3FT2A

Crystal structure of a citrulline peptide variant of the minor histocompatibility peptide ha-1 in complex with hla-a2
Total Genus 83
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
83
sequence length
275
structure length
275
Chain Sequence
b'GSHSMRYFFTSVSRPGRGEPRFIAVGYVDDTQFVRFDSDAASQRMEPRAPWIEQEGPEYWDGETRKVKAHSQTHRVDLGTLRGYYNQSEAGSHTVQRMYGCDVGSDWRFLRGYHQYAYDGKDYIALKEDLRSWTAADMAAQTTKHKWEAAHVAEQLRAYLEGTCVEWLRRYLENGKETLQRTDAPKTHMTHHAVSDHEATLRCWALSFYPAEITLTWQRDGEDQTQDTELVETRPAGDGTFQKWVAVVVPSGQEQRYTCHVQHEGLPKPLTLRWE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HLA class I histocompatibility antigen, A-2 alpha chain
publication title Steric hindrance and fast dissociation explain the lack of immunogenicity of the minor histocompatibility HA-1Arg Null allele.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
total genus 83
structure length 275
sequence length 275
ec nomenclature
pdb deposition date 2009-01-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00129 MHC_I Class I Histocompatibility antigen, domains alpha 1 and 2
A PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3ft2A02
3.30.500.10 Alpha Beta 2-Layer Sandwich Murine Class I Major Histocompatibility Complex, H2-DB; Chain A, domain 1 MHC class I-like antigen recognition-like 3ft2A01
3GSWB 1FNEB 2GYSA 5FKPB 1FL5B 2B0SH 1IGIH 1IAII 2QLVB 2DL9A 2WWKO 2NLJA 4HZAA 4N0UA 1IGFL 3BPLB 4PTUA 3WUZA 5C0IA 4FFZH 2H32B 1YYLH 3DJ9A 1OOAA 3GJFA 1ZGLP 1LP9F 1JN6A 3KPQB 3MO1A 5FM5M 3BPOB 3U2SA 3REVA 3HNVH 3NCYS 3IFNH 5JW4N 1KNOB 3LZFH 3ZDYF 4MD0A 4QRTB 5F9AC 1IFHL 5I76B 1AXSB 2NY3D 2MCG1 1IAIH 3SKJL 3B4NA 4KJPC 2M8XA 3AMKA 3C2SA 2BCKB 4NC1E 4M6OH 3PQYE 4X5WA 2OTUA 1JNLL 2QL1A 1A0QH 5J11C 3ALWA 4ZDHB 3WMSA 1HI6A 3MLVL 1DLFH 4NBZB 5CLWA 5I18H 1U8OB 1CF8L 3D3VE 5JLZA 3BD4A 1DVFD 4Q7DA 3HAEH 3ET9F 3W81A 2YZ8A 5KG9B 1G0YR 4HUXB 1PZUB 3LOWA 5I9QB 5LCVL 5MEND 5IVXE 2YBRB 3LKPB 1NQBA 1S78C 5IESL 5L2JB 4AMKH 3O2DH 4PB9H 3U1SL 1U0QA 3VXOA 1JFQL 2C3XA 4XMLH 3UMTA 4PP2A 4MA8L 3SCMC 4HC1A 4HQQH 3L3IB 3SCMA 1P5UA 4GG8B 4CMMB 5DQJB 4OZ4A 2Y06H 4W6WB 5IB5B 2YD1A 1AXTL 3CFBA 4PDCE 3WUWA 3CJJA 5L2KD 1EA9C 1MCWW 4F9PC 1RZKC 2DMKA 1IKFH 3JTTA 1XH3B 5DMKB 1VEOA 4N8VA 2X4QB 1Z5LB 4X6FA 5IKCA 1ZHBB 2X1QA 3UJJH 2ADJA 2NY1D 2ZUUA 1NCWH 4PJBF 2Q3AA 5TF1H 3I3DA 3F7YB 2NW2A 3S35H 1LP9E 4MCZB 3VG9B 3DYMA 4KHXL 5IHUH 3ZDYE 3X11B 2ZCLL 3V5DB 4XVTL 3SE8H 3WFHA 4MJ5A 4QY8B 4S1RL 4GKNA 3OAZK 2R1XA 4D0DB 4LLMB 3FFCA 1MFBL 5HYIA 1X7QB 3HUJA 2BY1A 2HLAA 1S5IL 4P23B 3CUPA 5CZKA 5KN5B 1CGVA 3MV9B 4YBLB 3BPNB 2P5WA 4XPBH 5IM7A 3SDCD 1EPFA 5E5RB 3CLEH 1VACA 2DBJA 5C08A 3G6DH 1OAKL 4MNGE 4O51B 3PXJA 4L4JA 3VE0A 4ZPTA 3W0WB 5CGMA 4PJ7F 1MPAH 3OKNB 2J5LC 2ZOKB 4LGSB 1RU9L 12E8L 3DO3A 5I6XC 4G9FE 3CDCA 4ZFOL 2DAVA 2YEZA 2X9YA 2DWDA 1JTPA 1RZJC 5I66B 5JOEA 5CUSL 5KTEH 1T6WA 1AFVL 1RUML 1WIOA 4OFKA 2DF3A 1QFWL 2F53A 5CZVL 3KYOB 3MCLH 3MUZ1 4UOW1 4Q9QH 4QF1B 3GUTA 4YBQD 4O2EB 3JVGC 3RTQA 1HHKB 1XCTA 2VLLA 4I5BA 3JVGA 2V9TA 4I18C 3UZQA 1TITA 3L3HA 1A6ZB 1YEKH 4I18A 5IHLB 3G5XA 5L8JB 1DDHB 4JFQA 3T0ED 2JJTC 4DVBA 1AQKL 4MQSB 1FFRA 1P4BH 4M5YH 3O4LE 1IGMH 1F4XL 4GKSA 4OUOA 3TM6A 4WI2A 2ZUWA 4PJBE 3TNMB 3MXVL 4JPIB 2BSSB 3BAEL 1FYTB 3VRIB 3CVIL 4OV5A 1XCQA 1FZKA 1A1MA 1MREL 1RJLB 1SJEB 2AVGA 3WFCL 1OAZL 4M43L 1I7TA 1UB6A 5EIIB 3MLRH 4ONOA 4MB5A 4HKBA 1NBYB 1F58L 2ARJQ 1E0OB 1EFXB 3CD4A 4P57B 4PRID 1FZMB 4HSQA 1F8TL 3ZT6A 3F12A 4JY5H 1GC1C 4WTZA 3WDJA 4HV8B 4QTIL 2Z8WC 4JY4A 3KGRA 1QSZA 3MGAA 4E42A 3H9HB 1IE5A 2GAZA 4G3YL 1MCKA 2MHAB 1G9MC 3O11B 4UTBL 4ZQKA 2FYYB 1HEZB 3DGGB 1EJOH 1S7QB 4PJ7E 1AHWC 5J3HC 4P2OB 5J4MA 2JJUA 2NX5A 1AHWA 4K8RC 1CICB 4LHUB 4Y0GA 5J13B 2IFFH 2OL3L 5GRWA 15C8L 3WJLC 5KSUB 3UC0L 3KPOB 3WJLA 1KLGB 2ORBH 3VD7A 5IWLC 2W91A 1YMME 4K9EH 3LRSB 3TBSA 4F2MA 2ATPA 4Y5VC 1R5IB 2XN9D 4Y5VA 3SDAC 4FQ1L 2VXUH 3EKCA 1BECA 3SDAA 3HZYB 4A2MA 4TNVK 3G5YB 4MVBC 3STZA 1XAUA 1A6AA 4LFHG 4QTHA 4MVBA 3BE1H 2DQGL 4CRPA 2BDNH 3SE3A 1FNFA 4JFPB 4PJ5D 4KJWD 5EBLA 1ED3A 1NC2D 1YNKL 3UZEA 2Q3ZA 4PRPE 2FX7H 3O2VH 2B5IB 2P47B 4GW1B 2EH7L 2YS4A 5D7IF 4KI5D 1W0VA 3WNOA 2GSGA 4OF5A 1VADB 1G7JB 4HKZA 5DUML 3CDGB 3CU7A 3O0RH 3HLAA 4G59A 1GHFL 5C0CB 3N9GL 1SEBA 5FF6A 32C2A 5EU6A 5FUOH 5ESAA 1OARH 2XI9A 3V6ZB 5JHLL 3KXFB 3V52H 3VXQA 3NCCB 3SOBL 1KPVB 2I25N 2VABB 1E4KA 4NCC2 5C0BE 2X9WA 3S98A 3KYMA 1S5HA 2XA8L 1A8JH 3V0WL 1KIPB 2KPNA 5MEOA 5FA4A 3EYSL 3EFDH 4NKOB 1CLOH 1JNNH 3FZUD 1BQHG 1UEMA 3U30C 5E8EB 4C83B 3SJVE 1A02N 3P0YL 4JN1H 3IKCB 2AP2A 2Q7YB 4Z78A 3BWAB 1OTTC 1NFDB 3ZHDA 4JM2B 1ORSB 3PQYD 2EYSB 1U8MB 2YSSB 1DEEB 1DE4B 2DQJL 3VFPB 3QIUD 3QQ9C 1J5OH 1QQDB 3X17A 2AEQL 1BPVA 1KB5A 1G9EA 3CFEB 3TFKD 2P8MA 3D3VD 5I1KH 4JAMB 1IM9D 4LCYB 4AT6B 5BXFB 2BRQA 2OZ4A 1FL6A 2JE8A 4O02H 1Q0XL 2IBBA 3VDAA 3RX7A 3PDOA 4XWOD 4R26L 5D93B 1T04B 3AXLA 3VFSA 2WUBH 2R8SH 2P8LB 3WFEL 3EO0B 3K2UL 5D7JC 3NMEA 3RHWF 1MAML 3F7RA 3KJ6L 5D7JA 2EDJA 3C6LB 5K9OA 2PW1B 4L5FL 2JELH 3TPUA 1PSKL 2Q7NA 3TZVD 3ARFB 4GQPH 2NXYB 3RWIB 3EYUH 4HWZB 4BH8A 1RZGA 1AJ7H 4J6RL 4LARH 4ZFZA 5DJAB 3HR5A 3UPCA 4AQ1B 1UEYA 2YRLA 5D7IE 2AK1H 4NOFA 1FO0A 2ATKA 4NZRH 2PF6A 1NJ9A 3PWUB 3WO4C 3CFDA 5JXAH 5C09E 4QHMA 1AQDA 4Y4HB 5EWIH 4QHKI 3IDYC 1VFUA 3OB8A 5CP7B 5FO9B 5JXEA 4EI6B 3GMQA 4V3EB 1I8KA 1SYVB 5F3HB 5M95B 5DJ8B 5EC2A 1DEDA 2VXVH 3BUTA 35C8H 3CFIC 4JO3L 5C7XL 5HI5C 3SGEH 3BP6B 1RPQA 3KYNA 3ZKMC 3DO7A 2OTWB 1BZQK 3IVKA 2PXYB 4WEBH 5E8DL 4KRLB 1U3ZA 1J12A 2XWBA 1A4JA 3S96B 1JGEB 5HBBA 1C5DB 3GI9H 3MBXH 2GTWA 1RK1A 1IEBB 4HS6A 1H8OA 4R96A 3GHEL 4CADB 4OM1L 4LMQE 1BM3L 4P99A 4XP4L 5GJTH 1T5WA 2OR9L 3L1OH 2IQ9H 3GBMH 4KRPD 3TYFA 4AQOA 5CJ8A 3HPLB 1KN4H 1NCCH 3O8XD 4L4TB 1S7WA 1FGVL 4JQXC 4HEME 5BZDA 2FO4B 4JQXA 1WAAA 3MRFA 2EYTB 3S5LG 2F74B 2I07B 2XZAH 5ICXA 4G9FD 4XP5L 4M1DL 3STLA 3BZFA 3V4VH 3F8UB 1JBJA 2C4FT 3B83A 4LLWB 4I2XB 4AENA 3BKCH 2WBKA 3HFML 2NY0D 3TBYA 3NZ8A 1YNTA 3OPZH 3ARSA 1RUKL 4G8FA 5ACLA 4F15C 5ICZB 1FNGB 5E7FA 3B3IB 5DWUL 3MREA 1QO3A 5IMMB 3MV9E 3VWKC 4U1KA 1Y0LA 1MVFA 1RIVH 5C07B 3VWKA 4ZSOA 2AJVH 1AXIB 2GUOB 2OMBA 2MQ3A 1X5KA 5JUEH 3EYFB 1IFHH 1JVKA 4O2FB 4NFCA 3O4LD 4NC2B 4B0MM 3W0WE 3K8KA 3FQRA 1FORL 1YEDB 4P4KA 5HPMA 3ETBF 1I3GL 3ARWA 3PHQB 4JFXA 1CE1H 1UFUA 3ZTJG 3IAGC 1RSFA 3IXAA 5GRVK 4Y4FD 4G8GB 4KKAC 3WL9A 3VGAB 25C8L 3MXWL 4OGXL 3NTCL 3QDMA 3MCKA 4MZ2A 3IAQA 5IB1B 5FM5O 5KVGH 4QXWA 1DUZA 4NT6B 2AXJA 3MFGB 3MJ9H 2ITCA 1A1OB 3C5ZD 2E7MA 2N4IA 3S4SB 2H8PA 2XPGB 4OD3H 1KJVA 1TQCB 4Q9CA 3U1SH 3K4ZA 4QRRA 2WUCH 3OJVC 5J1AB 3U9PH 4EN3B 3DRTA 1I9IL 4LASL 3WLBB 2CO6B 3L7FA 1RZFH 3SE4A 3QAZC 1FYTE 2VZSA 4HUVB 1MJJA 1DANU 1AXTH 4LEXH 4IDJH 4MXQC 4J3VA 4MXQA 1Y18A 2YPLA 3BKMH 1VENA 1UT9A 3F6IA 3NABH 1MCFA 5JZ7D 1YMMD 1CXFA 3GKZA 1ZT1B 3MV7E 2Y1VA 4O9HL 3S36H 4PJHA 5INDA 4LLUB 1RHHA 3MC0A 1K5NA 2F9BT 3EBAA 4EVNB 5J0BA 5B4MC 1VCAA 4X83A 3KLAA 3WIIL 3T2OA 4UQ2B 4YR6A 3O9WC 4FMFA 4WHTA 1X9QA 3O9WA 5TGBA 1U8JA 2CO7B 3WIFB 5DC4B 1T0MB 2DQUL 2LV4A 1PBYA 1V3MA 3H42L 4NQCA 3QNYA 4Z7UA 4HIJA 1NFDF 1SM3H 4JM2F 4HMCA 3P9LB 1MJ8H 4LDEB 4WFGE 4ODSH 5EC1B 4ZS7H 1UWXH 1IM3B 4FFYL 4PRPD 5H94A 5B8CA 5GGVL 4L8CB 1FJ1B 1LQVA 3HA0A 3EZ8A 3BOVA 1ZEAH 4JDTH 4OLWL 2IQAB 5FUZL 3LH2L 2FSEA 4JKPL 3U0TA 3B9KB 1GGCH 4ZOBA 3MOQA 5F6IB 1OAKH 2XOTA 2X44D 4APQB 1M6OB 4LRIA 4MJ6B 1YECL 4UDTB 4M4RA 1BQHA 3QXAB 5C0BD 4FZEH 3D39A 1G7PA 12E8H 1N7ML 1P69B 3TESA 2DLGA 3L3DA 4FXGA 4OB5H 1ZGLB 3OJDB 1CLYL 1J10A 2OK0H 4YIQA 5BJTA 5ESQB 1EX0A 3SJVD 4Q2ZB 5EBMB 1YEGH 2H45A 4XMKL 3PP4L 4QWWD 4PGCB 1ZTXH 3CH1A 4KQ3L 2FGWL 1HWHB 3BGFB 5I17B 1RIHL 3CH8A 4WI7A 1YNLL 3EFFA 5F72S 5C0CE 1CE6B 1MOEA 3VFNB 4WW2B 4N0YH 4U1GB 3KXFE 2VL5A 5E5MA 1HQRA 1N5AA 4P9HL 1RURL 3TPKA 4QCIA 3IDXH 4DUXA 1G7LA 2IPUK 4WI9A 5AG8A 2J8UB 3HS0A 2YMXH 3LDBC 1BBJB 3KPLA 3GBNL 3CLFL 1UH4A 5DZOA 1A7OL 4N8CH 4XAWH 1ZS8A 1NFDE 1HSBB 6CGTA 2EXWD 3HE6C 4JFDA 3DUSA 4JEGB 3VXSB 1OAUL 2VUYA 1LK3L 5HYSB 5FGSA 3HE6A 2J6EA 1QBMH 3NOIA 2VDQL 2X1XR 1RY7B 3X13B 3C6SB 5IR1A 4F7CB 4ETYA 1U8LA 2BXZA 1T1YB 1EZVY 1X5FA 3TA3B 1U8IA 1IAKB 1EEZB 5C09D 4KRNA 4G5ZL 4MS8D 4DGVL 4G3YH 4TQEL 3SO5A 3KWWB 3KNBB 4WY7L 3HI5L 5TDOA 5FKAB 1CXKA 4U1JB 1A14L 3QEUB 4L3EB 3GFUA 1DTUA 5J9PA 4LLDA 4TUOB 4POZC 3H8NA 1XF3B 5B3NA 3Q5OA 2O5YL 2OL3H 1R3IH 1AKJA 3LRGA 4NUGL 1UQSB 1WF5A 1IGTB 4W4OC 4NN5C 2ZPKH 4XVUD 5CEXB 4L3CA 4JO4L 2MTPA 3L5XL 5KSAA 1QFWM 1R3JA 4P3WA 4ZUUA 4UMGA 3TN0D 1P7KB 1A21A 3F7VA 3O2WL 4JLRB 1T2JA 1OAQH 3RZCC 3IT8D 1BFOB 5DJCB 2QADB 3H9SE 4FQ1H 4HMDA 4OIIH 5DQ9B 5JW3L 2UV3A 3PP3H 1MCNA 1J86A 4UILH 1CFSA 2HTKD 3S5LA 5J6HA 2D4DA 4RMTA 4XP9H 5C0ND 1B0WA 3NGBB 4LSQL 5HHOB 5DUPH 4DFHA 4JN2B 3UJTH 3T1FB 4DZBB 1JWUA 1A6TB 4XZUB 5DJDB 5D1QA 3IGAB 3NACH 4ELKA 4MJIB 3EAKA 3KPTA 2CIIA 1EGJH 1IKNA 1ORQA 4DGYL 1SQ2N 3N9GH 3FCTA 3FT3A 4PUBH 5JDSB 4P23D 3SKOB 3ZKXC 3RIAK 3MV9D 3EOBB 2V7HA 4M7LL 3ARDB 1ND0B 2MPAH 1HK6A 1BWMA 3SGDI 1N0LA 4YFDB 3V0WH 4NHUA 2WIIA 4MB3A 1PG7L 4ZAKD 3MRPB 2DYPB 3UTZA 1NUNB 1YN6A 4IIQC 3DECA 3W0WD 4L4TE 4WJ5A 4LSDA 3P0YH 3LQMA 2PTTB 1HKLH 1MI5B 2HMID 4X80L 1CGSH 1KCSH 5EB9A 5CHNB 2P5EE 1CDJA 1D5ZA 1IARB 4I2XE 4OZFH 3SGDH 4A6YH 3RWDB 2VKXA 5DJYB 3C9NA 5HHMB 4KMTH 1QZ1A 5CJOL 1MLBA 2X6MA 3D69A 3P11L 4Z5RA 2G60H 5ALCL 3GBLA 4NYLB 4V3DB 4ZTOH 1CQKA 2D7OA 2AI0H 5C07E 5IT2L 3BPCB 3K2UH 3KLSA 4KH2A 3JXAA 4ELMF 2AKRB 5EBGA 5F96L 5F1OB 5SWZB 1AGDB 2ICWA 3U0PB 1OM3H 1ZANL 1L9NA 2GITA 4HKXB 2P46B 3X3FH 1T4KB 3OMZA 4R7NA 5DD5L 5GGQL 1FYTD 4G8GE 1MEXH 2F8VA 2OJZL 2BSTA 1QOKA 3PWVB 5I74C 3AM8A 3LAFA 4QOKA 1DCLA 2R2EA 3IJHA 2CLRB 4L9LC 2BRRH 5IEKB 1WICA 4L9LA 5D70L 5L9DL 2NLJB 3QPXL 4K7FA 2ITDB 4PTUB 3MV7D 5C0IB 1LEIA 1WT5C 4C57C 3L6FB 1EFXD 1FRGL 1WT5A 4JFEB 5E2UL 3KYAA 1JN6B 3MO1B 4ZOAA 3GSXB 4B41A 3U2SB 3REVB 3LV3B 4X5LA 4AEIL 3H3KA 4ONGH 5F7UA 4KDVA 2E8ZA 1MFDL 1MQ8A 3GDBA 3K4AA 2M26A 1XGPA 1A5FL 1K8IB 2Q76B 3RL1A 2V5TA 3G08A 2LE9A 2VDLL 3I3BA 4P2OD 4WFGD 1CICD 4LHUD 1V7NL 3BH9A 3Q48A 4HCRA 5I15H 4Y2DC 2NPLX 1YJDH 3EDEA 2HG5A 3GHEH 5JLZB 3MRDA 4WW2F 1BM3H 4D94A 5ERWA 5ALBH 4QNPE 4HBQA 1JPGA 4WHDA 2FL5A 1N6VA 3I6GA 1FGVH 5HI3C 2VXSL 2NR6D 4RGMB 1ZK9A 3FOMB 1N0XL 2J8UF 1NUDA 2NYYC 3VXOB 3EJZD 5KVFH 1WV7T 4PP2B 1U8KB 4ELME 2C5DC 4G43A 2W92A 4HUKB 4G6KH 1TPXB 3HFMH 3LKSA 1S3KH 1VPOL 1BJ8A 3U9UA 3QO0A 2DL2A 1DBBL 3PE9A 3JWOC 4UTAL 4QRQA 2OI9B 4CJ1A 4LCUA 3MV11 4TNVF 4YHPA 3CFBB 5JHDA 3FB7A 1UXWA 3QI9C 3TNNA 3WUWB 3T0XA 2AQ2A 5F7EL 3NFSL 2WINA 3QI9A 2VIRA 3JTTB 4ODTH 4UNVA 5C0CD 2QQKL 1MVUB 4X6FB 5IKCB 3KXFD 1T7VA 2ADJB 2J1KA 1T21B 1DBMH 5L7XH 3OXRA 2NW2B 4M1GH 4MAYC 1C08B 3V7AG 1HINL 2FECI 4LHJB 4KK5D 4MAYA 4LLVA 4OQTL 8FABA 3WFHB 3NTCH 5CINL 3T4YA 1A7NL 1EO5A 1G6RA 1PYWB 5B21A 2ZUYA 1JRHI 4ESKA 3FFCB 5HGHA 3HUJB 5FYKE 5C0RL 3H6JA 4YHNA 5DJ0A 1U8NB 3RGVC 3MJ7A 2WLZA 3RGVA 4RBPH 2N1KA 5F44A 3M17A 2ZP0T 3U46A 4NZDA 1U95A 2C1PA 3PABA 1A7QL 1VACB 5EH1A 5C08B 5ILTL 3ESUF 1SJXA 4NC0B 1FAIH 3OGCA 3GSOA 3FONA 1I7UB 4ZPTB 1HNFA 2GSIA 1CFVH 3VXTA 1X5ZA 1Q1JL 3QH3B 4MNHB 5TF0A 2J8UE 1MHHA 1S7VB 2HT4C 2YEZB 3C6LD 1CDBA 2DWDB 3CSYA 1J18A 3ARFD 2YA1A 2NXYD 1HZHL 2W59A 1R0AL 2F53B 3SKMA 4D3CL 2WBJC 2V5YA 1HE7A 2E6QA 2C7UA 3GEWB 3GUTB 2WBJA 5BQ7A 3VXSE 3RTQB 2VLLB 3HZVA 4I5BB 4JG1L 4NRXA 1U8HA 4X6DA 2NY6C 4AEHL 3G5XB 4XCEA 4PJ8C 4JFQB 1ZLVK 5EU7E 3G6JA 4GKZA 3H9SD 4Y4HD 4DVBB 4OCRL 2ADFL 3SHSA 3D2UA 3RKDD 1FFNA 4KK8C 5ITFA 4GKSB 5EZOH 3H7LA 3OKOB 4L3EE 5GISH 4TSBL 5DTFA 4Z8FL 4OV5B 1XCQB 1FZKB 1A1MB 1LVEA 2NY7H 5FCSH 1R24B 4PRAA 4R8WL 4FZ8L 2PXYD 1MCHA 2FO1A 2KBGA 4S0TD 1LDSA 1LE9A 3WNPA 1I7TB 4YPGB 1UB6B 5HYJA 1NLBH 4HWNA 1NCDL 3MLZL 1OCWH 5ELIA 1XF5A 1JMXA 3ARXA 3CC5B 5I1JH 1UCBH 3K8LA 2DQEL 4E42B 2GAZB 4LSRL 2IPTH 1CLYH 5GHWL 3RNQB 4ZQKB 4L4TD 2DQFA 5CS7A 3RWCA 5A2LH 5SX4I 5CEZE 5T5NF 2EECA 4FQ2L 3MMEA 2NX5B 2G2RA 4J3OC 2DD8H 5GGRY 2Q8BH 4ERSH 4OT1H 3O6LL 2FGZA 2P5ED 4PRBB 2XWTA 4MJIE 4XX1G 2W38A 2HN7A 4RAHA 3S7GA 5DUBA 3B6SB 1S7RA 3FB6A 4ODXB 3KPSE 5FECA 4K94L 4KTEH 5CSZA 4P4RA 4F2MB 2ATPB 4LPVA 5C07D 2CDEB 4M8VA 4KFZC 4DCQA 3NN8A 3T65A 3S97C 2YOCA 5D2LA 3TT3H 3MLUL 4LCWD 4ZS6C 3ES6B 2ZNWA 2ZUVA 5IMKA 3HB3C 3ZE0F 5HYEA 2LAAA 2D9QB 3QHZH 4I8DA 4YDLC 1FCCA 1NCUA 1KXVC 1MI5E 1QFPA 2VQ1B 3RVTD 1QA9B 4LVNB 4G8GD 3OKDA 5CEZL 1W0VB 2Z91A 3CXHK 5HHQA 1JHKL 2GSGB 4HT1H 2P8PA 1TJGL 4HKZB 4ODWB 4ZG1A 1DLHA 3BGMB 3QDJA 4EOWL 1IAMA 5FF6B 5LGKA 32C2B 4KU1A 5HHME 4GG6A 3BN9D 4PLKD 1BAFL 3ABZA 5F7KC 3QXWA 4OBRA 2AV7A 1R3KA 1A14H 2PCPA 4YXLL 1BHGA 1Z3GH 3KYMB 2R1WA 3N1FC 5FM4A 4ZXBB 1PKQA 5FA4B 1I4FA 1T6VN 3PWJA 4DKDC 5E8NB 2FZ3A 4JM4H 2Y07L 4HFUH 3S37X 4EN3D 1JGLH 2CKBB 4Z78B 2ZSVA 1MFAH 2AERT 4M02A 1GXEA 1JYNA 3O2WH 5BVPL 2XXMB 4PB0L 1KB5B 5E8OB 4LF3B 2P8MB 1TVHA 3DIFA 4KTDH 4Z7OF 4N0UE 1AI1H 1NC4D 1FL6B 3JV4A 4H8WL 4IDLA 5KZCB 2C3VA 5TE4H 2E7HA 4UT7H 1HH9A 3PDOB 1SVCP 2EE9A 4JFEE 2Z0BA 3P9WB 3OZ9L 3VFSB 3W2DH 1F90L 4J4PA 4R4BA 4HAFA 5JW5B 3ME0A 3LPWA 1UM4L 4WU7A 1WUNT 4XPGL 5K9OB 4L29B 3NIDF 4BH7A 3TPUB 3LY6A 5D6DC 1SY6H 2VDNL 4HHAA 3C8DA 5D6DA 3ZE0E 1XR9A 3HUJF 4FRWA 2JJSA 4BH8B 5JTWA 1RZGB 3C8HA 3QEQB 3P9MA 2Y6SC 2VXQH 4ZFZB 2CR6A 4XCCL 1WQVT 2M2DA 4JHBA 1FO0B 4KK6C 3TJHD 3JV5A 4XNYH 3CFDB 1PQZB 2D9CA 2VB5A 3B9KD 4QHMB 4KK9C 3HMXL 4PS4H 2OJEA 1E27A 3BZDA 5AYUH 4G6AD 2HRLA 1PG7H 4Z77B 1MJ7L 5GJSL 4APQD 3GMQB 3R0MA 1JPST 3AU1B 5EC2B 1YN7B 2P4AB 4JKKA 4S2SB 4TULL 4OF6A 4HUWA 1X5GA 1U41A 4PGDA 2H9GA 3P4OB 3DO7B 4XPHL 4LOUC 2EICA 3VXRA 3SQOL 4YHKL 4K7PH 3OBAA 4PV8B 4UV4L 2XWBB 4X6BA 5ETUB 3WFDL 4OKDA 1G7HA 5FYKD 3EGSB 2GTWB 1RK1B 2FATL 3LVEA 1GCFA 1G9NH 5CJOH 4ONHB 5ALCH 3ARBA 5F9WC 4HS6B 4D9LL 3G9VA 3KPMA 4R0LC 3VGGA 4P2RA 4R0LA 1NMCB 4R96B 5IT2H 1J7VR 1H3WM 1N5YH 3HZMB 1T5WB 4Z7OE 3TYFB 5I2IB 1E6OL 3CFCL 3TH4T 4HS3A 2ADIA 3MNVB 5GRVL 1ZANH 3TWCH 5IIEA 5BZDB 4MQ7A 1XT5A 4JFFA 3ZHLA 3MRFB 1QHOA 2APBA 3ZL4L 2OJZH 1KULA 1S7XA 3LQAH 4FQIH 3GK8L 3STLB 3BZFB 1CXHA 5IP4A 3NIDE 4AENB 4HKJA 3OB0H 4FTVB 2YPVL 3FFCE 3H3PL 3NZ8B 3HUJE 3QULB 4HC1L 1GGTA 1YNTB 3QPXH 2B4CH 2RR3A 3VXSD 1QLEL 3C09B 1QO3B 1MJUL 4RMQA 3EW3B 5HGAA 2ENYA 4K7PY 4U1KB 1Y0LB 2HKHH 4X0KA 4OFYD 4PLJC 4Y16C 5F88A 3W11D 4I0CC 4OLZH 4Y16A 2HFGL 3CFJA 1C8PA 4OLEA 1RUQL 3SEPA 2AQ3A 4M48H 5C08E 1IJ9A 1QG3A 4LGRB 5HHNA 3GB7B 1D5MA 5E24E 1RZKL 4H88L 3UTSB 4P4KB 5DJ2A 3LEYH 4GBXC 4U1MA 4EKXA 4L3ED 2VDLH 4NKIH 1Q9OB 3VW3H 4PD4J 3WL9B 5DHYA 3HMWL 3QDMB 3NCJH 3UO1L 4X7SL 4FG6D 2F53E 4HJ0D 3OKLA 3FQXB 4D0BA 4KDWA 3FQNB 4LRNL 1DUZB 4NQEA 4OZIA 2IAMC 2IAMA 3LPFA 4OGYL 3GKWL 5EO0A 2VXSH 1J0IA 2H8PB 1DN0B 2BY2A 3WV0A 1N0XH 3VI4F 1KJVB 4W68A 5D7KE 1P9MC 2QADD 3HRPA 2CR3A 1QBAA 1BD2A 3EJYD 4ZFGH 2A2QT 3BEVB 4XXCC 4QRRB 4XXCA 4Q9RL 4WHCA 1CDCA 1I1FA 1FH5H 5CEZD 5IJVA 3DRTB 2R0ZH 5IFAL 1LD9B 3U7WL 4X9BA 2DQDL 1AGEA 1G1CA 1V5JA 4QXUL 3QEHB 1YEHL 1MJJB 3WNLA 1FDLL 2OXHA 4MJID 1H5BC 5DVMA 4ACPA 3HPJA 5LAXB 1NCBH 3SPVA 1LEGB 1H5BA 1YY9C 4OIBA 1JF1A 2V2WA 1QYGL 5CMAA 4NCDA 1BVLA 1I8MB 3KPSD 2Q8AH 1R3LA 4Y5YC 1RHHB 1Q9KA 1VGKB 5ADOH 2EC9T 1K5NB 4TPRL 1L0YA 3DNKA 4YR6B 5TFSL 1HHHA 1IRAY 4WHTB 1RZ7L 4DOHB 4HD9A 2A6IA 3DSNA 1U8JB 1G7MA 4OQTH 1ZV5A 2HRPL 2DYPD 1U6AH 1EMTL 4R4NC 3RIAF 1A7NH 4NQCB 3QNYB 3R1GL 4Z7UB 3WIHL 1OP5H 4F33B 2F15A 4HS8L 5DFVD 5DR5L 2VLRA 1MI5D 2NX5E 4HEPG 5H94B 4PGEB 5B8CB 2YD5A 2R2CA 5DMIH 5C92A 4DUVA 3M1BA 2H6PA 4NZTL 4XCYA 1JUFA 1AD9B 2FSEB 1GIGL 3U0TB 2X1PA 4F58L 1U92B 4L4VA 2XIDA 3CXDH 5HHMD 5IF0B 2OR8A 2FH8A 4YGVA 4N9OB 1OGTA 3BQUD 5D8JH 3V6FB 1G7QB 3NAAH 1WFNA 3G5ZA 2GY7B 4DJMA 3HRZA 3VI4E 3D39B 4HXAL 2NZ9C 1J05B 2BMKA 3QBTB 2AGJL 1ZT7A 3L3DB 4FXGB 5DHXB 1PX4A 1W0WA 1QLRA 2CIKA 4YIQB 5BJTB 4ZOCA 5EZIL 4LSVL 3VMPA 1NFKA 4K3GA 1NFIA 5DSCA 3CH1B 4ZNCD 1FPTL 3QCTH 2ESVA 4PJAB 4XC1L 3TEUA 1U91A 5ID0B 4B50A 4XNUH 5KVMC 3M8OL 3BHBA 5FYKH 2E27L 1EV2E 4JG1H 3B2VL 1AO7A 3EFFB 4TSAL 4I4WB 1E4WL 1J8HA 1XFPA 1KJMA 4OCRH 3CX5K 4HWBH 4KVNL 3DSFL 4NGHL 5IBLC 1N5AB 4JFED 2R4RH 2VZVA 4HXBL 1G7LB 1A4KA 1BQLL 1P6FA 4G6JL 5HYQA 3IJSB 4TSBH 3HS0B 2V9RA 5IB2A 1J1PL 3C60A 1CI5A 4NM8L 2Q6WB 3KPLB 3THMH 4R8WH 3QUXC 4FZ8H 4BSVA 1MCBA 3NCBB 4XCNA 3V5KA 1NCTA 1U3YA 5HGGS 5GXBB 1ZS8B 2EDHA 5FEBA 4G80A 5CD3A 3HE6B 5MEQB 3BMWA 4KVCL 1IC4L 1FG2A 3MLZH 5IR1B 5FYLH 4EUPH 1PW3A 3WN5C 1U8LB 5CAYB 3UCRA 3QPQC 1T89C 3WN5A 1WTLA 4M61A 1D5IL 1T89A 3MLSH 1H3VA 4HIEA 4N5EC 4XWGH 5E0QA 4N5EA 5GS0C 5CD5D 2Q87A 2D0FA 5I1GL 1TJHH 1WAAF 3D48R 4FQ2H 4MDJA 1MCWM 5J9PB 4LLDB 4XPTL 3ZLQC 5GIRA 2UWEA 3BD3A 5KJRL 2PTVA 3TPUE 3SCMD 4D2NA 1QPXA 2DBLH 2RJMA 1INEL 5DLMH 3QEQE 3L95B 5KSAB 1ZGLM 1R3JB 3UAJC 2LQRA 3ALXA 3OHXA 5DD1L 4TUKL 2CKBL 2Z9TA 4X4MA 3FQWA 3WXVL 5CWSA 1TQBC 4H20H 4RRPA 1GZQA 4WRLA 4GLRH 2EDXA 1EH9A 2AV1A 4M7ZB 4PRDB 2FEDD 1FVDA 4OCXH 1KB5L 2R4SL 1CFSB 3MLUH 4GXUN 2OZ4L 4AH2B 5J6HB 2CMRL 3ZYZA 1II4E 3HNSH 5CEZH 5DS8A 5IGXH 1B2WH 3CZJA 1BJMA 5D1QB 1ZOXA 2CIIB 2C1OB 5EOCL 4KJQC 3FFCD 4D8PA 4AG4L 3PWLB 3BEWB 2XKUA 3K1DA 1ZXQA 3CZFA 3K1KC 3N1PC 4WV1C 2EH8L 1MF2H 5GRXG 2VYRE 2I60L 1FO0L 1UA6L 1K3IA 5KANI 5C08D 5JORB 1HHGB 4IJ3B 2WIIB 43C9A 2WZPD 5DK2A 3UTZB 3AREC 4HLZH 4MAUH 4WJ5B 5AZ2L 4QHLA 4YDJA 1H8NA 1I1CA 5DEZA 1WAAE 1A3LL 3V4PL 5DURB 1RZ8B 1UENA 2IALA 4UUJA 1G84A 1R3HA 1Z9MA 5F9DC 2ENSA 4JKMA 4RWYL 4FTVE 4YDVA 2AABH 3ARGC 1RMFL 1DN2A 2F53D 3ILPA 3IFLL 3MJ8B 3C9NB 4H8WH 3T8XA 5EOQL 1MLBB 3D69B 3FFDA 4J8RB 4Z5RB 5KVEL 1G0XA 3RTQD 2BC4A 3L9RA 2VH5L 4K71C 4DTGH 1ITCA 2EYRA 4FQHA 1MIEH 4ZSOE 5D7KD 3E3QA 3FT2A 1UM4H 4XPGH 3MLYH 1UJ3B 2AJYH 3V2AR 2XY2A 4G7YH 2VXTH 4Z7UF 2R29L 5FO8B 2P45B 4PTTA 3RVWD 2GITB 4R7NB 1D6VH 4YXKH 1KEGL 4Z0BL 5FA3A 3TV3H 4QOKB 3QDME 4FABL 3O41A 4HIXL 9CGTA 1AR1C 5MI0C 2BSRB 1NEZG 2W0LA 3MRMB 3QIBC 1LEIB 3QDHA 5I1CH 4RAUA 3GNML 3ULUC 1CCZA 1TTGA 4FNLL 2YUWA 4TULH 3GJFH 4WNQA 3TC9A 4DKEH 3MRHA 3OTTA 3S37L 4QRRE 2QBWA 3VFVB 1KG0A 5GS1C 4TTDC 3S88L 5GS1A 3RL1B 4H0GA 2F54B 1EGJA 5GRUL 3G08B 2X7LB 4PJAF 4XHJC 2NX5D 3NH7H 1W72H 1I3UA 1NCAH 2FATH 5GS3A 1CG9A 1NBVL 1AE6H 4EXPX 4FA8A 5E56A 4G8IA 3MRIA 1AP2B 3BP4A 4GRLC 2HG5B 5E2VL 4PJEA 4QT5B 2YPLE 2A83A 4ODVL 5A2KH 2GCYB 3O6FC 5LQBL 5ERWB 3DVGA 3TBTB 3IRZA 1JPGB 3R8QA 5LWYL 4NQUA 2FL5B 1D9KA 1FVEA 3I6GB 5IV2A 1UB5A 1CFBA 1KJ3H 2HVJA 3GIVA 3ALPA 5T5FL 1OAXL 1CDUA 1NLDL 4XVJL 2O61A 4DOHE 3SDAD 3ZL4H 1ACYH 3ILQC 3HN3A 4NO3A 5EU5A 4V2BA 5KAQF 1F4AA 4MVBD 3HNTL 1DANT 5EO1A 4H5SB 4NQCE 3ROLA 3LKSB 4Z7UE 1IQDA 3S35X 3HKFA 2HKFL 3QO0B 4FQLL 4GW5A 1DFBH 1UH3A 5IBUB 3O3BA 3BN3B 4LAJH 3RU8H 4BQCA 4LDLB 4EXKA 1MFNA 4LCUB 3S34H 1KCLA 1MJUH 2B20A 1A7RL 5DJ6A 1UXWB 2AJXH 3TNNB 1E4JA 3OAUL 2FR4B 1MCOH 2V17L 2VIRB 4P5MB 1V8HA 4H1LH 2K1MA 2XKSA 4X7EC 5I1AA 1S9XB 1ZLUH 1T7XA 1RZKH 1QTYT 3OXRB 5B39G 4UBDC 5IROC 1EUUA 4NJAL 5IROA 4F7TA 3D39E 4P3DA 3CVHA 3GSRA 2G75A 3FRUB 4KXZI 4LLVB 8FABB 1FE8L 4GS7C 3RP1A 3SBWA 1CL7I 5C70A 4YHOL 1EHLH 1G6RB 1XF1A 1PVHA 1H3PH 2PYEB 3SY0A 5HGHB 3PWNA 5LGHL 4OD1L 1OTTD 2F19H 4YHNB 5DJ0B 4PJAE 1OAYL 3MJ7B 3C8KA 43CAB 5ABDE 3RUGA 3RGVB 4NIKB 5D7LA 3QQ9D 3HC4L 1QBLH 1RUAL 3PABB 2C1PB 3OWEA 4KXZH 1CLCA 2UZYB 4RNRB 2MCPH 4Z7NF 3ESVF 3MOBL 5KZCD 3ULVC 5FGCB 5C9JA 1CL7H 1Q94A 3OGCB 3GSOB 4C55A 4ZO7A 3U7AA 3EYQD 4R2GC 5DD3L 4YHLL 1KJ2H 1MHHB 4FXLA 5J7CC 3GRWL 1DUYB 1FBIL 2VDPH 3PGCA 4G8EB 3CSYB 4HGKC 1WCBA 4L1DA 1JGVL 2H2PD 4NN7C 3QEQD 4PJXA 3X12A 1RZJH 1QYGH 5HGDA 2C7UB 4N0CC 3VA2C 3HAEB 4JFDE 1JPTL 4TOYH 4N0CA 4RA0C 1UWEL 3DXAA 3Q2CA 5EOTA 3HZVB 4CVZA 4P5TB 3U6RB 3LKQA 4P9MH 5F6HJ 3I6KA 3VRLF 3G6JB 2V9QA 2ZCHH 3BDYL 4GKZB 3AS1A 4GW4A 4DAGL 5HVFB 1QSEA 4Z7WB 1RZ7H 4JO1H 4MZ3A 4OIAA 3D2UB 2E8YA 1NSNH 5ISZB 5D5MB 5JXED 5ITFB 5BMFH 4NZUH 4OTXL 1EMTH 3MNZB 4RFEB 4TVSa 2EDBA 3V6BR 4Y1AA 3GSVA 5F7NC 2BVEA 5I1EH 5GSRA 3KPPA 1YEJL 3G5VA 2XTLA 1RK0A 5D9SA 2CUIA 1I7RA 4CN6A 1HILA 1T0NB 3QEGH 1EHAA 4DN3L 5F9OH 3DTXA 3L7EA 4NHCL 4NZTH 5E08H 1FVCB 3VD4A 1GIGH 2HTLC 4Y8DC 3GMNA 1KACB 3DX8A 2VZ1A 3H3BC 4PJDA 5DI8A 3ZKQD 5HYJB 1PY9A 4OM0H 4HGMA 4ONFH 5C0AA 4DZ8B 5CCKL 1ZHLA 3TLRA 4FS0A 3BO8B 3L3OA 1IEAB 4KAQH 1HNGA 2J6EL 1NEUA 4UT9H 4DKAA 1JYWA 2H1PL 1JCKA 3GIZH 2BNQA 5IW3A 5T3ZH 1E6JH 3OF6A 4ZD3L 1GC1H 2FX8L 4Z7NE 3RY4A 2EZ0C 5CEYA 4R7DA 3U48A 3OL2A 4XNMB 2DQFB 1ZT4A 3RWCB 1L6ZA 1QFHA 2Y36H 4NOBA 2AJSH 3MMEB 4ODHH 2G2RB 1G9MH 1ES0B 1BOGA 1PD6A 2LTQB 4CW1A 3GM8A 3Q6FA 5EZLA 2E27H 1W8OA 5ACMA 1WSST 2XWTB 4OZGB 5GGTL 4ORZC 4K8RH 4PJIB 3M07A 3F5WA 2ZJSL 5IVNA 4FTVD 1CGXA 3N50A 4S1DC 2ADGB 1E4WH 1H15A 5DUBB 1AGFA 2IBZY 3BKJH 2XWJA 5FCUH 5IUSA 4KVNH 3FB6B 2NXZC 3DSFH 4NGHH 3QWQB 5IB3B 4M6NL 2ERJC 5CZXD 2WWMC 3OR7A 1DSFH 1M7DB 2ZKHL 1BQLH 4OI7A 5F7MC 3VWKD 3GO1H 1F4WL 1P84K 1S7TA 2GJZA 5CBAB 5TPWH 4DCQB 2BNUA 3VRLE 4BFBD 3MUY1 1J1PH 4MSWA 3V8OA 3HE7B 4XPFH 3P0VH 2VISA 5E6IC 5L8LB 4PG2C 4P4KD 5E6IA 3DV4A 4N8PA 4PG2A 3ARTA 3RVVC 2ICEA 4RFOH 2DB8A 4LVHC 3OKDB 5HHVL 3QRFM 3C08L 1MFCL 5HHQB 4NO2A 2VZOA 3G6AB 4KVCH 1IC4H 3QDMD 5TH2A 1X6LA 4YNYA 3TH3T 3WBDA 1KCUL 3MA7A 1DLHB 5DMYA 3ZKNC 1MUJA 1D5IH 5GGRA 1MFEH 4GG6B 5AZEL 1MHCB 4F7PA 4EIZC 2HT2D 3I75A 4YWGH 4IS6A 1UM5L 1R3KB 2AV7B 4RDQF 2YPKA 5I1GH 2PCPB 4LKXB 1A6WL 2R1WB 1R6VA 1NBZA 4YHZL 3H0TA 1J0KA 5DEGA 3QUZC 1I4FB 2AJZA 2JF1A 2NMSA 4QRRD 3QUZA 4UV7L 5IHBA 1Z9SA 3MX0A 4UB0L 2XTJC 2ZUSA 3TIEB 2EO1A 3TJEH 3MYJA 3WHE0 4OKVB 4TUKH 1ZVSB 3TF7C 5CGYC 1F4YH 1PJ9A 3TF7A 2N7AA 3LEVL 1F3JA 4QOKE 1J1OL 5E9DA 1IGCL 3ZHKA 1TVHB 4MXQD 2NW3B 3A6CL 3DIFB 2YPLD 1KB5H 1Q72L 3JV4B 5I8OH 2I24N 3WSQL 5HPOA 1P4LA 3MQIA 3C5SB 2CK0L 2HJLA 1JZ6A 4Y8AA 1JI1A 4MQTB 3D85A 4XB8A 4X5XA 5SWSA 5B4MD 2V6HA 4QRUA 3MODH 1CDGA 5EN2A 3O9WD 4R3SA 4ZO9A 2QHLA 3LS4L 4LHQB 1OW0C 1OW0A 3Q6GH 2F54E 1XR9B 4NQCD 1WVZA 1YY8A 4AG4H 2D7MA 4OAWA 2P44B 3PNWA 4U2ZA 4Y19A 1FZJB 1FIEA 2NTFA 2X4SA 3GHBL 2EKSA 4RX4A 1AY1L 4J3XA 1IQWH 1FO0H 5C6PB 5MENB 5C71A 1TETL 1UA6H 1KLUA 2OJEB 5B39A 2GK0A 2CDFA 3WXWL 1BJ1J 2B2XH 1JPSH 3TVMC 5DMGD 1A7PL 5SWQB 1CQYA 3LKRB 1EXUB 4JREB 1EBAA 5AZ2H 3P30H 4ZUWA 5HD8C 1VKXA 3QQ4A 1LE5A 3D39D 4HUWB 1A3LH 2R56H 4PGDB 2F5AH 3QRGH 2FWOA 2H9GB 4CAGA 3F7QA 3TIDB 3N85L 4ZO8A 4KY1H 4J7RA 2ZUXA 4BZ1L 1FSKB 1GL4B 4KZEL 2I5YL 1MHPH 3DYOA 2COQA 4PP1C 2Z31A 1UYWL 4JPVL 3DBXB 4XBEH 1UKQA 2VC2H 5GZOC 4J3UA 3RDTA 3ARBB 3BI9X 3T3MF 1SEQL 4EDWL 5L2KB 1N4XL 4P2CG 1L4IA 4R0LB 3OKKA 2UVFA 5C0FA 3G6JF 5GRJL 2A6KB 2NY1B 3GMOB 4Z7VA 1SHMA 5B38A 4TUJA 5D5MF 3HTLX 5FHBH 3CU1A 1HXMA 4HS3B 1C5CL 3QA3A 2AEPL 2ADIB 4N0RA 3FOLA 5EU4A 4FFWC 4KHTL 1LHZA 3SDDC 4M4PA 4BZ2H 4M9OA 3SDDA 1UACL 3ZTNL 5IIEB 4MQ7B 1CD9B 1C5BL 2ED8A 3ZYJA 4YXHL 1S7XB 2J88L 3FAXA 3O6ML 2HH0L 1IT9H 5B3JF 1MCCA 2R39A 2DRUA 4HKJB 4HIXH 1OF2A 2PYEE 3AUVA 4BM7A 2VZUA 5T1KA 4EIGB 4H0IA 4JFDD 4ZUTA 1WZLA 2HFEA 3HE6D 2ZSWA 2P24B 4GMSH 4NRYA 1XGQA 5ITBL 5HGAB 4X0KB 5H37G 1N6QH 5I1IH 1OSPL 3TBVA 4OLXH 4Y16B 3PGDA 3CFJB 4WI3A 4X99B 2AXGA 1KELH 3JUZA 3QWRA 5HHNB 2EIEA 2YUXA 5DMJB 2DLIA 5DJ2B 1BGXH 3R4DA 4MA3A 3KJ4C 2C3GA 4IRJC 5DHYB 4OZGF 4IRJA 4F57L 1XIWC 3EHBC 1HOCA 1MWAH 1XIWA 1MRCL 1U3HA 2W0PA 4U49A 3NFNA 1KOAA 4XNQA 5E2VH 2MSPA 3OKLB 5KSAD 3W9DB 4D0BB 2FB4L 1TVDA 5L6YL 1JGUL 1G6RL 1QNZH 1PAMA 4NQEB 4ODVH 1YMHB 3TH2T 1H8SA 2IAMB 1IGIL 4NO0A 2W9DL 5EIVA 3T3ME 5EO0B 2D03L 3MBEC 4FFZL 3MBEA 1YYLL 3G6JE 5T5FH 1OAXH 4K3DH 2J8OA 1DJSA 5D2LF 3IDIB 3RWJA 3QG7H 1JGDA 1LO3H 1VA9A 3HNVL 3S36X 5D5ME 4LAQL 3IFNL 4QGTA 3MRGA 3LZFL 2AAVA 3HC0A 1I1FB 2ZZUT 4MHHG 1O0VA 4Z76B 5IJVB 2DTSA 4HWEL 1IAIL 3GZKA 1AGEB 1NGXB 1N3NB 4FFVC 4M1CC 2FJFB 5IW6A 2DKUA 5D1QD 4M6OL 4BKLA 4HIIA 3SPVB 4I48A 5B3JE 1A0QL 2EC8A 3O4OB 5MERA 1JF1B 2V2WB 1DLFL 4GG6F 4PRIB 1BVLB 5I18L 5HYJE 5DRZA 1R3LB 2QSQA 1Q9KB 2NY3C 3QFJA 4YFLI 1DQJA 4EZMA 2XXCB 1NKRA 1QEWB 3RRQA 4NJAH 4AL8H 1OSZB 3BDBA 1NAMA 2VSDA 1HHHB 2P48B 4HUUA 3WEXA 3PJSA 2A6IB 4WO4C 3VFMA 4WDIA 4N0FA 4WO4A 1RJZA 2VOTA 5BOZG 4PB9L 2EE2A 2W9EH 4XMLL 4MD4A 2C4XA 3VFRA 2ZOLA 1DVFC 2VTFA 2DQHL 4NPYA 1JP5A 3JWDC 4HQQL 2QSCH 3DX7A 3MLXH 4AM0B 5DURD 1ZAGA 4WTXA 5DVLA 2NY4B 1JV5A 4Z6AT 4CBPA 1VFMA 4OZGE 2I27N 4XCYB 5BW7C 1JUFB 1LEKB 2D7TH 2Y06L 5BW7A 1RUAH 3F7PC 4L4VB 1TENA 5FHAH 2IMNA 1FFPA 4PJFA 4YGVB 4HJGA 1OGTB 1IKFL 3U4AA 3O3DB 5TQ0H 1KENH 3G5ZB 3U0WL 1MCJA 1BFVH 1YYMH 2ZNXA 3HRZB 2WP3T 4YHLH 1NCWL 1U3JA 1WFOA 4WWKA 1JK8A 1Q9LA 2BMKB 5AUMA 5TF1L 4BK4A 1ZT7B 4NQSA 3S35L 2XQYK 5D2LE 1QLRB 2CIKB 5IHUL 3MROA 2OM5A 5E6ZA 1NFIB 3IXTA 3SE8L 5DSCB 2X4RA 1U91B 3VGHA 4UIKH 2CSPA 3BHBB 3E6FA 4QOKD 4Y5XA 1AO7B 4EI5A 4ZPVA 4PGZA 4CMHB 3W5NA 4UINL 1X5LA 3BDYH 1KCVH 1KJMB 4ODBD 4Z7QF 4XPBL 4GG6E 3V0AC 4XP6L 1A4KB 3G6DL 2APFA 2PTUA 3EYVA 1DQMH 5IB2B 4UQ3A 1NMBL 3C60B 1REIA 5MP6H 1UXSB 1KPRB 4BSVB 4XCNB 1XGTA 4NHCH 3UP1A 3V5KB 4JQVC 2F54D 3SDCC 1XGYH 4OFVA 5AAWA 5KTEL 3L3GA 5IG7B 4G80B 5CD3B 4M62H 1D5XB 4Z18A 4WW1B 5CJ5A 5CCKH 5F8RC 2J6EH 3B5GA 3RWGA 4ZUSA 3CCHB 4U7MA 4M61B 1Z6JT 4RBPK 1U8PA 3FO2B 4LNRA 2FJGA 5C8JA 2APTA 2FX8H 4NO5A 3V79C 4M9PA 3MRRA 4DFIA 1FV1B 4M5YL 5HI3D 2QSTA 1DBJH 4MDJB 1IGML 4YBQC 4IEFB 1UZ6F 2BY3A 3VWJC 4NP4L 3B9AA 5GIRB 2UWEB 3VWJA 3MUJA 1EEQA 4RIRA 4QLRA 5D4QA 4D9RE 3T0EC 5D2NC 3KPNB 3P73A 5D2NA 3HCVB 1KIRA 3FQWB 1X5AA 5CWSB 4E5XB 3MLRL 3LN4A 1X5JA 1ZLWH 2GFBA 4RFNB 3LCYA 2QSVA 2AV1B 4LNVA 1D6EA 1F4WH 4LLQB 2FIKA 2GI7A 5I19H 1K6QL 4FN0A 2Z4QB 4Z7QE 4JY5L 4GAYA 5CIPH 3E6HA 1T2XA 4P49A 3I50H 3X3GL 5DS8B 5HHVH 4OFDA 3BRFA 2R0KH 2NNAB 2IFFL 2PYED 4D8PB 2V2XA 4OZIF 2PW2A 4KKBC 2D3VA 5D1XA 5FK9B 1K4DA 4K3HA 3ARPA 1CK0L 2R9HC 1I7ZA 4HWBA 4LSTH 2WY3A 4GJTB 3RGVD 2ORBL 2VJXA 2Y25A 5F1SA 4J1UA 2DLTA 4K9EL 4I3SL 3VRJA 4EDXA 1OPGL 4X6EA 5INCB 2VWEC 1A6WH 1WISA 4X6CA 4DEPC 5L0QB 1AD0B 4W6XB 43C9B 2X10A 4JG0H 4UV7H 1A1NB 2VXUL 4Q6YA 4G9FB 4ENEC 4QHLB 4HK0A 4YDJB 3VH8G 3BE1L 2IC2A 1UH2A 2OLDA 5E7BA 1CR9H 2Q86A 1CZ8H 3FHAA 1UZ6E 4UUJB 2Z92A 2VR9A 1R3HB 4HJJH 3DYPA 2FX7L 4GO6B 3VFTA 1J1OH 4YDVB 2AXHA 2YA0A 1NGZA 1KYOJ 1L6XA 4K3EH 2H3NB 1Q72H 3UPRB 5D96B 3T8XB 2WBJD 3TO2A 3NA4A 1F3DJ 3O0RL 3WSQH 2ICWI 3L9RB 1JIBA 1B0GA 4P5TD 5C6WH 1OARL 2EYRB 4KJWC 3MLPA 2HT3D 3QYCA 5FYJE 2NY6D 1DQQA 5T1LA 1NC2A 1QRNB 4MXVF 3FT2B 5H8DA 1B4JH 4PJBB 3D2UD 4KI5C 3CMOL 3L3JA 3QZWA 1GVIA 2MQCA 4DGIH 4IOSD 4Y4FB 3P4MA 4KK8D 3EFDL 4ZNEA 4PTTB 1CLOL 1JNNL 3UZVB 2DOCA 1CLZH 1FLRH 4U6TA 4OZFG 1KTLA 4GXVH 4JN1L 5IHZA 5I73B 2A0LC 2APVA 3U36A 5FA3B 1IMHC 1AGBA 1XGRA 4GAJL 2V5RA 2HJKB 3VXPA 4UI2A 4JFYB 1I1YB 1NMAH 1J5OL 4NUJB 1PG7W 4NQEE 4OZIE 3MLTA 4XGZB 5HYJD 3ULSB 3FZUC 3RI5F 5I1KL 2ILLA 4TRPH 1Z0NA 2MWCA 4O02L 5HHXL 3FO0L 4F8TA 4YHML 5LVEA 3OKYA 3FB8A 3GSQA 4NC1C 3OX8A 1VFBA 1OP3H 1BD2E 1K8DA 2EO9A 4PGBB 2R8SL 5FYJL 1VERA 5EO9A 3UBXA 3QIUC 2QKIA 1KG0B 2K7PA 3QIUA 4XNZC 4ODUA 2I5YH 3TFKC 3FT4A 5JOFA 2RAMA 2JELL 2AXFA 5JW4Q 2E5EA 3WHXA 4XTRD 4LLYB 1CG9B 1RHFA 3E2HA 3MYZA 4WIQA 4XWOC 1AJ7L 1CYGA 4LARL 4G8IB 3MRIB 1PX3A 3BP4B 4HCRH 5IVXA 4UIMA 1PGRB 2AK1L 4LSUH 3I3EA 4NZRL 5K9QG 1V7ML 4CVXA 2JJWA 4RWHA 2EDWA 3Q3GA 5JXAL 4BELD 5E00A 4MB4A 5FIEA 3TZVC 1D9KB 1FVEB 1T1WA 3TZVA 1CFTA 2R1YA 2HVJB 2FJHB 1LO4H 3FRPG 2O61B 5LGJB 3BXNA 4MXVE 3MRKA 2VXVL 35C8L 4X8XA 4PRPB 4YHYC 5EO1B 5E4EC 3ROLB 3HB3D 1IQDB 2WIMA 4A6YB 4J12A 2VLRE 3E8UH 4WEBL 4GW5B 5DF0A 3O3BB 1LK2A 3GI9L 1VEPA 2ID5A 3JWOH 1SMOA 4L4VE 4OGZA 4ZFOA 4MX7A 1U2CA 5I1AB 3IDMB 1HKFA 2NY2C 2YN5A 4X7TA 5DHVA 4IMKC 2WSKA 3L1OL 3DURA 5KSVB 3GBML 2IQ9L 4GRMB 4JDVA 4IMKA 1WZKA 4OCWH 3RPIA 1NCCL 1LNUA 3TCLB 3SJVB 4P3DB 3CVHB 2G75B 2UWEF 3QHFH 4LCCB 1CT8A 4KQ4H 3FMGH 2VLKB 2XZAL 1CDHA 4PLOB 3V4VL 3WLWC 5JO5B 1JGUH 1G6RH 3ERYA 3BKCL 1D7FA 1PLGL 3C8KB 2GTZA 2BOBA 4KRPC 3RUGB 5FB8A 3QQNA 1X4YA 2W9DH 4MNGA 1T7YA 1KB9J 3OPZL 1RJCA 3O8XC 3WNNA 2D03H 2BVOA 1AO7E 2F8XC 3V8CA 3KPRA 2H41A 1MCPH 1JNHA 2BSED 4U6YA 1RIVL 3I9GH 2WP3O 2NZIA 5C9JB 2QR0A 1Q94B 2AJVL 3DPBA 4LAQH 5JDJA 3OXSB 5JUEL 2NY0C 2NY5C 4J4PD 4HWEH 1F4HA 3MJGX 5F8QC 4O00A 4OZHB 1W72A 3CK0H 1CE1L 3PGCB 1S9WB 4XH2A 3U7YL 1WCBB 4YBHA 1NDMB 4RMVA 5F7HA 4D9RD 1WTGT 2X4OA 4NN7B 4PJXB 5D7IB 3X12B 2GT9A 3ZE1F 5HGDB 3RL2A 4WGVB 3OB0K 5EOTB 5C09B 5KVGL 4CVZB 3W39B 2VLJA 3FTGA 3O4LA 1BZ9A 5EZJA 1IBGH 5I71B 3MJ9L 1UADC 2HVKA 1ZLSH 2IANB 3I6KB 4GW4B 1QSEB 5JPMB 4OD3L 3ZT5A 1BZ7A 1NBQA 1KPUA 3MRCA 4IHOA 4KV5F 4Z0XB 2Y5TA 1I9RH 1WC7A 5C1MB 2W0FB 2WUCL 4POUB 2LFGA 2Y72A 5AD0A 4Y1AB 3GSVB 3MTRA 2DQHH 3AAZB 3VXMA 3QCUH 5DYOB 2MNUA 3U9PL 1OT1A 5EFIA 3G5VB 2QTEA 5D9SB 4NQVA 2UWEE 3C5ZC 1HILB 3VXRD 1RZFL 3TN0B 4PV9A 4U4BA 3LN9A 3GMNB 3IJYA 3L5JA 3VG0H 2OX5A 2Q1EA 4IDJL 4LEXL 1Y6NR 4H1LA 2IEPA 5I75C 5C0AB 3ARBD 3BKML 1ZHLB 3L3OB 4F9PA 2BX5A 3NABL 5ESVA 3U0WH 3S36L 3VU2A 4PJ7A 3BIKA 3VGEA 3QT2A 3SO3C 3T77A 4X4XB 3HC3L 5A43C 4L3AA 1ZT4B 1TZIA 1UKTA 4GMTL 4KROB 2SEBA 5E03A 4WHYG 3NBNA 1MCIA 4JY6A 1BOGB 3U4BH 1SM3L 1IAIM 1YMMA 3Q6FB 5EZLB 5EUOA 2IH1A 3MACH 1MJ8L 5I1DA 5JW4M 5FO7B 4ZS7L 4ODSL 2E7BA 4L8SC 3GMPA 4L8SA 4UINH 1NANI 2G5BA 1ZEAL 2VITA 4JDTL 1VESA 3ZE1E 3HI6H 1QR1B 2PETA 5D72H 5D1ZB 5C0JA 5IFHH 1GGCL 4U3XA 3BX7C 4XP6H 4P46C 4ZAKB 5FYJD 1INQA 4P46A 1S7TB 2GJZB 4Y16D 1SVZA 4L8BB 2YD4A 1NMBH 1KJ2A 2WMPA 4MSWB 4XP1H 3IF1A 4FZEL 2BNRA 2WNGA 4E41A 5IW1A 5JA9A 1NANH 4HULB 3PWPA 4OB5L 4KV5E 1KFAH 3UJIH 4LHUG 2OK0L 1WWWX 2CRYA 4XXDA 3PXHA 2ICEB 4LPTA 1KEMH 2DQTH 1QVOA 1YEGL 2EIZA 1RJYA 3BYYA 1ZTXL 4GH7B 4NO2B 5TH2B 1OP5K 4KZDL 4YNYB 4BSWA 4LEOB 4PJEF 3GI8H 1TJIH 3RWHA 4S1QH 2AJ3A 5J12C 1MUJB 4YHIA 5GGRB 2VN4A 5C0BA 5C0EA 3INUL 1RQ5A 1UM6H 4NQED 4JZJB 2UY6A 3REWB 4F7PB 4H26A 2IAMD 3I75B 3OKEA 4IS6B 1BVKA 2KQNA 4N0YL 2JJTA 4N9GB 4AEEA 1D3CA 3KYKH 3QO1A 4QWWC 1MH5B 1Z9OA 2EE3A 3E3QE 1QRNE 1KTDB 3IDXL 1BD2D 4IOFC 3H0TB 4U6XA 2OXGA 5DEGB 7FABH 3PV6A 2AJZB 4NP4H 1KIUA 4AEFA 2YMXL 5HSFA 1U8QA 1K4CA 1KCRH 4NM4H 1JZ4A 1HWGB 1I8LC 1SYSA 4WWID 3ZDXF 5FKPA 3AFLA 1FL5A 1I8LA 4FP8H 5EU3B 3LPGA 5C3LD 4N8CL 4XAWL 4JPWH 4TVPE 2H32A 1F3JB 5E9DB 5F7DB 3JTCA 1EO8H 3MV7B 4KGJA 3BPOC 3KPQA 1QBML 1E4XI 2CLVA 4ZUVA 1NGWA 5HGBA 1K6QH 3I85A 1KNOA 3BH8B 4QRTA 5I76A 4MDIA 1MLCB 2HJLB 3T04D 1P6AB 4C56A 1MNUH 2GW5A 3D85B 4MJ4A 3MOAL 5K33A 2OBGA 2IPKA 1B3JA 3UTTA 4QRUB 4O4YH 2BCKA 5EN2B 3D25B 3FQUB 4QRPB 1GGYA 3X3GH 4R3SB 1BREA 4XCFH 1PG7X 4ZDHA 1E4XH 1R3IL 1YY8B 5HI4D 5T1DH 2GK2A 2VLRD 2V5MA 4OAWB 1FC1A 3PNWB 3RUGF 5KW9H 4Y19B 1CK0H 2ZPKL 1DBAH 2EDNA 2NY4D 1QBBA 5C3TA 5I9QC 4PIRF 2X4SB 4N68A 3ZO0A 4K7PX 5IWLA 2LU7A 4NNYA 2KQMA 4I3SH 2GHWB 3DV6A 2CGRH 4TVPL 2YBRA 4HK3N 4PJEE 1OPGH 2YD2A 4IRSC 4L4VD 3IFPA 1OAQL 1KLUB 2GK0B 4IRSA 2CDFB 2A1WH 5J8OA 4AJ0A 2WQ8A 4OIIL 1YC8A 2UZXB 3WKMH 1BIIB 4UILL 4XVUC 3L3IA 1VKXB 1DL7L 1LE5B 4OZHF 3HG1B 4XB7A 1XR8A 2I9TA 3IETA 1KTRL 2BK8A 2NZ9D 4XP9L 3R0NA 2PYFA 5DUPL 1FGNH 3HI1A 1K9TA 5IB5A 3UJTL 4K23H 4PJXF 4S11A 4M93B 5F93C 2Z31B 3NACL 3ZDXE 4X8JB 1EGJL 2HTKC 3RDTB 1Z5LA 1ZHBA 4NFDA 4PUBL 1AO7D 5C0NC 3FKUS 4W81A 1X5IA 1KN2L 3VG9C 5LJYH 2JB5H 4MCZA 5B38B 4TUJB 3OR6B 2MPAL 1ADQH 3CMOH 1HXMB 3X11A 3VI3E 5EU4B 3FOLB 2CRIA 4PG9A 4QY8A 1H3TA 3JSSA 1EEYB 5I8CA 4U1SA 4D0DA 3ARVA 4LLMA 1M7XA 4HK3J 4LLAA 1X7QA 5F9JA 5BOPA 4P23C 3C60D 1GPOH 4P23A 3QWOB 1HKLL 2DLEA 2VLKE 4YBLC 1CGSL 1KCSL 3SKNA 4GAJH 1J0YA 5IK3A 1OF2B 4LL9A 4PJDF 1KTKE 5IEHB 1N64H 1GYAA 4LBEB 4ZUTB 2UVEA 3RUGE 4A6YL 1DQLL 3B2UD 4JVPA 2ZSWB 4NRYB 4O51A 4YC2B 4OJFH 4OI9A 4KMTL 5HHXH 3FO0H 4YHMH 3R06B 2G60L 5HVHB 1U93B 3EYOA 3OKNA 4ZTOL 2GIYA 4PRHA 5DGRA 2AI0L 5FYJH 4R4FH 1WITA 4N5ED 2XKNA 2A6DB 5I66A 4LSPH 5GS0D 2B39A 3LHPH 2A74A 3U79A 3LKOB 4OZHE 4RSVA 1OM3L 4JHWH 5K9JH 3W82A 2DICA 4O2EA 1HOCB 3X3FL 1HHKA 3CVHL 1U3HB 1MEXL 1A6ZA 3PL6B 2ICCA 4PJXE 4HIHA 1DDHA 4HX1B 4RA3A 2CLZA 1V7MH 1OT2A 2BRRL 4L9DA 5I30H 4NO0B 2VE6A 2RCSH 1C1EL 3H9SB 5JQ6H 2EXYD 5CBEB 2X2YA 4JZOA 3PHOB 4OSUL 3UDWC 1S9YA 2IANE 5LXGH 1YUHB 1QSEE 1G1YA 3RWJB 3X14B 1MRFH 1J0HA 3WFBL 2W65B 4ONGL 3MRGB 5ECJE 3HC0B 4HZLB 4I77H 4PBVC 4U1LB 4Y1AE 1CFNA 3I02B 3MFFA 4HDIA 5IW6B 5E6YA 4HIIB 2JB6B 1FZMA 5HY9A 5F89A 5I15L 1JL8A 4HV8A 4KJQD 1YJDL 4PJDE 1A6VH 2EEDA 5C0AE 4OCYH 3S4SG 2KH2B 3BRDA 1T83C 2CUMA 3QFJB 1DQJB 2OSLB 3O11A 5ALBL 5ICYA 2YUVA 1T2QH 4V2CB 2BNQE 4HUUB 1CICC 3Q0HA 1IZJA 2YD9A 3WEXB 3PJSB 5J13C 3VFMB 3T2QA 4WDIB 5E2WL 2O5ZH 1NL0H 3RJDA 5IQ9A 3GJFK 1ZA6B 1FIGL 1MCEA 5KSUA 4MD4B 5KVFL 5IMOB 1LO5A 3KPOA 2P5EB 1KLGA 4P9HC 3DX7B 4G6KL 1PLGH 4O58L 3BVNB 1GOHA 1S3KL 3BZEA 3MV8A 1NH6A 5FUCC 3LRSA 2O5XH 4JRWA 1R5IA 1O7VA 5BRZB 4JFOB 5FYKU 5FDWA 1KUMA 3EJZC 1OTUD 1CGTA 4AIOA 4LVOB 1FFPB 4PJFB 3G5YA 4K2UH 4ODTL 2X4PA 4P3CL 4Y4KB 5DC0A 4QRSB 5FOBA 4LCWB 3ZZ1A 4WGWB 4JFPA 1KCKA 5DK3A 2VLME 1DBML 5L7XL 1N2RA 1QRND 2XZQH 4WWKB 5AUMB 2B5IC 4NQSB 4M1GL 4GW1A 3U7YH 2DQIH 1G6VK 3MCG1 1EJ6A 1MWAA 1OTSD 1G7JA 3IXTB 5IB4A 4WI8A 2FBOJ 3ORJA 4HFWB 1CFQA 3D0VB 2P7TA 2Z8RA 3C87A 3E6FB 4TVPD 4Y5XB 4EI5B 4ZPVB 5C6TH 2VABA 2OQJA 1I1AC 3VCLA 3DVIA 2JIXA 3BDXA 1I1AA 1RIUH 1WZMA 3C2AH 5J06A 1KIPA 2FECL 2LVCA 3N0PB 4NKOA 4RAVB 4GQ9H 4C83A 3K46A 1YQVH 1FAIL 2Q7YA 4JM2C 1ZLUK 1ETZB 1NFDA 4JM2A 1T1ZA 1CFVL 1HXYA 3CSPA 2EYSA 4TTDD 1OD7A 1T0PB 1FAKT 5I1LA 3ZYIA 3L3GB 4LCYA 4AT6A 4XHJD 4PJGA 4X9HA 4FQQA 5D93C 1EHXA 1NC4B 5E9DE 1K85A 2B7DT 4X4YB 3RGHA 4Z7VF 1A9BB 2DLFL 4NKDA 3D5OF 3EO0A 4LNRB 3V6OE 4B7LA 4CJ0A 2FJGB 1K2DA 3C6LC 4NO5B 5JW4R 1FNHA 3HC3H 3MRRB 3ARFC 1D9KD 2NXYC 1LO0L 5JPNB 3VMNA 5HHPB 5SWSE 5T33H 4ELMB 4M6ML 4GMTH 5EZOL 3RBSA 1MRDH 5GS0H 2IH3A 1RUPH 4QRPE 4J23A 3RY6C 4LIQH 3RY6A 2PO6C 2X4TA 5GISL 1Q0YH 3VWJB 3MJ6A 4S0UC 2PO6A 3KG5A 5I16A 3EOTL 4RIRB 2NY7L 4CDGC 2PR4H 4YDIH 1WZ1L 4Y4HC 5F1IA 5ID1A 5HYSG 4Y4HA 4Y19E 1EERB 4OFPA 4LGPB 3LN4B 1HH6A 2E7LE 5CP7A 4QHNA 5FO9A 5GGSY 4UU9B 1NLBL 1MQKL 1SYVA 4O5LH 5DC9B 1OCWL 5HJ3B 1VHPA 3B9VA 4GAYB 5HYFA 1RFDH 5I1JL 1UCBL 1UWGH 4J3SA 2IPTL 3KDMA 4UBDD 5TDPA 3S96A 3HG1E 2ZUQB 5TE7H 2YK1L 1C5DA 2X9XA 2DKSA 4Q6IB 3ARZA 4JDZB 4RISH 4KZDH 2Q8BL 1GAFL 2DD8L 1CGUA 2VLKD 3QNZA 4ERSL 4OT1L 3FB5A 2V2XB 2VDML 2D0HA 2X1OA 4PGJA 3W9EB 5D1XB 1IC1A 3IU3B 3TO4B 3INUH 5CJXC 1I7ZB 5CJXA 5IMLB 5HVGB 1CBVH 1ZKAA 4PR5A 3HPLA 4M03A 1PY4A 3BYTA 3VRJB 4KTEL 5GSVB 2YRZA 1DP0A 4Z7VE 5A16B 4X6CB 1JWSA 3QR2A 1R5VB 4AIZA 1JWMB 2VL4A 2EDDA 5JOPE 5MHSE 3S3SA 2F8OA 4JVWA 4LLWA 1VFAA 2FBJH 3TT3L 3QUYB 2YWZA 4HK0B 2V2TB 4ZOEA 3QHZL 4FQCH 2Q86B 1KGCE 2X4UB 1G7IA 3VFTB 4IRZH 5IMMA 4U6HA 4EUPB 4LQFH 3D9AH 4U2YA 2F58H 1MIMH 1A47A 3WKNA 4HT1L 3EYFA 4N0CD 5FM8A 4JVUA 1L0QA 1B0GB 1KIQB 3RNKB 1OB1A 3EDJA 3WE6A 2CRZA 3MOAH 5E70A 1BMGA 1DQQB 2IAND 5L8KB 4HLZG 3GMLB 5T1LB 1QSED 4YGAB 3L3JB 3VGAC 3QZWB 1Z3GL 1I3RB 3PDGA 3EO9L 4DVRH 2VR4A 4Y1AD 4XMPH 5IB1A 4KKCC 4JM4L 4YQXH 4W4OA 4HFUL 4PLKC 1SJVA 1JGLL 2K3TA 3U36B 4R97B 1MFAL 1J8KA 1XGRB 1WBYB 2VNCA 3VFGH 1ZVHA 4TVPH 1I3VA 3VXPB 2XPGA 3Q5YA 1TQCC 1WLHA 4DN4H 2HTLD 2BVUA 4PJFF 1A2YA 3RZCA 5C0AD 3IFOB 4KTDL 4DKFH 1J1XL 1JHTB 3O45B 2BHZA 1AI1L 4RMRA 3RAJH 5TE4L 4EN3C 1UVQA 2B1AH 4UT7L 3FB8B 1DL7H 1B4RA 2H2SD 3GSQB 1JF5A 4LP4A 1CS6A 3OX8B 5CIPA 2FCBA 1VFBB 3BP7B 3FL7A 2BNQD 3K80A 3W2DL 5EO9B 3ULUH 1F3RB 3VXUA 3I2CH 2JTDA 2R2BB 4ODUB 4XNZB 5T5NG 3FT4B 5JOFB 4KROD 3LKNA 1SY6L 3E2HB 4ORGB 5I0DA 3NCEB 1ZT1A 2VXQL 4LLUA 2RFXA 2UZIL 3ROOB 3KPSB 4XI5D 4UIMB 1KN2H 3SQBA 3DROB 4CVXB 4XNYL 3UX9B 2QQNH 1GGBH 3Q3GB 5E00B 5D1ZD 3WIFA 2FEEI 3QFJE 4PS4L 2W1NA 3B8SA 5AYUL 2DIAA 4CVWA 2VLMD 5HDQH 2H26A 4V1DA 3MPCA 1SBSH 2Z93B 3BXNB 4IIQA 3IDNA 4YUEH 3TJHC 4CU8A 3NZHL 2DQCL 5E4EB 2IQAA 3B9KC 1U9KA 4JJ5B 1NGQH 2OCFD 4K7PL 3RVVD 3B9KA 5F6IC 2BVQA 1DQLH 4APQC 4QNPF 3RKPA 4JRXA 1F2XK 1K3ZA 2HLFC 1G9NL 2XNAA 1M6OA 4MJ6A 4U1NA 5BRZE 2WW8A 3BQUB 3MGOB 4X4ZA 4MLIA 4KUZH 1IC5H 4PJFE 3QG6A 2P49B 1N5YL 1ZGLA 4X7TB 3LD8C 3OJDA 2BOCA 3DURB 4MMZC 5ESQA 4LCWE 5EBMA 5DO2D 1CXIA 1LNUB 4PGCA 4I0PB 4XBPA 2VDKH 3BGFC 3V0VB 4LCIH 3TWCL 4KPHL 3QUZD 5I17A 3CVHH 1TTFA 2BVYA 3LQAL 4FQIL 4F7EA 3DRQB 1TVBB 4WW2C 5BV7C 2GTZB 2BOBB 4U1GC 5FB8B 1C1EH 1J11A 5CGYD 3WUWG 4N0UB 5KS9A 2B4CL 1FCGA 2BVOB 3JWDL 5E9DD 2FHBA 3KPRB 4MYWB 4OSUH 1HIML 1T22A 3GJFB 2HKHL 2QR0B 4YO0A 3WFBH 4OLZL 4NZJA 1MSPA 1C16A 3RX5A 4MD0B 4M48L 4JFZH 3D85D 3ULVH 5SWSD 4NBYB 4XPAL 1PEWA 1R5WA 4FHBD 1W72B 4QRPD 1HSBA 3LEYL 3PV7A 5CJQH 4XH2B 2AS5M 1ZVYA 4NKIL 3VW3L 1YEIH 3FO9A 4X5WB 2OTUB 1YDPA 3TA3C 5EU7C 1HI6B 2X4OB 5J11B 2IBZX 2GT9B 2YXFA 2JK5A 3TA3A 3NCJL 3Q1SH 5T3XH 4Y2DA 3RL2B 4Y19D 4MNQA 5DT1H 7CGTA 4RX4D 3KWWA 2VLJB 3FTGB 3KNBA 1VB9A 2ZCKH 1DQDH 3V9FA 2HVKB 3BFOA 4U1JA 4X6CF 3NIFF 3QEUA 1C7TA 1P2CA 1L7IH 4P5KA 5E2WH 1KPUB 1RD6A 3MRCB 5SV4A 4ZFGL 1IGTA 1FIGH 3OG4B 1WC7B 1FC2D 3NA9H 4HJ0C 5CEXA 4K94C 4AYFA 4JO2H 3HG1D 3VXMB 1S9KC 1F2QA 1FH5L 3IB4A 3QUKA 4O58H 3SCMB 1FZOA 1P7KA 2R0ZL 4JLRA 1M4KA 4OZ4B 3IJYB 2Z31D 2QADC 3JWNC 4FOMA 1BFOA 5DJCA 5K93A 4H1LB 1NCBL 3RDTD 5I75B 4P3CH 4N8VB 3ZKSD 3QSKB 4OD2A 5DEFA 2VSCA 2Q8AL 3NGBC 1YEEH 5ADOL 3BIKB 5HHOA 3B9EA 3P77A 5JOPD 5MHSD 3T77B 4DZBA 1A6TA 1S9VA 3B8YA 3IGAA 4Y88A 1TZIB 3SDDD 2SEBB 4MJ5B 1U6AL 3IS0X 4GKNB 2R1XB 2DJSA 3BKYL 1KGCD 5I1DB 2IH1B 3SKOA 1JHLL 1PKOA 3HZKA 2HLAB 1T66C 3GM0A 3IDJA 3MZTA 3ARDC 3CUPB 4L8SB 5DZLA 3ARDA 5CGTA 1VGEH 1HQ4A 5JMRA 5DMIL 2IPUG 5F7WC 5T1KD 1V05A 2P5WB 5IM7B 4MMXC 4XRCA 5C0JB 2B1HH 2WV3A 3CXDL 4WTZG 3MRPA 2DYPA 4OLYH 5TQ2H 2PTTA 5D8JL 5HVWA 1JRHH 2HFTA 3VE0B 4X6CE 1MI5A 2VWEE 3NIFE 3NAAL 1KJ2B 4G42A 3QWRD 3IF1B 3LS5L 5IW1B 2J5LB 4YDKL 4X98A 3PWPB 5DVKA 4MQXD 5I6XB 5DRXA 1QVOB 2EIZB 1RJYB 2QEJA 3PGFL 5HHMA 4HPYL 4IRJD 3MA9H 1HDMA 1XIWD 3QCTL 2DKMA 4BSWB 1U3HD 5FYLE 4XNUL 1XCTB 5FYKL 2AJ3B 3PL6D 1HSAA 1Q9WA 2DLFH 4L8DA 3BPCA 3L3HB 5EPMA 4I18B 4HPOH 5GGUA 4H26B 4NO0D 2AKRA 1XF2A 4PJ8A 2Y5EA 3LB6D 1BVKB 5SWZA 1LO0H 4HWBL 3VD3A 4GRWB 5EA0H 3QO1B 4M6MH 4HKXA 2R4RL 3RWEA 1T4KA 3PV6B 3MLWH 1RVFH 3K7UA 1K4CB 3S3PA 5EIQA 4MD5A 3EOTH 2W60A 2CLRA 4OCMC 1SYSB 4ZNEE 4LU5L 3THML 4WI5A 5IEKA 4U05A 1WZ1H 3RA7H 2YHGA 3IKKA 4NKMA 4M7JH 2ITDA 4A2LA 4FFVD 4M1CD 1U36A 4F3FA 1QKZL 3L6FA 4JFEA 1MQKH 4HKBB 1X5XA 5F3BA 3GSXA 2CLVB 4ZUVB 3L3KA 3LV3A 1NGWB 5HGBB 5FYLL 3F12B 3GSUA 4MDIB 4TNWK 2QQQA 3LN5A 3QFJD 3MLSL 4JY4B 2HWZH 4C56B 1K8IA 2Q76A 3VFUA 4XWGL 2IPKB 4PD4K 3UTTB 2YK1H 4RQQA 5KOMC 1TJHL 1LGVA 4WO4D 3OAYK 4N1EA 1GAFH 1AHWB 4F9LC 1TCRA 4F9LA 2VDMH 4M00A 4BSJA 3LRHA 1F02I 1EAPA 2DBLL 5DLML 5E99H 1JE6A 4S1SL 3ARQA 5CD5C 2J3SA 4RGMC 4NNYB 5I0ZA 5BRZD 3DV6B 3TBSB 3FOMA 4H20L 5SX4H 1QFUH 3IFPB 4YK4C 3N1QC 4IRSB 1OLZA 4Y5VB 4JQIL 3T09A 4OCXL 1U8KA 4Y4KD 3SDAB 1TPXC 3JV0A 3LEXA 2BFVH 3GMRA 3STZB 1A6AB 4QTHB 1BX2A 1IC7H 1XR8B 4WWKD 2I9TB 3IETB 2X70A 3HNSL 5EBLB 1ED3B 2OI9C 4XBGA 2PYFB 2OI9A 3N1GC 3HI1B 1JPFA 5IOPA 5IGXL 1B2WL 4MCYA 3S8WA 2FEDC 4XT1C 4BFEA 5ADPH 3HLAB 2BJMH 1MVUA 4EBQL 3BMVA 2OR7A 1SEBB 3U4EA 5EU6B 1T21A 4EI5D 5ESAB 1ZA3A 2EDRA 1ITBB 5I8KH 3VXQB 4FQJH 1MF2L 2VUOA 1ZLWK 1C08A 3P2TA 1S5HB 2CUHA 3EO9H 4ISVA 5IFJA 4PG9B 5MEOB 5I8CB 3ARYA 3RQ3A 4U1SB 1PYWA 4S0SD 5DFTA 4MAUL 5F9JB 1JNJA 4KMQA 3U30B 1EUTA 1U8NA 4M5ZH 1XMWA 2DMBA 4PBWD 1VFOA 3SKNB 3BZ4A 3RVXD 3BGAA 2Q20A 5IK3B 3I6LE 1QP1A 4HG4K 2AABL 3GGWA 1J1XH 2V7NA 5DJZA 1LWRA 1I7UA 3JV6A 2WM0A 3KPRE 3EYOB 3ZT7A 4DTGL 3QH3A 4MNHA 4PRHB 3AXLB 1T5XA 1MIEL 1S7VA 2XKNB 2FD6H 2YN3A 3MLYL 1S7UA 5D7JB 2AJYL 4RGNC 1GOGA 2A74B 4G7YL 2VXTL 5EUOF 5CSBA 4NQDA 2YD7A 3RTQC 3VWJD 4MA1C 5E94A 3HR5B 1D6VL 2UZIH 1LO2H 2IG2H 4YXKL 5FV1L 4QYOA 3WD5H 3TV3L 4HIHB 2ATKB 3VGDA 1NJ9B 2CLZB 5EULV 2D31A 2XQBH 4BQBA 2YKLH 2VE6B 3QXUA 3WO4B 1AQDB 5JIKA 2VLJE 3WIHA 2EC9U 1H3XA 3KHOA 4JZOB 5DZNA 3IDYB 3RVWC 1S9YB 3OG6B 1AC6A 1FL3A 3OKOA 5I1CL 2FHCA 4NWTH 1I8KB 3SGKC 2XRAH 3BSZH 3SGKA 3RIFK 4XNXL 1R24A 4POYA 4DKEL 1HYSC 4OF3A 3KYNB 3NZHH 1T3FA 2DQCH 4LPYA 3IVKB 3ZMRA 4YPGA 1CFNB 3VXME 3O3AA 1A4JB 3MFFB 4LPWA 4URTB 2NY5L 5H2BA 4HDIB 1JYVA 3NH7L 1W72L 4I3RH 1NCAL 1C7SA 1AE6L 3VGFA 5HY9B 1FNSH 5F89B 1KC5H 5D1XD 2BZDA 1BEYH 1XGUA 3TO4D 4KKBD 3CC5A 4S10A 1ADQA 2R9HD 1T7ZA 4N1CA 1MAKA 4GRWF 3TYGH 4G7VL 3RNQA 5F7FA 5ICYB 2LAGB 4J3WA 4PLNC 1S7WB 2DM7A 1NAMH 1KJ3L 4KPHH 5IQ9B 5I8EA 1X44A 4DW2H 4PRBA 2A9MH 1ACYL 5ICXB 1OP3K 3BD5A 4ALAH 1LO5B 3QUYD 4CNIA 4ENED 4Q58C 3B6SA 3TBYB 3BZEB 4ODXA 5EUOE 3MV8B 4G8FB 3QP3A 1DFBL 3JWDH 1YEFL 4N90E 3RU8L 5FYLD 4F15B 3MREB 3S34L 1HIMH 5FDWB 5FAAA 3J7HA 2CDEA 2VDOH 2AJXL 5LBSH 2P5WE 3VWKB 4WFEE 4ZSOB 1MCOL 2VZTA 2X4PB 3ES6A 4LPXA 3SE3C 2D4FA 3QCVL 5FOBB 2P43B 4XPAH 5M94B 2X09A 5T1LD 1N2RB 3FQRB 2VQ1A 4LVNC 1QA9A 5HPMB 4W70A 4JFXB 1RAMA 4GBXA 3IXAB 2BNRE 5DQDL 4E41E 4NQXA 1MWAB 3PWPE 4WUKL 4ODWA 2A73A 5IB4B 1CFQB 3BGMA 3MCKB 5EORH 1EHLL 2P7TB 1H3PL 2BHYA 3S3JA 2C3HA 2A0LD 2F19L 4H0HB 2R0LH 2JKXA 3D6GA 2ITCB 2OQJB 3O3EA 1E4KC 2VKWA 3VCLB 2JIXB 1I1AB 4HUNB 4ZXBC 4PJCA 4ZXBA 1QBLL 2I26N 1A9EA 2MCPL 4TYUA 1P9MA 1ZWIA 5E8NA 4GRWE 1CL7L 4EQ3A 4IOIA 2CKBA 2F5BL 3SDXA 5E5UB 1TDQA 1TTUA 1T1ZB 1HXYB 3L5HA 3L7FB 1KJ2L 3SE9H 3AMLA 3A6BH 3QAZB 5E8OA 2VDPL 4LF3A 5I1LB 5BS0A 3S9DB 3T2NH 3A6OA 3DETC 4YLQT 3K3QA 1PZ5A 4PJGB 1Y18B 2YPLB 5CILH 1RZJL 4FQQB 4NWUH 4WUUA 4OLUH 4TOYL 3EYQC 4PJHB 5INDB 4Y5YA 4NKDB 1TXKA 3SGJC 1MCRA 3T0VA 3KLAB 5JW5A 1K2DB 5T3ZE 3SGJA 4P9ML 1OHQA 5D7SH 2ZCHL 4L29A 5BZWA 4C56E 5TE6H 4JO1L 5D71H 3O9WB 1CTNA 4OV6F 5TGBB 3T2PA 2H2PC 1NSNL 4IMLA 3UTTE 5BMFL 3QEQA 4NZUL 2DWEA 2IH3B 4HIJB 3BKYH 5KAQG 2X4TB 1JHLH 1JZ3A 2X05A 5I1EL 2PO6B 5I16B 3SGEI 4YE4L 4DQOH 4HGWA 4G6ML 1PQZA 2VQUA 3QEGL 5F1IB 5ID1B 2EKJA 5F9OL 5E08L 4M7LT 3WFZA 5JR1H 5JXEC 3RY5A 3O81A 3GSNH 1HH6B 4Z77A 2DM4A 4QHNB 1DBKH 2A9NH 3ARRA 1WEJH 4OM0L 4ONFL 2WQRA 3AU1A 1YN7A 4MGXA 2J4WH 1P7QA 4S2SA 4KAQL 2KDGA 5BO1H 4X7CC 3KVQA 4UT9L 1BQHB 2DI9A 3P4OA 3LS5H 1G7PB 3FN0H 2NY2D 3GIZL 2D2OA 4YDKH 5T3ZL 1E6JL 4PV8A 5IJKC 1X5HA 4AK1A 1GC1L 3F58H 3KDMB 5IJKA 5TDPB 5ETUA 4I0PD 1N59A 1RI8A 2W07A 3EGSA 1A3RH 3PGFH