5E8OA

The structure of the teipp associated altered peptide ligand trh4-p2abu in complex with h-2d(b)
Total Genus 65
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
65
sequence length
276
structure length
272
Chain Sequence
GPHSMRYFETAVSRPGLEEPRYISVGYVDNKEFVRFDSDAENPRYEPRAPWMEQEGPEYWERETQKAKGQEQWFRVSLRNLLGYYNQSAGGSHTLQQMSGCDLGSDWRLLRGYLQFAYEGRDYIALNEDLKTWTAADMAAQITRRKWEQSGAAEHYKAYLEGECVEWLHRYLKNGNRTDSPKAHVTHHPRSKGEVTLRCWALGFYPADITLTWQLNGEELTQDMELVETRPAGDGTFQKWASVVVPLGKEQNYTCRVYHEGLPEPLTLRWEP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords H-2 class I histocompatibility antigen, D-B alpha chain
publication title The MHC Class I Cancer-Associated Neoepitope Trh4 Linked with Impaired Peptide Processing Induces a Unique Noncanonical TCR Conformer.
pubmed doi rcsb
source organism Mus musculus
molecule tags Immune system
total genus 65
structure length 272
sequence length 276
chains with identical sequence D
ec nomenclature
pdb deposition date 2015-10-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00129 MHC_I Class I Histocompatibility antigen, domains alpha 1 and 2
A PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5e8oA02
3.30.500.10 Alpha Beta 2-Layer Sandwich Murine Class I Major Histocompatibility Complex, H2-DB; Chain A, domain 1 MHC class I-like antigen recognition-like 5e8oA01
2OJEB 1IM3B 4X5WB 5EU6A 1XF5A 3MYJB 1FBIH 3MRNB 4PRDB 2JIXA 4ZUVA 5T3XH 3RVXD 2Q76B 4X7SL 5BV7L 3VXTB 1OGAE 3UTQA 1T04B 1EDQA 1B90A 4KY1H 3IDXH 1YN6B 4OCLC 5FUOH 5L2KA 1BPVA 3PNWB 2J8UA 4XMLH 3EOYG 1ZV5A 1YNTA 1KTKE 4DKFL 3UJJL 1KNOA 2VAAB 4O2EB 5BZWA 4WI4A 5JOEA 2NXYB 3D48R 3MLVH 2HYMA 1NGQL 5EO0A 3DOSA 3MMEB 4GSDH 5DRWA 4DN4L 3BUYB 3O4LD 3QDGB 1BBDL 2BXZA 3PWPD 4PJAF 3BSZH 1RULH 1G9NH 5JDSA 1T6VN 5TGBA 3KYKL 1VFAA 4WGVB 2P5ED 5D7JC 3SJVE 2PTUA 4J3SA 2ZJSH 4P5TD 1WBZB 2VH5H 2Q87A 3WUWG 1HHJA 4JGMA 1IGTB 1KJ2B 4TTDC 4IIQA 4F3FB 3HE6B 2KL6A 1MHEA 2DTSA 4HCRH 1I9IH 4PGDB 1CR9L 1RIHH 1JHLL 2EYTB 2X9WA 1CDGA 3MGTA 1NGYA 1XGQA 3BPLB 3P9WB 1CDYA 5DZNA 4MJIA 1MHHB 4LP5A 4H1LG 3RY6C 4H20L 4X6EB 3BP5A 3MV9E 5IQ7H 2HJFB 5K59F 2V5SA 2H1PL 1TJIH 3INUL 5E8DH 4HIIA 2YPVH 4HGKC 2ZUYA 1II4E 3PHOA 4K3JH 3GSRA 3IU4L 1T0MB 4APQB 1R3KA 3OGCA 4NQUA 3CSYB 3BKYH 4EUPH 4HC1A 3RGVB 3HPLB 4K2UL 4JM2D 3VRJA 4P99A 3QWOB 5FA3A 2XZZA 3KR3H 5TJWK 4ETYA 3QZWG 1M7XA 2VZUA 2DKUA 4UQ3B 5HYJA 1IL1B 1E27B 3Q1SH 5C9JA 4RRPG 2GSGB 3QUXA 3ZDYE 1DBBL 1LWRA 3DUHA 2YC1B 2V7HB 3DO3A 4G42A 1H15B 3L5HA 3VD3A 4FN0A 5AD0A 4PJGB 1GGTA 4LP4A 3MBXH 1MCHA 3MGOA 3LRSB 4NWUH 1F58L 1J88A 3ZYOA 3CVIL 4R4NC 3MO1A 1QA9B 1QLEL 3C6LC 2BY1A 2P43B 5KSBE 4NC0B 3PIQA 3CPLA 5HGHA 4G6KL 3BDYL 3T65B 5SX5K 1KPRA 4JZNA 4JG1L 4YHNA 5F7EL 5A2IH 2CXKA 5EZOH 2HLFD 1NCBL 4HUWA 3AS3A 3CVHL 2PETA 4NKIH 1T7VA 4KH2A 3I2CH 3H9SE 2R56H 5E94A 1D5XA 5KW9L 1RHFA 5F9OH 5KVMC 1MFDL 1KJVB 1PFCA 1S7VA 3ZT7A 2A83B 5B8CC 4KK8C 2CDFA 1CXHA 3GO1L 3MRCB 4IMLB 1GYAA 3Q6GH 4NUJA 1VDGA 1AO7E 5CMAA 5FDYA 1J8HE 4O51B 4HBQA 3VFPA 5GS0H 5F7DA 4BM7A 4EUPB 5TPWL 1RJYB 2B20A 1BZQK 2HH0L 4PJDA 2NTSP 4I0CC 3DLQR 3ET9F 3DMMD 5E8NB 2XTJE 4D9RD 1OAKL 2YD1A 1A7BA 4DTGH 1KEMH 1WWWX 4EDXA 4NDMA 1Y0LA 3RUGE 1N2RA 4X6DE 2X89D 3BYTA 4OZGA 4GG6E 1UM6L 4G5ZH 2IF7A 4LLAA 2ERJC 2AJZA 3W9DA 5I30H 1DBAL 3UJTH 1OAYL 3T77A 1XGUB 4EQ2A 4JPVL 1T03L 2D7NA 4WGWB 4PRBA 5ITBL 4X6CE 4NC1C 2EXWD 1MI5D 3T4YB 2VLRE 5F7KC 3DUSA 1MCQA 4QO1A 5FKAB 3TT3H 2APVA 4JM4L 3SBWA 1KFAH 1IZKA 3SDYH 1RU9L 5K33A 1CT8A 5BVJB 5TFSH 5JPNB 1CXLA 1A3RH 2HFEA 1KIPB 1I9RH 5J8OA 3RWHB 4M7ZC 1AH1A 3ROOA 2QSQA 4PJ9D 3QPQC 4A6YH 3OAYH 2J4WH 2VDOL 4UIKL 1GGUA 4K3EL 4ZOBA 1KBGH 1JUFB 1A4JA 2MTPA 1FNAA 1ZGLB 4L5FL 4TPRL 4PRAA 4QXUH 4JAMA 5AYUL 1IAII 1YYMH 5EU3A 5E24E 1TITA 5FM5O 4LF3B 1HH9A 5EOCH 4HIHA 5J1SC 4NRXA 4OLWH 43C9A 2G9HA 5IQ9A 4Z0XA 2A77H 9CGTA 1T3FA 1MIMH 5J12C 1JGLL 3FN0L 2BHYA 3C8KB 3MLRH 2VLLA 2MQ3A 3BGMB 5AZ2H 1TPXB 1WT5A 3OR7B 4QCIA 2VXQH 1T5XA 4XPBL 4GT7A 4DW2H 1ZGLM 1MCSA 3O8XC 2GFBB 3WFZA 1T2QH 5EOTB 5C0FA 1MWAL 1KLGB 4KMTL 5HBBA 5KTEH 4NFDA 1U36A 2QKIA 3HZMA 1OQXA 4OZHA 3EO9H 2VIRA 5KVGL 2RCSH 4KKAC 3W5MA 3QI9B 4D8PB 4U6HA 3VW3L 1MEXL 2VB5A 1BEYL 3PABB 4LCUB 4DQOL 5T1LA 4JR9L 5JUEH 3QHTC 4I2XE 4LCCC 3F65A 3RZCA 1UCBL 1WWBX 7CGTA 3WKNA 5KSVA 1GC1C 1FV1B 3N1GC 1A3LL 4U1NB 4P2YA 5C0CE 3TYGL 3EYUL 4K8RL 5HVGB 2G5BA 2B8OT 1W2KT 3RTQD 4U1MB 1F4XL 3VFUB 4ZO8A 3MLWL 5K9JH 4IRSA 5DRXA 2AXHA 5FOBB 4LGRB 1S3KL 5HGBA 3MNWB 4HK0A 5ADOH 2F5AL 2P44B 1A14H 2L0DA 1CGWA 5E6IA 4E41B 4WWKA 4F7MA 4XCEB 3S98A 3IDJA 1U8JA 4HMCA 5IW3A 5E2TL 2G75A 5BMFH 3GIZL 2AXFB 3N1PC 1MFBL 3G6JA 4ZNCD 5GRWA 3RWGA 1GZQA 1NFDF 3H0TA 3GSWB 4HQQH 4DN3H 1YMMB 5CCKH 5KAQG 2F54E 1DQQA 4D0DA 2WBJC 1LO4H 3MZTA 1JI1A 4N1CA 1S5HA 1AGBB 2LV4A 4G8GD 1IGFH 1DL7H 4O58L 3HZYA 1VPOL 3VD9A 3LB6D 1R6VA 4LSTH 3VWKC 4KHTL 4TNWF 4POZD 2NX5A 5MHSD 4GRLD 3MOBL 4XPGH 2XY1A 4NKDA 4LARL 4M7KL 1C12B 3L9RB 3O3EB 1QSED 5CSZB 5GRYA 4KHXH 1WEJH 4FFYL 5KJRH 2NTFA 1LEGA 2JKXA 1YEKL 2EICA 5BS0E 5FYLE 1EHLL 1W8OA 3HR5B 5DHVH 3F5WB 4XNYH 4OI7A 3ZT5A 4NZDA 4BUHA 3H7BA 3DVGB 1H5BC 3L3DA 2DLHA 4PJAE 3ARFA 1U3ZA 25C8L 3QDHA 4FQCL 2BVUA 1RK1B 2E6QA 2OXGA 3BVNB 3CNKA 4X7SH 5BV7H 1LVEA 4R97B 2AS5M 2P5WA 2UUDK 1Q0YL 5CEZE 5HD8C 3LQAL 1UXWB 3CLFL 1IVLA 4L4VA 2FDBP 1AQDA 1JN6B 3UJJH 1UENA 3CFKA 4Z7UA 1CXFA 3I6KB 3ALPA 1PKQE 3ZHKA 1NGQH 4K7FB 4RDQF 4DN4H 1XCQA 3KJ4C 4LRNH 1BBDH 5HHMD 1PX4A 1KTRL 1IM9A 4ODHL 5GJTL 4KUCD 4PJXF 3TA3D 3KYKH 1S7XA 5CD5C 2I9TB 2L4OA 4OZ4A 3X14B 5DJYA 4HCRA 3VGGA 4PG2C 3VGBA 3DBXA 3HHRB 4IEFB 4LSUH 4PR5B 4Y4KD 1OSZB 4MXQD 2D7MA 4TVSa 1F8TL 3DVFA 2WUCL 3WNPA 1CR9H 5DFVD 1JHLH 1EVTC 1JWUA 3ISWA 4NN6B 5ICYA 2VZTA 2FYYA 4H20H 3GMQA 4CRPA 2HRPL 5DXWA 2XWJA 5D1QD 5I9QC 4XVSL 1CN4A 4QOKA 4ZD3L 2P24B 4M48L 2H1PH 5D7IA 2A0LC 3INUH 3SO5A 2N7AA 4MVBD 3PL6B 4FQQB 4AIOA 3K8LA 5BV7B 2CRYA 3IU4H 5GQBA 4M62L 3WJLC 4FFWD 1TVHA 1VA9A 3V0VA 4C57C 5D5MF 4K2UH 4YPGB 2V9QA 1JTTA 1BGXL 3I75A 5LWYL 1D5BB 4Z7NF 3KAAA 2FHBA 2ICEB 1HINL 1FHGA 2ZNXA 1AXIB 1X4ZA 1RK0B 5C8JB 2XI9A 3JVGA 1ZHNB 4BSVA 4G7VL 1ETZA 1M7IB 3DRTB 4MB4A 1K3ZA 4P2RD 3JXAA 2D0FA 1EHNA 1PJ9A 1DSFL 3W0WD 4CN6A 2GK0B 4LSRH 1FL5B 2LTQC 1DBBH 4M6MH 2NY5L 4X6FA 5B38A 4Y5YA 3FFCE 2LAAA 2IG2L 2YK1L 3P0VH 4PJHE 5DJZB 5F7UA 5IMLA 4ISVB 5D7KD 1BD2E 3NTCH 1F58H 3CVIH 4XNQA 1QLEH 4P9HL 4XMPL 3OKYA 4G6KH 3BDYH 3K46A 1U2HA 2H2SC 4JG1H 5F7EH 2X40A 1NCBH 2J6EA 3DURB 3CVHH 3KPOB 4ODUA 1NC4B 3MCKA 3RNKA 1TZIA 1GGBL 2N4IA 3H3KA 3GMPB 3QUKB 1ACZA 1AQKL 1OGTB 1MFDH 1SMAA 2H9GB 3D3VE 2E7HA 4YAQA 3IFOB 4GO6B 1TJHL 1IAKA 2OZ4A 4I5BA 3D25B 3DROA 4HWBL 4BKLA 5T5NG 3P2TA 1GZPA 5DJCB 2ZUUA 4IHOA 5TPWH 5E99H 4HAGA 3T08A 2APBA 4JHZA 1RZ8A 4ZFOB 2HH0H 5KVEL 1QTYT 5EB9A 4BFIA 5DQDH 1MSPA 1OAKH 2OTUB 5JIIA 2AEWA 3G5VB 4QHUA 1RURL 5D2NE 4ZOAA 1UM6H 5SX5H 2P45B 4CMHB 4R3SB 3F7VB 3KYOA 4ZFFA 1J0KA 1OAYH 2LQRA 1MRDL 2OM5A 3HAEG 4FQHA 1ZTXL 1T03H 4JPVH 4P2QD 2HTKD 3REVB 2O61A 4Y2OA 2E7BA 5ITBH 1FG2A 1NH6A 4HMEA 3EJYC 4ZAKB 2QJDA 1IC4L 4Z78A 3PHQB 3QDAA 3VA6A 2JCCF 1RJLA 3QIWD 1KIQA 4JM4H 3SKMA 1KXVC 3ULVC 4FQXC 3EZ8A 3UZVB 3ZL4L 5EO9B 1RU9H 2OS7A 4Y16B 1GH7A 3BHBA 5JNYB 3BKCL 4KRPC 3REWA 4JPIA 5IMOB 2ZOLB 1A3QA 1B6DA 1EZVY 1BJMA 3U7AA 4S2SA 4OGXL 5E56A 5EIIA 5GS2H 2E3VA 2VDOH 4I0PC 4UIKH 4K3EH 1FFOB 5MERB 4OFIA 1IC7L 4LHUG 2ITCA 3EYOA 5F7HA 2AK4D 2GYSA 1QBML 4L5FH 2EH7L 2V17L 4TPRH 4JPWL 5AYUH 3LS5L 5IB4A 3FB6B 5J3HD 5DQJB 3HG1B 1D6EB 3QUZA 4PJ5D 3HLAA 2EDBA 5F8QC 4PJEB 4H8WH 3FO9A 4R0LC 3FAXA 1JGLH 4EIZC 4OIIL 5SWSE 2FWOB 5SX4H 3ZKXB 4ODSL 1ZLWK 3W9EB 2GJ6E 1BLNA 3TPUA 2NLJA 3B9KD 3NABH 4G6AC 5TH2A 4K55A 4M1CD 3E6HA 5D1XC 2DIAA 1I8MA 3GMNB 3STLA 5F71A 4Q97A 3VJ6B 1FYTB 1MWAH 4JZJB 4KMTH 5DK3A 5DR5L 1YNLL 5CUSL 1BWWA 4AEIL 2XWTA 4DUVA 5KVGH 3SDAD 1HN1A 2NY3D 4UB0L 5JLZA 3VW3H 1MEXH 3C87A 5DJAA 4QHKI 5A2FA 1BEYH 5I76A 5DA4A 4DQOH 4JR9H 4JQXC 5T5FL 4BK4A 3LVEA 4UV4L 3TO2B 1FAIL 1G7HB 2D3VA 2FBJL 2ZG3A 4Y4HD 1UCBH 2DS4A 3WEXB 3OJVC 1U8KB 3G5XA 4FQIH 3WS3B 4JRWA 1XH3B 4QKXB 4MSWB 5DJ8A 1CQKA 1FNEB 4Z8FL 4JDVB 4K23L 1A3LH 4LU5L 3NN8B 4OLUH 5L2JA 4FRWA 5FYLL 3TYGH 4PLKD 1I8LC 1NFDE 3EYUH 4K8RH 4JVPA 1REIA 1F4XH 1FFRA 3KPNA 3P30L 4G80A 1X5IA 4WHTB 3VXOB 3O9WB 3ARXA 3QUYB 4CJ0A 4F7TB 2F5AH 2NY2D 3TCLB 1BECA 1HCVA 2NZ9C 2MHAA 1IEBB 3QFJE 5I2IB 1U42A 5E2TH 3U4EA 5JQHC 5CEZL 3QEQA 3H6JA 3GIZH 2NXYC 5DZOA 1SYVB 1A9EB 1MFBH 1N64L 2BNRE 2JJTC 5F6HJ 4BZ1L 2NCMA 4YIQB 5DLML 1V3JA 3OTTA 3JV6A 3RPIA 3CFBB 1MWAB 1YEIL 1PAMA 4YXLL 2ADFL 1CGUA 4V3DB 3MV7E 2A6JA 3RY6A 1G0DA 1AGFB 4PRHA 2WV3A 5DJ2A 4ZDHA 1VPOH 4N1EA 4ZOEA 4U3CA 2BOCA 3WLWC 4OCWL 5LAXA 4C55A 3HE6C 5DUBB 1G6RL 2CJUL 1QSFD 3MOBH 1I1FA 3LPGA 4LARH 4M7KH 2VDRL 3QUMA 1JTOA 5DHVA 3BPLC 2A73B 1QVOB 3TM6A 4FFYH 1ZT1A 4YDLB 1YEKH 2X7LB 5I16A 4KAQL 2DMCA 4X4XB 2A6KA 4RQQB 3WS6C 5HGDA 4W4NA 4LRIA 5C08A 3L7FB 1CF8L 4Y19B 3QXAB 4MDJB 2ICWA 2CD0A 25C8H 5C0AB 2Y5TA 1URLA 4PJXE 4APQC 1UZ6F 3EOBB 4GAGL 2GKIA 3HNVL 2VLKA 4UILL 3RGVC 3KPSD 1PQZB 1Q0YH 3LQAH 1LK2A 4MD4A 3LKOB 3IXAA 4P59H 1X5AA 2NYYC 3WO4B 4X7CC 4RFOH 1FO0B 5JQ6H 1ZT7A 4IRJB 2D7QA 2Y07H 1KUMA 4ODHH 1HH6A 4M61A 4M8VA 4RBPK 3MRGA 3HKFA 2QSVA 3SJVB 4W68A 2V7NA 3PHSA 1QNZL 3WN5B 5D7JD 2PO6B 4LPXA 3NCBB 1RZJL 2XTLA 5GS3A 4OQTL 1GVIA 4TTDD 3ZHDA 4P4KA 3V5HB 4Q9BA 2BVEA 1U3JA 5D5ME 2QLVB 5FK9B 3QWRD 1P6FA 4Z7NE 1VKXB 2FNBA 4W4OA 4GLRH 2HVJA 2UUDH 4CUCA 3IYLW 5DJ0A 2IBGA 3RL2B 3MV9B 2HRPH 3ZTJG 5E0QA 2YPLB 4XVSH 2B1AL 2VTFA 4ZD3H 1HQ4A 4ZUSB 4M48H 1LO0L 1KCSH 5DEGB 3MRPA 1U8IB 4ZXBB 6FABL 4Z77B 3AREB 3JTSA 1AGDA 5E5MB 1KOAA 2FX7L 2PYEE 4M62H 1L0YA 3RWIB 1EFXB 5C0EB 2IADB 1O7VA 2GK2A 3S3JA 4QXGL 1SHMA 2W0PA 1QO3B 3VWJB 1UVQA 5KBNC 3MA7B 4KTDL 1FFNA 1ED3A 1S7TA 4G7VH 4L3CA 2VL5B 1DSFH 4QY8B 3KS0H 1OF2B 1UB6B 3MJ8A 4WI6A 1UM5H 2NY5H 2YK1H 2IG2H 4JY6B 4I9WD 3MNZA 3V7MA 4BZ2L 1A8JH 4JFHE 3KDMA 4HUXB 3WL9B 2V9RA 1ONQB 4U7MA 2HN7B 3JBG7 3NAAL 3LKPA 5KSBB 3O6FB 2O5ZH 4MS8A 2VR4A 3DV4A 3QG7L 4P9HH 3QQ9C 4R4ND 1HSAB 1DQLH 4XMPH 3TVMB 3C6LD 4QRRD 4J4PA 1KG0A 5HHPB 1KLUB 1KT2B 3BZ4A 5IW1B 1NCTA 3IFLL 3QWQB 4M93B 1A6ZA 1D9KC 3H9SB 3RDTA 4YWGL 2D7OA 5DVNA 3ULUH 4Q9RL 4ONFL 2GCYA 1AQKH 1H3PL 5E9DE 1TJHH 1KXQE 5GS0C 3FT2A 1BFSA 4FG6C 3PP3H 4KK8D 2PXYA 4HWBH 1J8HB 3WFBH 4XBGA 2IANA 5DFTA 4Y1AE 4KKCC 3A6CL 4U7KA 3Q5YA 1JK8A 4V1DA 4DZBB 4N8VB 2A74A 1FNGA 4XZUA 5KVEH 4U3XA 2XTJB 1DCLA 3VXRB 3QNZA 2LVEA 2JCCE 4DZ8A 1KV3A 1ACYL 4F33A 2D9QB 1QRNE 3GSUB 4PRID 3ZE2F 4GG6B 2WWKO 1BJ1H 1HDMB 4K3GA 4L8CA 1TPXC 4QRQB 4OM1L 4UIMB 5KSUB 1MRDH 4BELD 1EO8L 4MDIA 5E8EB 2EDNA 3P4LA 4GRWB 1ZT4B 4LCCA 1SEBA 4HFWA 4X6CB 1U8MA 5I1KL 1S7WB 3KPQB 1IC4H 3M07A 2ZOKA 4ELMA 4CVUA 2ZWLT 3ARZA 1C8PA 5MEQA 3QI9C 1A6VL 3VXNA 4CJ1A 5JXED 5HYSB 3VCLA 5D71L 4Z7VA 3ROLB 1RZFL 5HSFA 1MCIA 3ZL4H 5CSBA 3GIVB 3BH8A 4R4FH 1DE4A 4OFDA 3VGHA 4LEXH 3BKCH 4GRMB 1NBYA 3MODL 2XXCB 4Q74A 3P9LB 4OGXH 2DQJL 4LLUB 2VLJB 3MRQA 2A38A 3BE1L 3FB5B 2NY1C 5D7LE 5EZLA 4XCFL 3QPQD 1IC7H 3PGDA 4NO3B 3EFFB 1QBMH 3DXAA 2EH7H 5F88A 5IGXL 1RZKH 3L7EA 4BQ8A 4KV5F 4RA3A 2XY2A 4HJGB 4FMKA 1A1NA 3SEPA 1Y6KR 3WLBA 1K8DB 4WVRA 1H0DB 3N85L 2FJFB 4OIIH 3U7WH 1G1YA 4ODSH 5EG6C 4KQ4H 4GQ9L 2Y25A 1YQ2A 1OOAA 5BXFB 1O0VA 3DV6B 5EFIA 3S5LA 4G6FD 5JO5B 4U7SA 4PRPD 1S7RB 4MCYA 2YD5A 4WUUE 2D7TL 2WIMA 4YC2B 3ULSB 1V3LA 3SKUD 4XH2B 4D0CB 5J9PB 3MFFA 3CXHK 5DR5H 3G5YB 1YNLH 2OLDA 1N4XH 4NQDA 3O8XD 1CE6A 2ARJB 5CUSH 3TBVB 4AEIH 1ZGLP 1P5UA 2D31B 2V6HA 3JWOC 4UB0H 2QSCL 1G7PB 4KKAD 1QBBA 4ZO9A 4M1DL 4K94C 5T5FH 1IEAB 4I2XB 4UV4H 4G9FA 1FNFA 3UTSE 1FAIH 2FBJH 5C0BA 1MPAH 1R3LA 3GJFB 1NQBA 5ECJE 5CZVL 4OCYH 3O81A 4Z8FH 4LU5H 4PG9B 4KZDH 2CLVA 5FYLH 5DUPH 3KXFE 2DOCA 5KSAD 4FFZH 1ZLWH 2VJXA 1VGKB 4LLVA 2CK0H 3P0YL 4B7IA 1DUYA 2HAZA 3G5ZA 4LLMA 5CP7A 4NRYB 3P30H 3FCTB 4KROB 4PGEB 5T1KA 1OGAA 3MRDB 3UTTA 4MD0B 1I9EA 2BX5A 1P7KB 3D0LB 1F2XK 3UCRA 4R97C 1HZHL 1I7TA 4F7PB 1T1YA 4AY0A 4IMKC 1DVFB 1FRGL 4R7NA 5F3BB 5CEZH 3PWJA 4KQ3L 3ARVA 2H8PA 1UT9A 3JUYA 3EO1B 3T3PE 2FX8L 2RQ8A 2OP4L 2BVYA 2W60B 1Z9MA 3TLRA 3U48A 5HI4C 4AENA 4BZ1H 4Y7MA 3HPJA 3X13B 5DLMH 1KB5L 1HYSD 5JPMB 2XRAL 1JPSL 3PQYD 3J7HA 2ADFH 4NM4L 15C8L 4JFDB 5BJTA 2WBJD 2P8PB 1NUNB 5C0IA 3VI4F 6CGTA 4P57B 3B6SA 4OCWH 1TENA 5CAYB 1UZ6E 2UWEF 3CXHJ 3VWKD 4AIZB 3I6GB 5K9KA 1FZKA 2VDRH 5D6CA 5GSRA 2C1OA 3MRLA 5IG7A 1JWSB 1T20B 2B0SL 1WTGT 2P47B 2WAHA 2GJZA 3AGVA 4G3YL 5IVXF 4NN6C 5FGBA 2J7LA 3WDHA 4PJCF 5I1DA 1R3JA 2FH8A 4KAQH 3TBSA 1J18A 2E7LC 4TUOB 2QL1A 3GM8A 4Z18A 3H7LA 3C60A 3T1WA 3PL6C 1CF8H 3GKZA 4G8FB 3TBTB 4OT1L 5BV7C 4CVXB 1FORL 1F6LL 4GAGH 5K93A 1B0WA 3BO8B 2SEBB 3HNVH 4UILH 5FM8A 3OX8A 1AXSA 4XP5L 2DMKA 3LKNB 1BFOB 3MTRA 1NEZB 1KYOK 3LV3B 1NUDA 4MA1B 2CKNA 2DJUA 4NQCE 1WC7A 3O2WL 5ITFA 3FQWB 3KPLB 4R7DA 1TMCA 4QRPE 1PKQB 5HYQA 4M03A 3G04B 3OKLB 5ESAB 5E2JA 1AHWB 4PTUA 3FT3B 2NY4B 2E8ZA 3VFSA 5T1KD 2JJWA 2P8MA 3TP4A 3PWNA 1FZMB 1RFDL 5FUCC 3FRUB 1MUJA 3IETA 1Z5LA 1F45A 3A6OA 1PEWA 1ZEAL 3FFDA 3MJ6A 2CQVA 3MNVB 1NLBL 5DVOA 1RZJH 5FB8B 1F11B 1JZ5A 2FJGA 4WTWA 1NBZA 4OQTH 3QNXB 5DRZB 3LKRA 5IB1A 1F3RB 2V5TA 3RWEA 1J0ZA 4FTVE 1A7OL 3ARBB 3DRQB 5IMKA 2XG4A 4HXAL 3LPFA 3NIDE 5BZDA 4U31A 1IZJA 3D87B 1HKFA 3GKWL 3BP7B 2B1AH 5DI8A 4ELKB 2BMKA 2A1WH 5ICXA 1MHCA 1LO0H 5EU4B 4PYGA 4UMGA 6FABH 1FDLL 4JGJA 2A0LD 4WFEE 2ITDB 1QLFA 4UAOB 5I1LA 2FX7H 4K7PL 1QSZA 4QTHB 1A7QL 1CWVA 2BNQE 3DETC 4JM2F 4NNYB 1YN7A 4RBPH 2DICA 1EXUB 4QXGH 1VADB 3CMOL 3RUGA 2YA0A 5IV2B 4LEOB 1YPZF 4PJIB 1DQJA 1AY1H 4RAVB 2VN7A 5F7LB 1C7TA 2EYRB 4HAFA 1Y18A 4KTDH 2EDDA 4Q6YA 4HKXA 1CD0A 2JLLA 4Z9KB 4CMHC 1KYOJ 4FXKB 3ESUF 5FYKD 4PJHB 2YD2A 3KYNA 3TIDA 4BZ2H 2R2CA 1AD0A 1J1OL 4ZAKC 4GW1B 3WBDA 2Z4QA 3SDXE 1U8OA 1P4BL 3K7UA 3ZTNH 3NAAH 5EN2A 2BVPA 3QG7H 5FDWB 5A2KH 3BESR 4M5ZL 3MV8E 4LVOB 1K3IA 1EMTL 3RPKA 4NNXB 1XF3A 5FYJD 2Y9RT 3IFLH 1WFUA 4MNHB 4Y16C 2H2SD 1OB1A 5C6PB 4YWGH 1T80A 4Q9RH 4HWBA 4ONFH 3W5NA 4LNVA 1V8HA 1TFHA 3ZE2E 4R0LA 5TF1L 3LSOB 1Z9OA 1U3YA 1A6TA 2Q1EA 3LQZA 4KJPC 3QH3B 2QQNL 4YBHA 2YHGA 4ORGA 3MJ7B 3A6CH 4JFFD 3I02A 4I48B 3S3PA 3NH7L 3AUVA 1XGYL 4QF1B 4EIGB 4HPOH 4UINH 4KTEL 4NPYA 1ACYH 1EEQA 4PUBL 3BEVA 5ENWB 1BREA 1T0NA 2FATL 4NQEE 1YJDC 4O2CB 2UZYB 3ZKXC 1WFOA 3OXSB 5IB5A 4P48A 1MFAL 4ODVL 4OM1H 5DC0A 3GB7B 3HMXL 1QOKA 3UXFA 5EUKA 1EO8H 5JHDE 4JE4B 3U79A 3G6AA 1T66D 3A0OA 1BOYA 4U6YA 5I1KH 1J10A 3FT4B 4HUNB 4JZJC 1S8DB 2DQFB 1OARL 3C5JA 4KMQA 4MAYB 3EJYD 3CK0L 3EGSA 1OAQL 4M5YL 3K4ZA 1I8LA 3T8XB 1MJJB 1XGRA 1F00I 1A6VH 2CR3A 2CRIA 4HH9A 4LGSB 3C8HA 4EDWL 1J5OL 1WBYA 3SE9L 3KYMB 4KV5E 2L7UA 3QO1B 1LP9E 5D71H 2C3VB 1FFQA 1NDGB 3ULVD 4X5WA 3FL7A 1AC0A 3ILQD 5DTFA 4PRDA 1I4FB 4FQXD 4ZYKB 3QDJE 3BXNB 3QO0A 4QWWC 3OBAA 5C0CA 2YBRA 3U0PA 1KTLA 4KRPD 4X6BA 1YN6A 1P2CA 1RZGB 2DQJH 3LOWA 1D6VL 3B3IB 3DMMB 2FO1A 2ESVE 3DVNA 3BE1H 2I60L 4YNYB 1CGTA 2VAAA 4U0QB 4XCFH 4WFHE 1UM4L 4I0PD 1G6VK 5IW6B 4JCLA 2ZNWA 3P73A 5IGXH 4AQ1B 2R9HC 1U3HB 4HFUL 3MRJA 3O9WC 1DZBA 3P77B 3QUYC 5E6ZA 5L7XL 1CD1B 4H8WC 4OJFL 3B8SA 5KS9F 3SOBL 4I77L 1KJMA 4WEBL 3BFOA 3BN9C 5B38G 2WSKA 3X3GL 1Q9KB 3OKEB 4L4TE 5EWIH 5SWSB 3N85H 2YXFA 4JLRB 4OSUH 2DYPA 3IS0X 1IGTA 4YH6A 4GQ9H 4F3FA 1MREL 3ZE0E 1PW3A 3MROB 1XZ0B 1KGCE 5ISZD 4XX1E 2KZWA 2EYTA 3LEVL 4PJDF 2D7TH 3WFHA 1F3JB 4MQSB 3DSFL 3CFJB 4TN9A 5D1XD 1MHHA 2R0WH 3IDUA 1BM3L 3F7YB 5GGUA 1CTNA 3VE0A 4EI6B 2V5MA 2V2XB 2X4OA 4IOFC 4P2OB 1DQML 2J3SA 5EUOF 4GW4B 4OZGF 4ETQB 2QSCH 4X9BA 2NW3A 1DBJL 4M1DH 2MPAH 5F9AC 5DD6B 4APQA 1I3RA 2EEDA 2NW2A 3GHBL 2LU7A 1ES0A 1JZ8A 3HPLA 4YDLC 2E7MA 2Z31B 3C09B 5CZVH 2Q6WB 2DRUA 3QPXL 5FKPA 2E27H 4YHLL 4X98B 2AJUL 2APWA 3P0YH 1G7IB 3U0TA 4P23B 4PV8A 3EHBC 2OL3B 1HZHH 1AR2A 5J57B 3QFJB 1S9YB 1P1ZA 3KLSA 5DO2C 4WDIB 3VXMA 1FRGH 1LO5A 1I1YB 4S0SD 3WO4C 1FZJB 2UWEE 2IQAA 1U58A 5F7NC 5I17A 4QHLB 3MLYL 2R1WB 2OP4H 3PDGA 4JFZL 4IRJC 2MWCA 4N0UA 1KB5H 5IVXE 3UTPE 1JRHH 1B4JH 2XRAH 4PJCE 4ZTPH 1JPSH 3QDGD 1U91A 1SBSL 4NM4H 15C8H 3MREA 1KJVA 2IALB 1JFMA 1G6RA 2A83A 3WN5C 1INDL 2H6PA 1U8PA 3C6SA 4IMLA 4WHYG 3SDDB 3WCYA 2PO6C 2DL2A 4EOWH 4MNQE 3LD8B 1QFWL 4I4WB 1LNUB 1CG9B 3WUWB 3WLWD 3HE6D 5I1HL 5C09E 1T1ZA 3TBWA 4PY7B 4ZPTB 2Z92B 4G3YH 4FP8L 5E8NA 2MOVA 1B2WL 2DBLL 3TESA 4OFYA 1DLFL 4OCXL 4OI8A 4QRTA 3RWJA 3DX9B 5IBTL 2BC4A 3IRZA 4OZHF 5BRZB 4OF5A 4H1LB 4PIRF 3V4UL 3WSQL 2GY5A 4ZXBC 1JGUL 1A6AB 4ZSOE 3T0EE 2P7TB 4LHJB 3AREC 1CQYA 4X8JA 5D7SL 2XZCL 4E5XB 5T3XD 2MCPL 1XGUA 2DM2A 1H3GA 1SJXA 4APQD 1X5HA 4ZS7L 4XP5H 4GBXB 4PGCB 4OUOA 5FA4A 3RGVD 3VWJC 5C0DB 2YOCA 5JW5A 1RZIB 1U92B 4KZEH 3T4YA 4G8GB 3MJ9A 4JGUA 2NYYD 2OK0L 3CD4A 1KCLA 5IEHB 3FFCA 2PNDA 2YD8A 4KUCF 4IJ3B 4JO4L 3L95B 1BD2A 2HA1A 4HGWB 2J88L 5JPNA 1N7ML 1RUKL 4ZOCA 4RMTA 1RFDH 3CSGA 1NAKL 1PG7L 4WTZA 3G9AB 1S9XA 1K4DB 3O6FC 3BN3B 1JMZA 1CK0L 3TVMC 4V3EB 1G9ML 2W91A 4NZJA 3EDKA 2LVCA 4M93C 2C7UA 4NQSA 2IAMB 1A7OH 5L8KB 2ATPB 4HXAH 3D3VA 3SE4A 1YPZE 3VDBA 4C56B 5DS8B 2R39A 1F5WA 2YD3A 5EC2B 1L9NA 3VG0L 4UDTB 1EAPB 3BGMA 2COQA 1FDLH 3P4NB 1ZS8B 3S9DB 4NNPL 2PYEB 4IS6A 4NKOB 4DOHB 3HC3H 1A1MB 4TQEL 4H0GA 1NCCL 1A7QH 4PJ8A 4DWHA 1ORSB 2XTJC 4D0BA 4HF5L 4Z76B 4Y4FA 2X4PB 5L2KE 1ZHBB 3CMOH 4MXVF 5D2NA 2GFBA 5I18L 1I7UA 5EOTA 4MZ2A 5HHMB 1FIEA 1A0QH 3AS0A 1HXYA 5J13C 3P4MB 4OI9A 4M3KB 5C71A 5EBGA 1I3VA 1XGPA 1FIGL 2EDRA 3KLDA 3IJHA 2XPGA 1F3DH 5I75B 4XGZA 5CEYB 4L3EA 4TUJA 1C08B 4ZO7A 1VGEL 4GG8B 3S35L 3D0VB 4MJ2A 1P4BH 4PJFF 1FV1A 3F58L 4KK6C 3ZYZA 2NY6B 1I75A 3CDGA 3W39B 3BUTA 4H25A 4IDJL 4U1MA 3VFUA 4W6XB 1EMTH 3QQ9D 4D9RE 1GSMA 1JE6A 2JB6B 3ULUC 2EYSB 5DSCA 5FOBA 3MNWA 4MJIE 4HEPG 1CS6A 3TH3T 1KCUL 1D9KD 4H26B 1HNFA 5E9DB 2KZ1B 2C3XA 1DUZB 4LLYA 5TF1H 2CDGB 2GSIB 2H32H 3QNYA 4ZUTB 4YXHL 5F9JB 4J1UB 1F90L 5GS0D 2AXFA 2QQNH 4KUZL 4FG6D 3NMEA 2BK8A 2FECI 3GSWA 4NCC2 4KKCD 5J1AB 5BQ7B 1H3XA 1KB9K 4RA0C 2YR3A 1XGYH 3W0WB 4KJWD 1XCTA 2ATKB 1AGBA 4KTEH 5IBUG 2XN9A 2EDXA 3EUUA 3FHAA 4PUBH 4U6TA 5DJXA 3WO3B 4KKBC 1AD9B 1OL0A 2FATH 2GJ6A 3RHWF 3MLTA 4N0FB 4YBQC 1MFAH 2CSPA 1T89C 2OSLB 3TJHA 3HMXH 4J3TA 1DDHB 4RGMB 1C12A 1QFUL 4EN3A 2B4CC 3L9RA 3O3EA 5D1ZA 3TN0D 3SGDH 3EYQC 4YC2C 5CSZA 4HIJA 2X41A 4M8QB 1OARH 5FGRA 5I71B 1P6AB 1KCRH 3OF6A 3F5WA 1U6AH 3CK0H 1OAQH 4M5YH 1WV7T 3CIQA 3OKDA 4EDWH 1S7SA 4ONHB 5EORL 3SE9H 4CW1B 4XI5D 1X6NA 1P7QB 4TUKL 3ALXA 3QI9D 4GAYA 3ARDB 3OHXB 1DTUA 3GDBA 3RX7A 4JVWA 2DN7A 1NFDA 5GPRA 1I3UA 1D6VH 3MLSL 2I60H 1JN6A 4IOSD 4JFXB 1RZKC 3I6KA 3VU2A 4YUEL 1UM4H 4DEPB 3PWUB 1OP5H 3PJSA 4J8RB 2NY1D 4KROC 4PJDE 4JO3L 3RFZC 4HFUH 1O5DT 5KOVC 5C0NC 4OJFH 3ARGD 4JANA 1S78C 4JRXB 4I77H 2I9TA 4Z7QF 4F2MB 1LEKA 4CU6A 2WM0A 2VDKH 4HUUB 4WEBH 5EUOE 1DVFC 2ZPKL 4E41D 4OZGE 4IRZH 2BY2A 1I8KA 3BX7C 4P2QB 3X3GH 2BNRA 4MXWL 5FO9A 3DX8A 4M43L 4M6OL 3RY4A 3WV0A 3IJYA 2APFA 3CC5B 1IMHC 3EYSL 2AP2A 2OQJB 5IMMA 4FQ1H 2YD4A 3RVUC 4OCMC 3MV7A 2VWEC 3MUY1 2ZKHH 1YMMD 3DSFH 2ADIA 2P48B 4U6XB 1EBAA 1BM3H 1WF5A 3WXWL 3L3KB 2UY6A 1JMXA 4R8WL 2DLTA 3K1DA 3OGOE 1HHIB 4EZMA 1ZSDA 1DBJH 1QEWB 5IT2L 3LMJL 4LPVA 3UTSB 3VD5A 3TH4T 1JWMA 3GHBH 5GGRA 3FKUS 1MCBA 2AK4B 4HDIA 1UGNA 3AXLB 1C1EL 1KLFA 8FABA 3HUJB 4YHLH 1D5BA 3NGBB 5MEOB 4R96B 2Y4SA 3CZFB 1MCDA 2AJUH 1RK0A 4YDVB 5C8JA 2KKQA 4JDZA 4UTBL 4PJXA 1HI6B 4V2BA 5HHOB 2BCKA 4F9LC 4Y2DB 3BIKA 3X11B 4ZNEA 4YHIA 3K74B 4QHMA 2XNAB 1DEEB 3B9KB 4ISVA 3KLAB 3V6FB 4XAWL 3C5ZB 3NIGE 4BQ6A 1CZ8L 4EBQL 3L6FB 5MHSE 4CMMB 4MA1C 2FB4L 5DEZA 2R2EA 4RMUA 1GCFA 5SV4A 3FB7B 3T04D 3RX8A 1N3NB 4JN2B 3MLYH 2AABL 1WWAX 4JHAH 4RMQA 1AHWC 2VZ3A 4WFGE 3KHOA 3QIBA 1U8QB 3DURA 2NY4C 4BA8A 1JPFA 5HI4D 1CFTA 1A4KB 1S9VB 1FFPB 1W0YT 1MLBA 1SBSH 3B83A 4XP1L 3GMPA 3QUKA 1OGTA 4OZHE 4S0TD 2GHWB 5GGTH 1P84J 1WSST 2IFGA 1WITA 5C07D 1INDH 2YUXA 3SKNA 1ZA6A 4PJ7B 3D25A 2OXHA 1ITCA 5IVZB 1QFWH 1PY9A 1EGJA 5H37G 3NIFF 4MA8L 5I1HH 5MENA 1XR8B 1UFUA 3ARBC 3VGAB 2CIIB 3TEUA 43CAA 2VXTH 1U93B 2IPTL 1Q1JL 3JV5A 4RZCA 1IAIL 1B2WH 2DBLH 5E1AB 2OTUA 3O41B 1IEHA 1AXTL 4V2CB 1DLFH 4OCXH 3RJQB 3VFTB 5IBTH 2AGJL 3G5VA 3NFSL 1M6OB 3GI8H 3V4UH 4WW1A 4P3DB 3O3BB 4FQLH 3B9DA 1JGUH 1R3IL 4KDTC 3CCHA 4X80L 1OPGL 4AG4L 3DHMA 5TE6L 4YGVA 3F7VA 3PL6D 2A6IB 5ID0B 1R0AL 5D7SH 1KIRA 2XZCH 4F8TA 2MCPH 4E42B 3E8UL 2UZXB 4ZS7H 5JHLL 2C1PB 4ZAKA 2ICCA 3S5LG 4UNTA 4HKJA 3VRLF 4BFGA 5CIPA 2Q86B 1UC6A 4M1GL 4J6RL 4JQVC 1WK0A 1KC5L 5DD0L 2DQUL 1U8LB 2ZCHL 3KNBB 2HFFB 1FVCA 1NC2A 4JO4H 4NO5B 2V2TB 5JNYA 3W11C 1N7MH 1RUKH 1YEGL 2O5XL 3D18B 1QSFB 5I1GL 4JRYB 4D9LL 4MJ6A 5IB3A 1NAKH 1XEDA 1RZJC 4LCWA 3DI2B 4HT1L 2NX5E 4P4RB 4F9PA 3HAEH 3RA7L 1FFOA 2WUBH 1E0OB 1CK0H 4CU7A 3QRFM 1WCBB 4LVOC 2DQDL 3EOAB 4CU8A 3H42L 2JJSA 3VDCA 4GKOA 4C58B 4MXVE 1NGWA 5IESL 2YRPA 1NC4D 1XGTB 4MWFB 2KPNA 1CI5A 4PJEA 1CXKA 1YEFL 3V8CA 3MUHL 1A2YB 2FHCA 2EDJA 4XB7A 3VG0H 5F9WB 3ES6B 3C8DA 1ZA3A 3SDCD 4N8CL 5IHBA 3EFDL 4TQEH 2BNQB 5EIQA 1NCCH 2GI7A 1QKZL 3MRBA 2P5WE 4DK6A 2E9JA 3DVIA 4PJFE 3O4OB 3DETD 2FIKB 5I18H 4OZFB 2BSTB 1G7JB 1DLHA 1WZMA 4Z7UE 1B9ZA 4PP2B 5I8CA 2EEBA 3BQUB 5DK2B 1AJ7H 1MVUB 3IDMA 5I1IH 1FIGH 4OV5A 4LVHB 4MHHI 3WEXA 5K9OA 1VGEH 3MOQA 3S35H 3SDXB 4Q2ZA 2HLFC 3HAEB 1YUHA 2DLFH 1XH3A 4OGYL 2GITA 4MAYC 2R4RL 4ZAKD 3F58H 3BIBX 3MV8B 3OSKA 4X4YB 4DK3A 2HFTA 1K5NA 5HHNA 5DJ6A 4YX2L 4X5XB 4WHTA 2W38A 5CGTA 3O9WA 2H32A 1EJOL 3HI1A 2DQIH 4OFKA 3TCLA 2MSPA 3SCMD 1ZVSB 4OCRL 1KCUH 4Y16D 4PJBB 1IEBA 5D7LA 3WDJA 1NCWL 2WZPD 4IOIB 2VXSL 4YXHH 5M95B 1JJUA 2AV1A 3F12A 2PKDA 1WIPA 2X4RB 1VESA 5ACMA 4KUZH 3D1MC 2OMBA 5CEXA 4KJPD 5ABDE 3N9GL 1P69B 1U3HC 3IDNB 4YIQA 7FABL 1CFNA 4GXVH 3E2HA 2X1QA 1U9KA 4LHUB 3GSQB 3DGCR 1XF4A 2DLGA 3D39D 2B2XL 2R1YB 5D70L 2ILLA 3JTTA 3HG1D 3T2PA 1JGVL 1G84A 1B0RA 2R0KL 4KI5D 3IDIB 4DKEL 4OKVB 2EXWC 5CGMA 1U8HB 4QXWA 3RI5F 3A6BL 1ZWIA 2CRZA 5JHDB 1G9EA 3R4DA 4E0RB 1HSBB 2XQBL 4YPJA 1QVOA 3ZKSD 2NY0B 4HHAB 3O45B 3CGTA 2ADJA 2Y06H 1FYTD 2VKWA 2PCPA 4MJ5B 3VFVB 4X4XA 5C6TL 3UTZB 4P2OC 5B21A 3D85B 1N26A 2J2ZA 3GGWA 3C5SA 3L7FA 1LP9B 3O6LL 4Y19A 1AC6A 4TUKH 3WHE1 3FQNB 3QDJB 3UBXI 1J11A 2D4FA 2AXGB 2WIIA 3GNML 5CWSA 4XHQA 3NPZB 3D2UA 3TT1L 3C9NA 3FO0L 3UJIH 2Z31C 3C09C 3KXFA 3E6FB 4L3AA 3WNNA 2BSRB 2CO6B 3MLSH 3LKOA 4N90E 1Q9WB 2W1NA 1C16A 2YN5A 1NL0L 1MH5B 1FO0A 2I24N 4YUEH 2C3GA 1PD6A 3ZYJA 4JFOA 3UEZA 3MUGA 4IRJA 4JO3H 1UZ8A 4FZ8L 4P23C 4ESKA 5EBMA 2R9HD 2EIZB 5DWUL 2DI7A 3QUYD 2F53B 2XIDA 3GSVB 4YR6B 1IAOB 2ZPKH 5HPMB 1QLRB 2OTWB 1R5WA 4MQXC 4MXWH 3S96A 4OAWA 3FOMB 3BN9D 4M43H 4M6OH 4GKSA 4XB8A 5GGVL 4ODTH 3EYSH 5E5UB 1GJIA 1AGCA 5HGAB 5JIHA 2Y7QB 1NKOA 2YXMA 2K7QA 4JFEB 5AZEL 3OJDB 1SY6H 5IKCA 2B5IB 2YZ8A 1L6XA 4U4BA 2XA8L 1J8KA 3WIFA 1VKXA 4LPTA 3WXWH 5KZCB 3SDDC 2EO1A 4R8WH 5HI3D 1G7QA 4ZUSA 1IBGL 3U4BL 4N0CC 3LD8C 4IOFD 3MRKA 4JDTL 4XP6L 3GI9L 1UB5B 4G9DA 4ZXBA 5JORA 4Y5XB 5CJBA 4NJ9L 5IT2H 1KSRA 5E5MA 3IFPB 1F6AA 4X99B 3HE7A 2XG5A 1LDPH 2BJML 2IADA 5L9DL 1C1EH 5H94B 3VXSA 1M05A 5HJ3B 1FL6B 2X4SA 3QSKB 4ELMF 1YY8B 4K8RD 5DT1L 3S4SB 1C5DB 2I9LB 4UTBH 1UJ3B 3UX9B 1ADQA 4XXCC 4JFYB 2ZSWB 3CXDL 4QY8A 4Z7VF 1UB6A 4L4JA 4OGZA 3ZTJH 4CADA 4Y19D 4WY7L 1YQVL 3OKNB 3BJLA 5C0AD 1WZ1L 5GIRB 4Z7WF 1CDUA 1CLYL 4XAWH 4EBQH 4GBXC 1CZ8H 4NWTL 3EHBD 1YECL 2H26B 2FB4H 4LASL 2CPCA 3NIFE 3FHQA 1JZ3A 2F58L 5CZXD 1I1AA 1BVLB 1MAKA 2P46B 4L8BA 4L9LA 2GUOB 1R24A 5CJXC 2AJYH 4POZC 1H3TA 4IRJD 1JNHB 5BW7C 4EI5A 4JKKA 3UP1A 2FX9L 2HRLA 3SJVD 4YHML 4TSCL 4L8SA 1WISA 2PO6D 4LKXA 2XKNB 4MA8H 3KPSE 5C09B 2BERA 3F62A 4NT6B 1M7DB 4LMQE 2IAMC 4WU5B 4C83A 5KSAB 1UQSB 2IPTH 1Q1JH 4HPYL 3NFNB 2DWDB 1W72B 3TO4A 1EBPA 1AXTH 2FSEB 4N8PA 3F6LA 1BJ8A 3MV9D 2YPLD 4W81A 2VISB 4KXZH 1R3IH 1KPUA 1OPGH 4HULB 4YO0A 1AE6L 4AG4H 4QRQA 1F42A 5EULV 4ZXBD 3GSNB 3ARED 3E8UH 1JNNL 3DARA 5SX4I 1PSKH 1BP3B 1ZT4A 2HJKB 3DUUA 5JHLH 1AGEA 1EFXD 3QEQE 3LZFL 4QYOA 3O3AB 2X70B 1HOCB 3VXUB 2XKSA 2Q20A 3PWLA 1FCCA 3VWJD 3VGFA 5L6YH 3RHWK 2YKLL 3VD7A 5I15L 3IAPA 5F1IB 4M1GH 3U2SB 5F72S 1KC5H 5CBEA 3NA9L 4KJYA 5DD0H 2AQ3A 2DQUH 2ZCHH 3GIVA 3MRIA 5I75C 2Q7YB 3AAZB 4FXGA 3HI5L 1YEGH 4PRHE 2O5XH 3U9UB 1MCWW 4UZGA 5I1GH 4XXDB 1CL7H 4GRMA 4D9LH 3V7AE 2FJHB 3BP4A 4WU7B 3QA3A 3AM8C 4HT1H 2E9IA 4MX7B 1KF9B 1SVZA 3TV3L 2NY6C 3QXTA 4GQPH 1YDPB 3FB5A 3RA7H 1NDMB 2BHUA 2R1XB 1JPGA 2HKFH 3O6FD 3WHXA 1PG7W 4NO3A 3O3DA 4WHCA 3TVMD 3H42H 3KPRA 3BDXA 4R2GB 3QEGL 3PWVB 4YJZL 4BFEA 3H9SD 2R23B 3IVKB 1FJ1B 1QRKA 4LQFL 1YEFH 5F7WC 3L3IA 5C08E 1ZK9A 1H0DA 4QHKJ 2EXYD 5EU6B 4YDIL 1UKSA 3IT8D 2JIXB 1G0YR 1J8HD 5FGCE 1T2JA 3EFDH 3RIAF 3VRIA 1QKZH 4Q6IA 1DANT 4HC1H 1S7RA 5INCA 3RBSA 4RISL 4XH2A 2J8UB 3FO2A 1YNTB 4LDLB 4NQEA 2XTJD 1KNOB 5BZWB 3VXRD 2EEAA 5EO0B 2P4AB 1GRWA 2ARJA 3TBVA 4J2XA 3G08A 5DRWB 1BIHA 1NSNL 1Q0XL 3FTGA 4ZPVA 2EIEA 4WFFE 1Q38A 2WLZA 2Z8RA 4P46B 5JDSB 4OD2A 3ZDZE 2RHEA 2AKRA 4URTB 1F2QA 4MJ4A 4RGMC 4ZMAT 2CUHA 5C0JA 1OAZL 4MLIA 4S1QL 3NCJL 4OGYH 1S9KC 4IIQB 2UYLA 5I71C 3L5JA 1MHEB 2R4RH 4LLQA 3TFKA 3BJ91 4MAUL 4WV1B 2VLRD 3VXQA 4KK6D 3MGTB 4OD1H 5I8OL 3FCTA 4PGEA 4YX2H 3ARDC 5C86A 2J6EL 5FF6A 3IKCB 1DR9A 3MRDA 3IFNL 1EJOH 4K9EC 1MRCH 3ULUD 5H2BA 4OCRH 4PRIE 5DMJB 3ZKMC 3ECBB 1UCTA 1NCWH 4NZRL 5CD3A 2VXSH 3B9VA 2OZ4L 3PHOB 3GSRB 1E4XL 4HLJA 2VLJD 1R3KB 3OGCB 3WJJC 3WDIA 4DEPC 3NACL 3K2MC 5JW4M 2W60A 3RNQA 3N9GH 1S7UA 7FABH 3X13A 2GT9B 2HT2C 1TQBB 5JPMA 5FA3B 2VSCA 4MD5A 4MQ7A 1J05A 2X1OA 2VC2L 2NNAA 4M02A 5JA9A 4NC1E 5D70H 4L4TA 1JGVH 2P8PA 2R0KH 5HYJB 1X5GA 1BQHB 5F89B 5DMGC 4N9OB 3QCVL 5C9JB 2RR3A 3QUXB 3Q3GA 5JIKA 4KKBD 5SWZA 4OZIF 4G42B 2ICES 4UOJA 1MJ7H 2Q7NA 4WTZG 3EOTL 2BSSB 5AD0B 3A6BH 4YBQD 2E9WA 1JWSA 3MGOB 2XQBH 1NBVL 2J1KA 3VFWA 3MRFA 3MO1B 3IXTB 1FNSH 1E6OH 3VGDA 3PIQB 1C5BL 5HGHB 3LY6A 4OFVA 4RGNE 5C6TH 4JZNB 4YHNB 1UADC 4HUWB 4GLRI 1PY4A 1YC8A 3O6LH 4UT9L 2CDEB 3Q5TA 5E94B 1D5XB 32C2B 2GQHA 4CVXA 3QQ4A 1S7VB 4HX1B 1IQDB 3BO8A 2SEBA 3H9HA 2CDFB 3GNMH 3TT1H 4NUJB 3HFML 1JL8A 3FO0H 3HNTL 3LKNA 1VCAA 5CMAB 5ERWB 5J3HC 5EDXA 3NGBC 3VFPB 2CLRA 5F7DB 3HMWL 1TVBA 1X5LA 3OL2A 5E8PA 1VEOA 2CK2A 4V1DE 4AL8L 5ESAA 1H8NA 1NJ9A 4XAKE 4FZ8H 4Y2DC 4WRLA 5I1AA 2R2BB 2N56A 4KROD 1PLGH 4EDXB 3LH2L 5DWUH 4NDMB 3B9KC 2X9XA 1Y0LB 5C0ND 3C5ZC 1N2RB 3JTCA 4JO1L 3S36L 1NCDL 1K6QL 4QRSA 3GFUA 4LK4A 5E7FA 1DVFD 2AJZB 4NHUB 4OM0L 3W9DB 1L4IA 2K9UA 5HHQA 3GK8L 4ZUUA 3T77B 2M1KA 4BZYA 3QNXA 5DRZA 4PRBB 1ZHLA 5AZEH 5E6YA 4XHJC 1MCPL 3KWWA 2XA8H 2F54D 3RVUD 4ELME 1XIWA 1KPVA 2EDEA 5DK0A 4JFDD 5ANMB 3L1OL 1IBGH 3U4BH 3V2AR 5EU4A 1QFOA 4Z7VE 4XPHL 5D96B 4JDTH 4XP6H 3GI9H 4B41A 5J11B 4NN7B 4Z7WE 4PLKC 2WQ8A 2HFEB 3RVVC 1K4CB 3VGAC 4KVNL 3CH1A 4U1KA 2KQMA 1LE5A 4F80A 5C2BL 2AJ3A 1EXUA 2AI0L 3O4LA 3BIAX 3UDWA 4PJIA 5BS0D 3PWPA 1R5IB 4RAVA 5FYLD 2R4SL 4DAGL 2OR9L 3V6BR 1DQDL 4PRAB 2HP4A 4JAMB 3QISA 2P5EA 5EU3B 3WD5L 4MLSA 1N6UA 3CXDH 4P5TA 1XAUA 43C9B 4WY7H 2G9HB 5IQ9B 1YQVH 4Z0XB 1MLCB 1BOGA 5IJKC 1T3FB 1WZ1H 2BVOA 1CLYH 2VLLB 4G8IA 4JJ5B 3ILPB 4NWTH 3HZVA 5KVFL 1T83A 4LASH 3CDYA 4QCIB 5DYOA 2F58H 1T5XB 5H35A 4TYUA 3FAWA 5J6GA 4MNHA 5DF0A 2QADB 2QKIB 2NY4D 5HVHB 3HZMB 5E1HB 4NQDE 2VZOA 4OZHB 1VEPA 5F44A 2C4FT 2VIRB 2H3NB 2A6DB 4TOYL 1T4KB 1NGXA 1U95A 3SGKA 2AEQL 3GSXA 1BZ9A 3LSOA 4U6HB 4YHMH 2Z93A 1MFEH 4TSCH 1X5YA 5T1LB 4HWEH 4JM2A 3DTXB 1X4XA 1RHHB 4NBXB 2Z8WC 1RI8A 3RZCB 4YHKL 5CLWA 1I7ZA 3QUML 4I48A 5KSVB 3LEXA 4F57L 4PS4L 4FABL 4F8QA 3ARBD 4HPYH 2OYPA 2F5BL 2G5BB 1J1PL 1JYXA 2W0KA 4OV6F 3RWFA 1HHGA 4KMLB 4IRSB 5DRXB 4DGIL 5F9WC 1MF2L 3UTTE 2VR5A 5T3ZD 2F15A 5E6IB 4WWKB 1GOGA 1JNNH 1U8JB 2BY0A 3O4OC 2G75B 1HQRB 1X5KA 2Q8AL 3LZFH 1MNUL 3G6JB 3NBNA 3RWGB 1GZQB 3H0TB 1CIDA 5HHXL 2YKLH 3RKPA 3BQUC 5EZJA 1DQQB 4D0DB 5LGJA 4EXKA 3QO1A 3K0WA 3EAKA 1AKJD 3RI5K 3P11L 2C3VA 5HDQL 1PDKA 5LQBL 3PXHA 1WLHA 4LVHC 1I4FA 4CDGC 2X4NB 3HZYB 1LQVA 1Q72H 3BXNA 3I3DA 3O11A 3NVQA 4PJGF 3JWNC 1A7RL 3W11D 2NX5B 1RZGA 4Z5RB 3TV3H 3A67H 3DYPA 3DMMA 4X4MA 5MEPA 4NKDB 4DUWA 4I18A 5K9QG 4RDQG 3RX5A 2EC9U 4HZLA 4RNRB 1WFTA 2NTFB 3RWCA 1LEGB 3PGCB 4YFLI 2X89A 2HG5A 2RIKA 4N1HB 3QEGH 3RWDA 1FPTH 3EYVA 5IJVA 4LQFH 5JOFA 3H7BB 3G9VA 2XOTA 3L3DB 4G8EA 5GS1B 1JGEA 3ARFB 5F93C 5FYKE 5KANI 3OKKA 5DC9B 2YEZB 3MROA 5ETUB 3I9GL 1MI5A 3LN9A 2IFFL 2P5WB 4XCYA 3BPCB 1RIUH 4L4VB 2CO7B 3W81A 2R15A 1OTTC 1AQDB 5E70A 4Z7UB 1EIBA 5HI5C 3KJ6L 3DWTA 2Z35A 2R2HA 3W2DL 4EI6A 1CDHA 5DHXB 2DB8A 2ADGA 2M26A 1A22B 2HKHL 1Q0XH 1XCQB 1NAML 1YEDA 3CLEH 3PF2A 5DEFA 3GSOA 4PJ9A 1S7XB 4OZ4B 2HVKB 4NJAL 5BVPL 4L8DB 1MY7A 2NY0C 5DMIL 3DBXB 5KG9A 4S1QH 3NCJH 2E6PA 5AYQA 2Q6WA 5HYFA 4JFFE 3QFDB 2OX5A 3U6RA 1LE9A 4MAYD 4MAUH 1FVEB 4WW2B 3QULA 5KS9A 4S11A 5I8OH 4JHWL 3WNKA 2J6EH 4F37F 2AQ1A 5ICYB 2FYYB 3IFNH 2BRRL 5EBWA 2XWJB 4G6ML 1I85A 1LEIA 1CICD 4QOKB 1J9CT 4K07A 5D7IB 1OAUL 3AROA 4NZRH 3AS1A 2OZ4H 3M17A 1FZJA 3NCEB 1E4XH 4X5LA 4HIEB 3AY4C 1TVHB 3NACH 3OR6B 3WXVL 3I75B 3IDYB 1U3HD 5CJQL 2QTEA 5EUOA 4TULH 2VC2H 4MYWB 4P9ML 2IQ9L 4BSVB 3I6LE 1ETZB 4YBLB 5E8OB 4OLVL 4UU9A 3SDDA 5CJOL 3QCVH 3TF7C 2EDHA 1UKTA 5D2LB 1MRFL 2VXVL 1FH5L 3UAJC 5SWSD 4Y5YB 2JK5B 3EOTH 4JB9L 1ITBB 4M00A 5IMLB 2J8OA 5CBAA 2B5IC 4PY7A 4ZPTA 3RTQA 2HLAB 2V2WA 4YHPA 1NBVH 1RUAL 1RV6X 2Z92A 5ESQB 5JXEC 4XNQB 2GTWA 1DN0A 2F19H 4O2FA 5JIPA 5F6IB 1GC1L 5IFJA 4AH2B 1C5BH 4QHNA 3L3GB 4O4YL 1D9KB 3V0AC 3BZEB 4ODUB 4P2OD 1W0VB 4UT9H 4Y5XC 3RNKB 2JJUA 4KDWA 4KC3B 1TTGA 4JKWA 4OQ1A 5T1MA 4WHYH 4YAQB 4ENED 2FO4A 4I5BB 2VSDA 4PGCA 3HNTH 1RIVL 3DROB 3MLZL 4LAQH 4BKLB 1NUGA 3R06A 1GZPB 3HMWH 2X4TA 2Z31D 4IHOB 1RZIA 4FA8A 1U92A 2YWZA 4NQXB 2VDLL 1OCWL 4G8GA 2HJLB 1UJ3C 1RZ8B 3MRRA 4XCNB 4AL8H 1J12A 3MC0A 2DF3A 4HLZG 3CX2A 3S97C 2JELH 4P3WA 4HGWA 3LH2H 3MBED 4RGOL 3CX5K 4RWYH 4P23D 4GRLA 2GAZA 2ZG1A 1V7NL 5DDHB 1H8OA 4JO1H 4PFEA 5F9DC 4CDHA 3TN0B 5ICZA 1EV2E 1QSEA 3S36H 1NCDH 3QFJD 1F4YL 4BH8A 1K6QH 4U1GB 4RMVA 3LAFA 3QCTH 3KYOB 4OM0H 3GK8H 4FQHB 4MQXD 2AQ2A 1JYVA 4WIQA 1GHFL 3S3SA 2IAMA 5E2UL 4N5EC 2ATPA 4GAFB 1MCPH 4Z78B 3MX0A 1MFCL 1RJLB 3VXPA 3ERYA 3MCLL 2FLBT 4N5UA 5DS8A 4BH7B 3GM0A 5F70A 4O00A 1VACA 1WAAF 4XPHH 3SDDD 4UDTA 3OKMA 3BHBB 5AWNL 4A6YB 5FCUL 4KK5C 3MR9A 1HHKA 4N0CD 4JPIB 2P49B 3TJEL 1A1MA 5KSAC 4KVNH 5FOJA 5EIIB 1F97A 1MCRA 2NY1B 4HK3N 2AI0H 2C26A 2X4PA 1J0HA 2EDQA 5HHMA 1QHOA 3ARGB 1VEMA 2ITCB 3EYOB 4KKLD 4DAGH 1T21B 5GSVA 1DQDH 3NFPB 3TA3A 1D5MB 4KGJA 1FVDB 2NY7L 3QXVA 1I9JL 4O9HL 2AERT 3T3MF 3WD5H 2FIRT 5BRZD 1IAMA 4OF8A 4PB0L 3QUZB 1GGIL 2DM4A 3HLAB 3RIAK 4PY8I 3JUZA 4Y4KA 4GMTL 4MXQA 3FO9B 5F1KC 5CEYA 1C08A 2NMSA 2FZ3A 2OJZH 4P3CH 5KVFH 1BLNB 2NPLX 4GBXD 4NRZA 3TPUB 3BZDA 5TH2B 4HS3A 3CX5J 3SGJC 2YRZA 5D1QA 2WP3T 3STLB 2JB6A 1I7RB 5C3TA 5B39A 4Q9QH 2I5YL 1W8NA 4MVBA 3O0RL 1RUML 3JWDC 4HUVB 5TDOA 4LLWA 4WNQA 4H26A 1D5ZB 2X4UA 4TOYH 3VMPA 1SYSB 4I3RL 3FJTA 4J1UA 5I76B 3BRFA 3LQMA 4UI2A 1UWGL 2Z91B 4AT6A 2BNUA 3UROR 5HDOA 1WWCA 3QUMH 3MPCA 3G5XB 1R3HB 5C3LD 4P2RA 4R2GC 4F7CA 4F57H 5IWLC 3TC9A 4PS4H 3W0WA 2IAMD 5L2JB 4G59A 2ATKA 1UACL 3JZ7A 3QG6B 1J1PH 2CLZA 3P4OA 4WHDA 2R4SH 3NZHH 3KPNB 1TXKA 4XVTL 3ZSSA 4C56D 4G80B 4N9GA 3S88L 3U46A 1MF2H 4TVPE 5FYKL 5L8JB 3X3FL 5F21B 1DDHA 3SPVB 1MY5A 3FB8A 4PJFA 1EEZA 4XP4L 2MHAB 1K2DA 2PYED 4DKFH 2CKBL 3VXME 1FL3B 3QEQB 3OB0K 5DD3L 2Q8AH 1A6WL 3HS0B 1MNUH 1RJCA 5HDLA 5HHXH 3SO3C 3JV6B 3RPIB 4N0UE 4ONHA 1DBML 4P46C 5C07B 1FYHB 3P11H 5K59E 3EW3B 5LQBH 2A6JB 4JJHA 4PRHB 5DJ2B 4NP4L 1MCKA 2ZCKL 3BOVA 3JV4B 1IGJB 5EA0L 4R6UA 2BOCB 1A7RH 4JFHD 3B2VL 4IIQC 5LAXB 1RUPL 3EDEA 1HKLL 2EE9A 1ZOXA 1I1FB 4JFXA 5I0DA 4LLDB 4WV1C 3WJJA 2NY6D 5DHVB 3JV0A 4J8RA 4HS6A 3RKDC 4HH8A 1ZT1B 3GMMA 4YXKL 1BF2A 3MGAA 2W9DL 2A6KB 1OW0A 5HGDB 2R8SL 4BSJA 3C08L 4F2MA 3IRPX 2FCBA 3BP6B 5C0GA 4P2QA 5E9DD 5D93B 2Z8SA 2ICWB 3MV01 3ZMRA 1W0WA 4X7TA 3V79C 4KK9C 4YFDB 3CC5A 3N1MC 4X7FC 2VLKB 3I9GH 5FO8A 3QIWA 1YNKL 1GIGL 2IFFH 1TQBC 3QP3A 2VO5A 3V6OA 1HWGB 3QEUB 4MNGA 1LK2B 3N06B 4MD4B 3SHSA 4D3CL 3IXAB 5FUZL 5I66B 3LN4B 1HCFX 4U6XA 3HZKA 3L3KA 4JFQA 4NZTL 3B5HA 1JRHI 4CVZB 4JKPL 1ZT7B 3FO1A 3QUXC 2HKHH 5GZND 3VFOB 5IBUB 1NAMH 3KPTA 1QRND 3HB3C 2OR8A 3O6ML 3OPZL 3EKCA 5F1NB 1HH6B 4M61B 3D69A 3MRGB 5DQ9B 3GBLA 5D72L 3PDOB 4NJAH 5BVPH 4TSBL 2AK4A 5DD5L 5DMIH 5GZOC 4M7LL 2OBGA 4N8VG 3V95A 4EVNB 3CZFA 2HTLC 4PJ5A 4P4KB 1KEGL 4OCNC 5KW9H 1HI6A 5FEBA 3QEHB 5I1JL 3UBXB 4P0DA 3GO1H 4JREB 3QAZB 3H8NA 1RZ7L 2HVJB 1P7QD 4LFHG 2BRRH 2EZ0C 5DJ0B 5SWQA 4G6MH 3ARDD 2FL5B 1AFVL 3SDCB 3B9KA 1HQ4B 2IPUK 3KLAA 3KPPB 1VENA 1OAUH 4YHYB 4CMMA 2YD9A 4H5SB 5DZLA 3ZKMD 1A9BB 4HS8L 1AGDB 3FQUB 1WCQA 5JW4Q 2OTPA 5IEKB 1E4JA 4WI8A 2ZSVA 2EKSB 3QIUD 1U8QA 4L9DA 2K1MA 3SDAA 1IFHL 1UVQB 5CJQH 2HT2D 4FOMA 4P9MH 4KJQC 1LO2L 4PJEF 1FFNB 4OBRA 3WIHL 4JRXD 1ED3B 4L3CB 4OLVH 1YYLL 1DBAH 4Y4HA 5CJOH 4QXTA 1T66C 2BVQB 4PJ7A 1MRFH 2VXVH 1FH5H 4LKCA 3MJ8B 1BQSA 3LDBB 5DMGD 3BT2L 1PZ5A 5IVZA 3AU1A 3M1BA 4LCYB 4PREA 3QDMB 4BYHA 3GMOB 4L3EE 5TE4L 4JQIL 3KDMB 1HXMA 5FYKU 4U33A 5CLTA 1GL4B 2GTZA 1RUAH 1U93A 3QJFA 4WUUD 5E1AA 3LKPB 1A1OA 4FHBD 3CVHB 3UTOA 3DV4B 3M8OL 1GC1H 3ILQC 3SKOB 3CFEA 4RGNB 3RY5A 2D03L 3SBWC 3SCMB 4O4YH 1MIEL 3BZ4B 4QRUA 5D96C 1A6ZB 4WJ5A 5J11C 4NN7C 3RDTB 5J56B 1RJZB 2GCYB 5ID0A 4E41E 2FR4B 4E42A 1UWXK 3UTSD 4ZG1A 4OLXL 2K7PA 3SY0A 3FT2B 1A5FL 4N68A 1NPUA 3GHEL 2C1PA 1RIVH 2CXGA 2PXYB 4NHCL 3MLZH 1G1CA 4XBPB 5H37H 1KCGC 5A16B 1QQDA 2IANB 1D7FA 3N50A 3D39B 3L3JA 3OKOA 2VDLH 5C9KA 1OCWH 3B43A 2QQLL 1ORQA 4K7PX 5GXBB 5AAWA 3KNBA 3FN0H 3QNZB 2HFFA 4POUB 5HHOD 4DZ8B 4F33B 2V2TA 4FZEL 4AZ8A 2XN9E 4Y2DD 4RGOH 3D18A 4CN1A 1Z3GL 1QSFA 4JRYA 5GHWL 2PW1A 3C5ZD 1F4YH 1R5VA 2DKMA 2ED9A 5JW3L 3K1KC 2X10A 2ZUSA 1WT5C 4XPBH 2MCG1 1N6VA 1MCOL 4LAJH 1VSCA 4MDIB 3EOAA 1SEBB 2YA2A 1CLCA 4BQCA 4LDOB 1GHFH 2QADC 5E2UH 4LNRA 5AUMB 3V6ZA 4G6JL 3UYRL 4W70A 2ZOKB 4X9HA 5HVHC 1XGTA 4XHJD 5EC1A 5JDJA 3MCLH 3SGEH 2UV3A 1RUQL 3T3ME 3B9AA 3VCLB 4Z7VB 1M71A 3KPSA 4EEEA 2IH3A 3ES6A 3BH8B 5AWNH 1X44A 3ARSA 1Q9LB 5FCUH 3RZCC 1DE4B 3E1F1 1BVKB 2JF1A 5I6XB 3LRGA 1WQVT 3TJEH 1NBYB 2F9BT 2EE6A 4WO4B 3BDBA 1JF1A 3RVVD 2FECL 3BZFA 4A2LA 1YA5A 2FIKA 5EZLB 4OZFA 1NLDL 3MLWH 2BSTA 1G7JA 1GGYA 5I0ZA 3DXAB 1S3KH 4IRSC 2EO9A 2E7CA 3BD3A 5BOPA 5F88B 3L7EB 5HVWA 1L7TL 2NY7H 4O9HH 1I9JH 2F8OA 4GS7B 3SQOL 4PB0H 1MVUA 4NSKA 4NBYB 3KHQA 5D7JA 1GGIH 4PTTB 5E6IC 4TVPL 4WWKC 1A1NB 4YE4L 1I8IA 1U8NA 3P3YA 4XX1G 1FCGA 4FQ2L 4ZQKA 5SV3A 1J0IA 4KU1A 4OFPA 1MJUL 3QWRA 3SGDI 3LHPL 4RMRA 4XRCA 4NQCD 1FLRL 2ZUXA 3FMGL 3PE9A 4X4YA 5EFIB 3FQRB 1ZANL 1P4LA 4MCYB 1PYWB 4O58H 3S37L 3MFFB 3L3OA 2I5YH 1EEYA 3CFDA 3O0RH 1RUMH 4KHTH 2E7LE 1CE6B 4NKMA 3DO7B 1CDIA 4RFEB 1BF8A 3ZZ1A 1TJIL 2PW2A 1V7ML 4JRYD 5CGYC 2P8LB 5ADPL 3UC0L 2XFXA 2YSSA 5IM7B 4G9FB 1IILE 4GW5A 5C0BB 4HZAA 4Y88A 4F37K 1R3LB 1EHLH 2Y23A 1K8IA 1OLLA 4FTVD 2CIKA 2YMXL 2ZUVA 2CLVB 1BX2A 1UACH 3HA0A 2YPKB 4LLVB 5CP7B 1JTPA 2Y36L 1MCNA 4FQCH 3QQ3A 4XVTH 2VXUL 5GS1C 3ARFC 3WMSA 4NQVA 2FEDC 1OTSC 2MMXA 3IDIA 3S88H 1OGAB 2FRGP 3UTTB 3TBYA 5FYKH 3N0PB 4N0YL 1T1XA 4ZNEE 1U8HA 5AG9A 2VDPL 4WFED 3CLFH 5M94B 1I7TB 5EU5A 4XP4H 4U1HB 2FD6L 3HI6L 4E0RA 5FUCE 3C6LA 2BNQD 2CKBH 4R7NB 4QRRA 4DUXA 1B88A 2OI9B 3O45A 3LN5A 5DD3H 1A6WH 2H8PB 1G9NC 4ODXB 4MJ5A 5ESVA 2J12B 3UTZA 1GXEA 1N8ZA 3HPJB 5EZOL 3MJ9L 5GJTH 5A43C 2FBOJ 1DBMH 3P9MA 1BBJB 3ZDYF 2R56L 5ID1B 8CGTA 3BQUD 5B8CA 5BJTB 2BY3A 4YHOL 3V9FA 4NP4H 5C0IB 2AXGA 3GMLB 5EA0H 1QG3A 1F8TH 2GY7B 5INDA 2I07A 2WUCH 3B2VH 1RUPH 3E6FA 1HKLH 5GS0L 1S7QB 1F4WL 5K9KB 1FZKB 5KSBF 1CGYA 5F7MC 1EUUA 1H3WM 4WW2C 2X42A 5D6CB 2C1OB 5GSRB 3MRLB 5IG7B 5MENE 2VE6A 3MV8D 1X7QB 1NUFA 1YMHA 4PRIA 3BKML 3TBSB 2W9DH 4MGXA 3ARQA 1NANH 3OAYK 3C08H 3OB0H 3C60B 1IAOA 1NGZA 2OTWA 2W65A 1AR1D 3TF7A 4LDEB 2X1WL 2VQ1A 3QRGL 4PBXA 1OP3K 1BGXH 3NOIA 2Y7QA 5LWYH 1AXSB 3OQ3B 1YNKH 3IDYC 1GIGH 3Q5OA 1HINH 1E6JL 5FUZH 1WC7B 5JXEA 5ITFB 1NAMA 4LHUD 4R7DB 3JVGC 4YBLC 5HYQB 4NZTH 3IU3B 1OTTD 2DTML 2W0FA 5HI5D 5JR1L 4GG6F 1WIUA 3QR2A 3EIFA 4RX4D 1RD6A 5TDNB 3VFSB 4B53A 1UB5A 2B1HL 5TFSL 1Z9LA 4Y5YC 3O6MH 1E28A 2P8MB 3OPZH 1A3RL 3PWNB 3IFPA 2KH2B 4FMFA 4R26L 3IETB 4GRWF 5JHDD 3ZYIA 5DD5H 1QFWI 5CHNB 4LCWE 4X6CF 3RZWA 3CAFA 1DQTA 3K3QA 5F6IC 5HJ3A 1FL6A 2NY0D 2WMPA 4OBSA 4ZUWA 3S4SA 3LKRB 3RWEB 1T22A 2I9LA 5IB1B 1GGBH 1IGYA 1KEGH 1UYWL 4KDVA 1MELA 5C70A 3D85D 4JFYA 4KGLA 2Y5EA 5I1JH 3ULUF 5BZDB 3HG1E 1RZ7H 5FO7B 3IDGA 1OWRM 1TCRA 4GOSA 2CUIA 1MIML 4PJEE 1AFVH 1AO7B 2BMKB 2V5YA 3QDJD 4J3XA 3WNLA 4MCZB 5JW4N 3NCYP 4PRPA 4YDKL 2H26A 5LBSL 4KJWC 1JF5A 1QLFB 3OAUL 4HS8H 5F3HA 1VFUA 5I1LB 2ESVD 4B7LA 5KN5B 2A9ML 2MNUA 2PR4L 1FC1A 3IF1B 3D9AL 3O8XA 5TDPA 3DX7A 1X5FA 1YN7B 5EBLB 3RUGB 1DJSA 1IFHH 1T2QL 1RURH 4X6DB 1P53A 1JNHA 4NO0D 5J13B 2IPKA 5F7YC 5I1EL 1Y18B 2RCSL 3WIHH 5EOCJ 3TN0C 4R90L 1YYLH 4FS0A 4PD4J 2F53D 4U1GC 2Z9TA 5HHVL 1ZTXH 5DRNA 3BT2H 3JWOL 4PV9A 2YWYA 1U0QA 3KYNB 3BAEL 4OLYL 2XKNA 3MRMB 3TIDB 3UAJD 4DCQB 4K94L 3TCXA 5TE4H 1M7DA 5KSAA 4WU5A 5GGSA 2VLRB 1U8OB 2CMRL 5I1CL 4JFED 4XI5C 2Y1VA 5EN2B 4DJMA 2BVPB 1W72A 3M8OH 4PB9L 1PG7X 2D03H 2FSEA 3MUJA 3THML 1MIEH 5KZCD 1XF3B 3B8YA 1N5YL 4Z7WA 4YDJA 2G2RA 1OB1B 3GSNA 5IHZA 3SKJL 2WBKA 4OLXH 4QGTA 4Z6AT 2Q3ZA 1A5FH 1A6TB 1IGML 3GHEH 4PYHA 1OT1A 3S8WA 3BRDA 3LQZB 3ORJA 2V17H 3ARGC 4JPWH 5CJ8A 3O3AA 4ORGB 3LS5H 3PQYA 1EA9C 2JJVA 5FM5M 3I02B 4HQQL 5E7BA 2WBJA 5F1IA 3U2SA 12E8L 2QQLH 4KI1A 3QUZC 1BIIB 2DQHL 3IJSA 2Q7YA 4NPYB 1WBXA 4P5KB 3BEVB 4FZEH 2VR9A 3K8MA 3VWKA 3U9UA 1T0NB 1Z3GH 4DFIA 5LVEA 3TNNA 5IB5B 2D4DA 2O5YL 4OIAA 5JW3H 5J4MA 1TVDA 4PRNA 4W6YB 5EUKB 1NDMA 4X0KA 3T4AA 3G6AB 3TIEA 4U6YB 3RL1B 3DGGB 3IS1X 1G7MA 5J6HA 1QP1A 1UWXH 3UYRH 3UYOD 3C5JB 3UTPD 1SMOA 4HWUA 5IWLA 3S35X 4J12A 2R23A 3EGSB 1FJ1A 4N5ED 4U1SA 1H5BA 1GOHA 1KTDB 3DIFA 4HH9B 1RUQH 1EH9A 2M8XA 2UY7A 1WBYB 3J8F7 4HMDA 4Y19E 4MNQD 5DTFB 4HWZB 5C0AE 1FG9C 2PYFB 4AJ0A 4GKNB 3BWAA 3QO0B 2MQCA 3BI9X 4K23H 4RMSA 1FZOB 5C0CB 2YBRB 3U0PB 4KK5D 1KTLB 5C09D 4X6BB 2QSTA 3CU7A 1P2CB 1IGIL 4M3JA 3DVNB 3U36A 4YFLF 4C59B 1NLDH 1T7ZA 4GXUM 5J7CC 3P73B 5EIVA 1L7TH 3MRJB 4LRNL 4M6AA 1Z2KA 1CTOA 3SQOH 4LCIL 4P46A 3T0ED 5JXAL 3VFMA 4TVPH 1KXTB 4YE4H 1KJMB 3LKQA 4PG2A 1CDJA 4FQ2H 3HRZA 3FQTA 4DVBB 3O3UN 4ERSL 1MQKL 1N64H 4U0RB 2DYPB 1MOEA 4LSUL 4IDLA 2YZ1A 1MJUH 2ICWJ 2EDLA 2F54B 3LHPH 2F8XC 1PEZA 4LSSL 3DYMA 1FLRH 2DQEL 4JHBA 3FMGH 3VXUD 1YEIH 4WV1A 4U1LA 4YXLH 1ZANH 3WFHB 2I26N 3MRHA 3S37H 3IKCA 5CFHA 4KKNA 3TZVD 3FOLA 1LD9A 3CFCL 5GGUB 3VE0B 2YPLE 2X4OB 4B5EA 5CP3A 1G6RH 2CJUH 3ECBA 1V7MH 2XQYG 5ADPH 2YA1A 4MA3A 3UC0H 1CFSB 2NW3B 3WJLA 3FONA 4AK1A 5D6DC 1I3RB 2NW2B 1EGJL 4DVRL 5BS0B 3E3QC 1TTUA 1ES0B 4U1IA 2GT9A 4WWID 4ZFOL 2W0LA 3K4DA 3VXSE 2VYRE 5FKPB 2XWBA 4YZFF 2YMXH 3FN3A 4UUJA 4LRIC 2UVEA 3H3BC 4R2GD 3RVWC 4PJAB 2X1XR 1JF6A 1BQHA 5F89A 4XBEL 5D93C 2Y36H 4NO2A 2VXUH 5EOQL 4LSRL 3U0TB 3LKSB 5C7XL 1E4KC 5IOPA 4M6ML 3NZ8A 2CKBA 4HKBA 5EPMB 4PV8B 4N0YH 5EU6D 2BSSA 3P0VL 2VDPH 5CKAA 3V5DA 2JIXD 1P1ZB 2FD6H 3ARWA 3NTCL 4HEME 5LG1A 3HI6H 3VXMB 1LO5B 3IXTA 5D9SB 2IQAB 5L2KD 1U58B 5I17B 4JFPB 3CDFA 5T33L 4PJIF 2RAMA 1V05A 1CLOL 2WWMD 3MLPA 4N0UB 3MJ9H 2CDEA 1U91B 32C2A 1QNZH 4JY4B 1INQA 3MREB 4P46D 4HX1A 1G6RB 4PJHF 4YHOH 5FFLA 1IQDA 2H6PB 1U8PB 3C6SB 1Q9OA 1XR9A 4JFFA 4XMKL 4B50A 5EO1A 2IWGA 5DHYB 5CZKA 3QBTB 5ERWA 3T1FA 1F4WH 4I13B 4P4KC 1C5CL 5E99L 1T1ZB 4NYLB 3TBWB 2IBBA 2FLRT 4UTAL 5DQDL 5FIEA 4W4OC 4JREC 1Q94A 3QAZC 4UT6L 3VXRE 3BKMH 2R2BA 1PZUB 3RKDD 4MJID 4QRTB 5CS7A 3RWJB 3SDCC 3RP1A 2BC4B 3G6DL 1ZLSL 4OZIA 1CFQA 2BRQA 5IBLC 1TNNA 4YHYC 2AV7B 1BZ7A 2R69L 5IB2A 1G0XA 1YJDL 1HYRC 4NHUA 4X8JB 4PGJA 3QRGH 3QXDB 2WINB 2QEJA 4GRWE 4KK9D 1E6JH 5FA4B 2CRMA 4U1JA 5JW5B 1QPXA 1AKJB 1CIUA 2J5LB 1FN4B 5TF0A 3ETBF 5B39G 3MA9L 4BSWA 4FQXA 2DTMH 5ANMA 2OCFD 1YEEL 2VN4A 1T6WA 3ZO0A 5JR1H 3FFCB 5HYJD 3LDBC 3ULUE 2B1HH 3QUXD 1BD2B 3VH8A 2MKLC 3HB3D 4XT1C 1K4CA 4R26H 1CBVL 1T5WA 4I0PA 2WQRA 3MZGB 1S9XB 3UPRA 4MS8C 2VLJE 1ND0A 3OMZA 3QCUL 2C9AA 5IF0A 4RGNC 5GZOD 1R5IA 3ARUA 4J4PC 3SCMC 2PF6A 4NQSB 2C7UB 1UYWH 1OP3H 3KPRE 3RDTC 2HTLD 3D3VB 1H3PH 3EYFA 2VITA 4H8WL 1MLCA 4KXZI 4LPUA 1S9WA 4XVUC 5ISZA 2XZQL 2EZ0D 2PXYC 4XNZB 5ACZA 1J0YA 4JJ5A 3ILPA 4YDKH 3HNSL 5LBSH 1OQOA 3OAUH 3NABL 4IS6B 4F58L 3EJJX 4YLQT 1SJEA 5D1XA 4HW6A 1LDSA 2BSED 4PJ8B 2A9MH 2PR4H 1OY3B 4KI5C 3D9AH 4D0BB 2YS4A 4Y4FB 1T0PB 4YK4B 3WIHA 2IMMA 5D2NB 2XA3A 1I7UB 4NC2B 4RIRB 4D2NA 3VI3F 1CYGA 5I1EH 1HXYB 3KPMA 2H3NA 2A6DA 1T4KA 4R90H 2FGWL 4D9QE 4JZOB 1HHHB 2EECA 4JQXA 4KJQD 5HHVH 5I8EA 1XGPB 2ZP0T 1CL7I 3DTXA 3IJHB 2XPGB 3JWOH 1RHHA 1AIFB 4XGZB 3BAEH 4OLYH 4K94H 4L3EB 4TUJB 1ZMYA 1HEZA 3ZE1F 3HTLX 4FQIL 5DJDA 2CMRH 5I1CH 3AS2A 1VHPA 3QJHA 4OLUL 4UBDC 3CDGB 4PB9H 4H25B 1ZLUK 3R1GL 3TYFB 1RZFH 3WNOA 3THMH 2OJEA 1IM3A 3MYJA 1CICB 1N5YH 3MRNA 5DSCB 2Q76A 3VXTA 1T04A 1VFBB 5I6XC 3MODH 2D7PA 4JKMA 3PNWA 4UDUB 3LS4L 4WO4C 3SKJH 4LLYB 4NQTA 4O2EA 3AMLA 3QNYB 1IGMH 2DWEB 2JJTA 1HQRA 3MMEA 1TZGL 3BPOB 3BUYA 3QDGA 5B4MC 3B5TA 1FO0L 1QD0A 4GS7C 12E8H 3EDFA 1E4WL 2E5EA 2VWEE 1XCTB 3BD4A 1MAJA 2DQHH 2XN9B 4JFDE 1WBZA 5DJXB 2X4NA 4HUMB 1RMFL 4HBCL 2GJ6B 1KJ2A 3WE6B 5C6WH 3HE6A 5DURB 3MLTB 2RBLA 4XWOC 2O5YH 4Z5RA 4PGDA 5SWZE 1QR1B 4UNUA 4MZ3A 3D6GA 1AP2B 3OJMB 4EN3B 5D1ZB 3AMKA 2QQKL 3F7QA 1H9VA 2LU4A 4HIJB 5HI3C 5HGGS 4RNRA 4X6EA 4WFGD 3PGCA 4G43B 2HJFA 1MHPL 3WS6A 1Z0MA 1L0XA 4X7EC 2QADD 4NFBA 1FNLA 2GJJA 3OKDB 1S7SB 5ALCL 2G5RA 1T0MA 5GS1A 4GAYB 2AW2A 2C5DC 3CSYA 2PUQT 3RGVA 2YEZA 3ARPA 5T1LD 3TH2T 5ETUA 3VFRB 4K8RC 3QWOA 5JOPE 1JPST 3RZCD 4XPTL 1NFDB 3BPCA 4CAGA 5JTWA 1IGIH 4P59L 3AVEA 4UQ3A 1IL1A 1E27A 2QR0B 4RFOL 5CJ5A 5JQ6L 1OVZA 2GSGA 3PJSB 3MBEB 4MA7L 2YC1A 2V7HA 3I84A 1H15A 2Y07L 1QR4A 5E4EB 1ADQL 4IRSD 4LCIH 1HWHB 4JANB 4PJGA 3VI4E 3T0WA 2Q8BL 2EDWA 5JXAH 3LRSA