1OSZA

Mhc class i h-2kb heavy chain complexed with beta-2 microglobulin and an (l4v) mutant of the vesicular stomatitis virus nucleoprotein
Total Genus 74
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
74
sequence length
274
structure length
274
Chain Sequence
b'GPHSLRYFVTAVSRPGLGEPRYMEVGYVDDTEFVRFDSDAENPRYEPRARWMEQEGPEYWERETQKAKGNEQSFRVDLRTLLGYYNQSKGGSHTIQVISGCEVGSDGRLLRGYQQYAYDGCDYIALNEDLKTWTAADMAALITKHKWEQAGEAERLRAYLEGTCVEWLRRYLKNGNATLLRTDSPKAHVTHHSRPEDKVTLRCWALGFYPADITLTWQLNGEELIQDMELVETRPAGDGTFQKWASVVVPLGKEQYYTCHVYHQGLPEPLTLRW'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords MHC CLASS I H-2KB HEAVY CHAIN
publication title Differential thymic selection outcomes stimulated by focal structural alteration in peptide/major histocompatibility complex ligands.
pubmed doi rcsb
source organism Mus musculus
molecule tags Complex (mhc i/peptide)
total genus 74
structure length 274
sequence length 274
ec nomenclature
pdb deposition date 1998-06-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00129 MHC_I Class I Histocompatibility antigen, domains alpha 1 and 2
A PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1oszA02
3.30.500.10 Alpha Beta 2-Layer Sandwich Murine Class I Major Histocompatibility Complex, H2-DB; Chain A, domain 1 MHC class I-like antigen recognition-like 1oszA01
4YHIA 2DIJA 3O6ML 3C6LA 4JFFA 5EUOF 2CIIB 2APVA 1D5IL 1HQRA 4I77H 1SEBB 4JQIL 2KH2B 5ALBH 1ZA6B 1V7NH 4NKIH 5ESQB 4DFIA 4YBHA 1KJVA 3VFVB 1YEEL 2DTMH 2UZXB 3MV11 4HWNA 1MJ8L 1IM3A 5I19L 2XN9B 4LSUH 1D6EB 4X4XB 4OGYL 5IBUB 2GJJA 4HK3J 5C0BE 4IMLB 3RGVC 5HPMA 5ESAA 1TNMA 1UJ3B 5DS8A 3VFOA 1YEFL 3QI9B 5I16A 4NOBA 1AFVH 2JJVA 2EKJA 3KPTA 5D7IB 4ZS7L 3LHPH 3GUTB 4PY7B 3VRJA 3MQIA 1U8MB 5DJDA 1N7ML 3H0TA 5DMJB 2X4SA 1CFSB 2GKIA 2COQA 5I1KL 3CC5A 4UUJB 4WW2B 3AS3A 4LSSH 5JQ6H 1I3GH 1MFAH 3S98A 1B2WL 2FGWH 3EHBC 4UT6L 3V8OA 2WQ8A 4HGKC 3B4NA 4HJ0D 3BVNB 2GSIB 2JB5H 1FRGH 4PGDB 3C6SB 4HCRA 4M61A 1OTUC 1VCAA 1QSEB 2OTWB 4ODHH 4HKBA 1MLBA 1Y0LB 1AE6L 3QT2A 4BFGA 5I1HH 4QHLB 5SX5H 1BZ7B 5C0BB 3TYGL 2HT2D 4PJIE 5SWSD 2WUBH 4LCYA 3P77B 3WO4C 4C57C 2GEEA 3UTOA 1U8JB 4BUHA 2DD8L 4KZEL 4TTDC 5F7HA 4ODWB 1IGJB 3TH3T 1N5AB 5IROC 4PJGE 3TIDA 2VLRE 3WXWL 5C09B 1ZT7A 5A2KH 2VB5A 4NUJA 3NH7H 1G9ML 4YE4L 3KPMA 3AREB 3BXNB 4P5KB 1H9VA 3KPPA 1R3LB 5EOCH 1EAPB 3F7YB 2EC8A 4H0HB 1IC5L 4MAYB 1S7QA 4QEGA 3WIIH 4DTGH 3TO4A 5IEHB 4U1SA 3AB0B 5IMKB 5I17A 2DLHA 4PB0H 3TH2T 2QSQA 1FGNL 3TVMC 4GOSA 3CDGA 2HVKA 1BFVH 5H94A 2Q8BH 5CD5D 4TVPL 3CFCL 4MAUL 4ZQKB 2E6JA 5DD5H 1MUJB 5H35A 3TBYB 1IM9D 1JYNA 1YECL 5CJXA 3QEHB 3T0ED 3RTQB 2MMXA 4D3CL 4F15C 3U9PH 4KTEH 1CICD 1FLRL 1FNSH 2VLRB 2Q8AH 2X2YA 1P6FA 3BPLC 5D5ME 4PP8C 2AJ3A 5HVGB 5A2FA 3O8XD 1PZUB 1FYTD 1YPZF 2WIMA 5D72L 1II4E 1MVUB 3RHWF 3TV3H 1XR9B 5L2KA 2D4DA 5IK3A 4CMHB 4J3WA 4MJID 4BFEA 2BZDA 5GGVY 4ZNCD 3ARFD 5C86A 4FQ1L 1BGXH 4LNVA 4PR5A 1JI1A 4JEGB 5IQ9B 1AGCB 2EE9A 1KCUH 5EZIL 4FXKA 4M1GH 3QDAA 5GGQH 4KJPD 3IF1B 4PRPE 1FNGB 2L0DA 4POZD 3KPRD 3QSKB 3HTLX 1WCBA 1HWHB 2V2WA 4KTDH 4U6XA 4K7FA 4D9RD 4L8SB 1QKZL 1OWRM 5E08H 3QRFM 2E27H 3F6LA 5TH2B 1OAXL 3EFDH 5I1AB 4QTIL 3AB0C 1X9QA 1VGEL 3OGOE 4Z95L 4UV4L 1Z9LA 3QIUB 4HUMB 3NIFE 3ARBD 5JW4N 2BHZA 5JORA 1SY6A 3QUMB 4HPYH 1DLFH 2YC1B 4OF3A 1F4HA 2K9UA 2AEQH 3P73B 4BQCA 4LAQH 4LEXL 4NO0A 3ULVL 4XCEB 3VFMB 1Q0YL 4RAHA 1AR1D 1R3KA 5TQ0L 4AEIL 4WWKA 1QSFE 1QLFA 4GLRH 3PP3K 1UB6A 3V5DB 1BIIB 3MRNB 1MHEB 1LP9E 1RMFL 3HMWL 4M7KL 5JPMB 3TN0B 5KSVA 4X5LA 3ABZA 3OHXB 3CXDH 2ZCKH 4X7TA 1B0RA 4I18A 2EC9U 4PJ9C 1EEQA 4HMCA 1FO0B 1JGUL 1WWAX 3C5ZA 4U1NA 5GGVH 4X8JA 5BCAA 2CR3A 1JPTH 1X5IA 2E3VA 3ZE1F 2R15A 3OXSA 2OZ4A 4JDZA 5L2JA 5DJXB 4L3ED 3P4MA 1FVDB 3VGHA 3B5HA 3WIFB 5C07B 1WEJL 3OG4B 2F58L 2JIXB 4Y4FB 1OP3H 1QACA 2X05A 3TNNB 1KPRB 5HHXL 4HBQA 3PWLB 4OI9A 4F7TA 3FQUA 1JYWA 1R3IL 2EO1A 2L4OA 1CLZL 4S1DC 1CZ8H 3SE4C 2NY2D 4Z7WA 3PGDA 4ZSOA 3NACH 2OM5A 1VESA 1GZPA 4G80B 2HFFB 2C9AA 1LP9B 2ITDB 1DL7H 3D85D 2VDQL 4HXAL 3HR5A 3DMMD 5DFVC 3V0WL 1A7BA 4U4BA 4PJ8B 3TZVD 4HKZB 3QDGA 4KRPD 3SCMB 3KPSA 5ID1A 4ZS7H 3C08L 2M2DA 3RZCB 2K1MA 1KC5H 4JN1H 5IFHL 1T4KA 4D0DB 2P49B 5ICXA 4AG4H 1U91B 5C0FA 3OF6D 2BSRB 4IOFD 3HAEA 4D9QD 2H3NA 4Y16D 2WLZA 4GG6F 1AP2B 4IRSA 2R1XA 3BH9B 5K59E 1BVLB 4GJTB 1FNEB 4Q7DA 2ZSVA 1JMZA 2VL5A 4U6VH 1AI1L 3WNNA 2VDLH 2EDEA 1XIWB 2GAZB 4GW4A 1DR9A 2HN7A 1RQ5A 4JO1L 1LE9A 1VKXB 3MRJB 3V4VH 4XCFH 2Z8RA 3TYGH 2A73A 2BRQA 4P3WA 2HRLA 1OGAD 3NOIA 2XQYK 4NZDA 1CBVH 1UZ6F 4XWGL 4KJQD 5E4EC 1Z0NA 3MUGB 5BS0B 5CSZA 1EXUA 3JSSA 2FH6A 5FYLE 4WHTB 2R2HB 4JO3L 2RR3A 3V95A 4ODUB 4P9HL 5DMIL 1OP5K 2BNQA 5DRNA 1P7QD 3MGTA 1H0DB 4TSCH 3A6BL 1KJ3L 2XKNB 3GSUA 3HG1D 2HRPH 1KJMB 4WY7L 4UTAL 1MY7A 4JZJB 1KB5A 4P2CG 4P2RA 2WP3O 3T3PF 3S37H 5EB9A 3BAEH 2H41A 1GAFL 1MIEH 4YHLH 3BEWB 5E8EA 1IC5H 4Z76B 1IQDB 5IM7A 1JVKA 1Z3GH 3FN9A 1H3TA 4NWTL 1A1MA 3QEQA 2NX5E 4FQXB 4KMQA 1BLNA 1LEKB 1W0YT 1N8ZB 2C3VB 2CGRH 2KQMA 5GGTH 5C0RH 1FFPB 1DQJB 3PNWA 4JG0L 5T1KB 2CO7B 1FG2A 3BJ91 4UTBL 4QRRD 3I75B 3D18B 2MKLC 5EU6A 4X4YB 2QKIB 2SEBB 4WGWB 3K3QA 3KYKH 3V52L 5D7LD 5HBBA 1Q72H 1YEHH 2Z31D 4D3CH 4RISL 3NAAL 1QRNE 4Q6YA 4TSAH 1XIWC 1XGUB 1AO7E 1DBAH 2EXWD 1UWEH 3QDHA 2WBWB 5D72H 4GQPH 3VGAB 1KLUB 3RHWK 4EQ2A 3HZYB 3QNYA 3UAJC 1QPPA 2Z93A 3CSBA 1BBDL 5DHXB 3WUWB 2AI0H 1MWAA 2AK1H 5I30H 5DLMH 5FDWA 2ATKB 4PP2B 4ZXBB 4DZBA 3SY0B 4LSPL 2ADJA 3PG2A 3VXUE 3QH3A 4YHPB 3S3SA 3OGCB 2IFGA 2CRIA 2FX7H 3HZMB 5IBTH 4O2FB 4N68A 1IGYB 1EUUA 2NCMA 4GAYB 2XXMB 4BA8A 3QYCA 2IANE 5TFSL 4RGOH 4JY6B 4NBYB 4XMLL 5ERWA 2ZKHH 3KJ4B 1BBJA 1QLRA 4X99B 4AEEA 3UTZA 1KCVL 1RK0A 3DO3A 2P47B 1INEH 4YGAB 1RZ8A 4UV4H 5I8KH 1EFXB 3H7BA 4Q9RL 5J1SC 4DFHA 1AO7B 1LO5B 5ISZB 4R7NB 3O4OB 1OTTC 3PDOA 1EEUA 5CHNA 4M5ZL 4QRPA 4M48L 4U3XA 1J18A 1F4YL 1ERNA 1YEIH 3W39A 5GJSH 4J3UA 4PREA 3BX7C 1SMOA 1HI6A 3PDGA 5I8OH 2FD6H 4R0LB 4F7MB 3HUJB 1T1YA 4Q6IA 4U1MB 1NGQL 4RAVA 4H8WH 3SE8H 4HLZG 4JO4H 4Y2DD 4M7KH 5F89A 4KKAD 4LIQH 4BZYA 2DL9A 3MCG1 5D7SL 4C4KO 3KPQB 3WLWC 1JYVA 4ELMF 3SGEH 1YMHB 1MF2L 4DGIL 4B50A 1ZT4A 2OX5A 2JK5B 1I9RL 4HT1H 3B9KA 3VWJB 2Y6SC 2G2RA 2PYEE 4GRLD 1A64A 5F9WC 4MDIA 4YFLI 3PWPE 4YAQB 4L4VB 1YZZA 3I9GL 3VE0B 3QWQB 4Y5YC 3BN3B 3CCHA 2MCG1 4AIZB 5DK0A 1GGCH 5GRUH 2EE3A 3BP5B 3QXDA 2VIRA 2N4IA 2YD3A 2OTUB 5E2VH 3ARUA 4LQFH 3SDDA 4WFFE 2XZAH 1X44A 4Z78A 1CFVL 2UZIH 3LS5L 5CEXA 5LBSL 2GY5A 3EDKA 3TBSB 4IOSD 4OB5L 3LPWA 1HNGA 4G6FB 3DV4A 4M7JL 4HXAH 3EAKA 5CUSH 4MXWH 3RWHB 2J6EL 1WIUA 4U05A 1DDHB 1P5VA 2DQHH 4X7EC 3UX9B 4HUXA 4R6UA 2V9QA 3QUML 2LV4A 2OR8A 1AGDA 3QUYA 1E6OH 4OD3H 1KENH 1I8LA 2DLIA 4TULH 2IADA 3NTCH 2EDBA 3KHQA 2XFXA 5IMOA 1FNLA 2BNRD 1DANU 3LSOB 3FFCB 3MLYH 1PJ9A 3EBAA 4N5EA 2AEIT 3PV6A 4ZFFA 1IE5A 2UWEA 5MEPB 4PIRF 1VA9A 1CTNA 5J8OA 4PGBB 5JUEL 2VLLA 2RFXB 3FOMA 5E94B 5HYQB 2OK0L 5EOQH 2I27N 2EDNA 1FG9C 1FO0L 2GT9A 2V7NA 4L4TE 4XVUC 3H3PL 5ADOL 1XT5A 3ISWA 2DQCL 3FFDB 3ZL4H 4PJXA 4Z7QE 3OAZK 3WDJA 1P4IH 4BZ2H 1VACB 1QFWM 4Y19D 4IRJD 2P5WB 4AYFA 3QUXB 1OAZL 4PB9L 2YEZB 4M3JA 4PRDB 5DMIH 4JY4A 1JGDB 2HJKA 2YD2A 5A16A 1ZHLA 4MXQC 3MO1B 1JUFB 3A6BH 4NQED 3TPUB 4JN2A 5EO0A 5D1QD 1RZGA 4YHML 2W65B 3ZTJH 2IBZX 2ZOLA 1JWSB 2IQ9L 3BKCL 3ARGB 4JDTL 3LQZB 1LGVA 2FJGB 5HHOE 3MGOA 1S7SA 2PN5A 1CD0A 2YKLH 2F54B 4NWTH 3BUYB 4P2OB 3F5WB 4R4BB 4S0TD 5HDBE 2HTLC 4X6DE 4KAQL 3VRIA 3GKWL 5SWQB 5ANME 3CLEH 1NCBH 2DLTA 1FFRA 4UTBH 1G7MA 4JFXB 4BH7B 3E6FB 2VDPH 1I3RB 1PQZB 3UPCA 1KPVB 3C9NA 2FEDC 1OY3B 1BD2D 1G6RA 1XCQB 4WUKL 5IBLD 3NAAH 4OZ4B 3EJZD 2LE9A 3CVIL 2XTJE 4EEEA 4JKPH 3RGVD 2X4UA 5I6XB 2A6KA 1QYGL 4CN6A 4OZHB 4CL7A 4HC1H 5DUBB 1CVRA 5BJTB 5L88H 3KXFB 2K3TA 1JGVL 5C0AB 1M7IA 1MI5D 3B3IA 4YO0B 1HXMA 1HINH 3DURB 4FQ2H 3NCYP 4FQHB 4LDEB 2YPVH 2DIAA 3IFOA 3BP7B 4M6AA 5HHOB 1FL3A 1MREH 3NZHL 1CK0L 3MOQA 5C0IB 3VXQA 5F7LB 3QZWB 5DEGA 2WM0A 4OM0H 3W0WD 2AJZB 3WS6C 1A3RL 2CPCA 1DUYA 1D5XA 3T2NL 3UO1L 4E41A 4F58L 3QAZB 5ANMB 1P1ZB 3C60C 3QWRD 5MI0C 2VRAA 4WUUB 1A6ZA 4IM8A 3S5LB 1OTUD 5EBMA 2LU3A 1X6NA 3Q5TA 5FO8A 1CD9B 4Y4HA 4JKKA 2NW2A 2J8UE 4G8IA 4MJ6A 4MNGE 5E8DL 1RIUH 3KPOB 5DWUL 1DBKL 4CDHA 4OBSA 3WE6A 4PJ5D 2HJFB 4XMPH 4NBZB 4TTDD 3V6FA 1JFQL 3MUZ1 3RDTC 5IJKC 3NPZB 3PIQB 4UDUA 3CPLA 3T0BA 2ZUSA 5JHDD 1H8OA 4D8PB 3ARPA 2QQNL 4YC2C 1ZKAA 3RZWA 1UG9A 3DX9B 4HUVA 5E7FA 4W4OC 2IMMA 1RUKL 5DVLA 5TE7H 3SDCD 1FAIL 2A83B 3HI6L 3Q6GL 3L3KB 3V6ZB 1HHKB 3VFWA 5IOPB 4ZPTB 2OI9A 4YK4C 3EJJX 4V1DE 4MA7L 3ARYA 1Y18B 4GFTB 4LCUB 5BRZE 3KPLA 1ACYL 3VH8A 1GCFA 3R06A 5T1LB 4QRUB 4M4PA 4WTXA 5EC1B 3LOWA 2QTEA 2NY6D 1J0ZA 1MCIA 3H9HA 1I9RH 1S7VA 4DZ8A 4NQXB 2FHBA 4JRWA 3LD8B 3GSVA 4ZPVA 4EZMA 3NGBB 5I8CA 3FT3B 3PQYD 1GHFH 3BPNC 3QAZC 4PJHA 4Y4KB 3SQOL 5BXFB 4Z0BL 1FL6A 2YPLD 3EJYD 4WRLA 2CSPA 3CFDA 4PP1C 3HE6A 1IGIH 3WEXA 1EV2E 5KSAC 2Z4QA 3C2AH 4ELMA 4DVBA 3DO7B 2JE8A 2YBRA 3G5XB 2ED7A 5JW4Q 3L5IA 5ITFB 1D5BA 2JJTC 3DV6B 1WTLA 1CG9B 3Q3GA 4JFDA 4QYOB 1QUNA 5CEYA 3JV6B 3UZVB 1HOCB 2CMRH 4F7PA 2XTJC 3X14B 5K9QI 3O6FA 1J88A 5IFAL 1WBZA 1ADQL 1BEYL 3RUGE 4V1DB 3U4EB 4FZ8L 1JPSH 1EMTH 5J11C 3RU8L 4ALAH 1ZLUK 2ZJSL 3WFHA 3U4BL 2C3HA 3CU1A 4PV8A 4NNXA 2R23A 5F9JA 1QA9B 2Z35B 3VXMB 5BQ7B 1ZGLP 2F8VA 5E24E 3ROLA 5CP7A 3O11B 4YXKL 4KDTA 5KVGH 3WL9A 5DR5L 4YHIB 1L6ZA 2PW1B 3C6LB 4JFFB 2H1PH 3QIWA 3QUZD 5IB4A 4JGMA 4DW2H 3TA3C 1KJVB 2YOCA 1BQUA 3RQ3A 2AERT 1IM3B 3X11A 5CEZD 1UKQA 4I0PC 3TJHA 1U93A 4RMUA 5FHAL 1NGPL 5ADOH 3QFDA 4XCCH 3PHQB 2IF7A 3L1OL 2DDQH 5JXEC 2WV3A 3MJ9H 4P49A 3SE9L 2E8ZA 5KVMC 2AK4A 5T3XL 1C1EH 5HPMB 5ESAB 2ZUVA 5DS8B 4RIRA 3B43A 1H3PH 1NFIA 1IRAY 4NJAL 4UILL 2WBJC 4G7VL 3FT4A 3F62A 4RSVA 1Z5LA 1TFHA 3VRJB 4XHJC 1MHHB 2BVTA 4KKBC 5DJDB 3X17A 1I9EA 5CWSA 4AK1A 1CXIA 4MD4A 3GNML 4ODVL 4X6CE 3JV5A 1M05A 3ALPA 3CC5B 3KAAA 3NIDE 3FJTA 1IC4H 4NO2B 5D6CB 3CVHH 4QWWC 4WI4A 5HHMA 1BVZA 4N8VG 5B3NA 4KZDH 1MLBB 3MRHA 3T4YA 4LCYB 1X4XA 1C7TA 3D39D 4LNRB 3ZYZA 5CGYD 3CVIH 3OSKA 4O4YH 1RFDH 4U1HB 1KTLA 2QSCH 3S7GA 4JVUA 1QQDB 4X80L 1CGTA 2VDOH 5B4MC 1YEJH 1FGVH 3ARDD 4DKFH 5AEAA 3TIDB 1ZT7B 1JGEA 4NUJB 4YIQA 3P4NA 3S9DB 3KPMB 5IVXA 3RVVC 4X6CB 1LWRA 3EDEA 1CL7I 4S1RL 4CMMA 5E56A 4I3GA 1HHHA 1S7QB 4HGWA 1XMWA 5ACZB 3UO1H 5T5FL 4MNHA 5L6YH 3TO4B 5I17B 1H3XA 3H9SE 4AL8H 3WIHA 4WU5B 3UZQA 3CDGB 3T3MF 2HVKB 5C08D 1YEDA 5H94B 1G9MC 5L8KB 2JCCF 4GMTH 1AHWA 3CU7A 5TQ2L 1T1WA 4LIQE 2ICEA 3P0GB 4YJZL 5D7KD 4HFUL 1JK8B 2YZ1A 3D0VA 1U9KA 4N1EA 4OLZH 2WWKO 1JN6A 4C59B 4PJAF 5HI5D 4F7CB 1CWVA 1JFQH 2RCSL 4CGTA 2ED8A 3C8KA 3P0VL 1I1YA 4NZRL 2AKRA 2VLJA 4P46C 1DQLH 4PGCB 4JFPA 1N5YL 3HPLA 2QR0A 2VSDA 5L2KB 4LHUG 1DQDL 5LXGH 3SGJC 5IK3B 1H5BB 3Q6FA 3QHFL 4XNQA 4YNYA 4ERSH 4MNQD 3L3JA 2MQ0A 1LK2B 1ZEAH 3C5JA 2A77L 5F9OH 4JM4L 2E9BA 4M1CC 4FXKB 3VD9A 1FZMA 1UT9A 1Q9WA 3BH8B 3RWJA 3V7AE 4CVWA 2Y36L 1VEOA 4QRTA 2BVYA 4LSVH 1JGLL 2V2WB 3SKJL 1XFPA 5F1IA 5B8CB 4K7FB 4ZUSB 3KG5A 3HLAA 1K3ZA 3L95A 1S7RA 2VDNH 5T5NG 4ZO9A 4ZFGL 4FFZH 2FBJL 5E95B 4TVSa 5HPOA 4YX2H 4KJWC 3TT1L 2R0WL 1INDL 4RAUB 2GY7B 4R90H 2D7PA 4JR9H 3QEGH 5JORB 3SDAA 1WBXA 1HEZA 4KVCL 4NO0B 3V5HA 1KXVC 1R3KB 4WWKB 3TBTA 5KVFH 3S97C 1J8HD 1F2QA 1QLFB 2BCKB 1H8NA 4HZLA 4N0UE 4BM7A 4LSQL 1BEYH 1CDBA 3ZZ1A 1G7JA 1UB6B 3L7EA 3LEYH 1I75A 2X44D 3OZ9H 2X89D 12E8H 5EUOE 3TFKA 3M1BB 4LLDA 3UTTE 5KSVB 5JNYA 3MV7A 2C4XA 1LO3L 3CK0L 5EBGA 4YQXH 4F33A 4FZEL 1H5BC 1B0RB 4K71C 4QGYA 4PBWD 1BIHA 3MGAA 1R24A 2MPAL 5DD0L 2Z8VC 5MENA 2CDFB 4U1NB 4X8JB 3UTSA 2R0ZL 2R0KL 4PTUA 3CX5J 2DWEA 5E03A 5BO1L 3S36X 3OXSB 4JDZB 4FOMA 4I3SL 3BZ4B 5L2JB 3P4MB 2EZ0D 4KK8C 5D93B 3IJSA 4MWFA 3J8F7 1UEMA 5B8CC 2UYLA 3QJHA 4LU5L 3FQUB 1C5CL 4M9OA 5FHAH 2NY3B 2HAZA 4ZNEE 3D5OF 1ETZB 1R5IA 3LZFH 2BDNH 4Z7WB 1BJ8A 1SEQH 3I85A 2DYPB 4N0UB 1GZPB 4ZUTA 4LK4A 5FK9A 3GEWB 4WEBH 4NC2B 5E99L 1MIMH 4LPYA 1H15A 2GJ6D 3IDMA 4ZFOA 3HR5B 4IJ3B 5IB3A 1WISA 5DHYA 1S9YA 4J4PA 1MFBL 4IS6A 3QDGB 5ID1B 1DQQA 5D71L 5H37H 1DQMH 2APXA 4G8EB 5IESL 1T4KB 4WU7A 5ICXB 1E4JA 5D1ZB 4U1IA 2IAMB 1N6QH 5FYJD 3VG9C 3GM8A 3AY4C 2CKBH 4M7LT 1M6OA 1HN1A 1MELA 4IRSB 2R1XB 1FFOA 3AM8C 5TPWH 4KKLC 4UNTA 1FSKB 3MLRH 2RB8A 4E5XA 1SM3H 3LEXA 3QULA 3ARRA 3K1KC 3ELAT 1XF3A 4L5FH 1NCTA 1YN7A 5JIPA 4GW4B 4X98A 4UBDC 4GT7A 3C8HA 4A2MA 3RVTC 1J12A 2YD8A 1S5IL 2A73B 3FOLB 1BZ9B 3MRLB 3V8CA 5IBUG 1U3HC 4WFGD 4LRIA 2DM3A 2EICA 1FC2D 1MCFA 1WWWX 4QOKA 4D9LL 1YUHA 3DI2B 3FQNA 3MZTA 1UACH 5EU6E 5BOZG 4FFYH 1WAAE 4OCSH 3BUTA 2VH5L 3ZTNL 5CSZB 2PKDA 1EXUB 4YBLC 1Y6NR 1T7WA 4LASL 2NXZC 2BNQB 5DRNB 3ZSTA 4NYLA 3ZDZF 4MVBD 4FMKA 4CU7A 3BDXA 2I60H 3U1SL 4QCIA 1UYWH 1FDLH 1QFWI 3NCJL 1GYAA 1A14L 1HIMH 1XGTB 4JRXE 1N59A 5E8EB 1X6LA 2VZOA 5IM7B 3GK8H 4XNXL 1QFUL 4CNIA 4V3DB 3RL2A 1A1MB 2I26N 2EIBA 4FFWD 1K4DA 1QNZL 4QXUL 1J0IA 4XCNA 2FJFA 4Y5XB 3PNWB 1YPZE 1NAML 3MV8E 2HTKD 4LCIH 4NN7C 1JV5A 3L5WA 4XVUD 3VFTA 4UT7L 5IJVB 5EU6B 5FFLA 4LVNC 1FSKC 3ZLQC 3D25A 2XRAL 2ZG2A 3E2HC 3LQAL 1JWMA 5EIQA 5EDXA 3EYUH 1A7RH 2F19L 3RRQA 2BSED 3F7QA 2I5YH 2PUQT 4LSRH 5LGHH 3UJJL 2VE6A 4XP5L 3UDWC 2V17L 5EH1A 3QPXL 4NC1E 2I24N 2J5LC 3QNYB 4KQ3H 3QDJE 5IB2A 5HYJE 5EO9A 2Z93B 4IMKC 5HD8C 1QO3A 3NCMA 3HNTH 5JDJA 1MWAB 3N1FC 4IRZL 4S1QH 1WF5A 2YA1A 1TLKA 1QLEL 5AG8A 2ADJB 4LHJB 2HFTA 2DQGH 3QH3B 2AXHA 4C56E 1H8SA 1P4BL 1YPZB 2J12B 5J89A 1RHHA 5EBLA 3DGCR 3BZFA 4OD1H 1EVUA 2KDGA 5GGUA 3V4UH 1BBJB 2VXTH 5GQBA 1AXTH 4LMQE 4JFEE 1BHGA 2A1WH 4EIZC 5IHZA 5IV2B 4XI5D 3PUCA 1Q1JL 3UTZB 1RK0B 4WI9A 5D8JL 3VJ6A 1RZ8B 5FECB 3H7BB 1E4WL 3QIBD 3JUZA 1Z9OA 3LRHA 4XBEL 5DJYA 1T3FB 4QRPB 4J1UA 4Z6AT 3QDJB 4LLQA 4FRWA 3ECBB 4PREB 4J7RA 5HYJB 3WFDH 2W07A 3Q1SL 1HI6B 4KVCH 1RUML 3KVQA 3MRGB 4XB8A 1FV1A 7FABH 5JW3L 3TT3H 4Q6IB 2R2CA 4UIMA 4RAVB 3ZE1E 4WI5A 3AS0A 2HG5A 1GOHA 35C8H 5GIRA 1LO3H 3CK0H 3OAYK 4G8GA 1GOGA 3B2UD 4FZEH 1GGBL 4HF5L 3HB3D 3OR6A 2MNUA 1KB9J 2FHCA 4O02L 3B9KB 1PAMA 4HULB 1EHXA 1MRCH 4WO4A 4W6WB 4MDIB 3P30H 4GBXD 5KN5A 3DUUB 3CCHB 2X40A 3BD5A 3RNQA 2EDHA 2OMNA 1LO0L 3ZE2E 5DK0B 4NQDD 1WV7T 1MFCH 2X70A 3QXDB 3RKPA 3QNXA 4YZFF 5T3ZH 4ORGA 3LQMA 5D1XA 4N5UA 5JXAH 3TBVA 3SDDB 1RURL 4Z78B 3LS4L 2C1OB 1DN0B 3FO0H 5FGSA 3CX5K 1QFPA 2FO1A 4H0IA 5JR1H 5GS2H 1U8LA 4NC1C 1MFEL 4GG6E 1NGZB 2ESVA 5E00A 3GBMH 1RUQL 1MFBH 1A22B 1SY6L 2NY4C 3IDXH 4HUXB 4WW1A 2NPLX 5MHSD 4N0CD 1AGDB 3QUYB 3SE3A 1B6DA 5IIEB 3BHBA 1CGYA 1KCSH 3GMPA 2IADB 1YA5A 2K7PA 1E4KC 3B83A 2XFXB 5IMOB 3B8YA 4KHTL 1F90L 1T20A 2X9XA 1NBQA 3CNKA 3ZSSA 2IPTH 1UZ6E 1UM6L 4EN3D 3KJ6H 5IW6A 1AXSB 3PV6B 4ZFFB 3O4LA 2AJYL 2YK1H 4QTHA 4UV7H 4NT6A 2GITA 4EBQL 3BDYH 5C0CE 3PXHA 1W8OA 3WN5A 3NBNA 3EYVA 5FGCB 2A6JA 3ZO0A 2VLLB 1F58L 2EC9T 3CVHB 4APQA 1GC1H 1ZA3A 2GT9B 4G9FE 5FUZH 3N1GC 3T3PE 4PJXB 5DUML 2OZ4L 3GSRB 3LN5A 1N0XH 3HNVL 1EJOH 1OM3L 5F7WC 1G0DA 3S6CA 1GRWA 4LKXA 3LKSB 4Y1AE 4KUZL 4AEHL 1JCKA 3LKRA 2XWTA 3MV9D 5A16B 1ZHLB 3MLXL 1T83C 1X5HA 1L0XA 4J23A 5KW9H 1CE1L 2HT4C 1YYML 5EO0B 3NCJH 1RZGB 4PJCA 2APFA 4LCWE 3D9AH 2ZOLB 4PJEF 2R4SL 4MA1B 2CRYA 4XPBL 3OR7A 3EOAB 1S7SB 5GS3A 3IFLL 4B53A 5KZCB 2VZ1A 4F8TA 4M93C 4X7DC 1MPAH 3UYPA 3TA3D 3S35X 5DD3L 1A3QA 5KTEH 3VRIB 4I2XA 1R0AL 2DJ4A 1A1OA 5TJWK 3KLSA 1EHAA 5JA9A 1HHIA 2MHAA 1OD9A 5TDPA 1S8DB 3C9NB 4P5TD 5JXED 5ILTL 5GS1A 1I4FA 2EDOA 2BNUA 4OFVA 3T8XA 1EZVX 1REIA 4OCYL 3JVGA 2X4UB 4IDLA 2LTQC 2XA8H 1XZ0A 3ULUF 1M7IB 3O81A 1ZWIA 2QQKL 4KQ4H 1PG7H 3B3IB 1HXMB 4UU9A 5KS9A 1U92A 3IFOB 5CBEA 2W9LA 1FL3B 2ORBH 2R0LL 4U31A 5HXMA 3VXQB 1DP0A 5J9PA 3WFEL 5I75B 5DEGB 1S3KH 3O9WD 5AZEL 4WI2A 4DGYL 4EUPA 1DUYB 1D5XB 1DSFL 2RAMA 4KROC 4OF5A 5D9SA 4E41B 3STLA 1P53A 4Y2OA 1CD8A 1ORSA 2VDML 2NYYC 1A6ZB 4TSBL 1BJMA 3G5YA 3CH1B 5GRXG 5J3HC 1KB5L 4EI5D 5EBMB 5FO8B 4Y4HB 3VXSD 2NW2B 2A74A 4MJ6B 4LF3A 1OGTA 1RZIA 3MUY1 1Z0MA 2VXQH 3D69A 2NLJB 2ICES 1PLGH 3WE6B 1TJIH 3V6FB 4KY1H 3VCLA 4UDUB 2XQBL 3CPLB 3FQRB 1UFUA 4YHKH 1NMCC 5FCUL 4MMXC 4Z7NF 4HS3A 3ZT7A 3GMLA 2VXSH 4GSDL 4NRXB 3WUZA 2ADIB 4UQ3B 4I0KA 3OKKA 3WUWG 2G5RA 3ZKQD 4HUVB 3U9UA 1CT8A 3H9ZA 4JY5L 5FYKD 5IB5A 3ZDXF 1FLTX 3V6BR 1B4JL 5F71A 4KXZI 4FTVE 2QADD 1JF6A 3VFWB 2PTVA 1HYSD 2OI9B 4CW1A 1IAIM 2AEPL 3R06B 1W72H 5BW7A 4TRPH 1MAJA 3H9HB 1NGWA 1S7VB 3MMEA 5DQDL 4DZ8B 3DXAA 4P2QE 1A6PA 5EG6C 3GSVB 3PWNA 3LEVH 1EO5A 1CDHA 4PTTB 5I8CB 3OPZH 1YEGL 4PJHB 1BVKA 1FL6B 3CFDB 4XMKL 3HE6B 2GW5A 3SPVA 4ELMB 4P46D 1KPUA 2YBRB 4GUPB 3GI9L 2R29H 4RQQA 1D5BB 3Q3GB 1KB9K 4JFDB 1AQKH 2E8YA 5LKNA 1TZHA 4OZIF 4F7PB 3O6FB 5B22A 2APTA 2Q86A 4URTB 4TVPD 2GTZA 4KV5F 5BVPH 1YDPB 5EULV 3U7YH 3QDME 2PO6B 5DZLA 3O6LL 2DQUH 1KJ2H 3HE7C 4K8RH 2EH7L 4RWYH 2VQ1B 1IGFH 4YUEH 3QCUL 4BYHA 3S88H 2VLKA 3EIFA 4FN0A 4MCZA 5CSGA 4HAFA 4D0CB 1LDPH 4YHZH 4Z7VF 3VFPA 4PV8B 2MKWA 1ULVA 3PGFL 4P2QB 4OM1H 2R23B 1UKTA 2CIKA 3FN0L 3ROLB 1TZGL 5CP7B 2OXGA 3QIWB 3MNZA 5IB4B 2Y1VA 1YMMD 4F7EB 4RWHA 3T4AB 4KKNA 2P5EE 2F53D 4XP1H 2CJUL 1GXEA 1F8TL 3X11B 5CZVH 2CUMA 3LIZH 5K9OB 1U93B 2CXGA 4OKDA 3QFDB 2XOTA 5SWZA 5L0QC 3GRWH 3QDMB 1TETH 2BFVL 4MQSB 4K3DL 4KPHL 3MA9H 5ETUA 2E9IA 4NUGL 2AK4B 5AZ2H 4AEHH 4JRYD 2D7TH 4DKEL 4P23A 4PJBA 5TDOA 1NFIB 5TDNA 4PJ7F 1G7PA 1Z5LB 5ITBH 4N1HB 1S9WA 3UJIL 3R8QA 1CFTB 4JPVL 2PO6C 4LLWA 2APBA 4MD4B 3GO1L 2W60B 4DAGL 1OTSC 4MA8H 3ULVD 4XPTL 2JELL 4HW6A 4OF0A 2X4QA 2UUDH 4LL9A 4G43A 1X5FA 1NCCL 3DIFA 2P5EB 4RMWA 3P0YH 4KK8D 3MBED 2HMID 1P2CA 5HHMB 5KOVC 1NAKL 2PR4L 3WS3A 4JB9H 2E7LA 5I8EA 3GSWA 3MRHB 4TYUA 5GRYA 4OTXL 5CZXC 1FYHB 3U30C 3T4YB 1OLZA 3RJDA 5EZOL 1D9KC 3O3DA 1U58A 3MJ7A 5J6GA 4QXTA 4F57H 1ZGLA 3EZ8A 1JZ6A 1PDKA 4EDWL 3NN8B 5I1EL 5KSUA 1W0VA 4YIQB 1JTOA 3P4NB 5DRXA 1YC8A 1K8IA 2DS4A 2XXCB 5IVXB 4H25A 1E0OB 2GI7A 4A2LA 4CMMB 3DX8A 4JLRB 1OAQH 3H8NA 4XWOD 5FGRA 4JO2L 4MNHB 3MJ8A 1DVFD 2GK2A 4TNVF 1JF5A 4M1DL 3VI4F 3PL6A 3T2QA 1T0NA 1YEDB 1AHWB 1A7OH 1T1WB 2NY1D 2NNAA 2QJDA 3H2WA 3RVTD 1JNJA 4M62L 2IPUK 1U3HD 1UJTA 4DN3L 3QWOA 1JN6B 3HC4H 4FMFA 4CBPA 1J1PH 4EDXA 1UKSA 3OL2A 1NFKA 4N90E 1JNNL 3QG7L 4X8XA 1I1YB 1C7SA 2AKRB 2LFGA 1KFAH 1NGXA 2VLJB 2ED9A 4HIJA 3JTSA 4JFPB 3HPLB 2QR0B 4TQEH 3A6CH 3GI8L 1KIUA 5CIPH 3Q6FB 4XNQB 1G6RL 4EUPH 4YNYB 2XZCL 1OSZA 2DLFL 3ROOA 4LLVA 4QHMA 4OLXH 4NC0B 3C5JB 4UB0H 5T3ZE 5FO9B 2A9NL 4TOYL 2XNAB 4R4ND 4CVZA 1Q9WB 4EQ3A 3OTTA 1YNLH 2DI7A 3MROA 3MRDA 1JPGA 4G7YL 2XN9D 1KIQA 5FV2A 3VWKA 5F1IB 1CXFA 1QBML 3MLWL 5JOFA 5M95B 3HLAB 3ZKNC 3L95B 4LCCA 1S7RB 1W8NA 2CLRA 3HHRB 3QFJE 4MJ2A 4PJIF 3ESUF 4LHUA 5I1CL 4OLEA 3MLSH 3ULSA 1A7NH 4QGTA 1ED3A 2NR6D 4GW5A 4QRSA 3QI9D 4LP5A 4OQTH 4NQCD 1CS6A 2EEAA 3I6KA 5EU4B 3QQ9D 1U8NB 4JPKH 1WBXB 4H88H 2OYPA 1CL7L 2BVEA 1HEZB 4MA3B 3V5HB 5TE4H 4N0RA 3VRLF 1I1AC 1OWWA 4M00A 2QHRL 3BPOC 3HRZA 4HZLB 3LDBB 1G7JB 1HH6A 3S35H 3L7EB 4Y7MA 3PHSA 4LLDB 1RJCA 5JNYB 3MV7B 5GGSA 3WKML 2DQJL 1KXQE 4BKLA 4OKVA 3VDCA 5KJRH 4Q2ZA 1A9BA 4F33B 1QSED 5F44A 3PGFH 1DE4B 3I3DA 5DRZB 5HGHA 1R24B 2MFNA 4XZUA 4PJFA 1T0MA 5MENB 4KWUA 3UTSB 1O7SA 5IWLC 2WZPD 2I9TA 2CQVA 3ZKXB 3C5SB 4DEPC 5I1LA 1CLOH 1HDMB 3FQWA 4L9DA 2FCBA 4AMKL 2Z92A 2O61A 1RJLA 3IJSB 4MWFB 5CMAA 3UC0H 5KG9A 3HI5L 5F96H 5C09D 2BOBA 2UYLB 3GGWA 2FBOJ 1NGYA 1KULA 4FQQA 1NC2A 2YD1A 3BWAA 2YD6A 3WBDA 1R5IB 1NUGA 3ARED 4PUBL 5F6HJ 2J8OA 4ZOCA 5FK9B 1QR4A 3MBXH 4OFDA 4NUGH 1PKQE 4XPAH 5E9DE 1OB1A 2WNGA 4YWGL 4OZGF 2WP3T 2BSSB 1H15B 1G7HB 3IDMB 5IB3B 1HXYB 4DKEH 4YHOH 5DHYB 4NKDA 1ZK9A 1N6UA 2CK0H 1UA6H 4DUXA 1L9NA 3FHAA 1CR9H 5DMKA 1DQQB 4Q9QH 1JPFA 5FUOH 3HZVA 4WU7B 4QNPE 5FM5M 3E8UL 4U1IB 5E2TL 2LVEA 4R8WL 3JTCA 5EWIL 2I07B 5F97E 1JNLL 4NSKA 1WBYA 3I2CH 1TMCA 1M6OB 3PP4H 3RY6C 1FFOB 3RTQD 5GJTH 1MEXL 4MDJA 4E5XB 2ZOKA 1QP1A 1HQ4A 3LEXB 3OWEA 4PJ7A 3VA6A 1J1OL 3QULB 1XF3B 3MLVL 1YN7B 4ORZC 3NCBB 4X98B 4N9OB 2DJUA 5D7JC 4XNYL 4OTXH 3RY5A 4WFHD 1I8KB 3NA9L 3SGKC 3UTPE 2WSKA 3NIFF 4QOKB 1ZLVK 3PABA 3U0WH 4TPRH 1A2YA 4U6TA 2OR7A 3U0PA 3KGRA 1ZT1A 4R9HA 2DQDL 4X7CC 3QQNA 2GK0A 5I1EH 2R1WB 4BQ6A 2B39A 3MXVH 2CIIA 2WWMD 4QCIB 3T3ME 1AH1A 2JCCE 5ESQA 1N59B 4JZNA 4KFZC 5I9QB 1OPGH 1RZKL 1AJ7L 3D3VA 3DSFH 2C1PA 2HKHL 5IROA 4A6YH 3LKPA 1EHNA 3RAJH 2X1PA 3E6HA 4PJAE 5C70A 2ZPKH 3DLQR 3QIUD 4PRHD 1K4DB 4X4XA 5A3ID 4HIEA 4GQ9H 2X4NA 4R26H 2FJFB 3WKNA 4KGJA 1DBJH 4MMZC 5JMRA 1EERB 4K94L 5DVMA 1JV5B 3L5WB 3O3BA 3VFTB 2FX8L 4OV6F 4DN3H 3D25B 1ZANL 1SBSL 1XF1A 3LN9A 4JGUA 2C26A 4N8PA 3FQXA 4Q0XL 4IDJL 3TVMA 4ODTH 3KWWA 2YA2A 4Z7UE 3RKDC 4F3FB 3TN0D 4NFDA 5DQ9A 3KHOA 3HMXA 5KAQG 3IS1X 4ODSH 3O0RL 5D70H 1WZ1L 4HKXA 5F3HB 1MCLA 2JCCB 3G5VA 3MXWH 3WSQH 4ZDHA 4C4KT 1FNAA 1IGML 5IB2B 5EO9B 5IHLB 1QO3B 3BVNA 1Z6JT 3MRRA 5DA0B 3ULUH 3MRIA 1CXHA 1JZ7A 1B0WA 4W4NA 3LQAC 1Y0LA 4TOYH 4NJ9L 4P4KD 5C0BA 4X4ME 5C07D 4JANB 4CN4A 4Y4FD 5L7XH 4ZAKC 5K59F 1U8JA 1G0YR 4Q74A 3BZFB 1UH3A 3UZEA 1N5AA 2DQIL 2VN4A 5IHZB 1JRHL 1MCJA 5FGBA 2V7HA 3I50H 1DLHA 2O5ZL 4HS6A 1WWBX 3BXNA 4P5KA 1YJDH 2AJVL 3V4PH 4PJ8D 3T08A 4QF1A 3WIHL 4YHNA 5DVOA 5DJYB 1R3LA 4J1UB 4CRPA 4BSWA 1BJ1J 1MCBA 2BP3A 3SCMD 5JTWA 1QFWL 3NVQA 3UPRA 1SJHA 2EXYC 2GCYB 3G6AA 4G3YL 3ILQC 1FV1B 2AJXL 1WZKA 4XC1H 3HC3L 4UIMB 4J6RH 3R8BB 3QNZB 1BQLL 4PJIA 2HG5B 4GAGH 2VO5A 2VC2H 4NN6B 4ZQKA 4B7IA 2CD0A 2OCFD 1VDGA 4MGXA 3BT2H 4JFQA 3UJTH 2NYYD 3K8MA 2NY0C 5SWSE 1HYRC 4PJGA 2VLRA 2D31B 1AGFB 5J56B 4XP4L 3T0XA 1IAII 4P3CL 4G6KL 5BS0D 5KN5B 2B5IC 5JPNA 3DVGA 3RNQB 1G9NL 4PJ9A 2RJMA 3LPGA 2Q7YB 2R9HD 2X70B 3QNXB 1RK1B 1NANH 4N0FB 2J88H 5IQ9A 3ETBF 5D1XB 3TBVB 3MRCA 4N0YH 4RCAA 1E6JH 4GMSL 1QEWA 1AD0A 1IC1A 5CEZL 1MCOL 1FNGA 4Z7OF 3BD4A 1U8LB 1MCDA 5CINL 2ESVB 3BQUC 4NHCH 3V7AG 3TBWB 4RFOL 3UEZA 2YMXL 4FQXD 5BV7H 4YDLB 3SJVD 3SE4A 1VHPA 4LVOB 4ZD3H 1JHLL 2XPGA 2VDKH 3BPCA 3LRGA 4OAWA 4AQOA 5D5MA 3K8KA 1QHOA 4M6MH 3BHBB 5SV4A 3A67H 3GMPB 2XWJA 3T0EE 3BGMB 2VL4A 5DURD 1T20B 4PS4L 1QBLH 5ICZB 1SVZA 3TCLA 2H9GA 5IW6B 1BP3B 1GGTA 1FYTE 3O4LB 4QTHB 1MQKL 1UH4A 1PW3A 3VFMA 1J1OH 2GITB 3WN5B 1A6VH 4LPXA 1XAUA 3EYVB 2DBLL 2BHYA 1MHPL 2A6JB 1RVFL 1HH9A 4MJIE 3ZDZE 5CFHA 2IGFH 4APQB 1BIIA 1ZA3B 5JPMA 2ZG3A 4WIQA 4H0GA 3MACL 4PRPA 3WFCL 4QHKI 3LN5B 3OHXA 2VABA 1LO4H 5FM4A 4ZXBD 4X5WA 4LKXB 2W0KA 3HE7D 2W38A 3LKRB 2XWTB 4CJ0A 3KPRE 1H3VA 1IMHC 1JHKL 5HYSB 3GMQA 3T04D 4D9RE 3F12A 2VMFA 5DJXA 5E6IC 3BE1L 4PJCB 5INDA 3THMH 3WO3B 4HJ0C 2DICA 2JIXA 3N9GL 3OR7B 2WIIA 3TNNA 1KPRA 3O8XB 3ZTJG 1WITA 1FN4B 4ZFOL 1UCBL 4PRID 5B3JE 1EFXD 2HT2C 5AYUH 1QSFA 5ISZD 3R1GH 2EIZA 1PZ5A 3OKYA 4KKCC 4D0BB 5HVWA 3WXVL 1LP9A 1UB5A 5IT2L 1JZ3A 2ITDA 5SX4I 3RWIA 3EDFA 5I73B 1HHIB 3MOAH 2MHAB 1L8JA 4OF7A 1TPXC 5GS1B 1I4FB 2BNUB 3T8XB 5FHBL 2FO4A 3ZKMD 3RZCA 4D0DA 3RWCA 1U91A 4BK4A 1MOEA 4F37K 3GHBH 4GXVH 3HNSL 1Q9KA 1CDJA 3MFFA 4J8RA 4WHDA 1ZWIB 1IAMA 3LKOB 1ZLVH 4UU9B 1CU4H 1Q9LA 1U92B 1RY7B 3T2OA 5CBEB 1PYWA 2XQYG 4H20H 4NKQB 4L3EE 1XIWA 3CFBB 2QLVB 5J9PB 2NY7H 4OFYA 2B1AL 2ZUXA 4FABH 3DGGA 4XGZA 4EUPB 1JF1B 2BXZA 2W9EH 2R4RL 4L4VD 4M6OL 4FNLH 5D9SB 5T3XD 3D2UA 2AV1A 4OF8A 1J87A 1ORSB 3T0EC 3NFPA 1IKFL 4OI8A 3FMGH 3WNMA 1F5WA 1CICC 2EDRA 2VZVA 3RWEA 2R2HA 2A74B 4I1NB 5C6PB 3GJFH 1OGTB 1RZIB 1HCVA 5DDHA 1DN2A 3S36L 3D69B 4H26A 3HMXH 2XKNA 4G6FD 1MY5A 1KJMA 5ENWA 6FABL 1QD0A 4JHAH 1KN4L 2AJVH 5L8LB 4Z7QF 3ARFC 1Q0XL 5GSRA 3R0MA 3KLHD 2C5DC 5HDLA 4HS3B 3MLUH 4D9QE 3GMLB 2N56A 2FH8A 2IWGA 3LB6D 3OKKB 4TUKL 5DD1H 1OCWH 2CUHA 5DFTA 5DUPL 4KJPC 3U9UB 1T5XA 1CT8B 2C3VA 2R39A 4POZC 5IB5B 4FXGA 3FFCD 2PF6A 4OCLC 5T1KA 2ARJQ 2PNDA 3TWCH 4X4YA 2SEBA 5F7MC 2NY2B 3OB0K 1IT9H 2ADFL 4GS7B 5I71B 1U8PA 5HDQH 2VXVL 1OGAE 4YZFE 1ZXQA 1NGWB 5HDBF 1E4XI 4G6AC 4P9ML 1XGQA 4XVTH 4X6DF 3DXAB 5A1AA 3ARBC 3PWNB 4XNUH 1KXTB 1KLUA 4GAJL 4O5LH 2P5WD 1N64L 1U6AL 3HZYA 3FL7A 4U3CA 1BVKB 2B2XL 4OLWL 2X4PA 3G6DH 1AR1C 3HG1E 3WUWA 1GSMA 1K5NA 1KPUB 2E9WA 4PP2A 1VEMA 4HUNB 1GGIL 4OCXH 4RQQB 3VXTA 5J7CC 2NX5A 2XZZA 3U0TA 4YHPA 3OGCA 3TLRA 3HZMA 4OLUL 4MQTB 4O2FA 2NXYB 4Y5YA 3ARGD 3K4DA 3IVKA 3KR3H 1NSNL 4JFOA 5CINH 2F54D 1IFHL 2VITA 3TJEL 3S34H 3BKJL 1A7PL 3LMJH 4P2OD 4E9LA 5B38B 2VLKB 1QRNA 3VXPB 1KELH 4QRRE 3JTTA 5HHPA 5DJ8A 3NCFB 4K3EL 3S4SG 3QCTL 4JJ5A 1AO7A 5D7LE 4GXUM 1BPVA 3QRGH 2CIKB 3KDMA 4PS4H 4G6JH 2FEEI 3X3FH 1P7QB 4RGNB 1T04A 1WLHA 2FDBP 3B9DA 2J8UF 1WQVT 5IW1A 1LO2L 1J1XL 2R8SH 4M02A 4F7MA 2DBLH 4U1MA 1I9JH 3KXFD 1CFNA 5C0AD 4K7PL 1CFBA 3VXNA 3VXUA 3VW3L 5LGJB 3BI9X 1L7TH 3DMMC 2IEPA 5SWZB 2MSPA 5JHLL 1NLDL 1A6WH 4HUWA 3TZVC 1ZLSL 4KRPC 4PJEE 2IANA 2VZTA 5ETUB 3TIEB 2CDEB 4U2ZA 1GOFA 3B9VA 3IKCA 5ADPL 7CGTA 5I1JL 3B9EA 4P4RA 3LH2L 3VWJA 4P23B 4Y16C 4PJBB 3SDYL 5TDOB 4QRRB 2FHFA 3SOBH 1G7PB 4HJJL 4WUUD 5C7XH 3JV4A 5GHWH 4JFZH 4YAQA 4JDVA 5A2IH 2Z31B 3VXRD 4BFBD 1VADA 2F5BH 3GBNH 4LLWB 1HCFX 5T1DH 3PGCB 3EKCA 2X4QB 4G43B 4MXQA 2OTUA 1HNFA 2FECL 3DIFB 1WGOA 3WJJA 1MRDL 1P2CB 2VR4A 1NL0H 4O2EA 2WWKT 1PG7W 3DBXB 3WXVH 2XY1A 4A6YB 3WS3B 1QR1B 5GISL 4DVRL 4U7SA 1L7IL 5I8EB 4G42A 2ENYA 4HUKB 2W91A 2OLDA 3UCRA 4OGXL 1N26A 5FYJU 3V79C 4HIHA 4JZOA 4NZJA 3O3DB 1U58B 3MJ7B 5J6GB 1NMBL 3W11D 4DGVH 2PYEA 1ZGLB 2OL3H 1EO8H 3PWPA 1MCPL 1VPOL 3FCTB 4L8BB 5KSUB 1W0VB 5C2BH 3RUGF 5EU7C 5SX5K 3U7WL 5CGMA 5DRXB 1V3KA 3RI5F 3O2WL 3CXHJ 3P4LA 4FP8L 2DL2A 3HKFA 3K4AA 1R5WA 1T21A 2WUCH 2R56H 4OCMC 1U8HA 4YH6A 4HJGA 2IALA 3DX8B 4WDIB 1YYLL 5GS0D 3OJ2C 4K23L 3MJ8B 5HDOA 1G6VK 1MRFH 2IFFH 3FFDA 4YDKL 2NY5L 3OAUL 2QQLL 3DHMA 2WAHA 2YS4A 3PL6B 4RDQF 1T0NB 3QUXA 2DB8A 4ETQA 2W0FA 2MCPH 4Z7NE 2NNAB 4PRDA 4Y2DB 5HGAA 1UWXH 4LKCB 2EXWC 1FQ9C 1KLGA 2VXUL 5F9AC 3L5XH 4QXGH 3B5TA 5CD3A 3QWOB 1CQKA 3D87B 2GFBA 3O45A 3PWJA 1OW0C 4EDXB 3C60A 2ZCLH 1NLBL 3ES6B 4WCYL 5IQ7L 3IDGA 4NWUH 5CJOL 1NGXB 2DQEH 5GGRA 1EGJL 4UOW1 3HA0A 3REWB 4ENED 2FX9L 1JBJA 1TVDA 3BUYA 4JG1H 2BNRE 3MCLL 3H42H 3IU4L 3F5WA 5DUPH 1C8PA 3VXMD 1FORH 1X7QA 1OSZB 5B21A 3EFFA 3ROOB 5J6HA 4QHMB 5IMMB 3RDTA 5IJKA 4MD0A 4L4TA 4G9DA 3QEUB 1CGUA 3E3QE 2DM2A 3C6LD 4JFFD 3FO1B 3DSNA 1ZVHA 4CVZB 3NIDF 4R2GB 4K7PY 1BFTA 1JWUA 3MROB 2VXVH 3MRDB 1JPGB 3TP4A 4XVJL 1KIQB 2E7BA 5I18H 1FH5L 3VWKB 4W4OA 4P9MH 4OLYH 4OZIE 4HXBH 5BJTA 3GJEB 4Y19E 5JOFB 3GBLA 2QSVA 3DOSA 4MD5A 4JVWA 1V7MH 1GZQA 4KV5E 3WHE0 2CLRB 1CLYH 4LFHG 3DURA 5L9DH 4FQHA 4OLWH 3BKYH 3BP7A 5IVZB 3ULSB 2DI9A 1T80A 1ED3B 5HHOA 3TESA 2G5BA 4NQEE 5IKCA 4AIOA 3I6KB 4PBXA 4Y2DC 3X3GL 4KKAC 3MOBH 5E8PB 1IQWL 4Z7VE 1E27A 4X6DA 3C09B 5ANMA 4LARH 3HRZB 2H32H 1J9CT 2O5XH 1RZ7L 4IEFB 1HH6B 5GRVK 5I15H 5KSAA 1P4LA 5FYLH 1MNUL 3C87A 5HHNA 1FPTL 1M7DA 5D2LF 1U3ZA 1YJDC 4BKLB 4O9HL 4GRLC 1GIGH 4ZO7A 1RV6X 4Q2ZB 2BRRH 1J86A 4YHYC 3ULVF 4NM4L 5HGHB 4IRJB 1BD2E 4YXHH 1HZHL 4XZUB 5BV7B 4AH2B 4PJFB 1T0MB 1CXLA 2B4CL 4DQOL 3NFSH 5C9JA 3F8UB 4ESKA 5I1LB 2Q76A 5FYJH 2O61B 3QG6A 4JHWL 1MI5E 5CMAB 5D1QB 3UPAA 4JPWH 3GIZL 5CJQL 4K7PH 2YN5A 3BGFB 3GGWB 1NBVH 4Z7VB 4BSJA 1NGYB 4FQQB 1NC2B 5DRWB 1HHKA 3V6ZA 3BWAB 3P3YA 5IEKA 2A9ML 2FATH 3VD4A 4U33A 4PDCE 3W0WE 2P8LA 1VFBA 4KXZH 1Y18A 1OHQA 5J13C 1FIGH 1OARL 1I7RB 5T1LA 5EC1A 2J8UA 4MNGA 5DXWA 1OP3K 2NW3B 3LH2H 4HIXL 4NQXA 1MJUH 3SDYH 4I0PA 3TO4D 4YBQD 3I02A 5GRZA 1F3DH 5JXEA 5BMFH 2DQTH 2GTWA 3S37X 3B5GA 5C0DB 1DBMH 1JPFB 2HYMA 4Y4KA 1IGCH 5BXFA 3C09C 3HZVB 3E3QC 4I8DA 1N3NB 5H37G 4H1LH 3RGVB 2R69H 4XPGL 4NSKB 4LDLB 4PJ5E 2MWCA 3NIGF 1KEML 4R4FH 1RIVL 4D2NA 1GPOL 1UVQB 3EO1A 3EOTH 5ITFA 4QYOA 2WBJA 2HFGH 5JOEA 3DROA 4MDJB 4XPHL 1OLLA 1P7KA 3CLFH 5JHDE 5DMGD 3JWDH 1HQ4B 4PJ7B 1T2QH 4NZTH 4X7FC 2GHWB 2ZWLT 1IJ9A 3RNKA 1W2KT 4NM8H 4NZUL 3WNPA 5BV7C 5CSBA 1L7IH 5H2BA 4XC3H 4EOWL 1F4WH 3QP3A 5L2KD 4V1DA 4GRWF 5BRZA 3U4EA 1X3DA 5DZOA 4GW1A 3PABB 2LAAA 2H6PB 1QG3A 5AWNH 5F8QC 1RIHH 5FOBB 1TTGA 2YD5A 2OR9L 3U0PB 4CAGA 1ZT1B 3BQUD 4LGPB 4DKAA 5BQ7A 3WJLC 1NBYA 2VOTA 2AJUH 2GK0B 3F58H 1UWGH 4U0RC 5F1SA 2PW1A 1DZBA 3VI4E 3WO4B 2O5YL 2B1HH 4UT9H 4EI6A 2EDXA 1INQA 4PJ5B 5A2JH 1KN2L 3PQYE 1FBIL 4JZNB 2D3VA 4RGMC 4OJFH 2JKXA 2YPLE 3D3VB 2C1PB 3QHZH 3FO9A 5FEBA 3MCKB 3LKPB 3E6HB 5GGRY 3PHQA 5ALCL 1RUAH 4YDKH 4HIEB 5IBLC 2X4NB 5CCKH 3EJZC 4Z8FH 4UINH 3RUGA 4M5YH 1CFQA 2AQ3A 2QQQA 1AY1L 3SDCB 3O3BB 1NEZB 4NO0D 4BH8B 1ZS8A 4NIKB 1WIOA 5IMLA 4WWKD 1I7TA 3P4OA 1EHLL 3FQXB 3TVMB 1MHHA 2R2BB 3BD3A 3KWWB 4TUJA 5DQ9B 2X9WA 4WGVB 1BOGA 1EGJH 4HKXB 3VD7A 4ZTOL 1EA9C 2KPNA 4I4WB 4NO2A 3G5VB 3MCLH 3PQYB 4QHNB 1CGSL 5E6ID 5D6CA 4ZDHB 4WW2F 3DRTA 4K94C 4I9WD 3PV7A 2YPLB 3C5ZD 4F15B 3MRRB 3BPLB 3MRIB 4G6MH 1L0YA 3KPNA 5GGTA 2P46B 3MRFB 5FYKL 5AAWA 5CEZE 4NO5A 3SGJA 2HH0L 4LNRA 4KKCD 3BEVB 1VEPA 4U1HA 1FH5H 1EAJA 2NY3D 1QQDA 5EU3B 2AAVA 1CTOA 3O2DL 4L9LC 5EFIB 5E1HB 4JAMA 3VDAA 3MV01 3QA3A 4LSTH 4HWEL 5HHVL 1G9EA 3VRLE 3P9WB 2V7HB 1DLHB 4DCQA 2VNCA 1FAKT 4HS6B 4X6CA 2AQ1A 4RRPG 4QF1B 4YHNB 1FJ1A 2BMKA 1WAAF 5EOTA 4BSWB 3QDGD 3UYRL 3X3GH 3KPSD 1EBAA 3SDCC 3UPRB 1NUNB 1SJHB 2B0SL 5ACZA 3AAZA 3G6AB 4M7ZC 1A6TA 3NFNB 4MSWA 4WU5A 4O58L 4IOIB 3WLBB 4FQIL 1T22A 4NCC1 2NY6C 4IRSD 1RJZB 1RULH 3IS0X 4M8QA 4IIQC 4HUUA 4PJIB 3WNOA 1FPTH 5I76A 4XAWH 4PG9A 2I25N 5FM8A 1JK8A 2CUIA 3ZDYF 1NDGA 1CF8H 1U8OA 1Z9MA 5DK2A 1I9IL 4JFQB 2G60H 2CDGA 1OSPH 3EJYC 4F7CA 3L3GA 4PJGB 1AGEA 4GXUN 4M7LH 4YXLL 5E8NA 3D39E 2DM4A 1OD7A 2K7QA 3QO1A 4PGCA 4WNQB 4GLRI 4KDWA 1J10A 5E5RB 1TJHH 5FYKU 5CILL 4OZGE 1NMAL 1QOKA 4X9BA 5D2LA 1H5BA 1MAML 2AGJL 5JPNB 3DVGB 1T03H 4PJ9B 2BNQD 2AJSH 3EYSL 1LK2A 1K4CA 5E2UL 1QBBA 3IAGC 4DN4H 2VDRH 3H9SA 4PJDE 2XG5A 4P2RD 4S10A 3VDBA 3MRCB 2EE2A 1QEWB 1AD0B 3BH8A 1XGRB 2V9RA 1TJGH 1A1NB 4IBLT 4OFKA 3JWOL 5B8CA 5A40E 4X6EA 4PGEA 3QEQD 3NABH 2JB6A 4ZUSA 3GSNL 5C08E 1G9NC 2DWDB 2F5AH 4RFNC 5JOPD 25C8L 3EZJB 2XPGB 3BPCB 4OAWB 3QUZC 4QT5A 3KYMA 5D5MB 1UZ8B 5D7KE 4LDOB 3OXRB 5GRJL 4NNPL 2BY3A 2XWJB 5BVJA 4G6AD 2A6IB 4RAUA 3O6KH 5HYFA 2OJZL 2KBGA 3QJFA 1EEYA 4LRNH 3TCLB 4OZGB 2H9GB 1D5ZA 5I1IH 3T1WA 1OAYL 4FS0A 3BN9D 1JHTA 3BP4B 1RJYA 4HBCH 2BCKA 3IDYC 4HHAB 1HH9B 3WFBL 1KIRA 5TE6L 2J3SA 5C0EA 4MNQE 3M1BA 2BVUA 5FAAA 1HSBA 5ESVA 2ADGB 4PRPB 1ZHKA 1P6AB 2HWZL 4XVSL 1Z2KA 1KBGH 2VABB 4X5WB 1RZFL 4ZUVA 2BJMH 4BELD 3G9AB 2CDFA 2LQRA 4HDIA 4U7MA 4XH2A 2VAAA 3VFUB 3O6MH 3GMQB 3BZ4A 1U3HA 3F12B 5LWYL 1D5IH 4JQIH 3CX2A 5INDB 3IJHB 4U1GC 5E4EB 3T0DA 4NHUE 1IAIL 1X5XA 1YEEH 2WIIB 3D48R 5CJBA 1MJ8H 5I19H 3AROA 4X5XA 4ACPA 3PHOA 4NQVA 4OI7A 2DMBA 4OV5A 2D0HA 1ETZA 1QSFB 3MTRA 4OGYH 4N8CL 2DYPA 4N0UA 2EIZB 5DJCA 4FHBD 1PZ5B 4QRPD 5CGYC 5EUOA 15C8L 1UB5B 3UTTA 2Y07L 1PX3A 3G6JF 3PJSA 2ZSWA 1CE6B 3VG0L 3RWIB 4XP9L 3ARDC 1YEFH 4LEOA 1J8HE 3ZE2F 4KI5C 3IRZA 1X5ZA 3WHE1 4KRLB 3MODL 2FO4B 3ZT6A 4G8EA 4YEFA 3AUVA 1N7MH 1B0GB 3EO9L 3RWCB 1JZ8A 5D1ZA 1XF2A 4ZOBA 3HFML 2IAMA 3RPKA 5I1KH 1FHGA 1Q9KB 2FYYA 1YQVL 3MFFB 4J8RB 4Z5RB 5FM5O 1F4AA 3ZHDA 1B2WH 5I1GL 1Q9LB 1MCKA 4UT6H 3DARA 1PYWB 3E2HA 1T5WB 3B9KD 1DFBL 4ETYA 4ZNEA 1RUPL 4S0SD 3UDWA 1MFDL 3MREA 3SO3C 3DGGB 1AE6H 5CLTA 4XGZB 4OSUL 5DC0A 3FOLA 5FYKH 3D2UB 1BZ9A 3MRLA 2AV1B 2JJWA 1P84J 5I1DA 3NFPB 1HHJA 2DD8H 4KZEH 5HI5C 1CDUA 2DQFB 4M6NL 1NCAL 4X9GA 5LCVL 3RWEB 2RHEA 5BZDB 3SDDD 3WXWH 3QXAA 5DDHB 4UAOC 4H26B 1G9MH 2GJ6E 3SKUD 1IBGL 4YE4H 5ENWB 2YRZA 4HC1A 3K2UL 5J1TC 1XGTA 3ARTA 2HJLA 5GSRB 3AS1A 4WHCA 3AXLA 3VXOA 1YNKL 3DJ9A 3QUYD 5FYJE 4WTZG 4YGVA 4B7LA 3U6RA 2X41A 2C3GA 4LVHB 5INCA 4GG8B 2KUTA 4MQXC 1FGNH 4KRMB 4Y5VC 1T5XB 4KVNL 3IDJB 5D2NE 4Y5XA 4FXGB 5EC2B 3IETA 5ID0A 4N5ED 4TVPH 3CFCH 4MAUH 3FB5A 5IJVA 3FO2A 4TTGA 1WAAA 1R3JA 1YECH 5F7EL 1U8PB 2JTDA 4WFGE 4PG2A 5HI4C 1FLRH 3AU1A 4LAJH 2GJ6B 1XGQB 1BREA 4O00A 4FQJL 4NP4L 5T33L 1IILE 4Z7OE 3DRQB 1RHFA 4JRXA 2X4PB 1HILA 4FQ1H 1K5NB 3U79A 1A8JH 3SGEI 1IARB 2J4WL 1RZJL 1UC6A 5KVEL 1CIUA 3VXTB 4LPUA 2NX5B 3U0TB 5EZIH 2IBBA 1RSFA 5F9WB 5D96C 2UY7A 1CD1B 4UNVA 4Y5YB 1YPZA 3VD3A 3MV8A 2NQCA 4Q58C 3IVKB 4JFOB 5JO5B 5KZCD 2VITB 2D2OA 1FVCA 2V5RA 4M4RA 1QKZH 2YXFA 1YEKL 1N6VA 5IV2A 4KC3B 1OAXH 1QRNB 1DBBL 4QTIH 2EZ0C 1VGEH 4LVHC 4Z95H 3JTTB 5FECA 3QCVL 5HHPB 5DJ8B 3L6FB 4NNPH 1UM5L 4JJ5B 4FQCL 3SGDH 1FNFA 5F7NC 1I1CA 3LV3A 3HZKB 3KDMB 1T3FA 2VTFA 3EYQD 4FQLL 4XNMA 4ONHB 3QDJA 1BM3L 3ECBA 1T04B 3CUPA 5HYJA 4LEXH 3G08A 5IW1B 3ULVH 3MRGA 5FKPA 1Q0YH 4AEIH 5TQ0H 2EYTA 1CFNB 1M7XA 5J57B 3WFBH 4HPOL 3VXNB 1E4KA 3VXUB 1CXEA 3HUJF 4C56A 1A3LL 1RMFH 3HMWH 3EOYG 5BOPA 4JREC 4XPFL 4HK3N 3GZKA 4HUWB 1A6UL 2IANB 2EDFA 3RIAF 3STZA 4JFEA 1JGUH 3IKCB 4PYHA 3DUHA 3S4SA 2WINB 4P4RB 4E41D 1BAFL 5CJ5A 1Q94A 4HS8L 1KSRA 4GO6B 3VI3F 3JV4B 1ITCA 5D2NC 4WTWA 3PXJA 4JDVB 1E4XL 3DUUA 1WEJH 1VADB 2F58H 4Y4HD 1XCTA 5TF1L 3ME0A 5HHXH 3SKNA 1NEUA 1R3IH 1CLZH 1T83A 4OLVL 2P8MA 1H3UA 2C1OA 1DN0A 4O2EB 3SQBA 4FG6D 1EO7A 3FB7A 2XWBB 3GHEL 4HWBL 4K9EL 5JDSA 2VDQH 2YR3A 2H2PD 5LQBL 1NGZA 3V0WH 3HRPA 4G42B 3MJ9A 3NCEB 3BSZL 1YY9D 4MVBC 4O2CA 3C08H 1ZHNA 4HIHB 4JZOB 5IFHH 3M45A 5IIEA 4V2BA 3INUL 2KL6A 4F80A 2PYEB 4GRWH 5HYSG 3MSPA 3JWDC 3PWPB 4NGHL 1AXSA 1G1YA 2ITCA 4KK6D 4FFWC 1R5WB 1T21B 4HV8A 1AI1H 2FEEL 1U8HB 4NRYB 4U1JA 4HJGB 3MUJA 3K0WA 1P9MC 3U82B 2IALB 5HHQB 5IW3A 3EW3B 4JO1H 5DTFB 2HTKC 3CVHA 2HKFL 1MJJA 3EO0B 4W6YB 1VGKA 4NQDE 3HE6D 2YWYA 3RWDA 4XWGH 5FKAA 1PX4A 3GSRA 2HLAB 5F6IC 4GG6A 5DF0A 4MB4A 3U46A 2Y5TB 3TEUA 4BQBA 4ETQB 2W0FB 3LKSA 4JFDD 4JO3H 5DSCA 4AY0A 4P9HH 5HGAB 1KLGB 3O6FD 4HKJB 3RBGA 1KJ3H 2DI8A 5CD3B 2EDTA 1S7TA 4WY7H 4UTAH 2GFBB 3O45B 3PWJB 3C60B 5MI0B 3WMSA 1JMXA 5MHSE 5EIIA 1GAFH 2ZP0T 1V3MA 1BZQK 1P84K 3IDGB 3GSQA 4LLYB 3M8OL 3V6OE 5GGRB 1YNKH 4XTRC 3EOAA 3F7VA 1PSKL 3CMOL 5C0CA 3BIBX 1KEGL 1ONQA 1T89C 1X7QB 5J6HB 3EFFB 5ACLA 4LPCA 3RDTB 4JG0H 4MD0B 4G9FA 4JFYB 3GFUA 4G9DB 4L4TB 5HI3C 4EUPG 4KDVA 5EA0L 3QIWD 4R97C 1A5FL 1F4XL 1S8DA 3V52H 4XI5C 4YC2B 5C8JA 3ZKSD 4RISH 1JWUB 4Y1AA 3QIBC 4HX1A 3TJHD 2ZZUT 1X5JA 4MD5B 1IC7L 1XGYL 43CAB 1GZQB 4LCWA 4OZHF 4YK4B 5T33H 1HE7A 3MV9E 4HH9A 2AK4D 1A0QL 4HEME 4UIKL 3CSPA 3RY4A 2VR9A 1YNTA 1F3JB 1BBDH 2DKMA 4Q97A 2G5BB 2Z0BA 3HC0B 4RNRA 3ET9F 1R5VA 1VFUA 2OQJA 5C71A 5IKCB 5GZOD 4OGAC 4LSPH 4JQXC 2Z8SA 5HGDA 1U2HA 5MP6L 1FE8L 4EN3B 4NRZB 1MJ7L 1U2CA 1E27B 2FL5A 4X6DB 3BPNB 3B2UC 4HQQL 1AKJA 3HB3C 5E0QA 4UDTA 2F74B 5TFSH 3CH1A 4XMLH 5KSAB 1A6AA 1P4LB 3U36B 4X9FA 5HHNB 2JJUA 1M7DB 4Y8DC 5EU5A 2HLFD 5HHMD 1KCVH 2NLJA 2XTJB 1LK3L 1TCMA 1HHGA 1NFDE 2XYCA 4Q9RH 4GBXC 3F65A 3JUYA 3B2VL 2CKNA 4LHQB 4M5ZH 5IHUL 4M48H 3FQRA 1F4YH 4S1SL 3P9MA 5J11B 2DIBA 5C9JB 5F9DC 2DBJA 5DFWH 1IEHA 2Q76B 1KYOJ 4OCRL 4LMQI 1UM4L 3IDUA 3QG6B 4NRXA 8FABA 1OQOA 2ADIA 4UQ3A 1NGQH 5FO7A 1NUFA 1QVOB 3JV0A 1B9ZA 4XPFH 3U4AA 5EPMA 5K9JL 5IEKB 3EUUA 5D7SH 4I48A 4HSQA 2P8LB 1VFBB 1ADQA 4N0CC 5TF0A 5F70A 3TA3B 3V6OC 3L3IB 2J8UB 1MF2H 4DGIH 4MNGB 4NN5C 4HD9A 1OAKL 3F6IA 4I0PB 4K2UL 2AABL 1N2RB 3UXFA 3I02B 5B38G 4YPGA 1PEWA 4PTTA 1A7QL 3RVUD 4EN3C 1HSAA 2GTWB 3VXSE 3MYJA 3W9EA 3I9GH 2X1WL 5I0DA 4RA0C 2YD9A 4BZ1L 5JW5B 2W9DL 4XAKD 5MEQA 4NQSB 4GUPA 3EO1B 2WBJB 3DROB 2IG2L 1P7KB 1CFVH 3LS5H 5FV1L 5LBSH 3BIKA 2FB4L 4OB5H 1YDPA 1MCQA 2VLJD 4DOHE 4FTVA 3RNKB 2PO6A 4M7JH 4DJMA 5LQBH 5H2BB 3CH8A 3K80A 5IGXL 2J6EH 1S9XA 3O9WB 2VQ1A 5BRZB 5FYKE 4C83B 4OZFH 4Z0XA 3SDXF 4GW1B 3RA7L 5B39B 1KCRL 3QUMH 3BZEB 2E7CA 2XZQL 4D0CA 4J2XA 2EEDA 4LGRB 1WVZA 4P2QA 5DC4B 4KUCF 4XXCC 3WD5L 5LGKA 1NBYB 3IB4A 3RVWD 3VXSB 2PXYC 4JM2C 1K6QL 3CFKB 3MRMB 3BKML 3MRPA 1D9KA 4EI6B 2Y5EA 4F7EA 2VZUA 2CKBA 1INQB 3EDDA 3T4AA 2VZ3A 1MCNA 4K3JL 5JUEH 4HGMA 1CXKA 2OK0H 3FO9B 1FO0H 2EIDA 4X83A 5K9OA 3H3PH 1ZTXL 4DWHA 3BIAX 3PF2A 2F9BT 4P5TC 2DQCH 3QDMA 3RUGB 3VFRA 1OAZH 4PB9H 1CGVA 3SDAD 1CFQB 4TVPE 5LAXA 1TQCC 1YN6B 4MS8A 1ZS8B 4B41A 5IMLB 3KYAA 4I77L 5ALBL 2V5YA 1I7ZB 1V7NL 1JZ5A 1I7TB 3P4OB 4YHMH 1EIBA 2DTML 3TFKD 4TUJB 1CFTA 1LEIA 2IQ9H 3BKCH 2W60A 3MV7D 4FFVD 4JDTH 1UXSB 1BOGB 3HS0B 4LSUL 4JQVA 3CIQA 2IQAA 3O9WC 2BY1A 1T7ZA 5KSBF 4HEPG 1SYSA 2P5EA 3DRTB 3SBWA 3EDJA 4RBPK 5MEND 3UTSD 4KAQH 3GKWH 3QO0B 3MRBA 3F7RA 4EI5C 1YMME 3KPNB 4QNPF 4P46B 1AFVL 2F53E 3W5NA 1S7XA 2E7HA 3LHPL 4NO5B 3DTXA 3M17A 4WUKH 3RVXD 3OKDA 2UV3A 3QXUA 2DJSA 1QYGH 1R3HA 1B6UA 4ELKB 1JGVH 4LSSL 4JAMB 1I3GL 2W0PA 5JQ6L 3QA3B 1MFAL 4KI5D 3NN8A 2Q87A 2FGWL 3M07A 2EDKA 4GKSA 1LDSA 4U1KA 4AQ1B 4JRYE 1LQSR 4DCQB 3IFPA 2JB5L 1FRGL 4MB3A 3H7LA 3NZHH 1CK0H 4ODHL 1D6VL 2OJEA 1FJ1B 4J4PD 2FZ3A 5D2LE 2BMKB 5EOTB 5I1HL 4JLRA 2QADC 2WUBL 1A3RH 3QPQD 5MP6H 1HYSC 1JE6A 3T2NH 4F58H 3AAZB 3ULVE 3FRUA 1A6TB 2IPUG 3CGTA 4MSWB 2F53B 4KK5C 1T22B 1I8IB 4M8QB 4HUUB 3NH7L 5I76B 5E8DH 4PG9B 1LE5B 4XCYA 1NDGB 1U8OB 5CP3H 5DK2B 5DWUH 2AXGA 1DBKH 2CDGB 1CQYA 1CYGA 4AENB 1I1AA 4NO3B 5EOCL 3L3GB 1AGEB 1W0WA 5E8NB 4RRPA 3QO1B 3LKQA 4QOKD 5I74C 2QQNH 4PB0L 2Q3AA 5EN2A 5D2LB 4K71B 1BFVL 5DO2D 2WK2A 2Q8BL 4U6YA 1RUKH 1K4CB 1FAIH 2L7JA 3HI6H 3IGAB 3Q6GH 5DD5L 4Z7UF 5IWLA 3BMWA 5FO9A 3N06B 3H9SB 4MA7H 2XNAA 4RX4A 3MBEB 3NZ8B 3U9PL 1ACYH 2UZYB 4MQXD 4KTEL 1FNSL 2Q8AL 3NIGE 1T1ZA 1KYOK 2RQ8A 1TVBA 3HCVA 4PBVC 4PGEB 4X6EB 3H9YA 2XY2A 3TV3L 1N4XL 4JGJA 2JB6B 1PY4A 5DVKA 5JIKA 3SQOH 4Z0BH 4QT5B 4HZAA 3KYMB 3BP6A 1BGXL 2ERJC 2HT3C 5HI4D 3U2SA 2D7OA 3NPSC 5BVJB 4GRWE 4LCCC 1KCUL 5EU4A 3QJFB 1EEYB 3QR2A 2R2EA 1U8NA 1EVTC 4M1GL 1D5ZB 2D03L 1DTUA 1F6AB 5GGQL 2ID5A 1TZIA 1E28A 4MA3A 2FB4H 5IFAH 1JHTB 4KTDL 1D3CA 1RJYB 1ZVSA 1H3GA 3OKNB 1ADQH 3L5JA 3IDNB 3TPKA 1KIRB 3VG9B 5C0EB 5E08L 5HYIA 2E27L 3DUSA 4FZ8H 3RU8H 3EFDL 3RY6A 5CBAA 5HVHC 1HSBB 5ESVB 2ZJSH 1QHPA 2PETA 3U4BH 1IL1B 2MTPA 1KGCD 1ZHKB 4WEMB 1B90A 2ZUQC 3L3HB 1DE4A 3TF7C 5DRZA 4ZUVB 2LABA 2EO9A 5E8OA 5D7JA 1PG7X 3ULVC 1DLFL 4HDIB 4XH2B 4YXKH 2AEQL 2XN9E 3QFJA 5DR5H 2VAAB 1F6LL 1U3HB 3SGKA 3C5SA 3ORJA 3D1MC 1HDMA 1C5BL 3MBEC 2P42B 2HMIC 1KTKE 4K3JH 2BSTA 4ODXB 4YBLB 1QFHA 2NXZB 4X5XB 3RP1A 1NGPH 1T2XA 3PHOB 1EK3A 4NQVB 3L1OH 4OV5B 3MA7A 4NOFA 4R7DA 4NQCE 2ZCKL 5DJCB 5D7IE 3FN3A 3SE9H 1QFOA 4Z7WF 5EUOB 1KTDB 5T3XH 5GS0L 3UTTB 5GGVL 3PJSB 2ZSWB 1JPTL 2BSSA 1G7HA 1HXYA 4LEOB 4YFDB 4YFLF 5LG1A 1FCCA 4KRNA 4NJAH 4UILH 4G7VH 1ZV5A 2BVPA 5M94B 1MCHA 3BW9A 3KYNB 1WC7B 1XF2B 3GNMH 4ODVH 1NC4A 1QSEE 2I07A 4KHXL 2FYYB 1CZ8L 1V3LA 4NN7B 3MLTB 5HSFA 4K07A 4G8GD 4K8RD 3NACL 2CO6B 4LVNB 4XWOC 1AIFB 1WFOA 1DVFC 3E2HB 4WVRA 3ARSA 4N9GA 1DL7L 4X7SL 1WFTA 5BZWB 4HG4J 2V2TA 4WO4D 4PLJD 1Y6MR 3MREB 4NQCB 2NY1C 1F11A 4NPYA 3DETD 5J12B 5C09E 1I8KA 1PKQA 2J5LB 5E9DA 1KC5L 3QISA 1K8DA 4JN1L 1NAMA 4AG4L 2PTTA 5I1DB 4WV1C 1HHJB 4U49A 5KSBA 4X80H 4ZO8A 4ZFZB 1O5DT 1JRHI 4NDMA 5D1XD 5IFJA 1NEZG 1HKFA 1AQDB 3GKZA 3SKOA 3QXAB 4UMGA 1S78D 5E4IA 2R1WA 3CSYB 3X13A 4U6VL 2VDLL 4ZAKA 2ESVD 1TCRA 1D6VH 3UTQA 2D7QA 4S1RH 2EYRB 3V4VL 2EYSA 4XCFL 2HJLB 3ZDYE 3AXLB 1JYXA 3VXOB 5T5FH 2H26B 1CBVL 2BY0A 1IKNC 4YGVB 1CVSC 2DRUA 4R4NC 5INCB 2QEJA 3U6RB 1RAMA 4P9HC 4HIIA 2JJSC 5E1AA 3IETB 4J3SA 5ID0B 5TQ2H 3IRPX 3VFSA 1OP9A 1FFNA 4TSCL 5F8RC 3FB5B 4HFUH 3O4LD 3FO2B 2HRPL 5IF0A 5CZKA 1R3JB 4RBPH 3DWTA 4WFHE 3S37L 4CDGC 1T6VN 5B3JF 3BAEL 5HYEA 2RCSH 1NBZB 1MIEL 1UJ3C 3AU1B 4APQD 4YHLL 2NR6C 3P0VH 4F3FA 3MPCA 3QI9C 4NZRH 1SHMA 1Z3GL 4HCRL 1P69B 1N5YH 1MLCA 3QQ9C 5J12C 3ZE0F 5F3HA 2JCCA 3K1DA 1DQDH 1J0HA 5GGTL 5C0RL 4JRXB 2CGRL 4WTZA 3QHFH 1MCWW 3W2DL 1HILB 2YSSA 4F9PC 5EUKB 4WW2C 5DGRA 4PJAA 4XTRD 2A77H 3KYKL 3S3JA 4JM4H 4S0UC 1Q72L 1YEHL 1K2DA 3O41B 3K46A 4JANA 4DK3A 4ONOA 5CS7A 4TSAL 2Y36H 3AS2A 3MNWA 3CFJA 3MV8B 2DM7A 1JGLH 5HI3D 1DBAL 4PRHE 3SKJH 1I85C 1FVCB 1UWEL 1N4XH 4L29B 1W72A 3FRPA 4M43L 2W0LA 3DPBA 4GKOA 4Z7UA 1UXWA 2C3XA 4ZFGH 1RZJC 2AI0L 2FBJH 2XKUA 2AK1L 4PV9A 4B0MM 3TGXA 5I30L 4Z77A 5DLML 3TT1H 3LV3B 2R0WH 1INDH 4XB7A 3DECA 3BQUA 4GH7B 4XNMB 3ARWA 5FGBC 2FX7L 2D03H 5IBTL 3CUPB 4POUB 4AJ0A 2GCYA 2NY4B 3G08B 3AREC 4RMVA 5FKPB 1LMKA 2EYTB 3BZDA 4RGOL 2ZKHL 4LSQH 1I7UA 3QNZA 4MAYC 4HLJA 3MX0A 4OGAD 4BSVB 4C56B 4X4MA 1INEL 4JFHD 1WFNA 3ARXA 5I8KL 3QQ4B 1KJ2A 5FDYA 4PRHB 2Z8WC 3C2SA 4NKOA 3STZB 4TUOA 5C07E 4OZFB 4JFEB 1A4KA 2MPAH 3IDIB 5DD0H 3S4SB 3W5MA 1YEIL 2D31A 5GJSL 2R0ZH 1AGFA 2R0KH 4WEUD 1KV3A 1Q94B 5BO1H 4I3SH 5HY9A 5I8OL 3RTQC 2FD6L 1C5BH 2ATPB 3G6JE 1ND0A 1KLFA 1CDYA 3QXWA 4H8WL 3SE8L 3QQ3B 4JO4L 1XCTB 2C4FU 1ZSDA 3SKNB 4LIQL 2Q7YA 4K55A 4LU5H 4GKZA 5DMYA 1C5CH 3F7PC 1RK1A 4N0FA 2P8MB 4UOJA 4CMHC 5EO1B 5E6IA 43C9A 5E99H 5GS0H 3FB7B 4HT1L 2YRLA 5JDSB 3GRWA 1AC6A 3MRKA 3TBWA 4P57A 4P4KB 1V8HA 2UUDK 5D71H 5SWSA 4M93B 4O2CB 1A9EA 1KUMA 1ZHNB 2WWMC 4ZS6C 2I9LB 5IESH 5E6ZA 3MR9A 1GGCL 5GRUL 4L8SC 1ZGLM 3I6LD 4GRMA 1TVHA 4KHXH 3BGMA 3Q0HA 4LPWA 5E2VL 4LQFL 5ICZA 2XZAL 3G6JB 2UZIL 4K9EC 2ITCB 1MCRA 2R1YA 3GMRA 4MLIA 3QIUC 5A3IC 4HV8B 4X7SH 4XHQA 3DXAD 5FUCE 5CUSL 4U1JB 2UWEF 4MXWL 3LAFA 5BS0E 2LTQB 1SMAA 4NNYA 2DQHL 1MJJB 4V2CB 1S5IH 1VGKB 5C9KA 2EIEA 3T0VA 4D9LH 3RWDB 1E6OL 4I5BB 4OD3L 4U2YA 5FKAB 1KENL 2P48B 4GG6B 4TULL 3U46B 3NTCL 1F97A 1T2JA 2VH5H 3ZTNH 3GMMB 4PJXF 3TN0C 5DSCB 3S96A 2NTFA 4LASH 4PRNB 3MLYL 2OXHA 4RFEA 1GVIA 4HG4K 4KROB 2NXYD 5HYSA 2FIKB 1S7TB 3U1SH 1JIBA 1IM9A 2VSCA 5C0NC 1A14H 3T0EA 2AV7A 3SJVE 5EIIB 3GSQB 1CICA 5EOQL 1LEGA 3O8XA 2VLKD 2PXYD 1FN4A 4JM2D 1QFUH 3F7VB 4XNXH 1SQ2N 1FYTA 1T66D 3ZL4L 4P4KC 3D0LA 3MFGB 4G8FA 1V05A 5C0CB 1P4IL 4BZ2L 1QNZH 4Y4FC 4QXUH 2N1KA 1ONQB 2XTLA 4PLKD 4MJIA 5E5UB 4QY8A 4D0BA 4G9FB 1I1FA 3ARFA 1ZHBA 4RGND 1NAMH 1ES0A 3QUKB 1NMCB 4UT7H 3O3AA 5C8JB 4W70A 2XRAH 3LQAH 4Y1AB 2F19H 4HX1B 3UJJH 3KPRA 4XP5H 4PJ8C 5SWZD 5JA8B 2V17H 4HCRH 2YKLL 3QPXH 1QSVA 1F45A 3SCMC 3MLPA 2CLZA 4LCWB 4ZO6A 3LKOA 1C5DB 3RZCC 2RIKA 3SJVB 4HH9B 1Q9OA 2D0FA 4OFIA 1U3YA 3W2DH 1YNTB 3REVA 3CLEL 1NCBL 4P23D 4RNRB 2CK2A 3DYPA 4IRZH 1R5VB 2GIYA 2OQJB 3B8SA 3OX8A 3CFBA 4I3RL 2VDPL 3K2MC 5FXCH 1QLEH 5DURB 3CMGA 3ARBA 5CIPA 1JF1A 5HGDB 2FL5B 1P4BH 2BERA 1ORQA 3WDIA 4JKPL 1AKJB 4PRIE 2O93L 1WSST 4UDTB 4HC1L 5ISZE 5L88L 1A6AB 2J8HA 1GGUA 3UBXG 4HK0B 1M4KA 1HINL 4FQ2L 4M43H 5EU5B 1Q1JH 2YPVL 5D8JH 1HHGB 5FUCC 5F1KC 1MREL 1X5KA 1E4WH 2XIDA 3HUJE 4XBEH 3MJGX 1FL5A 4OM0L 3HE7B 5DQJA