ0D 2ZJSH 4NN7C 1HILB 2GSGB 5IJKA 3T04D 4QHMA 2ZOLB 2WP3O 3LMJH 2PW2B 4WY7H 3NFPA 5BRZB 3B9VA 1N7ML 1AY1L 4POYA 1JNLL 3ARTA 3JWDL 5IT2L 3UJJH 1NC2A 2R29L 1NSNL 7CGTA 4Q9QH 4XNYH 5CJXC 3C60B 1JRHI 3NIFE 2X1XR 3O2DH 4YHYB 5EULV 3L5IA 4PRHB 2X1QA 4BJLA 4NQXA 3GMQB 4GXUN 2AEIT 4IRSA 5I2IA 2RIKA 3QWQB 3SDCB 3E2HC 3ARFB 4R7DB 1UJ3C 3BVNB 4L8DB 4I0CC 3LD8C 2A9MH 1K8DA 4G7YH 4JRYD 2HMIC 1AE6L 3OAYH 5C0DA 1Q1JL 1G7QB 3QUZA 1AGEB 2X9XA 3MLVL 4YXLH 5I1CH 4NWUH 3WMSA 1F13A 5TE6L 5GZOC 4Z95H 1T66D 4TVPL 4U6YA 1UZ6F 2Y25A 5JDSB 2N7BA 2J8UF 1JN6A 1KTLA 4RIRB 5F9WB 4OSUL 1YEJH 3IDUA 8FABB 4FP8H 1K3ZA 1SM3H 2IANB 4G8GB 4RWYH 2PYEB 4FG6C 4GH7B 4HUUB 5JHDB 5JHLH 4WEUD 3QNZA 4CW1B 3QXDA 3MGTA 4DKEL 2AK4B 4PYHA 3U7YH 3U9PH 4MD4B 1VGKB 1RZ8B 2BP3A 3INUH 4PJGB 5SX4H 4JFXA 4HZAA 3BEVA 5AWNL 3BAEH 4JEGB 5J12B 3V4PL 3ARBD 3VRLF 4UI2A 2IGFH 4P3DA 2YD1A 1EX0A 3TFKC 3MRLB 5DLML 1ADQL 3OXSB 5F7HA 2J4WH 1F4YL 4DGIL 3DETD 4X0KB 3IJYB 4X6DB 1VPOH 2VH5L 2PXYB 4MXVE 3G6JB 2PETA 3O8XB 1IGIH 3AMKA 5IMOA 1KTRL 1IC4L 2NXZC 3V52H 2VDRH 2CO7B 4BSWA 5FK9B 1FNSH 2W60B 1K5NA 5F9JA 3WFEH 3BXNA 4LCCC 4ODXB 2DAVA 3P73A 5DQDL 2HWZH 3BKML 1OP9A 2VLJA 5DMKB 3FT3A 4YHML 1IKNA 4GRLB 1I7UB 3PGCA 1BBDL 4EUPB 1CTNA 1LO0L 4LPUA 4OI7A 3BPLB 4I18A 5EZLA 1UVQA 1PD6A 5DRZA 5L2KD 3QG7L 2FJGB 3FL7A 1WIOA 2P5WE 1HQRB 3SJVB 3PNWB 1XGTB 5E6IA 1KSRA 4N0FB 3R4DA 4JM2A 2HJKA 5K9JL 5JLZA 1V05A 3L5XH 4Z8FL 4E5XA 2V9RA 2FIKA 1HXYB 2N1KA 2AJZA 5EN2B 3KPPB 4PIRF 1M7XA 1PX4A 2GUOB 4MDJB 5TE4L 3TA3A 4XAWH 3O6LH 3SGDH 4ODUA 1IAOB 3KPQB 3CLEH 3VFTA 4M61B 3FN0H 4ONHB 4OLUL 3TT1L 2XFXB 4MQ7B 3BO8B 5C8JB 1X5IA 2XZZA 4PG9A 1E4XI 4J3UA 2VZTA 4Y4KB 4KH2A 1M4KA 1A02N 3JTTA 1OAXH 3GNMH 4YE4H 1F4WH 2VLRD 5HGAA 3BFOA 5C0JA 4U31A 4LFHG 5MENA 1QYGH 5DHVA 3V95A 1AGDB 3VFMB 4AEHL 3QEHB 2X70A 1JWSB 1PEZA 5CUSL 3MR9A 2V9TA 2ESVE 2NXYC 2GSIB 2ZSWB 4Y4FB 3UTTE 4CNIA 5E7FA 1G9MC 1RUML 5ECJE 4G8IB 4UV7H 2H9GB 2DMCA 3O2DA 1U9KA 1OAKL 3Q1SH 1EMTH 3RAJL 2NY5L 2QHLA 1PG7X 2HTKC 3ARWA 2HLAA 4H0HB 3MACH 1OGAB 1FN4A 4NRXB 1X5HA 3QZWB 4BH8B 4U6VH 4JDVA 4WO4D 4GW4B 4OFKA 5CEYA 2RB8A 2FBJL 5GRZA 1A4JA 4KVCL 4U1HB 3MCLH 1HDMB 2F19L 4RQQA 3EO0A 3QHFL 2DKUA 3DRQA 2J5LB 3K4DA 4Z7WE 3K8LA 3O4LA 3FQXB 3S34H 3MRKB 2W9DH 5HGHA 3HR5A 4YO0A 4LNRA 5DR5H 5BS0B 4LLWB 5AUMA 1IAKA 3HHRB 4CU6A 1Z5LB 4CMHC 1MIMH 4U1NA 4JREB 4JKPL 4NRZA 3DTXB 1CFTA 4LARL 1XF1A 1T0MB 4AK1A 3IAQA 2NZ9C 3QDGD 1IM3A 1IQDB 2BZDA 3W39B 3GO1H 3VXUD 1I8MB 4MQXC 2F5AH 2YR3A 5TPWL 1QFUH 5IIEB 2AJVL 1RZ7L 1HWGB 3BJLA 3FFCD 3D3VD 1QKZH 1C12B 4N0CD 3CUPB 2I60H 3DWTA 2FGWH 5IEKA 4JB9H 4Q58C 5F1IA 5SWQA 3RWJB 1P4BL 4L8SA 4LSRH 2EH7L 3FQTB 1U41A 2FX8H 3V4UH 3CJJA 5ILTH 4MJID 3H9SA 4U3CA 3HPLA 3LEVH 3TJEH 1ED3B 4ZYKB 4JFFB 1G6RB 3DURB 3HZYB 4E41E 2YKLH 1R3JB 1YEKL 4XWGL 3DXAD 4QHNB 5CZXC 3MJGX 4FQJL 4LSVH 1JNHB 2DYPB 5FGCE 3GDBA 5GGVL 4PJBE 4X5WA 5EU5A 3NACH 5EO0B 1M05B 1J0HA 3N1FC 3QO0A 1H15B 5AD0B 1RIHL 4OD3H 1H3PH 2K7PA 5LXGL 3TVMC 4KVNH 1YYMH 3ULVD 3SE3C 3NIFF 3Q6GL 5GJSL 2IAMC 1KIQA 3HAEH 1KJ2H 3A6OA 1RZJL 3K7UA 3O6FB 5I66B 4KRMB 2BOBB 4MXQD 1C1EH 4PRIA 4FTVA 4Q2ZA 1K85A 1MHCA 5HGDA 5IQ7H 1E0OB 2HH0H 4OCWL 1W2KT 1QPPA 1NGWA 4TUJA 4FABL 3ZYZA 4NQEE 4PR5A 1T7WA 3L5WA 5J7CC 4PJXF 5JZ7C 3QH3B 2ED8A 3A6CH 2NY7L 4OT1L 3O45B 2CK2A 4KKBC 4KK8C 4ZXBC 5T5FH 2XG4A 4OF6A 3SO5A 3GIVA 4IRZL 2Y7QA 5C0GA 1CLZH 4YQXH 4L8CA 4LLVB 2W9EL 2F8OA 5ACLA 4KJWD 4QRTB 1Z3GH 2CUMA 4GUPA 1JF5A 1RUQH 4K94L 5CHNA 4HKZB 3FKUS 4X98A 3VXNA 1P2CB 3P9MA 4QXWA 3LRHA 4ZO8A 1CXHA 3BPOC 3O4OC 5JPNB 1AR1C 1CDGA 3QUYB 4O5LL 5DJDB 2GJ6E 1JGEA 2ZUVA 1I85C 1FQ9C 4HS3B 5T33H 5GPRA 4LLUB 4HWEL 5BRZD 4KHTL 1G9NH 2F58H 2DIJA 5HI3D 2DQGL 4X8JA 5C7XH 5I8OH 5C9JB 4KC3B 4D3CH 5GRUL 3D18A 5ETUA 3LV3A 3KJ6H 5L7XL 3C60D 2A77H 1QLEL 3HG1A 3S5LB 3VE0B 5H94B 2BSTA 2D7TH 4MXVF 1EO8L 4TSAL 5DRWB 4PRHD 1TVHB 1LILA 1MI5A 5CZVH 1CVSC 1NBYB 2W38A 2Q87A 2QQKL 4P2CG 4ZOAA 5BV7C 3U36B 4OAWA 2FLBT 3SDCD 2OI9A 2W59A 4P4KB 3ARFD 2JJSC 4XC3H 1IGYA 5MEQA 3OWEA 1JPSH 4Z78B 1AD0A 1S9XA 1AC6A 5DA0B 4TNVK 4PB9H 3UAJD 4IRJB 5EU4A 3BQUC 1U8KA 4GAJL 3OAUH 1YJDH 1KC5L 3MSPA 2OK0H 5E2WL 4EOWH 5IVZA 4Y5VC 5I76A 5JMOC 2O5YH 1A7QH 1XGQA 4HJ0D 1DUYB 3KYAA 4OKDA 4YDVB 3S3PA 1AXTH 5C0AE 5TQ0L 3D39E 3I9GL 5DEGA 4YK4C 4I5BB 2IAND 3TN0B 4YHPA 4G8GD 3VXTA 2PYED 1C08B 4I8DA 4YGVB 3VWKA 5JHDD 2KUTA 3MO1B 4HWZA 4G8EB 3SDXB 1G7IA 4ELMA 1YUHA 1JI2A 5DUBA 2IG2H 5E1AA 4YXHL 1U3ZA 2AK4D 4OI9A 4HH9A 4WI2A 4K71B 2N56A 5LBSH 3BP7A 4M6MH 2NR6D 3RUGE 4F7MB 1U8QB 3VFUA 4DGVH 4Z7NE 3G5YA 4F9PA 3IDJA 2XTJB 1I75A 1DVFA 2AV7B 4APQC 2CLRB 2PXYD 3E8UH 1D5XA 4HUVA 3O8XD 3QIBB 2VSCA 1HHGA 4LVNC 3HCVA 3G04B 2MPAH 1F5WA 3L95A 1UENA 4QRUA 3RP1A 3PE9A 4ELKA 1S9VA 4GRLD 4IOSD 4TQEH 3MRIA 5DJYB 1GGBH 3HAEA 1KJ2A 4WCYL 4XNQB 4CJ1A 4OKVB 3RGVA 5E9DE 1QSFE 32C2A 4I77H 2DM2A 1P4LB 2DBLL 4UAOC 4DVBA 5FIEA 3L6FB 2VNCA 4PRNB 6FABL 4RGMC 3SJVD 4XPAL 5JA8B 4QY8B 4W81A 4MD5B 4Y19E 4AQOA 1CE6A 3T0WA 5IESL 1AD9B 1TCRA 4GRMB 3D0VB 3RTQB 4Z7WF 4QXTA 3FB5B 4DOHE 1PLGH 2BVOA 1FYHB 1IEAB 5ESAB 1FNGB 3RI5F 2VQUA 4WHYG 4L4JA 2ZKHL 2ZOKB 2ARWA 3VH8B 4TOYH 2CRIA 5D7IE 3TIDA 2YZ1A 2D0GA 3WS6C 3ISWA 3UP1A 4Y4KD 4YBQD 4NBXB 2FJHA 4UILL 2A0LD 1UM4H 4LMQE 4PFEA 4PJEB 1F3RB 4I48B 4RFNB 1MCRA 3TEUA 2P5EE 4N90E 1YY8A 1J1XH 5TFSH 1NCCL 2EC8A 3L3DB 1A6WL 2B39A 4Y5XC 3QPQD 1EAPB 4H5SA 3QFJE 4MA1B 4OD2B 4XI5C 4Y4FD 1L6ZA 5IWLC 1EHXA 5EG6C 1LO3H 3SE9L 3RWGA 3WHE0 4WUUA 2VXTL 4P5TA 4HUXA 5D72L 5ANME 4NCC2 5F88A 4QOKA 1VB9A 2FJFB 4PJBF 4RAUA 4HKJB 5L88H 5IFJA 1F58L 1OGAD 3KJ4C 2R0LH 1ND0A 5HHVH 5HI5C 2VZUA 3M07A 3PHOB 5E8DH 4BQBA 4B7IA 5M7QA 3MRCA 4KTEL 4GXVL 2O61A 1NJ9B 4NZRL 1QRNE 1RZIB 2WLZA 3HZMA 5EOCL 5GJTL 1TJHL 4CDHA 2YUWA 1QFWM 2GK2A 5A2FA 3O9WC 3IAPA 3CZFA 2PYFB 1HI6B 1Z9OA 1XF5A 5BS0D 1JGVH 3D85A 5IB4A 3PGDB 5J1AA 1Q9WB 5HDBE 4QXGL 4X7TB 5DC0A 1NMAL 12E8L 5D1ZB 3LKNA 1ZT4B 2C1PB 1SEBB 2DIBA 1WBXB 3ARDC 3QUMB 1HHKB 2ITDA 1DL7L 2VDLH 1JRHH 4P3WA 3STZB 3VRJA 3KWWB 1OTUD 2D7OA 1KB5L 2H41A 5IVXE 1T1ZA 1GHFL 4G43B 2XN9A 4NM8L 1RIUH 2AVGA 5E2JA 1KN2H 4Q9RH 4W4OA 3QDMA 4XPBL 1M7DB 1S9YA 1UH4A 2HKFH 4JFFD 4OZIE 3MLUL 3B6SB 2X41A 4JO4L 1A3RH 2EDTA 3VXME 3HC4L 1U8LA 3C2SA 4RGNB 5EOTA 2BOCB 3QDJE 4U0RC 3OTTA 2OTPA 4JZNB 4OGAD 4TYUA 2DYPD 3CDYA 4PLKC 1ORQB 4NHUB 2CMRH 3VXQB 3WO4B 1U8IB 5ICZB 4XVJL 4IDJL 5D93C 2P8MA 1KLGB 1ZA3A 4OF0A 4S0SD 2H1PL 4F7TB 5F70A 3O2VL 4Z76B 3GMNA 4LF3A 1MCKA 4ORGB 4WUKL 2I5YL 1NGPL 1HWHB 4ODTL 1T03L 4JFDA 1OAQH 3WUWG 3BD4A 3AU1A 4FQ1H 4JVPA 1EGJH 4YFDB 5F7FA 2DLTA 3O6FD 1UCBL 4KZDH 1IRAY 5DUPL 3SDDA 1QLFA 1WISA 1TTUA 5DO2D 4QTIL 1ZTXH 3T3PE 5TGBB 5KSBE 3TWCH 4NKDB 2Y6SC 4HMEA 3LPGA 1XCTB 4ETQA 3VDAA 3QHZH 1JFQH 4MGXA 5HYJE 1QBLH 4KJPD 5EZIL 3VXRB 1NKOA 1QR4A 4FQXB 4IDLA 2A6KB 4ONOA 4YDKH 2HLFC 5CBAA 2H2SC 1A22B 4L4VE 5IKCA 1UXSB 1FFNA 1YNKH 3H7BA 3F6LA 5FOJA 3C08L 1M6OB 1OCWL 4NBYB 3RJQB 3OKMA 1L7IH 5KSAC 5LVEA 2MKLC 1XGPA 2NW2B 3KYKH 4FZ8H 2DQCL 3HE7C 4MXWL 1XIWB 4NQSB 4NZDA 3U2SA 3LKQA 4POZD 3QUYD 1M7IB 3AC0A 3BKYL 1CG9A 3NAAL 4LLAA 1N6UA 2OL3L 2AJ3A 3TCXA 4FRWA 2WUCL 1BFTA 5D2LA 1FGNL 3V0VB 2X2YA 4M6OH 4PJCA 3RUGF 2ZCHL 3FQNB 1F4XH 1ORSB 1T21B 4OUUA 4LVHB 4NQCA 1KB9J 4BZ1L 5I18L 1YEHL 4JFQB 4QHMB 3BRDA 1GPOH 2DRUA 5F7DB 2B5IC 3WSQH 5J6GA 3NFPB 3OB8A 2LU4A 1EPFA 2R8SH 1NEZB 4OZ4B 1IGTA 1K2DA 2DQTL 4UIKH 3U0PA 4WU7A 4P4KD 1NL0H 4XNMA 1NC2B 4IRSC 3EO1A 3DSFH 4J6RH 2XNAA 3X12B 2ADIA 1A9EA 1D5ZA 2XKUA 2VUYA 4MZ3A 3CFEB 1J1PH 4GAGH 1QA9B 2YPLA 4IRJD 4NQXB 4JZJC 2NMSA 1E4XH 1N5YL 5I2IB 3L7EB 2UZXB 5LGHH 1AI1H 3GSNB 3RVXD 3AFLA 3TPUE 4KDTC 1S9WA 5HDQL 3MJ6A 1OM3H 2VQ1B 4KKCC 1HH9B 5C0DB 3QUZB 1ZLSL 3ULSB 2P24A 4JFEE 3VFGH 1LD9A 1GC1C 3TN0D 3BZ4A 1RVFL 4BZ2L 2V6HA 5DD3H 5I8CB 4U6YB 2D0FA 2CJUH 3V0AC 3N9GH 4MNGB 3DMMA 4W70A 2JELL 2GTZB 1IC7L 1JN6B 1J05A 5FOBA 1I9JH 5EZJB 3QCTL 1NAMA 2GJZA 5HHNA 1MFAL 5D7IF 3K8KA 4XHQA 3RNQA 3OZ9L 2R1YA 1ZANL 1T20A 3I84A 3DO7B 3BGFB 4HIXL 3E3QA 3QXDB 3MGTB 5IHLB 2XTJD 2GFBB 2ENSA 5DFVD 5FV2A 1IAII 5ALCL 4OZHF 1EEZA 1EO5A 5DJ6A 4A6YL 3I2CH 1PAMA 2HFEA 2BVYA 4JFXB 3SPVA 4OV5A 1CD9B 3QIBD 5E00A 4M4PA 4UNTA 3IVKA 1LO2L 1RUKH 5TF1L 5BV7L 4P3DB 5C0RL 3S8WA 3BP4A 1QVOB 2D3VA 2FX7L 2KL6A 2C3VA 4KZEL 3FZUD 5IJVA 2OSLA 3O3DB 5CEZE 4BK5A 1EGJA 5CD3B 3RHWK 2R1XA 4ONGH 2ZCLH 4GMSH 1RULH 4Y8AA 4D9RE 5IMOB 4BSWB 1S5HA 2HRPH 4F7CB 1YEFL 1XAUA 3BXNB 4KJYB 4DVRL 3P73B 4KGLA 3HNTL 2ADFL 5EBLB 3KDMA 5ALBH 1DTUA 3GSXA 3PGCB 3RVVD 1TVDA 4Y4HA 5E6IC 1IT9H 3RTQD 4YR6B 3LKSA 5GZND 1MCDA 4HEPG 2AJYH 4I18B 4WFGE 5EZLB 1UVQB 1BFOB 1MAMH 4LQFL 5DRZB 4C83B 1HOCA 2EE2A 5I9QB 3ZKNC 1JCKA 1HKFA 2G9HB 1QFOA 3MV8A 1VFBB 1RSFA 4TUOA 1IAMA 5BZDB 5HDBF 4JM2B 2HJKB 5JLZB 1MCOH 4J3OC 4PBVC 4XVTH 3TA3C 2WZPD 2Q7YA 4OLWH 3VI4E 3LN4A 2LABA 4U6HA 2Q1EA 1V8HA 4E5XB 4HS6A 2FIKB 3PJSA 5HY9A 5D6CA 1EJ6A 4PJXB 2AJZB 5DXWA 3IFNL 2Y5EA 3PQYE 2UY6A 1BQSA 3FB6A 2NNAB 1X44A 4YX2L 1MHHA 4D94A 2E6PA 4JQVC 1KCUH 1TLKA 4WFHE 2DQJL 4RNRA 3S96A 3C09C 4GG6A 5IVXF 3MGOA 3AMLA 3VFTB 2R69H 2R0WL 3LQMA 1KPVA 4NM4L 3Q5YA 1MQKL 3FCTB 5JXAH 4OLZL 4KKAC 4CN4A 4PG9B 1WWBX 1RUPH 4OZIF 4H26B 3OKDA 4X9HA 3JTTB 3KLAA 4FQHB 1NCTA 2R39A 3MUHL 2Z35A 1BIHA 1MJ8L 2A6JA 2BNRA 5GGUB 5DHVB 5E2UH 4BQ8A 5J9PA 3D1MC 2AJUH 5SX5K 2X70B 4K55A 2ZG2A 1IGFH 3VJ6A 2RHEA 4KJQD 2YK1H 3MR9B 1P5UA 4LASH 5DWUH 4EEEA 4OIIL 5GS0D 43CAB 1FCCA 4MJ6A 4KI5C 1YEDA 2XZQH 3MGAA 1INDL 2EDWA 2OTWA 2YBRA 1KIPB 1HINH 1SHMA 3BSZL 2IH3A 1FN4B 2P42B 1MFCL 3F6IA 4AEIL 3T3PF 2XG5A 5KSBF 3BZEB 1FYTB 4UT6L 3BT2L 3O3EB 2I9LA 4S1RL 5CEYB 4MHHG 1MCCA 5D1ZD 2CGRH 3V0WH 3EHBC 5C6TL 4RQQB 3QIUA 2IALB 3WS3A 3NPZB 1FH5H 3P30H 4U4BA 4GO6B 5D1QC 5HGHB 4LNRB 4Q7DA 5AUMB 3WL9A 4X8XA 3FONA 4LU5L 1ZGLM 4TSBH 1P9MA 2WIMA 5GRJH 1CFTB 1KCRL 4JDTL 2M8XA 4URTB 5AEAA 2C3XA 2CR6A 3RWCA 3TLRA 4NUGL 3FQUA 3NBNA 3V6FB 2EE3A 1U8NA 2OQJA 5H2BA 1A1NB 1JGLH 2J6EL 4HEME 3F7RA 4RGND 2FB4H 5C0FA 1ZLVK 1LEIA 4L3EE 2J8HA 5SWQB 1YN7A 5GS0L 3ZDZE 4L8SB 4XXCA 2O26U 4JQXA 4AH2A 1K4CB 2VB5A 1A3QA 3H9SB 2WBJB 3HPLB 1U8OA 3MBEB 4HPYH 5KOMC 5F8QC 3S7GA 4QRSB 3ZT5A 1O0VA 4K2UH 1T7VA 1CGXA 4LQ1A 3WKMH 5I75C 4MAUH 2EO9A 4NN7B 4L9LC 2AI0H 2VLJE 4QHKI 1J8KA 3T77A 4ZFZA 4X4ZA 2UWEB 4X5WB 5EU5B 4YHKL 1XT5A 3UYPA 4M1GH 3B9KC 3RY6A 5E8NA 3ME0A 3QO0B 4R2GC 2F54A 1X7QA 3G6DH 3EJZD 4XBPA 1HSAA 4HT1H 1JZ8A 1KIQB 3VXRD 4U1GB 1U3HA 2JTDA 3BWAB 5KZCB 3ZHDA 5GGQH 4FQXD 4OFPA 4G59A 5FB8A 3DV4B 5I1EH 1MRCL 4WEBL 4XRCA 1F6AA 1ZHNA 5IFHL 1MHCB 5HGDB 4N0UA 1YEGL 2JJTA 1NGWB 5IB3B 4I2XA 1T5WB 1NGYA 1HSBA 1UJ3B 4PR5B 5CP7B 5A2LH 1FE8H 4TNWK 4XZUA 4YBLC 1WF5A 4OZFB 2GKIA 1XIWD 5BXFA 4Z7WB 2M26A 3S3SA 3RA7H 3MJ9L 4WGVB 1NCNA 3WLWD 5ID0A 4RFOH 1JGUL 2W65A 5DMGC 1A47A 5GRXG 2Y7QB 3MRGB 5DJ8A 3CSPA 3E6FA 4XH2B 4XBGA 2Z91A 4K3HA 5TDPA 1FFQA 4KQ3L 4RBPH 4N5EC 3N06B 4X6FA 1ZLWH 4X98B 3VXNB 5CILH 3P9MB 1WAAA 1NCWL 5KVDH 5HYSA 4TTDC 1G7HA 1BFVL 4I3SL 3CMOH 5CEZL 1AXSA 5SX5H 4Y89A 1UKTA 3OG4B 3P11H 4LSSL 3NGBC 2H45A 2IQAB 5DC9B 1CFVL 1KT2B 1R5IA 4HDIA 1NC2D 3D18B 5ETUB 2F74B 1KPUA 3MLYH 2O5ZH 2BSTB 4KI5E 5FKPA 1MH5A 4QLRA 2ARJB 2BHZA 5KVFH 3HB3C 1MI5B 1TQBB 1AO7A 3DI2B 4YDIH 3QUKA 4P9ML 5EOQL 2OI9B 4OAWB 4NO0A 2ZCKL 3O4LE 1JUFA 3WFDL 5MEQB 1N5AB 4K3DH 3MLSL 1AD0B 4LCCB 1S9XB 2VLKE 3T4YA 3P0YL 3QUZD 5C0IA 2FR4A 4I9WD 1U8KB 4X4ME 4UOJA 1MFEH 5HVFB 2EXYD 3F62A 3V6OA 2DMKA 3WFHA 1FIGL 5IVZB 1J1OL 5I76B 1UYWL 2JF1A 3VGGA 1XGQB 5IB5B 3STBA 1MEXH 5CS7A 3EYQD 3REVA 3VG0H 5CJQH 5DEGB 4J12A 1VESA 3VI4F 1H3XA 3SKOB 4WFEE 3MV9E 4G9DA 3VXTB 4YHPB 2J88L 4ENED 4HC1H 3CVIH 2NYYD 3VWKB 35C8L 1PSKH 4FQCL 4HWZB 1WT5A 3QISA 3ZT6A 2BRRL 1S7RA 5DI8A 5DUBB 1ZLVH 1CZ8L 3G5ZB 3TIEA 4YHLH 1YNTA 3OPZL 4HH9B 4X99A 4X80H 5C0NC 4E0RB 1IMHC 2D7QA 1CD1A 3WE6B 1CU4L 4GT7A 2P46B 5J3HC 1CL7L 4IJ3C 3T0EA 3ZZ1A 2GIYA 3VFUB 3TO2A 3ULUD 4ZUTA 3G5YB 8CGTA 3G5XB 3WHXA 3IDJB 4X9FA 3W0WA 1DVFB 3MPCA 4YBHA 1ZWIA 5EU6A 3AM8C 1D5XB 2H3NA 3CLFL 5J1SC 1EHLH 5HYQA 3TBVB 1WBYB 1S78C 4HPOH 2NCMA 1HHGB 3EZ8A 2XICA 4GW5A 1OW0C 3RGVC 3HAEG 3WXWH 4R4BB 2Q8BH 2AEPH 4WHDA 1X5LA 3L95B 4PRIE 4QRUB 3MRHA 3UBXG 1W0VB 1B4JL 4FTVE 1S9VB 2A73A 3MA7A 3MRIB 2CD0A 3OKKB 1WVZA 1IQWH 4O4YH 3N0PB 4JAMA 1H5BA 3LSOB 1KJ2B 4O2EA 2V2WA 1P4IL 2KDGA 4GRWE 4C56E 1BBJA 4L1HA 2ORBL 5KVEL 4DVBB 3BH9A 3HTLX 2NTFA 4NOBA 1CE6B 4JM2D 1FNHA 3LQAH 3VFOA 5KN5B 1UXWA 3T2NL 3ALPA 4KK5D 5HYEA 2R4RL 1ONQA 1MFDH 1QEWB 2BVOB 1FFRA 1JNNH 3GI8L 3QXAA 3TJHA 4HW6A 3LHPH 2ZUQC 4XVSL 1MWAB 5GISH 3WNLA 4CMHB 1CS6A 4RDQG 2KZ1B 4KROC 2LVCA 3TIDB 5FYJE 2W1NA 3VD4A 2X1OA 2FJHB 1TPXB 3OJMB 4CVXA 5AG8A 1MCWW 5GIRB 5K59E 4TRPL 1AFVL 4MA7L 1QPXA 4OIBA 3MA9H 4RFEA 3HG1E 1YY8B 3ZDZF 4M3JA 2AXFB 2MJWA 3C2AH 2WNGA 1X5GA 4PP2B 3EDFA 4M6NH 4N8CL 4TSCL 5I30L 1BJMA 4H5SB 4RZCB 2CDFA 4JM4H 2P48B 3QAZC 1OARH 5I1HH 4ZTPH 2CDGA 4WUUB 4PBXA 2C4XA 4CN6A 4P5TB 1KCLA 1MSPA 4P4RA 3TT3H 5DD6A 4QOKB 3FB8A 1F8TH 3DOSA 2MKWA 3QEGL 2WANA 1VHPA 4QKXB 1DDHA 1ND0B 1NANI 2XY1A 3VGAC 4HS8L 1QO3B 4L5FL 1FYTD 3E6HA 3MRCB 2O61B 1R3LA 5E4EC 3HZMB 3D9AL 3O41A 3U1SH 1U92A 1RHFA 2UUDK 3CAFA 5EZOH 1HNGA 4KUZH 2VISA 4R7NA 3LRSB 1K8IB 4Q6IA 2XA3A 3B8YA 5CJBA 4DKFL 3CZFB 3ARYA 1A7NL 1XF5B 1A7PL 2R4SH 2VDMH 3HUJA 5T1DL 4M8QA 3GHBH 3D85B 4YNYA 5J1AB 4M43L 2EDOA 1KNOA 3CVHL 4PG2A 2ZJSL 4KUCF 4F33B 4ELME 2WV3A 5DDHB 1MUJA 4FXLA 3BZDA 4EI6B 1INQA 2VR9A 5ADOH 4HC1A 3EYVA 5IMLA 1BD2B 2ITDB 1F3JB 5M94B 5DGRA 2B2XH 2FZ3A 3VW3H 4HIHA 4GBXC 4BFBD 1NCUA 5CSGA 3RWFA 1IZJA 5FCUH 4XNYL 4Z7OE 3VWJC 3I3EA 1ZGLB 2XN9B 3QDMB 5HHPB 5IVOA 3H9SD 2WBJD 3MBED 4QGTA 2VRAA 2D31B 4ZD3H 4LSTH 3TYFA 1G84A 2R2HB 2X4TB 2PTVA 1AJ7H 5HHMA 1J0JA 2Y4SA 1OAZH 5EOTB 1U8LB 4QF1A 5HI4D 3H0TA 1S7WA 3ZKMC 4G7YL 3ZYIA 3RNKA 2JB6A 4OZHB 2QLVB 2E9IA 1P7QB 2EEBA 15C8H 4M7KL 2VZ1A 4X6EA 1JHLH 2AQ3A 3GSWB 3QQ3A 1B2WH 3OAZH 4U33A 3ERYA 5J13C 4YXLL 5I1CL 4HIIA 4NWUL 3QCUH 3SDDC 1C7TA 3GMNB 4LF3B 2A9NH 5FGBA 3PIQA 2JE8A 3V9FA 1R3KB 3OJDA 4JFDB 4GXUM 2EYSA 3AU1B 4R97B 4X83A 4KI5F 5D5MA 1FDLH 5KZCD 3EYSH 1QSEE 4J7RA 1YEJL 3U7AA 1HXMA 5I1LB 5I1DB 5GGRA 4DEPB 4F3FA 3L9RB 3SDYH 2DWDB 3QRFM 1SM3L 3ARGB 2GK0B 4TUKH 1J87A 1CICA 1IAIH 3CFKA 1KFAH 4NQDA 4Z18A 4ETQB 5JHLL 1S7QA 3PWUA 5C07E 3P4NA 1S3KH 1G7JB 2D7PA 2RGSA 3RWDA 3U7YL 4NGHL 3I50L 4WTXA 5B38B 3INUL 5MI0C 1IFHH 4QO1A 3RL1A 3TESA 3RZWA 5HPMA 2IGFL 5TQ2H 4I3GA 1MJUH 4MA3A 4EVNA 2J4WL 4ODHH 1T04B 1W8NA 2AXGB 2YMXH 1IBGH 1VPOL 4C59B 3L3KB 1KACB 1KCVL 1IGIL 3X11A 2VDPH 3QUXA 1FNSL 2UZIL 3PL6C 4N8VG 1L7TH 3VI3E 2W92A 2HWZL 1H3WM 5BQ7A 4F9LA 1JHKL 4H8WC 3RL2A 5ISZB 2VDQH 1FNLA 4F37F 4HUKB 1P84J 5FCSH 2B1HL 3P0GB 3GI9H 5IOPB 3QRGL 3TZVC 3NPSC 4OUUB 4NQCB 3VCLA 3ZTJH 4ZNEE 3EOAA 3BGMA 5EA0H 3HE6B 4YHNA 2H26A 4WV1C 3VRIA 3VXMB 5HGGS 5J6GB 4OZGA 3O81A 2YSSA 5K9QI 4P59H 1MI5D 5GGTL 4LVOB 1N2RB 1Z0NA 4ZSOB 3EJYC 1IGTB 1K2DB 2AS5M 5F7EH 4WU7B 3U0PB 3EGSA 1UA6L 5E5RB 3EO1B 2DI9A 1XF3B 5L0QC 3ABZA 4XAWL 3GKWH 3KLHC 1X6LA 2YPLB 4Y5YA 1DBJH 5SWZB 4JRYA 1DUZB 3CLEL 3MRMB 4ESKA 1MCEA 3QEQA 5IB1A 4ZQKA 3FN0L 4UT9L 3VFNA 1JPGA 4GRWF 2R2BA 5FECB 1PKQB 1YMMB 4AY0A 4NKQB 5I1JL 4M5ZH 4B0MM 3JWOH 3S37H 4D0CA 1OAXL 4CVZB 3GRWH 5J11C 3GNML 4YE4L 3GBLA 4RGOH 3NN8A 1LD9B 5LQBH 3MRDA 3UTPD 1QYGL 4XPHH 5C0BA 3SCMC 3VWKD 1EK3A 3MRRA 3DMMB 1U0QA 2DS4A 5FOBB 1QOKA 4UV7L 3QDHA 1NAMB 2GJZB 5HHNB 1EMTL 3FT2B 4YPJA 3UJIH 1A1OB 4JPKH 4HF5H 1YC7A 3RNQB 1JZ3A 2E27L 5T3XE 1U93B 2R1YB 1T20B 1SYVB 3ARBA 3ZL4H 4UQ2B 5E5UB 1G9EA 1JPFB 2F53E 4LRNH 3TPKA 5LWYL 3QFDA 5A40E 1DVFD 5K59F 1EEZB 1EJOH 4EJ1C 3GHEL 2HFEB 2OMNA 3SPVB 3ILPB 4A2LA 3JV5A 4OV5B 3ET9F 2V5RA 1KJ3H 4X7SH 3BP4B 4AL8H 5F44A 3S34L 5MHSD 5K9KA 2MQ3A 1W8OA 1MY5A 4C4KT 5DJXA 5DR5L 5E2VL 3THML 1EFQA 5IHZA 2C1OA 2UVEA 1MIML 2BCKA 3MODH 3RU8H 3P2TA 4P5KA 2R1XB 4KGJA 3ULVH 1BF8A 5FGSA 3TH4T 3CDGA 3TYGH 1C16A 4QCIB 4WIQA 1FL6A 2F5AL 1QFUL 4M03A 4HKBA 4XCNA 4PJHA 3BMVA 4JO2L 4PUBL 3KDMB 4MQSB 3BE1H 4ZO6A 1CFSB 1QKZL 2XXMB 3KLDA 3FQRA 3SY0A 5CSZA 3LKSB 4JB9L 3LS4H 4L1DA 4G3YH 2E8ZA 4LSRL 2APFA 1HOCB 5D7LA 2FX8L 5FO9A 5TDNA 3LEVL 1T83C 4TUOB 3TJEL 4N0YL 2Z9TA 5JR1H 3WO3B 1X9QA 4ELMF 2YKLL 2Q7YB 4RA3A 3MCKA 3LN4B 1D5IH 1DEEA 4U6HB 4HS6B 3PJSB 5HY9B 1YC8A 4EXKA 2BVPA 2DI7A 1LEKA 3FB6B 2BHUA 2EYRA 3NZHH 4XMKL 5D2LE 2L7UA 4Z0XB 3C5SA 4PJCE 1MHHB 3QIWC 2AV1A 4ZFGH 4RNRB 4LDEB 4GG6B 4NO3A 2O93L 2C5DC 4NIKB 4OD3L 4Z7OF 1NMCC 4UINH 1U8MA 4KVNL 1KPVB 1YYML 4LHUG 4X6CE 1RZKH 5F72S 1N6QH 4JG0H 3OHXB 5IGXH 4O2CA 4FQPA 4NSKA 2NY3C 1WTGT 2YPVL 1EDQA 2X4QA 1KBGH 3CNKA 1C1EL 7FABH 4PGEA 5ENWA 1Q0YH 3OKDB 3KLAB 1DBKH 2X6MA 5IQ7L 2Z35B 2YXMA 4WUUD 4Z7UA 1FL3A 4P5TD 3UEZA 4MCZA 1XF4A 2BNRB 3RVTD 5C71A 4QOKD 1XCQA 2GJJA 4KK9D 5AG9A 3UPCA 1U8HB 4E9LA 1FC1A 1BWMA 3VJ6B 3SKMB 4D8PA 1DJSA 5D93B 4S11A 3HMWH 5J6HA 2P8LA 3DGCR 4NN6C 5T5FL 1FGVH 1A6ZA 3QBTB 5F21B 4V1DE 4MJ6B 4OLYH 1YEDB 1FVEB 4WJ5A 4WO4A 1CBVH 2YEZB 1KUMA 1CLZL 2AKRB 4RMWA 5GSVB 2OTWB 2YBRB 4YQXL 1FNEA 2AQ2A 3EFDL 5CJ5A 2IFFH 5F89B 1Z3GL 2FCBA 3ZKXB 1RUQL 1VDGA 4DFIA 4M00A 3IAGC 2AGJH 2ICWJ 3BN9C 3D85D 3WJLC 2HJLA 2NY0C 4J8RA 1IM9B 1U58A 2I9LB 3OGCA 4J3TA 3T0XA 3BP6A 3GRWA 4H1LB 3CZJA 3QIUB 4OBRA 5GS1C 3WS3B 2DJ4A 3LZFH 5T33L 1BD2D 1F97A 1RFDL 3PWPA 5C7XL 5I8OL 3VXUA 1NBZA 2CIIA 2X4RB 4D3CL 3FRUA 3JSSA 4ORZC 4QRPE 3I6LD 2EC9T 3KJ6L 4XGZB 5L8KB 3E3QE 4RDQF 4BH7B 3FFCA 3D3VA 2XN9D 2A77L 3DUSA 1X3DA 4GMTH 4MNQE 3QDMD 2CK0H 2D7TL 2N7AA 3RWCB 4RMRA 3FQUB 4K8RD 1HCVA 4MS8C 3G9VA 4LCYA 4R4FL 2IPTH 5H2BB 5CZVL 4XT1C 4K7PL 2HP4A 3WD5H 1UWGH 2P45B 4MJIA 3DV6B 4XC3L 3VI3F 1EFXA 3QQNA 3QWRA 2KBGA 5FUZH 2EDHA 1AR1D 1LEIB 4LCUA 1RU9H 1ZHKB 1P7QD 2H2PC 4PB9L 4AH2B 1MAJA 2Q76A 1MRDH 4QRRE 1BIIA 2OK0L 1U8OB 4EOWL 3KPOA 4ZPVA 5E8PA 1CDIA 2GITB 4JFDD 1AXTL 1IZKA 4XP4H 1NC4A 3SGKC 3TF7A 1PFCA 1PZ5B 4JQIH 1TCMA 1MFNA 3D25A 1SJHA 4PY7A 3ARGD 3FQWB 3M8OH 3NH7L 4JY5H 2F54B 5SWSE 1HCFX 1VEPA 3MV8E 4XBPB 1HSAB 4P2OC 4UDUA 4FQIL 4U1LA 1BVKA 3KYMB 3GMOA 1Z2KA 1U3HB 3X3FL 2EE6A 1NAKH 2IPUG 4XRCB 4M6ML 1F6AB 3U4BH 1BZ9A 2RCSH 2EKJA 3FAWA 2HFTA 1NGYB 1HSBB 1P69B 4I0PC 2WMPA 2WP3T 2X1WL 4JHZA 4YC2C 5TDOA 3E8UL 4JY6B 3W81A 1LQVA 1D9KC 2OR9H 2R56H 3ZSSA 1OGTA 3BISA 5T3XL 5BXFB 3U83A 1Y18A 1F11A 4D9LH 1V7NH 1DE4A 2AP2A 3VXSA 2W65B 4YIQA 1SY6L 5DJ8B 5DURB 5ISZD 1VEMA 5EORH 1HILA 2GSGA 4TQEL 4OM0H 4XBGB 3FOLB 4ZUUB 3S35H 4FFYH 2R0KL 4M9OA 2ZOLA 2YUVA 4YFLF 5TDPB 1F90H 5HYSG 4FFVC 2PW2A 4DZ8B 1I3UA 4NQCD 4KKNA 4I77L 4ZUWB 3AREA 5IV2B 3HE6D 4YLQT 1DEDA 1G7HB 3JV6A 4XB8A 4I3RH 3VXMD 4HJGA 1W72H 4EN3C 1AXSB 3C60A 2QV2A 1KEGH 4LCWE 1YECH 4PRHA 3QYCA 4NQVB 2K3TA 4HDIB 1RURL 1VSCA 5C09A 1PLGL 5F93C 4PRPE 5C3LD 1KPUB 1SYSA 2AK1H 1XGUA 3SDCA 3BRGC 5TJWK 5HHXH 1P7HL 4XBEH 2YPLD 5DJCB 5SWZD 2QADC 1MH5B 2BDNH 4PGDB 3KPSA 4TOYL 1SBSH 2PTUA 3QUKB 4NO0B 4Z7VE 4B5EA 1JIBA 1JUFB 1YMMD 1ZT7A 3LH2H 1FVDB 2BNQE 3T4YB 1UM4L 2E5EA 2LAAA 2VAJA 4UIMB 5JDSA 5C0IB 4PJDA 4EI5A 3Q6FB 3LDBC 2FR4B 1FJ1A 5IFAH 4X4XB 1A7RH 3WFHB 3MRPB 4MQTB 8FABA 2PW1A 2ID5A 2E9BA 4XPTL 2PYEA 3DMMD 3I6KB 3S37X 4KAQH 4DKDC 4HUUA 5JHDA 4H8WL 5D7JA 2G2RB 5INCA 1LO3L 5LCVH 2XZAH 3HI5H 2AK4A 3IF1A 4ZFOA 4MD4A 4G9DB 1NANH 4JDZB 1DLHB 4MJ4A 1T7XA 1VGKA 1RZ8A 1Q0XL 2Q3AA 4MSWA 5L88L 5D2LF 2VKXA 4L4TB 5F1OB 3T0EC 2R0LL 5HHVL 5E8DL 5A1AA 3CFDA 3TIEB 1YNTB 3MRLA 1G6RH 1RUAH 4X99B 3OXSA 4JR9H 1AGFA 1CD1B 3KVQA 4X6CF 3C09B 3ZYOA 4X0KA 3IJYA 2EDRA 3BIKA 5F7YC 5TH2B 3GJFK 4LPYA 1FSKC 1XR8A 5K9OA 4MLSA 3DGGA 1MCHA 3HNSH 4ZUTB 4NNYB 1BQHG 5FK9A 2W60A 3M17A 4ODXA 3W0WB 2FX9H 5EU6B 4DN4H 3WNOA 1KLFA 2H3NB 5DMKA 3GM8A 1LGVA 5HYQB 2FL5B 3SGJA 4NJAH 3RX7A 5FO8B 4ETYA 3MRHB 1JRHL 2A73B 3MA7B 4EIZC 1HQRA 3WYRA 5FFLA 4YDLB 4N0UE 1XEDA 4JAMB 3PNWA 4I2XE 5B3JE 4O2EB 2V2WB 3HZVA 4UBDC 1RIUL 4JHAL 3MV7A 1KN2L 3B2VH 3QXTA 1BPVA 1NFDE 1HXYA 4XX1G 3BH9B 3UTSA 5EN2A 1XFPA 1UWEH 4Y2DC 4PJFA 1GIGL 2PO6A 3FO2B 1PW3A 1R5WB 4MDJA 3TJHC 3BPCB 3G6AB 1J5OH 1IAOA 3KPQA 4L8BA 3IJHB 1NDMB 3CC5A 5EU3A 3NA9H 3S36X 4ZUSB 1HYSD 4N9OB 4M61A 4ONHA 4LSPH 2OXHA 3JTSA 4YDJB 4AT6B 4CU8A 2BVQA 2XFXA 4MQ7A 4Z5RB 1VFAA 1SJVA 5I73B 2A74B 1TJIL 2FYYB 4GG8B 4JO3L 1ZT1B 1TTGA 4Y4KA 3D69A 3R8BB 1WAAE 2ZG3A 3BPNB 1F6LL 5ESQB 3EOBB 3LKOB 3QQ9D 1OAQL 1EGJL 2EDJA 3UTOA 3QJHB 3GM0A 2PUQT 4QWWC 1CGTA 3BD5A 3QEHA 3SDAC 1JWSA 3UYOD 3TWCL 1QFWI 1YMHA 2FSEB 2QJDA 1W72A 1JFQL 3QHZL 2BNRD 5D7SH 4V3DB 1QBLL 1CXFA 1AIFA 2H9GA 3ECBA 5C08B 1OP5H 2D2OA 2WUBL 5FYKH 4YDKL 1AO7E 2OBGA 1GGCH 1OGAA 4ZS7L 4HJJH 1VEOA 3SQOH 4BH8A 3S4SG 1RJLA 1FCGA 4EDXB 3L5HA 4P4RB 3CK0H 5DD6B 3FB8B 1L7IL 2ZNXA 4WTZA 4A2MA 4L9LB 4O58H 4FQLH 4FZ8L 5KS9E 2UZYB 2J3SA 5BJTA 3V6OE 2E8YA 3CFBA 3FQXA 3MJ8A 4W4NA 3IETA 1IM9D 3B9KB 3B2UC 4AG4H 4DJMA 4F15B 2HT3C 4PPTA 4R2GB 2Y6SD 4MCYA 3L3OA 3QIUD 1HHHB 5F96L 3DTXA 2VISB 3DYMA 4Q6IB 4X7FC 5I6XC 3PGFH 3DRTA 1IQDA 4M6OL 4YJZL 1MY7A 2DQHH 3LIZH 4IHOA 2HLFD 4U6TA 2H2SD 4YNYB 4XNZC 5IIEA 1KNOB 3LN5B 4D9QE 5HVHB 5CIPB 1C12A 4OCMC 2NLJA 3CUPA 1GPOL 1UQSB 1INQB 2QQNH 3WSQL 5IMLB 3EYVB 1EA9C 3RWJA 1SMAA 3ESUF 4JCMA 2HTLC 5FUOL 3T0EE 3CX5K 4S0UC 5C0CB 3DSFL 4ZYKA 3RZCB 3T0DA 3HZYA 4OM1H 4UNVA 1ITBB 5B39G 5I1AA 1N0XH 3F8UB 4JGJA 1J1PL 1QQDB 1QP1A 1JNHA 2DYPA 1J8HE 1KELH 3DUUA 1H0DA 5T5NG 4LSUH 3VA2C 5EO0A 1AI1L 4OD1L 4G8FA 1IKFH 2VDOL 1CD8A 3H0TB 1S7WB 1H15A 5AD0A 1OM3L 4PJ9C 3U0TA 5IMKB 2QSTA 4X6EB 3V4VL 5C1MB 3QQ3B 5BVPL 4PY8J 4U7KA 3O6FA 5I66A 2H8PB 5FV1L 2BOBA 4GAFB 5DD3L 2F54D 2CJUL 3PIQB 3MRNA 5CLTA 1JZ2A 1CICC 4QT5A 2W0LA 3OJDB 5D5MB 1U3HD 3DNKA 3B5HA 1HXMB 4XX1E 5EUKB 4L9DA 3TBYB 4F3FB 1CYGA 1DQMH 5D6DC 4PD4K 4Z7VF 3CFKB 1OTSD 4D0DB 3PWUB 3P4NB 1CGSH 3VGFA 5SV4A 4ZODA 3RWDB 3VMPA 3I2CL 4LLVA 1HH6B 3KPRB 5BO1H 5EBMA 4QRTA 5JOPD 2JB5H 3DBXB 1RUKL 2VXSH 3DX7A 4HKZA 1P7KB 5EUOF 3LQZB 2HT4C 1OD9A 2FWOA 4KTDL 1KYOK 4FFWD 5DURD 2MFNA 4G9FA 4CGTA 4CVUA 1QBBA 3CXHK 4LLDA 3QUYA 5KJRH 2IQ9H 2EZ0C 3FRPG 2APWA 3RX8A 4ONGL 2ZCLL 4GMSL 1RULL 1RI8A 1LK3L 1DQLL 2HRPL 4GKZB 4G6JL 1QBML 3O0RL 3SKJH 3V7AG 2XIDA 3T2OA 5BQ7B 3S35X 2ITCA 5ALBL 1TJGH 3VE0A 4WI8A 4HWNA 1IVLA 1JZ4A 4PJIF 5DRWA 3WFCH 2VJXA 1LP9E 1TVHA 2BJMH 1MAML 1XH3A 1PZUB 1NBYA 3U36A 5D8JH 4LPXA 2E7CA 4JRXE 5D7KD 2APVA 4YHNB 1CR9H 3LY6A 2H26B 3LS5H 3VRIB 3ILQD 4Z78A 4NZTH 2C3GA 4XVTL 1DBMH 1UWXK 3B9AA 4M5YL 4IRJA 3E0GA 1IARB 1XGYL 1B0WA 4PJ8C 1EXUB 1GOFA 4GAYA 2C3HA 4LCIL 2I24N 3HUJE 1AHWC 3JWDH 1T66C 4LIQE 3H42L 4Y5YB 5IT2H 1I8LA 4YDVA 1WZLA 5B3JF 1NSNH 2R69L 3QEQB 4MLIA 3VFNB 1JPGB 2WSKA 1V5JA 4BELD 1Z0MA 3EO9H 1A7BA 1NFDF 1WEJH 2FRGP 2NY4B 1HN1A 4I5BA 3BOVA 2AABH 2E9WA 1E4WL 3B5GA 3QUMH 4YGVA 4K07A 1JZ7A 4XAKE 4AENA 1WGOA 4D0CB 1Y0LB 1ZMYA 5J89A 3JVGC 1JWMA 3G9AB 5EU7C 4P2QA 4NRYA 5KSVB 1WC7A 5DC4B 3QO1A 1I1FB 3MRQB 1LO4L 5C0BB 2AJUL 5FHBH 4L4TD 1Q1JH 5CGTA 4F7MA 3MRRB 4AQ1B 1FL5B 4JO1L 2APTA 1DANT 4LASL 2VL4A 5B22A 1CCZA 4M02A 5DWUL 3RDTA 5TE6H 4ODWA 1WAAF 4TVPH 2AV7A 2CLRA 2X9WA 4AIOA 5DJAA 4P0DA 1LE9B 3WN5C 4PJ7E 2EE9A 5EBGA 1HINL 3DETC 1GYAA 4HX1B 4PREA 3MBXL 2JKXA 4NUJB 4WFFD 2R9HC 3OKLB 3QFDB 4WENB 3W0WD 2V7NA 5EU6D 1EVUA 4Y16C 2CGRL 4N0RA 3FB7A 5DJYA 2PKDA 4DKEH 1NLDH 1FH5L 4BUGA 5IBUB 5DJXB 4DN3H 1P4LA 2EDQA 3L6FA 4PRNA 3F58H 2C1OB 4NQDE 4MD5A 1BWWA 4TSBL 5FAAA 2A6DA 1AD9A 1ZE3C 1ADQH 4GRMA 2VXUH 1KPRB 1TIUA 5HPOA 2WBWB 1GCFA 1FL6B 2NY5C 5KS9F 1J0KA 1DLFH 3SOBH 4HKBB 2VWEC 4PJHB 1UEYA 1L8JA 2D03H 1FLTX 5KVMC 4P2YA 4G42B 5ITFA 3UO1H 2ZOKA 3SY0B 2DLFL 5CSZB 3EHBD 3RIFK 4X9GA 1QSVA 3VH8A 1LNUB 5J8OA 5D7LB 2Z93A 1JYVA 2FO4A 1ULVA 5TDNB 2E7BA 4DZBA 2G5BA 4M6AA 4K2UL 3WKML 5BW7A 1AC0A 2AI0L 1T22B 1UACH 5FF6B 2BVPB 3MLXL 1LEKB 3PP3K 2ATPA 2EYRB 2G60H 2DM3A 5FA4B 3V7AE 1FPTL 2AV1B 1CFBA 4XHJD 4M1GL 3ARPA 3V8CA 2LTQB 2E7LA 3G6DL 2OP4H 4M3KB 1U8MB 4H0IA 3ZTJG 5GQBA 2MQ0A 5I8KH 4HT1L 4PJ5B 3RHWF 2Y23A 5TE4H 5C08D 4OZGE 5GGQL 4NCC1 2VDKH 3REWA 5FHAL 4PGEB 5I1EL 4HKJA 1DQJA 4PYGA 3HPJB 4HKXB 1EO7A 4MCZB 1NJ9A 2VXVH 1RZIA 1XCQB 4P46C 5ITBL 1FE8L 2GCYA 3AS2A 3B9DA 4JRYE 4ODSL 4JLRA 4M48L 3KXFB 4YAQA 3EYUL 5EFIA 5J13B 2P8LB 3RA7L 3B9KD 2PYFA 1A6ZB 3VDBA 3GSNH 4UV4L 1KIRA 4EQ2A 4R2GD 2CKBB 3PGDA 4NP4H 4WJ5B 3TM6A 2V7HA 5DTFA 4X7TA 1T1XB 2Y1VA 3NCMA 1RUMH 3CSBA 5DVLA 4NZJA 3OAYK 1RZJC 2C1PA 4H88L 1JGDB 1TETH 3MJ7B 4LMQI 4HGWA 1WBXA 4WDIB 3QUMA 2HJLB 1MREH 5I0ZA 4F7PB 1MRFL 3OGCB 3BP6B 3PDDA 5KVDL 4GKSB 5EU7E 2B1AL 3KWWA 3CMOL 3MLZL 3NCJL 1CFNA 4N0CC 5FUCC 2R1WA 3VMNA 1BREA 2FBJH 3PWPB 1E28A 4KVCH 3GEWB 1NBZB 3SBWC 3L3JB 3FRUB 5C0CD 3RZCD 3PWNB 1S7VA 4WW2C 3MLYL 2EDXA 2C9AA 5DMGD 4HGMA 3TNMB 1BGXL 1N6VA 1KENL 2O5ZL 4ISVA 4WHCA 3D2UA 4JZNA 4LCYB 3X17A 5KVFL 1ORQA 2CO6B 3OMZA 3QEUA 4JKPH 4N5ED 4NQUA 3F65A 4YDIL 5FYJD 1K6QH 1KLGA 5I8EA 1EFXB 3ULUH 4K3DL 3VXOA 5TPWH 1MELA 2XYCA 4LCUB 1N0LA 4AMKH 1MHEA 4WI7A 2Q76B 1MFEL 1BIIB 3ULVC 1XF2B 1LP9F 4K23L 1JK8B 1QUNA 4ZPVB 1P4BH 1U91A 3TZVB 3NPSB 5E8PB 2HYMA 4OUOA 4MXQC 5GRVL 4NKDA 5L2KE 4LIQL 3TBTB 1T0NA 1XCTA 3LKRB 3VG0L 5CJQL 1ADQA 1NC4B 1QFPA 2ICWB 5CWSB 3VXRA 3D25B 4PY7B 1YEKH 4FQXA 2A6KA 2VWEE 4WI3A 4MD0A 1PSKL 4KQ4H 3HUJF 1MFBH 5EWIH 5T1MA 4UDUB 4KXZI 1BVKB 3GMOB 5L0QB 1M6OA 4DCQB 3K3QA 3IDNA 1G7LA 4F57L 1PQZA 3KPRD 2NW2A 1WICA 3EDDA 1A5FL 3Q6GH 4DGYH 5GJSH 4KJWC 2XXCB 1EEYA 2XQYK 4CJ0A 3OL2A 3FHAA 2DTML 4CADB 2MOVA 1T89A 2HFFB 1JWUA 1M7IA 4J4PA 5TDOB 1YDPB 1E4KA 2VLMD 4P9HC 3HNVL 1EHLL 1RZKC 2BFVH 5MP6H 4FABH 1KXTB 4HPOL 2VLRE 1Y18B 1F11B 1WQVT 1C5BH 2XRAH 4TPRH 3VXSB 4OCYL 3WXWL 2Q8BL 4YIQB 3FQNA 1ORSA 1TVBB 2NY7H 2AEPL 4OT1H 1FFOB 1UADC 4NPYA 4JFQA 1IQWL 4O4YL 4WWKA 2ADJB 4Z7UE 5C0ND 1Z6JT 4KDVA 3QXWA 5F7DA 2XA8H 3C60C 3OXRA 4PJ7F 3MLRL 4I1NB 5DHVH 5T5NF 5KVGH 3T2QA 1NEZA 4OZ4A 3AREB 4EDWL 3U4EB 4K94H 4XP1L 3JV6B 3SDCC 4HJGB 3X12A 1I3VA 2FECI 2DQEL 1A14H 3ARFC 2FHFA 4OJFH 1KV3A 4M93C 5DD5L 2ENYA 4O9HL 3CFEA 4OGXH 1QA9A 4GKOA 3C6LC 1S78D 1UM5H 2I27N 5C09B 5HHOB 3UAJC 2ZZUT 5AYUL 4OCLC 2I9TA 1JNNL 1SYSB 4HUMB 3L7EA 1XGUB 4KHTH 3GSNA 1G0XA 3EIFA 3GGWB 2NTSP 5D96B 2BC4B 1AQKL 5GISL 5GRUH 2PNDA 3KPSB 2VQ1A 4TNWF 1HH9A 4NWTH 4HJ0C 3QEQD 3P0VL 2BVUA 3ULSA 1QLEH 1DZBA 2NY4D 5F9WC 1ZT7B 2N4IA 1QFWH 1EO8H 3QDGE 3ALXA 4OF5A 2ICES 5I8CA 3VXUE 4MNGA 3V5DA 1CLCA 2QQKH 1MCPH 3ARRA 4PJDB 4EI5B 5B8CA 4HMDA 1FJ1B 2GTZA 5A16B 3FFCE 3D3VE 5KANI 5FUCE 5C0BD 5EZJA 2PW1B 3C2AL 4FQ2H 2A2QT 2V5SA 4GAJH 1VACA 5J12C 1KC5H 3ZO0A 2NR6C 2VXQL 4JM4L 3OQ3B 3DO7A 5D7JB 5INCB 1OARL 4MJIE 25C8L 2GFBA 1WTLA 3IF1B 4ZFOB 3TT3L 4Q97A 3F7YB 3ORJA 1F8TL 1NBVH 4MSWB 3AY4C 3DXAE 2PXYC 3O8XC 2V5MA 2IBGA 5DUMH 1REIA 3CFDB 1QVOA 5IHUH 1BQLH 4P2RB 2MHAB 1F3DJ 4YWGH 1AGFB 3U1SL 5ERWB 3O3DA 2W0FB 2X44D 5EZOL 5CD3A 3BIKB 4GRLC 5K9OB 4OZGF 1XR8B 3ULVE 3DGGB 2NY3B 4EUPG 4F7CA 3BPLC 2VDML 3WEXB 2ZG1A 3M17B 2KQNA 3UDWA 4KJYA 2ZSVA 3GHBL 2VN7A 4MNHA 2JCCE 5D1XB 1YPZB 5EBLA 1AH1A 3C6SA 2WY3A 3IYLW 4ONFH 1A7OH 2X7LA 5E6YA 2F5BL 4YR6A 4KK6D 1B90A 5KW9H 1BFOA 4C83A 1HEZA 3B4NA 2WQ8A 2G9HA 2B2XL 3IFOA 3VW3L 1VFBA 5BZDA 5CFHA 3BDXA 5FCUL 4UUJA 3EFFA 3ZDYE 4LOUD 4DUVA 3HZVB 2ERJB 3MV7B 5D7LD 4MAYA 4YPGB 4IIQA 3MZTA 5EB9A 6CGTA 4MVBA 4OZFH 4PJXA 1UB5A 3UTSB 2FO1A 4WCYH 4U1SA 2NNAA 3A6BL 4PJFB 4ZD3L 3VGDA 2PO6B 2YD3A 1AJ7L 4RMTA 1OAZL 2NY0B 5E03A 4F58H 4Y4KC 4YBQC 1LO5B 4L8BB 2F15A 6FABH 5DK3A 3CC5B 2A0LC 5EU3B 15C8L 1F42A 4LEXH 3JTSB 4WW1A 2LAGB 1S5IH 1KJMB 2BVQB 3RQ3A 1RJCA 1VFAB 3FCTA 3X14B 4PV8A 3DPBA 5BRZE 5E08L 4QRQB 3D69B 4UTAH 4H26A 3PG2A 5ESVB 5EUOB 4FQHA 3QPQC 4G5ZL 4PJ5D 4Y4FC 5JO5B 4QHLB 5GGUA 3HS0B 3EYSL 4U3HA 4U2YA 4WRLA 4IMKC 3SDYL 4PRHE 2G5RA 4KHXH 1UH2A 4TUKL 1IAIL 2MCPH 4OFIA 2EXWD 1YMHB 1W72B 1S3KL 1LVEA 43CAA 1AIFB 1JF1B 4HHAA 3QZWG 1GOGA 3ECBB 5DJZA 2V2TA 1KIPA 3KXFD 1OQXA 1OSPH 4PJIB 2J5LC 4HFUH 1I1AB 5TQ2L 1MJUL 1NCCH 4JGUA 1RJLB 3BZEA 1FYTA 3L5JA 3O3EA 2I25N 2NY1C 5I74B 1IBGL 4JREC 2IALA 2VL5B 5HDLA 3SE9H 1IILE 5BJTB 3CFBB 3ZYJA 3MJ8B 1GAFL 3IETB 2FDBP 1FRGH 2IANE 4G8GE 5CJ8A 2PYEE 1F58H 4MCYB 3L3OB 1FLRH 5JHDE 2P5WA 3CPLA 2VDQL 4HXBH 4KTEH 2NZIA 3DRTB 2AK4E 1OTUC 4MB3A 3PWPD 1TJHH 3GI9L 1UH3A 4IHOB 3V6FA 4PJGE 1A1NA 4NNPH 3FOMA 5EA0L 1EH9A 2NLJB 3LKPB 4JKKA 2V2XA 3SGEI 1NCBL 5FEBA 4YC2B 4P59L 1EV2E 3KYNA 1NMAH 1Q72L 4X6DE 4G6AD 1K4CA 3G6JE 4OGAC 1D9KB 2FD6H 1DN0A 2DLHA 4NO5B 5DD1H 3RPIA 2WBJA 3MBEA 4RWHA 3MXVL 1EFXD 3QWRD 1MIEL 3VD7A 4M7ZB 4WNQA 1D5MB 2HA1A 4QRSA 3E1F1 5I1AB 2FH6A 3GKWL 3JWNC 3V2AR 4Z7UF 2LFGA 4B7LA 1KB5H 3DUUB 2DL2A 2UWEA 1JV5A 1QACA 1H0DB 3VG9B 3TZVD 3O6FC 4LGPB 4G8FB 5T1KB 1U2HA 5DO2C 4M5ZL 3JWOL 1TZGL 3U0TB 3HI6H 3GRWL 1NC4D 3BKJH 3MLUH 3SJVE 3UTTA 4JO4H 1N59B 1G9MH 4RGOL 4EXPX 4G7VH 3BWAA 4KJPC 2BSRB 5CGMA 1T6WA 3BH8B 4XPHL 4XCCH 3DV4A 3PABB 1JL8A 3MRNB 2YPKA 4X9BA 4QT5B 3E2HA 3HKFA 5IB3A 1T5WA 4BQ9A 5CP7A 1UJ3A 4Q9CA 1EEQA 1NGPH 3CH8A 3X13A 4JPKL 4OZFA 1FO0L 4HF5L 4WWID 1EHAA 4V2BA 1JPST 4Z7WA 2D7MA 4HQQH 4LRNL 5DUPH 4NJ9H 4KFZC 3MRGA 5ACMA 4U1IA 1MWAH 1C7SA 5EBWA 4BKLA 4XH2A 4Z0BH 4Q9BA 4POZC 5EBMB 3GSUB 2XPGA 4GQPH 4UQ3A 2DQIH 3DX7B 5EZIH 3DUHA 4X7SL 3VXSD 4AL8L 1SVZA 2FWOB 2XZCL 1IGCH 4G9FB 3PWLB 4U1KA 3TV3L 1MNUH 4WW2F 3HC0A 4LLDB 5IQ9B 3MODL 3RU8L 4UOW0 3BYTA 2BHYA 4UNUA 4X7CC 3ULVL 3C08H 4IMLA 3BKCL 1OCWH 1XR9A 4Y1AB 4DFHA 2XWTA 3TYGL 3S5LG 2IQAA 4DK3A 2Z92A 3ARED 5LKNA 1KT2A 1I8IA 3GZKA 1WCQA 1FBIL 4NCDA 4XCYA 2F74A 1OGAE 2ITCB 3OR7B 1L0XA 3BE1L 4P4KC 3TFKA 2GAZA 4O2FA 3BHBA 3HRPA 3LS4L 4HWBL 4JFZH 2ARJA 4G3YL 5HHOD 5C09D 3ULVF 1Z9MA 4HG4K 2OL3H 1XH3B 3L7FB 3JV4B 4YHOH 4PJBA 2X89A 2EIDA 3GSOA 3LB6D 1FGNH 1N5AA 2JCCF 5FDWB 5BS0E 5JR1L 4LCCA 3KPSD 5EO1A 3RVXC 2WINA 4DW2L 4FQQB 1D5IL 3RWIA 3X3GH 1AP2A 3GK8H 4BZ1H 5I16A 3OSKA 3F7QA 3QA3A 1NMBH 5I1IH 3K0WA 4AIZA 4GAYB 3N85H 1V7MH 5MEPB 1Y6MR 3TN0C 4ZFGL 2APBA 4LBEB 4NKMB 5IB5A 5E56A 5JXED 4EI5D 3MRBA 3Q5OA 5A2IH 1EBPA 4P48A 3ZDYF 4P9HL 5E8EA 3VXPA 1RZKL 5C86A 4U0QB 5D2NB 3SKOA 4TULL 4KKLC 3O6KH 5E94A 1OTTC 1ZGLP 3BMWA 4K71C 1TZIA 5EC1A 1OD7A 5I17A 4LP4A 4AENB 5D7JD 1DBKL 4HLZG 3K74B 4J2XA 1JWMB 4P2QB 4NRYB 4QEGA 3G5ZA 4JFFE 1WC7B 1QZ1A 3QO1B 2XTJC 4E0RA 5DFVC 4BFIB 3WE6A 1GSMA 2DMBA 1TXKA 4YHIA 4K8RH 4OGZA 1ZLSH 2Z31C 3HMXH 3QIBC 3V7MA 3HMWL 2XKNB 4NN5B 1INEL 1TQCB 3RDTB 4BZ2H 4P2RD 4ODWB 5DRXA 3G5XA 5LG1A 3VFRB 4OLYL 3FO9A 1CBVL 5DJAB 3IU4H 1MVUA 2HVJA 4BA8A 3FZUC 3I02B 1KB5A 5I71C 3TBVA 2IFFL 2FLRT 1WBYA 2NY3D 4PREB 5GXBB 1WITA 1CT8A 2AGJL 4IOIA 4OCNC 2D0HA 4R4BA 3SDAB 2V7NB 5IHBA 3IFPB 5D1XD 1PEWA 1W0VA 3OKKA 1R3HB 1W0WA 3FB7B 4S2SA 1A8JH 3LSOA 3RVVC 3LZFL 4A6YH 5H8DA 1OSZB 3HI1B 3RTQC 5A2KH 5GZNC 2VZ3A 4IS6B 3L3GA 4QNPE 5TF1H 3H7LA 5C0RH 1D6EA 1X4ZA 4GLRI 2A6DB 3GUTA 2EC9U 4CMMA 3C5ZB 2V17L 4GMTL 3MV7D 5DD0L 4ZAKB 5KN5A 2CK0L 2VE6B 3D5OF 3FN9A 3UTSD 2FBOJ 1QEWA 2X4OA 3VH8G 2YD8A 3DECA 1UM6H 2PO6D 4QYOA 3WD5L 4B53A 3BN9D 1UWGL 2B4CH 3HR6A 5ITFB 1U3YA 2NY0D 5T1LA 3BUYB 3FO0L 1MWAA 3MNWA 4DVRH 4M4RA 1RU9L 3HNTH 2ADFH 1LEGA 1JZ5A 4JFHE 1Q9LA 5EO9A 2Z93B 5C0AA 2FO4B 3D39A 2YOCA 1T5XA 5I6XB 4PJAB 4DAGH 2CRMA 4PJGF 3RX5A 1I1YA 4DZBB 2G5BB 3EZJB 4LKCA 4XNZB 4LQFH 5GIRA 2E7LC 2CLZA 3P40A 1K3IA 2K7QA 1MCFA 3G08B 1QLRA 4FN0A 2ATPB 3S9DB 1A6VH 2UYLB 4X6DF 4JQIL 2AXFA 1ZHBA 2VZSA 3G6JF 3NOIA 4PP2A 3M8OL 4KXZH 3RUGA 1ACZA 4LAQH 1G7PA 3FN3A 2EDNA 4RZCA 2BSED 2X4PB 4UOW1 4KJQC 4K9EH 1OAYH 4YX2H 4OGYL 2GEEA 3DLQR 5GS0C 4HUWB 1LQSR 2DQJH 3REWB 2OL3A 4XMPL 1NEUA 3RVUC 4HK3N 4OIAA 1NAKL 4K3JH 1DQJB 2P8PB 1I1AD 5JW4N 3U4BL 1MQKH 1N26A 1QO3A 2DWEA 3PHQA 4GS7C 2EIZA 4P99A 4MZ2A 5F8RC 3TO4B 1OT1A 2OZ4L 2FATH 2GCYB 3W9DA 5D1ZC 2HG5A 5SV3A 4JLRB 2IAMA 1FG9C 1K8IA 1U95A 2OR9L 2R56L 3HC3H 3LRSA 4YAQB 5EFIB 1H3TA 1MJ8H 5J56B 1N64H 4FNLH 3ZTNL 3VFVA 5E9DA 1KIRB 3H9ZA 5HSFA 2V7HB 5DTFB 3SDXE 4F33A 5F1NA 2XWJA 1C5CH 5EORL 5DDHA 4Y19A 4OM0L 4FFYL 1YEEL 4OIIH 1UEMA 4NFCA 4EI6A 1NGQH 2WQRA 3GMRA 1CDUA 1F2QA 3LAFA 4HGWB 4I4WA 1BD2A 4O00A 4JHWH 5CEXA 1F3JA 3Q5TA 1ITCA 2B0SH 5DQ9A 2WIIA 5IM7A 4ZXBA 4UB0L 5F9DC 4PGCB 5FXCH 3UTQB 1CFNB 4MMZC 1ZGLA 2R1WB 2XTJE 4RGNC 2J8UB 1KEGL 1E28B 2GTWB 1NAMH 1YECL 2NY2C 3ZE0E 5C6TH 1D9KD 4GSDL 5HHPA 5IW1A 3WO4C 3HMXA 5DSCA 3W2DH 5D7IA 2D31A 4UT7L 1S7VB 1UKQA 2AK1L 2R2HA 2X4TA 2DOCA 2YD6A 1MCSA 1BQUA 3CFIC 5LGJB 4ISVB 2BDNL 3D2UB 4OZHA 1MPAH 1VADA 4LU5H 3SE4C 1P7QA 2BY0A 1MJ7L 3VFSB 3QEUB 1I85A 4FZEL 1SBSL 3GSWA 1MHPL 4B41A 5I8EB 4WI5A 2SEBA 3O3BA 3LH2L 3VXOB 5T1KD 3IU3A 1BAFH 3N1PC 3QFJA 1MHEB 3KS0J 2R23B 1R3KA 1SVCP 1F4HA 3CSGA 2IPKB 4JCLA 1A7RL 4S1DD 4A6YA 3DROA 1CLOL 5I1LA 5I1DA 5ANMA 5C9KA 3L9RA 2DWDA 1U91B 4YGAB 3ARGA 2GK0A 1EZVX 4KAQL 1T0NB 3RVWD 4NKIH 3UPAA 4N68A 9CGTA 1G7JA 3PV6B 3PXJA 2XZAL 3HI5L 1NUGA 1CF8H 5B38A 3BQUA 3JV0A 4PJ8B 4D0BA 4MD0B 4R0LC 1JYWA 3PWJB 1PYWB 1L0QA 4YHKH 1XIWC 5T1MB 4Y5VA 2DM7A 3EUUA 5LGKA 1G6RL 1RUAL 5F7LB 4JR9L 3U48A 1HZHH 2CPCA 3IDNB 1T89C 1G7LB 1PQZB 1T04A 1UB6A 2AXGA 3BUTA 4PJEE 4Z9KB 5E99L 1E4KC 5AAMA 2Z8WC 2IPUK 3L3KA 2FEEI 4YZFE 3WNPA 1EEYB 4KRLB 3NCEB 3AAZB 2NX5B 4G9FD 2FH8A 4LHJB 4MWFB 4LNVA 2FX9L 1JWUB 4LVHC 3WXVL 4FXKB 3K1KC 2E7LE 5ISZA 1JFMA 2Y72A 3UBXI 5IJKC 5IVXA 4Y1AD 3GIZH 1WFNA 5CCKH 4NJAL 3GBNH 5IOPA 1A6UH 1DQTA 3OJ2C 5GSRA 4Z7NF 3F12A 2CKNA 5EH1A 1QR1B 4NPYB 1NEZG 3LCYA 4JY4B 4OZIA 3HE6A 4RRPA 4ZS6C 4WWKB 3QJFA 4RX4D 1FAKT 3VXMA 3OXRB 5FYKU 5FYKD 5F6IB 3QDJA 4APQA 2DQUL 4HV8A 1N2RA 4ZSOA 3VD3A 5GS2H 1JTTA 3WIHH 4KQ3H 1UWEL 3CCHB 3WHE1 1XF3A 3T8XB 3U9UA 2V5TA 2VERN 4FXGA 1AGCA 4JPVL 5F9OH 1J5OL 2HVKA 2VC2H 5SWZA 4O02H 1J86A 1NCWH 2YUZA 4Y16B 1DUZA 1D6VL 3U0WL 2R0ZH 3MRMA 3QUZC 2I9TB 2EXYC 3QDAA 2DLIA 3S88L 5FECA 1PKQA 1YMMA 4QNPF 2VO5A 1CFVH 2CQVA 4JANA 5HVGB 4OQTH 4CVZA 4JPWL 4H1LH 4AM0B 1A6AB 1Q38A 3EYQC 1LDPH 1KTDA 5ELIA 3V5DB 4L4VA 2NYYC 4P2QD 2X4SA 5B8CB 1CDCA 2D9CA 3BGFC 5D7SL 5AZ2H 3MLSH 5D70H 3BP5B 4RGNE 5I1KH 1PX3A 3FT2A 3QI9B 3P0YH 1A1OA 1E4JA 1IC5H 1KGCD 3Q2CA 1VACB 4NHUE 1U93A 1SYVA 2XTLA 4UQ2A 3ZKSD 1CGVA 1JPFA 3RDTD 3WS6A 4ODVL 1FIGH 4HJJL 3VRLE 4P23B 4WHTA 1BM3H 4HBQA 3ULUC 1FAIH 1HKLL 5CD5D 1MCLA 2WWMD 2AJXL 5B21A 5LAXA 1ZHLA 1Q9KA 2EDLA 1CXEA 3ILPA 2Q8AH 1G7MA 1P5VA 4PLJC 5T3ZD 5D9SA 4GKNB 3SDAD 4H0GA 1P53A 4K3EH 1RIVH 2J88H 2PTTB 1R3IH 4R26L 3UDWC 4Y5XA 3N1GC 4AG4L 35C8H 5IWLA 1KF9B 1RJYA 1IKNC 2DDQH 3MOBH 3EYFB 5JUEH 2OLDA 3OPZH 3LVEA 3VXRE 4AYFA 1BZ7B 4QCIA 1BP3B 5L6YL 1CU4H 4XMLH 4JKLA 4I18C 2DQHL 4OLVL 2ZSVB 4MNHB 2P47B 4YEEA 5I9QC 3C6SB 3SGEH 3AB0B 1KXVC 1CFSA 2LU3A 2X7LB 3K4AA 5IF0A 3MTRA 1B0RB 3C5ZD 5BMFH 4ZAKD 4JM2C 1WJ3A 4PBWD 4P46B 4L3AA 2PR4H 2QSQA 3O9WA 1HEZB 2BERA 2EIBA 4OCSL 4KK5C 5DMIH 3IFOB 1BZQK 1NGXA 2EYTB 5A43C 3SO3B 1IEBB 3SDXF 4UUJB 4XNUH 3EFFB 3TPUA 3VFPB 3RKDD 3P4MB 3LN9A 1JMXA 3RWEB 4MAYB 4IIQB 3KPMA 4RAHA 1UB5B 2KH2B 1W0YT 1FG2B 1KELL 4U1SB 3EJJX 4Z0XA 1GC1H 4LSUL 3ARDA 2BK8A 3CFCH 4OCRH 1IKFL 5KVEH 3MXWH 4P3CL 4WW1B 2E7HA 3OHXA 5B4MD 4PV8B 3WCYA 3ZE0F 1URLA 3CXHJ 5FYLD 4RBPK 3EDKA 1NGZA 1IGMH 1S7UB 1ZLWK 2IADA 1MQ8A 5DVMA 5IW3A 5ADPL 1K9TA 2QKIA 4X5XA 4XVSH 2HT2D 4R90L 3RRQA 1U8HA 1L6XA 1DQML 3SKMA 3WIHA 2VOTA 1VGEH 2J2ZA 3FO1A 3PP4H 1X4YA 1QRKA 4KMTL 3WIIL 3TO4D 3K4ZA 4HHAB 4U3XA 5DJZB 1FVEA 1SBBA 2V2TB 2YEZA 5GSVA 3RBGA 2AKRA 3C5JA 1YEIL 2UV3A 4TRPH 1AFVH 2LE9A 3NABL 4HCRH 3U46B 4L3CB 5F89A 4I9WE 3MREA 3UYRL 3FT4A 4PP1C 4NO2B 1IM9A 4TSCH 4OQTA 4MNGE 4H1LA 3WDJA 5KJRL 2VTFA 5GRWA 2YN3A 1EUUA 5I1GH 2X4RA 3QEGH 3SKJL 2BNUB 3ETBF 1O5DT 2IMNA 2P5WB 3CPLB 4XGZA 5I0DA 5GRVK 4HS8H 4BH7A 4L5FH 3IJSB 1TJGL 3FFDA 2L7JA 3D9AH 4PJEF 5C6WH 5KSAA 2Y07H 4YZFF 4L8SC 1I8KB 5JNYA 2ICWI 3FOMB 3HE7A 2WBJC 3MBEC 4TVPD 3DV6A 5HYFA 3T65A 3ULUE 1A7PH 5JW4Q 3H9HB 2V2XB 4NZTL 3D2UD 4M43H 1ZHKA 1DBML 3CVHH 3KYNB 2AAVA 4OTXL 5HI4C 3OGOE 4JG1H 1DN0B 3RPIB 1ZEAH 2C26A 4WNQB 4RCAA 1R0AL 4KRPC 1ROWA 1CN4A 4JFYB 1CK0H 2GITA 1DBBH 1U6AH 2IJ0C 1PDKA 4R9HA 2J12B 1I1CA 5CJOH 1JV5B 1GGYA 1PZ5A 4U1GC 1VFMA 4OF7A 4XCFH 3EO9L 1WEJL 5DVKA 3FQWA 3C9NB 2AABL 5JTWA 2AJSL 3VDCA 3QUML 1SEQL 2ESVB 1CD0A 4QXUL 3UTTB 4XC1H 5C2BL 1B0GB 1FIEA 3KYMA 1Y6NR 4U1JA 4M93B 4XVUD 4ALAH 4PRDA 1CGWA 1ODAA 3QWOA 4DUXA 3C6LB 4PJ8D 5FHBL 1YNLH 3GB7A 2YUXA 4JZJA 4M7KH 5DS8A 2YPKB 4PJXE 1HIML 3BN3B 2XQYG 4OZFG 4BUHA 1GVIA 3E2HB 1DANU 3TNNB 3PDOA 3U82B 4KDTA 3CXDH 3LD8B 2OTUB 5L9DL 3X13B 4JY6A 3BEWA 5E2TL 5BVJA 1CVRA 2NX5D 4JZOB 4YXKH 1WCBA 1C5DB 4J4PD 2W91A 5GHWL 4U1IB 4BKLB 5EBWB 4ZPTA 5EC2B 2IC2A 4ZUUA 3FOLA 2XPGB 1JF6A 4UQ3B 1NLDL 5MENE 2JJUA 4NGHH 3S3JA 4DZ8A 5DK0A 3I50H 5CINH 1RQ5A 4GLRH 3ZKQD 4U1KB 4DN3L 4ZUWA 1VENA 1FFPA 5IV2A 1A3LL 3HC0B 3F58L 4WWKD 1EERB 3DARA 1CDHA 4IMLB 2VXUL 1XR9B 2XWTB 3FMGH 4L3EA 3SE8L 2Z92B 1I1RA 3P77B 4NQVA 1I8IB 1DLFL 3FTGB 3SOBL 1TQBC 4XCYB 5AZEL 1KCVH 2WBKA 3MLTB 2OI9C 2R9HD 1X6NA 2D03L 2CDEA 1YY9C 2GAZB 3UO1L 2UZIH 4O2FB 3BHBB 2HKHL 1FYTE 4G6MH 5DJCA 4E41B 3MOAH 5JA9A 4ZO7A 4JPIA 4FMKA 4Y16D 4PGDA 2RBLA 4XWOD 1JHKH 3R1GH 2CIKA 4HCRA 2Y36L 5FGCB 4PJBB 4RMVA 3GSOB 1X5ZA 2MQCA 2NXZB 4M7JL 2B1HH 4EQ3A 3F7VB 3QRGH 4AIXA 5I19H 1FVDA 2Y06L 5EO1B 3H3KA 5TE7L 3OB0H 4B50A 2WINB 1UC6A 1T7ZA 4UIMA 1SJEB 1NCAL 1AP2B 4IOFC 5IBLC 3RWIB 3Q6FA 5EIVA 3T0VA 5I16B 3W82A 1P1ZB 2A6IA 1G0DA 1UACL 3QA3B 4X4XA 5F1SA 3EDJA 1S7SA 4AIZB 5DEZA 3MRPA 4BK4A 2G60L 2HJFA 3MUGA 4N9GA 2QSCH 4PLOB 3EKCA 5GGTH 5IK3A 4XNXL 3ZHKA