3MR9A

Crystal structure of mhc class i hla-a2 molecule complexed with hcmv pp65-495-503 nonapeptide m5a variant
Total Genus 79
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
79
sequence length
274
structure length
274
Chain Sequence
GSHSMRYFFTSVSRPGRGEPRFIAVGYVDDTQFVRFDSDAASQRMEPRAPWIEQEGPEYWDGETRKVKAHSQTHRVDLGTLRGYYNQSEAGSHTVQRMYGCDVGSDWRFLRGYHQYAYDGKDYIALKEDLRSWTAADMAAQTTKHKWEAAHVAEQLRAYLEGTCVEWLRRYLENGKETLQRTDAPKTHMTHHAVSDHEATLRCWALSFYPAEITLTWQRDGEDQTQDTELVETRPAGDGTFQKWVAVVVPSGQEQRYTCHVQHEGLPKPLTLRW
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system
molecule keywords HLA class I histocompatibility antigen, A-2 alpha chain
publication title Crystal Structure of MHC class I HLA-A2 molecule complexed with short peptide
rcsb
source organism Homo sapiens
total genus 79
structure length 274
sequence length 274
ec nomenclature
pdb deposition date 2010-04-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00129 MHC_I Class I Histocompatibility antigen, domains alpha 1 and 2
A PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3mr9A02
3.30.500.10 Alpha Beta 2-Layer Sandwich Murine Class I Major Histocompatibility Complex, H2-DB; Chain A, domain 1 MHC class I-like antigen recognition-like 3mr9A01
2A6IB 4Y4FA 1MF2H 5FKPA 4EUPA 3GSVB 5EU4A 2P24B 4EBQH 2EIDA 4BH8B 1KPVA 4FQJH 4X8JB 4YPGA 2W0FB 1C7SA 4RWYL 5B39B 3UMTA 1NGPH 4XRCA 2A0LC 4RMVA 1M7DA 4X6FB 4KGJA 4JVUA 1GZPB 2D31A 4JFDD 1WBZA 4MAUL 5BVPL 1Q94A 3MV01 1BHGA 5AG9A 3O4LE 3KR3L 4M62H 2E7MA 2AJYH 5D7JD 1LD9A 3KDMA 3MRCA 4UIMA 3V4UH 5HPMA 3IDNB 4AT6B 5FYLL 4HT1L 1JYVA 2HT3C 2XNAB 3FB8A 4LARL 5T5FH 2D2OA 4YBLC 3O4LB 3T09A 2WWKT 7FABL 5I15L 1W0WB 4HFWA 3GJEB 4TPRL 1K3ZA 3TVMD 4LASH 5I18L 4JFDE 3ZTNL 3MRMB 2OQJA 1ZWIA 4L4TA 4P23D 4JO2L 2X4RA 2OM5A 4QHUA 5JXEA 4JFDB 1NKRA 2YD9A 2ZUQC 4P3CL 2DTSA 2H1PH 5IOPA 3P4MA 1INDL 3LMJH 4UDUA 4XB8A 5D7JB 5I1DA 3R06B 2WIIA 3ZE0E 5E24E 1M05A 3JWOC 5DVMA 1EFXA 3FQWB 1FC2D 4GS7B 2CH8A 5CS7A 3GMMA 4MD4A 3WMSA 1OP9A 2VITA 4YWGH 3IFNL 1BFVH 3T3PF 4YNYA 5E9DE 1WZ1L 1T6VN 3BQUD 1N5AA 3OKDB 1HINL 3V2AR 4C58B 2XKSA 2J8UE 3FB6B 1MCBA 1T2XA 5HPOA 3MJ7B 3TVMB 2E3VA 5C6WH 2H9GB 4F57H 5E9DB 2CUMA 2FH6A 4ZS7H 4I77H 3E2HC 5F7NC 2J8UB 4MMXC 2FR4A 5GRVK 2X40A 1I1CA 4Y4KD 2AVGA 2DQCH 4X5XB 1OSPH 3P2TA 3ZO0A 3CSYB 4L8CA 5EZOL 3NA9H 2Y06L 3ARFC 1WGOA 1DLHB 5DJZA 1KJ3L 12E8H 1YNKL 4UINH 4F3FA 3RZCA 5CCKH 1AQDA 3EAKA 1FVDB 4G3YL 3HC3H 4JFFD 3BQUB 5C0RL 3LQAH 5E95B 4KC3B 4TNVK 2A1WL 1V7ML 5MEND 4QRPA 2I5YL 2ADIB 2HJFA 3DX6B 4LGRB 1PSKH 3NH7H 4K9EC 3GMNB 2CIIB 4NM4L 3T77A 2DWEB 1U8KA 2H45A 3BE1H 1YC7A 2VH5L 5MP6H 1H0DA 2JB6B 5KZCD 4BA8A 4E41D 4R90L 1T7WA 4U49A 4Y4KB 4YAQB 5D1XA 5KVFH 1NJ9B 4FMKA 5INDB 2P1YA 1KXVC 4N1CA 3CXHK 1CG9B 1JPTH 4JFFE 4EUPG 1XGUA 1L9NA 3IKCA 1KC5H 1X5JA 2H32B 2XICA 4OV5A 4U6XA 1PX4A 4ZPVB 2FJFB 4BFIB 3AMKA 1KCLA 4MXVE 5L9DH 2VXSH 5MENE 1AXIB 4K3GA 5EU5B 1XR9A 2V9QA 1EO8H 3DO7B 1YEHH 2CXKA 3MLUH 2VZSA 4M6AA 5CJOH 4JFFB 4POUB 1AD9A 1MAJA 5IV2B 3QEQA 1EEYB 3I02B 3CX2A 5MENB 1CE6A 4FXKB 3AS2A 4E41E 3S3JA 3HHRB 5IP4A 3JUZA 1HHJB 1ADQL 2DQTL 4R97B 1RIUH 1P2CA 2FX9L 1T7ZA 1T03L 3T08A 4OIIL 3NCBB 5KZCB 4E41B 1CGSL 3D39D 2OR9H 1S5IH 3LS5H 2BFVL 3ULUD 1IRAY 3P9LA 2XTLA 9CGTA 4XMLH 3ULUH 1C08A 3ULVD 4R7NA 1Z5LA 4PJ9A 1OAQL 5KS9A 2EO1A 4Y19A 3JWNC 2FYYA 2WIMA 5HY9A 3U4BH 2AW2A 3ULVH 1Q0XH 5ICZB 3CJJA 4Y5VB 1MY5A 3VCLB 3T1FB 1G7QB 4X4XB 4XPAL 5C3LD 2BDNL 3U0TA 3EO0B 4N9GB 1YEEH 3D39E 5FGRA 4Z0XA 4OLVL 5E08H 3LV3A 1I7UB 4KK9C 2CD0A 4XP5H 3ULUE 1CGWA 3B83A 2CLVB 4MVBC 1OGTA 4B7IA 1ETZB 4L29A 5F3HB 4OD3H 4KRPC 2P5WD 2VDQH 4U6HA 2FO4A 2VB5A 3KPSD 3ULVE 5DUML 2C7UB 4POYA 1SEBB 3D39B 3GBML 5ITBH 5FHAH 1T89C 1FLTX 2IADA 1FFOB 4LOUC 4PLNC 3RI5F 2P49B 4M3JA 3QUKA 1N0LA 4M8VA 4OLWL 2Q3AA 5IGXH 1I1FB 1WCBA 5MEPB 1FN4B 3SGEI 4QRTA 4D2NA 2FEDD 3FQTB 1U8QB 5F7FA 4MS8C 3T0VA 1F90H 3RDTC 1M7IB 5I8CA 1PGRB 4JO3L 2ENSA 3HKFA 1QLFA 2PNDA 2P5WE 4PJGA 1YMMA 3V8CA 3KPSE 1RJYA 1EA9C 4LSUL 4APQA 1NBZA 1ZXQA 2QSVA 1LO2L 4YXKH 2DBLL 1RURL 4HV8B 2YPLA 3CLFH 3DYMA 4Q58C 1IBGH 2VIRA 4PLJC 5DJYB 5E00B 3WIHA 2P5WB 4U1GB 3QDAA 5IVZA 2O26U 1GH7A 1OF2A 3KPSB 4N0CC 5J1AA 3HB3D 3V7AE 4HS6B 3V6FA 5D70L 2IANA 1J9CT 5EBMB 1HOCB 4TTDD 5E03A 2EXYD 5FV1L 4HWBL 3LKPA 4GUPA 1ADQA 2Z8WC 1KPUA 2QKIB 2ZUSA 1NL0L 4K2UL 2FZ3B 1M4KA 4PRDA 4G59A 2BNUA 5EULV 4UNTA 3S7GA 4XNYH 1NMAL 2QQKH 4MZ3A 4WEBL 3WNOA 2WWMD 1T5XA 1ZANH 2JCCE 5MEQB 1P9MC 1HH9A 4XT1C 2Q7YB 3RWJB 2DQDH 4NO3A 3FT3A 2M1KA 4WCYH 2VDNL 1RUKL 3WFEL 5I76B 2DQIH 1RZGB 2WW8A 3ARSA 2EYRA 3EBAA 5K59E 2JCCB 4JPVL 1M1SA 2GSIA 1LNUA 2XACC 2VN4A 1CLOL 5F7DA 5E2WH 2Q8BH 4CN6A 5IQ7H 3EOTL 3VGEA 1CQYA 3VWJD 2ZZUT 2E7LA 3KPOB 1UM5H 3O6KH 2R0ZL 1L0XA 1R3HB 1RI8A 4LSRL 4AENB 4EZMA 1FG2A 2IFFH 2XTJC 1AGCB 3C5JA 3KJ6H 1B90A 1WAAF 2XZAH 4XNQB 1DANU 3U0WL 2FL5A 1T1YB 4FQXC 4DZBB 4PJCF 1QQDA 3BEVA 4DZ8B 4TN9A 2OTWB 3DTXA 4ZUUA 1ES0A 3V8OA 5T5NG 5TQ2H 2Y72A 1TETL 3C2AL 1RZIB 3REVA 1X5FA 1U3ZA 2IBZY 4P59L 3OPZH 2VISA 3C8DA 3MBEA 1CXHA 3O3UN 1RUAL 3BEWB 1A1MA 2R9HD 2EE9A 4K3EL 2XKNA 4R7DA 3S5LA 5INCB 5B4MC 5F1OB 1AI1L 3LZFH 4Y4FC 4Y4HA 4ALAL 2X1WL 3OJMB 1MCQA 3VWJB 5JW5B 4NRYB 3IVKB 2BRQA 3IGAA 2HT4C 2R8SL 1Q9LB 3VI3F 4KJYB 3PP4H 5IG7A 35C8L 3NGBC 3I6LD 3D85A 4MX7B 4XVJL 1RZJL 3LHPL 4PB0L 4KAQH 1LDSA 3O8XA 1XGYL 3LS4L 4WW2A 1ZLWK 4X6BB 1P1ZA 3BZ4B 4PJBF 3RI5K 3GSOB 3ZMRA 4HWBA 5FGCE 4P2CG 2BXYA 2FATL 3RGHA 1IGML 2IQ9L 2JJUA 4TPRH 3MCKB 5I1IL 1UCBL 4M6OL 4N0YL 4PP1D 3BW9A 3HI5L 4JHBA 3ZTNH 4Z8FH 1OAKH 3DHMA 1FGNL 4TULL 3MV7D 5FCUH 5FGCB 3S37X 2ICCA 2Z93B 4H88L 3I6LE 1WZMA 3OF6D 2JJWA 4WY7L 5DD3L 4BSVA 3VXMD 4F7CB 3WIFB 1IQWL 2BJML 5DGQA 3CZFB 5HYJD 3BAEH 3MJ9L 5ERWA 1XEDA 3JTSB 1VB9A 4G9DB 1ZHNA 3JTTB 3ABZA 4NGHL 1FNGB 3NTCL 5D5ME 2PW2B 5KSUB 3P9WB 3WDJA 2LTQC 2NX5D 5EOTA 5A2LH 3OL2A 1A6UL 3P0VH 4RFNB 4NDMA 4X0KB 1JVKA 4NOBA 1BJMA 3MV7E 3VRIA 1JHLH 2UY7A 2ICEB 3BIKA 1DBAH 5I8KL 5D5MB 3VXSA 3UDWA 4AIZB 5H94B 3VXME 4LCWD 5DGRA 5HYJE 2WMPA 3FZUC 1F6LL 4CMMB 2FJGB 3MV7B 4G7VH 3FCTB 3HZMA 2JIXD 1E6OL 2YXMA 5GGSA 2ATKB 3VXMB 5K9QG 5HYJB 3TJHA 4JRYA 5IMMB 3BKYL 3WNPA 1XR8B 2C3VB 1QFWL 3D0LA 3FL7A 3IU3B 4M6ML 2XIDA 3PL6D 4LCWE 3MCLL 4JG0L 2BHZA 3LKQB 4BSWB 1I9EA 3RZCC 3ZTJG 3B9KA 1CBVL 5K93A 3LEVL 4ONHA 2ZCHL 2W07A 1OLZA 1FQ9C 4OZ4A 4MA7H 4ODUA 4LCWB 5DJ2B 4HXAL 3KWWA 3GEWB 3ZKQD 4J3VA 43C9A 2JIXB 3EYUH 5T1MB 3RTQA 5IBTH 2X89D 1GGBL 4NJAH 3K8LA 1J0HA 2HFTA 4QRRD 3V6OA 1CE1L 4IRSD 3DRQB 4ODXB 1ZHKA 3V7MA 2VDKH 4Z7UA 1G7JA 2GAZA 4XI5C 1RV6X 3U2SB 3QHFH 5ESAA 4QGTA 3PL6B 4ZAKA 1A7RH 3FTGA 4FFZL 2VLRA 3TP4A 1LQSR 5BOZG 3WO3B 4LK4A 2CDEB 3EGSA 2ZSWB 3MJ9A 3HPLA 2BSRA 2X4TA 3LKOB 5D1QA 3NAAL 3L3HA 4AEFA 1L9MA 4JZNA 1S7QA 2R2CA 4QRRE 4OCNC 4I8DA 1A47A 1TCRB 5DRXB 1BAFL 4N5ED 4HUVA 3N85L 2BZDA 4LAJH 5J13B 4GRLA 5KSBE 3H3PL 3BSZL 2QADC 4QRRB 3V52L 5K33A 4IRSB 3H9SA 4ZUVB 3ZDXF 2FECI 5SWZA 1HHHB 3DECA 1D9KA 1BWWA 1YMHA 2FDBP 3ORJA 2HG5B 5D7KD 1FIGL 3IDGB 1WWWX 3K2UH 4P3DA 4GG6F 5JOPD 4DVRH 1PG7H 1BEYH 3WS3B 1CD1B 4PJ9C 2H26B 5CZVH 5DF0A 4UTAL 4A6YB 4XPAH 2ZSVA 5F9OH 5GJSH 2P42B 3SDDC 2W60A 4F33A 3ECBA 3ZTJH 5DQJB 5GGQH 2X42A 1U58A 4O2FB 3OKEB 3ZDZE 4LLWB 2GITA 3HR6A 4LIQL 4MJ5A 4QCIA 2QQNH 4X9IA 3HI6L 1AR1C 5D7KE 1PFCA 2AK1L 5KN5A 1BD2A 1UXWA 4IOSD 3ZDYF 1MHCA 4FQ1H 3V95A 5JOPE 4DTGH 3OHXA 3SO3C 4O00A 3UTOA 4QRQA 4OCWH 2X5PA 3VFRA 1ZEAL 3AREA 3FB5B 5H2BA 5ADPL 5ICXA 1L0YA 3TN0B 5FUOL 4R2GC 4ETQA 3THML 4NQXB 4U1JA 4RFOL 1HZHL 4NP4L 3U36A 1CDYA 4O9HL 4IHOB 5JO5A 1QP1A 4LKCB 3QDMA 2HTKD 1T0MA 4E42A 4YK4C 3A6BL 3NFNB 1KCVH 2CKBB 2HRLA 4MMZC 3V4VH 5ALCH 1QYGL 4APQC 2GTWB 3X11B 4I18A 4NNPH 5ECJE 1EAPB 3SDCD 1H3WM 5T1LD 4NPYB 3T4AB 3IFPB 3MRDB 3GFUA 5DK0A 1CFQB 1BJ8A 5DQ9B 4HJJL 4WUUE 1YYLL 1VADB 1DTUA 5IBLD 4Q9BA 3L9RB 4YUEL 1UB6B 5DURD 4RNRB 3F7QA 3T8XB 1K8IA 4Z7NF 4L3CA 4NNYB 5BV7C 1GAFH 4JDTL 4WUUB 4QTHA 3RA7H 2M26A 2IG2H 4NKMB 3U9PH 1KT2B 4P4KB 3BGMB 1MPAL 5CP3H 1O0VA 2LAGB 3W39A 4OZFB 1NAKL 5I19H 1U8HB 4X7TB 1WIOA 2A6DB 4TUOA 3R4DA 2OXGA 4YHML 2CRMA 4Q6IB 3Q6GL 1V8HA 1U92B 4X4ME 1FSKB 3LRHA 5C0FB 1HCFX 2X6MA 1H3VA 2WBWB 4QOKA 3EOTH 1P5UA 3UYOD 4LU5L 1QRKA 3C5SB 4LBEA 3SDCB 3QWOA 5T1LB 3IDXH 4YZFF 1HSAB 2GCYB 2R0ZH 3U46A 2BVQB 2FWOB 3QPXL 4QYOA 3TJEH 3PABA 4QT5B 3U0WH 1L8JA 2F74A 3QQ3B 1J5OL 5JR1L 1DUZB 2YA1A 5FM5M 1I8LC 3PWPA 5DURB 5DQDL 1RUQH 3VG0H 2PETA 1QHPA 4HGWA 4CU6A 5ACMA 1W0VA 1P53A 1FGVL 5EN2A 2A6IA 3SGJA 3GSVA 4WW1B 5FO7B 1AY1L 2P24A 2Z31D 1U2HA 5I74C 5FYJU 4QHMB 4BH8A 3FO9B 1FPTH 4X8JA 1E4WL 3FO2B 5B39A 3UPCA 3MBEC 3ARGA 5B38B 1NDGB 1H3XA 2JE8A 1RZ8B 2FO1A 5JDSB 4X6FA 2VXUH 1OP3K 4I3GA 4JGJA 1GZPA 5HYEA 4NC1C 4JN2B 4OTXL 5J0BA 2WK2A 2XG5A 3GO1H 1L7IL 1WWAX 4MJ6B 2BVEA 2Z91B 4IBLT 5GGTL 3IDNA 4AT6A 1KGCD 3VW3L 4ZS6C 2XNAA 1NSNL 3SEPA 2YUXA 3O4LA 3G6JF 4H1LG 3LHPH 4DK6A 4NO2B 1BFOB 4JHWH 1W0WA 2NZ9D 4HLZG 3PXJA 4MA3B 1U95B 3GJEA 4U0RB 5EO1B 5I75B 3V5KB 2VAAB 4QF1B 3QIBC 4WW2C 3C09B 4B0MM 2Z31B 2O61B 1WT5A 5I1KL 3MRMA 1BZ7B 2VZ3A 4BUHA 2J6EH 15C8H 3BRFA 3OBAA 1TZIB 4EDWH 4XNMB 3M8OL 1KGCE 2DJSA 1R3LB 2X1QA 3O6LH 4TYUA 4JFDA 1J7VR 2O5YL 3UC0H 5C6TH 4LEOB 1I9IL 3LH2L 5D7JA 2YN5A 4KK6D 1BF8A 3R06A 5IW1B 5JHLL 3O6ML 3MLSH 3IDIB 2IBZX 3FQWA 4R3SB 1OTSD 4KXZI 1U3HC 1P6FA 4GFTB 1AGDB 5DMKB 3OKDA 5GGRB 2C1PB 4O2EB 2O5XL 3RWGB 3FB6A 3D6GA 3MJ7A 3TVMA 4GKSB 4C55A 5K9QI 3L3KB 2H9GA 3QIWA 1DFBH 5E9DA 5I66B 4MNQD 1IAIH 5DLMH 2YKLL 4MDJB 4N8PA 3RWCB 4PLKD 1PLGH 1NLBH 2J8UA 2PN5A 4EI5D 1VFBB 3F12B 1VKXB 2P45B 5E2VH 4ZFZB 4X5XA 3S36H 1RIHH 4HG4J 3CSYA 4E5XB 3TIDB 5EU7E 4TNWF 3RPIB 4YR6B 5MERB 1DLHA 2IMNA 2MHAB 1N8ZB 1X4ZA 2LU4A 5HD8C 4UV7L 3TJHC 4M43L 2X9XA 5IB2B 5JIHA 1FVDA 1G9NH 4MNQE 3H42L 4ISVB 1MREH 1N5YL 3MCLH 4FQ2H 3EYSL 4ZUWB 5J57B 5M7QA 1E27B 3HMWH 4HLZH 2R2EB 5GGTA 3V6BR 5I30H 2C3WA 4JN1H 2D9CA 3LEVH 4KQ3H 2EDRA 2ADIA 3DX6A 4W4OA 4WFFD 3T65B 3GMNA 4MNQB 2CIIA 3CZJA 4G6KH 2HFGH 1OGAD 2A9NH 2DWEA 5DVOA 3HRZA 1NCTA 4M1DL 2JB6A 4U6VH 2E8ZA 3WLBB 3VXPB 4EI5B 3SCMD 4JVWA 1ZS8B 3LOWA 4Y4KA 4YAQA 3SE8H 2WAHA 5DRZB 1NJ9A 1RULH 4NFDA 5INDA 3O2WH 1CG9A 2DBJA 3KGRA 3EJZC 3GM8A 2H32A 1DUYB 2CKNA 4BELD 4ZPVA 3RTQC 2FJFA 4BFIA 2CK0L 4WUKH 4K3JH 3ARXA 5EU5A 1CE1H 4OM1L 4OGXL 4NBYB 4JFHD 4OF6A 4WFFE 1INEH 1FORL 1JWSB 3GSNB 1MCPH 4KPHL 3AGVA 4JFFA 4RCAA 2VABB 1OGAE 5IV2A 3IFLH 5E1HB 1EEYA 3HR5B 3I02A 5MENA 1FL6B 4FXKA 3ZE2F 3HE6D 5FYKL 4NYLB 4ZAKC 5E1AB 1HHJA 3QHZL 5D93C 3O4OB 3Q5TA 1OGAB 4QKXB 6FABL 1F02I 3SCMB 5C0BD 5KAQG 4E41A 2F9BT 3EDFA 4EIZC 4JFHE 4HJ0C 4PGZA 4U33A 3UJTH 2IGFH 5GRJH 4QXTB 4YPJA 1IAIM 3BSZH 3D1MC 4JQXA 3CVHH 5FO8B 3ES6B 1X5XA 3GI9H 3TBWB 4GRLC 4XB7A 4R96B 4GAJH 5ICZA 2EKSB 4DKEH 1WZLA 3MUGA 4Y5VA 5ENWB 2BMKB 3GBNH 3VCLA 3T1FA 4X4XA 2VXTL 4OF5A 1D9KC 3HE6B 5C0BE 2I60L 3EO0A 1D5ZB 2ZKHL 4N9GA 5CWSB 2FBJL 1H3GA 3WFHB 1ZT7B 1I7UA 1BVLB 3BPNC 4MXQD 1ETZA 1A3RH 5F3HA 1R3IH 2NY2D 5C0BB 1UXSB 2IBGA 5ELIA 2C7UA 5CEYB 3EO9H 1SEBA 3D39A 3RZWA 4K7FB 4PJFF 2W65A 3CVHB 1FFOA 3DWTA 3T2NH 1B6UA 3F62A 1CFSB 1I1FA 5MEPA 1RIVH 1FN4A 3SKNB 1ZEAH 3WJLC 3FQTA 1U8QA 1SBBA 4ODHL 5KVEH 1M7IA 3BZFB 1MRDH 4LP5A 5ADPH 3QPQC 5IBUB 2R0LL 1HWHB 2XZCH 4LDOB 3DJ9A 3TYGL 4TNWK 2F8XC 4OIBA 1IILE 3HZVB 3KYAA 5HHQA 5B21A 4XBEH 5C0ND 2DWDB 3SKOB 4LAQH 1A6WL 1SMOA 3KHOA 5FK9B 4H5SB 2QSCH 4HV8A 4WEUD 1S7UB 2W92A 2NR6D 5DJYA 4WWKD 1I9RL 2P5WA 4FZEH 2GSGB 2WP3T 3E8UL 1S9WB 3KPSA 3U30B 5DMIH 4HS6A 4KVNL 3TZVD 5EBMA 1JZ3A 3MA9H 4IOIB 1HOCA 4KY1L 3SBWA 1JF1B 4PJ8D 1ZLSH 1OT1A 1Y0LB 2JK5B 3MRIB 2XI9A 2QKIA 1C7TA 1K9TA 2FZ3A 2P4AB 3NIFF 4WENB 1JGDB 2HTLC 1YYLH 1N0XL 2L7JA 2G60H 2IC2A 5FO9B 5CBAB 5MEQA 3WUWB 3RWJA 3O2VL 4C59B 4AL8L 1QLRB 5AEAA 3S88H 3HG1D 2YD4A 3WHE1 5I76A 4POZC 1RZGA 4P9MH 3B3IB 3NIDF 4Z95H 4K7PL 4TSBH 2JCCA 5JXAL 1CL7H 3BISA 3QWRD 4LSVH 1NAKH 5F72S 4Q9CA 3O0RH 5FFLA 2EE3A 3VD7A 1YJDC 4TSCL 3SDXF 1XGTB 3QUZD 2KH2B 4WWKB 4HKXA 4XVSL 1D5IH 3KPOA 3D18A 5DZLA 3TZVB 2B0SL 1EEQA 1R3HA 4XCYB 4AENA 2VLLB 1MWAH 4JQVA 4PJ8B 1MFBH 1ZVHA 1AGCA 2HA1A 4XNQA 1YY9D 1T1YA 5TFSL 4DZBA 3LKSB 3HG1E 4OCSL 1HQ4B 4DZ8A 4UNVA 2OTWA 3MROB 4WI2A 2KZ1B 1YECL 3ZYIA 4FQIH 3SKJL 2GFBB 1AHWC 1RZIA 4JY6B 1MRFL 2YRLA 3OGCA 5IVXF 1TZGL 1RMFL 3HG1B 4YDJB 1CT8B 2HRPL 4KTEH 4JAMB 1FGVH 3EZJB 3BEWA 5F7YC 2XA8H 3VMNA 5DEFB 4ODTH 2AJUL 1AY1H 2Q8AL 2X4SB 2VDMH 5INCA 2OBGA 2B4CH 4OB5L 1I7RB 4WI8A 4GW5B 3N1GC 3QUZB 4BQ8A 4FZ8L 3VWJA 5JW5A 1MWAB 3VWKA 4XCNB 2AABL 4YHZL 5FOBB 4NRYA 5C9KA 4OLEA 3IVKA 4K71B 3ZKNC 1QVOB 2H2PD 2DQJH 2WINB 1E6JL 4YXLL 1Q9LA 3MOAH 1NCBH 4KJYA 1CXEA 4M61B 4MX7A 5DJXB 4XCFH 3GSUB 2MWCA 1NSNH 1WEJH 4LPYA 2DLHA 3EOYG 4X6BA 4EI6A 3BZ4A 1JMZA 4NRXB 3VFGH 3GNMH 5C6PB 1RUPH 1DP0A 5JHDD 3MCKA 1SBSL 4OGAD 4GXVL 1UA6H 4YHOL 2NTSP 1SY6L 2B2XL 3O3EB 2K1MA 2Z93A 2YUWA 1EHXA 3IFOB 1R5IB 4F7CA 2O5YH 3WIFA 3U48A 3CLEL 3CZFA 4X7SH 1I9IH 4OFYD 3U7WL 1GIGL 3MJ6A 5T1DH 1FRGH 3EYFB 5DUPH 4G9DA 3TBYB 3SDAB 3JTTA 1FNGA 2XYCA 5D7JC 2PW2A 5KSUA 5JHDE 5AZ2L 1GGUA 4HWZB 1UCTA 3V5HB 4QTIH 4GS7C 4X0KA 3STBA 5GZND 1AO7D 3DVIA 1J1XL 1XF5B 1NGQL 2ICEA 3M17B 4CADB 3MMEB 2DM7A 2NXYD 5D5MA 2VSCA 5JHDB 3HFMH 4AIZA 5TF1H 5H94A 4F2MB 5IF0B 2FCBA 2D7QA 5GGVH 3BJ91 4NUGH 3LDBB 1JNLH 1G84A 3NOIA 2BVOB 3TVMC 5IESH 4CMMA 2FJGA 4P48A 2YKLH 3MV7A 2K7QA 3FCTA 2W9EL 4Q0XH 3K3QA 1F3DJ 3OF6A 2G9HB 4YBQD 4P23C 2ATKA 3VXMA 2R0KH 4G80B 5HYJA 4A6YL 5BS0D 2OMBA 4OKVB 5IMMA 3NA4A 4JO4L 5CKGA 2J7LA 1JCKA 4N1HB 3W11D 1AO7E 4Y16B 4OFIA 1DEDA 1KJ2H 1XR8A 2C3VA 3IU3A 1R3KB 2DN7A 3UTPD 3MLXL 5KANG 1AGBB 4NWTH 3LKQA 4BSWA 5IT2H 4HSQA 1RU9L 3NPSC 1AO7B 2NXYB 3CFIC 3BQUC 4TRPL 3UJIL 3GK8L 1G0YR 2RHEA 1F4YL 1NQBA 4P5MB 2AQ3A 4Z5RB 4LCWA 3A6CH 3GKWL 3QBTB 5DJ2A 5BS0E 4M48L 3WFCL 1VENA 1DQQB 4UT7L 2JIXA 5T1MA 5F97E 2FX8L 5C07D 3JV5A 1T22A 3UTPE 4JPWH 1XFPA 2R56L 4R26H 5BS0B 1SY6A 2NW2A 3DRQA 4ODXA 5DEZA 5ILTL 4XVUD 4G43B 5EH1A 1CFVH 5K9OA 4U6YB 4P4RB 3RWEB 4HS3B 2EIZB 3U2SA 1O7VA 4XP1H 3UO1L 3PL6A 1X5KA 3MBXL 1IAKA 4UUJB 3B6SB 3LQAC 3D5OF 2CDEA 1BREA 2ZSWA 4GAGH 1KELH 1RZKC 4UOW0 3LKOA 3G9AB 5FYKH 5C07E 2Y5TB 2IEPA 5DI8B 2AEPL 2WLYA 3ARRA 3N0PB 4L8SB 4PJ5D 1TCRA 4ZQKB 5DRXA 5HHVL 1CLZH 4R97C 5FEBA 3U4AA 4PJDF 3TGXA 5JW4Q 2J4WH 4GW1B 1OAUL 4OCRH 5C07B 2X89A 3MRHB 4X5WB 4OSUL 4HQQH 1VPOH 4QRRA 2GIYA 3ARUA 4IRSA 3BKJL 4ZUVA 1FNAA 1HHHA 5GSRB 5GPRA 3MRKB 2VNCA 2HG5A 3NABL 3IDGA 5KSBA 4JQXC 1QLEL 4YC2B 1FLRL 2EDNA 3WS3A 1CD1A 4PJ5E 2H26A 5F7WC 3TCLB 5TE4H 5D7LD 1VSCA 4A6YA 3RWIB 4PJ7F 4Y5VC 5DHYB 5DQJA 3F6LA 3FAWA 1A7QL 4HIHB 4O2FA 3HZKB 1AGEB 4KRNA 3OKEA 4PJ5B 1MCWW 2DI7A 4LLWA 5I73B 1FZKB 1TQCC 3R0NA 3VXQB 1JP5A 3RNQB 3I75B 3RKDC 3GI8L 1AQKL 1H15A 3S98A 4CN1A 3UP1A 1M71B 4XZUB 1OHQA 4HWEL 4U05A 2AGJH 3PWVB 3T0EC 1X3DA 4DUXA 32C2B 4UDTA 3FB5A 3ULUC 2NZIA 4Y89A 4FXGB 1IGTB 3TN0A 3K74B 2J5LB 1NEZG 1X6NA 4LLMB 3UBXB 4MLIA 1NCUA 3ULVC 1F4WL 4NQXA 1T5WB 3BH8B 3WJJA 4IHOA 3DSFH 3NZ8B 1FBIL 4LKCA 3CH1B 3RAJL 4UV4H 2HKHL 3NFNA 4YHLH 3RP1A 2DD8L 2CKBA 2VQUA 1I7ZB 4TVSa 4NN7C 4EOWL 2GTWA 2HKFL 3G9VA 1R5VB 3X11A 1KFAL 1VEOA 3EO1B 1Z3GL 4F58L 5E7FA 2MCPL 1BVZA 4LVEA 4OQ1A 4NPYA 4LPVA 3IFPA 3T4AA 3R1GL 4U1GC 3MRDA 1FFQA 5EOQH 4F9PC 1R6VA 1FO0B 2D7TL 1VADA 4OQTH 2YOCA 3QP3A 3UXFA 3VFWB 1MI5D 3L7EB 3SBWC 3L9RA 2F58H 4F9LC 1UB6A 5CIPH 3T8XA 4MAYD 4OCYL 4NNYA 1EHLH 3TESA 2A2QT 4R4BB 2A6JB 3GBLA 4WUUA 3BGAA 3K0WA 4NKMA 3CK0L 1KT2A 4P4KA 3BGMA 4Y5YB 4JPKL 4U7SA 4OZFA 3BPCB 1JF5A 1U8HA 4X7TA 1BQUA 2A6DA 5DVNA 3H2WA 4OF7A 1UGNA 4Q6IA 1U92A 2P5ED 3FO1B 5C0FA 2VLJD 3MV9D 3O3BB 4ZNCD 4N9OB 3RGVD 1MI5E 2NY5L 5A2JH 2B7DT 3I6KB 4RGND 3SDCA 5T1LA 1HSAA 2GCYA 2BVYA 1IKFH 4X4MA 2B1AL 2BVQA 5ACLA 2FWOA 2RIKA 2AS5M 4XPTH 1EH9A 3CXHJ 1Y6KR 4QT5A 1MI5B 4HH8A 4TTDC 4PGCA 5DJDB 2EXYC 3MACH 4JQVC 2FD6L 1DUZA 5HJ3B 4GG8B 4PUBL 3O9WC 4MAYB 4ONOA 2NY1D 3EYQC 4G8EB 4PV8B 1OM3H 2P5EE 3EDKA 3RY6C 3MV9E 2YRPA 1GOHA 2YD7A 4RMUA 4WW1A 2ARJB 4WVRA 4JKWA 4Y88A 4RGNE 5MHSD 4QHMA 5J6GB 3FO9A 5GRYA 2A0LD 5DDHB 3FO2A 2P5EB 4BQ6A 4JM4H 4Q97A 3UYRL 5B38A 1NDGA 1B0GB 5F7EH 2YR3A 3MV9B 2YPVL 5JDSA 3RGVB 3WKNA 2NY4B 3MREB 2A6KB 4RGNB 2Y07L 4JN2A 4P5TB 1A14L 1T83C 4P9HH 4RX4D 5CD5C 3DXAE 1S9XB 2UZYB 4AYFA 4DN3H 1O5DT 3VWJC 1DBJL 3O2DL 4MJ6A 2Z91A 1NC4D 2ZJSL 1HDMB 1UACH 4UBDD 4XVTH 4KHXH 4XWGH 4NWUH 4JM2D 5MHSE 3EW3B 3DXAB 3NPZB 1MLCB 2VC2H 4NO2A 1BFOA 4OM0L 2NY1B 4AEIH 5C1MB 3P73B 1N6UA 4MA3A 4LSQH 1U95A 5EO1A 3V5KA 2AV7B 2VAAA 3HMXH 1K2DB 2M2DA 4PBXA 4QF1A 2APFA 2DIAA 4PJHF 3QCVL 4Y5XB 2O61A 1BZ7A 3HCVB 1BWMA 1MVUB 1MIEL 4FFYH 1QBMH 1TZIA 1GGIH 1L7TL 3GSWB 2VXQL 5KVDL 4XNMA 2DKMA 1R3LA 1EGJH 4AEEA 3GSNL 2EDDA 2I25N 4LEOA 4D9QD 5T33L 3V0WH 4LLYB 1EVTC 2R1YB 5IW1A 1P7QD 1MJ7H 3RQ3A 1NC4B 3C6SB 5C86A 1U91B 5DR5H 1ZT4B 4R3SA 3QH3B 4LVOB 3GHBL 4JM2B 5HHXL 4YH6A 1AGDA 5DMKA 4ONGL 2C1PA 4O2EA 2C3HA 4KUZL 3RWGA 1AR2A 2QEJA 3OSKA 2ZG2A 4HFUH 2J6EA 1KN4L 4GKSA 5E8EB 1NGQH 4QNPF 1CVRA 3L3KA 4RFNC 4OZGE 4D9QE 5I66A 4MDJA 3RWCA 4K55A 5ABDE 3P0YL 1VFBA 1WTGT 2R4RL 3F12A 1VKXA 1MFEL 5DC0A 4ZFZA 5KANI 5JW3L 5JDJA 4OZGB 2HH0H 3ARFD 4E5XA 3TIDA 5E5UB 4V2BA 3BWUC 3RPIA 5T1KA 4YR6A 1P7QB 3G5VB 5MERA 1WLHA 3OKYA 2MHAA 3C8HA 1N8ZA 2RJMA 1JPSH 5IB2A 2WZPD 1IARB 1NCDL 1MNUH 4X9FA 3I9GH 3QG7L 4ACPA 3TLRA 3G6DH 4ISVA 4O5LL 5EIQA 1UJ3B 2BOCB 1LE9B 4K94L 1JHKL 1IEBB 1T21B 3L5HA 5HGAB 3S34L 4ZUWA 2VDOL 1E27A 4WO4A 3V4PL 4TOYL 2NLJB 5J7CC 3T65A 4PJIF 5DYOB 1EZVY 3W5MA 1JL8A 4Y7MA 4MNQA 1ZA6B 3FRUB 3I2CH 5IROC 2BY0A 2HLFD 3WLBA 3VXPA 4EI5A 4M4RA 1AXTL 1ZS8A 3PWNA 2PTVA 1FFNB 1IGFH 1B0WA 5DRZA 2Y6SC 1MFDL 2IQAB 3ARFB 2I07B 2AJSH 5IMKB 4XXCC 1DUYA 5C08D 4JFZH 1HIML 3S37L 1W72B 2VZTA 2DJ4A 4MB5A 3CVIH 4AK1A 5B38G 1ZTXH 3PHQB 1JWSA 3GSNA 3VGHA 1N4XH 1U6AH 4Z0BH 4X80L 1PYWB 4G6FD 4JJHA 1NFDF 4LDEB 3HR5A 4GBXC 2YXFA 5FDYA 1G7MB 1I9JH 4NYLA 2QL1A 5E1AA 4OJFL 2BRRH 4V1DD 4ZTOH 3SGDH 2V9TA 3LQZB 1OGAA 2P8LB 1VFMA 4V3DB 1HN1A 4MXWH 4I0PA 5C08E 3SCMA 4X99B 4X98B 3H0TB 4BKLB 4KI1A 4PIRF 1Q9KB 3G6AB 5CINL 4GSDL 2DIBA 1JPST 4OSUH 4QXTA 3G04B 4P49A 5C08B 5DJ0B 5FO8A 2EKJA 3ES6A 5EWIH 3TBWA 3OAUL 3C08H 4XMKH 4R96A 3MJGX 1J88A 4V1DE 3SE9H 3BP4B 2X1XR 4IRSC 3QUMH 5CEXB 5ENWA 1OWRM 3AAZB 2BMKA 4NIKB 4I13B 2RBLA 1I85A 4G6FB 1FLRH 4TQEL 2K7PA 4UQ3B 3HE6A 5ISZD 4KK9D 1D5ZA 4DK3A 1LWRA 5CWSA 3BO8B 4O4YH 4V1DB 3WFHA 1ZT7A 1AFVL 3L5WB 1MRCH 1BVLA 4KRPD 1LMKA 2G2RB 1FNHA 4LRIC 5E56A 3N9GH 5F93C 4XH2B 3BUYB 5C0BA 1UXSA 4HUMB 3CFBB 1IT9L 3ALWA 5CEYA 5B3NA 4JFYB 5D2NE 3K4AA 2E8YA 5GJTH 3VG9B 3VGBA 3GHEH 4K7FA 3CVHA 5KG9B 4N5EC 4D8PB 1XGPB 1CFSA 4L8BB 3WSQH 5ISZE 2ADFH 5D2NB 4NJ9L 1HHIB 2E6QA 1KJVB 2YC1B 3BZFA 3H6JA 2UV3A 2D0FA 3JV4A 3MRJB 3QA3A 3F5WB 5E2TL 1F4WH 1S5HB 2C3XA 3D69B 3HZVA 5ISZB 1KTKE 3JBG7 4DN4H 1UYWL 4DW2L 3MRLB 3SKOA 4AQ1B 3VFUB 5EC2B 4KMTL 3WJJC 5I1GL 4N0FB 2EEDA 4KRPB 3T3PE 1S7UA 4MXQA 2P8PB 3QJHB 5DK3A 2GSGA 1S9WA 3ZE1F 4PRAA 1QO3B 5IIEA 2P7TB 2GY7B 4IOIA 5F70A 4M7LH 3BPLC 1JF1A 1CK0L 4HF5H 3ROLB 1QOKA 2JK5A 3MRIA 2WQ8A 3BDYH 2DQEH 3KPQB 1JGDA 2D7TH 3FN0L 4RBPH 1UM4H 4ZTPH 2OLDA 5DHXB 5FO9A 5CBAA 1ZGLM 3NIGF 5GS1C 2OJZL 3TBTB 2ICWJ 3WUWA 3KPTA 1KEML 2WQRA 5E4EB 1LHZA 4OCLC 1A1OB 1QLRA 4PBWD 4MD5B 3UTQA 2D9QB 2EECA 3WFZA 3DUUB 3ZKMC 3HNSH 5JNYB 1A7OL 1AP2B 3IU4L 1HI6B 4N8CH 5FHBH 5AUMA 1XGTA 4WWKA 1V3JA 2R69L 3IETB 5A2KH 4G7YL 3BMVA 5J6HB 3TZVA 4XCYA 1V3MA 2VLLA 1Q1JL 4RMTA 1MIML 4PJ8A 3C6LD 5KW9L 3EOBB 3P30L 1XH3B 2DS4A 3LKSA 3SDCC 2XV6B 1DQML 4HIIB 1HQ4A 5LGHH 4HK0B 1WBXB 3QCTH 3MROA 4P2OD 3WFDL 2FD6H 4L8DB 4JY6A 2ED7A 4PRPD 3HG1A 4YDJA 1MCCA 4NZTH 1CT8A 4JAMA 5DEFA 1RUMH 2OSLB 2X4SA 5L6YH 5D8JH 1I7RA 4PB9H 4GW5A 2I9LB 3VA6A 3QUZA 2PO6D 4M7LT 2EH8H 3UYRH 1MWAA 3BKMH 4ONFL 1EEZB 5L8JB 2HT4D 5IHUH 1QVOA 2WINA 3C6LB 4MQXC 1OOAA 2QSQA 4PRPE 2WBKA 3O2DH 1RHHA 4W81A 5DJXA 3GSUA 3WDIA 2ZJSH 5SX4I 2B5IC 1OP5H 2HWZH 1UH2A 1X4XA 5FYKU 2GJ6D 4WFHE 4FTVD 3TM6A 3TA3C 1KXQE 5D7SL 1IGCL 4PRPB 3DI2B 4ZO6A 4CMHB 3TH2T 4NRXA 2P44B 4JR9H 5I16A 5EU6D 4FFWD 1K3IA 4YBHA 5HYSB 3HNVL 5CILH 4WWID 4ORGB 1Q0YL 4U1HB 4M4PA 1DLFH 5BVJB 2OMNA 3C09C 4K8RL 2PO6B 2Z31C 1SJHB 3O3EA 1P4IH 3K4ZA 1MCJA 4KHTL 1NCCL 2KL6A 1RK1B 2VQTA 5CZKA 4X7CC 1E4KA 1R5IA 3IFOA 1HXMB 2GJ6E 2R23B 5C9JB 3N50A 5SV4A 4XP6H 4FTVE 3SGDI 2Z0BA 1W8NA 3CFCL 1WUNT 2FIRT 3EYFA 3TBYA 3SDAA 1C8PA 4G5ZL 1XCQB 3RJDA 4OUUB 5EU6E 4DFHA 4HWZA 2GJ6B 1NGWB 3V5HA 3BZDA 4FTVB 3E3QC 3S4SG 1HYSD 5E8PB 4QXUL 2IJ0C 1XF5A 3M17A 2NY5C 3D87B 4CADA 3MMEA 5EU6B 4GMSH 5JUEL 5JHDA 2NZ9C 4G9FD 4G6MH 4F2MA 4K3DL 5IF0A 1H3UA 1JZ5A 3CXDL 1BOYA 3FZUD 2VL4A 2YK1H 3FMGH 4Y2DD 1IC7L 3BD3A 3M07A 2BVOA 2WNGA 2OS7A 1BJ1J 4BM7A 4F37K 1ACYH 1AKJD 2ADGA 1OT2A 2G9HA 4XC1H 4UT9H 2R29H 1F11B 4G80A 4GW4B 4LCUB 1BBJB 4OFYA 5ID1B 4OKVA 1TXKA 1HEZB 3TT3H 4Y16A 3ZKXC 4KK6C 5LG1A 5EZLA 4G9FE 1R3KA 4MB4A 5L7XH 1DBMH 2KBGA 1OARH 3KS0J 1AGBA 5E2UH 1OTSC 4UAOC 1N3NB 1Q72L 3NFSL 4S1DD 4ZOBA 1MQ8A 1AO7A 1BIHA 1IZKA 4A2LA 5EU7C 4K3HA 3SQOL 5IEHA 4G9FB 3V4PH 1I7TA 4P5MA 1GOGA 4HS8H 4Z5RA 3INUL 1F6FB 5ALBL 3MLWL 4RISL 4Y2DB 1G0XA 1H3TA 1NPUA 5M94B 1DQQA 1AKJB 4OGYL 4WHYH 1A7PL 1MFAL 1AXTH 3IJHB 4XBGB 4N0UE 5JQHC 5BJTB 2E7CA 2ERJB 4S0SD 1C5CH 3B2UC 4EI5C 4HDIB 5BS0A 4I3SL 4DAGL 4MWFB 3RVWD 2RCSL 4UI2A 1BFTA 3UJJL 3E6FB 4G43A 4U6YA 2BCKB 4P4RA 4D3CL 2ZCKL 5KAQF 4HS3A 2EIZA 4CUCA 4N0UB 3T0BA 3ARQA 1TJIH 2UZIL 4FA8A 1G9NC 4UUJA 3B6SA 2UVFA 1WAAE 2ICWB 3R0MA 2AV1A 4PJXF 2DLFL 2Y5TA 4J3SA 1YEKL 5DI8A 1FO0L 4M5YH 1C1EH 4L8SA 1A8JH 3GSXB 1CLCA 4ZQKA 4XNXH 2XN9D 4J3WA 2B8OT 3O4OC 4GW1A 5DRNB 2BK8A 5CINH 4X5WA 1ZGLP 4AEHL 3LQMA 3SCMC 3T2PA 4LCCB 1RZFH 4FHBD 5GS3A 2XRAL 1NGZB 5IEKB 5GSRA 1I4FB 3MRKA 1EZVX 2CK2A 4MNGE 1VGEH 1KN2L 5EUOF 1JZ8A 3SKMB 3H9HB 4R8WH 2A77L 3VI3E 3TCLA 4ESKA 5JZ7D 3TT1L 3RWIA 2XN9E 3NZHL 2CLRB 4TQEH 5DHYA 3MLZL 5GHWL 2N7BA 4MNGB 5I2IB 1I85C 3S35X 3HZKA 1AGEA 5EIIB 2GK0B 4PJ5A 5T3ZD 5KJRH 4C56D 1DSFH 1FZKA 3JWDH 4LQFH 2MSPA 4PJBE 4JKPL 2XN9B 4CDGC 5FM8A 4YDKH 1SQ2N 4XPGL 3VXQA 1U2CA 2EH7H 2R1WB 5E5MB 3I75A 5HSFA 3HE7C 2BY1A 4AMKL 2WSKA 1EIBA 2F53D 1M71A 4XZUA 1A6AB 3PWVA 1W0YT 4G8FB 4PJBB 2FX7L 3PWLB 4PG2A 2UWEF 1XGQB 32C2A 1S8DB 3SE4A 4MNHB 4R2GD 3U7YH 4FXGA 1IGTA 1FE8H 1NDMB 2F5AL 4LLMA 4WU5A 3E6HB 4KTDL 3UBXA 3HZYB 5TDPB 3WEXB 5T3ZE 1T5WA 3BH8A 4C56E 3ARVA 3MXWL 3NZ8A 1NCAH 1MEXH 5J12B 3CH1A 3EJJX 4GKNB 1IC5H 3WFBH 4LHUG 5LWYL 4L4JA 3IDYB 1QBBA 2F53E 1I7ZA 1ACZA 4C56B 3F58L 1T1XB 4L3AA 1IE5A 5C7XH 1R5VA 3MR9B 3EO1A 1JFQL 3TBSB 4CW1B 5J1SC 4UIKL 1JBJA 1Q38A 2BXZA 2VLKD 4IOFD 2NY2C 5EOCH 3TWCL 2F53B 4NFBA 3HAEG 3U30C 2ITDB 1FO0A 5GS0D 1QBLH 4K23L 1AJ7H 1V3LA 5BRZD 4Z7VF 3VFWA 1M7XA 1BZQK 3L7EA 5E0QA 4LSTL 4R2GB 4Z76B 5GS0H 5DXWA 4DGYH 1G7LB 2XOTA 4HXBL 1I1AC 4R4BA 2A6JA 3QJFB 4NZUH 4WU7B 3PV7A 1X4YA 5I1CH 2DOCA 4Y5YA 4YK4B 1G9MH 3QFJD 3DIFB 4W70A 1KJMB 1YEGL 3GJFH 2VQ1B 3DMMC 4FQLH 2VLKE 5ADOL 4P3WA 4YEFA 4HUKB 3FO1A 3IU4H 4ZFGL 3RUGF 3R8QA 5IW6B 3O3BA 2B20A 5C71A 1GGCL 3B5GA 3I6KA 4RGOL 3MGOB 1PJ9A 2NR6C 2NCMA 2VLKB 4LVNB 4GQPH 3G5YB 4EN3D 3MRBB 3OAZH 4JGUA 1N59B 5KW9H 3TZVC 1MI5A 5TQ0H 4YQXL 3VRJB 5DJDA 3FO0H 1LK3H 3QFJE 1E4XL 5HJ3A 4GG8A 1RJLB 2AEQH 5BV7B 1QNZH 5DD1L 4MAYA 1OSZB 4BZ2L 4G8EA 4PV8A 1CIDA 3WFDH 3C2SA 2LFGA 2KQNA 5LCVL 3L5XL 1VHPA 5IJKA 2Q86B 1WK0A 1LDPH 1YEJH 3DSNA 3JWOL 4ZMAT 5TE7H 1KEGH 2ARJA 3QFJB 2OL3B 2E27H 1JNNH 3QUXC 1P4LB 5J6GA 3FRPG 5GGUB 4HPYH 5DDHA 4MJ4A 2P5EA 2CDGB 3TPKA 1B0GA 3MV9A 1JV5B 4M7KH 3RGVA 1JGVH 4MA8L 3MREA 5C0AE 2A6KA 2J88L 1GHFL 3P11L 1ZK9A 4P5TA 5IFAH 1I8KB 4GMTH 5IUSA 3QUZC 1S9XA 1JTOA 4EN3B 1IEAB 4WTZA 3HAEH 4HUNB 5C0AB 1HDMA 1MHPL 5CEZH 2JB5L 1V7NH 1OP3H 1B4JH 1BBDL 1YY9C 2ZOKB 3DXAA 4J1UB 1MLCA 1G9EA 5TGBB 5FKAB 4KU1A 4HC1L 3QIBD 4J12A 3SY0B 2AV7A 4KK5D 5L2JB 1K2DA 5I74B 3F6IA 4NC1E 4Y5XA 3ZDXE 2DQHL 2KKQA 4XP9L 1CGVA 3HCVA 1W72L 1MVUA 1X5YA 5GRVL 4GG6E 25C8H 1YNLL 3GSWA 3MFFB 2B4CC 4M7JH 5AYUH 1N64H 2OP4L 2ORBH 2D03H 1NCCH 1F5WA 4NQED 4I5BB 4LLYA 2J8HA 5TDOB 3FHAA 4GG6B 3MLYL 1OB1B 4K9EL 1NC4A 3C6SA 1U91A 1E4KC 5F9AC 5MI0B 1KBGL 4GXUN 1ZT4A 3T0AA 3QH3A 2H2PC 3L6FA 5TE6L 4U31A 4X5LA 3ZDYE 1KCRL 1CU4L 4O58L 1QR1B 3B2VH 3QIBB 4L9LB 5KVGH 1VERA 2DQGH 1WBYB 1F8TL 3Q5OA 4FOMA 5E8EA 4DUWA 4DGVH 2FHBA 2HVJB 4K3DH 1MFNA 1IC7H 4M1GH 4OGAC 5H37G 3NCJH 3LDBC 4TTGA 3KJ4B 4OLUL 4OZGA 4NZRH 4BZ1L 3BRGC 3I6GB 4LEXH 3HLAB 4O02L 2F19H 4UT6L 2RQ8A 1P7QA 3G5VA 4D0DB 5HD8D 5I17B 4JFED 4M93B 5C92A 2M8XA 3SHSA 1ZAGA 1U3HB 2B1HL 3EFDL 4X4ZA 1RSFA 2VXVH 1UJ3A 1FNEB 3RBSA 1LE9A 3AUVA 1IEBA 1T21A 5HGAA 1CZ8H 5ICYB 3I3BA 3NFSH 2E9BA 3LKNB 2NLJA 5DYOA 1L6ZA 4P46D 5GZNC 2BY2A 3RVXC 3TO2B 4TSAH 1SM3L 4Z7NE 1ZA6A 3FRUA 2NXYC 4JFEE 1N7ML 4ZDHB 1BP3B 1GYAA 4HC1A 1FFNA 5DTFB 4B53A 2IQAA 3ARFA 2I07A 2BNQE 1MFAH 1DVFD 5IMKA 1DE4B 1GPOL 4FP8L 3GRWL 1GCFA 4JFEB 4LDLB 1W72A 4YBQC 2KZWA 4DAGH 1IM9D 3HS0B 5LBSH 3K81A 1A1NB 3PHQA 1YYMH 4XPHH 1NAMH 3OB0H 4YZFE 1PYWA 2VL5B 2Y36L 1G7MA 4BQ9A 1K85A 1A4JB 4HBCH 2DLFH 2YZ8A 2H6PB 1TJHH 1YY8B 3LQZA 4R6UA 2P8LA 3WXVH 2F54D 4HIJB 1N6QH 1GGTA 3ZKSD 2ZPKH 4D9LL 4H20L 4A2MA 3SPVB 4X99A 4X98A 3H0TA 3IJYB 4OCMC 4BKLA 4CVXB 1TITA 1Q9KA 3G6AA 5GRXG 1A6TB 1JIBA 4XP4L 1DVFB 3QR2A 4L5FH 4NCDA 3G04A 1NUFA 5D4QA 5GGRY 3GB7B 5DJ0A 5C08A 4M03A 1IM9B 2EO9A 1UWGH 1NAMB 3RNKB 4GQ9H 5CJQL 2FB4H 3AFLA 5CEXA 5J9PB 3AAZA 4XVUC 2F54E 2V5MA 1MOEA 4QXGL 3EIFA 1CF8L 4FABH 3TFKD 4GAYB 1BIIB 4UQ3A 1O7SA 1MCKA 1ZVSB 3TBVB 2MQCA 5D93B 3BO8A 4V1DA 3VJ6A 5DJ6B 1FVEB 5HYFA 5HDLA 2EDKA 3LEYL 1KB5B 2G2RA 3G6JE 3VXTB 1CDBA 2AEWA 2F54B 1CFNB 1G6RL 4N8VG 3RWHB 1KXTB 3RY4A 3BUYA 5AZEH 1XF4B 3CFBA 4S1QL 4JFYA 2DL9A 2H2SD 1WJ3A 3WLWC 3G6JB 5KG9A 3MXVL 1LO3H 1RVFL 3QNXB 4D8PA 1XGPA 4BSJA 3LPWA 4L8BA 3NCCB 4NBZB 2BHYA 5D2NA 1HHIA 1KJVA 2YC1A 3QPQD 4Q9QH 4P5KB 1JI2A 3KNBB 3MRJA 4D94A 3RVUC 3SE4C 3F5WA 3HUJA 4AJ0A 4YXHL 1S5HA 3ARZA 3D69A 4FQCH 5ISZA 2J5LC 3OZ9L 5ETUB 3MRLA 4NM8L 1A6VL 3BPNB 3VFUA 3QDGD 5EC2A 5L0QC 5DT1H 4N0FA 4ZFOB 3TIEB 2QHLA 2YWYA 3WDHA 1RAMA 2P8PA 3QJHA 3STZB 1DQLL 4B50A 1CR9L 1MJ8L 3AROA 1HWGB 1T89A 5A2FA 1QO3A 4DUVA 1WIUA 1JZ6A 2NY7L 2P7TA 3LKRB 1K8DB 1DBBH 5BCAA 3STLB 1XF1A 1H8SA 3MLPA 3KPQA 3RDTA 1J18A 1B88A 1MQKL 1J0JA 3TBTA 3PGFL 1A1OA 4MLSA 2GI7A 3SJVD 4MD5A 4JFPB 3FOLB 1B4RA 3DUUA 3FONB 4PRBB 4UILH 5JNYA 1AP2A 2VZUA 5C0DB 1HI6A 4M6NL 4X9GA 4UTBL 2BSSB 4Y5YC 4N0CA 1FV1B 4XNZC 3NACL 2MPAH 1T2QL 2K9UA 4KKLD 5F3BB 3IETA 4Q9RH 3K4DA 5J6HA 4O2CB 5KTEL 5KOMC 4RGOH 1HKLL 4Q6YA 3VH8B 1IAOA 1MCDA 3EOBA 2VLMD 3JZ7A 2JJTC 3F7PC 4HIIA 2Q1EA 3QCUL 4HK0A 5KSBF 4NQUA 1P9MA 3NCFB 1WBXA 1FFRA 4UB0H 2YUZA 5T3XD 4L8DA 3JSSA 4YHKL 3RRQA 3PWUB 1BF2A 4DKAA 3BWAB 1JWMB 2FBOJ 4OD1L 2V9RA 5T3XH 5HDQL 4KK8C 1MJUL 2X4QB 4ODSL 4S1SH 3HC4L 4I0KA 2ENYA 5A43C 1IGYB 1XZ0A 3DARA 4JFOB 5BZWB 2OSLA 1UKTA 2LVCA 4X6CF 1F58L 2XQYK 5E99L 1UH3A 4LCYB 2I9LA 3V79C 2APVA 2AXJA 4MSWB 3ZE2E 2PYEE 1EEZA 4TUKL 4FNLL 1A0QH 2J88H 4OBSA 5EC1B 5E8DL 2NYYD 4Q74A 4RGNC 2CPCA 5C0CE 4HIXH 3QUYC 5J56B 2CDFB 4X4YA 3W5NA 3AB0C 4DQOL 1BM3L 3DVNB 1AHWB 4DJMA 5LQBL 2BC4B 1YDPB 3F8UB 1RFDH 2Z35B 4PRPA 5EG6C 4HWNA 1NMCB 2LVEA 2HJKB 5C0CB 1JGUL 1YNTB 3CMOL 3CC5A 1FDLL 3MLRH 1SEQH 4OCXL 3ZT6A 2DQHH 4ORGA 4U1HA 4XAKE 1I3GL 3PJSB 5BVJA 4YE4H 1IFHL 5ACZA 2ZWLT 4MYWB 4Y5XC 4P2QD 2PO6A 1SJHA 3PE9A 3BHBA 3SGEH 5D7IF 5DD0H 1RK1A 5J89A 1FZOB 1K6QL 3CAFA 1OAZL 3U6RB 1HXMA 2R23A 3I50L 5HVHC 3BMWA 5C9JA 4P9HC 1KLUB 1I8MB 1U42A 4LVHC 3MSPA 2YN3A 4RZCB 2Z8SA 3D9AH 5DJ8B 5TPWH 1LQVA 1XCQA 4OUUA 5DFVC 3F7VB 1IC4L 3VXOB 2GJ6A 1NGWA 3KLAB 4PJFE 3LIZL 4FTVA 1C16B 4LVOC 4UBDC 5GISH 3DBXB 5E8PA 2BVUA 3MODL 5EPMB 4P2QE 4JM2C 3MOBL 1TQBC 1DEEB 2DLGA 2GJZB 5EU6A 1QTYT 1OPGL 1JGLH 1PG7X 3MCG1 4LCIH 4N0RA 4PJFB 5FA4B 1BGXL 3P4OB 4XC3L 1G7HA 1QSED 3MYZA 3PP3H 4P2QB 3HNTH 1RJZB 2XZQL 1G1CA 1FL5B 1W2KT 1OAYL 1F11A 1BQHA 2WUBL 4GW4A 1FAIH 3QT2A 4LCUA 1BBJA 4ODWB 5ID1A 5BOPA 1GL4B 3B9DA 3VDAA 2ZCLH 5JIIA 1JFMA 1HEZA 4PV9B 5I1JL 3OJVC 2APXA 1RY7B 2B1HH 5HHOD 4WI3A 2IPKB 4I3RL 1KIRB 1XIWD 1I1YB 5JQ6L 1QSEE 1ITBB 1N3NA 4PGJA 4QRSB 3BT2L 3BDBA 3NIFE 4FQQB 4UNUA 2PXYD 2E7BA 4G9FA 1UJ3C 4Z18A 5IWLA 2YMXL 4F7TB 4NKIL 5LVEA 4Y2DA 4KROC 2QBWA 1QSEB 4NKOB 3N1FC 4P2RD 2X1PA 5DMJB 4P23B 1N7MH 5A3IC 4OLZL 5C0EB 4WV1C 4KZEH 3IJHA 3NIDE 4XBGA 1CDIA 5BJTA 5HHOE 4BYHA 2FGWH 1OW0C 4HDIA 5C0IB 4S1RL 4NZDA 5CUSL 4MWFA 1UADC 1FVCB 3SDXE 1EJOH 3E6FA 3MLVH 1DZBA 2BCKA 4J6RL 3IJSA 3QQ9D 4N0UA 5T3ZL 5HHOB 1FL3B 5H35B 1F45A 1XIWB 4HCRH 3NPSB 5I9QB 3KG5A 3SDXB 4P2RE 2ICWA 4AG4H 4CN4A 2Y36H 1YEIL 1Q9OB 2PXYB 3FFDB 3V0VB 5IB1A 2IPTH 3IDMB 2O5ZL 2R0WH 4R4FH 3GSXA 4IDJL 1WAAA 4NQCD 2VDPH 4P2RB 5IVXE 1H3PH 1X9QA 1UWXH 1NC2D 2WM0A 4X7EC 4KVCL 5DRNA 3EDJA 2HLFC 5FYJH 2R2BB 4AZ8A 1JYNA 4JHAH 4W6XB 1WICA 2Q7NA 1EVUA 1ZHBB 2AJVH 5IVXB 3IDJB 3ZHKA 1NGZA 1T80A 4EQ3A 1DJSA 3WD5H 5IEKA 1I4FA 2AXFB 4M8QB 2EDFA 3C5ZD 3KHQA 5DS8B 1HH6B 4JB9L 2UYLB 1ODAA 1A7NH 3SKMA 3H9HA 1PD6A 5DFTA 3RKPA 3WIHL 4NQCE 3E1F1 4QXGH 2AJXL 2CLRA 2XQBL 4R4ND 1QKZH 2EXWC 5D1ZC 4NZJA 3AS1A 4MNGA 5I2IA 1KCSH 1L0QA 5EIIA 2GK0A 3EUUA 1MAMH 1L4IA 2DB8A 3LEYH 4NQCB 2Y23A 5BV7L 2XN9A 4XTRD 3RKDD 1NC2B 2R1WA 5E5MA 5D72L 1FH5L 1A5FL 3B8YA 3T0ED 1MHEB 4H8WH 1A6AA 4IEFB 4G8FA 4PJBA 4RMSA 2OL3L 3VG9C 3PWLA 1XGQA 1B2WH 1S8DA 5GGVY 4MNHA 3QZWB 3GIZL 4JDVB 4KKNA 1VFOA 2FLRT 3C5ZB 2YUVA 1NDMA 5BW7A 4MQTB 3E6HA 5CGTA 3BZEB 3HZYA 5TDPA 4LMQI 3WEXA 4QHLB 5D2NC 3SKUD 3SDDA 2QTEA 3VXUD 1BQHG 1R5WB 1I8IB 3QI9D 4QEGA 1BX2B 3D25B 4PS4H 4GKNA 1DQDL 1QPPA 1J86A 4DKDC 1NCWL 4JG1H 3T0EE 5I0ZA 4J7RA 1YPZF 1TQCB 4C56A 1T1XA 3Q1SL 2CMRL 4C54A 3MR9A 4UU9B 2IH1B 1CR9H 3TBSA 4CW1A 2DKUA 1GC1H 1PY9A 3T0EB 1Q8MA 2F53A 2ITDA 3VXUE 2FIKB 4PGDB 1G7IB 4Z76A 1MCSA 4YDIL 3LVEA 4EUPH 2EE2A 1D6VL 1IGJB 2V17L 2VDRL 4LL9A 1FYHB 1G7LA 1J1OH 3GDBA 2CSPA 1BQLH 1IKNA 4ZFFB 1A3LL 3Q3GB 3TNNB 4CNIB 3VXUB 4WU7A 3PDDA 3DX8B 3QI9B 4CKVX 5EORL 3VD4A 3HN3A 4OLXL 3DIFA 4LLQA 1KJMA 5E4EC 1U8MB 2VQ1A 3VMOA 2CUIA 4LSPH 4DKFL 2LABA 4NN7B 1EMTL 4JQIL 1YEFL 5IW3A 3IT8D 2F5BL 3QEHB 5IW6A 1FIEA 2Q6WB 2W9DL 1QG3A 3KPPB 4RBPK 1UFUA 3MGOA 4M7ZB 1UWEH 5GXBB 1NKOA 3G5YA 3MRBA 4KZDH 4PJAF 1N59A 5EA0L 4TVPD 1EHAA 1KCUL 2QQLH 2VKXA 4JFQA 3S36X 1F3RB 3VRJA 2CR3A 4IJ3B 3O9WD 3QRGH 1KYOK 2GT9B 5DZOA 4TVPH 3EYQD 4UOJA 1RJLA 1OSZA 2OK0H 4JREB 1OD9A 4ZUSB 3SGKC 1FNSH 4P57B 1XF2B 2Q86A 5JXED 1HXYB 2DIJA 5BZDB 1EAJA 2H8PB 4ODSH 3MRGB 3QFJA 5LXGH 2OL3A 4NCC2 1P4LA 3BJLA 1TTFA 4ERSL 1HCVA 5GGUA 3RL1B 3MRCB 3VFNB 2CDGA 2V5RA 5EO0B 1JV5A 4UQ2B 4XCCL 1RPQA 5C2UB 5CD5D 3WIIH 3X3FL 4XPBH 1I8KA 4NQDD 3MGTB 4TUKH 5F1IB 4U1KB 1D5XB 1JWUB 2CR6A 4EN3A 4GKZB 2EZ0C 1IEAA 1S7SB 1CN4A 3JV0A 4YIQB 4MD0B 1I8LA 3O9WB 5C0AA 1F97A 3C6LC 4PJDE 4PBVC 5C2BL 5EZIL 2ZOKA 4J1UA 2ADJB 5TGBA 4DQOH 2OZ4L 5FKAA 4IRJC 4J3OC 5GSVB 3SY0A 4P2OC 5L2JA 2WBJD 4PJDB 3OWEA 4U0QB 4CMHC 4NQDE 2A9ML 3O11B 3QULB 3MFFA 3GM0A 3DV6A 5CMAB 4RWYH 4PJ7E 2AI0L 1OP5K 4I5BA 2D7OA 4NQDB 2PO6C 5TDOA 4GG6A 1KCKA 1CDUA 1OB1A 4MAUH 5BVPH 2G5RA 4RQQB 4ZOEA 4H25A 3KR3H 3EHBD 1KIUA 2HT2D 1UZ6F 5IR1B 1RZ7L 4PJ7B 2RAMA 1QFUL 5GRUL 3ARDC 1IGIL 3WS6C 4U4BA 5FYLH 4HT1H 3VFTB 1QR1A 4LARH 3QIBA 4L9LA 5D1XD 2WBJB 1WBYA 1J05B 7FABH 1H5BB 5I15H 3WKML 3MOBH 2HVJA 5E6ID 3CCHB 3FT4B 5I18H 3D2UA 1DL7L 2XFXB 2X70B 4B7LA 4FFWC 3B4NA 4XAWL 1U8PB 1JJUA 5DHVA 4JO2H 5A16B 3I6GA 5CLWA 3QO1B 3HLAA 4M5ZL 4AIOA 4WHDA 2WUBH 1UEMA 4D0DA 5I17A 1UKQA 4P3CH 4XGZB 1KULA 1U3HA 4MQSB 5FUZL 1INDH 1BPVA 1CXLA 4K7PY 1KB5L 4PRNB 2Q20A 4LHQB 4L9DA 3FHQA 2KUTA 4LSSL 1FNEA 1J8HD 3RVTD 1UM6L 3IFNH 3VDCA 1LILA 5ICYA 1WZ1H 2IAMD 2ID5A 3QHTC 3LKNA 5HGGS 5AWNL 1HINH 3FN9A 5F9DC 3IKCB 1HYSC 5E6IB 1SMAA 3TO2A 2OZ4A 4ZDHA 5K9JL 1XR9B 5IWLC 2Y6SD 1NMBL 4PY8J 4XPFL 1U8IA 2YWZA 2FLBT 1MFCL 3MOQA 4RMQA 4Y2DC 5DTFA 4OLZH 1IVLA 5BXFB 1DE4A 2P8MB 2AJ3B 4NHCL 2PKDA 4NN5B 4JFEA 1CD0A 2NX5E 1J8HE 4IIQB 5EZOH 2ERJC 3SOBL 4YX2L 3HS0A 1A1NA 2Y06H 5DWUL 3TV3L 2BNQA 1KJ3H 1OAXL 1YNKH 4GBXD 1OCWL 2NX5B 1J8HB 2VL5A 2EDLA 3BN9C 4G3YH 2IAMB 2D4DA 5C0RH 1A4JA 2A1WH 1V7MH 3T0XA 2H6PA 1YY8A 4S1DC 3WN5C 4CU7A 5FGSA 4HIJA 5HVFB 5I1HL 2I5YH 2DTML 4HJGB 4EDXB 5ITFB 3SPVA 3IJYA 4CVXA 4NM4H 5BMFL 1A6TA 1WIPA 3G5ZB 2VH5H 4I9WD 5IJVB 1DVFA 4R90H 4HULB 1UT9A 5GRWA 1R24B 4LSDA 1T3FB 1JUFB 1IM9A 3RNKA 1TNNA 4P2YA 1YN6A 5CD3B 4BFGA 4QRUB 3S5LG 4LCCC 3RVWC 4GBXB 1TVBB 4OLYL 1P4BL 4GAYA 1BIIA 4JO1L 2IAND 3EOAB 1ZVSA 3TBVA 5L8KB 4MQ7B 2IBBA 4LRNL 5DJ6A 1FVEA 2NW3B 3FQRB 2EE6A 4I9WE 1KB5A 3VXTA 4LLDB 2F54A 3RWHA 2YS4A 3SDYL 3WXWL 1A6PA 4LNRB 1S9YB 1ADQH 2DQTH 1XF4A 3QSKB 4KXZH 5C0GB 2FX9H 1A9BB 4PJHE 3L1OL 1T03H 4OIIH 3G6JA 1J12A 3T3MF 3KLSA 5HGDA 5I8OL 1A5FH 1CGSH 2CJUL 3QNXA 4HPOL 2BFVH 4OGZA 1YJDL 3Q2CA 4OF8A 4PJHB 3RWFB 4IRZL 2CUHA 3KNBA 3V5DB 1OAQH 5E5RB 3VFOB 3OXRB 1PEWA 5J1AB 5CSZB 1JRHL 5ETUA 5BW7C 5HBBA 3C8KB 1NBYB 3AS0A 4J2XA 3MRQB 1Z0MA 3TIEA 5JZ7C 2BDNH 5IQ9B 2OR8A 1KIQB 1LP9F 5J12C 1PX3A 3STZA 3CFJB 4OLVH 5BO1L 3GMOB 1CLYL 3JWDC 4KI5F 2R4SL 1CQKA 3IDYC 3R8BB 4NFCA 1KIPB 5IFHL 3LKRA 1K8DA 4QNPE 1MCOL 4Z7QF 5L88L 3NCYS 1JPGA 4AM0A 5DUMH 4PP2B 1NLDL 3STLA 2BSED 3WJLA 3GBMH 1TPXC 4TUJB 2E7LE 3VRLF 2EYSB 3ULSB 4U3XA 3NCYP 4RDQG 4YO0B 4JCLA 4OLWH 4FQHB 4IMKA 1T04B 1A3LH 2DDQL 3MUY1 3ZKMD 3ESVF 4JFPA 3FOLA 3CH8A 1LEIB 3RWDB 4JO3H 3FONA 4PRBA 1IKNC 1KTRL 4KDVA 5C0DA 1TJGL 5I1EL 2FL5B 3MUZ1 2BSSA 1FV1A 1II4E 3O6FC 4LSUH 4R9HA 3MRPB 4ORZC 1LO2H 3D85D 2DBLH 1RURH 5F3BA 4OD2B 4KUCF 5D2LF 4ZUUB 3BPLB 4O2CA 3S35L 4XNUL 2Z4QB 5E6YA 4PJIE 3F7YB 3VH8A 1MF2L 1T7VA 3BYTA 2X2YA 5D70H 4S2SB 4EBQL 3VGAC 4LVNC 1A1MB 2EDTA 4IOFC 5GS1B 4FQJL 4HWBH 4R7DB 1LE5B 2E9IA 1NGPL 2LV4A 2EC8A 3GJFK 5HDBE 4K2UH 1NL0H 2VZ1A 4PJIB 4QHNB 5GS0C 3MNVB 4PRHD 1HNGA 3BWAA 1JWMA 5F9JB 1NMAH 3DURB 2X4QA 4WEBH 4M62L 3MRFB 1YA5A 3P0GB 4RMWA 2AJYL 1IGYA 5B8CB 5JW4N 1EFQA 2LU7A 1A64A 3KAAA 2NMSA 3HPJB 1G9MC 5BZWA 1IQDB 4U1LB 2VDNH 1RUKH 3WFEH 1EUTA 4LCYA 1KF9B 3OAZK 5T5FL 3D85B 3MRNB 4JPVH 1NFDE 4MSWA 1CLOH 4R0LC 3AM8C 4MQXD 1JZ7A 5EC1A 4PRHE 5J06A 3WE6A 4LASL 4BUGA 2Q3ZA 4LSRH 2X1OA 1NFDB 2CDFA 2GYSA 2PYEA 4EN3C 3DVNA 5IM7B 1AHWA 3TA3D 2BC4A 4PRHB 1YDPA 4YHYB 2Z35A 5C0CA 2HJKA 1YNTA 3P77B 4J4PD 5L2KD 3LMJL 4HK3J 1TETH 3C2AH 4HEPG 2W9LA 3GGWB 4P59H 1MH5B 3PJSA 1E0OB 1RUAH 4MCZB 2MNUA 4K3EH 4YWGL 2W0FA 1BFVL 2HVKB 3EDEA 2OX5A 1AI1H 4KJPC 3ROOB 5EOTB 4ALAH 3MV8D 4J3UA 1I8MA 1Z9MA 2H41A 3MYJB 2WUCL 4RZCA 4V2CB 2YZ1A 4F57L 2B5IB 4KKCD 5L2KE 2YA2A 4RAVB 2R8SH 4ZS7L 4I77L 3F7VA 2NY0D 3CSBA 3L7FB 3IRZA 4MGXA 3TA3B 3VXOA 3KLAA 35C8H 5MI0C 5EIVA 1FCCA 1IGIH 4XVJH 1RZJH 1C16A 2DQCL 3DBXA 5EPMA 4PB0H 1OSPL 1B9ZA 5F7HA 1XGYH 5KSAD 1DEEA 3LS4H 2GJZA 5B3JF 5L2KB 3NA9L 1UB5B 3CNKA 5CSGA 4KI5C 4L9LC 3MV8E 4PJFA 4KK5C 5FA4A 4H26B 12E8L 2FATH 3P4OA 2VE6B 4UINL 2AXHA 1IGMH 5CCKL 2IQ9H 5I1IH 1UCBH 1VFAB 1RJZA 4M6OH 4N0YH 4QLRA 2E9WA 3HC3L 3HI5H 3LQAL 1FL5A 5A40E 4LFHG 3K46A 3MV8B 2PYFB 1EK3A 1FGNH 3E3QE 4TULH 1RZKL 4ODWA 4H88H 3CU1A 3KJ4C 4WY7H 4LPCA 1PSKL 2DYPD 5DD3H 3NH7L 4PV9A 1NUGA 1IQWH 2BJMH 3DGCR 2Q87A 3ZE1E 4UOW1 3MJ9H 4CL7A 2NY0B 3BE1L 5MP6L 4M93C 5JPMB 2IPKA 2LU3A 1KIRA 1JTTA 5E4IA 1I1YA 4NGHH 43C9B 1KB9K 3NTCH 2YHGA 5KVFL 4QRSA 5KSAB 4FQQA 1A6UH 1UM6H 1KC5L 4F7TA 4LLUB 2VXSL 3NIGE 5I8KH 1EO8L 1QSEA 4NKOA 1YEHL 3MLUL 3UPRB 1T7YA 5CJOL 1QUNA 4P23A 1GOFA 4W68A 5C0EA 3B2UD 1KPRB 2RFXB 1TNMA 1MFCH 5CJXC 5CSBA 2XY1A 1G0DA 5CAYB 1E6OH 4OZHF 1Y6NR 1FVCA 3ZKXB 3HPLB 2DYPB 2GY5A 1RIUL 5LKNA 2VDLL 5D6DA 5HHOA 1FL3A 5H35A 3BKYH 1XIWA 5EUKB 4UAOB 1QFWH 2OR9L 1S5IL 4M6MH 3BQUA 3SDXA 4GRWH 3LS5L 4ZO9A 1Q9OA 4H1LH 2PXYA 3MA7B 3FFDA 4JG0H 3V0VA 4F7PB 3MNWB 3WNLA 4XMLL 3CDFA 4DFIA 3ULUL 1CBVH 4WHCA 3LN9A 1K4DB 2ZCHH 3RHWF 4Y1AD 4P2RA 3U4BL 3ULVL 1Q0XL 4IDLA 2V2TB 4P46C 4K7PX 1PG7W 1MLBB 5GS2D 4P3DB 4HXAH 4CJ0A 2V7NB 3RVVD 4OV6F 3FAXA 1CGTA 2HMIC 5GS2H 2R2BA 4ELMF 3OB0K 1YEEL 2IPUG 1GGBH 1ZHBA 5E08L 5IVXA 3IDJA 4YFDB 2YD2A 4XP5L 6CGTA 1DVFC 2FEEL 3DGGB 3DYPA 2AXFA 4M8QA 3L95B 1RK0B 5F7MC 4OD3L 2VDQL 5DS8A 5B39G 3B5TA 4KKBD 5E2JA 3DO7A 2UYLA 4H1LB 4Y1AE 4WRLA 5ITBL 5FHAL 4DGIL 1S9VB 3RIFF 2EDWA 4FFZH 3NVQA 4HAGA 5IGXL 1IL1B 1WTLA 1QA9B 3D3VD 3ERYA 1CDHA 4Y1AB 4QWWD 2XPGB 4NQCA 1F90L 3NAAH 2CLZB 4X6DF 3HE7D 5LGKA 2LE9A 1BAFH 2ED8A 3L1OH 3N85H 1MHEA 1I3UA 4YXKL 1NGYB 2DL2A 4P0DA 4PD4K 2P48B 3H3PH 3QZWA 1PBYA 4JDVA 3V52H 3CLFL 1IBGL 3C5ZA 4NOFA 1VA9A 3CUPB 3BZEA 2VERN 3CSGA 3A6OA 4QHLA 1B0RB 1LO4L 3D3VE 3DI3B 2MJWA 1FIGH 1PY4A 1I8IA 1R5WA 4HWUA 5EDXA 1G7QA 1BX2A 3D25A 5DRWB 4HX1B 4UTAH 1T0NB 3TFKC 1CDCA 4U2ZA 3C60C 3D3VB 5FA3B 4XNYL 4X8XA 1Z2KA 4BQCA 2QQKL 1G7PB 3VE0B 4CVWA 2CLVA 1ZANL 3JXAA 4UU9A 2IH1A 3GIVB 3HE7B 1QHOA 3MC0A 3OKLB 2DQDL 1P84K 4LIQH 4KFZC 3T0EA 4OFVA 2DQIL 3RX5A 4H0GA 3HI6H 1TTGA 2AK1H 2FIKA 2H2SC 4PGDA 1P5VA 5DEGB 2WV3A 3H9YA 2Q8BL 4NSKB 1I1AD 1IGJA 3ARGD 1LEGB 1NUNB 4ZFFA 1A7BA 2Y7QB 3Q3GA 1UM5L 3O6KL 4CNIA 3VXUA 4CU8A 2D7PA 3DX8A 3QI9A 5SWQB 5FUOH 4Z7WF 3DMMD 3O41B 2IFFL 3THMH 4EEEA 4TNVF 3KJ6L 1U8MA 3NMEA 1CS6A 3PDGA 4IMKC 4RFOH 1HZHH 4NP4H 3MX0A 4O9HH 3VDBA 2V5TA 4FMFA 4X6EB 3QEHA 2Q6WA 4QHKI 3A6BH 5TQ2L 3KPPA 1ERNA 5E00A 3CFDB 2NY2B 1QYGH 4F9PA 4IS6B 3WV0A 4HIEB 2F15A 3DRTB 3OPZL 5EFIB 4GLRI 1W0VB 3AVEA 3LAFA 4O51B 3ALXA 2EYTB 4WI9A 3RHWK 4F9LA 1S9KC 3MJ8B 2GT9A 1ZA3B 1C5DB 3LZFL 5TH2B 4FN0A 1I1AB 4HJJH 1D5BB 2JTDA 4CVZB 3ARGB 4KJQD 4Y0GA 4ZUSA 1KACB 4X83A 4OZIF 2Q7YA 4YUEH 4P57A 1XF2A 1R3JB 3CU7A 3QUXD 1HXYA 3DETD 5BZDA 2H8PA 4WHTB 3DMMB 3FQUB 3MRGA 4JDTH 1DBKL 3PP4L 3RL1A 4NNXB 5IHZB 3VFNA 1INQB 4QGYA 2VR5A 4M9OA 1MPAH 4NN6B 3QNYB 3T1WA 1GJIA 5EO0A 1CD8A 4KAQL 4UQ2A 1H8NA 1I75A 3IDUA 4YHMH 1JF6A 2EC9T 3Q6GH 4PJXE 3QXVA 1AGFB 2VUYA 4PFEA 3RIFK 3ME0A 1A4KB 3MGTA 5F1IA 1NANI 4U1KA 1D5XA 4ZPTB 1JWUA 3VMPA 3UTSD 3OKNB 4KKLC 4GKZA 1JK8B 4LU5H 1S7SA 4JJ5B 4YIQA 4MD0A 3IAQA 5J3HC 1J8KA 3O9WA 1ITCA 5J1TC 3QIWD 4Z8FL 5E9DD 4PJXB 1OAKL 4Z9KB 3QPXH 5LGJB 3FFCD 2ADJA 3HUJF 5FCUL 3RY6A 3QEUB 1J5OH 5JR1H 5GSVA 1D6EB 5DQDH 3DV4B 3QUXB 3B9EA 3BAEL 4PJDA 5ESQB 1NMCC 3O11A 3QULA 4JKMA 3ZYZA 2V5YA 3QZWG 3UTSE 1VESA 2EDBA 1T20B 5F6IB 5C09D 5EUOE 3ARTA 1UQSB 2MFNA 5CMAA 1T83A 1QFWI 4XHJD 3P0VL 1E4WH 2IH3B 4NQDA 3FFCE 4PJEF 5HGBB 1JHLL 4G6AD 3UTSB 1DBAL 1CXKA 1WFUA 4RQQA 5EUOB 4QY8B 4OTXH 1KOAA 1XMWA 2WUCH 1T4KB 3QIWB 5IR1A 4PJ7A 2NYYC 1L7IH 1EV2E 5GGTH 3FFCB 4JRXD 3VW3H 4G7VL 3KLHD 3VFTA 5HI5D 3NN8B 5C09E 1PVHA 3H3BC 2WBJA 1J05A 1H5BA 2E9JA 3GSOA 2UWEE 4LNVA 1EPFA 2X4PB 1KTDB 1UJTA 3GSRB 2D4FA 3CCHA 3FT4A 2XFXA 2X70A 5C09B 2H32H 5I1KH 3P4NB 1Z9OA 2UWEB 1U8PA 2V6HA 4MCYB 5A16A 3QO1A 3QXTA 1I1RA 1ZT1B 3M8OH 2WANA 4JRXE 4FQPA 4WI4A 1R0AL 1RZKH 2AQ2A 4XGZA 3LH2H 4MA7L 3JTSA 4PRNA 3DLQR 5JHLH 3BUTA 5F1SA 3O6MH 4JRXB 3T0DA 4HUXB 5DVKA 3HRZB 5FAAA 3EYUL 4BZYA 3UAJD 2XG4A 5IBTL 3PP3K 4NJAL 1JZ4A 4U1NB 1WV7T 4Z7VE 3RVXD 4I48B 2O5XH 1MUJB 3ARWA 5E6IA 4KKAD 2VDKL 3V7AG 4YFEA 1IAMA 1ZSDB 2PR4L 3QHFL 3PUCA 1A7RL 4Z7VB 1SYVB 2SEBB 3Q5YA 3REWB 5JW4M 2GK2A 1JRHI 3U1SL 5BXFA 2N7AA 2P8MA 2AJ3A 3FQXB 4IIQA 3RUGE 3OJDB 1C12B 3KYKL 3O3AB 2J8OA 2VDLH 4UV7H 2NX5A 1J8HA 4M43H 1V05A 3RUGB 4EJ1C 2HN7B 5D6DC 3E0GA 2VOTA 4ZXBD 2IAMA 1XIWC 4PPTA 1H9VA 1A9EB 3H42H 5I9QC 1N5YH 2YD1A 2D0HA 1LO0L 3EYSH 5IROA 3AS3A 2PXYC 1BOGB 3OV6A 4HJGA 4EDXA 1CCZA 5ITFA 3K2UL 1JTPA 4DVRL 1PG7L 1BEYL 3G5ZA 4XXCA 5CZVL 3MUGB 1TTUA 4M1DH 1SJEB 1S78C 5IJVA 1DN0B 3JV6B 3VFPB 5F9OL 4GKOA 5GJSL 1R24A 1XGRB 1T3FA 5GGQL 1JUFA 2DJUA 1KJ2B 3BH9B 1URLA 2VO5A 5CD3A 4QRUA 5HDOA 3U79A 2BVPB 2CK0H 4U1SB 2CKBL 4GBXA 1TVBA 2QQNL 3J7HA 4OM1H 4XWOD 4OGXH 2VMFA 3ARBC 3QQ9C 1DDHB 4DVBB 1FORH 5C3TA 4KPHH 3EOAA 4FQ1L 3GMQB 4ZXBB 3OXSB 4MQ7A 4DTGL 1UWXK 5FYKD 4DGIH 2W65B 3RL2B 2NW3A 4OCWL 3FQRA 3CMGA 4RIRB 4IMLB 4LLDA 4ZO8A 3PIQB 1CYGA 4LNRA 1S9YA 4N68A 5IB3B 3QHZH 5K9KB 3HA0A 5C0GA 3WLWD 2A38A 2IFGA 6FABH 1A9BA 1OL0A 2JJSC 3FKUS 1PEZA 2E6PA 2AQ1A 5HHQB 1KCVL 1QSFD 2YEZB 3V4VL 4PJHA 5FYKE 3RWFA 5ALCL 3RVUD 1FZMB 1F6AB 3V5DA 4MDIB 4NNPL 3VFOA 3OXRA 5CSZA 1HQRB 2Z8RA 1CD9B 3C5ZC 1LO4H 2AXGB 3EFFB 3NCEB 3VXRD 3C8KA 4LRIA 1NBYA 1AC6A 2VXTH 3MRQA 2EDJA 1MCRA 5HI4D 5IQ9A 8FABB 2I60H 2ZKHH 1KIQA 4R4NC 3ZZ1A 2FBJH 3CFJA 3GMOA 1QSFE 2GHWB 1KIPA 4N5EA 4JVPA 3VFSB 1GAFL 3T04D 3RA7L 2IG2L 1WFNA 3U9PL 4PP2A 1HSBB 4XTRC 5I19L 4H8WC 4TUJA 2EYSA 3ULSA 1QSFB 3VGDA 3ALPA 4AH2B 3VXRE 5HYQB 4YO0A 5D7LE 5JPNB 4FQHA 4HKXB 1T04A 4ODHH 3ZT7A 2AAVA 1X5GA 3VWKD 3KPLB 3D18B 1SVCP 3MRRB 1VDGA 1LEIA 3IDXL 2UUDH 5L0QB 3RWDA 3VXRB 1T6WA 2R0LH 5D7LB 3TYGH 1J87A 1F3JB 3TJEL 3QI9C 1MAKA 3BPOC 3K1DA 4MA1C 1T1ZB 3MRPA 3TPUE 1A6WH 1KV3A 1RUQL 3VG0L 4OD2A 2HYMA 3EKCA 5F88B 4W6YB 3AXLB 1I9RH 2L0DA 2Z4QA 4LP4A 3F7YA 3E8UH 1EAPA 3OGCB 1GC1C 4KVNH 4S2SA 3TPUB 4M7ZC 1CFQA 4KY1H 4WDIB 2EEBA 5GS1A 1FPTL 5DQ9A 1LE5A 4EXPX 4S0UC 3FQNB 5JW4R 2C3GA 4PJIA 4QHNA 3MNVA 2VXUL 4KK8D 2C9AA 2EDHA 4IJ3C 5C8JB 5F9JA 1N0XH 4RNRA 3DURA 4XHQA 3MUHL 3VWKB 3MRFA 4JREC 5B8CA 1L6XA 5SX5H 3GO1L 1MCHA 3O2VH 1KENL 4AL8H 3HPJA 4S10A 5J8OA 1IQDA 4U1LA 1SYSB 4XNZB 1PKOA 1J0YA 1DBKH 4HGKC 4Z7OF 3VA2C 4XBPB 4K7PH 3MRNA 5T5NF 5JXAH 4KMLB 2O93L 2DI9A 4C83B 4JHWL 3QG6B 2BERA 4TSCH 4EI6B 4HKZB 4CAGA 4ODBD 4XVSH 2J12B 3C5SA 4NQTA 5KBNC 3QUYD 1JYXA 2B0SH 1NFDA 2BNRD 3H3KA 2J6EL 4U7MA 5DFWH 15C8L 4JDZB 5KS9F 5CIPB 5IM7A 3QQ3A 5TFSH 4EDWL 4PRHA 4OCSH 2EIBA 3O6LL 5I71B 3UTTD 3UC0L 1DQTA 5C6TL 1Y6MR 3P77A 5CP3A 3Q0HA 2Z8VC 1YECH 3SKJH 2VLJE 5GZOC 3UEZA 3DROB 1NEUA 1MRFH 3GGWA 3ZL4L 2V2XB 1TZGH 1CVSC 1RMFH 3MLSL 1JHTB 1M6OB 5FO7A 5JXEC 1MH5A 2VRAA 2HRPH 3LB6C 2EDQA 4MCZA 5GRZA 1FP5A 2AJUH 4I2XE 2Q8AH 2HVKA 2VLJB 3BRDA 2BNRE 3FB7B 1RZ8A