1G7QA

Crystal structure of mhc class i h-2kb heavy chain complexed with beta-2 microglobulin and muc1 vntr peptide sapdtrpa
Total Genus 77
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
77
sequence length
274
structure length
274
Chain Sequence
GPHSLRYFVTAVSRPGLGEPRYMEVGYVDDTEFVRFDSDAENPRYEPRARWMEQEGPEYWERETQKAKGNEQSFRVDLRTLLGYYNQSKGGSHTIQVISGCEVGSDGRLLRGYQQYAYDGCDYIALNEDLKTWTAADMAALITKHKWEQAGEAERLRAYLEGTCVEWLRRYLKNGNATLLRTDSPKAHVTHHSRPEDKVTLRCWALGFYPADITLTWQLNGEELIQDMELVETRPAGDGTFQKWASVVVPLGKEQYYTCHVYHQGLPEPLTLRW
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system
molecule keywords H-2 CLASS I HISTOCOMPATIBILITY ANTIGEN, K-B ALPHA CHAIN
publication title Crystal structure of a non-canonical low-affinity peptide complexed with MHC class I: a new approach for vaccine design.
pubmed doi rcsb
source organism Mus musculus
total genus 77
structure length 274
sequence length 274
ec nomenclature
pdb deposition date 2000-11-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00129 MHC_I Class I Histocompatibility antigen, domains alpha 1 and 2
A PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1g7qA02
3.30.500.10 Alpha Beta 2-Layer Sandwich Murine Class I Major Histocompatibility Complex, H2-DB; Chain A, domain 1 MHC class I-like antigen recognition-like 1g7qA01
3U9PL 4E42B 1CL7L 1QQDB 3SPVB 5AAMA 3ILPB 4ONGH 4EDXA 3VXUB 5DD3H 1QSFA 3OJDA 5B21A 3S98A 2GQHA 5I18L 1UM4L 4FABH 4LCWA 5KG9A 3RZCA 5KSUB 3O3AB 2AV1A 4LARH 4PJ7F 1QFPA 3CXHK 3E6HB 2WWKO 4YBQC 1BFSA 4LSVH 4JFYA 2BJMH 5DT1L 4ETYA 2Q6WB 1A02N 4ZTOH 4BSWA 4OZGF 4JO2H 3Q6FA 5LWYL 3SDAA 3QIUC 5B4MD 1T04A 5F9JA 2ESVE 2VZVA 4PR5B 4FQCH 2BY3A 3IF1B 4KVNH 1QRNA 1MFBH 2WLYA 4P46C 3KYOB 5HYQA 4GAFB 4JCMA 1RZGB 4P2OD 4M1DL 1FCCA 3RTQB 3QRGL 3O11A 5FHBL 2P5WD 5I66A 1C08B 5CZKA 3N50A 3CVHB 3T8XA 1P6FA 4RZCA 1FORH 1MRDH 1QSEE 1AHWC 4MAYC 2HAZA 1MI5E 1BF2A 5E95B 3MRMB 4HULB 2B5IB 5FUZL 1JF1B 3RGVC 4YK4B 4YEFA 5BJTB 3V95A 3GBNH 5ITFB 3V5KA 2G9HA 3U9UA 4KHTH 3WXVH 5MEPA 3VFUA 2C3VB 3PQYB 3QJHB 1INQA 2E9WA 1RZFL 3ARFA 3RIAF 4X8JB 1MCDA 4YX2H 1OAZH 4U1SA 5B22A 4DW2H 3PHQB 2O5ZL 3IJHB 4QT5B 5ESVB 2Q7YA 1V7ML 3TNNB 3FFCE 3VRJB 5F7FA 3UMTA 3VXTB 3NFNB 3MRIB 3L3KB 2AS5M 3AGVA 4KDWA 4O02H 3DURB 3RWEA 4YHLH 3NCYP 2I5YH 5DK3A 4PREB 4RNRB 4QHUA 1DUYB 1CXIA 4NSKA 5SWSD 3PV6A 2Z31C 3G5YB 4JFEB 1IGML 4WI4A 4P4KD 2Y5TB 4CVWA 4YHPA 1XGTA 2R1WA 4GXVH 5F9OH 2CXGA 3S37H 3O45A 2Y6SD 4Z18A 5T1KA 4OLVH 1ZS8A 3IU3A 2WINB 2QR0B 3H8NA 5DJZB 5DJ0A 3TT1L 2VWEE 4GJTB 2APBA 3D25A 4L9LB 2V5MA 4YDVA 4F15C 3D39E 2NX5D 5CZXC 3B9KD 3VXQB 2QHRL 5DI8B 3MLWL 3EHBD 5DQDH 1JGVL 2ZSWB 3HAEG 4FOMA 5EU7C 3VFVB 1DQMH 3I84A 3T2QA 3OX8B 3P77B 5E9DB 4ODUB 1AGFA 1ZHNB 1FYHB 2AKRA 5EBLB 4NC2B 4CVXA 3PHOB 3ZDXE 2BNQB 4J3OC 1XF3A 2FECI 5D5MF 1OCWH 3PGFH 3FB5A 5E8DH 5SWQA 1GPOL 3MQIA 1RUQL 3GSQB 4R7DB 2OZ4A 1L6ZA 1W0WA 1QVOA 2FJFA 3PP4L 1TVHB 2XTJB 3DX9A 2UUDH 1DLFH 1G9NL 4JPVH 4X4XA 1U92A 5DC0A 2IQ9L 4M7JH 2EDRA 4R0LA 3MV7D 3BP4A 5TE6L 5EU6E 3UX9B 1I8MA 1CFBA 2B1AL 3DYPA 3I3BA 4GKZB 4M48L 4DKAA 4K94C 3ZKMD 2F5BL 2X41A 3VGEA 4C83A 1BJ8A 4Q9RH 5CHNB 3SOBL 5CJQL 1JGEB 1ADQH 4LPUA 1CGTA 3QO0A 1JWMB 2PW2B 1NH6A 5L2KE 1TJHL 2XRAH 3FJTA 1DL7H 1LNUB 2A73A 3CFEA 3N0PB 1A6TA 4CMHB 4EI5D 3ARZA 5EB9A 2AABL 2PN5A 4WWKC 4ZAKD 1FNAA 2J88H 1R3IH 1YNLL 3QDGE 4OGZA 5E4IA 1RMFL 3SY0B 4L4VB 5EORH 2VLJA 2QQQA 4S1DC 5JO5A 4OCXL 4LBEA 5L2JA 1H3WM 4OCRH 1PZ5B 4H8WH 5MEOB 2VQUA 1BQSA 4NQEB 1P2CA 4DCQA 3ARBD 4X5WA 4HT1L 2EDOA 3RWFB 2R2EA 2JELH 3KG5A 3F7RA 2B2XH 5JZ7D 2DQEH 2D7TL 4PGEA 4NWUH 3FOMA 4GRMA 4NZJA 3Q6GL 1F58L 1UVQB 1CE1H 2XA3A 3ES6A 4HIEA 5TDPA 3CX5J 4QY8B 3K8KA 3UBXI 1OTUD 3IDXH 4X9HA 5DLMH 1YEIL 1MWAB 1WC7B 5I1DB 1T1WB 4JANA 5BW7C 1J05A 2X2YA 5DJXB 4NHUE 2YA2A 5CEXB 4UOJA 4XP4L 4FZ8L 3ARED 1XGRB 1P4BL 1N8ZA 4PJ9C 1IM3B 2EIDA 3MRNB 4KKBD 4PRPD 4F58L 4OT1H 5MEND 1IC4L 1MCPL 1HHHB 1FL6B 4NDMB 1A6AA 2NTFB 4EIGB 1NAKH 3HCVB 3TA3D 3HNVH 4PY8J 3EFFA 4FTVB 1T7YA 5E03A 5EOTA 5CP7B 3K3QA 1WITA 4U31A 2AQ1A 2MJWA 3VXMA 5DQ9B 4Y16A 4BH8B 2NXZD 3SE3C 5I8KH 4NRXB 2IF7A 4J6RH 2BERA 3GB7B 1CT8B 3FO9B 5J89A 3QFJE 1YYLL 3EJZD 4K9EH 4LLAA 5EUOA 2JIXA 4WO4B 3ROLB 5LXGH 1AKJD 1NAMH 2E7HA 4F37K 1E6OL 2FCBA 3X11B 3JTSB 4J1UA 1IMHC 5GZNC 1EH9A 4YAQA 4N8CL 4BKLA 1CLOH 4TUOA 4NWTL 4GLRI 4IBLT 1MCIA 4PJBB 3VWKD 2ATKB 3WFHB 3VWJD 1E6JH 3MLZH 1A9BB 4JVPA 4ZNCD 3PG2A 2HT4C 5D4QA 8FABB 4FQQB 2C1OB 2GJJA 4QCIB 4IMLB 4UT7L 3T1WA 3F5WB 1MF2H 1KN4L 5IIEA 3MLYL 1JPST 1R3LB 1IGTA 1KTLA 2QSCL 2P8LA 4QHNB 3HG1A 4H1LH 1Q0XL 4E0RA 1A0QH 3FB6B 4XCFL 2GCYA 4WU7A 3V8OA 4HDIA 4FN0A 1NBZB 5DMIH 1IL1B 3QI9B 1JRHH 1ZHLB 2I25N 4PD4J 4KMTL 3F6LA 2FD6H 5KN5A 4Y1AD 3BIKB 4NHCH 5T3ZD 4N0FB 5ID1B 4PB0L 5C0GA 1KULA 2BSSB 1WBYB 4YFEA 1DQTA 3CX2A 3ARFC 3SCMD 1MFDH 1S9XA 2DQGL 2HT3C 3GSRB 1CDUA 3RPIA 2A0LC 4RDQG 1OM3L 1UEYA 5FO9A 5JW5A 3LY6A 5E1HB 5D7JD 3WIFA 1IGCH 3MX0A 1MUJB 3QDJB 3VFGH 3HI5L 2G2RB 5E8OA 1P7QA 3AS2A 1RI8A 3O6KL 1SY6A 4QXTA 3UJJH 3O6LL 1UB6B 1KCSH 1F6AB 1ZAGA 4ISVA 4Q6IA 1UXWB 4WHYG 1GGBL 1JZ4A 4X4YA 1JZ2A 5KSBF 2EIZB 4QRRE 5DC9B 4HS6A 5IT2L 1XZ0B 3DRQB 3K2MC 3GNMH 3BDBA 2A6JB 4ZUWB 4M7KH 5HGAB 3LN4B 5CD5D 4N5UA 2HN7B 4HUWA 3KXFB 5ICZA 3BZ4B 4P5TB 3D87B 3Q5YA 4R4BB 3FQXB 4GBXA 3UROR 3EYFA 5IB5A 4GAYA 4GQ9H 3A6BL 4XMKL 4DK6A 5TFSL 4IRJB 1BD2B 5F7EH 4P9ML 3WXWL 2PR4H 3CX5K 4HUXA 3UPRA 1LEGB 2NY1B 5IKCA 3WFCL 1UQSA 5IMMA 1T7ZA 1CFTA 4PJ5D 3OXRB 3GMLB 3TH2T 4N0UA 3HUJA 1SEBA 2XWTB 5H2BA 3H3PH 4FRWA 3BZEA 1I3RB 2JJTA 3AXLA 3G5ZA 5ALCL 3TIEB 3IDIA 5J6GA 4S0UC 2ICWJ 3L3JB 2BHUA 2P46B 3TESA 5E94B 3QULB 5TE7H 3ZSTA 1FZOB 3SQOH 4H26B 4ODBD 2A1WH 2ENSA 3AM8A 4MJ5B 2CK0L 2LU4A 2R0KL 2EDNA 3ARDA 2HMIC 1JF6A 4F8QA 4PBWD 1D5BA 1KCRH 1NJ9A 1S7QB 4XNMA 4FQ1H 1S7VB 4A6YL 1DBJL 5MP6H 3EOBA 3D85B 4LVOC 3IDJA 3THMH 2V17L 1NCDH 4JN1L 5IF0A 3GKWL 5IHBA 3F12A 1JIBA 2PYED 3MV8E 3S4SB 4P3DA 2FWOA 4XPFH 2GTZA 5C70A 2QLVB 3DUSA 1M6OB 1DEEA 3FOLA 1CG9B 1WUNT 2ADIA 2VZOA 4XRCB 4P4RA 4BQCA 2IFFL 3PP3H 4HMCA 5GPRA 4EDWL 1NEUA 2R4SL 3LKRA 4JLRB 5C0CA 3RX7A 1EO7A 4P59L 1EPFA 5I9QB 4KHXH 5C86A 4D94A 4ZFFB 2UUDK 3X14B 2VABB 2EE6A 4IDJL 3TVMC 1KC5L 4HKJB 2O5YL 4HPOH 5B3NA 4G42A 2YK1L 1HYRC 1U8JA 2CXKA 5I1KL 1IM9D 3QIBD 43CAB 1XH3B 3VD9A 2D4FA 3L1OL 2GITA 2JB6B 3PWJB 3EO1A 3C2SA 4PD4K 1IQWL 2YPLD 1KG0A 1LK3H 4OCYL 4K23L 4XNQA 1UJ3A 4MNQE 3MGAA 3IKCA 2UZYB 1NFDA 4PJHA 1ULVA 1JPFA 4DTGL 1NCBH 2GJ6B 4QXGH 4KVCH 1OPGL 1QSZA 3DBXB 1DLHB 3MUHL 2OP4L 4WW2F 4M5ZH 3MPCA 1NMCC 5CEYA 4JFFD 3T2NL 3S88H 1BEYL 1UH3A 2VC2H 2AERT 4G5ZH 4PRDA 3QQ3B 2FJGA 5FKAB 4M3JA 2WBJA 2H32H 1JTTA 5LVEA 1DQJB 4P9HL 3NABH 1YQ2A 2GAZB 4KAQL 2RJMA 2R2CA 4Y16C 4LU5H 3OKKA 5J4MA 3BQUA 1VFMA 3B9VA 2DQJL 1P7KA 3STZB 4I0PD 5EU7E 1GOHA 1I7TA 3ARGA 3ZKXC 4OF8A 3JWDH 2FHFA 4CW1B 3MRBB 4PJ8B 3NBNA 2W60A 3OBAA 3F7YB 4YXHL 3EZ8A 1GHFH 4I3RL 5T5NG 4Y8AA 3O6ML 2UWEE 1RUPH 1JNNL 4CGTA 3BYYA 1H9VA 3MCKB 3KDMB 1X5XA 1BF8A 2QEJA 3HI6L 1VACB 3HI1A 1Q1JL 1NDGB 4PTTB 4L29B 3TIDA 3MJ9L 1FIGL 2E5EA 2DM7A 4ODHH 4XWGL 4YXLH 2QJDA 3WNOA 4WEBL 4JPKL 3RNQB 5DQJB 2VDQH 4IEFB 5GQBA 1FN4A 5JPMA 4HV8A 4OLZL 5HHMB 1P4IL 5I1AB 3TO4B 1B3JA 4RRPG 1FNGB 4X7EC 1RJCA 1EAJA 5CLTA 2OL3B 1JMXA 1H3TA 1V7NL 3DIFB 3LKPA 4MCZA 2CLVA 3W9EB 1NUDA 3UTTB 1BZ7B 4RWYH 4QRPA 3VFNB 3U7AA 1PG7L 1YECL 3CXDH 3MRFA 4TVSa 5GS3A 5T1MA 4APQD 2AJVL 5IJVA 2D7OA 4Z7UE 1S5IH 5C0RL 3OPZL 4KJPD 1HDMB 3DMMA 3STLA 1CU4H 1OT2A 5J3HD 1R24A 2NCMA 1JI2A 4HS8H 3WIIH 1FC2D 2DYPB 4JM2A 1RK0A 2FEDD 5KS9A 2BVQA 3FT4A 1VADA 3BESR 3D3VE 1BVKA 1N3NA 4JFPA 2PO6D 5ITBH 3FZUD 1TMCB 3WFBL 3MJ7A 2IG2H 2VQTA 1D5XA 4PRIA 3RTQD 3H0TB 4G3YH 2ARJQ 3CZFB 4AT6B 3G5XB 1RV6X 5E2WL 1SYSA 4NKMA 1XR9A 3UDWC 3KPLA 2HKFL 1V8HA 4HMDA 2W92A 3DO3A 4K2UL 5EIQA 4JPIA 5DR5L 5IHZB 1A14L 4G7VH 5IVXB 4UV7H 3H9SD 4WUUB 4L4JA 4P3CH 4YNYA 4MD5A 5D1QA 2R8SL 3UZEA 4GBXC 2AK4B 3D6GA 4C56B 5GZOD 1U8IB 3PQYD 3L7FA 1G7LA 4PJFA 5DFTA 3BPCB 1NAMA 4XP9H 4WV1B 1A7PL 4JO1L 1ES0A 2D9CA 4Y5XA 2H1PL 4CU8A 4NYLB 3MODL 2QADB 4L4TA 4F2MB 5AZEH 2IEPA 1Q94B 3V4PH 3WL9A 4P5KA 5BZWB 3LDBB 3TBYB 4U1KB 3GSXA 4YHIA 4PJIB 2NTSP 1EA9C 4TOYL 4P2QB 4OM0H 3RFZC 4PJGB 5TPWL 1SBSL 2EYRA 3MLPA 3WNKA 1FL5A 3HE7A 4AEFA 1OTTC 1E28A 4HAGA 4ZQKB 1OGTA 4H1LA 2WBWB 2Z0BA 4ZPVB 1Z3GL 3AS3A 3D0VA 3FCTA 3ZZ1A 4Z5RB 3MGTA 4HJGA 1N5YH 1NFIB 1AGBB 3QFJB 3HRPA 4J4PD 2AEPH 3UYPA 4PRHA 2QSVA 3FQNB 2G75A 1JCKA 2Y7QA 1QRNE 5K9OB 1UA6L 3SKMA 3JWOH 1J1XL 5E9DD 4UQ3A 4KUCF 3KHQA 1WJ3A 1DQDL 3JUYA 3SKNA 2BNUA 4AENA 3VD5A 2BNQD 1X44A 2HJFA 3UTZB 3S5LG 1FL3A 1KTKE 4S1RH 2E3VA 2Y36H 1PW3A 1Q9KB 4FQIL 5TE4H 4K3DL 3L7EA 1N59B 4EEEA 1A3RL 2VE6A 4OD1L 4F57L 3REWB 4ONHB 4Q0XH 3NPSC 4NNXA 2IBBA 1CWVA 1MCWM 4U1HB 2DIJA 5HGHA 4JG1L 4C4KT 4EOWL 6FABH 1G7JB 5GS1B 2DTML 3FQTB 1TVBB 3QNZA 2FGWH 4YHYC 1K6QH 3QSKB 5C8JA 4HH9B 4UQ2A 4MXWH 2QQKH 2DM3A 5E00B 1JTOA 4HD9A 5TF1L 4JE4B 1C16B 5C0NC 2DKSA 3O9WA 3TF7A 4EQ2A 4HZLA 1EGJH 2VIRA 4MQXC 1BBJA 5TJWK 3RX8A 1CXEA 1AXSB 1HKFA 1PKQB 5ACZA 1B0RB 3ESUF 2BSED 5JHLL 2DD8L 1HE7A 1BX2A 4AM0B 1I3UA 4QTIH 4XPGH 3T0EA 2YUXA 1JV5B 4UNVA 1MFAL 4U6XB 3VA2C 4FZEH 2W9EL 4NQED 1ZVSB 3MSPA 1L4IA 1KJ2B 4TPRH 5IESL 4BQBA 4NZRL 3RKDD 2F5AL 1HQ4A 1C12B 2VDNH 3HPJB 3IXAA 1ZT1B 3PWLA 2FATH 3PP3K 3TEUA 5I75C 3MFFA 4RAVB 3LQAH 3VGBA 5B38A 1S5HA 3NTCL 2EO1A 1JGDA 3QZWG 4FFVD 1A6VL 1E27B 2HRPH 5IB3A 5MEQA 4LLDA 1T0MA 4OGXH 4GKOA 1MQ8A 3WUWG 5C1MB 4E41B 3JZ7A 3OR7B 5HHQA 2VLKE 3F7QA 3W0WB 1AIFB 4G9DA 5D7IF 4M43L 2CKBH 5HYSG 4LNVA 5D2LA 4HWEH 3V7AG 1WAAE 5AWNH 3FQWA 4UTAH 1U8OB 1OY3B 2BXYA 3TN0D 3I6GA 2MFNA 3ORJA 5T3ZH 4BSVB 3QQ4B 1OSZB 1QACA 4RFOH 5E2TL 3RVUD 4KRPC 5JXEC 4FMFA 4OKVA 1L0YA 2CLRA 4MWFB 4LVEA 3RA7L 2DQIH 1F45A 1EO5A 4ENEC 3C5ZB 5DMGD 5FO8B 4H8WC 2F74A 3QUZB 1CGVA 1M71B 2X4OB 4B53A 4JZJA 2OTPA 5EZJB 1YQVH 1MREH 3B3IB 3C8DA 1CD1A 5IR1B 4UMGA 5LG1A 4HJ0C 5B8CA 4G59A 5GS2D 2D2OA 3LCYA 5ANME 2IH3A 4AIZA 1CLZH 5E7BA 3QUKB 5ISZB 2J8UF 3QCTL 1S7UB 2ZG2A 5KVEL 2V9TA 3BH9B 5GGVY 5GGRA 2YBRB 1CS6A 3OMZA 4R8WL 1ZHKA 2VLJE 1QUNA 5F9AC 2PXYB 1TFHA 2W0LA 1ERNA 1VGKA 2ZUYA 5E5RB 3H42L 1ROWA 3JVGA 2ZWLT 1UACL 3CPLB 1I7RA 1T1YB 5I71B 5HPMA 5F96H 4DFHA 3IKKA 2XQBL 2CH8A 3AB0B 2N7AA 5GIRB 1I3VA 1RJYA 2OXGA 5DRNB 2VKXA 4F7EA 1CTOA 2R2HB 4KMLB 2P5EB 2Q8BL 3KLHC 1U36A 4AEIH 1MSPA 2XY1A 2GSIA 1Q72L 4NN6B 4P2OA 1J5OL 2H32A 2GI7A 3BGFC 1T3FA 3WD5L 1DFBH 1A8JH 4HK0B 3QI9D 3CLFL 2P5WA 5D1QC 5GSRB 1KEMH 5HHOE 2EE3A 1HOCB 3C87A 3E2HA 3GSUB 3ZDYE 3P9LA 4PGCB 2JCCA 2A38A 3MBEC 4K9EC 5IK3A 3C2AL 3GDBA 4XTRD 4H0GA 3UAJC 1I1YA 3NFPA 1F11A 2R2BB 4L8CB 3I6LD 3D5OF 6CGTA 3LS5H 5AD0B 4Y5XC 5I76A 1H15B 2F8XC 3H7BB 4R4FL 1X5FA 4JR9H 4LAQL 1KLGB 1ZGLB 2EH8H 4M8QA 4PJEA 5FDWB 1TJIH 5JIHA 5TDOB 3G08B 3N1MC 4NC0B 1WBXB 2D7MA 4ZFGH 2R23B 4X6DB 1MHCB 4JHWL 4UTBH 1IQDB 3LH2H 3HRZA 3BAEL 5F88B 1XF2B 4KKNA 4LQ1A 3HE7C 4LRNL 1YNKH 2F58L 4FQHB 5FGCE 5E08L 1OAYH 1I9RH 4MAUL 5SWSA 3BEVA 2AJXH 5JLZB 5E6ID 5GISL 3ZE2F 4L8SB 4P4KA 3WV0A 3FMGH 2DWDB 3FRPG 4JFOB 4NM4H 3WLWC 2IAMB 25C8L 3JV0A 3VFPB 3I50L 4GRLB 2X1QA 3C5JB 1T21B 3WKML 4QOKB 5I17B 2G5RA 1L7IL 1MIEL 1KXTB 1T1ZB 2HVJA 1NGZA 4LVNC 3KWWB 1PG7X 1M05B 2NY0C 5C0JA 5C3TA 4NRYB 4KZDH 1FV1A 1IC1A 2NX5A 4XC1H 5ID0B 3HB3C 4WY7L 3FN0L 4CN4A 3ZKNC 3FTGA 4PV9A 5TQ2L 1ZWIB 3HG1E 1IEBA 2ZJSH 4EVNB 4MGXA 5FYJU 2GUOA 1MVUA 3HZKB 1JTPA 1KJ3L 3LMJL 4LKCA 1VSCA 1I85A 4DGIH 1A7RL 3DI2B 5J06A 3QFDA 1CLYH 1CFSA 1H0DA 4YHZH 5DO2C 3RL1A 1YEGL 3L3IA 4F7CA 4DZBA 2J6EL 4I48A 3MUGB 1IGIH 1D5IH 2A6KB 4U0RC 1CGSH 1T6VN 3EYUL 3LQMA 4BZ1H 1I7UB 2XPGA 3UJIH 3GZKA 5F7WC 3AUVA 4FG6D 1OQXA 4TTDD 4GMSH 5F97E 3MV7A 1R6VA 5F8QC 3GSVA 1LO0L 3TFKC 3IFLH 2Y72A 3MRPA 4GAJL 4U1IA 1UT9A 1KT2B 2GKIA 4NJ9L 4O2EB 4TULL 1W8OA 3Q1SL 2XYCA 4DQOL 4KKAD 4AYFA 3Q3GA 4TUJA 4EIZC 1TQCC 4QRTB 1AJ7L 1KFAL 3IFPB 1V3MA 5D7SL 5GHWH 5C08B 2CR6A 4I77L 3EAKA 3SN6N 5DJ8A 2CUMA 4XAKD 1WK0A 5D1XC 1JP5A 3O2DH 4EI5A 2DMBA 5IMKA 1T2QH 4ELME 1T03L 1OAQH 3P0YH 4ZAKA 3CFKB 3BFOA 1FO0L 3ALWA 1QSED 3QUXB 4JY4B 5B38G 3WHXA 1GJIA 2DQDH 1MI5D 1F4XH 5HBBA 4AMKH 4BQ9A 4J3XA 1BGXL 1ZSDB 2WUCH 3SGEI 1LO5B 4NN7C 4UOW0 3Q5OA 4NT6A 3GJEB 4MA3A 3O3DB 3MXWL 3U46A 2ZOKB 3ARBA 4JFDE 1JWUB 4ZFOL 1VFBB 4Y8DC 4HEME 5HDLA 1N2RA 3IJYA 1KCUH 3OKNB 3HR5A 3C5SA 1F13A 3FFCD 5DTFA 2C3XA 4X80L 2FX7H 3R8QA 1IGJB 1KB9J 4EBQH 4LLQA 4PDCE 3BW9A 4WWID 5GJSH 2D31B 1YEFH 3GSNL 4MA8H 1FNEA 1DBMH 1EHXA 3RWJA 2PETA 2VITB 3AREA 4JFXA 4KI5C 2Q76A 2Z92A 3SKOB 2NNAA 4PRPA 5IVOA 5CD3B 5MENA 5B8CC 2FH8A 1BM3H 3E3QA 3BP6B 2W07A 3CVHH 3VGHA 4PJ7B 2VDPL 3TA3A 1MLBA 3UTQA 5JA9A 4HWBH 3D39D 3CH1B 4JZNB 3U0PB 3RAJL 4XVSL 4LIQH 4OZGB 4D0BB 3UC0H 5FAAA 5HY9B 1NMBH 5HJ3B 1A3LH 1GXEA 4KDTC 5E8PA 1CDCA 2ADFL 4KGLA 1KBGH 3T3MF 5HHXL 2OI9A 1Z5LA 3BDYH 3FT2B 3X12B 1IAKA 4ZFZB 4Y4FB 1EGJA 5IV2A 1I1FA 3R06B 1RJZA 4IOFD 4DEPB 1FLRL 4G43A 4BFIA 3JVGC 1R3KA 5F9DC 1AKJA 4FQ2L 3IDNA 2B20A 2AJYL 2F54B 2YN5A 3FFDB 2BOCA 4RISL 4GKSA 1X3DA 4WTZA 4NO3B 4GW4A 2OLDA 3VXRE 3UPCA 4X6BB 3TBSB 2VXSH 4OUUA 3W9DA 4OV5A 3U1SH 2CDFB 3PGDA 5JPNA 1O7SA 3QNYB 3VWKA 3VWJA 1OGAA 1FZJA 4YHKL 4WI7A 1EHLH 3RNKB 4XH2A 4EXPX 1DQQB 2AJUL 3UTTD 2XKSA 3IVKB 2OR9L 3V0VA 3K81A 1C5BH 5J1SC 3K1DA 2NY5H 3RZWA 3TYGH 1MHHB 1MEXH 4FQXB 4O00A 1U8KA 4XWOC 4LKXB 5D93C 1MHPH 3JWDC 5IVZB 4HS3B 2CKBA 1F3JA 1QOKA 4HC1H 2G5BB 2X5PA 1LE9A 4ONGL 5F1NA 1O5DT 3QDGD 4PTUB 4YDKH 2DYPD 5JDSB 4Z95L 3QUYB 5JNYA 4Y1AA 4HGWA 5E56A 1UJTA 4PB9L 4LPCA 5IP4A 2P8MA 2QTEA 4LEOB 3ERYA 1VHPA 5E99L 5BQ7B 3FB8A 3GMPA 1NLBH 4XB8A 5EA0L 4R96A 5DA4A 3KJ6L 2DBLL 3FQRA 3SCMA 4XMLL 1HHJA 4XAWL 1L0XA 3KPMB 4DUWA 4YEEA 1GC1C 4X7SL 2FLRT 3P9MB 1NUNB 3WIHL 4XVJH 4XP1L 4YUEH 5D7JA 2Z4QA 4I2XA 4JB9H 4M02A 4JFQA 2GT9A 2JJVA 1MIMH 1GGUA 1J0JA 4KVNL 5F6IC 4WUUD 2Y07H 2NZIA 4X6FB 5DYOA 4OI7A 1UZ6F 3FRUB 2AQ3A 3PIQB 2AK4D 3MJ8B 4P23D 3V0WH 2WBKA 5LAXB 2BXZA 4NJAL 3IFOA 3OV6A 4MDIA 4XP5H 3WJJC 2Y6SC 1NEZB 5HVWA 2AVGA 3VG0H 4PLJC 1D6EB 5I1LA 2EYTB 2IQAA 5CSGA 3INUH 5AZ2L 1VFAA 1YEHL 3B9AA 2VLLA 15C8L 4LDLB 3MRDA 1EEZA 3LKSB 3QR2A 4Q2ZA 1KPRB 3B9KC 5EUKB 3EBAA 1RSFA 2LAAA 1T89A 5KANG 1KB9K 2VNCA 5JR1L 1ZE3C 3GBNL 3DV4B 1BLNB 5D5MB 4P2QD 4YO0A 4KHTL 2NR6D 4TNVF 4LNRB 5EUOF 1PLGH 1WBZB 1WCBA 1GIGL 1TQBC 1K5NB 3D2UB 4DW2L 3RUGB 5JQ6H 5ANMB 3FHQA 1HH9B 2AXJA 4KK6D 3PHSA 3M07A 4O02L 1I1AD 1CR9L 3QFJD 1IGFH 3VMOA 2R0WL 1TIUA 1PQZB 4YPGB 1T20A 3VCLA 1JGLL 3MMEA 2CMRH 3DV6B 4OJFL 4Z8FH 4KK8D 3B2VL 3LRSB 3K2UH 4NIKB 5EC2A 5TF0A 3S37L 3PGCB 3ZKMC 3HC0B 5ICXA 2CDGB 4OLYL 1P53A 1FVCB 2X4QB 2XZAH 1BZQK 5DK2B 1R3JB 2EECA 4HZAA 1X9QA 5IGXL 4NKOB 1OP5K 5F89B 2EXYD 1EXUB 3L9RB 3KYMA 2EC9T 4M3KB 4DN4H 3IGAA 1U3JA 2PYEA 3MXVH 1HI6B 5K59E 2V9RA 3UTPE 2OTWA 1C5CL 2JTDA 1CVSC 4PJFE 2UVFA 1P69B 5DF0A 4FP8H 4UNTA 3V4UH 2DJUA 5JW4N 1FO0B 1I8IB 3ARBC 1AY1L 5E8DL 2P47B 2O26U 5HD8C 3MGOB 1AD9B 3NVQA 5GS2H 3NGBC 1EAPB 4JRYB 1DLFL 3PNWA 4JPVL 5FOBA 2E9IA 3TBWA 4F7TA 1IM9A 1WQVT 3QIBA 1FVDB 3BGMA 3WJLA 5I18H 1UM4H 2NY3C 3DUUB 1D9KC 1YMHB 1SVZA 1YY9D 3VFWA 1T0NA 5F8RC 2R56L 4HIJB 3KYKL 2YPLA 3FN3A 3V79C 4XCYB 3OGCA 1X5GA 1ADQL 4GS7C 1HYSD 4G6FB 3AREC 1LGVA 4QRRD 3VJ6B 3D69B 5HDBF 5LWYH 3MNWB 4MD0B 3GSNB 4WFEE 4U1GC 4ZYKA 2EZ0D 3ZE0E 1OTSD 3MROA 4Z7VB 2J88L 4NO5A 3RVTD 3E3QC 3S8WA 1U58B 4PRHE 5CMAB 4Y5YB 5L0QB 4JFFA 3KPRB 2NY6C 4Q7DA 2CIIB 3NA9L 4ZPTA 4BUHA 4M1DH 2M1KA 4DZ8B 2FR4A 4BK5A 5HHVL 3QRGH 4Q9QL 4XXDB 5FHBH 4H8WL 3HUJF 4WRLA 1J8HB 1Q9LB 4RWHA 1CFNB 3S36X 4O2CA 5L6YL 1NUFA 2C26A 2IANB 2CRIA 4XBGA 2BK8A 2NXZC 1IZJA 2DQEL 4I0PA 4AIOA 2ZUWA 4AEEA 2V5YA 4PRAB 4NWUL 1G7MA 1U93B 1RIUL 5FUZH 2RAMA 4R97C 1KGCD 1V3LA 4FMKA 1XR8B 2HVKA 2DB8A 1KPVB 4LLYA 1G7QA 3C5ZD 5GRVK 1NBYA 3DECA 5I74C 1FG2A 2BNRE 5IB2B 3O2DA 1P1ZB 3IDXL 4YBQD 5DLML 1U3HB 4OZIF 4K3GA 1N5AB 5TDNB 1NQBA 1X5KA 4AL8L 3VWJC 1V7MH 1QQDA 1ZXQA 3VGGA 3QDMB 1G7HA 2KZWA 2XN9E 4M93B 3ILPA 4HJJL 3QIUD 4OT1L 2ENYA 5ISZD 3AU1B 2EYSA 4YIQB 5ABDE 3GSOB 4P46D 1Z6JT 4IIQC 4Z0XB 5GGRY 1NAKL 1UZ8B 5KSUA 4AH2B 1A4JB 1IGMH 3HNVL 4Z0BH 4DVBB 4HUKB 4H20L 4XXCC 5DFWH 3KPSB 2PXYD 3CJJA 1FNSH 3VFSA 4LLWB 2ADGB 1HSAB 4HFUL 2R4RH 3ZT6A 1D6VL 1MY7A 4APQA 3SKUD 5I8KL 3D9AH 1SVCP 4XC3L 1FG9C 4OF3A 1Q9OB 2BC4A 4JKWA 3RWDA 4K9EL 3O4LB 1QPXA 4PR5A 3R0NA 4I3SL 2P5ED 4FQLL 3RGVD 5LXGL 2FX9H 3VRIB 3IXTB 4K7FB 2HA1A 3MLWH 1AXTH 1JGVH 2PO6A 5KSBB 4Y5VB 4RQQA 1YPZB 2HJLB 3RTQA 1A6UH 4OZHF 1TZHA 1UWXH 1ZKAA 2CK2A 4X6CF 1PGRB 3GJFB 1QRKA 4LHUB 3QA3B 3CFJB 1LP9E 2VDLL 4OFVA 4PJHF 3MLZL 1F2QA 4HWBA 1KOAA 4UNUA 3R8BB 2A6IA 5L88H 5HI3D 2BOBA 4W4OA 1NCCL 4GG6F 5EULV 1K3IA 1RZ7H 2PCPB 3H9SA 5D7IE 3N1FC 1NC2B 5CEZH 3SHSA 4ZS6D 5ITFA 2FNBA 4AQ1B 3HKFA 4KTDH 3RWHA 3CFBA 3SDCB 4MQTB 2C3VA 3PQYA 3NCFB 4Z9KB 5F7LB 3P4NB 3DVNB 1JRHL 2B1AH 4KI5E 4M48H 4PPTA 2FD6L 3PHQA 3IJHA 5ESVA 5CJQH 4P57A 4F7MB 1ACYH 1YA5A 1TJHH 1PJ9A 3DURA 1MFDL 1RZJH 3QHFL 3R1GL 3PDGA 5J1AB 1R0AL 2AABH 2AJ3A 1RMFH 3G5YA 1HKLH 3KPOA 3PWNA 1U8MA 4NNYA 2APXA 3AVEA 3IRPX 1DSFL 4GRLD 4OCXH 4G8IA 3PDOB 4NGHH 1XCTB 4OB5H 4EUPG 4LRIA 2J8UE 4NQCB 3UJJL 3EYVA 3WEXB 1KCSL 4MS8C 5DWUL 4HC1A 5DJZA 1TLKA 3LKNB 2BZDA 4IHOB 4L9LA 4UDUB 5J7CC 5IW1B 3BKYH 3PXJA 4J4PA 2D7TH 2C7UB 4I18C 4NC1C 3S5LB 2BVUA 3ZHKA 3V8CA 3Q6GH 1F58H 1UGNA 2ZSWA 3S96A 2K3TA 1GZQB 4RMUA 5E9DA 4ODUA 1ZHNA 3G5VB 3ZDZE 4ZSOB 2OR8A 5F7EL 2NMSA 2F53B 3KJ4C 3GBLA 4Z77B 4KI1A 2BNQA 5C09B 1HHIB 4NQVB 5GGTL 3S3PA 4FZ8H 1F97A 4OLWL 4JO4L 1P4BH 2JCCE 4CRPA 2HG5B 2EC9U 4JM2F 4Z7OF 4F58H 1IC4H 4O51B 4WWKD 4W81A 4LMQE 2BMKA 2E8ZA 4L3EB 4PJEE 4S1DD 4PLNC 3L3GB 4Y4HC 4MSWB 4U6YB 3MRRB 5SV3A 3SDDB 4JKMA 1WIOA 1IAMA 3D3VD 5JUEL 3LKQB 3WJLC 4N5EC 1JGEA 1LWRA 3L5JA 4OLEA 3UXFA 4XNXL 4PJAF 5C08D 5EBWB 4YFLF 5IBUB 4PLOB 4XVTL 3CZJA 2V5TA 5TE7L 2CIKB 2AJSL 2ITDA 3BZFB 4AK1A 3RPKA 2A1WL 1YYLH 4WW2B 2MPAL 4QRSB 4Z7WA 2CRMA 4OSUL 1D5MA 3RWGA 5KZCB 4LCCC 2YXFA 3TT3L 4P5MB 4FQ1L 1BAFH 5MP6L 2VYRE 1B2WL 3QZWB 3BH8B 3LQZB 4OD2B 5MEOA 3V6BR 5BV7L 4N8CH 5TH2A 4NQEA 5MI0B 4NWTH 1AO7B 4JY6B 4LLVA 4XB7A 3WUWB 3TPUE 1F8TL 1KELH 1QSVA 3RWFA 2R1YA 5HDQL 4G80B 3MRLB 5DJDB 3WE6A 4HSQA 1T4KB 1VDGA 3RHWF 2CPCA 3RRQA 2X6MA 1S7RA 2NX5E 5FXCH 3C09B 1WEJH 1UVQA 2QSCH 4NN5C 1QR1A 5IQ9A 2Z93A 4I0PC 3VH8A 4XCFH 4WI8A 5CJBA 5SWZB 1WC7A 1T1WA 3VDCA 1NMAH 4PY7B 5DJXA 3K4AA 3OAYH 4HX1A 3S37X 1XCQB 4KMTH 4JJ5A 4PB0H 1G1CA 3TN0A 2CLZB 1IM3A 5C0AB 1KLUB 3MLVL 1RJLB 5KSAB 2J4WL 1MCJA 4YHML 1FL6A 1BIIB 2EICA 3T65B 3VFRA 4XCEB 5LGHL 5E2JA 3WS3B 3FKUS 1ZT7B 4KXZH 4X5XB 3VFMB 1NCBL 2B1HH 4QXGL 4KVCL 5GZND 3KGRA 5CP7A 4PP2B 2OX5A 3HI5H 5DZOA 1VENA 4NQDB 4WU5B 3LD8C 3LKOB 4MCYB 2VC2L 3C6SB 1GGBH 4LQFH 4XHQA 4BH8A 5HI5C 4AJ0A 1NKOA 4NRXA 5IT2H 1CT8A 4YXKL 2H8PB 3GM8A 4DOHB 1XIWB 3UPAA 4MNGA 3KPPB 4LU5L 3M1BA 3ULUF 4KJPC 4XMKH 2P43B 5FF6B 1S7WA 4Z76B 4XNUH 1JK8B 5TFSH 4P2RB 5JW4M 3GIVA 4YGVA 4P9MH 3O41A 1GHFL 3PJSB 5A2JH 3MZGB 4IDLA 5HI4C 2BVTA 4PJBA 1LQVA 3WFHA 3FZUC 2NY2B 5SX4I 3BUYB 1HHGA 3RTQC 3U6RB 1RUPL 2CJUL 1GGYA 2ZCKL 1OB1A 5FUCC 4FQQA 4ELKB 1ZVHA 4QCIA 1N6QL 3F5WA 4WFGD 2HT3D 4FQXD 2Y5EA 3GMNB 1Y6NR 1C1EL 1YUHA 5K93A 5I30H 3OKLA 4ODHL 4EXKA 1F42A 1GC1L 2V2WB 5C3LD 2VDQL 4NCDA 2B5IC 3REVB 1NBZA 4HWNA 4U2ZA 1IL1A 3QI9A 4YK4C 4D2NA 1ZHLA 2XNAB 4XT1C 2EDEA 1ONQB 1JUFB 5ILTL 5ALCH 1WT5A 4O5LL 3BIKA 2AGJL 4N0FA 2J8OA 4W68A 5ID1A 1G9MC 2CDEB 5EU4A 4ONFH 5GZOC 3LEXA 4IOIB 1WBYA 4G8EA 4JM4L 4EN3B 3IDYB 1JN6B 1PFCA 3LSOB 1IAII 2DLIA 4OZFB 1ZMYA 3I6KB 3SJVE 2CK0H 12E8H 2R0KH 3E3QE 5DHVB 1N6UA 1QD0A 1MUJA 1DBJH 1ZLVK 1CU4L 4UU9B 2G2RA 1EEQA 2RHEA 5SV4A 5D2LF 4K71B 2V17H 3PWPE 4JN1H 2ZUQB 3GKWH 1J8KA 5EU5A 4MMXC 1WTLA 2R1XB 2IG2L 4PJCB 2VLKD 2EIZA 1I7ZB 1QLRA 4ZS7L 4G3YL 1UWXK 2NY5C 2HJKB 1MFNA 5HGAA 3LN4A 2HLAB 3EUUA 2IFFH 4D9LL 2RFXA 4GW1B 4EDWH 5E6IA 4R4BA 2R4SH 3FQXA 5I0ZA 1JYVA 3JUZA 3JV6B 5J56B 4P59H 4L9LC 4G7VL 1DJSA 4JCLA 4UV7L 3U30B 4IDJH 3CFCL 2R0ZH 3GBML 4P3CL 2YK1H 4O2FA 5DJYB 3UYOD 1JZ8A 3L1OH 3MA9H 4OF6A 4IRSB 2J7LA 4M6OL 3DYOA 5DVKA 3PDDA 3C60B 1T7VA 3OXRA 5D8JL 5IG7B 3G9VA 3MNZB 2HMID 3NIDF 1AC6A 1KJVB 2XTJC 5CBAB 1KJ2H 4DTGH 1NLDL 1QHPA 3BPLB 2ZCLL 1YY8B 1F4WL 5D1ZA 1QFWM 3O0RL 2IALA 4GO6B 3T2NH 4OM0L 4PP1D 1BEYH 4DAGH 5T3ZE 4WGWB 4JRXE 1NGXB 2FJHB 4IOSD 1M7IA 1AI1L 2YHGA 1N6VA 4AZ8A 1FZOA 4H26A 5KJRH 4P9HH 3DX6B 4MJ5A 4KAQH 3CC5B 5DD6B 3IRZA 4LSQL 3OKOA 1S7VA 2DQJH 2OQJB 1N5YL 5BRZE 2I9TA 5FM4A 1IJ9A 4CMHC 4I2XE 3TVMD 1ZANL 1PKOA 4WFHE 4CU6A 4FQPA 1T5XB 1U8HB 4Z6AT 1QLEH 1I8KB 3S4SA 4QF1B 5E6ZA 3GI9L 3MV11 4YXHH 4DJMA 1I3GL 2ARWA 2UYLB 1M6OA 1CG9A 4XCNB 5CSZB 4U7MA 3AMKA 3O6MH 5HHOD 2M2DA 1X6LA 1JNNH 1JYWA 1X7QA 5KBNC 5KVMC 1UZ6E 4FXGB 1QSEA 1HXYB 3BMVA 1MI5A 1VEMA 3MJ9H 5C0BB 1K4CB 4HKXB 4S1RL 1FIGH 4XWGH 1OL0A 4G6JL 4XI5D 4HKJA 4JPKH 4PY8I 5D6CA 5BV7B 4UDTB 5DJCB 3LVEA 4QYOA 4HAFA 5CBEA 4X7FC 1XH3A 1ZEAL 3O8XB 3Q0HA 4OLZH 2JB6A 2EE2A 3G6JF 1DTUA 2P7TA 4X83A 1HHKB 3PL6B 3OR6A 3MRQB 2A77H 4ZUVA 2Y23A 4U1MA 4G6FD 4MVBC 2E6JA 4PJ5E 3FFCA 4UT6H 1PG7H 2QQKL 5MERB 2IADA 5DJ6A 2AJVH 1MH5A 2B8OT 1EHAA 3OTTA 5C0RH 1H3VA 3N85H 3RVUC 1CD0A 2WQRA 1GGCH 5FYJL 3OPZH 3J8F7 1DLHA 3BO8B 3QUMB 3ULSA 2ZG1A 3DLQR 5DMGC 4N9GB 4QTIL 4QTHB 5FKAA 4RAUA 5DDHB 4E5XB 2XWBB 4FZEL 3ILQC 2M26A 2GAZA 3BVNB 3T3PE 2HKFH 3T4AB 5JHDE 4NC1E 1CDYA 1YMMB 4K2UH 3BIBX 3MACL 2FATL 5DR5H 3D39A 1A14H 5KSVB 4ZXBB 1QPPA 4WO4C 4CW1A 2MMXA 1KPUB 1VEPA 2R8SH 3VXPB 2PYEE 3TNMB 4GRWF 4L8DA 1JYNA 4BYHA 5HVFB 1U3HD 2NXYB 1R5IB 2BCKB 2CKBL 3OAYK 3VD7A 3LN5B 3O2VL 4W6WB 1PYWA 3MCKA 1JHTB 5KVDL 1CLCA 4JO1H 4X7TA 2H1PH 1HQRA 5GGSA 4PTTA 4L29A 3MODH 1G6VK 2ICEB 2MHAA 3FB7A 1YNTA 3DVGB 4N8VA 2ITCA 1JNHA 3DHMA 4LCUB 3SGKA 4PG2C 4TOYH 4QHLB 2PTUA 2PTVA 3M45A 4I1NB 5TPWH 1SBSH 1MREL 1YQVL 2X4PB 3QI9C 5EC1A 3UTTA 4PJXE 5IEKB 1TITA 3ZKSD 2YPLE 3VFNA 5I1HL 5EO1B 2QSQA 1MQKH 1BQUA 1W72L 1F4HA 3H9YA 4TN9A 5JW3L 4CVUA 5L2KA 4XTRC 1UM5L 4PGBB 5E8NB 1CLZL 1DZBA 1S7TB 1W0VA 1WZMA 3BX7C 4HGKC 2YUWA 1E4WH 1HDMA 1AP2A 5HXMA 2BHZA 3QDGA 5SX5H 4G9FB 3ECBB 1EFXD 2DYPA 2P42B 3DXAB 5AG8A 1G7IB 4Y19B 1BVLB 4YHNA 1RY7B 3EGSB 1QLFB 1UA6H 4ZNEE 2YRZA 1J1XH 1YYML 2XG4A 4R6UA 5ESQB 5IEHB 4AT6A 3NACH 2YSSB 1DQDH 5JOFA 5M7QA 5C7XL 3TPUB 3IAPA 4HG4J 4R3SA 4POYA 4JFDD 1B9ZA 1UH4A 4XPAL 1A6ZA 1SMAA 5IHZA 5C07E 5I1GH 3IETB 5IVXA 4I0CC 2BY0A 5FO7B 2K9UA 4M8VA 3V4VL 4WUUA 3OHXA 4AEIL 4FA8A 5F3BB 2ED8A 3PWUA 4P5TC 2XZCL 5GRJL 1UADC 1G7PA 2AK4A 4UINL 4IRZH 4OD1H 4P23A 1DFBL 3PWVB 4EDXB 1QSFB 4IRJC 3OAZH 4KRMB 1OTTD 4LCWB 2DTMH 4N1CA 3RZCB 2YRPA 2AV1B 2NY1C 4F2MA 4P99A 1Q94A 4HXAH 5TF1H 5I6XB 5ENWB 3LS5L 2YD9A 4QRQA 3WFZA 3TBYA 4U1KA 3VXUE 4PJIA 3CMOL 3Q6FB 2CO6B 4JR9L 2EH8L 3V2AR 3SDAB 4P2QA 1BWWA 4R4ND 1HILA 5DD5L 2VH5H 2DQHL 5IBLC 4I5BB 5HYJB 1MFAH 4ZQKA 3PE9A 2V7NB 4B7IA 5HYQB 1LO3H 2W0KA 3TYFB 3MOBH 4G6MH 5EOCJ 4JREB 4ZPVA 3O11B 5IESH 5A16A 5I66B 1I1AA 2VXUL 3QFJA 4ZUSB 2ARJA 4MLSA 3T8XB 3NIFE 1I9RL 3FQNA 4J3WA 1FBIH 1MFCL 3NTCH 3STBA 4FG6C 2AJXL 3OKEA 5F1OB 1H5BB 1IAIL 3S4SG 3VXRD 2EO9A 5E0QA 1CXHA 1BFVH 4NQUA 3ZHDA 2F53D 1PX4A 3BEWA 3E6FA 4ZOEA 1OW0A 4DVRL 3WN5A 5IFHL 5FUCE 4KKAC 4JKPL 5C09D 2L7UA 4I9WE 2H2PC 4NBXB 3U9UB 2CR3A 5MEPB 3VFUB 5B39A 1RZJC 5BXFA 1INQB 2DWEA 3BKCL 4KZDL 5C0ND 3RGHA 2GTWA 5FHAH 3UP1A 5CJ5A 4KZEL 4U1SB 5E2TH 2X4NA 3G9AB 3JTTA 4XC1L 1N59A 2Q7YB 1MCWW 3V7MA 1XF4B 3VU2A 4MQXD 3RA7H 5I9QC 3REWA 5I15L 2FSEA 3D18A 1FZMA 3ROOB 2OMNA 2X4TA 3SDDD 1J0HA 3UYRH 3K46A 3SE4C 4DGIL 4N90E 4NSKB 1G7JA 1CLYL 3FQTA 1H3PL 3PV6B 4MJIB 1TVBA 4HH9A 3EFDL 1D5IL 3KVQA 4H0HB 5E00A 1XGTB 1CGSL 1RZKH 3QQNA 4BZ1L 1UKQA 3O45B 2FO4B 4X98A 3U0WH 1CFQB 1PY9A 3UJIL 1VESA 5CZVH 5T1KB 1ZS8B 3QCTH 3IU3B 4ODWA 2YC1A 3RI5K 1CIUA 5KZCD 3VRLE 1PKQA 5TGBB 5I1IL 4JFEE 2IPTH 4R8WH 3B5GA 2XI9A 5HSFA 4YDVB 1JV5A 2HP4A 3CIQA 3BSZH 1KB5L 1MJ7L 4EI6A 4Q6YA 1ZVSA 4WHDA 1AO7D 4G6KH 3RY6C 3H42H 8CGTA 4HKBA 5IMOA 4QRRA 5GHWL 3QEHA 3HPJA 2AKRB 4LDEB 3QNXA 3VI4E 2XQBH 1LEIA 1P4LA 4CVXB 5HHNA 2OSLA 3VXNA 4HG4K 3TJHD 4GMTL 1OAQL 3P0YL 1XF3B 4U49A 5JTWA 3ZYZA 2I07A 5JXED 3IU4L 2PYFA 3ETBF 2VB5A 2DQDL 1ED3B 5SWQB 1F4XL 5F1IB 1W0WB 2L4OA 3GM0A 1QVOB 2FJFB 3QCUL 1J5OH 3DX9B 2FBOJ 1X5AA 4X4XB 5E9DE 43C9A 5SWZD 3WD5H 3BWAB 4KROB 1FSKB 4PJ8C 1UCTA 3QEGH 3CLFH 1EZVY 4R0LB 4ORGA 1IT9H 3BP4B 1A9EA 1IAOA 2BNQE 4U3CA 1I8MB 2QKIA 3QDAA 3C2AH 5C0AD 3EO0B 3L95B 3MRKA 4BSVA 1OSZA 1G0DA 2X40A 5KSAD 4IOFC 2XTJE 3SGDH 2WW8A 4BELD 4MWFA 4R4FH 1S7XB 1A1NA 5FFLA 3QO0B 4Q74A 5H35A 3C5ZA 2OR7A 5JW4Q 1QR4A 2ADJA 4LAQH 5FO8A 1DP0A 2A73B 4MXVF 1NPUA 3QPXH 1YEFL 4HIIB 3MRHA 4XX1G 3NCMA 1LE5A 1WWWX 3BD3A 3DWTA 4QHKJ 3TO4C 1NL0L 3MJ9A 1NANH 2YPKB 5A3IC 4KJYB 5JO5B 5L2JB 4ODVL 5EU3A 4LRNH 3QIUA 3QUKA 5ISZA 1KCKA 1XIWD 2F58H 4HBCH 3HLAA 2X9WA 4DCQB 5E08H 3BH9A 3KLHD 1V5JA 4LVHB 4P46A 3CVHL 2R2EB 3QXDA 5GISH 4L4VE 5KVGL 5IHUL 1T22A 5I8OH 3VFOB 2PXYA 3IYLW 3FOMB 4LLMB 5HGDB 4P2RD 3WKMH 3NCEB 1W72B 3QIWB 3FO1A 1NMBL 1L7IH 1FP5A 3ES6B 3MLTA 4HIEB 5TDPB 4YZFF 3UTPD 1YDPA 2NY2D 3CVIL 3NCCB 4NQEE 4U33A 1T1YA 3QRFM 3MBED 4WI5A 4L3CA 3BDYL 3UAJD 1XGQB 3OAUL 5GIRA 3BYTA 1G9ML 1GGIL 4UIMB 4OCWL 3GK8H 3Q48A 3UCRA 2R2HA 5D72L 2P5EA 4MMZC 3RGVA 3VG9B 4WY7H 5CP3H 1N8ZB 3FT3B 1XF5A 4JFZL 4N0YH 1N26A 2IBZX 3VMNA 3DX8A 3V5DB 5CWSB 1Z9SA 4LSPH 5GSRA 2VXSL 2EC8A 4BUGA 1HOCA 1A6AB 1KJ3H 5IFAL 1A7RH 5GS0L 4V2CB 4NZUL 2VAJA 1L9MA 4PGCA 3AY4C 2GHWB 5EOTB 5FEBA 1X5ZA 1BECA 3WLBA 4WV1C 2KBGA 3WHE0 3TYGL 3H7BA 3VXMB 2QADC 2PKDA 4RGNB 1ZGLA 2HRLA 5FDWA 4LSTL 1LO0H 3LDBC 5DURD 4FTVE 4GAJH 5EUOB 1F4YH 2WAHA 2JIXB 2FEEI 2FRGP 3DRTA 3MREB 5K9QI 4NO0B 1BIHA 4NJ9H 1MHCA 1IRAY 5DRZA 4J1UB 3GSWA 2XICA 2DLHA 3PXHA 1G9EA 1AJ7H 1U8PB 2ZZUT 5D7SH 2NY0D 4EUPB 4I77H 1NLBL 3ALXA 4YAQB 3EDFA 4BKLB 4TUOB 4FQHA 4YPJA 3G6AA 1XFPA 2YMXL 4XPBH 5F93C 1T03H 5ACMA 4KJWD 3ZKND 1FO0H 5JLZA 3DYMA 4KK6C 1F6LL 1CGWA 1MLCA 4JB9L 5KAQF 2DWDA 1NCAL 3GIZL 1MIML 4JFOA 3L3DB 3VFPA 4KUCD 4GRLA 1T21A 2GEEA 1RUKH 3D0LA 1BGXH 2V2XB 5IIEB 3HAEA 2C1PB 1U6AH 1KTLB 1A64A 3RWIB 2BNRD 3V0WL 4HDIB 4PJBE 5J13B 1WICA 1M05A 3HZVA 3OAZK 2UWEA 4IRSD 5IFJA 4F3FB 1OW0C 4HIXL 5EBMB 2JE8A 2VZ1A 2IMMA 5KN5B 4M7ZB 5ID0A 2LFGA 5C0GB 2H6PA 3HNSL 4KPHH 3INUL 4KV5F 4X80H 5C0IB 2XN9D 2EDQA 3MR9B 3TFKD 3W2DL 1P84J 1S9XB 5J6HB 3RPIB 3GSNH 5FO9B 5JW5B 4Q58C 1AH1A 5IM7A 4X9FA 3NH7L 2A6KA 5E6YA 2LVCA 2XXCB 2BRQA 4DGYH 5GS1C 1IEAA 5D1XD 3I6LE 1WWBX 4QXTB 4PJDF 4Q6IB 4WWKA 4I8DA 2UY6A 4Z7UA 2WUBH 3K0WA 4JQVC 4L3AA 3V6ZB 4N1HB 1E4XL 1MCCA 1T66D 3O6FB 4HUWB 3QDJE 5ICZB 4O2EA 5JORA 2CMRL 2RCSH 3RAJH 3D3VA 4Z8FL 4JDVB 4XVSH 3NA4A 2DQUH 5GGUA 1VKXA 3EYFB 3TZVB 5IB5B 4X5LA 1KIQA 2GY7B 2ADFH 5C08A 1GCFA 4OGAC 3BGAA 5HHXH 2XKNA 1IC5H 3DROA 4HUXB 1MWAL 3CFKA 1JYXA 3UPRB 2V6HA 1RZIA 2XZAL 1IKNC 1Y0LA 3KXFE 4JY4A 1KIRA 1P7HL 4Y88A 4FQ2H 2Q86A 2XFXA 5C0BD 3MLUH 3T77B 2EKJA 5IMMB 2EZ0C 3X3FL 1OTSC 3FL7A 4U6HA 5J12B 5BOPA 1CFTB 2FHBA 4QO1A 4HXBL 1ZSDA 4N0UB 3HUJB 2Z8RA 3RVTC 1SEBB 2HFTA 1BD2E 5BW7A 2Z35B 4PYGA 2R0LL 3KYNA 4K7PL 2ZOKA 1D7FA 1TCRB 3BZEB 5FB8A 4D0DA 4YHKH 2AJZB 1VFBA 4KI5D 1FYTB 3AXLB 3GMMA 4PG9B 4LP5A 2YKLL 1NCWL 2NY4B 3PL6D 2AJUH 3DPBA 4UB0L 3IDIB 2OR9H 3FO0L 5CS7A 5J6GB 4PLKC 1KN2H 4KJQD 4NOBA 1VFOA 3BOVA 3TO2A 2WM0A 3AS0A 3KYAA 4GT7A 2I26N 4QLRA 4OZIB 1VEOA 1M1SA 4MX7B 1RURL 4YDJA 4Z95H 3C5ZC 3CD4A 3LD8B 1D5BB 5FA4A 4XNMB 1OVZA 3QUZC 4PB9H 3BPOB 3EOBB 3SKOA 3IDJB 5DEFB 3T0XA 4QNPF 5IF0B 4LK4A 3SE3A 2ERJB 3BN9C 1NC4D 2LAGB 3F12B 5E99H 5CEZE 3CLEL 5EA0H 3KJ6H 1ZHBB 2DBLH 1J0ZA 4XMLH 4XAWH 2FWOB 3GHEL 2GTZB 3BP6A 3V9FA 3GJFH 4JGUA 4X7SH 1DEEB 3FOLB 4K55A 4CVZB 1YMMD 3WIHH 4XP1H 5A2KH 4CDHA 4W4NA 2I9LA 2WANA 4NBYB 3CH1A 1X5YA 1TETL 4ZXBD 1Q9WA 3U0PA 4RA0C 3I2CH 4D0BA 4YDIL 3UBXG 4HIHA 5C0CB 3RJQB 4ODSL 2LU7A 4Y4KB 32C2A 1QEWA 3PV7A 4J3SA 1ZA3A 1NDMB 1B0WA 1UM6L 2PXYC 2YPVH 1V3JA 4G42B 4ZFZA 2FBJL 1U8JB 4NJAH 2R29H 4WDIB 1YZZA 3A6CL 3EOYG 5GRUL 5HYIA 3RIAK 4XAKE 5ESAB 1RIVL 1T83C 3I3EA 3LZFH 4NZTL 5GGSY 1Z9MA 5I71C 4XWOD 2YRLA 2J12B 4R9HA 3WSQL 3AB0C 5AZ2H 1YEHH 15C8H 4OZHB 5EN2A 1UJ3B 4X6CB 4X6BA 2WP3T 1I8LA 3GHBH 4JHAL 3IKCB 3KPQA 2CDFA 2HFFA 5JR1H 4NN6C 4PJHB 1JPFB 1P84K 5I8EB 3DJ9A 4IMKC 1QBLL 5E5MB 4GG6B 1DQQA 4RBPK 1KYOJ 1KV3A 4Z7WF 5CEYB 1XGPA 1GIGH 4FQXA 3FO2B 1FFPA 1DR9A 2FJGB 1KJMA 3MRJA 5DD1H 2WBJB 5IJKC 1EEYB 5HI3C 2AAVA 2V7HB 1CR9H 4BJLA 2GJ6E 4G9FD 2R0WH 4KDVA 3DXAD 1TTFA 4Y19D 3B2UC 3OKKB 2RIKA 5D96B 5JDJA 3BQUB 1WFTA 1JGLH 4YC2B 4ZS6C 4OJFH 1MFEL 2EDBA 4Z0BL 3OL2A 4HK3J 4XGZB 3B2VH 4J7RA 3ARGB 2X10A 3ZKQD 4WENB 1DVFB 3D1MC 3DTXB 1FNSL 2W60B 1NKRA 4FFYL 2R4RL 2CD0A 4CDGC 4PLJD 4OLYH 1ORQB 4M62L 3N9GL 2V2TA 3P9MA 3D9AL 1MCOH 5IGXH 2ZSVA 4PRBB 1HK6A 5AYUH 1NCUA 3HI1B 4GXUM 1TZGH 2FX9L 3FRUA 1D5ZA 4L8SC 3CDCA 3PIQA 1AXTL 4EQ3A 4WCYL 4CL7A 2IAMC 2VLKA 5LAXA 4GRLC 3ARYA 1GL4B 1A6UL 4ODTH 4WW1A 3X17A 1C5CH 1N4XL 5J1TC 2WWMC 1FN4B 1GH7A 4Z78B 3TP4A 4HV8B 5KAQG 3BT2L 5JOPE 1WAAA 1AY1H 5B3JF 3QYCA 4MCZB 5L88L 1S9VB 2I60L 1RZ7L 3P2TA 3LKSA 4QRPB 1I1RA 4BSJA 3QAZB 2Q3AA 5CEZL 2O61B 1DBAH 5FYLH 3MRFB 3RUGF 4M9OA 3U4EB 3DV4A 1BLNA 5HHME 1IKFL 4RFNB 4KTDL 1EX0A 3ZMRA 2IGFL 5F7NC 3DMMB 3STLB 4XX1E 5H37G 5HYJD 4JM2B 3W5MA 2R56H 1WBZA 5CP3A 3KYKH 2BVQB 1K5NA 1VADB 3UTTE 1BVKB 1N3NB 4JFPB 4QEGA 4OFDA 3RX5A 3MJ7B 4PRIB 5ANMA 1D5XB 1ORSA 1ACYL 5ERWB 1HH9A 5M95B 5E5UB 2CQVA 2YUZA 1RZJL 4UAOB 1MCLA 1SYSB 1L6XA 4NKMB 4PGDB 3B9EA 4M03A 3KPLB 1MVFA 4U0QB 5BOZG 2J6EA 1OLLA 1HKLL 3LRSA 5DRWA 4PJAB 5ICYA 3BXNA 1A7BA 3NA9H 1U8LB 4UT9H 4NGHL 4P0DA 4OB5L 5HHVH 3PGCA 4YNYB 4Q9QH 3NCBB 2CDGA 2ZUTA 2OK0L 4XPHL 2X4QA 5EOQH 5L6YH 1J86A 3L7FB 1G7LB 1P5VA 4NKOA 2WWKT 5HD8D 1NAMB 2L0DA 1EXUA 2CSPA 3BKYL 3L9RA 3TVMA 1IZKA 1V3KA 5IVXE 3S35H 3HPLB 1RIUH 3QUXC 4I3GA 4L4TB 4WUUE 5DGQA 3WL9B 4P5KB 3OQ3B 3HZMA 1UCBH 2NY3D 1HI6A 4ZODA 2H3NA 2AK4E 1D9KD 4C56E 1A7OL 3MA7B 2X44D 3SBWC 5F7MC 3CFIC 3GSXB 4YHIB 5HHOA 1A47A 4X9BA 1FO0A 2E7MA 4MJID 3C6LB 4HHAA 3O3EB 1JE6A 4AL8H 2EYRB 5CGYD 4CNIA 3CUPB 5F44A 1KYOK 4DKDC 1EAPA 1OGTB 4HJJH 4H1LB 2VAAA 3T0VA 5T1KD 5FKPA 3SJVD 4PJIE 4ZFOA 3D0VB 1EERB 4N0CC 2J5LB 3FCTB 2ID5A 2NY6D 3MGTB 4P2QE 3O2WL 4PV8B 2DM4A 4LEXH 2AW2A 2C3WA 4PJGE 1OD9A 5CIPB 4H20H 1HIML 4HIJA 3PWPD 1CK0L 2G75B 1ZLWH 4OI9A 4Z7VF 3EW3B 4HFUH 3VJ6A 2DI8A 1LMKA 5FYJD 1D6VH 4UQ3B 3MCG1 3GSNA 4CBPA 4XC3H 3LIZL 3SKNB 2BNUB 4AENB 1ACZA 2VDML 2HJFB 4I3SH 2BVYA 1U58A 2DICA 4FQLH 1FL3B 1BAFL 3CMGA 2C4XA 4UBDC 4HUMB 5J9PA 3ULVF 3QH3A 4KROD 1CBVL 4XXDA 3L7EB 5FYKH 1Q9LA 1KCGC 1RZKC 2XWJB 2F15A 2VE6B 1M7DA 4CADA 5J0BA 1KELL 5D6DA 2VDLH 3O3BB 1QFWI 1QG3A 4LCYB 5HGHB 3P30L 4GG8A 4Y4FC 3BZDA 1EMTH 4U05A 4DEPC 2OL3L 1NCCH 5DMKB 1ZGLM 3QNZB 1LD9A 5C8JB 5JXAL 1XR8A 1WEJL 1KPVA 4ZO9A 2VXTH 4NCC1 4MB3A 5DUML 2EDFA 2LABA 2EH7L 3O9WB 4U1NA 4Y0GA 1U3HA 5DHVH 4HZLB 3FONB 2DKUA 1NMAL 3GMOA 4RRPA 1I8LC 1BBJB 3NFSH 2AQ2A 3ZO0A 3LRHA 2X09A 5ACZB 3GUTB 1BX2B 1MRFL 4JRXD 3T0EB 3VFTA 3F7VB 1EZVX 1HH6A 3CDFA 4LAJH 5ALBH 5T33H 2FIKB 1FAIL 3AU1A 3QHFH 3R1GH 3CDYA 4FQXC 3GJFK 1JHLL 4Z0XA 1R0AH 2FYYA 1UZ8A 1HQ4B 4AH2A 3PWLB 5BRZD 1PKQE 4LGPB 2B1HL 4J3VA 4WHCA 2EDXA 3MLRL 1FCGA 4K7PX 4WFHD 3MLSL 1DSFH 3C08H 4GQPH 3S7GA 1S5HB 3LB6C 4JAMA 1JGDB 3QIWD 3QUYC 4LLWA 2ADGA 1HSAA 2APVA 1JPSH 5L8JB 4LLDB 1T0MB 5DWUH 3UDWA 4LQFL 3TBTA 5HHQB 3U4BL 1S9WB 1YPZF 4BM7A 1Q9OA 4TSAH 1FZKA 1PEWA 1Z0NA 4ELMA 2D9QB 3OJMB 5GGQL 2C4FT 5D2LB 1EFXA 1WFOA 3IXTA 4U6VH 1J0YA 3I6GB 5AEAA 4HK3N 4RMVA 5KSBA 4ZD3H 3U7WH 2HJLA 2XTLA 2ZUUA 4XNYH 3SGJA 4XNUL 2Z9TA 4E41E 4FFEX 4OKVB 3W0WE 2CLRB 1J1PL 3GJFA 3V6OE 3WIHA 4Y7MA 3QA3A 2YEZA 3V5HA 2F74B 4JFDA 1NEZG 5GGTH 4U3HA 3RBGA 4JZJB 1UB5B 4OLWH 4JO4H 4G6AD 4KY1L 1CD1B 2PCPA 1J10A 4M1CD 2YA0A 3HNTL 1F6FB 1OHQA 2Z8VC 3LHPL 4RGND 2IH3B 4KH2A 5I30L 3TBVA 5JMRA 1KGCE 1VPOL 4JEGB 1PBYA 5CINL 4JN2A 3ARUA 3DVNA 4FFWD 3L5WA 4RGOL 4NO0D 5GGRB 4OIAA 2E27L 5JUEH 5FV1L 1ZHKB 4MS8D 4ONFL 4X99A 3RIFF 4F7MA 1EBPA 1NSNH 4XNXH 1JGUH 4R26H 4XVTH 1CCZA 2R15A 2AJSH 2DMKA 5J1AA 5ISZE 1T1XB 5IOPB 1I7RB 2MPAH 5IHLB 5JHDD 12E8L 5DJ2A 4OSUH 3S97C 5HPMB 1HSBA 4WNQA 4KTEH 3TT3H 1MOEA 3ZDXF 3PDOA 1B2WH 5ETUA 4QWWC 3GRWL 4XHJC 3QEQB 3U4AA 5BV7H 3W39B 4P2OB 4PP1C 2H32B 1F8TH 1T3FB 1UWEL 4YH6A 5C6TL 2P5WB 4UDUA 3B9DA 5HDQH 5IW1A 1WZ1L 4UUJB 4MDJA 2DM2A 2C7UA 3E2HB 2VXQL 4PRNA 3P9LB 3S5LA 3Q2CA 2P5EE 5IK3B 1YN7B 1GZQA 2JJWA 4Q9BA 3N1GC 3IDMA 3BHBA 3VXRA 2C3HA 1SMOA 4Y4HD 5KOVC 2R0ZL 2F53A 5E70A 2VQ1A 4Z7NE 3M17A 1MCHA 4M8QB 4N5ED 1E4KC 3MA9L 5F1KC 3EOAA 4CKVX 3RP1A 3MLVH 3WYRA 3J7HA 2J4WH 1JPTL 1ND0A 3HRZB 1S7SB 4YHMH 4R90L 3T2PA 4YQXL 3OKDB 5LGHH 2FECL 2P45B 3G6JB 4QHMB 2YZ1A 3L3GA 1KJ2L 4XI5C 5AYQA 3MRRA 3O6FD 2J3SA 3SDDA 2R39A 2UZIL 3KLSA 5SWSB 1QO3B 3BEVB 3LKQA 4X6DE 1RPQA 4P4KB 3TZVD 1JNJA 4DAGL 4YWGL 5T1LB 1K85A 1KACB 3EOTH 1A6PA 2CIKA 2Y06H 1PEZA 5E8EA 5FYKU 5KJRL 4YXKH 2HVJB 4WW2A 4QRSA 5GRWA 5C07D 4P5MA 5I16A 1J18A 4NPYB 1XGYL 2DL9A 5DJAB 1FV1B 3HFML 4X4ME 3QZWA 3BH8A 4OFYD 1ADQA 3OJ2C 4QOKE 2ATPA 4Y5YC 3FTGB 1QLEL 5L0QC 4GAGH 3WUWA 1AO7A 3QBTB 3EZJB 4XP6L 4JZOA 1FYTD 2PNDA 4DGVH 5HYSA 1MVUB 3VXOA 4LKCB 2CJUH 4G80A 5F21B 2ZCKH 5DJDA 3QFDB 3KLDA 2CRYA 1H0DB 3TJHA 3AAZB 1N6QH 5JXEA 3L5HA 4QRUA 4DZBB 5D6DC 3BP7A 1U2CA 1C1EH 1W0YT 2IBGA 3BDXA 3U82B 3NIGE 4GRWB 3WHE1 3BRDA 3EDDA 1GC1H 5EDXA 3VXUD 5SWZA 2HFEA 1IVLA 4HUUB 1XCQA 4KQ3H 3DGGA 5ILTH 3FN9A 3MV7B 4O5LH 3GSVB 2AGJH 3BKJL 3MRPB 2CLZA 3ZT7A 3MV9B 1U3HC 5HI5D 4N0RA 4JM4H 3BWUC 5C0AA 1ZLWK 3CCHA 1KLUA 1X6NA 2DIAA 1RJLA 5KSAA 2A77L 4TUJB 4LOUC 2ILLA 4V1DB 3WDHA 5GRYA 4UT6L 3T65A 4M7LT 3NN8A 1WIPA 4X5XA 4OLUL 4M93C 5DJ8B 4I13B 3N85L 1GGCL 4EI5B 2VN4A 5IMKB 2H26A 4ZAKB 4OZ4A 2VL5A 4WU5A 5C0CD 3LKOA 4MCYA 3ZL4L 4Y4KD 5HI4D 2D3VA 4Q9CA 3C6SA 1FDLL 4NFCA 4ZS7H 4I4WB 5C08E 1J11A 2Z91A 1CL7I 4NQSB 4WGVB 4I9WD 4MA3B 4TNWF 5EOCL 4U1LA 1XIWA 3QXVA 3U46B 4D9LH 1A1MA 1F90L 3OG6B 1RHHB 3DO7A 2P24B 1N2RB 3IJYB 3HR5B 1FNFA 3HE6B 4CMMA 4DKEL 1JK8A 4QXUL 1A6WL 1ITCA 2FL5B 2ICWA 3CFCH 1LHZA 4P2RA 5DTFB 3GBMH 3UO1L 2O5XL 1T80A 1WFNA 4MNHB 1RK1A 4Y5VC 4TUKL 4LHUG 3VMPA 3MBEA 3SGJC 4N90D 4ELKA 1UXSB 2C4FU 3DX7A 2WNGA 4M6OH 4FS0A 4M6NL 3RWJB 4LPWA 5D8JH 2Q3ZA 5BVJA 3TV3L 3A6OA 2Z92B 1CDIA 4U7KA 2EKSB 2V2WA 4PRPB 3EJYC 5MENB 5I1JL 5CJOL 3P4MB 1MCQA 3QP3A 5GS0D 2XNAA 2SEBB 1NLDH 4YBLB 1MJJA 2ZCLH 1ONQA 5F3HA 5AUMA 1JUFA 3BQUD 1NGQL 4JFED 1F4WH 3TA3B 1MLBB 3O0RH 1K2DA 3SDCC 3UTQB 4IOIA 1CE6B 1DVFD 1AI1H 2VDRH 4B7LA 3KNBA 1YEEL 1PD6A 4D0CB 5E8PB 1MQKL 3W11D 3GKZA 3QXTA 1BFOB 1AD0A 4PJCF 4LSQH 1IAKB 3RJDA 2NYYD 3LV3B 4PJ7E 5ELIA 5IV2B 4W6XB 1E4WL 1I1FB 1RJZB 4K8RH 4G43B 4BFIB 1D3CA 1WGOA 4A2LA 1ZANH 2LTQB 1R3KB 5LGJA 3FAXA 5E4EB 3IDNB 2UY7A 3FRPA 4OZGE 1A4KA 2BOCB 4GKSB 4NNPL 4R4NC 3GI9H 3S34H 3K80A 5JA8B 1I3GH 4GW4B 3NACL 4GKNB 4OUUB 3W9DB 4OV5B 2HLAA 2QL1A 4WJ5A 1A21A 1OGAB 1FZJB 3MOAH 1R5VA 1T5WA 4KUZL 3SDXF 3JV6A 2F54E 2A2QT 5I1GL 5DHXB 2XTJD 4G6JH 1YJDL 2EEDA 2GW5A 5DJYA 4JDZA 2BRRL 1KIPA 3E8UH 3LEVL 1ZEAH 4IRZL 2BNRA 2MQ3A 1S9KC 1B6DA 3DMMD 4IRSA 1IBGH 3DSFL 1MNUL 5EIVA 3BI9X 3U0TA 2AXGB 3IT8D 4Y1AB 1BBDH 2AXFB 4IJ3B 1W2KT 5IG7A 4O58L 4PRID 5KW9H 4WFGE 2P8MB 5FK9A 4NKIH 3U2SB 2XN9A 4HXAL 4HQQL 3FB8B 5CBAA 3SCMB 3TFKA 4R96B 1A7QH 3MYZA 4X6EA 1SJXA 2EIBA 4LGSB 5FYJH 5LQBL 5GGTA 2VTFA 3U7YH 4L4VD 3HS0A 3CK0L 5D7JB 2Z4QB 4JFQB 3JXAA 1YN6A 2VH5L 3MRCA 1NGXA 1U8NB 3GMQA 3SDDC 2AV7A 1I75A 1TPXB 5E1AB 5IBUG 1LO3L 3MOBL 3VW3H 1IILE 4G6ML 5D1XA 3RVWC 4HEPG 4F8TA 4C58B 5F7DB 3ARXA 5DD6A 3G6DH 3IFOB 3R4DA 3MACH 4OAWB 4EJ1C 4WW2C 1FBIL 4TRPL 3B8YA 3O81A 4ESKA 2IQAB 4QF1A 1VFAB 1KTDA 2VLLB 2IH1A 2UYLA 5CSZA 1BFVL 2ZKHH 1EEZB 4Q2ZB 1BOGB 3PABB 2ZPKH 3C6LD 3ISWA 3O2VH 5MI0C 1EJ6A 1LP9A 2D03L 5KVDH 4YO0B 4MVBD 3WBDA 1HXYA 1KENH 5D7LB 5C0BA 1EHNA 2PW1A 3WO4B 1WCBB 2HWZH 5FHAL 5D7IA 3TJHC 4UDTA 1MELA 1S8DA 3C09C 3SO3B 4MZ2A 1Y6MR 5D5ME 4JVWA 4FTVD 5B3JE 2OS7A 4DUVA 3UYRL 3CSPA 1HHKA 2OXHA 4NRZB 1T20B 3PL6A 2VZ3A 3MMEB 1NGWB 1JVKA 3ILQD 2VDOH 5I1HH 1ETZA 5E7FA 1W72H 3RUGE 1LO2L 3MO1A 2DOCA 5JW3H 1RZKL 2CUHA 1UM5H 1G6RL 2YWYA 2X42A 3U0WL 5ICXB 5KSAC 4HLJA 2XXMB 5CZVL 5F7UA 4WO4D 3BO8A 2UWEF 4KDTA 2IPTL 2NZ9D 4N9GA 3AFLA 3WO3B 2W0FB 4MA7H 3KYMB 3BSZL 3UBXB 1YYMH 1NC4A 4E5XA 2J8UA 1MY5A 4HF5H 4P2CG 4F33A 4G6KL 5DS8A 1BMGA 5CILL 5C7XH 4ODXA 1OT1A 3T4AA 2R69L 3T04D 1F4AA 4XPAH 1YMMA 5IW6B 2EDKA 4AIXA 1XGUA 1AQKL 1PZUB 2XKUA 5KSVA 4ZXBA 1XIWC 35C8L 2XA8L 3I75A 4CN6A 1KPUA 3V4VH 2HYMA 4OQTL 2IJ0C 1CICB 2XZCH 4K3EL 5GRJH 3TNMA 1RAMA 1MJ8L 4UINH 4G7YL 1OSPH 2B0SL 3PNWB 1WLHA 3JV4B 1J88A 5C92A 1F5WA 2BCKA 2WV3A 3QEGL 3ARSA 1IM9B 3QIBB 3BGMB 1IT9L 4KTYA 4ZO7A 4PFEA 2NY2C 1RUMH 5D2NC 1N7MH 4RX4D 1T0NB 2FX8L 1BZ9A 1X5HA 3DVGA 3NZHL 3RDTB 5SX4H 4EUPH 4JRYE 5IWLC 4LCUA 3CMOH 2KQMA 1A2YA 4RGMB 1AGEA 3QPQD 4ZYKB 1GZPB 4J3UA 2XQYG 3QPXL 4M5YH 3KHOA 5F9WB 5DD5H 3QDJD 2X4PA 4WI9A 2DQHH 1LEKA 5IEKA 3BN3B 2BVPA 2FB4L 4JFFB 1JHKL 4K3JL 4OQ1A 3I3DA 4WEUD 5DUPH 4ZPTB 3LEYH 1KEGL 4Y2OA 2FR4B 4EN3C 1N0XH 5HGBA 4OZFG 1QZ1A 1S7TA 2BY1A 3IDYC 4ZO8A 4HMEA 2VXUH 4H88L 3RL2B 1HXMB 4O2CB 4HBCL 2VL4A 3KXFD 4Z7VE 1O0VA 4Y19A 2Q7NA 1MFCH 3IDGA 4XBGB 5E24E 3MUZ1 4P5TD 1QLFA 2GSGA 1IAIH 3KPRE 5I8OL 3OKMB 3ME0A 3I02A 3TJEL 1ZV5A 2BX5A 4MHHI 4WVRA 1KNOB 2YZ8A 1YEKL 2WIMA 1BD2D 3OXSA 4IRJD 4K71C 1Z9LA 4O9HL 1GOFA 5J57B 2ZUQC 3WJJA 4LLYB 1G7QB 4DVRH 1J8HE 1RIHH 3TPUA 2NLJA 5IFHH 2MQ0A 4YE4L 4JKPH 5I8CA 2NY1D 2IANE 3BKCH 3GK8L 1OP5H 3ULVE 3WNLA 4KZEH 4H25B 4J12A 1SJHB 3NZ8A 3B9KA 3P40A 4O4YL 4ZUTA 2VLRB 4KJWC 3QB7C 1H8OA 1SY6H 4N0YL 2AI0H 1G7HB 5EFIA 5I15H 3L3HA 1AFVL 3PWVA 3U30C 3GMRA 2P48B 5L9DH 2DIBA 4LSPL 3KLAA 4HLZH 1P9MC 2EYSB 4F7PB 5IBLD 1FGVL 5HVHB 1WZKA 1NBVL 1H3PH 3ABZA 1SJEA 1BQHG 3G04A 1KXQE 4IRSC 4U1JA 3EFDH 3KR3H 3VE0A 5CEZD 5ENWA 3QDME 3VFSB 3C60C 5KVFL 2EIEA 4AQOA 4LF3A 4L8BB 4WHTB 4APQB 2VJXA 5I1IH 4EKXA 2BC4B 3RWDB 3D85D 2VISA 1F4YL 3BPLC 3KPSE 4I5BA 5HYJA 2BSTB 3P73A 5C0DA 2V7NA 2VN7A 3MBXL 3TYFA 3QEQD 4PJDB 1KB5H 1MJ7H 2PO6B 4KMQA 4JPWL 2H2PD 4RQQB 3BD4A 5LCVL 5GXBB 4LASH 2PTTA 4YHOL 4WIQA 1FVEB 1TZHB 4NFDA 5I2IB 5DEGA 4ZUSA 4IM8A 4XNZB 3E1F1 4XPBL 5D7KD 3O4LE 4GMTH 3IDUA 5H94B 5HTSA 1R5WB 3IU4H 1I9IL 1H5BA 4RFEB 1IGYA 2A6IB 1SYVA 3QO1A 4LLUA 2BOBB 5KSBE 3QCUH 1T66C 1YPZE 1RUKL 3H9SB 2NW2A 1RUAH 1U6AL 3MUY1 1VB9A 5BMFL 2VUYA 4OD3H 5BCAA 3RWHB 3CFBB 4RDQF 3B6SA 1MCSA 1ITBB 2QSTA 4NM8L 2X4UB 4U6TA 5DK0A 2AP2A 4P57B 1XF4A 4KPHL 3K4ZA 2DQFA 5HHPB 3V6FB 1RZ8B 3ROOA 4JVUA 1D9KA 2GJ6D 3BRFA 5BV7C 1U95B 4HH8A 2AJ3B 2GFBA 2H2SD 4D8PA 4MJIA 3O8XC 3KPOB 1NL0H 3PWNB 1U8MB 3CSYA 2FLBT 4NNYB 5T1LD 3VXSB 5IVNA 1NGYA 4G8IB 4C55A 4DGYL 4OUOA 1HEZA 5EZLB 3PL6C 1KCLA 4ODVH 4XVUC 1RVFL 1IFHL 4MD4B 2FO4A 1CFQA 4NUJA 3EYVB 4PIRF 5EO0A 4KJQC 3SJVA 2WUBL 2ZOLA 5INDB 5TGBA 3U36A 5KVGH 3H7LA 5IHUH 3FHAA 3PWPA 1MHEB 3ULVL 4PJ8D 1WAAF 3VGFA 2RCSL 3DETC 4JQIH 1EJOL 2DQUL 3S96B 4NQCE 3MRGA 1G6RB 2HKHL 5INCA 3CVIH 2A83A 4WFFD 1IC5L 3OAUH 5K9KA 1G9MH 1GGIH 2IPKB 5JOPD 4OCWH 1ZT4A 4NO2A 1UWGL 5D72H 4MQSB 1ED3A 5F1IA 3MLUL 2DL2A 2FIRT 4JFZH 4FQJL 1BPVA 3QHZL 3HHRB 4MA1B 4ZXBC 3BWAA 1DUZB 2DLEA 3B8SA 4ZSOE 1BVZA 2F53E 3T4YB 5HHMD 3CDGA 4RMQA 2BMKB 5IFAH 4XZUA 3TO4D 5GS0H 5C09E 5A3ID 1GRWA 4NZUH 1DDHA 3MV9D 2NXYC 2BVEA 3EO0A 3L95A 2J2ZA 5KTEL 1MCNA 5IMLA 1DBBL 3EJJX 4V1DD 1KN2L 2Z8SA 3WNNA 1J7VR 1S7XA 5FGBC 2HLFC 4IIQA 5J11B 2BSRA 1PAMA 3HZYA 4LSTH 2ITDB 4L3EE 4HIIA 5C0EA 4XXCA 2MNUA 1AQDB 4Z7WB 3FQUA 1D5MB 5EO9A 3RWGB 4BZYA 2Q8AH 5BVPL 2YPKA 4KJYA 4TVPE 5IQ7H 4JRXA 5CGTA 3QEUA 5CCKH 5FYLE 5TH2B 1LO4H 4LLVB 2E7LA 2YMXH 1XAUA 4YR6B 2R1YB 4LCIL 2ICCA 2RR3A 1LK2B 2DKMA 1LILA 5BRZA 5K9JH 1NCAH 3GIZH 3WE6B 1U91A 3HE6D 3VFOA 3C8KA 2YD1A 4LLMA 5HGDA 5FECA 1GAFL 3I2CL 1S7RB 1W72A 3ZDYF 3QIWA 3QCVL 2GY5A 2AEQH 1QR1B 5IQ9B 3X13A 2Z93B 1AO7E 5IROA 4C56D 3VH8B 1JWSA 3CFDA 4BFBD 5C9JB 2YPVL 4NP4L 3GEWB 4TNVK 1XGQA 4LP4A 4UIMA 5C2BL 2R29L 2YD6A 4HIXH 4HX1B 1YEDB 4JJ5B 4G8FA 1TENA 3V7AE 2EDLA 3LZFL 2QADD 3OF6D 3HNSH 4HPYL 3TN0B 3FT3A 4WI2A 4GUPB 4JJHA 1JZ5A 1H3GA 3V5DA 5CWSA 3W2DH 1KXVC 2YD3A 1A1OB 5SWZE 3GHBL 3VFRB 2UZXB 3QWRD 4S0SD 5BS0B 7FABH 4M1GL 3NH7H 3ELAT 4BH7B 3DVIA 5C0AE 5HPOA 3RZCC 4NKDA 4PJ5A 5C71A 1YEJH 4LPXA 4F9LA 2FH6A 5DD1L 1OP3H 4ZDHB 5I6XC 4KKLD 2BDNL 2EDJA 1OF2B 1E4XH 3MREA 4MNGB 4S1QL 3HC4L 4ZOAA 4JFHD 5T5NF 3U83A 4NO0A 4NQDE 3SDAC 3M1BB 2GK0A 4N9OB 1KUMA 1FQ9C 2WIIB 5C0FB 4MS8A 1U8PA 1S7WB 4EUPA 2H9GA 2ZNXA 4M6MH 3GIVB 4YGVB 3QJFA 1CGYA 3O41B 4JKLA 1FH5H 4JREC 1DQLL 1MWAH 1OGAD 4DOHE 5EIIA 4DWHA 2X7LA 5JHDA 4I18A 1HHGB 2BVOB 1MCOL 4N1EA 1ZA6B 1OB1B 3L6FA 2E7CA 3L3DA 3X3FH 5AYUL 3W5NA 2V2XA 4HXBH 2C1PA 4F37F 1S3KL 1TZGL 2F8VA 4P2RE 1YUHB 5DD0L 1H5BC 3OKLB 2M8XA 3RWIA 2E9BA 4CJ1A 2R0LH 3LPGA 3UTSB 4K7PH 4ODTL 5D2NE 4F3FA 1G84A 4TSBL 1QBMH 3MZTA 1EUUA 3ARRA 5EBMA 2YKLH 5LKNA 1NCWH 5EZIL 4FFZL 4UB0H 4JG0L 5CIPH 3FO0H 3OGOE 3TWCL 3SO5A 5EU4B 3LEXB 3SE9L 1WZLA 4K8RC 5C0IA 4G8EB 1UFUA 4TVPL 4CAGA 5I73B 1EVUA 3MR9A 4OFIA 2OCFD 5FYKE 5J6HA 4R7NB 4Y4HA 1DBAL 4U3XA 5FYLL 1RURH 3C9NB 2HFGH 4IS6B 4F9PA 4N5EA 1Y18A 2A6DB 4B0MM 5DUBA 4ELMF 4OGAD 3QXAA 4PJXA 4MQ7B 3UZVB 5EU5B 3QWOA 4DKFH 3CLEH 3OKYA 4ALAL 3VA6A 2RQ8A 1U0QA 1RFDL 2F19L 3GHEH 3P3YA 1QLRB 5CGYC 1QNZL 4TSCL 4LCCA 3V6ZA 4POUB 1FFOA 4W6YB 3UJTL 2EDWA 3O6FA 1TETH 2RFXB 3ULUH 1R3HB 2OTUA 4EZMA 4JDVA 4YDIH 5E6IB 1FC1A 4ZNEA 3TZVA 4ODSH 4UT9L 4E41D 4PJCE 3H9HB 3W0WD 1UM6H 4AG4L 1INDL 5T3XD 5C6PB 2FBJH 4O2FB 1S78D 1U8QA 3A6CH 4H0IA 4H5SB 5GRUH 2W9DH 1RIVH 4PLKD 5EOQL 3BE1L 1MPAH 4NZTH 2DS4A 5D7LD 4BZ2H 5LBSL 5C07A 3T0DA 2FZ3B 5EZOH 3T77A 1JPGA 3WSQH 2H45A 2X1PA 4JY5L 1KB5A 5DFVC 2KPNA 4G8GB 3S35L