5E8OA

The structure of the teipp associated altered peptide ligand trh4-p2abu in complex with h-2d(b)
Total Genus 65
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
65
sequence length
276
structure length
272
Chain Sequence
GPHSMRYFETAVSRPGLEEPRYISVGYVDNKEFVRFDSDAENPRYEPRAPWMEQEGPEYWERETQKAKGQEQWFRVSLRNLLGYYNQSAGGSHTLQQMSGCDLGSDWRLLRGYLQFAYEGRDYIALNEDLKTWTAADMAAQITRRKWEQSGAAEHYKAYLEGECVEWLHRYLKNGNRTDSPKAHVTHHPRSKGEVTLRCWALGFYPADITLTWQLNGEELTQDMELVETRPAGDGTFQKWASVVVPLGKEQNYTCRVYHEGLPEPLTLRWEP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system
molecule keywords H-2 class I histocompatibility antigen, D-B alpha chain
publication title The MHC Class I Cancer-Associated Neoepitope Trh4 Linked with Impaired Peptide Processing Induces a Unique Noncanonical TCR Conformer.
pubmed doi rcsb
source organism Mus musculus
total genus 65
structure length 272
sequence length 276
chains with identical sequence D
ec nomenclature
pdb deposition date 2015-10-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00129 MHC_I Class I Histocompatibility antigen, domains alpha 1 and 2
A PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5e8oA02
3.30.500.10 Alpha Beta 2-Layer Sandwich Murine Class I Major Histocompatibility Complex, H2-DB; Chain A, domain 1 MHC class I-like antigen recognition-like 5e8oA01
1T2JA 3MACL 3KPOB 4H20L 4Q6IB 1HEZA 4ODTH 2AJVL 2DM3A 1JGUL 1Q9KA 4KVNL 4NZRH 1PG7W 2DQHH 3DX9B 3P4MB 4FRWA 4NKIL 2V7NA 4Y5YC 5IHUH 4XNXL 4XMKL 2NNAA 3V5HA 5C07A 4KKAC 2EYSA 1RZIB 3UYPA 3FB7B 3G6AB 2MJWA 4LK4A 1LE5A 1S9XA 2ZUSA 3LQMA 4IOIB 3U6RB 1RJLA 2X4OA 1JPSL 4PRDB 5DJYB 1RZGB 4XXCC 1CK0H 5DUML 1X7QB 4E41E 4HWNA 4N0CC 1ACYL 4H25B 2FL5B 2F54E 1JJUA 2JIXB 3ZKSD 4X99A 2ID5A 2UWEE 5LBSL 3MUGB 3UTTA 2FX8H 3HZMA 4G9DB 4ZYKA 1OAZH 3FHAA 5KSUA 4ZAKC 3SKJH 4KDWA 2D2OA 2VZUA 2BZDA 5D7SL 1FL6A 4CU6A 1HNFA 3MLVL 1KTLA 5DRWA 3E6HB 2Z0BA 3DWTA 3TH4T 4Y2DA 3O6KL 2F53E 2JB6B 5KANG 4K94C 1TZHB 1HHKA 2QADC 5AZ2L 4JRYE 2P42B 4KK9D 4DGIL 1Y6NR 2VDOH 4U1GC 4OLUH 5JIKA 2ORBL 1FAIH 1A1MB 3R1GH 1PQZB 1BJ1H 1JHKH 3T09A 1E6JH 1JK8B 3G5YB 1NCCL 1TQBB 4NFBA 4HKXB 4BH8B 3BW9A 2FO4B 2IPKB 4K3JH 4OUOA 1RMFH 4G6JH 5HHNB 1ZLUH 4PRBA 1XH3A 2HJKA 3TO2B 1OT2A 5J9PA 1CFQA 4OZHE 4QHMA 4ZTOH 4D3CH 4ZUTA 5DC0A 5C0CB 2UY6A 4JY4B 5CKAA 5FKPB 2Z93B 4NQSB 4Z78B 2VDML 3PWNA 4CADB 1IEBB 1AFVL 2G9HB 4LCWB 4EKXA 5L0QB 2PYEE 4CVWA 2B1AH 4XTRD 2XKNA 5AZEH 4IEFB 4LPTA 4NZTH 3D25A 1ROWA 4WWID 4LPVA 5HDBE 3FN0H 2W59A 1PYWA 4Y4FD 1L4IA 4OFVA 4OQTA 1MNUH 1D5BB 1D6EA 2CRIA 5LXGL 4V3DB 1JZ2A 3B9AA 4P3DB 4OCXL 1P4LA 1K8DA 1KB9K 5CZVL 1FZMA 3VMPA 4YDIL 3QEUB 7FABL 3A6OA 4QY8A 4DGVH 1UKTA 1JFQL 1DQDH 1TLKA 4NHCL 1HQRB 3M1BA 2X1OA 5GZND 2C3GA 3PWJB 2A73B 2QTEA 4X6DB 2HYMA 3CFKA 3MLSH 5F44A 5L2JA 5CJ8A 3EO1B 5JXAL 2KBGA 1SBSL 1Q9LA 3GFUA 2J4WH 2FATL 3JXAA 3QUMA 1QOKA 3TBYA 1JZ5A 4JB9L 3GJFA 3FFCD 1I1FA 4BZ1H 1UM6H 1FNGB 4LPCA 4H0HB 3FQUB 2FGZA 4WVRA 3CZFB 4PJEF 4LNVA 1WFTA 5AWNL 1GZPB 5K9QI 3FT4B 4NWTH 1DFBL 2Q76A 3PGFH 4PRIA 1WGOA 2NY6C 1G1YA 2Z9TA 4MWFA 1Y6MR 1JI2A 4Y2DC 1DBBL 2C9AA 1NGQH 3S88L 1CXLA 1WFNA 4YBQD 1UVQB 4NNPL 3CH1B 5FYKD 5A3IC 3BD5A 1Z9LA 2K3TA 3NABH 3WBDA 5IQ7H 4M93B 3KYMB 4NRZB 3HR5A 3WN5A 1E4XL 2A6JA 3IJHA 5BS0E 1W0WA 4LSUH 4HKJA 2QQLH 5E8OA 2AK4B 3LQAH 2O5XL 3HPLB 4YK4C 1DLHB 4BFGA 1F8TH 3TYFB 4QHKI 5IBUG 4NKDA 1J8HA 3CXDH 4LEOB 4F58H 1CICB 3NTCH 5FM8A 1FGNL 3RAJH 4PGBA 5ALBH 1JPFA 5FO7A 3NH7L 2RJMA 4OF8A 5D7LA 2Z91A 1YMMB 4X80H 3ET9F 4OZFA 2VXUL 3MXVL 1U41A 3JUYA 3PG2A 3P0VH 5CEYB 1JNJA 8FABA 5B8CA 1MUJB 2OCFD 5EOCH 2EIDA 4NUGL 3SJVB 3D39E 4KK8D 1RPQA 4LRIA 3GMPA 5DEZA 4F7CB 1QSFD 4ZUWB 1AQDB 4NO5B 2Z4QA 3VRJB 3A6BH 4JDTH 4ZDHB 2OQJA 2K1MA 3HC4H 3RFZC 5A2JH 3MRCB 3MLXH 5FOJA 2EDFA 3OKNB 4HH9A 4NDMB 5E7BA 4Z7VA 3MJ7B 2AXFA 3B3IA 2WY3A 1NGYA 3L95A 2VQTA 1P5VA 4O9HL 1XF4A 2APWA 3L5XH 3DXAA 4B5EA 2PXYB 4QHUB 4OFPA 4PGDB 4LU5H 1FFPB 4JO4L 2DBJA 1DTUA 5IW6A 2OTPA 1INEL 5A2IH 3KNBB 1DN0B 3LN4A 1K4DA 4QTIH 3MRBB 2OMBA 4GT7A 2LQRA 1JWSA 2WP3T 2NY7L 1CGYA 2AXGA 3QHZH 3BPCB 3SCMB 1FNEB 4JKPL 3WN5C 2BC4A 1CDIA 4D0CA 1LQVA 3WHXB 3MREA 2XA3A 3QR2A 4HZLB 4XP6L 5CZKA 2PTVA 3V6ZB 3ULUD 1D9KA 2W07A 2ZPKL 3W2DH 4XNUL 1ZANH 3B43A 4PJAE 2VAAA 3ZT7A 5ADOL 3I3EA 3KJ6H 4G6MH 5IVXF 4F3FB 3H9HA 2Q86A 1CL7H 4JLRA 1B88A 4MJ6A 4MJIA 4YDLC 1VA9A 1FQ9C 1L7TL 5IG7A 3RWEB 5SWZE 3DO7A 4UOJA 2OSLA 1XCQA 5INDA 4APQB 4F15C 4D9QE 3LH2L 5E2WL 1B4JH 1U3HA 3MJ8B 4Q0XL 2P5EB 1DLFH 4HKZA 3D69B 1DUZB 1M7DA 4Q6YA 1KN2L 3GHBL 3EDJA 1FYTE 3SGKA 2L7JA 3VXUE 3O2DH 2RB8A 1VGEL 3GMMA 4ZPTA 3RIFF 5B8CC 2IC2A 1RHHB 3TV3H 2C7UA 1S7TA 3OX8B 2X4QB 3VD9A 2APXA 5GIRB 1H8OA 4FZEH 4H5SA 2A2QT 4UILL 2C4FU 5GJSL 4LRIC 4C83A 2X4NA 5HYFA 4PFEA 3FQTB 2GUOB 3AREC 4GKNB 4DKFH 3WKMH 4HBCL 2XNAB 1C16A 3KYOA 2AEQL 1A2YA 2XWTB 5DHXB 4MJ5B 2ILLA 4CU7A 1PZ5B 1NKOA 5GGTA 1E4WL 3PP3K 3BT2L 1BLNB 5ETUB 5JLZA 4X9GA 1FVCB 2NXZB 5GGSA 3ZKMC 2I07B 2MKLC 2D7TL 1ZHNB 2IGFL 4I9WE 2DQDH 1HINL 4MZ2A 5DC9B 4R9HA 2XZQL 3CXHJ 3OBAA 1S8DB 3RVXC 2A9NH 4GLRH 1JUFA 2WQ8A 4C55A 4NQCA 3GO1L 2LABA 3CVHA 3CMGA 5CILH 5C0IB 2NY0D 2VE6B 4UIKL 3BJLA 4IOFC 3L3OB 3T2OA 1NEZA 5F89A 2Z31D 3PWPA 3UTSD 3PJSB 1DE4A 1D9KC 1EPFA 4OD2A 1QSED 3ABZA 3RWHA 1SY6A 1MELA 2ADFL 2GSGB 1QKZH 5BV7C 2W0FB 4XAKD 1AGDA 5GS1B 4MAYB 4M7KL 5KSVA 3ARTA 3DI3B 2XTJC 4UT9H 2EDDA 1GAFL 3HNTH 3P73A 5SWSD 1J1OL 1ADQA 4XCCL 2KQMA 4R8WH 1P7HL 5FM4A 4KROD 4OF7A 3ERYA 1KCVH 5FOBA 1FG2A 3FO1B 5FGCB 4PJXA 2DLIA 4OCNC 1U3HC 3LIZH 2HA1A 1YN7B 4F7PB 4YXLH 3SGKC 5HYJA 5JO5A 3QQNA 2UV3A 3IFNH 5F7WC 5T5NG 3W11D 4ZTPH 4NNYA 3RWJB 3X3FL 5BW7A 4I4WB 1VENA 3BFOA 1EEZA 2UZYB 3BZFB 3PV6B 4HGKC 4IRSB 5LGJB 1CQKA 1VHPA 4I2XB 3VXRA 5F7DB 3OKMB 3MNWB 4R4FL 2GK2A 3OKDB 4Y19A 2HFEB 4R2GC 4QRPE 1N64L 5HPMB 1Q8MA 1T66C 4LHUA 2A74B 4Z7VF 3IDYB 4U6XA 5CS7A 1EFXB 1K2DA 5JW4R 3EO9H 3VI3E 4BQ9A 5ISZB 5GHWL 4WTZG 3DUUB 3VFPB 1DANT 5IFHL 2DQJH 1AQKL 1H3WM 3MV9B 1KJ2L 5DQ9A 5E2JA 1AI1L 3T4AA 3D0VA 1S7QA 5DUBA 4CJ0A 3WLWD 4M6OH 4P3CH 4BYHA 1DL7H 4N8VB 3S35L 3U0WL 3WFCL 1I7RA 1LO3H 2AW2A 4R3SA 4U1KB 1OOAA 1NFIB 4OCRL 4NT6B 4GAGL 5JQ6L 5K9KB 2OL3A 2HVJA 3CDFA 3QXAA 3PGDA 5KS9B 4YDVB 1WT5A 4DQOH 2PYFA 3C60B 4P23B 5F7EL 3KYNA 1SJEA 5IIEB 4ACPA 5CCKL 1ES0A 1DEEB 1ZT1B 2P5WB 4HJ0D 1NAKH 3SJVD 5GS0L 3S97C 1FN4A 3CDGA 4LFHD 4HCRH 5EU7C 4Y5YB 5FYLH 1NGZB 2I25N 4L9DA 3OKLB 3LRHA 3QO0B 5I15H 3HS0B 5GS3A 1ED3B 1I7ZA 4H8WC 1ZHBB 4JHWH 4WFEE 3HRZA 1NMAH 4M62H 3PQYE 3TT1H 3ES6A 1A7QH 3FOMA 1N2RB 4W6WB 5HGHB 1QFWM 4HC1L 3S36H 5JORB 3QCTL 3DYMA 3UBXG 1MAMH 4JFDD 1BVKB 4YDKH 4Y4KD 5IJVB 3ZDZE 3FO9A 3GSNA 2XA8L 4J4PD 5CP7B 4OGZA 3FZUD 3JV6B 4ZAKB 5CWSB 3IDJA 3VXSA 2R4RL 5BW7C 1X5YA 1CXHA 2FH8A 4XCNA 5T3XD 4PJEB 4JM4H 2IANB 3DOSA 1BECA 5FUCC 1A6AB 2MNUA 2X7LA 2A0LD 2FSEB 2QADB 3C6SA 1SYVA 1F6FB 5I1AA 2BX5A 2Z92B 4U1GB 4ZSOA 1P7QB 2BERA 4HLJA 2VSDA 3FFDB 1KXQE 3B9DA 4KK5D 4ONFH 3NIFF 1DP0A 1YDPB 5C0AB 1NCBH 3SGEH 2B4CL 3B9KA 3GM0A 2Q3ZA 1G9ML 3VXPB 2D7PA 2RGSA 3MGTB 4GUPA 5IV2A 3AB0C 3RGVA 3P4OA 3GRWA 1WBYB 2ZNWA 1L7IL 3KPRE 2DJUA 2HJFB 3AS1A 4DZBA 1RFDL 2Y9RT 1OAXH 4HPOH 3G5VA 5J3HD 5C09A 1YC8A 4WNQB 4JFEE 5HHOD 4YHZL 3KPNB 1DQQA 1S7UA 3LKPB 2FEEL 4NRXA 4GMSH 2V7HA 5F70A 4ELMA 3FOLB 1P7KA 1WT5C 4L3EB 3UYRH 1AGEB 2HRPL 2AXJA 4LLQB 3MODL 3QZWA 1MRFL 1HEZB 5E9DA 4PJFE 5LCVH 1SJXA 1Q9KB 2MKWA 4NYLA 4V1DE 5C2BH 2B20A 1NUNB 1JYVA 3GM8A 2QJDA 3D3VE 2V7NB 1LEGA 2NNAB 3V5HB 5C07B 4R6UA 5L7XH 2EYSB 1HYRC 4S1RH 1YJDH 1EUTA 1LE5B 4MHHG 3EDKA 1NBVH 1RJLB 4LFHG 2X4OB 1MFEH 2NXYD 4PJXF 4PLKD 5K9OA 3BEVA 2JCCE 4TUKL 4WUKH 3RWDA 2PNDA 5TPWH 1CLYH 4X99B 2UYLA 3SBWA 1F4YL 3UTTB 4N9GA 3ULVD 4X98A 2X4TA 4ZYKB 5KSUB 5C86A 3INUL 1FZOA 4X7EC 1TTUA 3QUMH 1FL6B 5AYQA 2EYTA 1FO0L 1KTLB 4UV7L 5DRWB 3OG6B 3QJHA 2NY6B 5I1CH 1ZT7A 3SN6N 4Y2DB 5T3ZE 4LEXL 5J0BA 2VXTL 5JNYA 5BVPH 5GSVA 3OAZH 5BMFH 3QDJE 1S5IL 4Y89A 4MX7A 2YUZA 3WO4C 3RY4A 2CK2A 1N6QL 4XP5L 5C08A 1ZTXL 4HIEB 4FQJL 1KBGH 4XPHH 1TJIL 5I2IA 4YWGL 3B9KC 4YK4B 2XIDA 4RFOL 3RGVC 3DV6A 3BW9B 4HS3A 1B90A 4M1CC 1LK2A 2RAMA 4PRBB 4HFWA 2HJKB 4LDLB 4JRXE 4ZPVA 7CGTA 5J9PB 1CFQB 4QHMB 4P5TD 1BD2E 4ZUTB 2NTSP 3RRQA 3BPOC 2EC8A 1YZZA 1NFDE 3PWNB 3TZVD 3MUZ1 4MAUH 1T0MA 1YEEL 1GGTA 5FV2A 4H88L 2AEWA 4Z77A 5EIQA 3BP6A 3EYSL 1QNZH 1BEYH 4HXBH 4NKQB 4EI5D 5EOTB 1NMBH 5KOVC 3D25B 1RZKH 3RY6A 4I3GA 1VFUA 5T1DH 1PYWB 2R1WB 2H32A 1AKJD 4YH6A 5I1JH 4KUZH 5EZOH 3BAEH 1D6EB 1DDHA 1UM5H 1PLGL 3W9DA 3GSRA 3L3KA 4AMKL 3RBSA 5LVEA 3L3JA 1P4LB 1K8DB 2JB5L 3IS0X 4MNHA 1FZMB 1V3KA 4WI9A 2PF6A 3VFUA 3M1BB 1KV3A 5JUEH 2ZUWA 1H0DB 2R8SL 2M2DA 1RZ8A 3RQ3A 3CFKB 4YFLI 5L2JB 1Q9LB 2D0GA 2MQCA 3QUMB 3TBYB 5TFSL 3GJFB 2BNQA 3I6KA 1I1FB 5I1HL 1JF1A 3MV9D 3VGGA 1TZIA 2X4UA 4FP8H 3SBWC 4X6CE 4IOSD 3LOWA 4KTDL 3L5HA 3GB7A 4PG2A 1FORH 4A2MA 1U9KA 2Q76B 1ZLVK 4PRIB 1P6FA 5EWIH 4MWFB 1F4WH 5D72L 3AM8A 3OKYA 1I9JH 3DRQA 4O2CA 5F1OB 3LKSA 4TPRL 3LZFH 3QWQB 2P5WD 1X5IA 4YNYA 3VW3L 3VI4F 3HR5B 2G5BA 3WN5B 4UTAH 2A6JB 4OI8A 4NQDA 5I1IH 1OY3B 2FBJH 3IJHB 1W0WB 3MRGA 4HKJB 4OM1H 5E8OB 4LVNC 2BVPB 5MHSE 3RX8A 4KHXH 4P5KA 2VLJA 3ZKND 1YEFH 5HPOA 3WS6A 1HHHA 5D9SA 5B39B 3I50L 3ZKQD 4NKDB 1XGRA 4D9LL 1UYWH 5C7XL 3WXWH 4YDLB 4EDWL 5BV7H 4PGBB 3MRDA 1JPFB 3RHWK 5L9DH 1NCTA 5E5MA 4MS8D 2H6PA 5FO7B 1GC1C 4X6FA 4RAUA 4F15B 4LQ1A 1MCNA 5D7LB 1ITBB 4Z8FH 3H3BC 1U3JA 2Z91B 5C70A 3EJYD 5HI3D 3RY6C 4OZFB 4ZO7A 4ESKA 1FIEA 1G0XA 3DETD 2DYPD 1I8MA 3RJDA 8FABB 5B8CB 3KXFA 5EU6A 4POUB 2E9WA 3CVIL 3H9SE 5IBTH 4PP8C 5DMYA 2HTKC 3AU1B 2VXVL 3GMPB 3VGBA 3ZYZA 4XBEH 1MRCL 4ZQKB 4WEBH 3T0ED 3AREB 2Z4QB 4U6HA 1CN4A 2OQJB 4P9HL 1JHTB 4HH9B 4Z7VB 2AXFB 3B3IB 4WFGE 2BSED 1UWEH 1NGYB 2Y4SA 3L95B 4AEHL 3G5XA 4P2OD 4FQ1H 4KI1A 1T7VA 1XF4B 3KLSA 4HW6A 4N90E 1L0QA 3DXAB 2WNGA 1GGBL 3QHFL 3UO1H 1UH3A 4PG2C 1MFCL 5T33L 3HC3L 3RVUC 1D5XA 3A67H 5GSRA 1UJTA 1W8NA 3QDGA 3W0WD 1T7WA 3KVQA 4K8RH 4FQIH 5D71L 5IW6B 1CXIA 3BUYA 1J0HA 3LN4B 2DQGL 5CJXA 1K4DB 4MQXD 1U8MB 4G9FA 4MB4A 3CCHB 2AXGB 2I24N 5BRZB 1AR1D 1T03H 3NN8A 2BC4B 1LP9A 4D0CB 4MJ2A 1NH6A 3H7LA 4K23H 3MREB 2XZCL 1R3KA 5FFLA 4YHMH 4F33A 4U33A 3QDMD 1D9KB 2EH7H 4S1QH 3RKDC 1IMHC 3L3DA 1MHPL 3SE9H 3HE7D 5BV7B 3MBEA 2GKIA 4AIZA 5HVFB 3WS6C 1JRHL 1IE5A 2VAAB 3O3BA 4J7RA 2XTJB 3H9HB 4O58L 3SKNA 2Q86B 4JLRB 4MJ6B 4MJIB 4ALAL 5IG7B 3HI1A 4FQ2L 4LKXA 3ALPA 5E0QA 4A6YA 3DO7B 3W81A 2OSLB 1XCQB 5INDB 2ICWA 3V7AE 3RZCA 5DD1L 2X9XA 3UTOA 1U3HB 1T6WA 1ADQH 4LIQH 2MQ0A 3WS3A 1Z3GL 4HKZB 4UB0L 5FA4A 1M7DB 4QRRA 3TFKA 4ODVL 1FPTH 5DI8A 2NX5A 2VO5A 4MA8H 1ZGLP 2HH0L 1NANH 1T3FB 3U9PL 3BKJL 3GMMB 4ZPTB 1RUKH 1OP5K 3WIFA 5D2LE 2C7UB 3TWCH 4OB5H 3WJJA 2KUTA 2GJ6E 4H5SB 4NNXA 5IF0A 4C83B 2X4NB 5DD5L 4JKLA 4FNLH 4R2GB 4Z7NF 4OIIL 1K8IA 4LSRL 1I8KA 5K9JH 4LSQH 3RIAK 1C16B 4MA7H 3KYOB 5KW9H 3K4ZA 5D70L 1GCFA 1A2YB 4YHOH 1RJZB 2XXCB 3N50A 3C6LA 1J10A 1MCBA 3P77A 5JLZB 4U3CA 5F88A 3HMXH 1FE8L 5GGSB 5D2NA 3T0BA 1QO3A 3HZYA 4HK3J 2CDFA 3N85H 4R90H 5CJXC 1JUFB 1XZ0A 4NQCB 3FMGL 2NPLX 3BIKA 3CVHB 1OAUL 3LV3A 1R3IL 4FN0A 3TBWA 3MGOA 5KJRL 4Z7WB 4RISL 1NEZB 5F89B 3VFGH 3PWPB 4OLXL 3BPNC 3OAUH 1J12A 4OD2B 3RWHB 4DWHA 4LSPH 3MRQA 3EGSA 2OZ4L 3DRTA 4WIQA 4S1DD 2GJZA 4PJGE 3D85A 1CE1L 1KB5H 3MBEC 1AGDB 1A6TA 1G7LA 5JZ7D 4U31A 3VRLF 4GXUN 3OZ9H 3TJEH 3BKYL 2BHUA 4ONGH 3P73B 2NZ9C 3U36B 5KVMC 1JNHB 5T5FL 3MJ9L 1AO7A 3D48R 1N0LA 5IVOA 2FIRT 5FOBB 1FG2B 1R5WA 3KPTA 2Y25A 4M7ZC 4WFFE 1Z6JT 4PD4J 2YRLA 1CLOL 5D8JL 2H1PH 3TFKC 3NCMA 2E7CA 5GISH 1OM3H 5CD3A 1XR9A 3F7YA 3NFPA 5HYJB 3TA3D 5JO5B 1QG3A 5IESH 5TE7H 4NNYB 4K7FB 5CSGA 4QO1A 4TRPL 2QEJA 1CD1A 3F6IA 1YYML 3GMLB 4PGZA 3WJJC 3VXRB 4UBDD 2X4RA 4P46D 4CW1A 3K1KC 4HJGA 4OI9A 3LD8C 4Y19B 1KYOK 3GSOA 2QQNH 1PBYA 1RURH 2J6EL 4LHUB 2XPGA 4MXWH 4U6XB 4P2QD 1Z0NA 5D7JA 2ZCHH 2PETA 4LARL 4YJZL 3U7WL 3T3ME 2R4SL 1IEAA 5FCUH 3CX5J 3S4SA 2B0SH 3C6LC 1J8HD 1HZHH 1ONQA 5ECJE 5F9OL 2FX9H 1R0AH 2HKHH 1ZVYA 3ZTNH 4Z7QE 1UM4H 4LQFL 4Q9RL 3KPQA 4PJBF 5DQ9B 1UWGL 1NUDA 1VEPA 3D0VB 5DUBB 5D2NC 5EZIH 5AD0A 5EU3A 1I7RB 4JEGB 3K2UL 5D7LD 4Q9QL 4R3SB 4PRHA 2O5ZL 1CZ8H 4J6RH 4FTVA 2OL3B 4G6FB 1LP9F 2HVJB 3QXAB 2AV7A 2EDTA 3I6LE 3W5MA 1AY1L 3MNVA 3V6OE 2VERN 2PYFB 3LMJL 3EYUH 4OD1L 3KYNB 4J3SA 1KIUA 1ES0B 4HHAA 1NC4A 4YQXL 1FN4B 5E6ID 3V0VA 3BD4A 3CDGB 3L7EA 5DVMA 5CEZD 1BOGA 1R3LA 3G08A 5HHVH 5B3JE 3MRMA 4EIGB 1RIUL 1ZA3A 1BZQK 3ESUF 4PLJC 1I7ZB 3HRZB 5FYLE 1B9ZA 3ES6B 3FOMB 4RCAA 1YEKL 5TE6H 4OLVL 4OSUL 4GG6B 5GGQL 3IFLL 3SDCD 3PHSA 4XNMA 4HIJA 3TVMD 1IGFH 4GQ9H 1YNLL 3FO9B 3GSNB 2NY4D 2Q3AA 4NN6C 3VFVA 4QEGA 4YFEA 1KTRL 3IDJB 3VXSB 4Q2ZA 5DJDA 5I1KL 1WEJL 2D03L 5IB1A 4O2EA 4XP4H 4XCNB 4MA3B 2K7PA 2YPKA 2X7LB 1FBIH 1A7OH 1ZKAA 3ALXA 1SYVB 5I1AB 3I9GL 4ZSOB 1EVUA 3U30C 3WO4B 3R8BB 4HT1H 1LEKA 4PJ7A 5C0DA 2YOCA 5D7JC 2DDQL 3MFFA 2Q7YA 1QYGL 1U58A 3EKCA 2YUWA 3B9KB 5HDQH 3VXNA 4GUPB 5IV2B 3RGVB 3P4OB 3C9NB 5GGVL 4MJID 3U1SH 1V7NL 3IU4H 4XPAL 1UXWA 1BAFL 1WSST 3MLPA 4DZBB 3B8YA 2APFA 1KPRB 2EICA 3BPOB 4G6KL 3G5VB 3DX6A 4ODTL 3GUTA 1OTUC 4HS6A 1EBAA 4NZRL 2DQHL 2Z8WC 3O3EA 1S78C 4NRXB 5GRYA 2V7HB 4XVTH 1A3QA 1OHQA 4ELMB 3RU8H 1P7KB 3GSVA 3PP3H 5KVDH 3QZWB 5CIPA 2UZXB 5E9DB 4M7LT 2EO1A 3PF2A 1GC1H 2FHFA 1CR9H 3UAJD 1TPXC 2OXHA 5C0BA 1GHFH 1CK0L 1GPOH 1RUPH 2HLAB 1T66D 3TPKA 2H9GB 2VWEC 4X9FA 1LEGB 3DTXA 4KKBC 2FX8L 1CT8B 4OF3A 1OAZL 3AUVA 5T3ZL 1ZVHA 4NQTA 3SKJL 4LVOC 3NIGF 3O45A 1PG7H 4XVUD 2W9DH 5K9OB 3BEVB 4GAYA 3RWDB 4L4TE 1JGEA 4TUJB 5ID0A 3NCYP 2UYLB 5TDOA 4UTBH 4N9GB 3ME0A 1GH7A 1V7MH 2NY1C 4X98B 5DK0A 2X4TB 2VDOL 4NCC2 2ED7A 4OLUL 6FABH 3MOAL 1A6WH 5JHLH 2EYTB 2ATPA 2R0WH 2AGJH 3QJHB 1Q94A 1ZT7B 3PDGA 4AQOA 5IHLB 3I02B 1EERB 1JHKL 3WUWG 3T1WA 1E6JL 2XICA 4PJIE 1U8PA 5JNYB 5GSVB 1HIMH 5TQ0H 4K3JL 4WI5A 1RMFL 2Z8RA 1FRGH 1PY4A 4MX7B 1QZ1A 1JWUA 4D3CL 4ZTOL 1CL7I 2OR8A 4Y5VA 3BO8A 4Q7DA 3HUJF 4N1CA 5C08B 2YD1A 4LVNB 5I2IB 2VLLA 3QDAA 2Q20A 4YUEH 1N59A 3MJ6A 2IQAA 3RUGE 4M5YH 2B1AL 3O8XD 3HHRB 2I5YL 4HS3B 1LK2B 5BXFA 3MYJA 4HFWB 3K7UA 1A6ZB 4HGMA 4ZPVB 5AZEL 2APBA 4NZTL 4BQ8A 5IMKA 3GSUA 3ZDXE 4QRQA 3FN0L 1DR9A 1T0MB 1UWXK 4RGNC 1V3JA 4Z77B 3BP6B 5I76A 4M1DH 4U1HA 1EGJH 2CGRH 1CDUA 5F1NA 4DGVL 1J8KA 1WAAF 4NOBA 3VXRD 4Y1AD 1AGFA 2DKSA 1S7RA 4RMWA 1DDHB 3W9DB 4MDIB 3GSRB 3MLSL 4CRPA 3C5SA 3L3KB 4HIHA 4AM0A 3O2WL 3L3JB 2X10A 4MNHB 3MMEA 2J4WL 4PYGA 3QIUD 1A47A 3SDDD 3LN9A 5TGBA 4BZ1L 4OZIF 1UM6L 1HCFX 1LO4H 1G0YR 2HT4D 1R3JA 3VFUB 1I8IA 2DQFA 3IFOA 3F62A 3TNMA 4QHNA 2VZTA 4ISVA 1RZ8B 5DFTA 4LP5A 1AGBA 3KPSA 4NWTL 1OP3H 3PGFL 3IVKA 3TCLA 2XQBH 2BNQB 1NGQL 4GLRI 5JA9A 4K55A 1TZIB 2X4UB 4NC0B 3V6FA 1NLBL 3NABL 3GB7B 3UJIH 5K33A 2CUMA 5DJXA 1WBXA 1PVHA 2X1QA 4G6FD 1TFHA 4LSUL 5ICYA 2QQQA 3H9YA 3D9AL 1F3DH 3DRQB 4O2CB 4CJ1A 2BSRA 3MSPA 4LLDA 3LKSB 4YNYB 1J87A 1F8TL 1I3GH 2G5BB 3G04A 4N0UA 5F9DC 3UZQA 4URTB 4NQDB 3V4VH 4Y5VC 4MD5A 2QSVA 3T0VA 3JWNC 3CXDL 3MRGB 4YHYC 4F58L 3F8UB 3NTCL 5B22A 5ALBL 1G9NL 2VLJB 4FG6C 5CKGA 4MZ3A 5HD8C 1I7UA 2NW3A 5HXMA 5D9SB 1ETZA 4X80L 4ODBD 1Q0XH 1XGRB 3D18A 2W91A 1MSPA 2AABH 5I0ZA 3ARSA 3P0VL 3CIQA 3MRDB 4YEEA 1FVDA 4U2ZA 5E5MB 2H6PB 5C6TH 5EOCL 1A0QH 4X6FB 4XB8A 4RAUB 5D93B 4HUXA 4U7SA 4AK1A 3VXSD 4KI5D 1KGCD 3NIDF 1WISA 1TDQA 4JFFA 4JM2F 3QJFA 2AI0H 3A6BL 4JDTL 4WW2A 1I8MB 2NY3C 4XHJD 5IT2H 4G6AD 3HC4L 4WO4D 3KXFB 1HOCA 3Q6FA 3MLXL 2WUCH 1DN2A 1XGYH 4HIXH 5ENWA 5HYEA 1LHZA 2WBJA 5TE4H 1VEOA 5DJ0A 1EBPA 3L5XL 1F13A 3FFCE 3OGCA 3CLFH 3CFBA 5HBBA 2A6IA 4ZOAA 1UEYA 3PHOA 4U6HB 3O81A 4U0RC 4P57A 2R1XB 4GSDH 3MRJA 1JVKA 1WC7A 2HWZH 3MGAA 4RFNC 3OMZA 2DN7A 1KJ2A 3G5XB 2DQIL 9CGTA 3EFFA 4QTIL 3J8F7 5C09D 1PKQA 3QHZL 5EFIA 2FJGA 1D5XB 1E4KA 4XI5C 3SE3A 5GSRB 5FYKE 1MCDA 4QOKD 3QDGB 4HDIA 4IDLA 2LAGB 4XPGH 2EXYC 2ED9A 1EHXA 1ZSDA 1LDPH 3QI9A 3QIWA 3KYAA 3AFLA 1JNLH 4BA8A 1ZV5A 4MLSA 3W2DL 3TO4A 4X5LA 3VMNA 1ZE3C 3GI9L 3X13A 1ZANL 5CEXA 1AIFA 4DW2H 3NN8B 4K71C 1LP9B 2Q87A 3KJ6L 1CL7L 1R3KB 4F33B 2P7TA 3BPNB 2V9TA 4DOHB 1Z9MA 5DRZB 2W92A 3MA7A 3TIDA 1JGUH 4V2BA 5DT1H 1UKSA 4KVNH 3MBEB 4PBVC 4AQ1B 3I2CH 4KGJA 5FHBH 1B4JL 4ZG1A 4NKIH 2ERJC 4HC1A 3O3BB 2E27H 5IB4A 1DLFL 4IMLA 3SKNB 3E6FA 4E9LA 2XN9D 5LG1A 3O2DL 2OR7A 3HI1B 1JGLL 5DF0A 4A6YB 4NQXA 2W9EH 3AMLA 3TV3L 3MV01 2CPCA 4P2RD 1JPSH 3UPRA 2ICWB 2CH8A 4M7ZB 2A38A 3B5HA 4FZEL 2D7MA 3WS3B 4OGAD 4AEFA 5FA4B 4QRRB 4NIKB 1FLRH 4KJQC 5DI8B 2NX5B 2RBLA 2XZZA 5IB2A 4YPGA 4DKFL 3WKML 4WW2C 3TPUE 3MXWL 4LIQE 3WIFB 4S0SD 3O4LA 1MCHA 4MMXC 3KS0H 3MLVH 3MRKA 4NNXB 5IF0B 3RKPA 4AIXA 3QNYA 2WBJC 3LD8B 3MUHL 1SYSA 1INDH 2NQCA 3LQZA 1K8IB 3MLTA 4G43A 4DGIH 4MD4A 1I8KB 3SOBL 2ORBH 3VRIA 3EFDH 2DQDL 1WIPA 4FMFA 3B9EA 5F9AC 3C6LB 3ARGA 1OTSD 1NCCH 4ZFZA 4F2MA 3P77B 1IAIH 1FFNA 3CSBA 5F88B 3FCTB 5CILL 4M7LL 4RGMC 1E4KC 1XIWA 5D2NB 1B3JA 5D7IE 1G1CA 4G8IA 1MCEA 5D1QC 2DAVA 5MEPA 4ENEC 3PUCA 1QO3B 3HZYB 3QIWC 3QI9C 5DXWA 4E41A 1A64A 1QKZL 1K3IA 3TO4C 3BIKB 3ULUE 5GS0C 5KANI 3LV3B 2F54A 4JZNA 1G6RH 3TBWB 3MGOB 5I8EA 4UT9L 2QSTA 3HNTL 4G5ZH 2CXGA 1MI5D 2HTKD 4X83A 1ZLVH 3K81A 5DTFA 3DJ9A 4R8WL 5DEGA 3MRQB 3EGSB 3DRTB 3UEZA 2GJZB 1KCVL 3D85B 4PS4L 1KCGC 4Z95H 1G7LB 2F53A 2P8MA 4XHQA 3LIZL 1NBZA 4FFZH 4JRYA 1PX4A 2DF3A 1VACA 4Z7UF 4YXLL 1BBDL 3IFNL 1AO7B 3V6BR 4K3GA 1XGTB 1K85A 1R5WB 1IBGH 5JXAH 4YHPA 5CAYB 2H2SD 1ZLSH 4S10A 2FYYA 1DSFH 4WW2F 1FO0A 4EZMA 4G3YL 1AXTL 5FGSA 4NN6B 4EQ3A 5CD3B 5HYIA 1XR9B 3F7YB 5ICXA 1A21A 1M05A 4OZHA 1EEQA 3OSKA 1H3TA 3EO9L 1LO5A 2NYYD 2X4RB 4CW1B 5A40E 2PYEA 1LNUA 4HJGB 3S88H 3KG5A 5CJBA 3GSOB 4UI2A 4QXGH 5EUOF 5JW4M 2DQJL 2KH2B 1MAKA 3U30B 3CLEH 3RNQA 1G9MC 3W39A 5DFWH 5TF0A 2XPGB 3FONB 2YEZA 5D7JB 4M6OL 4P3CL 2B5IC 5F6HI 1DL7L 1LO3L 3OKOA 1IEAB 1IC5H 3OV6A 4DTGL 1IGJA 2O5XH 3S4SB 1WFUA 3ARGC 5DJAA 5FKAA 1ONQB 3CX2A 2I9TA 3ETBF 2VLKA 1RI8A 1X4XA 3KPQB 4Y8AA 4DQOL 4QHLA 1XIWC 4K3EL 1TENA 5F8QC 2Y72A 5AD0B 5EU3B 4MDJA 1P5UA 3BH8A 4PRHB 1N8ZB 1O5DT 4QWWD 4FTVB 1CI5A 2R2EA 2AV7B 4HCRL 3QEGL 4JRWA 1ZMYA 3UTSE 3MNVB 5FYLL 3SE4A 1QSEE 5IUSA 5FAAA 5I15L 5EU6D 3BEWA 4JPVH 4XAKE 3MRLA 4HHAB 1NC4B 4JHWL 1NMAL 4X9BA 3TT1L 1J1XH 3T1FB 2ZKHH 3V0VB 1A7QL 1TPXB 3L7EB 4HQQL 5GGRY 1BOGB 1R3LB 5SWSE 3G08B 3S36L 4MGXA 3ILQC 3MRMB 4MMZC 2R39A 1MAML 1ZA3B 5J6HA 4YDKL 3LCYA 5IBLD 3O6ML 5CGYD 3VDAA 5D7KD 5DDHA 4LVOB 4FFVD 1I1RA 1X5FA 5DHVA 5BS0A 1REIA 4JM4L 2VRAA 4HIJB 3ZDYF 2NY1B 1PKOA 3VFVB 4O9HH 4P48A 2ZOKA 4Q2ZB 5DJDB 4YHNA 4ONFL 5IB1B 4PGJA 4O2EB 3WCYA 4ETQA 4G9FD 3HLAB 1NCBL 2XY1A 3CC5A 3K8MA 2YPKB 1INEH 4YFDB 3WFEH 1FC1A 3LEXA 2DKUA 4LOUC 4PUBH 4PTUA 2NY7H 3PWUA 1LEKB 4PJ7B 5C0DB 4HMDA 1OAXL 3MFFB 5ALCH 4LPYA 4HPOL 1OP5H 1A02N 1U58B 4LPUA 5JMOC 2BSSA 3ARFC 2ENSA 5BZWA 1MF2H 3VXNB 3QEQD 3BOVA 3LVEA 1QRND 1H3UA 1IT9H 1MJJA 3WL9A 1OLLA 2BJMH 4TVPD 2ZPKH 1UXWB 3SDXF 4DEPC 3UYRL 2HAZA 3IFPA 5KOMC 4KJYA 4U1MA 5E1AA 4ZOEA 3DX6B 3GUTB 3RZCD 4W68A 5LCVL 4RWYH 2ED8A 3ARZA 4HS6B 5CEZH 1NCDH 1OW0A 4RGNB 1HI6A 1UEMA 3O3EB 2FJFA 3SJVE 5C2BL 3E1F1 2NX5D 2K9UA 5B38A 3SE4C 1BWMA 3LH2H 3GSVB 3UPAA 1M1SA 4X4XA 5CIPB 4S1RL 1YJDL 1NBVL 4QF1A 5C0BB 32C2B 5KVFH 4WUKL 5EC2A 1ZVSA 5TPWL 1CLYL 3OGOE 2CLRA 3RNKA 3DTXB 5GJSH 3HNSH 4LGSB 3QUZA 4Q58C 4QT5B 4OCMC 4JFDE 2GTZA 1KTDA 4QRTA 1BGXH 3NA9L 1L0XA 3O45B 4HBCH 5LJYH 4EJ1C 3EHBC 5FYJD 1FAKT 3IXAA 5I1CL 4OF6A 3V0WH 4GAYB 4LLMB 1X9QA 1JGEB 5MERA 5GRVL 1WV7T 5ID0B 4ZMAT 5TDOB 1INQA 1U92B 5T3XE 4OZHF 5DK0B 5BVPL 1RUQH 1TTGA 2YD5A 5BMFL 4LPXA 1T1YA 1A5FL 4PJAA 3VA6A 4XNYH 4BQ6A 2ATPB 4XC3H 4PJ8A 1Q94B 2D7TH 2IGFH 1CD8A 3UTZA 1KBGL 4XPHL 1HINH 5BCAA 2GW5A 4GJTB 5SWZA 4BH7A 3NCBB 3VU2A 4QLRA 3U82B 3LDBC 3JWOL 1JWUB 4CGTA 3KPLA 4Y5VB 1SEQH 3BO8B 1JPGA 3JV5A 3D85D 3LKNA 3QG7H 4YHYB 1RUMH 3WO3B 4BUGA 2VLLB 3OKEA 1DBMH 1N59B 1ZXQA 4DK6A 4AEIH 5IGXL 2IQAB 1KOAA 1XF2A 4PJCA 1QNZL 1BEYL 4HXBL 2ADFH 3L5JA 1V3LA 1NMBL 3MYJB 5HHOE 5BXFB 4WGWB 5IMKB 1RZKL 1BQHG 3GSUB 4M7KH 4CUCA 1H3GA 5ACZA 4QRQB 5T1DL 5I1JL 4KUZL 1OW0C 3BAEL 1H8SA 5I0DA 5I76B 4HZAA 4U1HB 5I19H 3G9AB 1H3VA 3QXTA 5F1NB 5H2BA 2NLJA 3UX9B 1V05A 5DA4A 1AGFB 2NY3B 1S7RB 1W0VA 4HS8H 2MWCA 3EYQD 5CD5D 2AQ3A 3C5SB 4AM0B 3EJJX 3MMEB 5M95B 5HGDA 2DWDA 3E8UH 3HZKA 1AD0A 1B0WA 4XWOC 5EG6C 3SKOA 2R29H 4P9HC 5TGBB 1EEUA 1R3JB 3G6JF 1T1XA 5I1DA 1I8IB 2DQFB 3QUZC 2J8UF 4GW5A 4QHNB 2XKUA 1FORL 1AGBB 3TNNA 4V3EB 3KPSB 3ULVE 4U0RB 2QSCH 4NO3A 4OIAA 1U8KA 4PJHE 3IVKB 3TCLB 4RFNB 4NCDA 5EWIL 2H2PD 1F4WL 3RI5K 5E7FA 3B2UD 5D5ME 4HUUA 5GHWH 4QGYA 1U8NB 3V6FB 3UCRA 1KCRH 2VAJA 3KGRA 3LZFL 2D4DA 1HXMA 1OTUD 1XFPA 4RA3A 1MIEL 5DJXB 3QQ9C 5D4QA 4UTAL 1WBXB 5I1IL 2FBJL 1KJ2H 2CUHA 4OM1L 5ICYB 5E1HB 3WFCH 1DBAH 4RX4A 3RL2A 2BSRB 1KJMA 4LLDB 5JQ6H 1NC4D 1YEFL 3LEVL 3ZL4H 2C1PA 3G04B 4N0UB 4KJWC 2OZ4A 1UA6L 3GJEA 2V2XA 1UYWL 5F7EH 2YD8A 3WXWL 5CCKH 3BXNA 5L9DL 5GS0H 2LAAA 4KKBD 2BCKA 3IF1A 3U83A 3VFMB 4Z8FL 1I7UB 2NW3B 1HKFA 3MJ9A 3QUXD 5HVHC 1ETZB 5TDNA 2ERJB 2VIRA 4XCFH 4OBRA 3CJJA 1DUYA 4QRPA 4KRMB 1NL0H 4M02A 4GRWB 1NC2A 1T83A 4JHAH 4NQED 3SDYL 1EAPA 4I5BA 4I2XE 1DVFD 1LWRA 4RQQA 1BP3B 4N0YL 4CNIA 2FJHA 3MLWH 1VEMA 2IAMA 4XBEL 2XA8H 5HI4C 3QJFB 5MEND 2EIEA 3L5WA 4NPYB 1JBJA 1HOCB 3Q6FB 4OGXH 2R4RH 2F5BH 3CSYA 3DMMA 1BF8A 5FO9A 3O0RH 2J6EA 3PWVA 5ENWB 1UWEL 3RDTA 5HHMA 2WBJB 3VWKC 4FQ1L 5TDPA 1RUAH 5DA0B 5DJ0B 3TJHD 5ANME 4N8CL 3CFBB 2A6IB 1IQDA 4POZC 3MV9E 3PHOB 3UO1L 4P4KA 1MJ7H 3A67L 2X1PA 3FQRA 4P57B 4U1IA 5EU4A 3BWAB 1YPZF 3MRJB 4H0IA 4K8RL 1WC7B 4FQIL 3FQWB 1KJ2B 2LVCA 3UPCA 1C5DB 1CLCA 3EFFB 2OR9H 3ARUA 4HJJH 3UBXI 3TBTA 1PKQB 3VH8A 3WIHH 5EFIB 1HK6A 2FJGB 3HI6H 4RGMB 1T03L 3CU7A 2VTFA 5E00A 4K23L 3OHXA 1MCSA 1RFDH 2P5WE 2XY2A 5D1QB 3PQYA 4HDIB 3KPOA 4YHML 1ZSDB 2EH7L 3QI9B 3QIWB 1FZJA 2IALA 3SE9L 1OGTA 3TO4B 1QVOB 1FLTX 4OGYH 4YEFA 1OPGL 3X13B 1J0KA 1AIFB 4UT6L 2BXZA 4OD3H 4GOSA 4JM2D 4FQHA 1NCUA 1MRFH 5T1KA 3G6AA 4PJCF 2RIKA 5JHDD 3S34H 3TIDB 3MA7B 3PL6A 2EZ0C 4TNVF 4YGAB 1I8LA 2V5TA 1OF2A 1T2XA 4K9EL 3TBSA 3BE1H 4PD4K 3GK8L 5EBGA 4JJ5A 4LIQL 5IB4B 2V2TA 3PGCA 1KFAH 4NP4H 4IMLB 5E4EC 3BIAX 3V9FA 3E6FB 1FPTL 3SDAD 3MUGA 4WU7A 4G9DA 3VXQA 1T83C 5ITBH 4NQXB 1RUKL 4PJEE 3UPRB 3TWCL 4OB5L 5B4MC 1NQBA 1T0PB 4TUKH 1F97A 4MNQD 3V52L 3HAEH 3QPQC 1U3YA 2R0KL 2IAMC 4PJ5D 5IB2B 4WDIB 4YPGB 3KPRA 3INUH 4G8FA 1YECH 3B6SB 1KEGH 3O4LB 4LSQL 3T0EE 1UWXH 2Q1EA 3ARVA 5KW9L 2EYRA 5GZOD 4U7KA 3BD3A 4YBLC 3CX5K 2Y1VA 3MRKB 4YHOL 4JFEA 3V0AC 2VXSL 1U8LA 3QNYB 3RDTC 1CDCA 2VXTH 1SYSB 2D4FA 2XT1B 4EI6B 1D6VH 3MLTB 4G43B 4J3UA 2FO4A 2IPKA 3HMXL 4OFDA 4MD4B 4P4KC 1FH5H 3EOAB 3D0LA 5J06A 4WHYG 3VRIB 4WEMB 2QL1A 2B5IB 4FG6D 4MHHI 4PJFA 1N6QH 2DLHA 2A6DA 5FDYA 4R4NC 3ULUL 35C8H 1UXSB 3S3PA 4NQSA 5JXEA 4YWGH 3ARGB 3N85L 4PTTA 3W0WE 4V1DA 2ZOLA 4ZFZB 3T8XA 4F2MB 3VWJD 3MNZA 1FFNB 4WUUA 4KMLB 5CJQH 2DOCA 4WFHD 4CN1A 2YC1A 3TBVA 1XIWB 3WFHB 2P44B 3RA7L 4G8IB 3I84A 1I1CA 1WTLA 5MEPB 3VFGL 5DURB 3OAUL 2MCG1 4JPIA 1JZ8A 3VD4A 4LSPL 1A8JH 3HG1D 3QIBA 1L9NA 1YEEH 4PY7A 4E41B 4WENB 2JCCA 4FQLL 1KPUB 5I6XC 2Y7QA 1KB5L 5IK3B 4TQEH 3QDME 4JVPA 2F54B 4JZNB 1QSZA 3TJEL 5I8EB 2WBKA 4KRPD 4XNQA 2H45A 5DTFB 1D3CA 3PL6C 5DEGB 2GAZA 3OWEA 1I8LC 3QHTC 2F53B 2EIBA 2OK0L 1F3RB 3REVA 4NC2B 2P8MB 1CF8H 3C5JA 1NBZB 4MQTB 4JRYB 5IMMA 2H1PL 1CFBA 3FAXA 1VACB 1LDSA 2ZJSH 3HAEB 5GISL 3FQUA 3QDJA 5ESVA 2DQTL 5IESL 5TE7L 3S9DB 5CINH 3CSGA 3RTQD 4MCZA 1HDMA 4YHPB 3ESVF 4JN1H 1FO0B 2Z8VC 1RURL 3A0OA 3QISA 5ICXB 1M05B 5LWYL 5C9KA 4OZHB 3KYMA 4MXWL 2ZCHL 2OYPA 1FFQA 1YQ2A 1R24A 4JO1L 3MCLL 4L8SA 1NFDA 2X9YA 1TXKA 1LO5B 4ORGA 2CLZA 2IF7A 5FCUL 2RCSH 2OX5A 5IKCA 2PYEB 2B0SL 2I9LA 4GMTH 4HPYL 1HZHL 3HPLA 1UT9A 3U4BH 4F37F 2FX9L 5GGUA 2X05A 1C12A 1R0AL 5FB8A 4JKWA 1S9YA 3RNQB 2HKHL 3TLRA 3W39B 3ZTNL 1UM4L 1QUNA 1WF5A 2YEZB 1A3LH 2A77H 5DSCA 5DD0H 4GAFB 3DGCR 3OKOB 5IVXE 3ARFB 3QWOA 5JXEC 1IGJB 2ZG1A 3MRRA 5CUSH 3MROA 1CZ8L 5FKAB 5JPNA 4JANA 2LTQC 5MEQA 4J3TA 1E6OH 2YZ1A 2DLFH 3S8WA 1RQ5A 1TIUA 2I9TB 4DEPB 3EYUL 4QHLB 3NZ8A 5C2UB 4D9LH 4MDJB 1SEBB 5C7XH 2AJSH 4EDWH 3QIBC 4G8GA 5HHVL 4JFFD 1MH5A 2BVOA 4MVBA 1HH6A 4GKSB 2YHGA 4R0LA 4UMGA 5EBMA 5CZXD 4CKVX 4C54A 3BEWB 4X6CA 2NMSA 3N06B 2L4OA 3BRDA 3AS2A 2MTPA 4UV4L 5TE6L 1A7NL 1NGXA 3TP4A 3REWA 3MRCA 2O5YH 2DIBA 4ZXBD 5J6HB 1ZS8A 5HYSG 1IGFL 1EJOH 4GQ9L 2VXVH 1AXSA 3DX7B 1PDKA 1ORSA 1T1WA 5C6PB 3V5DA 5DDHB 5GGSY 2PTTB 5DHVB 5BS0B 1G7IB 3HMWH 5HTSA 3BN9C 4I48A 1IQWH 4KJPD 3LS5H 2BSTA 1OTTC 4W4OA 5E03A 5FK9A 1FBIL 1A7OL 3RVTC 5JMRA 2ZOKB 4YHNB 4HT1L 5EB9A 4YHLH 4P9MH 1Z5LA 1CGTA 1QFUH 4L8SC 2PW2B 1HQ4A 3CC5B 4P2QE 3SHSA 4HGWA 1LO0H 4D94A 3UTPD 3LEXB 3BIBX 3ARDA 2DQGH 3LDBB 5FF6A 3U1SL 3BISA 4LSSH 4PTUB 1J8HE 3PWUB 1I4FA 1MRDH 3N0PB 1GIGH 2X1XR 3S5LG 3CDYA 3DYPA 2VZ3A 2BSSB 4HD9A 5BZWB 1DQLH 4M8QA 1HHGA 3RWEA 1MJJB 3WL9B 2YA2A 2GEEA 1MHPH 3MV8D 2OLDA 4LKCA 5D7LE 3D39B 3HE6A 2IFFH 3RU8L 4APQA 3IFPB 4JDZA 2R69H 4KJYB 5KVDL 3PWLA 5E1AB 2WWMC 3RPKA 3MZGB 4O58H 4HG4J 5DRNA 1HI6B 3K0WA 5J13C 1YY8A 2FJFB 1GHFL 2HN7A 4MVBC 3JV0A 1GPOL 1RUPL 4KPHL 5B38B 1BPVA 5CEZE 4R0LC 2DJ4A 2V5SA 1NBQA 4K3DL 4UNUA 3V95A 4JE4B 4X4XB 1Z3GH 4UB0H 4X6DF 3MLZH 1O7VA 4QF1B 1PG7L 5A43C 2GY7B 4XAWL 4Z7VE 3GZKA 4HV8A 3VXMD 5EC2B 4M3JA 5GPRA 4WWKA 1ZVSB 3RGHA 3RNKB 3HI5H 4UTBL 2OMNA 3MRNA 1V7ML 3QUZB 4G7YL 4RRPG 1S9VA 2GTZB 1KTDB 4QRTB 2VSCA 6FABL 1A6WL 1S3KH 4LSRH 5JHLL 5DS8A 1EX0A 3IXAB 2AGJL 1F5WA 4PJ9D 1IC4H 1INQB 1MCOH 1XIWD 1HYSC 1S8DA 4HFUH 4W4OC 1HIML 3WFBL 5TQ0L 3CFIC 4JQXA 3U9UA 1FRGL 4PJAB 2VITA 4N5ED 1HSAA 2NW2A 1FE8H 1GYAA 4B7IA 2WWKO 3UTZB 4TOYH 4YUEL 5SWZB 3S37X 4BH7B 4FFEX 4M5YL 3ARDC 1J1PL 3FT3B 4BZ2H 2GSGA 1MQKH 2QLVB 4AENA 1OAUH 1G9NC 3KPLB 4OZGE 4LVHC 2HTLC 1JPGB 1FYTB 4MJIE 3STBA 3VGDA 3LKNB 3VXUB 4RMSA 5LGHH 2XI9A 3OKEB 1R5VA 1GGIL 4OLXH 5D2LA 1XF2B 1QLFA 4M1DL 1EGJL 1FJ1B 2MMXA 3BKMH 3O2DA 4YXKH 4C59B 3HE6C 2FECL 5HVHB 4APQC 1H5BA 2ZWLT 3QT2A 3BKYH 4TTDC 3VG0H 5ACZB 5H37G 3QWRA 4H26B 1XMWA 1KCUH 3FB8A 4KV5F 3U7AA 3MJ9H 1C7TA 1XF3A 4X6CF 4IRSA 3PV6A 3LKOA 4ZD3L 1I1AD 3NCJH 5H2BB 1LO4L 4BUHA 2NLJB 5F3HA 5D8JH 1OSPH 1WITA 5I1LA 4LSTH 1XGPA 4OLWL 1AC6A 1W0VB 3OXSA 5FYJH 2X40A 4F7TA 3DV4B 3L1OH 2B8OT 2DLGA 4JKKA 5HGDB 1EFXA 2DWDB 3HZKB 2A1WH 2XQBL 1AD0B 1MQ8A 3NIFE 4WWKC 1FGVH 5F93C 2WIIA 4BSWA 3VWKB 1IL1A 1CGVA 1T1XB 3DUUA 4GW5B 5FO8A 3TNNB 1X4ZA 1U8KB 4LNRA 2VLKD 1FNSL 1IM3B 2BNRE 2VR9A 4G8EA 4HUUB 3BMVA 2PKDA 3B5TA 4PJGA 1NFIA 4AJ0A 5L8LB 5I73C 1FL5A 2E9JA 1HXMB 3W9EA 4JQXC 1I3GL 2VN7A 2JTDA 4MLIA 3BQUA 4PRNA 5KS9A 3V4VL 1CG9B 4LQFH 3SGDI 5IQ9B 3RL2B 1KJMB 5EU7E 3ZLQC 1TVHA 3P3YA 2C1PB 2R2HA 1GZQA 2EDOA 4FQQA 4NM8H 4ODXA 3GJEB 1Q0XL 3HTLX 2V2XB 2WW8A 3HS0A 2AABL 3HB3D 4KKLD 3QULA 3T65A 3BXNB 4PRPD 2BCKB 5C6TL 1A0QL 4KZEH 3IB4A 4PJXE 4RAVA 4RMTA 5TDNB 1H5BC 4PLOB 2VIRB 5E4EB 4BZYA 1DUYB 4QRPB 5IEHA 2YPLD 1AGCA 1MPAH 3MUY1 1NC2B 5IT2L 4ZAKA 3EYVA 5IW1A 1KACB 1EAPB 4I5BB 1YEKH 2WUCL 1XGYL 4IRSC 4RQQB 4Y1AE 4Y7MA 4HIXL 1DQJA 3IFLH 4CNIB 2IBBA 5ILTH 2FJHB 3IYLW 5DZOA 5TE4L 1A6AA 2IAMB 2ESVA 1JMZA 3MX0A 1DANU 2J88H 3CLFL 4LLYA 1MFAH 5BVJA 2HT3D 3L5WB 4MB5A 1F45A 4Y4HD 4YC2C 5I1KH 3CSYB 2D03H 5FO9B 4YBLB 2HWZL 3PWVB 3B4NA 1LQSR 1MHEA 3RDTB 5HHMB 5TDPB 1IGCL 3V6OA 1IQDB 2JLLA 4GBXD 5CGTA 2F5AL 1UH2A 4P4KB 5CHNA 2QBWA 3FQRB 2HT2C 4JY5H 4U1IB 5EU4B 1DQTA 1KUMA 3LB6C 1J11A 1MCFA 4H1LG 2IMNA 3L3IA 4XPGL 3Q5YA 1CCZA 1LDPL 5EO9A 4LMQE 1JNLL 4WCYH 1F4AA 3KPNA 1ZGLA 4B0MM 4PV8A 1CWVA 1U93A 3TBTB 3VH8B 2E3VA 1EHNA 4LSDA 4DW2L 3BQUC 3OR7A 5E00B 2DLEA 1CS6A 4L3EA 1AGEA 3OHXB 4HCRA 4LLQA 2A6KA 1GJIA 3PQYB 4G6KH 4XH2B 3TN0A 1FZJB 4WGVB 5DT1L 2IALB 1JTPA 5I6XB 1OGTB 1MCPH 3I2CL 4NBZB 5FHBL 3GSWA 2E27L 4HSQA 1L9MA 1SJHA 4FQHB 3FT2A 5T1KB 2BK8A 4IRJA 3PL6B 5JOPD 1KSRA 2W9EL 1MJUL 3O4OC 2VH5H 3QUZD 1FNAA 1II4E 1OF2B 3TBSB 1ERNA 5HI5D 4KMTH 4JJ5B 3BHBA 4QXUH 2V2TB 3QNXA 3PGCB 3UTQA 1EHLL 1FLRL 3Q1SL 1RK1A 4HLZG 2HG5B 2DBLL 5EIIA 4WU7B 3L3GA 4XVJH 3VXQB 4KI5E 1KGCE 4FFWD 5T3ZH 1P1ZA 1YNTA 3K1DA 5JIPA 4DN3H 4TNWK 4KKCD 2I60H 3QQ9D 2DQUH 1A6VH 5FGBA 1C5BH 2ICEB 4PJ8D 4ZFFA 3KLHC 1INDL 3KPRB 5F9JA 4G8FB 5SWZD 5C3LD 3MOAH 3EFDL 2EYRB 5SV3A 4JFEB 4HIEA 5D1ZA 5GRWA 1U8LB 4KJWD 3D2UA 2ARJQ 4KK6C 3CMOH 1TITA 3V6OC 1IAIL 2VKWA 2EKSA 5DO2D 2K7QA 3D0LB 1IC7H 5C09E 2VLMD 3O9WA 4PJFB 2XACC 3ARBA 4WHCA 2A6DB 1VFOA 1LVEA 4QOKE 4WHDA 4PTTB 2LTQB 4V1DB 2ZOLB 3T8XB 4PP2A 1VDGA 4K7PX 5KS9F 1GGUA 1KB9J 1MFDH 3D3VB 1F3JA 4F37K 3MNZB 4F57H 4WUUB 2FH6A 2I5YH 4GW1A 1HHJA 3EJZC 5EOTA 1G6RL 2YC1B 4M8VA 3T2NL 3TBVB 4MJ4A 1KPVA 2CKBL 1IILE 1OGAD 4PB9H 4G5ZL 1RK0A 4M43H 2R1WA 2OJEA 4JPIB 3TN0C 3QIBB 4PY7B 1RJYA 2JCCB 2Y7QB 3WD5L 4CVZA 4L4TA 4Z95L 5DFVD 5C0NC 2PR4H 2VJXA 3QFJD 3O6FA 4FFZL 3GDBA 2C3HA 5B38G 4XNQB 1I3RA 2HP4A 1T6VN 43C9A 4IRJC 1H0DA 5SX4I 1WCBB 2R23B 2GAZB 2HFTA 3PDOA 1J0IA 25C8L 2XN9E 4YHIA 1IBGL 1JWMA 3O2WH 1ZLSL 3REVB 5IR1A 2IH3A 2HRLA 1T2QH 1X5KA 3C5JB 3UXFA 1DSFL 1T5XA 4PJIA 4P2RE 5IMMB 4JZOA 1QR1A 1E28A 2VDKH 3QDJB 5E6YA 5ESVB 2HMID 2AJ3A 3QP3A 3SQOL 5FYJU 4PLNC 5IHBA 1F00I 4FQPA 1HDMB 4MCZB 4WHTA 1IGML 4QXTA 1UJ3A 3BYYA 1VPOL 3QH3A 3RUGA 3IDMA 4JJHA 5FGBC 4K7PY 3QXVA 2YRPA 2YXFA 4QXGL 1NLBH 1BFSA 1T5WA 3CLEL 4RX4D 2E8YA 1PEWA 2EEAA 3MBXH 3OJMB 3IETA 1R24B 4L8SB 1NFDB 1W72H 1IC5L 1BX2A 3ECBA 2CLZB 4ORGB 1AH1A 2P46B 5D1ZC 5IKCB 3GMOA 2I9LB 2JJSA 3D9AH 2BVPA 3BUTA 1YY9C 3GKZA 5DWUL 5GGUB 1C12B 1X3DA 5FB8B 1S9YB 1UB5A 2IWGA 1YEHH 5B39A 4DCQA 5DSCB 1EA9C 3WKNA 3OB0K 3O9WC 3ARBC 4X5XA 5HHQA 3QWOB 4BK4A 3ZSTA 3MRRB 3MROB 1K5NA 5JPNB 3OJDA 4FQCH 4JANB 1EJ6A 4O02H 4R4BA 5MEQB 1G9NH 1MREH 3V5KA 3U4AA 4NO2A 3Q3GB 3QRGH 4EUPG 2VYRE 4JPVL 4DKDC 3NZ8B 3SKMA 3C2AL 1MCJA 4NOFA 1J1XL 4ZNEE 2ZKHL 2I27N 4G8GB 1F4XH 5J13B 1MH5B 1YJDC 2BVOB 1MI5E 5DJ2A 1HH6B 4KY1H 4R0LB 3O6FC 5EBMB 4DKEH 5DJ6A 3AU1A 4X6CB 2EC9U 4P2CG 1TJGH 3DMMD 4JREC 4PP1C 4ZQKA 4HK0B 3AREA 3WNKA 5HHMD 3L3HA 1JHTA 1NGXB 1QFWI 1U8HB 3REWB 5JOFA 1U8JA 1ZS8B 3QUYD 1VADA 2NR6C 4NZUH 1AXSB 4AYFA 2I26N 2IG2H 1ORSB 1T1WB 3KJ4C 3V5DB 4OTXH 3KLDA 1FNFA 3WDJA 4LLUA 5FUZL 1UJ3C 4YDJA 5IFAH 5KSAD 4I48B 2VOTA 1WIOA 3IDGA 3WFEL 3DURA 2BSTB 5FK9B 2DQIH 3TH3T 1U8MA 4PUBL 3CCHA 5LKNA 1X5GA 5BRZA 1Z5LB 5T1LA 5ALCL 1U8OA 3B5GA 1HQ4B 3JWOC 5CSZA 4L1HA 4HGWB 1N5AA 2PO6A 4NQUA 1MF2L 5DD3H 2JJSC 3DHMA 5DJCB 3ARDB 3DNKA 1IT9L 5FF6B 2BJML 5J6GA 3A6CL 3GI9H 1I4FB 4LVHB 5TF1L 8CGTA 5ESQA 3VRLE 1QFPA 3ZTJG 3TESA 4RWYL 3WIIH 5CEZL 1NCDL 4M8QB 1HHGB 1RZKC 2AAVA 2P49B 2JIXD 1ZEAL 4LKCB 2AJXH 3HE6B 4S0TD 2CQVA 3EYFB 4JDZB 3PWLB 2HLFD 3FFCA 2X89D 3QBTB 4XMPH 5DRNB 2YD7A 3HA0A 5EU6E 1JGLH 5HHXL 1T3FA 1YY8B 3GI8H 2HN7B 5I16A 5KVFL 5E99L 1G84A 2YSSA 1GOGA 4OCYH 2E6QA 3HNSL 4D9RD 4R7DA 3ZE2F 1TVBA 4LMQI 4MA1C 1BGXL 1GRWA 1N6UA 2AJUH 3MXWH 4KK9C 1G7PB 1U91A 4HV8B 3V0WL 2VR4A 2D9QB 3WHE1 5D7KE 5C9JA 4HX1A 4WWKB 3MA9H 4WW1A 1RJZA 1UENA 2N56A 3MRNB 1JGDA 4JG1H 1RUQL 2J5LC 1S9VB 5C0CD 3ZYOA 2G75A 5L88L 4XNYL 4YZFF 5DS8B 1UB6A 3KLAA 4V1DD 4XC3L 1A4KA 2YD3A 4LCWD 3SOBH 2ATKA 4NWUH 4PJBE 1KT2A 3EDDA 2NTFA 4WUUD 3K4AA 1T0NA 5E95B 4ERSL 1WQVT 3H8NA 4G9FE 1S7VA 1RU9H 3TH2T 5I73B 3U9UB 1TCRA 2VITB 1WVZA 1HSAB 4XTRC 3M45A 2NW2B 1SEQL 4M7LH 1Q0YH 5H37H 2KQNA 3QG7L 1RUML 3DX8A 4Z7WA 4HAFA 3RVWD 3CH8A 1DBML 2PO6C 4EVNA 4AEIL 3IDNA 4ZO9A 5B21A 2W9LA 3LPFA 2QR0A 1JN6A 3QEQE 4WY7L 4AENB 1QRNE 1I3UA 4TVPE 3RWFA 4UAOB 5KZCB 4TSBH 3VCLA 4UU9A 3TPUA 3F7VA 1R5VB 3U36A 1JNHA 3ZE0E 5D2LB 5GZNC 1UH4A 1MCRA 1KJVA 2F19H 1QLFB 4LGPB 4PS4H 1IGYA 2GJ6B 4JN2A 1QBLH 5I19L 2W0PA 1H5BB 2ICCA 2IBZX 5IVNA 2NX5E 2QKIA 4WU5A 2XWBA 1S7WB 4XPTH 3FB8B 4JO2H 1BBDH 5H8DA 4HS8L 2VC2H 1OTTD 4K7FA 2XQYG 1XF3B 5ITFB 3LKOB 1EO8H 3E8UL 3GMLA 2R29L 3V4PH 4YO0A 5F3HB 4G3YH 1AXTH 5CBEA 5I1LB 4MXVF 3F65A 4PR5A 1HE7A 4YBQC 1KCSL 1XGPB 3OXSB 1QR4A 2AK4D 4YC2B 2QSCL 4F7TB 5D7IA 2G60L 1DCLA 5I30H 1QFWL 4HF5H 3RY5A 3HMXA 2Z35A 2WIIB 5FYJE 4BSWB 3BDYH 4Z9KB 1IL1B 3TT3H 2DTML 4K8RC 1KCRL 4KFZC 4NC1E 3CFCH 3QA3A 1U3ZA 2P1YA 4LCUB 1CICD 3WHE0 5FO8B 3FB5A 5GRXG 1ODAA 4BQBA 3HPJA 1BIIA 4LNRB 1KCLA 4G8EB 4MXQA 1DBAL 2YWZA 2V17H 3VA2C 1YMMD 4DTGH 3FQXB 4PJGB 4LAQH 4EBQH 1FL5B 3W9EB 3ZL4L 1FZKA 1V5JA 2IBZY 3BQUB 4PRNB 3Q6GH 4G8GD 5FHAH 1KB5A 2X41A 4K3EH 4M03A 4MVBD 5DUPH 2GHWB 3DYOA 4YLQT 3BP5A 1BWWA 1UKQA 1OP3K 1F3DJ 1TVHB 4HUVB 2EDWA 3QEGH 2R2HB 4KKNA 1GZQB 4FQQB 4ODXB 4XCFL 3K4DA 3MZTA 1EXUA 2FZ3B 3N1QC 4K9EC 1NL0L 1KNOA 1N7MH 4KK8C 1F90H 5EIVA 1HSBA 3QULB 3T65B 4JHAL 4WTZA 3R0MA 3ALWA 3PIQA 3O4OB 4HQQH 5I66A 3NIGE 4GG6A 1E0OB 1W0YT 4RAVB 3E2HA 2PXYD 3MLWL 4RMQA 1H3XA 3O6MH 5IEHB 1AGCB 4JVWA 2IH1A 4HXAH 2FNBA 3T0WA 1YEIL 3BVNA 3EYVB 3OL2A 5IW1B 4OGXL 2F5BL 2BNUB 3O0RL 1RIHH 1DQJB 5F3BA 3LN5B 4MA3A 4H1LH 3OXRA 3SCMD 2ESVB 1RUAL 2DM7A 1BOYA 4LLYB 5DMIH 5BVJB 1MJ7L 2EEDA 1GOHA 3CFEA 4JQIH 2ICWJ 5JQHC 1VESA 5CLTA 1K6QH 5TQ2H 3HUJE 1MHEB 4EDXA 1QBBA 3NZHL 2N7AA 2OR9L 5HY9A 1F11A 4AG4H 2Z31A 4HJJL 3ULUC 3C9NA 1QSEA 3ELAT 1LO2H 3WIHL 5ACMA 4G7VH 4JPWH 3HI6L 5CHNB 3O41A 2B2XH 5J1AA 3UBXA 1KPRA 2CK0H 4APQD 3L3IB 4MXQC 5JPMA 3BKCH 2R15A 3AS3A 3FL7A 4OM0L 5EO9B 3R4DA 5SWSA 1AC0A 2P43B 2P5ED 5J7CC 4IHOA 1ZGLB 1U2CA 4PV8B 1U93B 1HWHB 4OGYL 1AHWC 1P4BH 2VQUA 3WYRA 4Z7WF 4YX2L 3AXLA 3OR7B 4OD3L 3UYOD 4L5FH 1CE6A 2A6KB 2BMKA 4YIQA 4OLZH 4LGRB 1RHFA 2OS7A 1WAAE 2WK2A 3S34L 3TN0B 2FHCA 5IB5B 1KENL 2E9BA 3MOQA 2OP4H 2VB5A 3BE1L 2HLAA 3GSWB 4EN3B 2H8PA 2MPAH 2H41A 2H9GA 3C87A 4LBEA 1KFAL 1SJHB 4NP4L 4TYUA 5H94B 1CFTA 3FT2B 4OZIE 4JFOA 1CT8A 3TC9A 1QQDA 2EDJA 4IRJB 5C92A 3Q0HA 4JZJA 5FCSH 5ITBL 4J3WA 2DRUA 3H0TA 1FIGL 2OTUA 5AUMA 1H15A 1V3MA 4ZOCA 3E2HC 1BF2A 4NQEE 3BHBB 3QNXB 5HGBA 3UTQB 4TUJA 1RK1B 2NXZD 3QPXL 5EIIB 1KELL 4MB3A 3DROA 3L3GB 2CD0A 5E6ZA 1MLCA 1YECL 1KEGL 1P1ZB 1YNTB 3F58L 1A4JA 3NA9H 4CDGC 5MENE 5DJ8A 1JPTL 5IEKA 1NBYA 3I02A 3M8OL 4KRLB 2F15A 2FLBT 4F7EA 5F1KC 3VD5A 4ZFFB 4UNVA 2P8PA 4JAMA 5F9JB 1D6VL 5JW5A 1KLGA 4ZFGH 2VISA 1A5FH 1U95A 1FH5L 5EA0H 4NKOA 2NY0C 35C8L 4OV6F 5D1ZB 1JTOA 3D2UB 4XP1L 4MAYD 2Z31C 5EU5A 3WSQH 5KZCD 3S35X 4Y16B 2E5EA 1MVFA 3JWOH 2EKSB 5CJQL 4AL8H 1A6ZA 3I75A 4S1SH 5A2FA 4XC1H 3O9WB 3ARBB 1BFVH 2L7UA 1IAOA 2IEPA 1Y18A 3LPGA 1UZ6F 5EDXA 4PP2B 3QWRD 5IGXH 1F3JB 4TQEL 4IS6A 1OCWL 4NGHH 1BVZA 1F42A 4GW1B 1HHJB 2NY2C 1KPVB 1MCIA 1WLHA 4GXVH 4JFDA 1RK0B 4IRSD 1I3VA 3NIDE 4Y4KA 4GRLA 2OJEB 1X6LA 4J4PA 1S7SA 1RJYB 4MDIA 3W11C 4CVZB 4L4TB 5JHDE 3LPWA 4QKXB 1EVTC 3O6FB 4XWGH 1CVSC 1MFNA 1CF8L 1EH9A 2WMPA 4JREB 3ZT6A 4Z7OF 1NGPL 4J3OC 2ZJSL 3IXTA 1I3RB 1ZAGA 4E42A 1EFXD 43C9B 5EPMB 4JZJC 4GG6F 5ISZD 2FEDD 3PDOB 5CINL 4YHIB 2YUXA 3BGMA 1JWMB 5IR1B 2IH3B 4YAQB 4JN1L 2E7LE 1T5XB 4PJIB 2C3VA 3SE8H 3BRGC 4JZOB 1QR1B 1E28B 2EC9T 4MNQE 5F9WC 3KJ4B 3J7HA 2AJ3B 5GRUL 4PJ5E 3FAWA 4WHTB 1BIHA 4M1GL 4QXTB 1UJ3B 2BVQA 1HXYA 2RCSL 1MY7A 3QH3B 3RUGB 3IDMB 3QQ4A 4GMTL 1P84K 1DBJH 2XG5A 3C60D 3C8KA 4P23D 5I74C 5I8OH 2CIKA 3U4BL 4KHTH 5HHOA 4KWUA 1IGIL 1T5WB 4PJDA 2VN4A 5I1EH 2HJLA 2CRZA 3ORJA 1MIEH 4UOW1 1A3LL 2A77L 3IETB 5DD0L 3ECBB 1BX2B 5F7UA 4RSVA 2YN5A 3GMOB 3JTTA 5CUSL 1G7QA 2ZCKH 4HJ0C 1E6OL 5DD6A 4KKAD 2DLFL 3B83A 1I85A 3FRUA 1TNMA 3BI9X 4WEUD 2YZ8A 2ZG2A 1UB5B 3LEVH 4DCQB 4YE4H 1EGJA 1UA6H 1LILA 3MCG1 5C0GA 4X5XB 5GGRA 4WFHE 4N0CD 5HHQB 2AJSL 1KIQA 1HKLH 1XR8A 1K5NB 2EDNA 3OJDB 4R4BB 4WI4A 4ELMF 1P4IH 3V5KB 3UJJH 4NO2B 1G0DA 1URLA 3HG1E 2P47B 4ZAKD 2YD4A 3C8DA 3WUZA 2WUBH 3VFNA 4MCYA 3SKMB 3U2SA 5C1MB 1UADC 5GRJH 4Y4KC 4GRLC 4FFYL 2IAND 4F8QA 4NHUE 1HILA 4J4PC 4PJHA 2ESVD 3FZUC 3WE6B 5DJ2B 1T22A 2QADD 3SDYH 1XF5A 5ERWA 2O5YL 1EJOL 4N0YH 1P7QD 5DJ6B 4MA1B 3H3KA 5C0AD 2A0LC 4PY8J 1J88A 2EDKA 3L3HB 2R2BA 1B4RA 3RIFK 3HMWL 1QLRA 1YQVH 2V2WA 2R1XA 4KK5C 1U8JB 5JOFB 5I75C 1VADB 5A16A 1IQWL 3LS5L 1JP5A 3NACH 2R56H 1TTFA 5FYKH 2J5LB 4LF3A 3R8QA 3LKRB 4N8CH 2Y5EA 3ZHLA 5IVZA 4YHLL 3IS1X 4P9ML 5GJTH 3GJFK 4LLUB 1QFUL 2FO1A 4YDJB 1A22B 1M7IA 1O7SA 3IDGB 4HEPG 1KIPA 1LO0L 3DURB 3TF7A 4L3ED 2F74A 4I8DA 1BQLL 3TZVA 4N8VG 4YR6A 2M8XA 2YD9A 4LSSL 2ZZUT 2F8XC 2ZSVA 1KF9B 4OFYA 2Y6SC 3MRIA 2BP3A 1MRDL 1GIGL 5T1LB 4EI5A 1U8OB 5CSZB 3W82A 2FWOA 1DQLL 1N5AB 2PO6B 4OCSH 1UQSA 3NFSH 4Y4FB 1Q72H 5DRZA 2CKNA 4UOW0 5C07D 3FKUS 3X3GH 5I1GL 1UGNA 5I18H 2CLVA 1I85C 2DD8L 2CRYA 5J6GB 2IFFL 5DMKA 1OPGH 2R69L 4M4PA 4UT6H 5ESQB 4OZ4A 3BZ4A 2C3WA 2EH8H 4Z7UE 2GI7A 4FQXA 3UTTD 3L9RA 4L8BA 2NXYC 4K9EH 1C7SA 5D93C 2NY5H 3BGAA 3GK8H 4XNZC 4JFFE 3ROLA 1YEGL 5ANMA 3FFCB 2NY6D 2UUDK 1ZK9A 3MLZL 4Y2DD 1OSZA 3UROR 1KEMH 5I16B 5L2KA 5A3ID 1EV2E 4RIRA 2YSSB 1JGVH 1AP2A 2P24A 3HI5L 3V52H 4XPFH 3X11A 3IDIA 2R0KH 4OLEA 4R7DB 5SV4A 4Z0XA 3P9MA 1TVBB 5KSBE 1TZGH 15C8H 4NN5C 1S3KL 5EUOE 4K7PL 2ZNXA 1J05A 3FO0H 4NUJA 1U91B 4I3SH 1YY9D 1LMKA 5C9JB 1IC4L 1EMTH 3GIVB 1YN6A 4HX1B 4WI6A 4WW1B 1MCOL 4OQ1A 2VXSH 4HFUL 1JGDB 1XGQA 2IPUG 4NBXB 4NJ9H 1PKQE 3BSZH 3JUZA 2G75B 5FM5M 1FSKC 3KLAB 1LK3H 1UB6B 3FCTA 4YHKH 1CDHA 5C0JA 1A4KB 2ATKB 1KT2B 5FUOL 4TOYL 2NTFB 1T0NB 3ULUH 4XP9H 4YBHA 1D5MA 4PJDF 3TF7C 1S7VB 3SQBA 4JHBA 4TVPL 3TZVC 3AVEA 4BZ2L 5C8JA 1TCRB 3UTPE 1MQKL 3VG9B 5JDSA 4MS8A 3HFMH 1KULA 4B7LA 3MCKA 4GG8A 2GSIB 2C5DC 4EI5C 4G42A 3DX8B 5LGHL 3RA7H 2GIYA 3V4UH 1B0RA 2J3SA 4EVNB 3IDNB 1NJ9A 2DYPA 4UQ2A 3BKML 4YXKL 4FQLH 1XAUA 2QR0B 1JN6B 1R5IA 4WV1A 3LS4H 1CTOA 3VG0L 3MV8E 3RWFB 3VCLB 2CXKA 3F7PC 2CDEA 4UU9B 3TPUB 4XXDB 1KCUL 3F7VB 2GTWA 4R26H 3T0EA 4FQXC 1J0JA 1KJVB 5JA8B 1XGTA 5IJKA 4DN4H 1IGYB 4JN2B 1MJ8H 2OK0H 5A2KH 3NCJL 4ZODA 3RL1A 1KYOJ 4X4ME 2QKIB 3P0GB 4WU5B 5HGGS 3ZDYE 3BZEA 1OSPL 1P2CB 2XWBB 4PRID 4LSTL 1IAKA 3OB0H 4QHKJ 4P0DA 5FYJL 2DQTH 2ZUXA 4JCMA 2AQ1A 4OCWH 4XPBH 3L1OL 3W5NA 12E8L 2A1WL 1WBZA 1FGVL 1WZKA 3TM6A 3W0WA 4YO0B 3VXME 1A7RH 2PCPA 4RDQF 1OD7A 5CBEB 3FO2B 4PR5B 3C09C 1WZ1H 5LWYH 3LRSA 3P30L 5D7IB 3FONA 3K46A 5BQ7A 4KAQH 4JO1H 3MCLH 5CP3H 5E4IA 2Z35B 4WRLA 1A6PA 2LU4A 4HPYH 2EE6A 3QDMA 3QA3B 3GIZH 1J86A 3HE7A 2BXYA 1SM3H 3FB5B 3ZKNC 1CFSA 2DL9A 3SDXE 2OI9B 3HPJB 1BIIB 4XMLH 1G6RA 1S7XA 2CKBA 1N8ZA 2J7LA 5E2VL 4N5UA 1AHWB 1T21A 1FZKB 4MS8C 5HJ3B 1A9BB 4NM8L 1KB5B 1YYLH 4S0UC 4JY6A 1OQXA 3EJYC 3EOTH 3BP5B 1QACA 3IAQA 5HI3C 2EIZA 3T1FA 4HUWA 1EDQA 3DETC 4Y8DC 4DFHA 3OKKA 4KZEL 4O5LH 3SY0A 3EAKA 5C0RH 1VFAA 2AJZA 3ARED 3T3PF 5J1TC 3Q2CA 4WV1C 1EXUB 1F2XK 3LEYH 3Q5TA 1KNOB 5EORL 2MCPL 1HSBB 2ARJA 1MPAL 3T0EC 3PIQB 1A1NA 5I66B 2X1WL 1N0XH 3MRFA 4UV4H 5IJKC 1A7NH 2P48B 3E2HB 3DXAD 2E9IA 5ILTL 2FBOJ 3ZKMD 2IH1B 2J88L 1RZ7L 1MFAL 4P2OC 3E3QE 3BVNB 2R2CA 3RVXD 4JFHD 5HVWA 5IVXA 5INCA 1L8JA 5F3BB 1OARL 2IADA 4IDJH 3HLAA 3ZZ1A 2V5RA 3IRPX 5BRZD 3OXRB 3P11H 4C4KO 5T1LD 1EUUA 2APVA 5FYKU 4IOFD 2PO6D 4MQXC 3O3UN 3K8KA 1D9KD 3CFEB 4JY5L 1NAMH 3NA4A 1AR1C 1G7JA 1SVZA 2NY0B 3H7BA 2JELH 2RFXA 4EDXB 1DBKH 4WCYL 5HY9B 1F11B 4PIRF 2X9WA 2Z31B 2V6HA 5E24E 3UTSB 2XTJD 2VLKE 2DWEA 1QSEB 1UFUA 4L29A 1MVUA 1PW3A 3UZEA 4K2UL 3HE7C 3EO0A 2Q7NA 2D0FA 4HWBH 3P4NA 3O41B 1TVDA 5J1AB 2CMRL 5EOQH 3UBXB 5B39G 2FD6L 5JPMB 5SWSB 1U3HD 3RJQB 5FA3A 1U36A 5EBWA 4IHOB 1B2WH 3TYGH 4FS0A 1MCPL 1A7PH 4P99A 1IAIM 4KROB 1J7VR 2NY2B 3AXLB 2YD6A 5DHYA 1ZLWK 3WV0A 1CE6B 1CGSH 2X70B 1GSMA 2BMKB 4YIQB 5E2TH 1EO5A 3I6GA 1H9VA 4OZFG 3TA3A 2VH5L 4M5ZH 1NPUA 2Q8BH 5DRXA 3UJTL 4R2GD 2HKFH 32C2A 4KMTL 2Q8AH 4KPHH 2A9MH 4PRPE 2H8PB 3NGBB 3NAAH 4LBEB 4QXUL 1WJ3A 4K3DH 5H35A 1CFTB 3K8LA 1ZHKA 4JFOB 4JFQA 4GFTB 4P46A 3G6JE 4XVJL 1QQDB 4QT5A 3ZHKA 2J8UE 4JZJB 5E08H 4TSCL 2YPLE 4K8RD 3VD7A 3H0TB 2OTUB 5T3XH 4XAWH 5AUMB 1H15B 5JOEA 1U2HA 4DN3L 4P2QA 4LLMA 1C5CH 2I60L 1VFMA 1S9KC 5HGBB 2DQUL 1A6VL 4N68A 1C5BL 3AY4A 1U92A 2UVEA 1X5ZA 5F9WB 3DROB 4G7YH 3MYZA 4MNGE 1MLCB 5EH1A 3HR6A 1A4JB 5DLML 3AGVA 2F8OA 5DJ8B 3JWDH 4W6XB 3V2AR 1EEYA 5IEKB 1NBYB 3L7FA 4JFYA 4NQCD 4TN9A 3SPVA 3UDWA 1NAMB 1X5LA 4UNTA 3IU3B 4F7EB 3CMOL 4L4VA 5I74B 1TJHL 2P8PB 4JAMB 5JW5B 3WFBH 1IKFL 1KLGB 4Z6AT 3DO3A 4X7SL 2VISB 2DMKA 1U95B 3PWPD 3GHEL 4B41A 1IC7L 5BO1H 2BHYA 4NKOB 5JIHA 5A2LH 3O3DA 2C26A 5DZNA 2VLRA 4CVXA 5EU5B 1MFDL 2ZCLL 5E6IA 2C1OA 4F57L 1J1PH 1JMXA 1X5XA 1ORQA 4S1DC 4FOMA 4RFEA 3I75B 4Q74A 2O61A 5JZ7C 5HDLA 4PB9L 4M43L 5K59F 1IAOB 1Y18B 1GGIH 5ESAA 3NCYS 4BK5A 4X6BB 4KH2A 4IS6B 5I71C 2PR4L 5HYJD 1OP9A 5ACLA 2AEPL 4JFDB 3SDCA 1IGTA 4Y4KB 3ARPA 3TVMA 4GRLB 4KDTA 3WUWA 1S7SB 3NFNA 3TA3C 1NSNH 5F7FA 4Y19D 1TMCA 1KLFA 4JFZH 4ZD3H 1T2QL 5JOPE 4LHUD 2WSKA 3ULVH 3ROOA 3IXTB 4UBDC 4E42B 2VDKL 2HVKA 4P46C 5E2UH 4JKMA 1Y0LA 4OLWH 3V8OA 4OV5A 2GY5A 4L1DA 3PP4L 1ZOXA 3BGMB 3RHWF 1G7HA 4C56A 5GXBB 1LE9A 5I75B 1KG0A 3L6FA 1YPZE 2FX7H 2C3VB 5EUKA 3JTCA 3AY4C 1U8NA 3O6LH 4JR9H 1WZMA 4MXQD 4OZGA 4I0KA 3GBMH 3MBXL 2YPVH 1CFNA 1CXEA 4W81A 1W72L 2BVQB 3BESR 1HXYB 3QSKB 3UDWC 5FM5O 1FNSH 3QQ4B 1R6VA 3C8KB 3LHPH 4U6VH 2CIKB 1B6UA 4HWUA 5HHOB 4PJ7F 1E27A 1JYXA 4PJDB 2HJLB 2VDRL 1YEHL 3CD4A 4X4YA 3GBNH 3ZYIA 3QFDA 2Z8SA 2DLTA 1JL8A 4LASH 5DR5H 1RZFH 2EDHA 3OTTA 3JTTB 2VLME 1G7QB 4PJCE 4FQCL 4O02L 5DD6B 2ITCA 1MREL 3WDHA 1NEZG 3FRUB 1TQCC 1MHHA 5E6IC 1BVLA 3VFMA 4Z5RA 2VQ1A 3QRGL 4BSJA 2D3VA 1OAQH 2ZUTA 2AV1A 4ZNCD 5C0GB 5GGRB 2CUIA 3BP4A 3X17A 1J5OH 1KIQB 1XR8B 1MIML 1OGAE 1F4XL 3WDIA 4PDCE 3G6DH 1PFCA 4KY1L 2NXYB 3H2WA 3CAFA 2KKQA 4XNZB 3U0TA 4DKEL 3VFNB 4HKBA 3RWIA 4MCYB 3U2SB 1TJGL 3SDCC 3VXTA 3QFJE 2VABA 3TVMC 4ZS6C 4KDTC 1HILB 1HHIA 2NY4C 5DMGC 5I8KL 4NM4L 3H3PH 3MV7A 4PJHB 4NPYA 5DVNA 1T22B 5F72S 1XF5B 5ERWB 1BFTA 5D5MB 3VXOA 2BNRA 2FEEI 4M7JL 5GRZA 1CD9B 4NZUL 3V7MA 2D7QA 1A14H 2IG2L 1C1EH 2VZSA 1EHAA 1KN4H 4GS7C 4OUUA 4OTXL 1QPXA 4NN5B 4RMUA 3B9KD 4TSAL 1CD0A 2R2BB 5GGVY 1EK3A 3LAFA 1UCTA 4R97C 1QLRB 2V2WB 3RGVD 5IFAL 2FRGP 3BWAA 4LHUG 3CXHK 1P53A 4M1CD 5A16B 5F96H 1QLEH 1SMOA 3FQWA 5JR1H 1JHLL 2COQA 3HNVH 1C5DA 1WIUA 4LF3B 1IGCH 5DEFA 1PZUB 1Q9WA