4PRAA

Crystal structure of a hla-b*35:01-hpvg-q5
Total Genus 76
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
76
sequence length
276
structure length
276
Chain Sequence
b'GSHSMRYFYTAMSRPGRGEPRFIAVGYVDDTQFVRFDSDAASPRTEPRAPWIEQEGPEYWDRNTQIFKTNTQTYRESLRNLRGYYNQSEAGSHIIQRMYGCDLGPDGRLLRGHDQSAYDGKDYIALNEDLSSWTAADTAAQITQRKWEAARVAEQLRAYLEGLCVEWLRRYLENGKETLQRADPPKTHVTHHPVSDHEATLRCWALGFYPAEITLTWQRDGEDQTQDTELVETRPAGDRTFQKWAAVVVPSGEEQRYTCHVQHEGLPKPLTLRWEP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords MHC class I antigen
publication title A Molecular Basis for the Interplay between T Cells, Viral Mutants, and Human Leukocyte Antigen Micropolymorphism.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
total genus 76
structure length 276
sequence length 276
ec nomenclature
pdb deposition date 2014-03-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00129 MHC_I Class I Histocompatibility antigen, domains alpha 1 and 2
A PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4praA02
3.30.500.10 Alpha Beta 2-Layer Sandwich Murine Class I Major Histocompatibility Complex, H2-DB; Chain A, domain 1 MHC class I-like antigen recognition-like 4praA01
4LRNH 4ODTH 3OSKA 1E4KA 3BVNB 2BNUA 3HPLA 4PJCF 4MB5A 2H1PL 1KLGB 1N0LA 4MDIA 1I1AB 2PYEA 3CFKB 3QJFB 4N8PA 5DHYA 5IVOA 1RIVH 3BZFA 3ZKNC 5EO1A 3CC5B 3LZFH 1RJLB 2AJVH 4MXVE 3UCRA 2CLVA 3L6FB 2V9TA 4KHXL 4JQIH 1GGCH 3FTGB 4NP4H 4XVTL 4GW5B 4D9RD 5J06A 3FQRB 1OVZA 3M8OH 2UWEF 4L4JA 3MJ9H 3AC0A 4JPVH 2DYPB 1MAKA 4YX2L 2X40A 3G6AA 2R8SL 2X6MA 3SDCD 3FB8A 3KYNB 4MAYB 2G9HB 2YPLA 3NIGE 5EOCH 1GAFL 3ULSB 4U1GC 2Y1VA 2DMBA 4DVRH 4RX4A 1YA5A 2Y07L 4KMQA 4ZUTA 4FOMA 1S7UB 4K94L 1FVCB 4QWWD 4YBLC 5E8OA 1WUNT 2FD6H 2BDNH 1BJ8A 3IB4A 5E00B 3TZVA 4U6XA 3QXTA 4XCCH 4P5TA 2PR4L 1D9KB 3BRDA 2E3VA 1MJUL 1P53A 1EJOH 1J9CT 1S78D 3B4NA 1FNHA 3BSZL 2X4RB 1HSAB 4JHAL 4NJ9H 4WFEE 2HYMA 3MREB 1Q0XL 4DOHE 3MGTB 2GYSA 1P84J 1NFIB 4NKDA 3NFNB 1QRNE 2UUDH 4LRIC 4U0RC 2P8PA 4HIIB 5GGUA 4XP5L 1VFAA 1TVHA 4R4NC 2PCPA 1NKRA 1DE4B 5I71C 1MCOL 2XN9E 1NAKL 2F54E 2J7LA 2ZPKH 4PBWD 3KWWB 3B9KA 1N2RA 4I3RL 4ONHA 5I1GL 4OI8A 4Y2DA 4KU1A 5F70A 3M07A 3HR5B 3G08B 2YEZA 3MFFB 3BI9X 3U4BH 1FFNB 4PJIE 5CP7A 3S5LB 1HKLH 3OPZL 3PWUB 4RFOL 1F6AB 1T1WA 1ZK9A 4LMQI 4X6CF 1BIHA 3PDGA 4HXBH 3OF6A 4QRRD 4X4XB 1G9NL 1W72B 3DXAE 1MIML 5A40E 2V2TB 3VWKA 3I6LE 1WIUA 4PJEE 2H3NA 1BQUA 1A6PA 2IH1B 2VL5A 5IFHH 4PJHF 1R5VB 6FABL 1LO0H 2KKQA 2APFA 1WICA 5K9OA 3C8DA 4QRUA 4PJCA 4JY4A 2VDNH 1HHKA 4KUCF 4FFYH 1U8KA 3DVGB 4RNRA 3BH9B 3DX8A 2DM3A 3Q3GA 1A02N 4Z7WB 1FO0L 4I0KA 1INQA 1PX3A 3WNPA 5IB3A 3RKPA 3TA3C 1TJGH 4NT6B 1QLFB 2V2WA 4HMEA 4X9GA 3SDYL 3SDDC 4Z7UE 1TJIH 5KANG 1HHIA 1JBJA 1CE1H 4W4NA 2WBWB 5CGYC 3NFPB 3S5LG 1A6UL 1JPST 1XZ0A 3WLWC 3O6ML 3N0PB 5I75B 3QIBC 1ZHBA 4OGAC 1A0QH 4I0PC 5ICYA 4ODVL 2EKSA 5C8JB 1MFBH 3HZVB 5ACLA 4CVZA 1RVFH 1Q9WA 1T1ZA 1TZIB 3HPJB 2XWJA 3DNKA 3SO5A 1JPSH 1IT9H 2IBGA 4S0UC 3PL6C 5D6CA 1KG0B 3FJTA 5HI3D 1K85A 5I17B 1F5WA 4KK6C 5E6IB 3CVIH 4N0CC 1MCNA 5T1LA 3QUXD 1I3RB 2F8XC 2RCSH 2HT3C 3NZHH 4LCWB 4CMMA 2R0WL 4BSJA 4F3FB 4OT1L 4HIJB 1FNLA 1Q0YH 4PGDB 4YK4B 2PYEE 1F3DH 3IKKA 1MLBB 1XR8A 3DX9A 1ZLSL 3RHWK 2WIMA 4JG0H 4EI5C 4UDUB 1Q9OA 4ALAL 3KLHD 1GGBH 4PGEA 1RUPH 3IJHA 1I1RA 2DQFA 3STZB 5DJYA 4KRMB 4QHKI 3OKEA 4F7TA 4ODSH 4QNPF 1F4YL 4JHZA 1VA9A 3DX6A 1ZT7A 3QDMD 4NIKB 3W0WB 1H5BA 5KS9B 1S7RA 1HXYB 4U1MA 1VPOL 2JJSC 3WE6B 3HI1B 3SO3B 4GRLD 1OARH 5FGSA 4JM4L 3MOAH 5FO8A 4EN3D 1ZHNA 2YPLE 1TQBC 3X14A 5DK2B 1RUKL 4FZEH 3SJVB 3WIHH 4KJYA 2C3WA 3P40A 3MX0A 2W9EL 3LEXB 2E7LE 1CLCA 3OR6A 5I1CH 1QKZL 1VEPA 4OUUB 3LS4H 4X6CA 1PEWA 4LEOB 2FO4B 2B8OT 4DKDC 3WSQL 3VW3L 2L4OA 3GSXB 1BX2B 2HLFD 5IHZB 5CILL 4RGMB 4RAUA 4JM2B 4PJHA 3GSWA 3M1BA 3QUYB 5DT1H 1E28B 4HWZA 3DO7B 3LIZH 5L8KB 3V7MA 4ELKA 3ARFB 2GJZB 4JANB 4YHOL 1FAIH 2ZUQC 5F7KC 1EERB 4M4PA 4YDJB 5L0QC 5E2UL 4JPKL 4Q9QH 4F8TA 3MNWB 5DJ6B 5F7DB 1CXIA 2IQAB 5HHMA 5BXFB 2OL3H 5EO9A 2GTZA 4BSVB 3MOBH 5J9PB 4TOYH 5C07B 3DMMB 4POUB 2XIDA 3GBMH 2AEPH 2FX7H 2RB8A 2XA8L 1EK3A 3QDJB 4LAQH 3IDUA 3D18B 3DPBA 4Y4KD 4XX1E 5B21A 1I85C 3ZL4H 1LE5B 2ERJB 1LDSA 1RI8A 1BZ9A 1MCKA 2RHEA 1JPTH 2CDGA 1SYSA 2Q8BL 2R1WA 2DOCA 2Y7QA 1S5IL 4V3DB 3RZCD 1TPXB 2K7QA 5HDBE 1A1MA 1QQDA 4AT6A 5BV7L 1FE8H 3VXSB 2AJUH 3KJ4B 4XPBH 3WFHB 5C6WH 1X44A 4PJCE 3T0ED 2X4PB 4C83A 3WN5B 2XWBB 4ZDHB 4NO0A 4ISVA 1G9EA 1QHOA 1E0OB 2N7AA 4PY8I 1BQHB 3RZWA 5DD6B 2V7HA 1DP0A 4XRCA 3U82B 4IRJA 1JYXA 3U0PB 3ROLB 2QHRH 4NN7C 1M7DB 1IGCL 4PV8A 3U4AA 3SE8L 2UWEE 5FYKL 4QOKB 3C8KB 3KR3H 2BOCB 2JJWA 5E1HB 1A5FL 4NQSB 2YHGA 1IGIH 4F7CA 2O5YH 1FZMB 4L3AA 1KN4L 3BJLA 3L95A 4P23D 3BGFC 4GUPB 1W72H 2IANB 1SJEA 4NHCL 3BDYL 1UH2A 4YH6A 1N0XH 1OP3K 3O8XB 1FP5A 2Q7YA 3RDTB 1B88A 5JPMA 3R0MA 5EN2A 5F9WC 1OWWA 1JWSB 4XWGH 4APQD 3AY4C 1HSBB 4HBCH 3JBG7 2XFXA 4H0GA 4J23A 2RQ8A 1LP9F 1R3HA 3BAEH 3MLZL 4HGWA 1C5DA 2A74B 5F3BA 4BFBD 4YLQT 4RMRA 2P5ED 4N9OB 2VDRH 1I8IB 4L5FL 1NLBL 4PRDB 4DAGH 5BMFH 1JMZA 4WO4A 1IC4L 5FV1L 3Q48A 1BM3L 3ZDXE 1GGYA 1JGDB 3IETA 1W0VA 5D1ZD 1LK2A 5EBLB 3PGDB 4OIIH 3G9AB 2D03L 5I73B 3JV6A 1P69B 4XPGH 5CKAA 4LKXA 1B4JL 1R3IL 2Q7NA 4LU5L 3DVIA 5I8EA 1FNSH 3TT1H 3QA3A 4QXUL 1BHGA 1CLOH 5F93C 1JTOA 5F9OH 3FFDA 3GBNL 1NC4A 1M6OA 3DETD 5I9QB 5CEZE 2B0SL 3BE1L 5J6GB 5DGQA 4EDXB 1IFHL 4TVPL 2ZCHH 1RIHL 4L3CA 1P2CB 4PJ8B 1T7XA 2BSTB 5IM7B 3ESVF 1AGBA 5EG6C 4P2OA 3SKNA 4EXPX 1G7LB 3AREB 1X5FA 4TULH 3OXSB 4BZ1L 2QADB 2NXZC 3EOYG 5B3NA 4PJHE 1FRGL 3O9WC 4GJTB 4D0CB 4LHQB 3V7AG 4FFWC 1N4XH 1Y18B 3T2NL 1NLDL 3U7AA 3VU2A 5IB5A 1R3JA 1FYTB 2R23A 4NUJA 3MLTB 4XP4H 4N0CA 3ECBB 3N1GC 1NQBA 4P3DA 5IJKC 1NCTA 2HRPH 2JELH 2VXVL 1YJDL 2CIKB 1T1YA 1DEEA 1AD0B 3T09A 4LRNL 5HHME 1EFXD 1FIGH 4PB0L 1E4WH 5ESAB 3DX7A 4H1LB 1GOFA 4BFIB 3SE4C 3D25B 4XCYB 3MA7A 1FPTL 3LAFA 4CUCA 3MLSH 5KAQF 1RIVL 4IJ3C 5E8NB 4J2XA 4XBGB 1LDPH 2WBJC 2AJVL 3SN6N 3TH4T 4HT1H 2C1OA 4FHBD 4JQIL 3LN5A 1GGCL 3HS0A 4NP4L 2JJSA 2XKUA 3M8OL 5KN5A 2A0LC 4J3SA 4XP9L 3UJTH 4OLZH 4JPVL 3FO2A 1OAUH 1FNAA 5GGSA 5EC1A 5F7HA 1LD9B 3RWIA 2ZSVA 2AKRA 2LVCA 1LP9A 1R5IA 3VXRD 1KXVC 5GZOD 5FM5O 4Z7OF 4QHKJ 5IFJA 2MQ3A 3MV9A 4H1LG 2QBWA 1U8JB 2P24A 5E0QA 2DD8H 4O2CB 5HD8C 3VGBA 1SY6H 3IF1A 3UPRB 5DMGC 2FD6L 4P5KA 2HRLA 4L8BA 3D9AH 4A6YA 1EPFA 5CLWA 3HTLX 3RPIB 1IILE 2VZVA 4RMVA 4PBVC 3TBVB 3KLSA 4NJ9L 4NYLA 2BZDA 2VABB 3V6OE 3SDXF 3S3JA 3HKFA 5J11B 2IPUG 1G6VK 1Z0NA 5IIEB 2HVJA 4JVWA 4J3OC 1BJ1H 3D2UB 2ZPKL 3AMKA 2YZ1A 4K3GA 1BQSA 2ADGA 4MLSA 3FB5B 1U41A 3HG1D 3QHZH 2QSCL 3DGCR 4P5MA 1VFOA 4P59H 5DGRA 2GJ6D 1YY8B 4GW1A 5D2LA 1EIBA 4JZOA 4YDVA 5DF0A 35C8H 5EU3B 1FZJB 1HKLL 3HR6A 2XZAH 4LSQH 1UWEH 1PX4A 1Z3GH 5HGBA 4LARH 4M00A 1YN6A 5D1QC 4FFEX 4HXBL 4RQQB 1URLA 4C55A 4IHOA 3I85A 1U92B 4LPWA 3QJHA 2P42B 5TF1L 3QUMH 3V5HB 5IFHL 1LO0L 2GT9B 1HH6A 2N56A 2VDNL 2YN3A 3C5ZD 3MUZ1 3VD7A 1F4XH 1H3WM 4NQVB 2MKWA 4MD4A 4X7SH 3O11B 2NY3B 1LMKA 1S9WB 1LNUA 5DXWA 3RI5F 5B39A 5IB2B 5EO0A 1KFAH 1T20B 2FYYB 5KBNC 2AEIT 1F3JA 3O3UN 1HHGB 2Z31C 4WDIB 2ZOKA 1XGYH 3T1FA 2ZOLA 3WD5H 3P4MB 5EH1A 1ZS8A 3D39B 1U8PB 5TE6H 4C4KO 1A0QL 2ADIA 4PY8J 5ICXB 1AH1A 5IVXB 1MFBL 5IK3B 4A2MA 1V7NH 1T3FB 1VGEH 2DJ4A 3QT2A 1RVFL 4JRXA 4MA1B 4ZFZA 1KPUB 2QL1A 3F12A 3F5WA 1JPSL 1IT9L 3ELAT 3H9ZA 5IWLA 1DBBL 1NBVH 3MACH 1FLRH 1XGRA 1ZT4A 3AY4A 3CVIL 4CJ0A 4JFED 1A1NA 4Y7MA 4DCQA 4BSWB 3QQ9D 3WO4B 1DQMH 2FHCA 2RCSL 3NZHL 2MMXA 5F6IC 5DUBB 4PJGF 1AD9A 2QQKH 4H5SA 2W0KA 5E8EA 3S7GA 2UYLB 1Q0YL 1UENA 4XZUA 2X4NB 5CP3A 2BC4A 1T7ZA 2O26U 4XP6L 3V52H 5KSBA 4JG0L 3E1F1 3C6LC 3SDXA 4M7JH 4KRPB 2Z35B 1INDH 3DURB 1RUPL 1HH9B 3RWGB 2VQ1B 2DM4A 4MSWA 1T2XA 3I6KA 4ODSL 4ZXBC 5I8CB 4RFEB 5SWSD 2C7UA 1AXTH 2ZUSA 3JWOC 3BWAA 1FNEB 4U1JB 4HW6A 5DZNA 4WFFD 3BISA 4M3JA 1ZHLB 2CK0L 1IEAA 2V7NA 4KI1A 1OARL 3MPCA 1FORH 2FWOA 5MEOA 4M7LT 1LP9E 5GGRA 5I19H 3QXDB 3RWEA 4LOUC 2XKSA 3SE3C 1NBYA 5DFTA 3D0VA 2X4UA 2FATH 3BO8A 4FZEL 4G6AD 3WIHL 3MV9E 5L9DH 3MR9B 4F7EB 5DRNB 5ICZA 1MWAL 3F7VA 3BIBX 5KOVC 5LGHH 3H7LA 1CFTA 4NQEA 1A6VH 3VGAC 5EOTB 3OKOB 4LLMA 1CL7H 1U8IA 1CI5A 3MJ8B 2HLAB 3FO0L 5DT1L 4MD5A 3TBTB 1RK0A 2L0DA 3LIZL 2PTTA 3MZGB 3MCKB 4FQCL 2WANA 2A73B 1BWWA 1FAIL 3OKLA 2ICEA 4WY7L 2ZCLL 2K3TA 3EDEA 5D1XD 1WZKA 3O2VH 1H8NA 3KYKH 3STLB 2VZ3A 1VGKA 1J7VR 4NRXA 4AM0B 2OL3L 3MOBL 4L3EB 2G5BA 4TOYL 3GKWH 3QZWA 1YEEL 1BD2D 3V4PH 3RIFF 3VXTB 1KIPB 3C08H 5DRWA 4JR9H 2FX7L 4LAQL 1RZIA 3U4EB 1K4CB 4KKCC 1N6QH 1SBSH 1T04A 4NNPH 3TNNB 4U3HA 3ZT7A 2DLHA 4URTB 3ZL4L 4TQEH 4ONGL 1JPTL 4HS6B 2Z8SA 3I75B 3V0WH 2BCKA 5LXGH 1FE8L 3LKOA 4MQSB 5J1TC 2NY6D 2AJUL 1CT8A 4RWHA 3B2VH 1R3KB 2GSIA 4HK3J 3RBGA 4PJGA 5E8PB 4X7TA 4TSCH 1TTFA 4AMKH 1R5WA 5I30H 5DVNA 5SWZD 4WJ5A 3MRIA 43C9A 3D69A 4LSUL 3F7YA 4IBLT 4K8RD 4KROB 3VGFA 4RGNC 3OHXB 4YAQA 1G9NC 3VFMB 3DV6A 1ZGLM 2QHRL 3GM8A 3MMEA 5EIVA 4OZ4A 2XY1A 1TZHA 2EYSB 3KR3L 4P9MH 2A1WH 2CDFB 1G7QA 4BQ8A 3BPNC 3C9NA 3P9MB 4YDIH 4OQ1A 1AQKH 1IGIL 1S9XA 1YEGL 5GJTH 4BFGA 3DIFB 2O5YL 4G43A 1OP3H 2YD7A 4O2EA 1DQQA 4Z7OE 3OWEA 4P4KB 1AO7D 2EEDA 3UTSD 1CFNA 2FDBP 3UJIH 5T5NG 1QSEB 5F1SA 5EPMB 2APWA 1N0XL 3GSQA 4XI5D 4PRIB 3BP5A 4QRQA 4FQJH 1OGAB 5D7KE 4ODWB 4PRNB 4U0QB 4FTVB 3V5DB 2G2RA 3FO9A 5DHXB 1D5IH 3TJEH 4XCNA 3RY4A 5A2JH 4XWGL 4HBCL 1R3LB 4Y5YB 3N85H 1HXMB 5IB4A 3BAEL 5C0DA 4Z8FH 2FEDC 3FZUC 2VE6A 2VDRL 4DAGL 1MELA 2YUVA 5BMFL 2BK8A 3SDAB 3KXFD 3SDXE 4E9LA 2HMIC 2DN7A 5D1QA 3KPMA 5HI5C 1JNLL 2NY4D 3LQZA 1U58B 2Q86A 4OIIL 4PG2C 4O51B 3FQUB 4UTAH 3T0WA 4WNQA 1M7XA 5DWUH 3DO3A 3EOTH 3MJ7A 4XPGL 5BOPA 5F9JA 4E41D 3CFEA 2AVGA 3L5JA 5EORH 1FNSL 3TIEA 3GMLA 1U3YA 1OTSC 5GRVL 2AXGB 3S6CA 5KW9H 3QWRA 3TPUB 3IDNB 1MQ8A 3CLEL 4PJ9D 5AD0B 5DJAB 1F42A 5DJ0A 3LRSA 1CLOL 5C9JB 1AP2A 3BP6A 5KVDH 5F9OL 3NCCB 4KC3B 1BVLB 4YR6B 5EU5A 2AJYH 3GM0A 1N5AA 1ZXQA 3GMPA 4OLXH 5FYKU 4B53A 4HHAA 1JYNA 4POYA 5D70L 2IPKA 3D87B 3X17A 4YXHH 2EYTB 4HWBA 3WNLA 1J0ZA 4WHDA 5FA3B 4TULL 4FQPA 1U2HA 1W8NA 2R0KH 3CNKA 3L7EB 3EYOA 4BK4A 4TTGA 4U33A 4LHUG 3VCLB 3IFLH 1N4XL 5E4EC 2VQTA 1RZFH 4G9FA 1KCSL 1QO3B 3DUSA 4U1IB 5CLTA 1JPFA 3C5SA 5KSUA 1UCBL 4XP4L 3DHMA 5ECJE 2HG5A 2R2BA 4IRSC 2DWEA 2HRPL 1LO3L 2JELL 4HX1B 3O3AB 4N1HB 5K9KA 1JPGA 1YMMA 3IKCA 1FIGL 3RWJB 4F58H 5HHNB 5GGSY 3VH8B 3ULUF 32C2A 1QBLL 2F74B 3C6LA 1J1XH 4TSAH 4OM0H 3MLSL 2WBKA 5TE7L 1JZ7A 4D3CH 1QEWB 4N90E 1LDPL 2YK1H 1EJ6A 1JP5A 3NCJH 3VRJA 4ZXBA 4WV1B 2HFTA 2J8HA 1F2QA 4HT1L 4AQOA 5GRUH 1KB5B 3RY6C 4PRHA 1DSFH 3KPSE 5IQ9A 5J13B 4WWKA 3UJTL 5BS0D 4OLZL 2K7PA 1OAUL 2DQCH 3HUJF 4PJGE 3SE3A 4QY8A 3TH3T 1U0QA 5C0ND 4LLYA 2VAJA 4HCRL 3X13B 3KPRD 1SJVA 5E5MA 2X4QA 1NUDA 5BRZA 4L8SB 2F8VA 2DD8L 3OB0K 1SY6L 1AE6H 3O4LB 4NN5C 3NCFB 4OCXH 4GRWB 4RFNB 4LLDB 4QRTA 5I16A 4M43L 3V2AR 4NRZA 5MENA 5IHUH 1NDGB 3C60A 4MJ5A 5BV7C 5HHQB 4YBHA 3D9AL 3QDAA 3GJFA 5KSAD 1JWMA 4RWYL 4MNQA 3KYMA 1ADQH 1U93B 2GUOB 3EFFA 2JB6B 4LCIH 3CFCH 1MFCH 5C0CD 4JRYA 1U6AH 3JSSA 5MEQA 4HZAA 3TJHC 4OF7A 2FL5B 5C0AD 43CAA 1XGQB 5FAAA 5DJDB 2PTUA 5ESVB 4IMLA 1LGVA 4LCYA 1CBVH 5HDQL 3TVMA 4M5ZH 1RY7B 5F1KC 3BN9C 3B5HA 2JK5B 1FG2B 3T0XA 1DQJB 4OGZA 3QCTH 2ESVD 4IIQC 1H3PH 5CSGA 3QHZL 5HI4D 1VB9A 3VFNA 5HGHA 4BQCA 1JNJA 4PY7B 1CD9B 1RZ8A 4KJQC 1NANI 4P2RD 4HV8A 1ED3B 2HWZH 3DGGB 1OGTA 35C8L 4GXUN 4QRSB 4Y4FA 2J8UB 1BBJA 3HFMH 4XVUC 2HTLD 1BGXH 4JZNA 2XTJB 1E27A 2L7JA 2XZAL 4GLRH 4LSQL 3MLYH 1Z3GL 4Q2ZB 4LARL 4M8QA 1VFMA 3FAWA 1GZPA 1T21B 4R2GB 3WHE0 3GMNA 5FGBA 3QFJD 4AIZA 5CEXB 3QUML 2X4OB 4PREB 3WNMA 1XH3A 4U1HA 1UH3A 3UDWC 7CGTA 1CU4H 3WJJA 4JDZB 1F4XL 4TTDD 3NABH 4N0UA 3UBXB 4LDLB 5DHVB 5B4MD 2HFFA 2W59A 2YRPA 4X7SL 1C16A 4G7VH 5CHNB 5DLMH 5F1OB 5GSVB 4KKAD 5HHOA 3ZKXC 4B50A 2GSGA 1GOHA 1KF9B 4OQTL 1DUYB 2YD4A 3QH3B 4YDLB 4HMDA 3ZHLA 1AGDB 1XGYL 3WD5L 5T3ZE 2X4TA 4FFVD 3IU4L 5TE6L 5FF6B 1NFDB 1KTRL 3HUJA 2XACC 1FO0A 1HOCA 2D4FA 5LBSH 1V7NL 4G9FE 1NJ9A 2XA3A 2EIZA 5JNYB 3QAZC 4R8WH 4NZTH 3SGJA 1QSVA 4ZUSA 1UWXK 2IBZX 4LCCB 2W92A 4ETQB 3TF7A 1B2WH 1NBVL 1FLRL 1ZGLA 1KTDB 5TJWK 1CYGA 3UBXG 1QBMH 2OLDA 1YMME 3VMPA 3V4VL 2QQKL 3AFLA 4NQDA 5DRZB 5IFAH 5GGRY 1WC7B 1Q8MA 5DD3H 1VFUA 3RWHA 4PLKD 1X7QB 4M61A 3V52L 1X5LA 2KZ1B 3PWPE 3B9AA 2Z8RA 3V6FA 2Q3ZA 1IGTB 3LB6C 1XT5A 4M7JL 5FO9B 5HYQB 3L3DA 4JREB 3WS6C 3CX2A 3MLRH 2OQJB 1AXTL 5D5MF 4OF3A 5LG1A 4PRHE 1CG9A 1YJDC 4W4OC 4ZAKB 4GSDH 2VDMH 1PKQB 3B5GA 1FORL 1FSKC 1HDMB 3DVNA 5DVOA 3RNQA 5I19L 1MHEA 5HGAA 4RISH 4U7KA 5FYJD 5L9DL 4WUUB 3CSYB 4NQUA 5BRZE 2EH8H 5DK0B 1XGUB 4NZDA 3TBWB 4WFED 1SYVA 2ARJB 3FQWB 5D2NA 3LV3A 4WRLA 2VXTH 4D0BB 3RGVC 4M7LL 3RZCB 5LGHL 3S34L 3RRQA 3GSUA 15C8H 1IKNC 1QRND 3T77A 4OD2A 1AGCB 4DKFH 1UZ8B 3VXOB 3U2SB 1JCKA 4X0KA 4NNYB 2YKLL 5SV4A 1CL7L 1YPZF 2XN9D 2F54D 2ARWA 3GKZA 5JHDA 5D93B 1J8HB 5C09A 1W0WA 5FYJH 3ILPB 1LK3L 1DUZA 1KB5H 4WVRA 4Q9RH 2CUIA 4YGVB 1XF3B 1E6JH 4IS6A 5KVEH 3VFPB 4DW2H 1XR9A 1FFRA 1EH9A 4I18B 3VFSB 3EAKA 1QLRA 2P4AB 1I7TB 1L9MA 3O2VL 5F44A 3QCVL 3PDOB 1I1CA 1YNKH 2DQJH 1IAOA 5E9DB 3DXAD 3V4PL 2DIJA 2PO6B 3I6LD 4GAYB 5AAWA 3SDCC 3DRQA 1ZLWK 4JR9L 2DIAA 3LEVH 1N6QL 3INUH 3KPNA 4QXTB 1G0XA 5JW5A 3LH2H 4TQEL 4MCZB 5GIRB 2LTQB 3LY6A 1DQDH 3HLAB 3QG6B 1D6EB 4X4MA 2BHUA 3GGWB 3V0WL 1A6ZB 5LXGL 2WUBH 3BZ4A 5GRXG 4RZCA 1IM3B 2H32A 2ICWA 5DJ2B 3ULUE 1S78C 1J11A 2AK4B 2P5EB 4ZOEA 2MSPA 1LEGA 1TVDA 4N0UE 4AMKL 2Q76A 4CU7A 1FVDB 1I7UB 4LSSL 4X98A 3UMTA 3FQTA 1FFOB 4DN4H 5AYQA 5DMKA 1JHTB 4Z5RB 4M7ZC 5MEPB 1HCVA 3B3IB 4W6YB 3OZ9L 4EUPG 5D5MA 3PWVA 5C0GA 1P6FA 4ONFL 1SVCP 5IVZB 1RJCA 5HVHB 1PYWB 3HUJE 5L7XH 4NKQB 1FVEA 1AQKL 1HHHA 2EC8A 3KYOB 5GJTL 4QXGH 3IU3A 4H0IA 3A0OA 4HUXB 1FFPB 3AXLA 5HDLA 3UJIL 3TGXA 2PYED 3U9PH 3L3OA 4JFFA 5CBAB 4GRMA 3P4OB 1CDBA 3FMGH 4XXDB 3FFCB 3L5WA 4XTRC 1QR1B 1M71A 1MIEH 3GMQA 4NQDE 4F37K 2R2EA 3VFTA 4O02H 3RP1A 4Z8FL 3ARQA 4D9QE 3E2HC 1JIBA 1EO7A 2OJEB 1CGWA 3PV7A 5L2KA 3U48A 1U8MA 2F19L 1JGEB 2JIXA 3MRLA 5I1JH 2YPLD 5CD3B 4MJIE 3QDGE 3QIUC 2DQGH 2H8PB 2FIKB 2QJDA 3MRKA 5DWUL 2NTFB 3EOTL 1T66D 4RX4D 3F6LA 3IDJB 3SKOB 3HE6B 3UDWA 3HI6H 1LEIA 5EORL 1RSFA 4S1SH 3TZVD 2DM7A 4HKBA 1L8JA 3SCMD 2P8LB 1TCMA 4P5TD 2Z91A 5F89B 4P49A 3M17A 2XI9A 1NGXB 3WFDH 1T4KA 4RMSA 2AJYL 4FQ2H 4R3SB 4OLXL 5D2NE 5CD5D 3DROB 5HI3C 1AKJA 4N0FB 4OJFL 4YXHL 3U79A 3QUXC 4D9LH 3KHOA 1Y6NR 3MRJB 2R0KL 1S8DA 4OF6A 5ERWB 4K9EH 2YA0A 4J1UB 1FG9C 5JHDE 5F97E 3IFLL 5C09E 3V5KB 1HE7A 4U6VH 3B9KD 1RZ7H 4HWUA 1H0DB 5D7JB 4L1DA 1RZFL 1OSZB 1NGWA 3DSNA 3I3BA 3KLHC 4YHKH 4RMQA 3TNMA 3LN4B 4K3JL 2P43B 3TLRA 1ERNA 4NHUA 1X6NA 3MV11 4PGBB 5I1HL 1S7VA 4F58L 4LPVA 1R0AH 3PQYA 4GRLC 3BEVA 4M93B 1AC6A 2DQDH 4UT9L 3QXUA 1BOGB 3VWKD 2J5LC 4GW4A 4EN3C 1SJXA 1Z6JT 5AG9A 4PV9B 1J1XL 4G5ZL 4OM0L 1F4AA 4O2FB 1S7XB 4E42A 5FKAB 3REWA 2H2PD 3BGMA 3O0RL 3IXAB 1J86A 2YK1L 4K7PX 4NCDA 4KQ4L 3NCJL 2W60A 5TPWL 2OSLA 3BP4A 4W4OA 4X4ME 5GHWH 2BNQB 3FB6B 2EIEA 3BUTA 1Q9LA 1DSFL 1Q94B 1P1ZB 1UVQA 4J8RB 4XNMA 3PWNA 2EZ0D 3JTTB 4Z0XB 3NZ8A 5DRXB 2BVOB 4HK0A 3ARDD 1M05B 2FX8H 1GIGH 2DQHH 4P3CL 3TWCH 2X4SB 4WW2B 1P9MA 2YZ8A 3QDHA 2AGJH 5FK9A 4KUZH 4EQ3A 1AE6L 1IKNA 3LVEA 4OCXL 2IADA 1WBZA 3G5ZB 3MJ9A 3VXQA 1G1CA 5DA4A 4C58B 2R1YB 5I8KH 3HZKA 3ARXA 1FL6A 2EE3A 4ZSOA 2G75B 1CN4A 1LO4L 1ADQL 2GK2A 5T1LD 3MLPA 1JK8B 2VLRB 4LCIL 1MFCL 4U1SB 3UC0H 1M7IB 1XGPA 2A6DA 1JN6B 4MXQD 2C1PA 2JCCB 3N1MC 4X9HA 2FH6A 1JRHH 2X44D 4G6KL 1QZ1A 3DUUB 4Y4KC 1JF6A 1KCLA 1CBVL 3BYTA 4CDGC 1UB6A 3TO4D 3GUTB 4JFFE 1Q9KB 1CICB 2DTSA 3KNBB 1YQ2A 2EECA 3QEQB 1ULVA 1U8LA 1IEBA 1SJHB 5IR1B 3MV7B 1H3PL 4KGJA 5DDHA 2VZUA 4F2MA 3SDCA 3TT3H 3BIKA 3T0EC 1YPZE 3S9DB 2IJ0C 3L3HB 1NUFA 3X3FH 1YEIH 1L6ZA 1H15A 2LVEA 1P7HL 1OPGH 4WEMB 1JI2A 5L2KE 5BVJB 2GK0A 3BHBB 3HE7B 2FX9H 2OCFD 5J3HD 3L7FB 5IGXL 3MRMB 4M6MH 3P9LB 3HMWL 1J1PH 1OAZH 3BZEA 3JV5A 4JFEB 4LNRB 4ZFOL 5A16A 1A3LH 3QNZB 5CEZD 4R97B 2XKNA 1HQRA 3J8F7 2EYRB 5DQJA 1JNHA 2HJKB 1DFBH 1DN0B 5I0ZA 5ADOL 1CU4L 1KC5H 4FP8H 1VACB 5EUKA 4HH9B 3NABL 1CTNA 1V05A 4WTXA 2DBLH 3ES6A 4FQHA 4P23C 4HKJB 2Q1EA 1KJ2B 2X70B 3NFSH 1K8IA 4ZUVA 5F1IA 3W5MA 3RL1A 4MQXD 2B4CH 4CNIB 4KUCD 1A9BA 3N1PC 5SV3A 5HGDA 2CDEA 3QR2A 5CEZH 4APQC 5IMOA 5I15L 3VXPB 1CD8A 3G04B 4K7PY 4L8CB 1BREA 3K0WA 1RJYA 4QHMA 4NQXA 1JFQL 5DQ9A 1UACH 4FQ1L 2ADFH 5C2BH 1CD0A 1UWXH 5LBSL 3ZHKA 4JGMA 5EA0L 4Z77A 4TVPE 4R8WL 5D1ZC 5IP4A 4GXVH 2NLJB 5IBUB 1B2WL 1X4YA 4XGZB 3PHQB 3WXWL 3UX9B 4NHUE 2FR4A 1QBML 3RWDA 2DS4A 4F7MA 1NSNL 4LCUB 3PQYE 3BQUD 4JKPH 4CKVX 1I8KA 3MLWH 5DD3L 1AI1H 4XH2A 3NGBB 4KH2A 1CGSH 2OI9B 4ZTPL 4I8DA 3QIUA 1OT2A 3UPCA 3Q6GH 1O0VA 1UWGL 2ED9A 3MLRL 2OR9L 3UJJH 2C4FT 1QVOA 4U1NB 3OAUH 3HZMB 1UM4H 2JB5H 5GS1A 3PHOA 3QO0A 4QHUB 3CFDA 1VESA 4IOIB 4IRJD 4KV5F 1YZZA 1MCQA 1D5MB 4HIEA 4JFPA 2CO6B 4RISL 3L3IA 4MQTB 3VXUA 3OQ3B 1N59A 3S4SG 3O3BB 2EDEA 3V0VB 1PFCA 5GSRA 4GS7C 2EH8L 4DQOH 2DI9A 2KH2B 3VD4A 3KLDA 2I60H 2J4WL 1ODAA 1X5ZA 3WHXB 5GS2D 2VXTL 4ZYKB 4NM4H 2DQEH 5FM8A 4DKFL 4KK9D 4R4BB 1U8QB 4ZFFB 3EZ8A 4GBXB 4ZSOE 4NKMB 4OKVA 3FT3A 1P4IH 3ZYIA 3UYPA 3E6HA 1DBKH 1D5ZB 5B38A 5FYJL 4K7FA 4F9LC 4M9OA 5FUCC 3VI3F 4YHLL 1UFUA 4Q9RL 3BVNA 3IFOA 1E6JL 3CMOH 3LMJL 2Y5EA 3F7QA 4WO4D 3QDMA 3D1MC 5I2IA 1KLGA 3T2PA 1P4BH 2ICWI 3NIFF 1I1AA 3CFKA 5DO2D 2B39A 3CC5A 3AB0C 1ZLWH 4K71B 2W9DL 1RJLA 4EIZC 2YN5A 1WCBB 3L6FA 3G6JB 1S9YA 4GW5A 5GZOC 4X8XA 2B1AH 3LEVL 5HYEA 1KEMH 4BQBA 3FQRA 1QFWM 3LH2L 1F11B 1CR9H 4OF0A 2DYPA 4JJHA 1WEJH 3AUVA 5F7WC 1FNGA 1DQDL 5C9KA 5EZIL 4JO3H 2G9HA 3CSPA 1NC4D 3ULSA 2OL3A 4UV7H 2WUBL 5JMOC 4MD0A 3TC9A 1A7RH 2CSPA 4OZFH 3AVEA 5IMKA 3WLWD 1U95B 1S7UA 4P2OD 5ITBH 3U30B 3LKSB 4M8VA 5KZCB 3SQOH 3SOBH 5E00A 4X5XB 4FN0A 2JKXA 4I9WE 1BFTA 3KXFB 5F7EH 5TQ0H 4NQTA 2VQUA 3DLQR 3FO1B 2NY4B 2SEBA 1BPVA 3D48R 4DN4L 1A9EB 1T22B 4ZPTB 2NXYB 4KPHH 2X1OA 3CPLB 5DEGB 3MCLL 4KK6D 1VKXB 4TNWK 1KEGL 1NFIA 3IDYC 4PRBA 4HG4K 4JFOB 2NY5H 5L7XL 4CMHB 4Y4KA 4FABH 1CIUA 3MBED 4QXGL 5KS9F 1UEYA 1T80A 5JIPA 4G8GA 1QD0A 4YXKH 3LS5H 3DSFH 5BZDB 1I1FB 3ALWA 2VJXA 1B4RA 4C54A 4AH2B 3G08A 3BPLC 3FMGL 2G60H 3MFFA 3LN9A 3TEUA 3T0EA 1FFNA 2YOCA 4PGCB 4HKZA 3PWUA 1MIEL 2WNGA 1F6AA 4N8VB 2WIIB 5KVFL 5H8DA 4UNTA 1HQ4B 1AY1L 4GKNA 3PWJB 2NY1D 2HTKD 4C56E 5FM4A 3C5ZC 4EI6B 1W72A 4M62L 2OZ4H 2XXCB 5MERB 1ZHKA 1PZ5A 2IH1A 5D72H 4JM2F 5ABDE 1R5VA 3IDIB 5MI0C 5I1JL 4I3GA 2D2OA 1YUHA 2DQGL 5HHPB 3MV9D 1BZQK 1SEBB 3HZYB 5KG9B 3BH9A 4K2UH 3WFZA 4LSPH 3O3DB 4OM1H 1FGVH 2V2XA 3IVKB 3HI6L 5IB1A 5T1KB 4NT6A 5EFIA 1OM3H 1JWUB 4PRPB 3CFJB 1MVUB 3UTZA 4P23A 4HUUA 5J12C 5BW7C 1EHXA 5ISZB 5DYOB 3VXUE 4P57A 4G3YH 3WFDL 4TN9A 1WT5C 4N8VG 3I02B 5JA9A 4FQ2L 3G5VA 3RX7A 1FV1B 4NO5B 1S7QA 1GPOH 4TPRL 4DK3A 3QQ9C 1ZSDA 3HZVA 4HWEH 4D9LL 1MCJA 1NGQL 1I4FA 1TZIA 2APVA 2CKBB 3BEWA 4K9EL 2QQNL 4Z18A 5D96C 4JDTH 1OAKH 3SY0B 1RAMA 4U6VL 5E6IA 4A6YH 1RZ7L 4KI5F 2UY6A 5D1ZA 5CZXD 3O6KH 4D0DB 4Q74A 3BXNB 4LCWA 1U91B 4QF1B 4YHKL 4YFEA 4F3FA 4DEPC 4HIJA 1A6TB 3MYJB 1WLHA 3B2UD 1RIUH 1ZANH 5F7LB 5I1AB 2X10A 1HK6A 3ABZA 4M1DH 2PW1B 3T8XA 1BMGA 4NN6B 5GPRA 4YHMH 5FUZH 2DQDL 3STZA 2Q3AA 4NNXA 4I77H 1YC7A 3ARGB 3HC3H 5EUOF 4BH7B 2ZUTA 1JGUH 1G7MB 4G6AC 4DGIL 1OW0C 3W0WA 5KS9A 1HXYA 2WV3A 3VWJD 3NH7H 3HI1A 1TETH 4JGUA 4S0SD 3ALPA 1XF1A 2DI8A 3WL9B 3BPOB 2VXUH 5GHWL 4JHWL 4KK8D 2GCYB 2FCBA 1Y6MR 4ACPA 3IXTB 3PP3K 5DK2A 4HXAH 1WAAE 3VRIB 1J88A 4Y19A 1F13A 4V3EB 2FX8L 5IF0A 4OUUA 2DQHL 4LEOA 5E2VH 3TWCL 1EEYB 3LKRB 5HHXH 1BX2A 5IHZA 1BVKB 3PJSA 2DJUA 2R29H 2AGJL 4KUZL 3S98A 1TMCB 1JNNL 4JM2A 1QA9A 5BQ7B 2V17L 1EAJA 4WU5A 1E28A 3DO7A 2A6JB 2Z92B 2EKJA 2GJZA 3MRQB 4WENB 5I8KL 1GGIL 2BVYA 1C08A 4LPXA 5FKPB 3VFOB 4QTHB 4Z7VB 5D7KD 4MX7B 3V79C 4KV5E 3K80A 3K1DA 2CK2A 3ME0A 4LDOB 3NAAH 3MNWA 5F7DA 5JQHC 2QQQA 1JRHL 4G8GE 1PQZA 1WIOA 4LSDA 5ETUB 1SY6A 2E7MA 4XNUH 2XWTB 1CLYH 4BSVA 4HEPG 3KS0J 5J9PA 1GSMA 3K1KC 4QRPA 3TBYB 4EDWH 3DMMA 4NJAH 1D6VH 3RHWF 5DFVD 3QDJA 3VFWB 3ZDYF 3D18A 4ZMAT 1PG7W 1BIIB 2NY6C 1LE5A 1NEZG 4Q9BA 4AEHL 2J88H 2PXYB 4V1DA 4WHTB 5JORB 1T03L 1G9ML 1N3NA 1OPGL 3VI3E 2ICWJ 2YUZA 3WIFB 3VXSA 4YEEA 3EYQD 1NDMA 3MYZA 3A67H 4M6ML 3OV6A 4YHYB 1J1PL 1OAZL 3WN5A 2XWBA 3CFBB 2ORBL 3NIFE 4XMLH 3OJ2C 1DL7H 3E6FB 2W0LA 1J8KA 1BQHA 3ZE2F 5DD6A 2ATPA 1DFBL 3RU8H 2NXZD 4ZD3H 1KC5L 3U0PA 2X42A 4FP8L 4CW1A 3MTRA 5EUOA 3CXDH 3HAEG 4OFDA 2PW2A 1M7DA 4PTUB 3NFSL 4RIRB 3WUWA 2B4CL 4XI5C 2BOCA 1G7HA 5FEBA 3C87A 3ZMRA 4TNVK 2Y23A 1ORSA 1FZMA 3QUMA 5CEZL 1TVBB 2AV7A 3L9RA 4MYWB 5CJXC 4GUPA 2H6PB 2IANA 1KIRB 4YWGH 3ZKQD 2IH3A 4HPYL 1DDHB 1B0GA 2NW2B 3X3GH 2XRAL 4JO1L 2FLBT 1UACL 1WTGT 2ADFL 5I0DA 5JXAH 4JZJB 4FXKB 3KPOA 3K7UA 1MLCB 2FRGP 3QUZC 4R7NB 4LCWE 1GZQB 3LSOA 4ZTOH 4GXVL 1UKSA 4IMKC 4DOHB 2A74A 4YPGA 4N90D 1T2QH 1J10A 2FJGB 3GNMH 3MGOA 4HPOH 4P9HH 5HY9B 5J4MA 3A6CL 1P7KB 1ETZA 1INEH 1JGDA 2RJMA 4JKPL 1NPUA 2YA2A 5EBLA 3MLWL 3JV4A 1AI1L 4PJ9C 3KPSD 3LRGA 1CGSL 4GQ9L 2FZ3B 3IJYB 1JTTA 3W0WE 4CN4A 5KS9E 1A6WH 4K07A 5DTFB 1IC7H 3HC4H 4Y5XC 4ODUA 3Q6GL 5E7BA 4GMTH 1X9QA 3RUGB 2CKBH 3UJJL 2FECI 1G7IB 2DL2A 1UM4L 5FDWA 2P5WA 4OGXL 2GAZA 3SJVE 3VFVA 3ARBB 2A83A 3W9EB 4E0RB 4Q0XH 4Y19E 5BW7A 3OGCB 3MO1B 2MKLC 5J89A 3QNXB 3ZLQC 5DI8B 3ZSSA 4PJ8A 3GSRB 4CRPA 5IM7A 1UXSA 4N5EA 1G7LA 2GKIA 4DQOL 1G6RH 2NMSA 4PJFB 3QRFM 1DJSA 1BQLL 4I1NB 3RY5A 1C12A 1VADB 2LAGB 2IMNA 4L9LC 4PS4H 3HI5H 1OAYH 4NM4L 2A9MH 5GRJH 1WWAX 4WW1B 1XF2B 4M03A 5B8CB 2MPAH 1NEUA 4P2QD 2BVTA 3S97C 2ZNWA 3ECBA 1I3GH 1DBKL 4P46B 2D3VA 3QP3A 1AD0A 2W0FB 5IOPB 4OZGF 1FN4A 5ESAA 5SWSA 1CFQB 4YHZH 3CMOL 3D25A 1VSCA 4QRPE 1QNZH 5C07E 3RVTC 3CGTA 1P4BL 3QIWC 3QDJE 5GS0H 3DYPA 2ZUVA 4QLRA 1CD1B 5T5FL 3CX5J 3LKQA 1T7WA 1YEKL 1NBQA 1EMTH 5ID0B 2KDGA 2B2XH 3PE9A 4W70A 4DK6A 3BP7B 3K4AA 1OW0A 1IGYB 5K9QI 4V1DE 5C0NC 2WINA 4NZUH 2B1AL 3HPLB 4KI5E 1HILA 5C3LD 2D7OA 4WWID 3QWRD 3SKJH 3VXSE 3H3PH 4PGZA 4YUEH 2VDOL 3CLFH 1LD9A 4JKKA 1QRKA 3BZFB 1WEJL 3QNYA 2WSKA 5ACZB 5IW1B 3GSNB 4CADA 2CLVB 2I5YH 1U8JA 1A7RL 4NQCB 4GAJL 4PTTB 5F3HA 5KSAC 4HUWA 4O2CA 2R1XB 1K2DA 4PG9A 4RAHA 4PUBH 2O61A 5ITBL 3SQOL 1C1EL 5EUOE 3SOBL 5T3ZD 4CU8A 4LVEA 3O3EA 3WXVH 5F7EL 1T83C 5EOCJ 2A9NL 3I2CL 5ID1A 5IG7B 2EDBA 1BEYH 1DCLA 4G9FD 2HP4A 4KPHL 1BFOB 1CVSC 2VABA 1B0RA 3RIAK 4MA8H 5JDJA 3ARZA 5FYJU 5FA4B 2IANE 1BD2A 5IIEA 5HI4C 2EIBA 5CKGA 1HHJB 4Y8AA 2P8MB 3MUGA 4U6XB 2VDLH 2J3SA 3IDGA 2I07B 4IDLA 4XXCC 5EB9A 1YMMD 5T3ZH 4FABL 1TCRB 4J6RL 3FRPG 3QI9B 1NCBH 2VXSH 2HTLC 2R0ZH 4MCYB 4YXKL 3LS5L 2ADJB 8FABB 3BKJH 1EUUA 4LL9A 1QPXA 2VLJA 3HN3A 1UJ3B 1X6LA 1YY8A 3PWPD 3EYFB 1KUMA 4ENED 5EU3A 2G60L 1VFAB 4ORGA 1P7QB 2EDLA 2PCPB 1U3HC 4S2SA 2IPTH 4ZOCA 1A4JA 3RVXD 4PRHD 1QFPA 4F33B 3ZYZA 3B9KB 4WWKD 1N2RB 1K3IA 2A6IA 2OZ4L 4TTDC 1MCHA 4ONHB 5E7FA 5B4MC 4Y2DB 3V5HA 6CGTA 5D72L 4AY0A 2GT9A 4OZGA 4HJ0D 4KKAC 1NCAH 4Z7NF 5BRZD 3O6FB 2P5WE 1I9JH 1ND0A 4K2UL 2Y5TB 4LSPL 3V6ZA 1T0NA 4OM1L 2VYRE 3X11B 1EV2E 1FGVL 1MJJA 1OM3L 1MFDL 1S9WA 2CKNA 5F96H 3VWKB 3LD8C 3HMXH 2H3NB 3C60D 5IB2A 1T20A 2FYYA 4G80A 1MCDA 5ILTH 3PNWB 1RULH 5CJOL 1XIWD 4X5LA 1REIA 2IAMB 2DICA 4JY4B 3H2WA 1HHKB 4JQVA 3D39A 1U8KB 1U8PA 2HA1A 4RNRB 1A8JH 2WY3A 4KMLB 3DARA 2ICCA 5IB3B 1OAQH 2GQHA 3RTQC 3TVMD 4CDHA 4HWEL 4GKSA 2VDPH 4N8CH 1FYTE 1X5XA 2IWGA 4XVSH 1KPUA 3C09B 5K59F 3UROR 4WI3A 1A7QL 2DKSA 4LF3B 4JLRB 3ZE2E 3MODH 1MRDL 4JDTL 1DEDA 1OAKL 4XX1G 5FO7A 1X5IA 4PLKC 3QUZA 1XZ0B 4A6YL 4BSWA 2E7HA 3O6KL 1UB5A 2MQ0A 4IMKA 1FCGA 1KGCE 5SWSE 2UYLA 4Y4FD 5GJSH 4CVZB 4E41A 2X4NA 1ZANL 1QFUH 1Q9WB 3NTCH 1T1ZB 1ZGLP 2XWJB 4M1DL 3OKDA 4R0LC 4PJ9A 5HTSA 4YHML 2XG4A 4NC1E 1HH9A 2VQ1A 1BFSA 2NQCA 4I77L 3TN0B 2H2SD 1JGUL 3CU7A 4U1JA 4LLWB 5H35A 2BFVH 1F3DJ 3CVHB 3ULUD 1L4IA 3NH7L 1LO5A 3G5XA 3PP3H 3D3VB 2UZIH 1XR8B 3MLUH 3DX9B 4QTIH 3FT4B 4R9HA 1Q9OB 2VXUL 3VFRA 4FQXB 3AGVA 1HWGB 1NAMH 1EEUA 4PGEB 4JKMA 4HXAL 3LDBC 2DQFB 5IBTH 2FB4H 1CTOA 1I9IH 3MR9A 3OKEB 4F7TB 3A6BL 5C1MB 3PDDA 1QACA 2J1KA 4X4YB 5LJYH 1XCTA 3DX6B 4KVCL 1H5BB 1S7RB 4XBEL 5E2VL 3VA6A 3MRCA 3UTOA 4Q6IC 2WWKO 2FBJH 1DBML 2GW5A 1PKOA 2IG2H 2YC1A 2QLVB 3TBTA 3R1GL 3ZTNH 2UVEA 4UAOC 2CXKA 3MLVL 2A73A 5ADPH 4XHQA 2WP3T 4X6CB 3C5JB 1N6VA 4KTDH 1IL1A 4RCAA 1Z9SA 5HSFA 2FGWH 1S7TA 4NQDD 2KPNA 3STLA 4QGTA 3JV0A 2HMID 3W9DB 4WTWA 1RZKH 1CLYL 1MQKL 3QIWA 4HWZB 4D9QD 4OV6F 4DUWA 4L3EA 2Z8VC 2VLJE 4HD9A 4EDWL 1KIPA 1GHFH 5FGRA 1D6VL 1SM3L 2VLLA 4UV4H 1TJHL 3U4EA 1VERA 1QFWI 2XNAB 4NZJA 1ADQA 4MJID 3TNNA 3QDGD 1DR9A 5HPOA 3F58H 2J88L 4HS6A 1MI5A 1OTSD 4NRYB 1A7BA 5HHMB 3QYCA 5EO9B 2GTZB 3SBWA 3UP1A 3CXHJ 4NO2A 3BH8B 3MV8D 4FMFA 4OZGE 1R3KA 1KIQA 5E8PA 2E5EA 4JPWL 4HIXH 3L5IA 4XMLL 5KSAA 1HI6B 1DL7L 1KTKE 2R1WB 4CBPA 4NCC2 4TSBH 5ELIA 3RU8L 1QQDB 4Y5VC 1Z9LA 4AT6B 4ZD3L 3C2AH 3OHXA 3TBSB 3RBSA 3VFMA 3CXDL 4D8PB 4U1GB 4C83B 5JHDD 2EYSA 3D39E 1LE9B 2OTUA 5C09D 4NO0B 4ISVB 2ESVA 1LWRA 4ZFOA 5LQBH 3P9MA 1HKFA 1K4DA 5IVXE 4YBLB 3DIFA 1RV6X 1JI1A 4KFZC 2XZZA 4XRCB 2FIRT 5JR1H 4YWGL 4XXCA 2QKIA 2VXQL 4P2RA 5EPMA 3TIDB 3H9HA 1UQSA 3EOBA 3OAZK 2YWZA 1W0YT 3FRUB 5DEFA 4YIQB 4FTVA 3K4DA 3O6LH 4XHJD 1AGEA 4JFYA 1N6UA 2FEEL 4ZTOL 1R3LA 5E1AB 2AQ1A 4F7CB 3ET9F 1WF5A 1NL0H 4U0RB 5JUEL 1CGXA 2EIDA 4E41E 4E5XB 1T2QL 4U6HA 1SJEB 3VE0B 1T66C 2E7LC 1JZ4A 3F7RA 5I71B 1U3HA 4F7PA 3SDAA 1RFDH 2Q7YB 3VXMD 1S7SA 4LSTL 3ARSA 3MRNB 3QWOB 1T5WA 5EN2B 1U58A 3TZVC 4PLJD 5JHLH 3SCMC 4CL7A 4O51A 4KRNA 4P5TC 3FQUA 5C3TA 2XFXB 3OAYK 2LAAA 4HGWB 5J0BA 1C5DB 1AHWC 5F3BB 4UOJA 1IC7L 2YPKB 3HC4L 3VD9A 3KYAA 3B5TA 5CD5C 3THMH 2AXGA 3JWNC 3TPUA 1D5XB 2W0PA 1W0VB 2FH8A 1LK2B 1ROWA 2DIBA 5LGJA 5JQ6H 4WTZA 5C9JA 5IEHA 5EC2A 4Q0XL 4YR6A 2BSRA 1FFQA 3OX8B 2UY7A 2KQNA 1AIFA 1F00I 2NCMA 3AU1B 4LKXB 5E2JA 2O93L 1K6QH 5I8EB 4YXLH 3KDMB 2IGFH 1UM6H 3QA3B 1IMHC 5K9JH 5FA3A 4PRAA 1G6RL 4G8IA 1CL7I 4MJ4A 1ZWIB 3TA3B 2MCPH 3RTQA 3VCLA 5TFSH 3CXHK 4Z7UF 4PS4L 4NUGH 3HI5L 1S5HB 3SDDB 4Y89A 2A9ML 4Z7NE 2J8UF 4DN3L 5F7NC 4L4VB 2MPAL 4JFFD 1QO3A 2EDOA 4P2CG 2NY2D 4JFZH 3CVHH 4NZRH 4H26B 1RHHA 4K3EH 3QIBB 2NR6D 3SKNB 3OG4B 1YYMH 4I0PB 3MXVL 4XAKE 2H2PC 3O3AA 5INDB 4GG8A 4NFCA 5C0BB 2XQBH 1D5BA 3RWJA 5F8RC 1YNLL 1FL5B 1OTTD 4X99A 1LEKB 4L3EE 3VH8A 4YHZL 5A3ID 1KXTB 5KSVB 2D9CA 1R3JB 2F74A 3PL6B 2E8ZA 5L2KD 1QEWA 4OLVL 2JIXD 2EZ0C 1EMTL 5K59E 4WV1A 1IM9B 2O5XL 4HULB 3ARDC 4X83A 4KTYA 1NGZB 3T04D 1MI5E 3BD4A 1RD6A 1MCPH 3DX7B 1KB5A 1IBGH 4RBPK 4LIQH 3MA7B 4G8EA 4EI5B 2AV1A 3H3PL 4LDEB 4YUEL 4BUHA 2BP3A 1GYAA 4LQFL 5DD1H 2E9WA 2N1KA 1E4XH 3X13A 1NMCC 5CUSL 2C4FU 1P5UA 2C1OB 2MNUA 4L8SA 2CJUH 1AKJD 4LQ1A 1FZKA 4PUBL 4N9GA 4Q6IA 4BK5A 4LLDA 2APXA 5KN5B 3NIDF 4MXQC 3FO2B 5JOEA 1TQBB 2ZSVB 1G9MC 4OCWH 2AKRB 3U6RA 1U3JA 4I2XB 4JAMB 4RGOH 4TYUA 3B9DA 3TO4C 1UA6H 4MVBA 1BEYL 2JB6A 2GJJA 1L7TH 4OV5A 5IFJB 2P24B 3PGCA 4TVPD 1QUNA 4MA8L 2DKUA 1T0MB 2FL5A 3DXAA 2MJWA 5DJDA 5M95B 4KDWA 4EQ2A 4PJEA 2VDLL 1D7FA 4PJAF 2JK5A 1FG2A 1DQJA 1U42A 5T3ZL 4FTVE 5E2WH 3PQYD 3AAZA 1NCBL 1JE6A 2VXSL 4IOFD 4FQLH 4J4PD 1KULA 1CDUA 1F4WL 2PYFA 1YQVH 2CLRB 4HFUH 4KHTH 1J5OH 1ZLUK 2DLFH 3BKJL 4NYLB 4HUKB 2HT4D 2ZUQB 3LHPH 2C9AA 3EHBD 3PV6A 2B4CC 4M6OH 5HYJA 5L0QB 5E94A 1ED3A 5C92A 4Z7UA 2J8UA 4YZFF 1BJ1J 1PSKH 2VISB 4PR5A 4LP5A 2ZKHH 2IPTL 2ZWLT 4Q2ZA 3HNTH 2ADGB 1H3VA 1B90A 5JIKA 1OB1A 5D2LB 4GW1B 5CEXA 1AQDB 4PREA 4MQXC 1A4KA 2EO1A 3TPUE 4D94A 1NCWL 2E7BA 3QWQB 2PUQT 1I9JL 4JDZA 4S1QH 1OL0A 5HGBB 3VGHA 1H3XA 2ATKB 4PIRF 4RRPA 4WFGE 2IF7A 3JXAA 2DTMH 5F96L 5GSVA 3HMXL 3QJHB 4F8QA 4HUMB 1DUYA 4BZYA 1OLLA 3QH3A 5ILTL 1RULL 5SWQA 3I84A 1AGDA 4Y2OA 1RK1A 4U7SA 1NMBL 5FF6A 4MD4B 2HJFB 3FRPA 5J57B 2F53B 3DYMA 5EBWB 4XVSL 3BQUC 4NN7B 5EO0B 4UQ3B 4ETQA 3MODL 1A22B 1UM5H 2ZOLB 1UYWH 1ZS8B 5GZND 4G9DA 1N8ZA 2ADIB 4NBXB 5T1DH 1NUNB 3H9YA 1PEZA 1T89C 3BGFB 2OTWB 3VGDA 5IT2L 2VITB 2E7LA 4JRXB 5GJSL 5FV2A 1WC7A 4U4BA 5F1NB 4ZFZB 1QFUL 1MEXH 1X7QA 3WDIA 1U2CA 2EEBA 3F5WB 5FUOH 5F9WB 1N64H 1B6UA 3SCMA 3UEZA 4IRJC 4ONOA 1ZT4B 5KAQG 1KCVH 4FG6D 4UU9A 1KPRA 5FYJE 4DCQB 1CXHA 4H25A 3ZTJH 4PJAA 4A2LA 5I6XC 2OQJA 1AHWA 1FGNH 2PN5A 1WGOA 5E8EB 5DURD 5B39G 2BFVL 3VMNA 4ZAKA 3ZDXF 2GIYA 1PKQA 1QFOA 3KVQA 3MLUL 4QTIL 2HH0H 3V6OC 5KSBB 1HDMA 1ZVYA 4I9WD 2Z9TA 2YBRB 2GEEA 1NAML 4RSVA 4LSVH 1ZVSA 1A7PH 1KNOB 5IBTL 3CSYA 4KK9C 2FB4L 1I9IL 3I6KB 2XZCH 5HDOA 2C7UB 3TBWA 1RZJL 5L8JB 3BWAB 2ARJA 1RQ5A 3IGAB 3O4LE 2XTLA 1U3ZA 1KLUA 3PUCA 1CLZH 1AGCA 4ZO6A 3ULUL 5MEOB 1R6VA 1QTYT 2IG2L 4WO4C 3BO8B 4JFQB 5I1IH 3O4OC 3ILPA 4KZDH 4KY1H 5DO2C 3ZTNL 1YEHH 5D8JH 5ADPL 5E99L 1IEHA 4YGVA 4XTRD 1XF3A 3EIFA 4KTDL 3VFPA 4RA0C 2NXZB 3ULVF 1HN1A 3O9WB 4NQEB 3VFSA 4MQ7A 4YFDB 3UZQA 4LLMB 1YYLH 3D85B 1I7TA 5LCVL 1J1OH 3FONA 4N1EA 1MCRA 4C56D 1RZKL 3EDDA 4MD5B 1RK0B 5E9DA 2YA1A 1HYSD 2H41A 1F8TL 5HYJE 4QT5B 2PO6A 4GAYA 4FA8A 1GHFL 4JFHE 3OKLB 3QIUD 4UV4L 2J8UE 1GRWA 1JYWA 4Z95H 3ARDA 2VLKB 4QXTA 1CGTA 2XTJE 2VR5A 4GLRI 5FECB 2WK2A 2VNCA 2UWEA 4MCZA 3F58L 3WV0A 4P2OC 3CK0L 5DC9B 2PF6A 1VGKB 3FCTA 1D6EA 4K7PL 4LKCA 4ZS7H 3GGWA 3BRGC 1A6ZA 4FNLH 3QZWB 4IJ3B 3EO0B 5DVLA 5H37G 3HCVB 4BA8A 1RZIB 2WBJB 5C0EB 4O5LH 3VXUD 5LGKA 2AK4A 4HIXL 1ZA6B 4UUJA 3TCLB 1I7UA 2BJMH 4NO3A 4UINH 1OQXA 4G6FB 1FFOA 2C5DC 4MXQA 3IFPA 3LCYA 5E6ZA 2BERA 3QUKB 1JHTA 3QEHB 1ZEAH 4AQ1B 3MBEC 5FM5M 1IAIH 4JB9H 3B3IA 2OYPA 2QR0B 2B20A 3TO4A 2GSIB 1W2KT 2ILLA 4G6JH 2VMFA 1OSPH 4X7TB 1BZ7B 5IVZA 3T0DA 1R5WB 1EX0A 3EUUA 2IQ9H 2P46B 43C9B 1CK0H 4OB5H 4HKXA 5FIEA 3EDJA 3OAZH 3QZWG 3RWFB 1O7VA 2B5IC 3RVWD 3IRZA 2EICA 3MUY1 1I1AD 4JRWA 5CBAA 3MMEB 1N26A 2HTKC 2NY1C 4OZ4B 4DZBB 1TZHB 3WEXB 3O6LL 4IM8A 3NIDE 1QBAA 1Q72H 4LGRB 4XXDA 2EDRA 2EC9T 2VN7A 3T08A 5T33L 4MDJA 2EDQA 5CS7A 1S9XB 5C7XH 4G43B 3IJSA 2FSEB 4HIHB 4O2EB 1NL0L 5I18H 1CFNB 3S3SA 5EU6B 4WW2F 1WFOA 1JZ6A 2DYPD 5IESH 1RFDL 1NH6A 4X6BB 4S1RH 1OAXH 1JGEA 3OAYH 2G2RB 3FO9B 4WU7B 4MAYD 5HBBA 5FYLH 3P4NA 5DUPH 2AEQL 1WWBX 4PJAE 4QHNB 4AG4L 2X2YA 2R56H 3T65A 1KT2B 1IC5L 5C0DB 3IDJA 1PKQE 1JJUA 2VKXA 2I9TA 2APBA 1WWWX 3THML 3ARRA 4O4YL 4P2YA 1T1XB 5D1QB 3KPMB 2JCCF 4FS0A 1D9KD 1EGJH 2R2HA 2WQRA 5F89A 2Q86B 5JQ6L 4NOBA 1ZOXA 2XQYG 4YZFE 3TV3L 1J05A 4PBXA 4W68A 2IPUK 4R3SA 4X9BA 3DROA 5F9JB 1P6AB 4HS3B 1K6QL 5L2JA 4YXLL 4N0FA 5CZXC 2IGFL 1UM6L 5K9JL 3MRJA 5C08B 2IFFH 5DSCB 5ERWA 4J1UA 5DJ0B 3LRSB 4OIBA 5TFSL 1B3JA 3B2UC 1J8HE 4G8GD 4NUGL 3LKPA 4P4RB 3V5KA 5CCKH 3BQUA 3U36B 5TDOA 1H0DA 3NACH 1N5AB 1OSZA 4POZD 3TYFA 4R26L 1NCDH 2Z31B 4L29A 4JFZL 4LVNC 3LN4A 1EZVX 2CRIA 2IALA 4K3EL 2AS5M 1YYML 1TDQA 1T89A 3EYOB 3WFBH 4XPHH 4PGBA 3P0VH 2E6JA 3VWJC 4F37F 2YPVH 5E9DE 1EDQA 5L6YH 1BOGA 4G9FB 4FQIL 1TTGA 4PV9A 1JPFB 3C5SB 4KK8C 5KSUB 4O2FA 1S7XA 5FKAA 1WZMA 1F90H 3L1OH 2HG5B 3IXAA 5J8OA 4FFZH 4XT1C 4LLQA 3VJ6A 4X4ZA 4RBPH 1Z5LA 5F6IB 4IRZH 3MOQA 2KBGA 1JPGB 1YMMB 4GXUM 1L0QA 3P0GB 1MCPL 1IBGL 4AL8L 3BYYA 32C2B 4J8RA 1P1ZA 3V6OA 1CF8L 3C6LB 3JTTA 1CGYA 1U36A 3ZT5A 4YE4H 4LEXH 1M05A 5DD1L 2AK4E 4DKAA 1NC2B 1G84A 2XICA 4ZXBB 4KZEL 5IWLC 2X4SA 3MGAA 4WW2A 3LPGA 2EXWD 1PY9A 5IQ9B 5HVWA 4V2CB 4U2ZA 1XF4A 4OBRA 3BKCH 2R1YA 4QY8B 3VDCA 4RGOL 4MMXC 5TQ2L 4CVXA 3MBXH 1UA6L 5DVKA 5E6ID 2NX5A 1MCWW 5C0RL 3GIZH 2VLRA 1L7TL 1M7IA 4LCWD 4I48B 4BM7A 3MNVB 5DFVC 1C8PA 1JN6A 3I6GA 2GTWB 2JCCA 4OZFA 5DFWH 2Y9RT 1GCFA 4Y4HC 2F5AH 3R8BB 4QRTB 5I16B 3GUTA 3VGAB 4NRZB 4J3TA 5MENB 1CICA 3Q5YA 5INCA 1BP3B 3KNBA 4MJ5B 1ZLUH 3GJFB 5E2WL 5FCUH 1JWMB 1SJHA 3MV7A 4MNQB 3KYMB 1A7NH 4R4FL 3EFFB 1YQVL 3LEYH 4JRYB 4HFUL 3EYQC 3UBXI 4HLZG 5MEQB 2DLFL 4MNHB 4M6OL 1LO2H 3W0WD 3L3HA 4HMCA 2UZXB 4IMLB 4LCYB 4U7MA 1S9VB 2J6EH 4DFIA 1ORQB 3FT2A 1U8OB 1PSKL 2E7CA 2QV2A 5BVJA 3FKUS 3QRGL 1DLFH 2CRYA 2ZKHL 1F58H 5H2BA 3MRMA 1NGPH 3P9LA 3SJVD 3U9UB 3ULVE 1I9RH 4OIAA 4LNRA 2XT1B 4Y19D 1KENH 1CFBA 3QNZA 3VFNB 1PLGH 5F88B 4JO4H 4JY6A 3MNZB 4OLYL 1EEZA 5GS3A 3DRTB 2EYRA 4ZUUB 4YHIA 1BBJB 1DN0A 1EZVY 1IZJA 1E4JA 2NNAA 3EZJB 4BYHA 3W82A 1VACA 3AMLA 4HH9A 5JXEC 1RURH 5IJVB 3BUYB 5JLZA 4M8QB 1GZPB 4JM2D 1KJ2A 3QUYD 1N7MH 4ODTL 4KVNH 5I8OH 1BLNA 3GMNB 3MBEA 3GBLA 1J0KA 4AIZB 3KPPB 4CNIA 2JF1A 3ARFD 3CD4A 2OZ4A 4X9IA 3H9SA 4JCMA 5GGVH 4Y1AB 1XH3B 4OF5A 3VXPA 5HGGS 3G04A 3LZFL 4WIQA 5GRYA 4KXZI 3G6JF 2I9LA 4BELD 2HFFB 4JY5H 1C16B 1F45A 5CZVH 5JO5A 4RGNB 5I66B 2VR4A 3DI3B 5HHOB 2OK0H 4QRPD 2GSGB 4YHPA 5C07D 3DMMD 3MJ9L 4NGHH 3DWTA 1PY4A 3QDJD 4XGZA 1UM5L 3PHQA 1UYWL 3BPNB 1SBBA 1GC1H 5EOCL 3HUJB 5T1DL 3OGOE 4V1DD 2P49B 4JVUA 4DVRL 1NBZA 1NJ9B 5E95B 2X7LB 4KI5D 2EIZB 3I50H 4O58H 4V2BA 1MEXL 5EBMB 3HC0A 3VXSD 1IGJB 3G5YB 5IV2B 4ZUSB 2BDNL 3QCUH 5K33A 1WBYB 3F8UB 1N64L 1PD6A 2VRAA 3MC0A 4XCCL 3KPLB 1KCVL 3QISA 2AEWA 5I1LB 4EBQH 1NCCH 5ANMB 3BW9A 1EJOL 1I7RB 4M6AA 2BNQE 1YNTB 4XVJH 3WYRA 3BDBA 3T0AA 1MHHA 5JIIA 2ZUXA 3VA2C 4IOIA 3FAXA 3RWHB 4M61B 2HH0L 5D7SH 4GOSA 3B9EA 3VD5A 1WBXB 3LQAH 3V6FB 3LRHA 3L3DB 1XF5B 1A7PL 3O3BA 3V0VA 4FXGA 4JKWA 1FBIH 2XZCL 5FOBA 4ZQKA 3WHXA 5CMAA 3C6SA 4F9PC 4PJXF 2DI7A 4ZYKA 2IAND 3DVFA 4IEFB 2GITA 2MQCA 5HXMA 1MJ8H 4OTXH 1G7PB 5D7LB 3DVNB 4R4BA 1FQ9C 4M1GH 3RNQB 2BRRH 1U8QA 3RDTD 3RQ3A 3U4BL 5DJ8A 3VG0H 4ZFFA 4NKMA 1QFWH 5HGAB 2NX5E 2VLRE 1EBAA 5I1IL 5SX5K 3NPSC 2JCCE 4KY1L 5DA0B 5C70A 2OTPA 1JRHI 4KZDL 1YEHL 3LV3B 1H9VA 3QPXH 4W81A 3EO1B 3EDKA 3GSUB 3HB3D 4L4TB 3T77B 4OFKA 4OD2B 1S7WA 1WZ1H 1IGMH 3QEQE 3VWJA 4XWOD 3MV7E 4FFYL 5E4EB 5HYIA 5JOFA 4UDTA 1J1OL 3QULB 1CGUA 5IEKA 3WKMH 1CE6A 4OFYA 1TJGL 4C57C 1WCBA 1MFAH 4QCIB 3G6JA 3QFDB 4IRSB 3C2SA 1TJIL 5E5UB 5CEYA 4IS6B 2H1PH 1CE1L 4OZHF 3VRLF 4X6EB 5IMLA 2CLZB 5EU4B 2P5WD 4WI5A 1YMHA 4KJWD 3MRGA 2NPLX 5E8DH 1IAOB 4ODHH 4ZS7L 4EVNA 1I75A 1U8HB 3FN3A 4FNLL 4KHXH 2D0HA 3CZJA 4PJ8D 3FHAA 2AABH 4O5LL 1BBDH 4N5ED 3NA9H 3ARED 4Q97A 3EKCA 3EOAB 3LKSA 4PJ5B 5I1DA 4X5XA 2QADD 3NMEA 1KJVB 4YX2H 3EYVA 2BJML 4B7IA 3FO1A 3S88H 4UINL 1KTLB 2ZCKH 5JDSB 2R15A 2BHYA 1A9EA 4HFWA 4ZPTA 3H9SE 1ZEAL 1I1YB 2HKFH 1FYTD 3BZ4B 5D9SB 3UZEA 5T3XE 4JB9L 3MJ6A 2C3HA 3GRWH 2H32B 2ICWB 5E24E 4UQ2B 4G6JL 4XP1H 3T4YA 3RVUD 2F5BH 1LEGB 1U8NB 1GGBL 5D6DC 4NPYB 5I74C 2Q76B 3ISWA 1QSFB 2PR4H 4Y4HA 4NN5B 1CK0L 4ENEC 2XPGB 1KGCD 4U31A 3NVQA 5BZDA 5BV7B 1I1FA 2Y36H 4PLNC 5D5MB 3RVXC 4FQQA 3AS1A 1MRCH 5C0GB 3MOAL 4WWKC 4PJXA 4YJZL 4LPYA 4TUKH 4Y16C 2FECL 1Q72L 3REVA 4WI8A 2O5ZH 3J7HA 4ELMB 4PGCA 3JTSB 1J18A 1ZA3B 1HHHB 5C7XL 3JTCA 1MCOH 2BNRB 4HJ0C 4LPUA 4OZIF 5I1CL 2P7TB 5I18L 1HQ4A 3PWJA 3AXLB 4H1LH 4EI6A 3LS4L 5MERA 4X7EC 4IIQB 5I1GH 5IESL 4YPJA 5MP6H 2Y25A 4S1RL 1OAXL 3IDIA 2K9UA 1R24B 5FYLL 4LPTA 5DUPL 5HHPA 1K8DB 3C60C 1M71B 1AJ7H 3OPZH 3GMQB 3HZYA 4RFOH 2R56L 5KG9A 3GMRB 2R2EB 3VFTB 3O3DA 1A21A 1XIWC 1UT9A 4Z7VF 2BHZA 3IVKA 3I9GH 5T1KA 1BAFH 3QXAA 5JXEA 1FZOA 3CFJA 1MVUA 4UOW1 4UIKH 4HSQA 4K94C 4PLOB 3EO9H 5ISZA 4JN2B 5DYOA 3TVMC 4Q9QL 5EDXA 3MRLB 3S37X 3WBDA 4MJ6B 4OZHA 2X1PA 3A6OA 4NO5A 1MVFA 3EFDH 4U6YB 4J7RA 1LEIB 3IFNH 3PHSA 3FOMB 5GGTA 3GBML 4TNWF 2AEPL 5BJTB 3SDYH 1H3TA 5GGQH 2FGZA 2CKBA 2IFFL 2HT2D 4XB7A 2Z91B 3D2UD 4Y4FC 3M17B 4MNGB 3TESA 3O41A 2QTEA 3ZKXB 5C0FA 2W65A 3WJLC 3BXNA 2VLJD 1NCDL 2XY2A 3L3GB 4J3UA 4QF1A 3DECA 3KPSA 3WMSA 2QEJA 1RZJC 4XPBL 5FGBC 1A6TA 3MYJA 2H2SC 1S8DB 3WFBL 1G6RA 4XPHL 1OLZA 3P0VL 1RUMH 4JFDA 3ULUC 2CPCA 2YPVL 3WJJC 3QAZB 2I27N 2PKDA 5L6YL 3VMOA 3G6JE 3ARGA 1NGWB 4BH7A 2R0WH 1JHKH 4KKBD 4ETYA 5HJ3B 1F90L 3VFUB 1O7SA 3L1OL 4OT1H 4FFZL 2D0GA 2BXZA 1JHLH 4IRZL 3HRZB 2E9IA 2QHLA 1Y0LB 4ALAH 5CSBA 3IXTA 4UT7H 5EIQA 2NY3D 3DBXA 4HUVB 1QLEH 1W72L 1RZKC 3REWB 1F4YH 2XG5A 4LEXL 1DZBA 2DF3A 5LWYH 4OZIA 3SGJC 4P2QA 1EEYA 3D39D 1JYVA 2W60B 3LKRA 4JM4H 3TF7C 1CDHA 3BP4B 3MLXH 4F9PA 2F15A 4UT6H 2DM2A 2AJSH 3Q2CA 4G6MH 1RUKH 1Q9LB 5BQ7A 1FSKB 4BFEA 2W9EH 5D7IF 2EXYC 4X6DB 1A1OB 1V3MA 3MBXL 5FKPA 3QUZD 4QTHA 3VFOA 4Z7VA 4MA3A 3JVGA 1YEFH 3GIZL 3DTXA 4P99A 3WS3A 3DI2B 3RGVB 4LHUB 3GMOB 1CXEA 5ETUA 4ZNCD 1PZUB 2IADB 2F5AL 2HN7B 2XWTA 1JF1B 3RUGF 1NKOA 1CGVA 3TT1L 3TBYA 1JF5A 1F02I 3HZKB 1T2JA 4PJXE 1FL6B 5JZ7D 4UNUA 4KRPD 4OAWA 1A7NL 1AGFB 4DUXA 1BIIA 2YD8A 2BVPA 1W8OA 2DBJA 4X6FA 1GGUA 2A6DB 3ORJA 1LO2L 4CJ1A 5IW6B 5J6HA 1G7JB 2PXYA 4EZMA 1PVHA 2WAHA 2J6EL 2ZCHL 5L8LB 1UB6B 1E6OH 5D2NC 1IQDB 3CDCA 1DLFL 3P4LA 3IAPA 1F58L 4PJDB 5JIHA 1NGPL 1CWVA 2ZNXA 3QB7C 3CFBA 1I9RL 4G42B 3SDCB 1KENL 1PLGL 3IS1X 1CDIA 4Z78A 4JO4L 2Q8BH 4OLUH 1S5IH 4PRPE 1CQKA 1HNGA 2GK0B 3KPQA 5ISZE 1XGTA 1RURL 4XNZC 4F57H 1EFQA 1A2YB 3ZT6A 4OZHE 3BZEB 4KVNL 3VRLE 3CU1A 4RIRA 1E4WL 5ESQB 2XKNB 1HQRB 3MRDA 3P9WB 3NCBB 2V9QA 4XHJC 5GGVL 1TVBA 5D6DA 1J0HA 2H6PA 1GXEA 3PWPA 1K9TA 3PG2A 1UKQA 1DDHA 5EUKB 2DB8A 4XAKD 3ZTJG 3MQIA 1YDPB 4FQHB 4ZUVB 4KAQH 4PFEA 4JZJA 3GI9H 3SE8H 5ENWB 5F1IB 3RVTD 2KQMA 4FXKA 3QIWD 4M7ZB 1MLCA 3OKKA 4L3ED 2OK0L 4R7NA 5DMIH 1GZQA 3HMXA 3MZTA 5HGDB 3BKMH 2CDEB 2LV4A 2OXHA 4PLJC 4Y16A 5IMOB 3FOLB 4J3XA 3BDYH 5DD5H 1GC1L 5D7IA 4JFDE 1P7KA 3O45B 5DQ9B 1MI5D 4R90H 3NPZB 1D3CA 1RMFH 1AXSB 3I50L 4O58L 4QRRB 2FZ3A 5BZWA 3VXNB 3IJYA 1X5HA 5JPNA 2H26A 5F21B 1EVTC 2GI7A 2FR4B 4EBQL 1NCCL 5ITFA 3RUGA 4JKLA 1XIWA 2CMRH 1G7IA 3AROA 2YD5A 2C3VB 5E4IA 3W11C 3HHRB 4MWFB 2H9GB 3E2HB 3EJZD 4KROD 3ARBA 3W9EA 4E0RA 3OGCA 3QQ4A 4NCC1 2HVKB 5CAYB 4X7FC 5CZKA 4B7LA 1B4JH 4OZIE 1R3IH 2RBLA 3LQAL 2VUOA 3QNXA 5DI8A 3QIUB 2WUCH 3WLBA 4P2QE 5HVGB 4X5WB 2VZ1A 2EE6A 5CGTA 1FBIL 3K74B 1QVOB 2NY2C 2RR3A 3IAGC 1UXWA 2ZSWA 4HWNA 1H8SA 2NR6C 1VADA 5GRVK 3CFDB 4P59L 2NY0C 4TNVF 2GY7B 1QSED 3BKYH 4WW1A 1MJ8L 4OTXL 4YGAB 3BE1H 4M1GL 5HHXL 3ARUA 4PRID 1RIHH 3H7BB 1J87A 5SX5H 1KOAA 1QFWL 4Z7VE 1OTTC 3AS3A 5A3IC 3L3IB 4FTVD 5JA8B 1N59B 1NAMA 1UWEL 3MRBB 5GSRB 4NKOB 1EHAA 4P46A 3WJLA 1MCFA 3QO1B 5BVPH 4OSUH 3QPQD 4AENB 3PP4H 2W0FA 3QUXB 2VZSA 3QPXL 4OBSA 2D7TH 3T2NH 1CFQA 1IKFH 2ED7A 4YO0A 1WZ1L 1IGML 1U3HD 2XZQH 1YN7B 2DQIH 4JJ5B 3SDAD 2DL9A 4OKVB 3S36H 3FT3B 1CD1A 1CDCA 3OMZA 3WKML 12E8H 5B38B 5ID0A 4K7FB 2Y6SD 2VWEE 2VXVH 1YJDH 3BP7A 2R2CA 1U9KA 2EO9A 1MWAB 1IGYA 3GIVB 4PB0H 3IFOB 1KFAL 1KCGC 3HNSH 4ODXA 3QDMB 5I2IB 1FPTH 3WCYA 3AM8C 2ZZUT 3O2WH 4GRLB 2X1XR 2J5LB 5ACZA 1EVUA 4EN3B 4WFGD 1XCQB 1AR1C 5E8DL 5IW1A 4ODHL 2VIRA 3GSNA 1VGEL 4PTTA 4NQCA 4NSKB 1S9YB 1FJ1A 1A3RH 4QYOB 2AABL 1BBDL 2R1XA 4S1DC 1I8MB 4ZODA 2BRQA 3NA9L 4XP9H 3MACL 3T4AB 3RTQD 5B38G 1DQML 1FNGB 2VZTA 2XXMB 3S88L 2ZCKL 4HJGA 5IG7A 4U3CA 5DD0H 4GMSH 1DQLH 2OL3B 1KIUA 4DTGH 4EKXA 1BFOA 1EEQA 1PG7H 2HKFL 4MD0B 4JPIB 4NDMB 3H0TA 3ROOB 5IMKB 3T0BA 3GRWL 3NN8A 4MHHI 4IOFC 4J4PC 5FA4A 4XP1L 2F5BL 3O2DH 5FB8B 1QSZA 5TF0A 2YUWA 1HHJA 2P8MA 2HT4C 2ITDB 3EHBC 1INDL 2I07A 4MJIA 3QDGA 5C0IB 1TCRA 3TYGH 2SEBB 2LU4A 3QI9A 1DVFC 4MCYA 2FEEI 2ADJA 3T2QA 8FABA 2Y36L 3SQBA 3ZKSD 1MRCL 1UJ3A 4PJBB 2OMNA 3EYFA 3BPCB 3MV8A 4EIGB 4TUKL 4PRBB 4BZ2H 5D7IE 2O5ZL 1P7QA 1YC8A 4LP4A 2FATL 4ZS6D 1ZAGA 2ARJQ 4Y4KB 4G8GB 4F33A 1P9MC 1RZGB 4YHNA 2QSCH 1GGTA 2I24N 5SX4I 4BH8B 5MP6L 4EJ1C 2UZYB 4UBDD 1A6VL 3RUGE 2N4IA 3QG7H 3T0EB 1AJ7L 4HKZB 5K9QG 3O6FA 2A6KB 5A2LH 2Y5TA 3X11A 4GKNB 3O4LD 2CUMA 3DHJA 3I9GL 1BAFL 1J0YA 3P73B 2Z4QB 1ZHKB 2ENSA 5EIIB 1ZVHA 4UIKL 4M48H 1IAKB 1PZ5B 5TF1H 4F15C 3EO9L 3PNWA 4MVBD 4X80H 3CDGB 3IDMB 2IAMA 1YUHB 3KYKL 4PJFE 4GG6F 2YS4A 3W39B 5GXBB 3EFDL 3GKWL 2V2XB 4LGPB 3IFNL 5FHBH 3RIAF 5EFIB 1KCUH 5IB1B 3C08L 5GZNC 4MGXA 5GQBA 5HHVH 4N68A 3UTZB 4LHJB 4WEBH 1SBSL 4HUUB 4GRWH 4NNPL 4P23B 5GGQL 3T3MF 2YXMA 4LF3A 4EUPB 1YECH 3R06A 4JLRA 4P57B 3VXMA 2XOTA 5H94B 3G5VB 1O5DT 3M45A 1S7QB 2GFBB 5HYJD 4APQB 4FG6C 3BT2H 4JFHD 1IQWH 1ZSDB 3MUHL 3B2VL 4NWTH 1I4FB 2IBZY 2XTJD 3BEWB 4TUOB 4TSCL 3MRHA 3DYOA 5IKCA 4JFXA 1RUML 2E8YA 1DBBH 1KXQE 5I30L 4RAVB 1J0JA 3GDBA 4R2GD 5D1ZB 3FHQA 2EC9U 4I0CC 4LVOC 4DZ8A 3TN0A 1JHKL 4LLWA 1EO8H 3RFZC 3CVHA 3RVVD 1WCQA 1MUJB 4N0YH 1MRFH 3D3VA 1JHLL 3UTQB 4XP6H 3FT4A 4JGJA 4P9ML 2A1WL 3T8XB 2OBGA 3FQXA 1TQCC 4FQXA 2ITCA 1OD9A 4YDIL 2BOBA 4UT7L 1QP1A 1DLHB 4LLVA 1P84K 3LKNA 1QLEL 4NNXB 4NQCE 4XMPH 1EXUA 3EJYD 5KOMC 4X4YA 3GEWB 2OX5A 2MHAB 5LWYL 3GMMA 4FQJL 1HEZA 4HC1H 3GO1H 2CK0H 2L7UA 3RGHA 3MLXL 1D5IL 3TJEL 4UT6L 5CBEA 3OL2A 2AJSL 3GB7B 5DJXB 4G6ML 4JEGB 1X5AA 5DHVH 3N85L 4LVHC 1YPZA 5AEAA 4Y19B 1IAIM 1IVLA 5HPMB 1MWAH 5IF0B 1K3ZA 1I8LA 4GS7B 3C5JA 1HYSC 4WFHE 3OJMB 1YEFL 2JJTA 3N1FC 3PJSB 5TH2B 4UTAL 5JTWA 1QA9B 2BVQA 1EFXB 2AI0H 2M1KA 3FO0H 3S35H 2AJXH 4WU5B 3W9DA 5GS1C 4GG6A 4FQCH 3OJVC 1ONQA 3K8KA 5KW9L 3MV8E 1C08B 3P2TA 4WY7H 1G0YR 1MH5A 2R4SH 2ZCLH 2XNAA 5KVDL 3VG9C 5C0JA 2E6PA 1H3UA 1PQZB 3K46A 4NRYA 3UPAA 4ZAKD 3I3EA 3K81A 1DTUA 4YC2C 3EGSB 5DJCA 5KTEH 3AM8A 2R69H 1E6OL 4QRPB 1YEEH 5TDNB 3BH8A 5CJ8A 1JV5B 3AB0B 2HAZA 4WUUD 3Q5OA 4KXZH 3VXRB 1HI6A 2VAAA 4ONGH 3FN9A 4V1DB 4GKZB 5AYUH 4OLUL 5CSZA 1N3NB 3BWUC 1MY7A 1SQ2N 3TBSA 2NW3A 1NDMB 4F57L 3RVWC 4D8PA 4RDQF 5B3JF 1J8HD 1LE9A 1I1AC 4J4PA 5HYSA 1MCBA 1RJZA 4LSUH 4TSAL 2RFXA 4HAGA 3RWCB 2ATPB 3CCHA 4XPAH 4D3CL 1X4XA 2N7BA 2AW2A 3OXRA 4LBEB 3I3DA 3PABA 3TIDA 4CW1B 5EUOB 3UYOD 3FRUA 2Q6WA 2PW2B 1DVFA 3VXME 4KDTC 4KAQL 3GI9L 4L8DB 4YIQA 4N0RA 1F97A 3WUWB 1TZGH 2VDQH 3K3QA 1F6LL 4PJ7B 5GRUL 5E9DD 1G7HB 5DMIL 2PO6D 3OKNA 5E1AA 1YEGH 3BKML 3HG1B 3IDYB 5AZ2H 4MAYC 1ORSB 4LRIA 1JGLH 3QUMB 2DQCL 2AV7B 2D31B 2G5RA 3L9RB 4E5XA 2GJ6B 4U1KB 1QR4A 3VE0A 2IH3B 1OF2A 4NC2B 5DD5L 1B0GB 5AG8A 3ILQD 1MCCA 4YBQD 3MRNA 3QWOA 4R90L 5F71A 3KPOB 1RMFL 1BQHG 3LSOB 4LGSB 1D9KC 3ZE1F 2EDJA 5AUMA 4PP1D 3BPLB 4GKOA 5IHUL 4YPGB 2YRZA 2YPKA 2AK4D 3D3VE 3MGOB 1V5JA 3BFOA 3DV4A 2VSCA 1ETZB 4EUPH 1D5XA 2CMRL 3WUWG 3CFCL 4MA7H 5CINH 3SGDI 1JNLH 1U6AL 3C5ZB 4UMGA 3JV4B 4KJPD 3OX8A 4JDVB 1BFVH 4OGYH 1RUQH 3CH1A 4M5ZL 5MI0B 3AU1A 4XNQB 4ZOBA 2WUCL 3KDMA 4ODUB 1HNFA 3QCTL 4XC1H 25C8H