3FT2A

Crystal structure of a citrulline peptide variant of the minor histocompatibility peptide ha-1 in complex with hla-a2
Total Genus 83
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
83
sequence length
275
structure length
275
Chain Sequence
GSHSMRYFFTSVSRPGRGEPRFIAVGYVDDTQFVRFDSDAASQRMEPRAPWIEQEGPEYWDGETRKVKAHSQTHRVDLGTLRGYYNQSEAGSHTVQRMYGCDVGSDWRFLRGYHQYAYDGKDYIALKEDLRSWTAADMAAQTTKHKWEAAHVAEQLRAYLEGTCVEWLRRYLENGKETLQRTDAPKTHMTHHAVSDHEATLRCWALSFYPAEITLTWQRDGEDQTQDTELVETRPAGDGTFQKWVAVVVPSGQEQRYTCHVQHEGLPKPLTLRWE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system
molecule keywords HLA class I histocompatibility antigen, A-2 alpha chain
publication title Steric hindrance and fast dissociation explain the lack of immunogenicity of the minor histocompatibility HA-1Arg Null allele.
pubmed doi rcsb
source organism Homo sapiens
total genus 83
structure length 275
sequence length 275
ec nomenclature
pdb deposition date 2009-01-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00129 MHC_I Class I Histocompatibility antigen, domains alpha 1 and 2
A PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3ft2A02
3.30.500.10 Alpha Beta 2-Layer Sandwich Murine Class I Major Histocompatibility Complex, H2-DB; Chain A, domain 1 MHC class I-like antigen recognition-like 3ft2A01
2EDHA 2MQ3A 1JF5A 5DUML 4DGVH 4BZ1H 1OARH 1RHHA 2ITDA 3CC5B 3GJFB 4IRZH 5KSBA 4FXGA 1I8IB 2ZG3A 4WV1A 4LHUA 3V6FA 3CFCL 4XWOD 1GZQA 1GGCL 1UB5A 4XP5H 5B38B 1TCRB 5EC2B 3SDAC 3IDUA 1ZT1A 4QRRD 3U9PL 4X83A 3WNOA 2NY7L 5JOPD 2AGJL 2P45B 4QRRE 5KSAC 2VDPH 5JOPE 2X1XR 2C1PB 3G04A 4WHYH 1F00I 2E5EA 2VDOH 2Z8WC 5GRYA 1U6AH 2Z91B 3G5XB 4KTDH 1MNUH 2R1YA 1O7VA 2J8HA 2NY1C 3D69A 4PJHA 5D1XD 1RU9H 4YFLF 1G9NL 1OL0A 1C5CL 3LPFA 1IGCH 2B2XH 4Y16A 1CF8H 2AERT 1MHPH 4WJ5B 1J10A 1N5AA 4ZO8A 3REVB 2QADC 3FQTB 5L2JA 4M5ZL 4FFEX 5GISL 5EO9A 5CSGA 3EDKA 1JNNH 2EIZB 2H32H 2AEQH 5F3HB 3RPKA 1H0DB 1XR8B 2I07B 1VADB 1KIPA 1W0YT 4KZDH 4HKXB 5C0CE 4U3XA 4D9LL 3D6GA 4CVUA 5KAQF 1D7FA 1JE6A 1J8HD 3BGFB 5F1IA 3A6OA 3RX8A 4O2CA 2ICWI 1J8HE 3BPNC 2BSRA 3QFJD 3NIFE 2H9GB 2Q8BL 3TEUA 2H6PB 4MJ5B 5I75B 1MJUL 4PFEA 4Z7UB 2WY3A 5FYKL 4BSVB 3RDTC 4PJDA 2BXYA 1OWWA 3OG4B 4WHTB 3RA7L 3TJHD 2N7AA 2YWZA 1ZWIA 3FRPA 1B4RA 4CVZB 1NCAH 4N1CA 5EC1B 1YEKH 4X6FA 5DK0B 1A5FL 5C08A 4Q9QH 1M05B 1JMXA 4RMWA 1MJ8H 1T04A 1DFBL 1AI1H 5L6YL 4RFNB 3EYVB 1UG9A 5IK3A 2F54D 1T1YA 4MZ3A 1GC1H 2JJWA 2F54E 5CP3H 2Y9RT 5IW3A 3CSBA 2AJVH 1V3LA 5DJDB 4HIEB 1X7QA 1MRCH 4NQEA 3IVKA 1MCNA 4GXVL 4XHJC 1EVTC 4YBHA 4JG1L 4EUPH 1NCDL 5L7XH 4L8BA 5LG1A 3OXSA 1WF5A 1OM3H 4GRMB 2F9BT 2VQ1A 2Q6WA 2ZG2A 4M6OH 1CGXA 3MOAH 2ZCLL 4YDVA 5HYQB 4ERSL 1A22B 1FORL 4I5BA 4X4XB 5I2IA 4XNQB 3V7MA 2FJHA 1MAML 3KPRA 4QRRB 5E6IA 2VSCA 3KYOB 3D25B 1FG2A 4LKCB 5CSBA 4YNYB 2BX5A 1AQDA 1N4XH 3RVUD 3NIGE 4WVRA 4R3SB 4Q7DA 3RPIB 4K9EH 4JFFD 4P4RB 5D8JL 2YHGA 5F9WB 2EIDA 4JFFE 3P77A 2P8LA 3LQAH 1A3QA 2CXKA 5DRWB 5D1XB 5KTEH 3FQNA 5TGBA 1ZMYA 2FJGA 5DD6B 1LVEA 3LZFL 1RZJH 4U6HA 1YEEL 3QCUL 4PLJD 4E0RB 1CG9A 1IGMH 3GRWH 5SWQA 3ILPB 3TBTA 1A14H 3GSOB 4I77H 4NRZB 4DW2L 1RURH 2CRIA 1YA5A 3OJ2C 1HH6B 3MUGB 5DD3H 4N0UA 4YX2H 3E2HA 3QA3A 5CD3A 2QSCL 4L9LC 5F7LB 1O0VA 3VXPA 2VISB 4YHPA 1KJMA 2ZJSL 3CH1B 5DJ6A 3SDAD 3LMJL 1ZLSH 1J8HB 2F19H 3KPTA 1IAII 4IRJC 5KSAD 4KXZH 1AXTH 1NLBL 4DOHE 2ADFL 1U8OB 4JG0H 3OGCA 5HGHB 2OZ4L 1P4BL 2HJFB 4M7LL 3LY6A 3V8OA 5IV2B 3GMLB 4P57B 5JA9A 3RJQB 3SOBL 2DI9A 4NHUE 4DK6A 3WNMA 2NY1D 2DLFL 4PJ5A 2A77H 2MTPA 4UIMA 3SE3C 5D7LD 3VDCA 5SX5H 3VXUD 2YPVH 5EN2A 1FVEA 3X3FH 5D7LE 1YPZA 4OF3A 1AGEA 4RAUA 2F54B 2YN3A 4NP4H 4X6DA 4L8SC 1WK0A 4BFGA 2VLJE 2ADGA 4D94A 1RZFH 4XP9L 3SKNB 4MWFA 5F9DC 3GMNA 5FYKE 3QIUA 1ZT4A 5IVXE 4P2OA 1UKTA 1QBML 2X70A 1JK8A 2J7LA 1NGQH 3RIFK 4WWKB 1I9JH 3CXDL 5C0GB 2XQBH 4HIXH 4OUOA 3LHPL 1MCEA 4K3GA 3MRNA 4MDIB 2CR6A 3BKCH 3O8XC 3OKEA 5EU3B 3L7FB 3QEQE 3RDTD 3EUUA 1KFAH 4PG2C 2FWOB 3FONB 5EPMA 2EKSB 3U79A 1B3JA 1ZANL 4KUZL 3VU2A 4Y4FA 3SKMA 1BAFL 5I1IH 1W0VA 5CUSL 4OZIA 3BDXA 2D7QA 4JFFB 1CBVH 1KELH 3HE7C 1OT1A 2VL5B 4X7SL 5DR5H 3IDJA 3VJ6A 1QFWM 3MRKB 3OKLB 2GI7A 4WW1A 3JWDH 4M8QA 3BWAA 4WU7A 2HT4C 3DV6B 5HGAA 4M93C 4WIQA 1C7SA 4ZFZB 1NGYB 5ALCL 5F72S 3GK8L 3KPSD 5DWUH 5ICYA 3NZHH 4NZUL 3KPSE 3T0DA 3QQ3B 3SE8H 4D0CB 1YNKH 4Y1AA 3LN5B 5I6XB 3VFGL 1EAPB 1GGYA 4JO3H 3MLPA 1WIUA 4PJCF 1KYOK 3LS5H 5FECB 3SDAB 4DVRL 3BMVA 3MXWL 2G60L 2Q76A 1C16B 4MGXA 5KVEH 4P23B 3HFML 1FCCA 4PGBA 4DOHB 5KSAB 5L9DL 4DGIH 1RUPL 5M94B 4PP1C 2Z35A 3F6LA 1E6OL 1LE9B 2X9XA 4MA8L 5ILTH 4P2RD 4UU9A 5F7EL 3MRMA 4NHUB 4JDVA 3VFUB 5HGGS 4P2RE 5DS8A 2F8XC 4BK4A 3B9KA 4S2SA 3CXHK 2NY1B 2WINB 1KEML 5TQ0L 5FUOL 1K5NB 5D7LB 4NIKB 4P59L 3VXUB 4OCSH 3BHBA 4LLMA 4OFKA 2VLJB 3VGFA 1XR9A 1U58B 2YUXA 1W8OA 2WWKO 2HLAA 3JTTB 4NKIH 3VW3H 1FHGA 3UTTD 5I1GL 2X9YA 5IVXB 5CSZB 5CBAA 3UTTE 1HHHB 4PTTA 3PP4H 3LN4B 4TRPL 2QHLA 5A16A 2EE9A 1N59B 1BIIA 5IOPB 4LARL 2GK2A 3DUSB 2KZWA 3U2SB 4IRJD 4JFHD 2CDGA 4U33A 1JZ7A 3U6RA 5AZEH 3VXMD 4HIJB 4QHNA 4YHKH 4Z76B 1T22A 3WCYA 4NQCA 1HI6B 1HKFA 1KJ3L 4I0CC 2BP3A 3MMEA 4NFDA 1FIGH 1U42A 1YMMD 1GGBH 4GBXC 2IAMA 4JB9H 4GKNB 3G5YB 4LF3B 4L29A 4QHUB 2DDQH 3WUZA 1T5XB 5JW4M 3QDME 1UB6B 3QHZL 3HLAA 5HDLA 5KVGL 32C2B 4LVHC 5E8OA 5HGDB 1F58L 1TQCC 4ZUSA 3BP7B 4ZMAT 3RWCA 3K2UH 1QVOA 2HA1A 3ERYA 3UC0L 1H3UA 3GM0A 3KLSA 4S10A 3ULVF 5D93C 3TWCL 5IIEB 5DMIL 4AH2B 5FM4A 2DLHA 3DETC 4HH9B 3TH4T 4PJ8D 3AS0A 1EHAA 5D2NA 1ADQA 2DQEL 3KPSB 4RGMC 1DZBA 4LBEB 3DX8B 5BJTA 3DXAE 4HLJA 2J6EH 1EFQA 4HPYH 2R0LL 1CDJA 5E08H 2I5YL 1MCBA 2DJ4A 1GIGL 3O8XD 4G8EB 4OKDA 5SX4H 5DEFB 1PAMA 4O02L 4X5WA 3MREB 3CFJA 3HMXA 1T2JA 5E6ZA 3ZYZA 1I1RA 3P4LA 3TPUE 2YC1B 2WK2A 1JJUA 4JY4B 2FGZA 5DDHB 2FX9H 4ZPTB 5T5FH 2FRGP 5LGJA 2RJMA 2XG5A 2ZNWA 1I9RL 1KPRA 1JYVA 4POZC 1MCPH 4MVBC 5D7SL 3QG7L 4GQPH 3REWA 4I3RL 3RL2A 3GBML 1KJ2L 4P2RB 3HE7D 4I18B 3UX9B 3B9VA 1A1MB 1AY1H 2IH1A 3I50L 3QDGD 4CN4A 3PWJB 3MNZB 2R4SL 1DEDA 4LSTH 4GW1B 4XPAL 2WWKT 2HT4D 3O0RL 2IGFH 1BP3B 1QD0A 1Z2KA 1EHLL 1S7XB 1UENA 5CJBA 1Z9MA 4MD5A 2BSED 3FB6B 5I8EA 3KG5A 4WFFE 2CPCA 3UTTB 5D2LA 4L9LB 2MHAA 2CDFB 4ZFOL 4YHML 1IILE 1WLHA 5FFLA 4FFWC 5EZIL 2B20A 3PL6C 4O00A 4IRJB 4FTVA 3MRDA 4WWID 4XHQA 5FO9B 2HJLB 1YC7A 1NGZA 4AT6B 2JB6B 4PP1D 4U6VH 5DUBA 1UXWA 2XZAL 1GGTA 1YZZA 3SO3C 1INQA 4TN9A 2VLKA 1T0NB 3BXNB 5DQDL 1YEHL 5JNYA 1MFNA 4A2MA 5D5MF 1AD9A 1G1CA 1I75A 4YHLL 5IEHB 2I25N 1ZGLP 2MCG1 3QDMB 3FT3A 2Z93A 3VD9A 3CLFH 3SN6N 1I1YB 2QQLL 5HPMA 2AK1L 4UNVA 3LQMA 1R0AL 2XOTA 1S9VA 2DYPD 4KRMB 1F4AA 1YYML 1DVFC 1RZIA 2MMXA 5FGRA 3AMKA 3J7HA 2AV7A 4PJ8B 3ARBD 4EVNA 3K2MC 3DXAB 4WY7H 1E4WH 2CR3A 4S11A 3UTQA 1QG3A 2CDEA 4MJ6A 3BI9X 4WEMB 3P73A 5FA4A 3O8XB 1KTDA 4NZRH 3TPUB 4JM2A 2NW3A 3DTXA 3O3BA 3E8UH 3FOLB 2AS5M 2Z31A 1HHGA 1UZ6E 1MCSA 3F7VA 4X98B 3S96A 2DL9A 5B21A 3PDDA 2HRPL 2HVJA 2ZWLT 2ADIA 3Q5OA 2X4PA 1VPOH 4NO3B 3S97C 4BKLB 4RWYL 4N5EA 2GSIA 1EFXD 4GQ9L 3PWUA 2DWDA 5HHOA 3U7YL 4FZ8H 1U92B 2OMBA 4KMTH 1RK0B 1U8PB 4ZOAA 5E8DL 3C5JA 4LLVA 3BRFA 2WZPD 5EDXA 4Y2OA 3LDBC 4PRAA 5A2LH 4ZXBC 3RKDD 1PY9A 2DQFB 4DWHA 4N5UA 5L8JB 1E4XH 1XGTA 4BQCA 1NAKL 3N1MC 15C8L 4WV1C 1LO4L 3GBNH 3EFDL 4PP2B 4PJBF 1LNUB 5D7IA 3WNKA 1IE5A 1YJDC 3SKJL 3GJFH 3DV4B 3L9RB 5MEQA 3LKOB 1WUNT 4EI6A 2XT1B 3MR9B 3QQ4B 4WW2F 4POZD 4MVBD 3SGDH 2VDLH 1TCMA 5SV4A 2ADJA 3ARTA 3TZVA 4OJFL 4HV8A 4LAJH 1UM4L 2FEDC 3V4PL 4HUVA 4PJAE 1YJDL 3BN9D 2RB8A 4N0RA 1UM5L 4HWNA 2ITCA 4F2MA 3HCVA 1FFOA 3UO1L 4WENB 2DQCH 4F37F 1U8KA 3STLA 4JCMA 3V5KA 2QR0A 4UILH 3C9NA 1MHHB 2NY0C 5D7JB 2MQCA 3TNMA 5CFHA 1CR9H 1F4HA 1DQQB 5IGXH 1FYHB 3AS1A 3V5HB 2Y07H 3VG0L 1A6PA 3TGXA 5GXBB 1QLRB 5C0NC 3KPMB 4N8CL 4XVJL 1MCLA 3K8KA 4FFWD 4XWGH 4HS3A 4XP4H 3ARBB 3PL6D 2WP3O 4PJFA 3MV9D 3F7YA 4HUWA 1RSFA 3MV9E 2A6JB 2BJMH 3SDXF 2XQYK 4MLIA 3THMH 3MRJA 4O4YH 3PWPD 4ODSH 5A2FA 4FMFA 5I1HL 2CXGA 2GT9A 3O3DB 3PWPE 4HIHB 5SWSD 1XGUA 4N0YL 4C83A 5SWSE 4Y5YA 1BQUA 3S6CA 3UPCA 3QEHB 1SBSL 1OP9A 3O45A 3DGGA 3RY4A 4HX1B 1WWAX 3F7RA 2DM3A 5E99L 3OKMB 3WXVL 2IBBA 2ICWA 1EFXB 4YXKL 1LD9B 4F57L 5GRUL 4OLZH 5ACZB 4HFWB 3HA0A 3D85A 1A2YA 3NPZB 2XPGB 2D7MA 2Y5TB 1U93A 4QTIL 5JXAH 2E9BA 1FRGL 4HIIB 1V5JA 1K8DA 2NMSA 4HK3N 1ZHNB 4NQXA 5EO0A 1MHCB 3J8F7 3OX8A 5DRXB 3GUTB 1EEYA 2NY4C 3BE1H 3TV3H 2GCYA 3K1DA 1CQYA 1IVLA 4CNIA 4NCC2 3MLYL 1F8TL 2X4NB 5E00A 1JTTA 3CDGA 4YBLB 1KJ2B 5EU4B 3RWHB 2X5PA 2JCCE 3N85L 1TZIA 4KC3B 1CCZA 2H3NB 3FB8B 4IMKA 2CKBA 2AXHA 3U9UA 2ZUSA 1D6VL 5CINL 4KHXH 1JV5B 4U1JB 3IDYC 3HNSH 2PTVA 4LSSH 4OTXL 4UNTA 4DEPC 4Z7OF 5I1LA 3FQRB 5HHPA 5IB3B 1VESA 4UTBL 3VFMA 3MRBB 3QIBB 2B1AH 2GK0B 4PJAB 2BNQD 4V1DE 4YXLL 1LILA 4QRTA 2W0FA 3R0MA 2BNQE 2DLGA 5E2TL 1MQKL 5TF1H 3I02B 4ZFOB 3MNVB 4PYHA 4X9IA 2OXHA 3QO0B 4ZXBD 1U3HA 3IT8D 1U95B 4LSVL 3WE6B 1YEIL 5F88A 1NEZB 2VC2H 3TO2B 2C1OA 2FBJH 4LHUD 5DHVB 1YN6A 2WP3T 3E2HC 4ALAH 1VSCA 3MBXH 1VGEH 1OTTC 2YPKA 3O2DH 4HLZH 3PL6B 5J11B 2MQ0A 2Q3ZA 4QNPF 5IG7B 3MV9B 3P0GB 1J05B 1EZVY 5C09A 3BZEB 5ALBH 4PIRF 5EBMA 3PWPB 4X9FA 3GJEA 3OBAA 2FEDD 2R9HD 5SWSB 4K71C 1WFNA 3DECA 1DDHA 4RDQG 2FH8A 3W9DB 4LPUA 1VCAA 3MUHL 1UJTA 1PQZB 4AYFA 1ND0A 4OGZA 3BSZH 4DQOL 3OR7B 4RBPK 3TCXA 2XZCH 3FB7B 1K4CA 4O9HH 2NY0D 5ADOL 3LEXA 3L6FB 3QEGL 3VGGA 1VERA 3TA3C 5B4MD 1T1XA 3NH7L 4IOIA 1BWMA 1WC7A 5C0ND 4HJ0D 3SY0B 3Q0HA 3QIUC 1H3GA 2VLRE 4NPYB 5D6CB 4P2OC 4Q58C 3NFSL 2JELL 4PB0H 3P11L 4JDZA 3L3HB 3VXSA 1CICA 1A7PH 2CO7B 2JCCB 3CSYB 1MFEL 4ODWB 3MODL 4HMCA 3WLBA 4MD0A 5E70A 2QKIA 1KV3A 4MJIE 1CL7H 2OQJA 4GMTH 1OGAE 4UV4L 3BUTA 4Y4FC 3QRGL 1OW0A 5HYJA 1JGDA 8FABA 1HNFA 5KS9A 1XF3A 1FVCA 2YD8A 3O6FB 1H8NA 5JOEA 3ULSA 1HXYB 4V1DB 5I8CA 4PY8J 1XMWA 4M3JA 2BNQB 3B3IA 1GGUA 4AEHH 2VSDA 1JHLH 4M62H 3S35X 1F02I 1UH3A 4BSWB 4X99A 1IL1A 5IESH 2ICES 1RHHB 3S36H 5GQBA 4Z7UF 2F5AL 2NY4D 1CTNA 1JPSL 4WV1B 1BF2A 4JZNB 4NNYA 2O5XL 1UB5B 1FL3A 5GGSY 2P49B 2VZVA 1QFWI 5HI3D 2LE9A 4I3SH 4FNLL 1WGOA 2FEEL 3ZE2F 3FO2A 4TVSa 1HWHB 3AFLA 4M00A 1OAXH 1OB1B 4GXUN 4KRPB 1Q0XL 4JGMA 2CIIB 4P3DA 4LCYA 2QQNH 3MYZA 3D48R 1I1CA 4PBWD 3VGHA 2B4CC 2VXSH 3IU3B 4ZG1A 3PJSB 4FXLA 4Y88A 3S98A 4KY1L 5INDA 4TVPD 3B9KC 4MNGA 2IMNA 1VENA 4HZLA 4Z95L 3VWJA 1DQDH 3SCMB 3R0NA 3U1SH 4TQEL 2ZNXA 2NY0B 3MBEB 4KK8C 3GHBH 1JWUA 2B4CL 5ETUA 1KIPB 1TVHB 4NHCH 5I1KL 5KSVA 4LSRL 1D3CA 5K9OA 4JFEA 5EO1B 2DMCA 4HUKB 1MPAL 4ZYKA 1A6AA 4GG8B 3H9HA 1Z9LA 5DMGC 1CVRA 3NVQA 4Z8FH 4ZDHA 2A6KA 4MJIB 2G2RA 5FHAH 4FZEL 5FYLH 3RNQB 1G7MA 2L7JA 1W72A 3GI8H 4APQA 1OGAB 1JYXA 5BOZG 4BUHA 1OAYL 3O11A 2IAMC 3GHEL 4O58L 5IVZA 1KCUL 3W39A 5IMOA 3NCMA 4P9MH 1CLYH 1CXHA 1CDHA 3V6OA 2ATKA 2VXQL 3RUGA 1K3IA 1N7ML 4HK0A 1BZ7A 1C12A 1H3WM 3LKPA 3AU1B 1LO0L 4TNWF 7CGTA 2CIKB 3NIFF 3CK0H 1TJHL 1FH5L 3TA3D 2Y7QB 1AJ7H 3RWEA 4OFVA 1KEGL 3IVKB 3PXHA 2GSGB 4Q6IB 1C08A 2AABH 4P2OD 5F7NC 3TBSA 3IRPX 4B53A 2NY4B 2LQRA 1DBJL 2FX8H 3IDNA 4K3JH 5D2NC 1QHPA 3ARYA 1T0PB 2IPKB 4PS4H 5TPWH 3SQOH 1KJVA 1UH2A 2D9QB 4GKZA 4TSAH 4KUCF 4YDVB 4M43L 4YHNA 3EOBB 5I2IB 2BY0A 1OSZA 3NA9H 1QPXA 3ALPA 3ARFA 3OB0K 4Y4FD 3HAEH 5JORA 3IJSB 1EEUA 3W82A 2DQGH 3IDYB 1AQDB 3H9ZA 3PV6A 2MPAH 5HD8C 3OJDB 2ZUYA 3T2NH 3P0YH 4XPBH 2P8LB 4KI5C 1WEJH 5MI0B 3SO5A 4G6AC 5IVNA 5ESVB 2HTKC 5JLZA 5F9AC 4JRXA 2Z8RA 3QULA 4QCIB 2M2DA 4OQTH 5DEGB 5C0BA 2O61B 5E8EB 4ZNEA 1CFNA 3ORJA 3FN0L 2DRUA 2XWBB 4PGCA 3W9EB 4R4FL 5DJXA 2ATPB 5K59E 4U6YB 2AJUH 4GS7C 3NIGF 3VXPB 5GHWH 1IGJB 3O3AA 5T33L 3KLDA 5HBBA 5I1EH 5INCA 1A4KB 2C26A 2KQMA 1KPVB 1DN0A 3RWJA 1DLFL 3RI5F 2XN9A 1UZ8B 3QWOB 1WFTA 5DI8B 2IH3B 4PJ7E 4K71B 4LEOA 4YO0B 5AZ2L 1M6OA 1J8KA 3B9KD 2PTTA 1N64L 1DQJB 3EDEA 3L3IA 2W65A 3GMMB 2YSSB 1T4KA 2Y25A 1WCBB 2Z4QA 2O5ZL 4WTZG 2D7OA 4D9QD 3UTZA 2CMRH 1NMBH 1OVZA 3QG6B 4KK8D 4D9QE 3RWIB 1SY6H 4OBSA 5TE6L 4XNUL 2EDLA 1IC1A 5JUEH 3TA3B 5FV2A 3PGCA 4L8CA 3V79C 4OCWH 2NY5H 1CFVH 4GKSB 3D0VA 2C3HA 2X70B 4YEEA 1N6QH 4OLUH 5DMGD 2E7LC 4UTAH 1MVUA 4YWGH 3LEYL 3KPQB 1UM6H 3MJ9A 4KQ4L 4DKFL 4OCNC 1IZKA 4X4YB 4NQCD 4MYWB 4X0KA 1XAUA 2CUMA 2W0PA 3BP6A 4JM2C 3P30H 4NQCE 4K3EH 5EPMB 2IAMD 3MFGB 4QRUA 2EYRA 3OAYK 3B2VH 1OY3B 2AP2A 1QA9B 3UJTH 4N5EC 4JFOA 2EIEA 5T1KD 5IVXF 4J3OC 3EGSA 4ONFL 1YDPB 3GO1L 3VFTA 3GIZL 1AXIB 3LKNA 4QXGL 4HG4K 2GQHA 1J0HA 1IGYB 3T3PE 1HEZA 4O2FB 2J1KA 1S9WA 4DTGH 4ZQKA 4M8QB 2V5YA 4G43A 4ODBD 12E8H 1EGJA 2ZZUT 3HS0A 5AG8A 1U36A 5J9PA 3IDMB 2VXTH 3H3PL 4FABH 2RIKA 2EH7H 1IQDB 5L8KB 1MREH 4JFQB 1OP5K 1UT9A 5BRZA 2MFNA 1JHTB 1FZJB 2ICCA 4LPCA 2GTZA 3PV7A 4NBXB 5CCKL 2V7HB 4S1QH 4QRPA 1P7QA 4NFBA 4KAQL 1N6VA 5CEZH 3MV8A 3BGMB 1A02N 1F3JA 3RL1A 1EXUA 1NCWL 1N8ZA 1EO7A 3E0GA 1LMKA 3QPQC 5DQ9B 3BDYH 1QSEA 5HVFB 3MACL 3EO1A 1WICA 2PETA 5J57B 5E9DA 2VJXA 2YD1A 1MLCB 4XP1L 4XVSH 4PJ7B 1RJLB 5HD8D 3TZVC 3LRGA 3RTQA 4JZOA 3BPLC 4KI5D 3B9KB 5HHQA 2RCSH 5K9JL 4KI5E 4BFEA 2HTKD 2RHEA 4NQSB 1AD0B 3ZT6A 4PGDB 5HI5C 1QNZH 2DIBA 1A7QH 5JHDE 1CGUA 3MUY1 3GB7A 3RU8H 4LNVA 4N0FA 3MRLB 3GMQA 5EA0H 2BMKB 3STBA 1WVZA 3BUYA 3QUYB 2P46B 4HKBA 1U3YA 4JJ5A 4X7TA 5J4MA 3HR5A 1BEYL 5F89A 4XPFL 4LLWA 1EIBA 3GSRA 2IQAB 1F90L 3EYOB 3ZKXB 5BZDA 3MUZ1 4OFYA 1IC7L 1U8HA 4R0LA 1GAFH 1T1ZB 5D7KD 4J4PA 4PRPD 2NY6B 3JV0A 1A6WL 3C87A 1MELA 5D7KE 3KPNA 3DX7B 4NQCB 4PRPE 2E3VA 4MQTB 1MFAL 1FL5A 2XWTA 3MMEB 5DZOA 4LLQB 2JJSC 2VLKD 4YDJA 3G5ZA 1S7QB 2GAZA 2IAMB 3L5XH 4Y5YC 5DJAA 3EAKA 1P69B 2BVYA 3CMOL 4M1DH 3CX5J 1T2QL 1NBYA 4OLYH 1BMGA 5T1KB 1TVDA 2Q86B 3L5IA 4BZ2H 1DBBL 1KF9B 1J1OH 3T3ME 5SWZE 5FUZL 5E8OB 4NKMA 2Z9TA 4XMLL 4TYUA 5LBSL 1URLA 2UUDK 5F7UA 4U6XA 2OR8A 3WUWB 1WTGT 4P46A 4NWTL 1A3LL 5HGBA 5D72H 3GSWA 3B4NA 3VFVA 3JV6A 3DSFH 3QISA 3MLTA 4B7LA 3EYQD 1RUML 5EBGA 1WWCA 4PJGE 4RA0C 5GGTH 1YNLH 4NNPL 2E7LE 3HG1E 4WU5A 3RAJL 4OSUL 3HI1B 3CLEH 4K3DL 2AI0L 4DGYL 4JM2D 4F3FB 3LD8B 3Q5TA 5CJQL 1S7SB 2VXUH 4YDIL 2R2EA 3MRQA 1DE4A 4JANA 1LO2L 4MXVE 5LGJB 2PYFB 4YZFE 3MSPA 4X6EA 1O5DT 3REWB 1ODAA 3M07A 4N5ED 2VWEE 4LDLB 5HHOD 5I1AA 3N50A 2V9TA 4HGWA 5D9SB 2IH1B 1CD9B 2BOCA 1YYLH 4HXBH 4J3WA 5IROA 4UQ2B 3ULUH 4MHHI 3MX0A 1L4IA 4GRWE 1U3HC 1ZOXA 3CU1A 5DF0A 3TFKA 5JHDB 2CJUH 4FXKA 4U7SA 1EO8L 4K2UH 3QSKB 1PKQA 4W6YB 4DZBB 3IU4H 3TIEA 4LCUA 2N4IA 3MRPB 5E6YA 5I8EB 3D39E 2VITA 1OCWH 4FQCH 2GYSA 5T3XL 5JPNB 1FG9C 2MHAB 2E9JA 3IDXL 3EJJX 1AIFA 1UEMA 1ZV5A 2VDRH 5CP3A 3WJLC 2DI8A 3R06B 2CRMA 2IAND 4PJCA 3QPQD 2FR4A 1Q0YH 3UAJC 2IANE 4LGRB 1N5YL 4PRPB 4EUPA 4UIKL 1RIVH 2ICEB 2X1WL 1UXWB 2GUOA 2A6IB 1JPGA 3CFBB 3TZVD 2W07A 3VFWA 3X13A 1EJOL 2VLKB 1I4FA 5AUMA 3PGFL 1U41A 3QDJA 3FMGH 3QUXA 1Z9SA 1HYSD 3DX9A 1MRDH 1JGEB 1YEFH 5HI5D 2Z93B 5SWZB 4HWBH 4ODUB 3MO1A 2IWGA 2UY6A 1N0XL 3BYTA 5KVMC 2D3VA 3BW9A 1WBXB 1AGDB 1NQBA 1S9VB 2L0DA 4HAFA 4JKMA 2XXCB 4MNQA 1QRNE 4FQJH 3LKSB 1PYWB 1G7LA 4HCRA 2ED8A 1SM3L 1Z0NA 1IAIL 4EVNB 2HWZH 4PJGB 2MSPA 4JPWL 1NGXB 4LU5L 4A6YH 3HG1B 4JVUA 3UTQB 2FJFB 2B1HL 1EJ6A 1CICC 1J87A 3K3QA 4ISVA 4FQLL 4JY5H 5FA4B 3I2CL 2NXZB 3WS3B 3QAZC 5ICZB 5DD0H 5EZLB 5A1AA 1KTDB 3P4MA 3QIWA 1GOFA 5HI4C 2YBRA 4HBCL 1G6RH 4WTZA 4EIGB 4JFXA 4JO4L 4UT9L 4KI1A 2EDWA 1X5JA 1N26A 5FDWA 3INUH 4PGZA 4J1UA 2X4PB 4V3EB 4YAQA 4ZSOE 3TF7A 1JNHB 2GSIB 3BQUD 3MNWB 2DQDL 1R3IH 3RIAK 4G7VH 3D85D 4UBDD 2X40A 1LWRA 3C5JB 4GUPA 1TZGH 4TUKL 3O9WC 1T0MB 3OKKA 4GRWB 2JK5B 3ROLA 1UVQA 4FS0A 5FF6B 5B8CA 1T21B 2UWEE 4LCCB 4OIIH 5GS0C 5E5UB 4G3YL 2J88H 3STZB 1NH6A 2VDQL 3AM8A 4JFDA 3ARDA 5EOTA 4HC1H 3NIDE 2DWEB 1M7XA 3D39B 3FOMA 5HHNB 4F7CB 1UZ6F 5KZCD 4UV7H 4R2GD 1JGLH 1XH3B 3WHXB 5ABDE 3IJYA 4MD4B 5F44A 2F5BL 5ESAA 3AS2A 5ID1B 1S9XA 3QUZC 4RZCB 5CBEB 5MEQB 2IANB 5EWIH 2YWYA 5EB9A 2NNAA 1HCVA 3HZYB 2HRLA 2XTJC 4ENEC 2G9HB 2IMMA 3S34H 2V7NA 1NCCL 5K93A 3ESVF 2ESVA 4Q74A 2WNGA 2DM4A 4UI2A 5J89A 2R0KH 3DARA 3BX7C 2IBGA 3N1QC 3GMPA 2R4RH 5T3XD 3IJHB 3K7UA 2YR3A 3VWJC 3FN3A 2DMKA 3HCVB 1FFOB 4MA1C 4ZUWA 3MRRA 3HC3L 4GH7B 4HD9A 4XC3H 2XTLA 5E2VH 4AIXA 5TE7L 3BGAA 5C0DA 3ZTNL 4LCWA 4LOUC 5LJYH 3GI9L 3PHOA 1QRNB 3F12A 1ORQA 5MP6L 4PR5B 4QY8A 1JUFA 4FN0A 2AJXL 5HYFA 5B38G 4UOW1 2GTWB 2QQKH 4PJAF 4LLYB 1WSST 5C09D 3UAJD 4P9HC 1K6QH 2P43B 2XKUA 3MRJB 4U0RC 3NZ8A 4YHYC 4HS8L 4N8PA 4X5XA 4APQC 5GIRB 4G6FD 4RCAA 1L7IL 4G7YL 3MXVL 4Y5YB 1FO0A 5DD5H 4GW4B 3DIFA 4QOKD 1TZHA 3O45B 4QOKE 4P9HL 4KVNH 3BQUB 5FO7A 5D5MA 1TVBA 3FQWB 4M1CC 3V6OC 5AWNH 2FHCA 3VXRA 1HIML 4XMPH 1W72L 5DJ0B 1MWAL 2UWEB 1U93B 5E1AA 3H42H 1NCBH 4XCCL 5FHBL 2V17L 3PIQB 4F15B 3OX8B 3CNKA 4L9DA 1FNGA 4LSQL 2GCYB 4OIBA 4CU7A 2EDXA 5EIVA 3F8UB 3OG6B 1NAMH 4LNRB 3VXSD 4JFYB 4R2GB 5KZCB 2V2TB 3DPBA 5E00B 1F4XL 2Q7YA 5I18L 4IHOB 3LEVH 4PTUB 4S1RH 4U1KB 4G6KH 4M7JH 3U36B 1XF2B 5FCUH 3KXFA 1RUAH 2R1XB 3B8SA 4AL8L 3IGAB 2DQJL 5CJXA 3NABL 5IT2L 3H7BA 3ARFC 3OAZH 1S3KH 2L4OA 1VDGA 3ECBB 4Z78A 1F97A 4EBQH 1XGQB 4NRYA 5HYJD 5I66A 1XF4A 1VFBB 1LK3H 5I1LB 5HYJE 4QHMB 3CVHA 1V7ML 4HXAL 2NW2B 4TPRH 4MHHG 4J3XA 1J7VR 1BGXL 1MIEL 3FHQA 4DZ8B 4HMDA 4QRTB 2W0FB 2BNUB 3O9WD 4G42A 3QUML 4ESKA 4X4MA 4KU1A 2R23A 1EV2E 1OAQL 3L3JA 4Y4HA 2A9NH 3A6BH 2BY3A 5FOBB 3EYFB 3EZJB 2QHRL 2ZG1A 4LGSB 3G6DH 3ARWA 4CW1B 4ELMF 4F80A 5CIPH 4AM0A 2IQ9L 3PDGA 4MNHB 4YDKL 3QUZD 2CSPA 1JHKH 4PJBA 5M95B 2P5EE 3TT3L 1FL6B 5DVNA 2V2WA 3BH9A 1L7TH 4NKOA 3SDDD 3QHFH 1Z6JT 4ENED 2VDMH 2OK0H 1FLTX 5EBMB 5GGSA 2JIXA 3AMLA 4HMEA 4WW2A 1WZKA 1KTLA 3O2WH 4G6FB 1GGIL 4ONGH 4HKZB 1WT5C 1ES0B 1XEDA 3FZUC 1E27A 3KJ6L 1MY7A 4D0DA 4QOKB 3VWJD 2A1WH 2W9DL 4RGOL 5DK2A 1RJYA 5DD1H 1LEIA 5GGUA 4NGHL 5J13C 3AGVA 3AAZB 2PTUA 5I0ZA 5DJCB 2P5WA 4LOUD 4OV5A 2VABA 5DHYA 1GVIA 4G6MH 1OPGH 3ESUF 3A67L 2DLTA 5DGRA 1J1XH 4WEBL 1OD7A 3MLUH 1NDGA 4JFED 3MGAA 4AG4H 2X4OA 2E27L 1ED3A 3DURA 1MVFA 3O3EB 3KPLB 5IB5B 4LSUH 2VZ3A 3EDJA 3MV7D 2WW8A 3C2SA 4EDXB 5SV3A 2D7TL 1YN7B 3MV7E 4PRHA 3QAZB 2LVEA 3WLBB 3SDXA 4APQD 2UZXB 3TT1H 5I16A 1CE6A 3QNYB 5DT1L 1OQOA 4R90H 1VKXB 4IDLA 5HYJB 4LVOB 2Q8AH 4DKEL 1IQWL 1XF3B 1N3NB 4FFYH 3SKUD 2CK0H 1A7NH 2DTML 4ODXB 3MJ9L 4M1CD 3ROOA 3ULSB 5KVDH 1FZOA 5C0FA 3RQ3A 3BKMH 3RUGE 3O9WB 3BIKA 4DN4L 5I71C 3VDAA 3D9AH 1FJ1B 3C5ZC 4X99B 3VFPA 5CHNA 1FQ9C 4MSWB 5JW3H 2XKNA 4QKXB 1BX2A 3MLSL 4PBVC 2OLDA 5BQ7A 5I1CH 5HHMA 4NNYB 2WUBL 5GGRY 1NLDL 2ILLA 3W5NA 4L1HA 2ZOLA 2NY3C 1R3LA 3CVIL 3QUZB 2P5EB 3T8XA 1EGJL 3V7AE 5LQBL 2X09A 2D7PA 1IC5H 1UWGL 5HXMA 3SDDB 3KHOA 25C8H 4HUXA 1QO3B 1M7DA 1G6VK 3DYMA 2G75B 3M1BB 1CYGA 1X5HA 4YHOH 5MERA 1KIQA 3U4EA 3RTQC 2VAAA 2ZSWB 1AKJA 4NN5B 1OF2B 5CJOL 3WKML 4HJJH 3VWJB 5I15H 1I8LA 4P4KA 3VFOB 1MFDL 1YEGL 4XAKE 1U3JA 1MFCL 4JY6B 4CJ1A 4AJ0A 1OGTA 4O51A 1ETZA 4MCYB 4LVNB 1CFTA 2EYSA 1X5GA 1JWUB 4QT5A 3BEWB 4Q0XL 4M1GH 4ZO9A 1BVLB 3EOAA 5K9OB 4YFEA 1SHMA 1R3JB 4AMKL 2OTWA 3BT2L 1U8NA 4JFEB 4N0CD 4KKBC 3W11C 1R5VA 2YD2A 4L3EA 3TNNB 4ZYKB 4IIQA 1CQKA 3H9SA 3MRGA 2IEPA 3RGVB 5DLMH 5CEYB 3MV7B 1UWEL 2XACC 4ZDHB 4B5EA 1SEQL 4J4PC 4D8PB 4U0RB 1IC4H 3JUZA 1G7MB 3MRCB 4U2ZA 4R96A 1W72B 4APQB 4OFIA 1DLHB 1FBIL 1J9CT 1MWAB 3HUJE 3MRFB 3O11B 1P1ZA 4OM1L 2O26U 3MA9H 1A3RL 5J12C 4JN2B 5F1OB 5C6TH 1NL0H 1HDMB 2ED7A 3WEXB 3R1GL 2ZUWA 3GJFA 4G8IA 4OKVA 1HQ4A 4DGVL 4BZ1L 5EUOE 4NSKB 1OARL 4IRZL 2ATKB 4Z9KB 2YA1A 3RUGB 3JZ7A 4RMUA 1BZ7B 4ODVH 1A21A 3LKPB 5B38A 1TCRA 5EC2A 4XP5L 4PRBB 1UADC 4XAWL 4P46C 4JGUA 5AYUH 3RY6C 3BP4B 1X4YA 4ZS7H 1C08B 1ZHBB 3T09A 2AJZB 3WV0A 1CU4H 2C1PA 2AVGA 3KR3L 1AP2B 2Q3AA 2VDPL 3MFFB 1T7VA 3RZCC 3PDOB 1I1AB 2EDDA 2VDOL 8CGTA 2Z91A 3G5XA 3VDBA 2YD6A 1X5XA 4CDHA 1U6AL 4POYA 4KTDL 1MNUL 2NCMA 3QUMB 3T0WA 5HHXH 1UQSB 1RU9L 4BFBD 3LRSB 5JORB 4HWEH 5DGQA 4P99A 3HE6B 4WJ5A 1OQXA 3REVA 3FQTA 1IGCL 5E4EC 3F62A 2B2XL 3PV6B 5FYJH 1CF8L 1HHJB 1MHPL 2EIZA 1H0DA 2I07A 3WD5L 1VADA 5TDPA 1JNNL 2AEQL 5BO1H 1OAUH 5DZLA 4HKXA 2EH8H 3ZE0E 3F5WB 5IROC 4KZDL 1U8LB 3C5ZD 5JLZB 3TFKC 4H20H 3QULB 2H9GA 3PHQA 5J6HB 2APTA 2H6PA 2W0LA 4MJ5A 5BRZD 4UDUB 4LPXA 4Z7UA 4BSVA 1P7QD 1PLGH 5EOCH 3FO0H 4WHTA 1AO7D 1BFOB 4CVZA 1W2KT 1AO7E 5DUMH 4Z77A 2Z92B 5EC1A 3NAAH 1NCAL 5DK0A 3U0TB 1M05A 1YEKL 4W70A 4Q9QL 1DBMH 2H8PA 4IOFC 1MJ8L 3HUJB 1AI1L 1DQLH 3RTQD 1INEH 5C2BH 1GC1L 1M6OB 5DJDA 4HIEA 4J8RA 5C0IB 1JCKA 2AJVL 3VMOA 2W65B 1UJ3A 3O4OB 5K59F 5EUOB 1T4KB 1MRCL 2YKLH 4ODHL 5BS0D 1L9MA 3CMGA 5BS0E 5L7XL 2R69H 1OM3L 2DM2A 4M6OL 5HYQA 3MJ7A 3CFDB 4NOFA 3DVIA 3QRFM 5IB1A 3PGCB 4X4XA 2B5IC 4XNQA 4LSPH 4DAGH 4QRRA 4Y8DC 3KYOA 3LQAC 3D25A 4I13B 4LKCA 3JWOH 4PJ7F 4KTYA 1HOCB 4YNYA 4KQ3H 3DYPA 1ZTXH 3T4YB 1RZJC 1Y18B 2NTSP 5F3BB 4R3SA 2FIRT 3RPIA 5F7DB 3QXAA 1N4XL 4J4PD 4P4RA 4ORGB 1PG7X 4WEUD 4K9EL 1NPUA 5GSVB 1BZ9A 1UWXK 5CZXC 3HPLB 2BHYA 3QIWC 5DRWA 3LQAL 5D1XA 1P84K 5KTEL 3H3KA 4E0RA 1RZJL 2OXGA 5FAAA 5GRJH 3ILPA 4NRZA 1IGML 1UXSA 3GRWL 4JFOB 4GAFB 1HH6A 3MUGA 1A14L 1TPXB 4I77L 1RURL 3LKNB 4AZ8A 1TFHA 4UAOB 5DD3L 5C0CA 2VZSA 4YX2L 4X8JB 5I71B 2VISA 3CH1A 2D9CA 3C5ZB 3OF6A 3HTLX 3MRIB 1J8HA 2KUTA 4NQVA 3P40A 1A5FH 4U1NB 3AM8C 1ZLSL 3X11B 2F19L 3ULVC 3ARDC 3HNTH 3OJMB 1DFBH 1U8OA 1K4DB 3ZDXF 1AXTL 5HGHA 3BAEH 3RZCD 4JG0L 2HJFA 1XGRA 5J1AB 3GMLA 4YC2C 4P57A 3TJHA 3OZ9H 5IFJA 2DKMA 3JXAA 1AO7B 3RL1B 1N0LA 4M03A 1EXUB 3MCG1 2AEWA 3T3PF 1N8ZB 5IQ7H 1ZA6B 2A77L 3GIVB 5JQ6H 2YPVL 3GGWA 2F54A 3X3FL 2VMFA 2XA8L 2WIIA 3RTQB 4NQTA 4NP4L 5BOPA 5ESQA 3SKNA 4KHTH 1BWWA 1RZFL 1SJHB 4TNVF 2BK8A 3MGOB 5BS0B 3G5VB 3TFKD 4JR9L 1WV7T 4WWKA 2X4UB 4DN3H 5C0GA 1NGQL 3GSNH 4U1SB 1I9JL 4PRNA 1UFUA 2XQBL 4HIXL 4MDIA 5EU3A 4X7TB 3BKCL 2FWOA 5F89B 3FONA 3QJHB 1KFAL 1YEEH 3GSRB 1P4LB 3CCHA 3EYUH 4R4NC 1QR1B 2H1PH 4OZFH 5I1IL 4PJCE 5ERWB 1U8HB 2N1KA 4LPVA 2QEJA 2VL5A 2BVPB 5L2KE 1CBVL 1KELL 4IOFD 4RAVA 2HKFH 2QSCH 3MRKA 1FL5B 1JWSA 4K8RC 4AENB 2ZCHH 5DR5L 5DYOB 3LMJH 1KIUA 1RPQA 2BHZA 3JWDL 1BBJA 3EYSH 2AJSH 2I9LA 1RVFH 4ZFZA 1NGYA 1NBYB 1PX4A 2OZ4H 2X1QA 5DWUL 3QQ3A 4D0CA 2WMPA 3LN5A 1CGTA 3QB7C 3NZHL 2UZIH 3SE8L 1YNKL 4M7KH 5JPMB 3KPPA 4OCRH 3UROR 3KYAA 4JO3L 3UTPD 4MNQD 2DMBA 1C16A 3LS5L 4P23A 5C07D 1EEZB 4P2QD 3VFVB 5KSAA 5C07E 2CUHA 5KVEL 4P2QE 3MLZH 5ELIA 4QGTA 3QDAA 1QP1A 4DGIL 4XNYH 4R7NB 3RZCB 5GZND 2EYTB 4Z7WE 1LE9A 4KMLB 2EDBA 4ZFFA 4NHUA 1CN4A 3VFUA 5ILTL 2H32B 5CZXD 2XZQH 4S1SH 3QIWD 2WINA 4ZD3H 3T3MF 4H8WC 5EIIB 3HI6H 5CJXC 3WXWH 2BSTB 1DE4B 1K5NA 3BYYA 1B88A 4QRSB 1FNEB 5JOFB 5D7LA 5H35B 4M6ML 2P4AB 2VLJA 4C4KO 4KROB 1U58A 4OCSL 2VR5A 1NMAH 4JRYD 2X9WA 3JTTA 4HGWB 4JRYE 1E28A 3ET9F 3L5JA 4NKIL 5AAMA 4UDTB 5IVXA 4PJGF 3VW3L 3LN4A 3NN8A 1G9MC 4CVWA 1A0QH 1BAFH 3DUSA 3B9EA 3I6LE 3PP4L 4JQXA 3U2SA 3VMPA 4NFCA 4Y4HC 5K9QI 3CVHL 3ARDD 5BVJB 5K33A 4LCUB 3QEQA 2R56H 4HIJA 4MXVF 4X7SH 5GJSL 4Z76A 5AZEL 2COQA 4K7PX 4YZFF 3I9GH 4YHKL 1U2HA 1ZLUK 2XIDA 3O6KL 1ZSDB 4MAUH 4GKNA 3G5YA 4V2CB 4LF3A 1GGBL 3U46A 4PJCB 4QHUA 2JJTA 1J0ZA 2DBJA 1T5XA 3GDBA 2WBJA 5L2KB 1UB6A 2EEDA 2WBKA 3DHJA 4EUPB 4GRWF 5KJRL 32C2A 4JN1H 3BP7A 2HFFA 4WW2C 2F74B 4QXTA 1RI8A 1ZS8A 1I4FB 3OQ3B 5IMLB 3MXWH 4FP8H 3K2UL 3V0WH 5IIEA 4AH2A 5L9DH 1BLNB 4HH9A 3RVWC 2WWMC 2GKIA 1D5BB 3KPSA 1NEUA 1SVZA 3MO1B 4LBEA 3DX8A 4JQVA 2CRZA 3LKRA 3MGTA 3BW9B 5A40E 2BXZA 2J6EL 4HPYL 4G8EA 2R1WB 1NEZG 1XF5B 3MREA 3GSXB 2X2YA 5E08L 3BPOB 4B41A 3ES6B 5C07B 2YC1A 4JY4A 5EU7E 4P2QB 1R5IB 4ZPTA 5T1LD 3TPKA 2FX9L 3R8QA 2FATH 3KYNB 4R97C 3EO9H 4Z7WB 1XIWB 2C3VB 5ITBL 1MCPL 4G6JH 2WV3A 4P2RA 4KRNA 5EULV 4I18A 1XZ0B 2VNCA 4ZPVB 5DVKA 1A1MA 2C4XA 5E4IA 2CUIA 4K8RD 1OHQA 2YBRB 3MNZA 4C4KT 4GW1A 1AY1L 4TRPH 3DVNA 4LSTL 1HHKB 5JDSB 4MXWL 5FDWB 2C4FT 1G7JB 4N9OB 2IGFL 4FHBD 1IJ9A 4KWUA 3FB6A 4JRYB 43CAA 5D5ME 2YZ8A 5MEPA 3PABB 3UTTA 2V5MA 4L9LA 1JFQH 1NDMA 1WZLA 4J12A 5MHSD 1JI2A 1V05A 5MHSE 4Y5VB 3TYGH 2DICA 4IRJA 1VACA 3V95A 4WI9A 3ARDB 5EOTB 5FO9A 2HJLA 3QHZH 5FYJU 1E4JA 5C0JA 3LCYA 4AT6A 2JB6A 4AEIL 2LU3A 2EDQA 4AK1A 3MZGB 5ESAB 1ORSB 3DO7B 1PZUB 3SPVB 4YC2B 1LDPH 1CFSB 3BXNA 3WN5B 4LKXB 5DMIH 1FE8H 5IEHA 4LAQH 2YRZA 1ZK9A 4TULH 2XRAH 3QDMA 4EXPX 3UJIH 2ZUTA 2UWEF 1LEGB 1AHWA 1Q72H 4OGYH 3TBVB 3V4UH 5HJ3A 4NQDE 5DRNA 3CLFL 4UZGA 2I27N 2FL5A 4W6XB 3NIDF 4O02H 4KMQA 3ARGD 5ISZE 2APFA 1L0QA 1I8LC 1IGFH 4P4KC 4PJ8A 5KW9H 3WIFB 1K3ZA 3NOIA 3DXAA 4Y4HD 2MCPH 2E9IA 4PRID 3UZQA 4WY7L 1E4WL 2UZYB 5AD0A 4PRIE 3TM6A 4B50A 4FG6C 3F12B 3TPUA 2HKHH 3IFOA 3FOLA 4LCIH 4NZRL 4XPAH 4K3HA 4X7DC 2OR7A 2FEEI 1M71B 3E8UL 5T1LB 4IIQC 4NO3A 4CMHC 4BKLA 5EOCJ 1VPOL 1CZ8H 3DI3B 1U92A 1DL7H 1U8PA 5C3TA 3BWUC 3PNWB 2OMNA 9CGTA 3M45A 4FZ8L 4X5XB 4KMTL 4HF5H 3N06B 1KC5H 4OF0A 5LAXB 3GNMH 2DQFA 1TZHB 5DJZB 5BMFH 3RVWD 3D5OF 2VDNH 5E5MA 3LIZH 3IFNH 4JPKH 1OTUC 3ALWA 5D5MB 1E4XL 2K7PA 2HMIC 2W59A 1B4JH 3B6SB 1T7XA 1KB9K 3UJJH 2XZAH 1D9KD 2D4DA 1S7UB 4PP2A 3U83A 1H3TA 1LNUA 3OXRB 5JIIA 5DQDH 3GBNL 3TBWB 4FQHB 5J56B 2EECA 4YE4H 4OUUB 3DV4A 3IDIB 3LKOA 1JTPA 3MR9A 3NTCH 3NCFB 1CDCA 3MLRL 2AK1H 2APVA 5DA4A 3I84A 2VDLL 4OLWH 4PRHD 4S0SD 1KNOA 2X05A 3MCKB 5GGVH 4PRHE 3QFDB 5F9OH 1BJMA 1IGTA 5GSRB 5B39B 2OI9C 4N68A 3LS4H 4GW5B 3JV4B 1GRWA 5JA8B 4Z78B 5C2UB 1H3PH 3JTCA 4NQDB 2DQCL 1MHHA 5D7JA 4UILL 1DQQA 5ISZB 1S9KC 1CR9L 5K9QG 3ARGB 1F3RB 1QLRA 2Y07L 3KPMA 4F58H 1FLRH 2F53D 1J0JA 3BP5B 5F97E 4HFUH 3QCVH 3ARBA 2F53E 4F37K 3BGFC 2R23B 3L3JB 4Y4HB 1YEJL 4XWGL 4XP4L 3IF1A 4LK4A 4XPTL 4PRIB 2HYMA 4UB0H 2A6JA 4HWUA 4WCYH 3HZVA 5I75C 3RY5A 1VB9A 2JJVA 3O3DA 3THML 4HIHA 4O4YL 1MCQA 4QHLB 4BH8A 4P3CH 1KYOJ 4KDTC 1IBGH 4KTEH 2H2SC 4NO2B 1JZ2A 3L3GB 43C9B 3MJ8A 4U0QB 5CWSB 4ETYA 4OIAA 2OX5A 2V2WB 4HX1A 3OKMA 4D0BB 15C8H 1EFXA 1LD9A 2YD7A 5ACZA 4HFWA 5E1HB 2EDJA 1ZHKA 1QQDB 2XPGA 1YNTA 4RBPH 2Y5TA 2KBGA 1UYWH 4RISH 3B5TA 3BD5A 4M6NH 4WUKH 1U8QB 1AKJD 3CXHJ 4HIIA 2BVEA 5JXAL 1Q9WB 3FAXA 3ZLQC 1Q9LB 1UJ3C 1YECH 3GUTA 4P4KD 3C6SB 4LEXH 5GGUB 3BE1L 3TV3L 3TP4A 1U2CA 5J6GB 4XWOC 2X4NA 3UZVB 1D9KB 1I3RB 2I26N 2AV1B 2VTFA 3RWHA 1UKSA 5JO5B 1YJDH 4FG6D 5DHYB 2H3NA 3FB8A 4NYLA 5T5NF 1CIUA 1S5IH 2HFGH 3O6LL 3UO1H 2PF6A 4YPJA 4L3ED 2HAZA 1JV5A 4U1JA 1ZE3C 4L3EE 1ED3B 3DURB 2C3WA 4KHXL 5IB3A 1F4YH 1PSKH 4U7MA 1FYTD 3SGJA 3HNSL 4HGMA 4LSSL 3QIBA 2OYPA 4PJAA 2GK0A 1FYTE 4PRHB 5F9WC 1G0YR 1JPFB 2B1AL 3VI3F 3ZKQD 5D1XC 5DTFB 1BVZA 1L9NA 3BZDA 3MNVA 1A8JH 4UOW0 5TF1L 2D4FA 3HI5H 3H0TB 5FM5O 2QSQA 4HEME 1CE1L 1OTUD 3TO2A 2HMID 3T04D 5C0AD 1FZOB 1CGSL 5DHVA 2C7UB 2VC2L 4TUJA 5C0AE 4Z6AT 1RHFA 3BIKB 4N0YH 4HUUB 2F53B 4DKAA 3RVXD 4KKCD 4Z7QE 5IFAH 3O2DL 5IG7A 3VGEA 3KLHD 2BNRD 1J05A 5E99H 2VAJA 4BJLA 1ACZA 2OP4H 2BNRE 1KT2B 1MCCA 4PDCE 4KKAC 5BQ7B 1NANH 3PWPA 5ALBL 4XBPB 4FFZH 1KGCE 5IHUH 2W9EH 3ARXA 3ZDYE 4PJEF 4NN7B 5SWSA 1J5OH 1KN2H 1R3LB 1X5LA 4HS6B 4UINH 4JVPA 4P5TB 3WFHB 4Z5RA 3W9DA 1I7TB 3QUKB 4U2YA 1X5YA 1PQZA 4ZOEA 2BSSB 4N9GB 1E4KA 2WSKA 4HUXB 3OR7A 4DCQB 3FB7A 3BSZL 1AH1A 5DUPH 2XZCL 3L6FA 3ARSA 2C3XA 3GJFK 5D4QA 1TXKA 1VFAB 4P2CG 3SY0A 3S9DB 5F71A 1LO5B 2QTEA 2EE2A 5D6CA 5HVHC 3GBLA 1I9EA 2WLYA 4OTXH 1OGTB 4O51B 1KSRA 1ETZB 4WWKC 3P9MA 2KDGA 4PB0L 4NT6B 3WJJA 5IKCA 3T1WA 4YXHH 4I2XE 4W68A 2JCCA 4H1LH 3CSYA 4ODWA 5HDBE 2E7HA 4G8GD 3QHTC 4X5LA 4G8GE 1WWWX 2ARJB 1CL7L 2H2SD 4L3EB 2HLFC 4GMTL 4CMHB 1YEIH 4WFGD 3RVUC 3DRTA 3O6FA 1DSFH 2NXYC 3L7EA 1FYTB 1FZMA 1HXYA 4V1DA 4HC1A 4GAGH 4TVPH 3WMSA 4R96B 3BKJH 2WLZA 4CU8A 4U7KA 4AEHL 1JHLL 4M62L 2B39A 4PLJC 5IFHH 5H94B 5IESL 4G8IB 4OKVB 5H37G 1HQ4B 1MHEB 1RZKC 2GJZB 4XNMB 3S36L 4GMSH 5C0AB 2NTFA 4U3CA 4MDJB 5EFIA 4JZNA 3M8OH 4IEFB 4ZTOH 4MLSA 4OGXH 4IBLT 1RJZB 5I6XC 1RK1B 1AE6H 3TIDB 3RRQA 4I1NB 3V5DB 5I19H 4I3SL 3HNVH 4P23C 3QH3B 2BNRB 3DROB 1G9NC 1N2RA 1OB1A 2FD6H 1RZKL 3HUJF 3WIHH 4ZUUB 2DLIA 1OAXL 2CIIA 3OB0H 3C5SB 1WZ1H 3S88H 3IU3A 2QQNL 3PJSA 3PE9A 3TN0B 5EUOF 5JW4Q 4XH2B 2OI9B 4PLKC 5FUCE 3Q1SH 3NFSH 3SCMA 3IDGA 3L5WA 2X6MA 5IR1B 2X4SB 4JFZH 3MBEA 3R4DA 2FO4A 5EZOH 5L0QB 3GHBL 1D5IH 5TDPB 1TVHA 5C0CD 2VLRA 5J06A 4NJ9H 1SMOA 1OP3K 2FSEB 5EO1A 4GLRI 3OF6D 3QRGH 1ITBB 5AYQA 5JXEA 4JQXC 4GG8A 3WUWG 4I2XB 4Y19E 2J12B 3F6IA 3PHQB 3T65A 4YGVB 4KKAD 4Y0GA 1KLGB 2BOBA 3X12B 4JZJC 1F6LL 1VFMA 4PJ9A 4MJIA 3RNQA 4Z8FL 2HFTA 1DEEA 1IFHL 4G8GB 4ZUVA 1WFUA 5FYLL 5FHAL 1OGAA 4XBGA 4U1GC 4G5ZH 5ACMA 3GI8L 4ZOBA 1NUNB 4Z77B 4KUCD 2OL3H 3UYRH 1IKFH 1LEKB 2JJTC 2W38A 2X1OA 1YQVL 1J86A 1T7YA 2RGSA 3WDHA 3ZE0F 2WBJC 1CLYL 2EDOA 2H8PB 5BXFB 4FQXC 5C1MB 3AU1A 2CIKA 2VH5H 2Y7QA 5EZJB 4J8RB 3QCTH 3CK0L 3BKYH 4PJXE 1AJ7L 1UJ3B 1PVHA 1I3UA 2GSGA 2JB5H 4Q6IA 5C9JB 3VFNB 1BFVH 1H3VA 3LQZA 2AABL 3VXQB 4WWKD 2FX8L 4K3JL 5IW1B 2GJ6E 3TBYB 4JQVC 1LO3H 2IPKA 4TNWK 4JDTH 1XGPA 3HPJA 2FH6A 4PS4L 5IJVA 3MJ7B 4W4NA 3OMZA 3SQOL 3EOBA 4I4WB 5IB1B 1HNGA 3BH8B 4XCEA 1U91B 3NGBC 3RZWA 3QDHA 5FO8A 3NA9L 3UPRA 2HLFD 4GT7A 5JTWA 4FQ1H 2ZUXA 3IJSA 1Y0LA 4WGWB 1FAIH 4AEEA 2NXYD 2DQGL 3OJDA 3OAYH 2P8MB 3QXAB 4NKDB 2MPAL 5I1KH 4I18C 3DNKA 2K9UA 3T2NL 1BZ9B 4XPBL 5ESVA 3HRPA 4DJMA 4HKJA 2FYYB 1WEJL 4MA7H 1MCRA 3Q6FA 4G8FA 3S7GA 4D3CH 1IEBB 3D18B 3GSQB 4F9PA 4QCIA 3QZWB 5DEGA 3ARZA 1PZ5B 2PO6A 1UXSB 2O61A 5E8EA 5F7KC 4OQTL 3EDFA 2XWBA 1BQLH 3W9EA 5C0CB 2ATPA 1OP5H 4U6YA 4Z0XB 1U8MA 3SGEI 1CFBA 4JLRB 3VRLF 1IGJA 2AJUL 4YR6B 4JCLA 4EI5C 4HBQA 5GHWL 1JGVH 1A4KA 4OI9A 4P23D 4Y19B 4CADB 4NQVB 1EUTA 5I1EL 1KPVA 2X89D 2HG5B 4NWUH 3FCTB 2KKQA 4X7FC 2E7CA 1LK2B 3OHXB 1UZ8A 4DVBB 3QWOA 3WFCH 4WTXA 1XGRB 5DI8A 2IH3A 4F7TB 5IFJB 4YO0A 2VOTA 4RX4A 1CLCA 4N8VB 5IM7B 1DQJA 4PLKD 3IFLH 5LCVH 3MJGX 4O5LH 5F1NB 3GMMA 2YSSA 4K7FA 5F8QC 1WCBA 2NY5C 3JSSA 3PG2A 4PV9B 5GGVY 5GS2D 2G5RA 3IAQA 2IFGA 3GGWB 2CGRH 1AHWC 2VLJD 3QG6A 3RWIA 3FO1A 2CMRL 2WIIB 1DP0A 1NMBL 3LRHA 5TDOB 3KHQA 1PEWA 3QXVA 4C59B 1SY6L 3TA3A 4H25A 4PJXB 5FYKD 5ESQB 4ZTPH 4OFDA 5JUEL 4MQXC 5FYLD 1ZLWK 1FC1A 4GKSA 5EOQH 5FYLE 1ADQH 5HVHB 1YPZF 4PJ8C 3UBXB 4OCWL 2NY5L 1CFVL 5KN5B 2V5TA 2BC4B 4GG6E 2RFXB 2FBOJ 2VR4A 4OZ4A 3DO3A 1N6QL 1SJXA 3KPQA 4BYHA 4OLUL 4PRNB 5GGQH 1B90A 4O2EB 4UTAL 3QEQD 4U1IA 4YWGL 3FQXA 4NQUA 1DBKH 1UM6L 3QWQB 3HMXH 4X4YA 3B5HA 4RMRA 4OD1H 3P30L 3VD5A 3KGRA 4K3EL 3BVNB 1HZHH 4NM4H 3VRIA 2AEPL 2VLLB 4P5KB 3CCHB 2YMXH 1CWVA 3E6HA 2OTPA 4HT1H 2NXYB 3K0WA 1QA9A 5C0RH 3B2VL 3HN3A 4JKPH 1EA9C 2WBJD 4JPVH 1YDPA 3S5LB 3UJTL 1IGYA 1OLZA 4FQXD 4RAVB 4GAJL 1BOGA 4O2FA 4YQXH 2GY7B 1JWSB 4DTGL 1PY4A 3AB0C 2UUDH 1BBJB 3V0VA 3IDMA 3WLWC 2I9LB 12E8L 4B0MM 1IQDA 2VXTL 4MXQA 4JFQA 3W0WE 3IRZA 5J1TC 1JHTA 1FZJA 2EH7L 1LHZA 4U49A 2V7HA 1MREL 5E2UH 3NMEA 3I85A 5E95B 4S1QL 3BGMA 3U82B 1UGNA 3KPPB 1ZHLB 5CEZL 5IB4B 5E8PB 5HDOA 4XPGH 5IWLA 5FGCE 5CILH 5F70A 5FV1L 5T3ZH 4LRIA 4WTWA 5DQ9A 1X6LA 4U1MB 4LRNH 2YD4A 1MRFL 3AXLB 4NCDA 1MLCA 4PJ7A 1RJLA 1T80A 2FX7H 4ZFFB 5HY9A 4XTRC 4XVSL 3TH3T 5DJ2B 3S35H 1KXQE 2DF3A 5KVFH 2W91A 4NQSA 1AD0A 4PGDA 4J3TA 1C7TA 1IM9B 1QNZL 1YEDB 5D7JC 4LP5A 2YA0A 3MRLA 2BMKA 3RU8L 3QUYA 1KCVH 4UMGA 5EA0L 2R8SH 1E28B 3KJ4B 1MLBA 1LQSR 2AJ3B 1INDL 4Z7WF 3NN8B 4EI5D 4X6CE 4GG6B 4L4VD 3ARBC 1Q9KB 2IQAA 1B9ZA 3EYOA 4XVTL 2F15A 4L4VE 2P8PB 4TUOB 1T1ZA 4X9HA 3QEQB 4JZJB 1T3FB 4IOSD 2GHWB 1RUKH 3CIQA 1GAFL 3DX7A 1QSFA 2X44D 4XCNB 1F6AA 4LLQA 4U1GB 4Q9BA 1IMHC 3QWRA 1S7QA 1G7PB 2X4QA 3U46B 3L5XL 4HPOH 1IAOA 2LVCA 3QDMD 2HT3D 1NSNH 5JZ7C 3S8WA 4M1DL 5T1KA 2WBJB 2Q86A 3H2WA 4KDVA 6FABH 1I9IH 2EKJA 4KPHH 4FQXB 4BZ2L 2HFFB 1JRHH 1J1OL 3WDJA 4QXTB 1ZS8B 3PUCA 1WISA 3WUWA 4WFEE 2IFFH 3FFCE 1WAAE 4MQXD 3RKDC 3NA4A 5F96H 3DSNA 1ZLVK 3MACH 4YK4C 3ZDZF 1ZAGA 3VH8B 3DXAD 3DSFL 3HAEB 2A2QT 3LKRB 2H2PC 3CSPA 4YBLC 3MGTB 3HI1A 5GGTL 4RAHA 4PB9H 3O6MH 2EO9A 2BVOB 5DRZA 1HH9B 4KV5E 1QSVA 3CLEL 5FGCB 4F3FA 4MMZC 1UA6L 2J8OA 2OJZH 3NGBB 1JF1B 1S7SA 4XNZB 3FTGA 3OV6A 1H9VA 1TMCA 2PYFA 2C3GA 1ONQA 1QOKA 4MJ4A 1SMAA 1FFPB 1NBQA 3DMMA 2JE8A 1HSAA 2EDKA 1DN2A 1MJ7H 3SGJC 3L95B 3QIBC 4MJ2A 5D9SA 2B0SH 3E3QE 3BN9C 5LGHH 4UQ2A 2YXMA 5D71L 4OB5H 5CEZD 1YYLL 3DVNB 4HXBL 2CRYA 1I7ZB 5JHDA 3ULUL 5CEZE 3WLWD 1FP5A 2CJUL 1P2CA 4DZBA 4K2UL 4PPTA 4WFFD 3T77B 3MRPA 43CAB 3WNPA 5MEPB 4BQ9A 1A7BA 3IU4L 1MFAH 1T1WA 2LTQC 3DBXA 1OCWL 5JPNA 4X6CB 1NDMB 4EI5B 4L4VB 3U7AA 3R06A 3CMOH 5J11C 2VDRL 1KLUB 4JHWH 3FT2B 4UQ3A 1VACB 2DQHH 3RWDB 4YFLI 4EZMA 2ZUQC 1DBBH 5C0JB 2J4WL 4PRPA 5B22A 1Q0YL 4MZ2A 1S7RB 2ICEA 2A6IA 3CFBA 5LBSH 4NC1E 1RIVL 1PEZA 5T1DH 1Q8MA 3SE9H 4Q9CA 4XTRD 1FNSH 1A6VH 5F6HJ 3ZTJG 3HKFA 4E5XB 1DUZA 1A3LH 1SEBB 3H3BC 2GIYA 2J5LB 3FMGL 1JGEA 1KB5H 1WBYB 1GSMA 3ZSTA 1E4KC 5SWZA 1MRDL 5ENWB 3ARVA 4ODUA 1BD2E 1YEFL 4F33B 1AHWB 3RX5A 5E0QA 5D7JD 4I48B 5HJ3B 5DRNB 2AI0H 1Z3GH 1WBXA 1AGDA 2EXWC 1MCOH 2FL5B 3FFCB 2RBLA 3O81A 4P49A 4M7LT 1CVSC 3GSUB 1X9QA 4Y2DA 4YDIH 3LKSA 3AREA 1PYWA 2O5YH 4Q2ZB 3SDYH 3WFDH 4PJGA 2IALB 1NGXA 1HCFX 2E7LA 3HG1A 2HWZL 4JM4L 1YY8B 2FJFA 3WJJC 4A6YL 3E1F1 4QXUH 5AD0B 5KOMC 2FO1A 3Q6GH 3WS3A 5ICZA 5EZLA 4JY5L 2CKBH 3IFOB 3CAFA 4U1HA 1FGNL 1TETH 4CVXB 2BVUA 5CP7B 4EDWH 4OZHE 3INUL 3O6FC 5JZ7D 2XNAA 1JNHA 1PW3A 1II4E 1PD6A 3CUPB 4XPHL 1T6VN 3K4AA 3MNWA 1GH7A 5FM5M 5T3XH 5HVGB 4PGEA 5F6IB 5FEBA 1R3IL 5IW6B 4G7VL 4F7EB 1T0MA 3C8KB 2JK5A 2Y72A 1B0GA 1TZGL 5FF6A 1T21A 4LCCA 1BBDH 3WL9B 4M61B 4MMXC 3AB0B 1TITA 1KCGC 1YUHB 4L5FL 3STZA 4OIIL 1S8DB 4KJQC 5E5MB 1QFUH 2J88L 1N5YH 5HHNA 2DWEA 3D39A 4F7CA 1J1PH 4HC1L 1XH3A 2H2PD 3WHXA 4MD4A 4UV7L 1RFDH 4RFOH 1EJOH 1JGLL 5ID1A 1M4KA 1GPOH 4RZCA 5IHLB 1TQBB 3D2UB 5CBEA 5E7BA 1S7WB 2IANA 1WTLA 3HZYA 4KRPC 5EWIL 3ULUD 2G9HA 2CD0A 1EVUA 1PDKA 3ULUE 3L5HA 3VFSB 4ETQB 3AC0A 3S34L 3ZL4H 3QIBD 3PHSA 3V4VL 3OTTA 2R9HC 4Q9RH 1KNOB 2DBLH 3OKYA 3VWKA 1H15B 1IGTB 3IJHA 3V8CA 4M7ZC 1IAIH 3SCMC 3ARUA 4LU5H 3OKNB 5TJWK 1JPTH 5HDQH 5F9JA 3WIIL 3MBEC 3LN9A 2XY2A 5DQJA 4XC3L 5E2VL 4XNXH 4HG4J 5B4MC 1QRNA 6CGTA 5EBLA 3RIAF 3P0VH 4HJ0C 4PR5A 1MCWW 2G5BB 4QHKJ 2YK1H 5JXEC 2GTWA 4LLYA 4C56E 3IF1B 4PV8B 3EOTH 1R3KB 3HZVB 3SKOB 4PJ9C 1K6QL 3MQIA 3MROB 4TUKH 3NFNB 2M8XA 1CDIA 5GIRA 4BH8B 3GZKA 4X4ZA 2JJSA 3QBTB 5EORL 1RZ7H 1FVDB 5I1JH 2AXJA 3MJ8B 4GW4A 4OZHB 5CLTA 4ZSOA 3V7AG 3L3OA 3IXAB 5DD5L 5GGRB 4WI4A 3BQUA 4Y7MA 3FQWA 3QQ9C 3X14B 4G80B 4KVNL 5IF0B 3WO3B 1ZVHA 1ZHKB 5AWNL 1YNTB 5DJ0A 2UWEA 2R15A 2EXWD 3IXTB 4LGPB 4D9RD 4XMPL 1X6NA 5GS0H 4RNRB 4J3SA 4X9BA 4D9RE 1BF8A 3H42L 1NCBL 3VFRB 3QT2A 5ECJE 3PIQA 2PXYA 2LV4A 4Q6IC 5J3HC 1BJ1H 2A83B 5I9QC 4YK4B 1ULVA 4OD3H 2WQRA 5TE4H 4ZAKC 5E2JA 4LNRA 4JFYA 2V2TA 1TNMA 1H5BA 1NAML 4IHOA 3HMWH 4PTUA 3SJVD 3NFPB 4U1KA 5FB8B 5HI3C 1DJSA 3BZ4B 3FAWA 3U36A 1XF2A 3KDMB 3SJVE 4S1RL 2R1XA 4G6KL 4NYLB 4M7JL 2VE6B 3IGAA 5FCUL 1AR2A 1RUAL 2A38A 2ZP0T 3NCYS 1UKQA 3ECBA 3V6BR 1KIRA 3PQYD 4ELME 3HC3H 1JYWA 1XGQA 1S3KL 1VFBA 3PQYE 4H88H 4QHMA 3O6FD 4EBQL 5J7CC 5IMKA 3CZFB 3DRQB 2NW2A 1LK3L 3U4BH 3MZTA 4V1DD 4TPRL 1RIUH 3HC4H 4DZ8A 2BNUA 5MI0C 1KCKA 4LPWA 4DK3A 4F9PC 1GOGA 4KJQD 1KUMA 1TTGA 1BPVA 5FOBA 3EYFA 2PO6C 1C1EH 3BZFA 3A6BL 1CD0A 4CW1A 1WZMA 2GITA 4TUJB 3G6DL 5I30H 4LDOB 2LTQB 2GFBB 4KJWD 4PLOB 1BQHB 4QTHA 4MNHA 1QEWB 4G7YH 4WI5A 3B9DA 2DQIH 2R0ZH 1GXEA 3WJLA 4C56B 2Y36H 5EU6A 4CL7A 5ITFB 3VD4A 1JHKL 1FL6A 1FNLA 4R8WL 2EE3A 5D96C 5JIKA 4CBPA 3VGDA 2ZUQB 5JHLH 4KRPD 3FRUB 1L7TL 3QHFL 2OK0L 5EU5B 3S3PA 5KAQG 2X10A 3O2WL 4HKZA 1CK0H 5FHBH 1ES0A 5CZKA 1XGYH 2MJWA 2DKUA 4ONGL 1U8IB 2AXGA 4Z5RB 4RMVA 4QOKA 5E94B 3VD7A 4W4OA 4XGZA 3HC0B 3SCMD 2F58H 2Y5EA 2YA2A 3G9AB 5LVEA 4XRCB 4KKNA 1G7QB 2A1WL 3BRGC 4WUUE 5DD1L 4Z7QF 3MBED 3AAZA 4IRSC 4A6YB 4P3WA 5DJCA 5GRVL 5K9KA 1TIUA 2OSLB 3C08H 2VLRD 1GHFH 4G6ML 1OPGL 3UPAA 3T4AB 1X5AA 4NO5B 3ZDYF 3MLUL 1G6RB 5JXED 3BJLA 3M17B 3V52H 1JI1A 3MRHB 3O3EA 1D5MB 3KPLA 3P9MB 4KXZI 5IB5A 5IKCB 2MNUA 4EDXA 1JN6A 2YZ1A 1YN7A 2PR4H 3SJVB 4PJ9D 4MJID 3U0WL 1QKZH 5IBLD 2OR9H 1OGAD 3ZKND 4TSCH 3QNYA 4OD2A 4ELMB 3ARQA 3TT1L 1VKXA 3PQYB 1QTYT 4R90L 4FOMA 5I8KH 1N3NA 3DRTB 1B2WH 2BCKB 2QHRH 3L7EB 4XC1L 2Q8AL 4ODXA 1FZMB 5C70A 3QQ9D 4FFYL 2CK0L 1A7NL 3CX2A 1V7NH 5KVDL 3O9WA 3V9FA 4FQIH 1IM3B 1FJ1A 3TT3H 3D9AL 4J6RH 2ZKHH 2XZZA 4MSWA 4V2BA 1KTRL 4XXCA 5HDBF 4NC2B 4A2LA 5J3HD 1FGVH 2MWCA 2ERJB 4MXQC 4ZAKD 2NTFB 3D0LB 3FQUA 1X5ZA 4HK3J 5EFIB 1LGVA 2YOCA 4G59A 5I1CL 3EDDA 1UACH 3QUZA 2P5EA 5CAYB 4H0HB 3HZKB 5IWLC 1K2DB 2Z8SA 4L4TE 1N2RB 4F8TA 3SDDA 4LRIC 1IC5L 1QO3A 1FZKB 2G75A 3M1BA 4Y5XB 3BO8A 4OF8A 2OCFD 1FAKT 2ZSWA 1D6EB 2JTDA 1OF2A 4L3CB 5E56A 1OSPH 3TO4C 3WYRA 4M7ZB 4U05A 3ZYOA 4HJJL 3IDGB 3VFOA 5I15L 3L5WB 4WI3A 4WUUB 3K8MA 4JY6A 3IKCA 5FGBC 2O93L 2VDKH 1M7IB 4Q97A 4MCYA 2VKXA 2PO6D 3MCLH 3P2TA 2FO4B 1FSKB 3BEWA 3L3KA 3QUYC 2Y23A 3W5MA 3PWNB 5DHXB 1BVLA 1T66C 4OF7A 4XZUB 3WBDA 2I60H 2VLRB 4M1GL 4M3KB 1R3JA 5DT1H 4OT1H 2W9LA 4OFPA 4WHYG 5AAWA 1NFIB 3TNNA 3RGVA 3ZKXC 3T65B 5CEYA 3MV7A 3HB3C 2BOBB 5DLML 4PJ9B 4D8PA 2NY6C 2CKNA 1A4JB 4AY0A 3MRCA 2CLRB 1DEEB 4ZUVB 1DLHA 1IC4L 4HQQL 1FFNB 3MRFA 1MWAA 3LKQA 4XBGB 3GMRB 1QSZA 4RX4D 3MOQA 1T20A 4JN2A 1CXIA 1ZEAH 2X7LB 1HDMA 3WEXA 5KANI 3MA9L 5C6TL 1I7UA 2EDRA 3NACL 4NSKA 2QV2A 3K81A 5BZWA 4PD4K 5C92A 1A1OB 4IRSD 2D03H 3T08A 1NAMB 1DR9A 1K9TA 4ODVL 3CVIH 2ICWJ 3LPWA 4PRBA 4GAYB 3SBWC 3BP4A 1CFQB 1A6TB 1XF1A 1KTKE 1UWGH 1ZHBA 1IEAA 1BVKB 5HYSB 2AJZA 5I9QB 5I8OL 3KYKH 4I0PD 3U0PB 3LQZB 4HWZB 1AP2A 4LHJB 2DAVA 4GFTB 4ZAKB 5LWYH 3MFFA 3O4LD 3PDOA 5E8NA 1XGPB 1I1AA 4LLUB 3HPJB 3O4LE 3FO9B 5IJVB 3DJ9A 3C2AH 5CJOH 1BFSA 4X8XA 4YPGA 3LD8C 4XCEB 4L4TB 2IC2A 2DS4A 4PY8I 1UWXH 3QUMA 1KBGH 1KENH 4ODTH 4EIZC 5FO8B 1UQSA 3UPRB 3LRSA 4NM8L 2IG2H 5HHXL 3HE6A 5IP4A 1Y0LB 4HWEL 2LAGB 3DMMC 4PJXF 1HHJA 2NZIA 3OR6B 5FYJL 3L1OH 2R29H 1I85A 4YHZH 2FLRT 1MEXL 4AMKH 4EUPG 3EJYC 3FHAA 5IHZB 3F5WA 1OAUL 4HKJB 4RIRB 5BO1L 3B43A 1U8LA 5CIPB 3DX6B 2YUVA 2EH8L 1VA9A 2E8YA 3Q6FB 1O7SA 4G8FB 5CEXB 1AQKH 4LIQH 2J8UE 5J6HA 4H20L 2PO6B 3A6CL 4MXQD 1AGFB 5FA3B 2XFXB 4UDUA 2YD9A 1CLOH 1NCTA 4R7DB 3QR2A 1U8MB 3LVEA 5TH2B 1RUQH 1PLGL 5EOCL 4NZTH 3SQBA 3FO0L 4N0CA 4M5YH 1BFOA 1NUDA 5SX4I 4OLXH 1AGBB 3JVGA 2Z92A 1JNLH 1KCRH 1DQMH 3B83A 5D96B 4LMQE 3U0TA 3NAAL 4OQ1A 4CU6A 3WNLA 4TOYH 1BM3H 3HUJA 1DBML 3MOBH 4MQ7B 1DQLL 1WT5A 4XAWH 3X17A 1EX0A 3GSVB 1INEL 4YHIA 5C0IA 5C2BL 1L0YA 3TO4D 3VD3A 4K7FB 5EUOA 3VCLA 3KR3H 1F4WH 5TFSL 4AIZA 2YKLL 1PG7W 1QZ1A 3JWOC 3T0BA 5C0EB 2J3SA 4IRSB 3FO1B 1TJGH 2R69L 3NCJH 3I3BA 3QUYD 4NO0D 1SJVA 3TJEH 1WCQA 2VIRA 3CFDA 4H25B 4P0DA 1T66D 3BFOA 1AFVH 4Y2DC 3AREC 3OKOB 4LSPL 5FCSH 5EG6C 4DAGL 4IS6B 3EYQC 4I0PB 3A0OA 1HOCA 1T03L 3JWOL 3T4YA 1Y18A 5F3BA 3O4LB 3CFKB 1MIMH 4KQ3L 4OZ4B 1ZTXL 3HB3D 5F7DA 4UT6H 3WD5H 1MF2H 4U1IB 1CS6A 4ORGA 2NY6D 1KULA 2NXZC 3FQXB 5KSUB 1I3VA 1TNNA 5GSVA 3VG9C 1QSFD 4PG9B 4WNQA 3HPLA 1QSFE 1E0OB 3QWRD 3ZDXE 2HJKB 4F7MB 1A1NB 3CH8A 3VRIB 2BFVH 4FQ2H 2VWEC 3E6HB 1LP9E 1LE5B 1A6UL 4RDQF 4OF6A 5GRJL 5D1QC 3QFJE 2UVEA 4GG6F 1BOGB 4X8JA 4LQFH 5H8DA 1TJIH 1KN4H 1IAKB 3C5ZA 4LCCC 3MRIA 4PUBH 3V0VB 2J8UB 4JKLA 1SYVB 3B5GA 4HW6A 4U1NA 1P5VA 1C5BH 3X11A 1HK6A 4MX7A 5GRXG 5JR1H 1K4DA 3HNTL 4L8DB 2FECL 1NMCB 4F8QA 4ZUTA 3BAEL 2QSTA 5J1AA 5FYJD 3C6LB 1BJ1J 1AO7A 1S9YA 5FYJE 4C54A 1R6VA 1BHGA 3OZ9L 1MQ8A 1T5WB 4TTGA 4ODHH 1KXTB 1ZA6A 1FNAA 5IQ7L 3GIVA 3DMMD 1JPST 5JQ6L 1W0WB 5HY9B 1CGVA 1DBAL 4H1LA 3VWKC 3EJYD 3TO4B 1T7WA 3H9YA 1SJHA 4KHTL 4LDEB 1HYSC 3MGOA 5BS0A 3S4SB 2BRQA 2ZCKH 3G5VA 5JHDD 2HH0H 3BD3A 2H26B 4OCXH 4OZGF 2X4UA 1E4XI 1RZGB 4YJZL 4U1SA 4DN3L 1A47A 3QPXH 1HXMB 3GSNL 4ZFGH 4NO0B 3VRJB 2E6JA 1P4IL 1MLBB 2A0LC 1MUJA 4TNVK 4HCRH 3QJHA 1ZLUH 4KVCL 1P4LA 1HYRC 1QR1A 2A6DB 3GKWH 1CXFA 3EYUL 5ERWA 2H1PL 2YN5A 2EC8A 2BVPA 1Q9OB 1DUYA 4OCYH 3SGDI 5KANG 1QSFB 5IB2B 1K8IB 1F6AB 3L3DB 4FFVC 4AENA 2HKFL 5DYOA 2A9MH 2ZCHL 4FQPA 2X4QB 1LP9B 3BEVB 1A7RH 2N7BA 3AY4A 5IBUB 1IAOB 4LSDA 3EYSL 4M4PA 5B39G 2AJSL 3BQUC 3QFJB 5SWZD 5FGSA 1RVFL 4X6CF 1VHPA 2AK4D 3WIHA 4UBDC 3OPZH 2AK4E 3MYJB 5CZVL 1PKOA 5JPMA 2UZIL 3RY6A 4M7KL 4MB3A 5TDNA 4Y2DD 4OCRL 3ULVH 4JHZA 1OAKH 4F15C 1EEZA 2PXYC 2Z0BA 3ARED 1QFPA 1NC4A 3ABZA 1BFTA 3HG1D 3MLZL 4R2GC 1FPTH 2XA8H 4R7NA 3RZCA 2QADD 2EYTA 3VXUE 5JW5A 1H5BC 2FIKB 1P7KB 5DVOA 4XNYL 5A2IH 5F7WC 2NXZD 3WKNA 5DRZB 2E7BA 4URTB 2H32A 4MA3B 4FRWA 4OGAC 5IVOA 5EIIA 2XZQL 3FTGB 4S1SL 2BSTA 4NN6C 2V9QA 3MLVH 4ZD3L 5C8JB 4JR9H 3RWFB 4QRSA 1TMCB 1FNEA 5JOFA 2IBZY 3HI6L 1S7TB 3WXWL 5H35A 1ONQB 1T7ZA 2KQNA 4LFHD 5DXWA 1A9BB 3DMMB 1WAAF 3X3GH 1R24B 1HHIB 1HSAB 2YUWA 1UCBH 1B0RA 2XYCA 5D1QD 1REIA 4U1LB 5CMAA 1NMAL 1QFWH 1B6DA 4UDTA 2P24B 3EFFB 2H45A 1RZ8B 4JAMB 3OAUH 4KV5F 1A0QL 4CN1A 4G9FD 3ZT7A 1P2CB 5BVJA 3D39D 2OL3A 4UT7H 5HYIA 4G9FE 4MAYC 3SEPA 1D5ZA 2LFGA 3NPSC 5L8LB 2GEEA 2R56L 1T1WB 3DBXB 3CDFA 2OM5A 2UYLA 3UYOD 4G9DB 3I9GL 1A64A 3N9GH 1ZSDA 3QO1A 1FNFA 4RQQA 1W8NA 4MAUL 4F7PB 1SYSB 4UQ3B 4XHJD 4XCYB 1I1FA 5L2KA 4X6BB 3KYMB 4K8RH 2IBZX 2F74A 7FABH 4JN1L 1IARB 4CKVX 1RULH 1BQSA 1FO0H 3DVGB 5IMLA 3V6ZB 3VWKD 1DUZB 4HDIA 4FP8L 3TCLA 1QACA 3V0WL 1BLNA 1S5HB 4W4OC 4OLVL 1D5BA 3LSOB 4CDGC 5FIEA 1JWMA 2AK4B 1MI5A 4XP6H 1PJ9A 2YUZA 2AQ2A 2LU4A 4ZOCA 2R1WA 5ICXB 3ZHDA 1QRND 1I3GH 1XF5A 3GSXA 1X4ZA 2A0LD 3ES6A 4Y2DB 3PWVB 5C07A 1VGKB 3AREB 4P2QA 1R5IA 1EEQA 2UVFA 5MEOB 1ZT7A 3T1FB 1MCJA 4M6MH 2FZ3A 2BRRH 3KYNA 4Z7WA 2XXMB 1XIWA 5F1SA 2C3VA 3I6GB 2QADB 5CGTA 2FATL 1EMTH 3EO9L 3GRWA 1MCHA 2CK2A 2V2XB 1NGPL 5I74C 1XZ0A 4G6JL 4ZPVA 3VG9B 1OTSC 2PYED 4H8WH 4ACPA 4FFVD 2PYEE 1Q1JL 3JBG7 4U1HB 3D3VA 1HHKA 1RMFL 3BD4A 5JDSA 4JJHA 1QFHA 1G7JA 4LVOC 3CVHH 3EO0B 3BPNB 2XNAB 3FT4B 5HHVH 5DFWH 5GRWA 1P9MA 2AJYH 1NC2D 4JRYA 4JFHE 5GJSH 5D1QB 3O3UN 4PGEB 5T1MB 3PABA 1KG0B 1QBAA 3VGBA 3VXME 2X4RB 3RDTB 3O6KH 1G9MH 2AAVA 1B0GB 5DJ8B 2Y06H 1JFQL 4IMLB 4N90D 2PXYD 4Y5VA 1PGRB 1YMME 4XXCC 4N90E 3NCBB 4G9FB 3TYGL 4K23H 5KJRH 4NJAL 1PG7H 2IADB 4KGJA 4UUJB 2ENSA 1MSPA 4JO1H 1ORSA 3EZ8A 3DO7A 3SPVA 4OZHF 1NJ9B 1CFSA 3WN5A 4LKXA 4OGAD 1LDPL 3UBXI 1CL7I 4BELD 4NUGH 3OL2A 1FE8L 3RHWK 4LAQL 4TULL 3SDDC 2XRAL 4C57C 4Z7VE 2R39A 3UJIL 4KZEH 1LEGA 5JMRA 1P53A 2XA3A 3TBVA 2I9TB 2DD8H 3ILQC 2Q7NA 1Q72L 3GSNB