1OSZA

Mhc class i h-2kb heavy chain complexed with beta-2 microglobulin and an (l4v) mutant of the vesicular stomatitis virus nucleoprotein
Total Genus 74
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
74
sequence length
274
structure length
274
Chain Sequence
GPHSLRYFVTAVSRPGLGEPRYMEVGYVDDTEFVRFDSDAENPRYEPRARWMEQEGPEYWERETQKAKGNEQSFRVDLRTLLGYYNQSKGGSHTIQVISGCEVGSDGRLLRGYQQYAYDGCDYIALNEDLKTWTAADMAALITKHKWEQAGEAERLRAYLEGTCVEWLRRYLKNGNATLLRTDSPKAHVTHHSRPEDKVTLRCWALGFYPADITLTWQLNGEELIQDMELVETRPAGDGTFQKWASVVVPLGKEQYYTCHVYHQGLPEPLTLRW
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Complex (mhc i/peptide)
molecule keywords MHC CLASS I H-2KB HEAVY CHAIN
publication title Differential thymic selection outcomes stimulated by focal structural alteration in peptide/major histocompatibility complex ligands.
pubmed doi rcsb
source organism Mus musculus
total genus 74
structure length 274
sequence length 274
ec nomenclature
pdb deposition date 1998-06-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00129 MHC_I Class I Histocompatibility antigen, domains alpha 1 and 2
A PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1oszA02
3.30.500.10 Alpha Beta 2-Layer Sandwich Murine Class I Major Histocompatibility Complex, H2-DB; Chain A, domain 1 MHC class I-like antigen recognition-like 1oszA01
2V5SA 2XV6B 4NT6B 4P57A 3B43A 4POUB 1I9JL 3JVGC 2QBWA 4Y16C 1R3IL 4WFHD 4BJLA 2EDHA 2DLFH 4JGMA 4QLRA 2JLLA 3QUML 4DUXA 1LP9A 4DOHB 3D0LB 4W4NA 5DJXA 3DURA 1CD9B 4QWWC 4U1JA 5ISZD 1LK3H 4WV1B 4LLQA 5TFSL 5CZVL 4X5XA 5D7LB 1FO0A 4PJBA 3VGFA 3QIWD 1RAMA 3GKWL 2BVEA 5CIPA 2W9LA 5IB1B 2P49B 2CKBA 2JJTC 2ZUSA 4NRZA 5E99L 1MLBB 1X7QB 4IOIB 4NKIL 3EOAB 2FX9L 2JJWA 3BKJL 1JPST 2LU3A 4R96A 4XNQA 4FP8H 4QHUA 4GSDH 3GGWA 4FXLA 3QRGL 3RVWD 2EDBA 4UUJA 4D8PB 2F53D 4M03A 1DVFB 3OPZL 3TM6A 4MQSB 2HH0L 5HHOA 5E2TL 3RL2A 2DM2A 3SE8L 1IGFH 4JFOA 5CBEB 3GIZH 2VAAA 5B39B 5DQJB 3LKOB 3O6MH 1AP2B 4PRPE 2LFGA 4W6YB 1TFHA 3C5ZB 4LSQH 4XPHH 3QAZB 2UY7A 1AXTH 5DMJB 3ARVA 1CFSA 3FZUC 3GNML 3KPLA 1A8JH 1MEXH 4LCCB 2Z92A 3IGAA 3QZWA 4DZ8A 5DUML 1YNTA 1XGTA 3K4ZA 1PDKA 3NFSH 5T5NG 4L3EE 3MV7E 3KYNB 3IDNA 4MVBD 1R3LA 5ID1A 4MQ7B 4DVBA 2R56L 4JY5L 2DLEA 4NO3A 5HGBB 3WYRA 5DVNA 3MRDA 2UWEF 3PHOA 5GIRB 1X5ZA 5EZIH 4PDCE 1JPSH 3NPSB 1VA9A 5CSZA 4LSSH 2GSIB 4Z7NF 4PJEE 3CPLA 3DX8B 5DDHA 1DSFL 3VXUE 2YN5A 3S36H 2UZIH 4PRBA 3TA3D 4RX4A 3BN3B 1J86A 1XF4B 3PF2A 1TVBB 2P5WB 5EC2B 5J06A 5I71C 5AZEH 5DSCB 2Y1VA 2PO6C 1FVEA 4HK0B 1Q0YH 3HI5L 3C60B 2NY7H 5IHZA 1RZJH 2QQKH 3U2SA 3F7YB 1A6TA 1FFQA 2VO5A 3S4SB 5MEPA 3IKCB 1C5DB 2FH8A 3WEXB 4QHNB 2OK0L 5DQ9A 2DIJA 3KPRD 4N5UA 3QUZB 1UA6L 4QTHA 3IXTA 3PL6C 4FABH 3OGCB 3BKML 4PJFF 5ENWA 4G9FD 3ZL4H 5ERWB 3LHPH 3OHXB 3HC0B 2XZAL 1IM9B 1IKNC 1GGCL 1OGAA 4Y2DB 3P4OA 4QY8A 3MBEC 4JFDB 5HGHB 4AK1A 3IDGA 3ZKXB 1XFPA 2AJXH 5FKPB 4PJ7B 5IMMB 2NR6C 4YR6A 3SCMB 4HJJH 4KMLB 4GBXA 1X5XA 1A7OH 4DGIL 5BOPA 1F58H 4KRPC 3QNZB 3QA3B 4B41A 4CVUA 4LNRA 2OL3B 1GHFL 5EA0H 2NTFB 1KIQB 1CDIA 5KSBF 2X42A 1FJ1A 3QNYA 3RP1A 3JWOC 5B8CC 3MV9B 3V0AC 2GI7A 2PXYA 1P5UA 1MJ7H 1E4KA 2OXHA 3TT1H 3IJHB 3L3KA 4YDJB 5IBTL 2FX7L 1P4IL 4X9HA 4ONGH 4WTZA 3VDBA 2VXUL 3UPRB 2R2EA 2A83B 4LLWA 3VI4F 5BZWB 1MFDL 3DV6B 5IHUL 2WP3T 2EDTA 2VL5B 5JOFB 5I19L 3AREB 4CN6A 2ZG1A 4NQXA 3OKOA 3ARFD 3SKMB 3VGHA 1QNZL 4OZFH 4R6UA 1XGYH 4ZNEA 4PG2A 1SY6L 3P9LB 4TOYH 1JE6A 1JHKL 3VWKA 4GW1A 1NC4B 2AKRB 3M17A 4F9LA 5JW5A 2WY3A 1U6AL 1P7KA 1UM6L 2FGWL 4WWKD 5DEZA 4LPCA 4HUWA 3NIDE 1NL0L 4YWGH 2QQLL 3EOBA 3LRHA 1KBGH 1K6QL 1WZMA 4P23D 4WHTB 1P4BH 4JPKL 2R9HD 1JZ4A 2E9BA 1H3VA 3ES6A 3ARWA 5DHXB 3ARZA 1VADA 3CXDL 3H3PL 4CN1A 3HZKA 4YQXL 1HDMB 3ALXA 3D69A 1NGWA 1ODAA 2DB8A 4R7DB 1AGDB 4GMSH 2XN9B 3GSUA 2C3VB 3ILPA 5JXAH 1JYXA 1T3FB 4X7CC 5JW4Q 2DRUA 5ESAA 2EDYA 3IDMB 1U8JB 2HLFD 4DKEH 3MA9L 1YNLL 4GW4B 4NM4L 4JLRB 1UH2A 2VQ1A 4NM8H 1FORL 3DX6B 4KV5E 3SQBA 1IBGH 4WI7A 4I0PB 1U8LA 4OGXH 5M94B 1KB5H 4N68A 5HHME 5I6XC 4PTUB 4MS8A 1XIWC 4RFNB 5HYQB 4FQ2H 3MUY1 1EXUB 4P2OB 1UACH 5C0RL 5D7JD 2HT4C 5ACZA 2GTZA 1F4AA 4CJ1A 5ISZB 1ZSDA 4ZPVA 3HNVL 4PG9A 1RFDL 3MFGB 2OI9C 2BOCA 3L3JB 3QIWB 5C0DA 4QRPA 1FNGA 5JORB 3DO7A 1UEYA 5I76A 1F3JA 3NTCH 3EDDA 3A0OA 3GEWB 4KK9D 2W07A 3F5WA 1DQQA 4MCYA 1HYSC 5BXFB 4L3ED 3MV7D 4IBLT 3DVNB 4YIQA 3LB6C 3GI8H 2F53B 3GSXA 1SYVA 3WDHA 1KFAL 2N7AA 3BSZL 3BESR 2EIEA 3BH9B 1PQZB 4MB5A 4OUUA 2C4XA 1G6VK 4PJ8D 4NNPH 1KCUH 5L2JA 2NW3A 4DTGL 2H2SC 1OP3K 4P9ML 3VXUD 4CU7A 1AC0A 3QHFH 3TBYA 1RZGA 2O61A 1EIBA 1ZHLB 1WBXB 4UQ3B 4G8GE 4GG8B 4P0DA 1QA9B 3KXFA 3TIEA 4QXTB 3QCTH 2FIKA 4YH6A 1Q72H 4G6FB 1U8PA 4OZFA 1VHPA 1NMCC 4ACPA 1OAYH 4AEIL 3B9EA 1XEDA 3E2HB 3RJQB 1F45A 3SE9L 3VFOB 1GGUA 1MH5B 1RJZB 1KOAA 3L5WB 1DANU 4Y5YA 3O3AA 3PXJA 2H32A 1SEBA 4R26L 4J3WA 4FQQB 4UILH 1KXVC 2E27H 3C6LC 1MJUH 5F71A 3WNLA 1NGQH 2PNDA 2CQVA 3CLEH 3TA3B 3FRPA 2D0FA 4NN7C 3MLXL 3UTPE 5F7DA 3BJ91 4BFBD 3FFCB 3WUWA 5D1ZA 4I3GA 1JVKA 1JHLH 3S5LA 5SV4A 4H26A 3PWJB 5IVXB 1MJ8H 1TIUA 1MCHA 4GLRI 4X83A 3G04B 1NBQA 3G5XB 6FABL 1JNHB 1KIUA 1UVQB 2X9YA 2I25N 4EI5C 2MCPL 2APTA 4HIEB 4M7JH 1T80A 3WFDH 5ILTL 4U2YA 3TNNA 5F93C 1WFUA 4XP6H 1MWAB 4G9FB 4YHLH 4NP4H 1F6LL 5T1DH 1FH5H 2AJSL 3BGAA 2IGFL 1NCAL 3C5SA 2AP2A 4PJXA 1A7NL 2EEBA 2XZZA 2DBLH 1XF2A 5I66B 1FYTE 4NOFA 3FB8A 1QEWA 4TPRL 4WCYH 1A14L 3WDJA 4QHMB 4QNPF 3TYFA 1AO7A 1XH3B 2IPTH 3NCEB 4J23A 5GXBB 5DVMA 4WHDA 5IFHL 2Y23A 4LVHC 5ESVB 3WFHB 4Z6AT 5F72S 4X6DF 3N1QC 3VCLA 5F89B 3PJSB 3I75A 1EDQA 1HNFA 1K8DA 3UP1A 3IYLW 3DNKA 3QFJB 2PKDA 1MHHB 3EUUA 1ZVSA 4ZO7A 5J1SC 4QHKI 5DRZA 4AH2B 1BQLL 3MLYL 3PQYA 1TQCB 2B0SL 4JVWA 3NOIA 2D7NA 4G80B 2FWOB 3QDME 3ARBD 1F02I 4U6TA 4N9OB 4KI5F 3ME0A 3V6FB 2GCYA 4JHWH 2R2HB 4WWKB 4O51B 2YC1A 5C08A 4PJDA 4HW6A 1I1FB 4P3CL 5BO1L 1JV5B 4G5ZH 1KIPB 5IMOA 4NNXA 5JO5B 5HHMD 2PYEA 5HY9B 1CE6A 1S7RB 3HKFA 3OG6B 3ZDXF 1KPUA 1I9IL 1V7ML 2PTTA 5FYLH 5DK3A 2VQUA 1DCLA 4R4BA 1IGCH 1TITA 3UJIH 3OJMB 4DN4H 3JV0A 4NC1E 3ZTJH 2FDBP 2HVKB 3MLRH 4G42A 3U0WH 2BNRA 1DFBH 4L8CB 3WN5A 4WJ5A 3WLBA 1JNLH 2MQCA 3ARPA 3EDEA 3Q5OA 4Y5XB 4JANB 4LIQL 1ZANL 2FZ3A 1CFQB 4KTEL 1IGTA 3X3FL 1S9YB 3FHQA 2MWCA 3HLAA 3HZVB 5EOCJ 4YHPA 4HEME 2CPCA 5D7JB 1YC7A 1T03L 5TDNA 3VXRA 1GPOH 1FBIL 1IGJB 4FRWA 4PRPB 4S1DD 3DBXA 5F1OB 2ZJSH 1D5XB 1UWGL 5EN2B 3ZE2E 5D5MB 2VDQL 2G9HA 4PV9B 4YFEA 4G8GD 4M48H 3O8XB 5E9DA 4Z7VE 1E27B 3RFZC 4OI7A 2C1OB 4YO0A 1F4WL 1NUDA 2R4RL 3BDYL 4FTVB 1ZLSH 3OX8B 2J8HA 1C1EH 2VL4A 1NFKA 2NYYC 2E6JA 1HKLL 1PD6A 1MRFL 4RMUA 4PRDB 4HULB 3QBTB 4CL7A 1MCKA 3D5OF 4PV8B 4HFWB 4PJ8B 4KVNL 2PN5A 3DGCR 4LPYA 4R90H 4Z76A 3B9KC 2D4DA 5FM5M 3UTTE 3GJEA 3VXUB 3MJ9A 1QZ1A 1MCBA 4RGOH 5DJ0A 3HNSL 3UTPD 5I1GH 1JMXA 1T7XA 3CDFA 3DXAE 3T1FA 5HPOA 4R4FH 4K3EH 4O2FB 2QHRL 4HSQA 3F62A 4OIIH 3QUXD 1NMAL 5JW4R 4Z7UA 1RZFL 1A6VL 3C8DA 2XTLA 3THMH 1CWVA 3JXAA 2JB5H 3NCJL 4JZNB 4MLIA 3D0LA 3DJ9A 4RGMC 5ALBH 4WV1A 2YOCA 4NZRL 3ZT5A 2WUCL 2EDXA 4L4VA 2CK0L 2HG5B 4DN3L 3NVQA 4OTXL 5IB1A 5D6DC 1FRGH 1PSKL 1MLBA 1X7QA 4IOIA 4JQVC 1G7LB 3EOAA 2AAVA 4LSPL 4ZFOB 4M7ZB 2A77L 1UB5B 2D03L 4D8PA 4WI5A 1DVFA 5EBGA 4J3XA 4XMLH 5ALCH 3U48A 5I1KH 3SO3B 5I1LB 5CBEA 5DQJA 4XNZC 1H8NA 2ADIB 3LKOA 1AP2A 3C5ZA 1EEYB 1QBLH 4X99B 3X11B 5KSUB 4KY1H 1M7XA 1Z9SA 1IFHL 4LCCA 2YWZA 4LEOB 4I5BA 1KNOB 3Q0HA 5E2VH 1DBBL 4XCCL 3GRWL 1CLYL 2WWMD 3KYNA 1FSKC 2ZKHL 4V1DB 1BQUA 3BGFB 2YPVH 1BVZA 1L7IL 1NCWL 3TBSB 2R29H 5HGBA 3KJ4B 5DRWB 1BPVA 4LPTA 4WFFE 2Z31C 5F1SA 4TVPE 2GITB 5GRZA 3QDMD 3T3ME 1DQDH 2GSIA 5B4MD 3DX8A 1S7VB 1K3IA 2Q20A 4LKXB 1V3MA 3OTTA 3MLUH 4PP1C 1TVBA 2P5WA 5EC2A 1H3GA 5DSCA 4XHJC 4FQJL 5C6TH 4ZQKB 4HK0A 4HIXH 3C60A 3F7YA 3S4SA 4WO4D 3IKCA 5E08L 1CXEA 1MPAH 4HK3J 1C5DA 2J8UE 3NCCB 4NZDA 4R2GC 4QHNA 3WEXA 1T4KB 1J5OH 4GKOA 2BVYA 1L9MA 1I8LC 3D85D 3QUZA 1LDSA 2OQJB 5FM8A 3LCYA 1B4RA 2GAZB 3O2VL 3S88H 5FGCE 3NACH 2XTJE 3OGCA 3TN0C 1N5AB 4QHKJ 5ERWA 1G84A 5FO7B 2BFVL 2OX5A 3OHXA 3PNWB 3GSNB 3HC0A 5IVOA 1A6WH 1IM9A 4LCYB 4Y2DA 3HUJF 4MAYD 4K3DL 4JFDA 5HGHA 1MCPH 5FKPA 3KYOB 4PJ7A 5IMMA 3N1GC 3SCMA 1ZVHA 2MHAB 2W9EH 5HHMB 3RRQA 3MUGB 1NEZG 4UV4L 2B1HH 3QNZA 3QA3A 3VXPB 4K23L 4KKLD 2OL3A 4I18B 2NTFA 3NIFF 1KIQA 5CINL 4S1RH 1PY4A 5IBUG 1NFDF 3MV9A 1UQSB 1LVEA 1KACB 1BBDH 3REWB 2HTLC 1YEFL 5FYKE 1XGUB 4MDIB 5GHWH 5KTEL 3E3QE 4L8BA 3IJHA 4YDJA 4HWZB 3BFOA 3PV7A 1QKZH 1WZLA 1NLBH 1HYRC 1KELL 3MRHB 5LQBL 2LV4A 3UPRA 2A83A 5BZWA 3DV6A 4OLUL 2VL5A 5JOFA 4KTYA 4EIGB 1HXMA 3AREA 4G3YH 3RDTD 5F96L 2X4RB 2F5BH 2ZUWA 3SKMA 1ADQH 5GRJL 3VFWB 4OLVL 1OCWH 3P9LA 3U1SH 1BIHA 1F90L 1GGIL 1A0QL 3S8WA 1NC4A 4OCWL 3UTTD 1T0NA 2UV3A 4TNVK 5CZXC 3UMTA 4K8RD 3IFPB 5EOCL 3DXAD 2EDQA 2KQNA 5F7MC 4H0IA 4APQB 1KN2L 4WHTA 1T83A 4BH7A 3PP4L 1A3RL 5I8OL 4PB0L 4YK4B 5IW3A 4E42B 3SDYH 1RZKL 3Q6GH 3RL1B 3RGVC 4QTIH 1N7MH 1HDMA 2EYRB 4L8DB 4XPBL 3OXRB 4R7DA 1AGDA 1VFOA 4HIJB 3BEWB 2XN9A 2C3VA 4GQPH 5DJ8B 4D0DA 1T3FA 3P9WB 2FCBA 3IDMA 1U8JA 5DQDL 2BY0A 1D3CA 2R69H 5D2NC 2D7TL 1AFVH 2YR3A 4GW4A 4NO2B 4JLRA 1OQXA 1YPZE 1T6VN 3TFKA 3DX6A 4GXVH 2A0LD 4FQHB 4LHJB 1MWAH 4I0PA 5C0IB 4RSVA 4ZAKD 3QUXB 3TO2A 4PTUA 1UCBL 5HYQA 2EEDA 4RGNE 1EXUA 2YZ8A 4P2OA 3VFNB 4HXBH 2Y5TB 2YXFA 2HT2D 4U6XB 4AZ8A 2ZCLH 4PJ5E 2GYSA 4TUKL 4ZDHB 2XXCB 3DHJA 5GS0L 4M5YH 4AG4H 3L3JA 3QIWA 5JORA 4ZXBD 5D1QC 5SWSA 3O6FC 2E8ZA 2HT3C 5BXFA 3QWRD 2KKQA 3RVUD 2GJZB 1JZ6A 3DVNA 4F8TA 4YUEH 1GC1L 1FYTB 2NY4C 2F53A 1C5BH 1S3KH 2W65B 4XVUC 4CVXB 4WFFD 1AHWC 1WK0A 4HPOH 1F3DH 2XWJB 3BH9A 1PQZA 5EULV 1UT9A 3KLHD 3RWJB 4D0CA 4K2UL 4X6EB 1JPTL 1IZJA 2YD7A 2BZDA 1WZ1H 1WIPA 3WJLC 1BZ9B 1WBXA 1H9VA 4UQ3A 4QT5B 3EOTH 4GG8A 4GAYB 2IQ9L 2VSCA 3MLSL 1QA9A 4WI9A 4G7YH 2EECA 1CQYA 2Y5EA 3FAWA 4QXTA 2NX5B 4IRZH 5JOPE 1OAXL 4MVBA 3H8NA 1CXHA 5F7KC 4X4ME 3E2HA 4D0BA 3VFOA 1BIIB 1MH5A 1RJZA 4GW5A 4X7DC 1BD2E 3L5WA 2Y07L 1A21A 5E4EC 5A2LH 4FFZL 3QDMB 1VESA 3S3PA 3DTXB 2XTJD 4FQQA 3ARGB 1FG9C 2WMPA 5JUEH 5JOEA 3TA3A 5DC4B 1FNSH 2IANE 3PXHA 3DUUB 3FFCA 2OTUB 4HUXB 3S35X 2IFFH 1IL1B 1X6NA 3BPCB 4NQDE 5GS1B 1BM3L 3JUYA 4Q9BA 3PWJA 5IVXA 1KN4H 2OJZH 3Q2CA 3BUTA 4WO4B 5FCUH 4OCSL 3G04A 3G5XA 1JGDA 1JNHA 1NAKH 4H8WC 1UVQA 4MA3B 4MA7L 1NCCH 2NQCA 1I85C 4HIEA 3BAEL 4BSWB 1GZPB 5HVHC 4PIRF 4BSVB 4U6HB 1QYGL 1R24B 4MQTB 3QDAA 1MSPA 5FYKD 2PW2B 4G7VH 4G9FA 3DX9B 4QKXB 5I75C 3LOWA 3GSWB 4MAYB 1I7TB 3QUKB 3CVIL 5I66A 2ZCHL 4MXVE 1KLUB 2VH5L 2I07B 1FPTL 4NJAL 1CFBA 4PFEA 4AL8L 2JCCF 4QHMA 4P4KD 3ZHKA 1XH3A 3GKZA 5TJWK 4J4PD 3ULUE 1WBYA 3ULSB 1EEQA 4PLJC 1KJ2L 4RDQG 1TPXB 1CGVA 1J9CT 5BQ7B 5ESVA 3MA7B 1G6RL 4P9HL 4NBZB 3WFHA 4UZGA 3OKYA 5JNYB 5HHVL 5F1IA 4Z7VB 1LE5B 4LL9A 7FABH 5F89A 4AQOA 2VUYA 2DM3A 3N85H 1XF3B 3PJSA 4OZHE 3I9GH 5SX5H 5TE7H 3QFJA 3I3BA 3F12B 3P73B 3IAPA 4H88H 2J8OA 3RVXC 4AH2A 43C9B 1QRNE 3OV6A 1BQHB 5DRXB 4KUZH 4G80A 2FWOA 4OCYL 4D9RE 4HAFA 2WBJD 3WFCH 4L3AA 4LGRB 4X8XA 3EFFB 3V6FA 5BRZB 2PW1B 2R2HA 4WWKA 4O51A 3TBVB 4K94H 4YPGB 4DQOH 5EU6B 3GDBA 4FMFA 1F8TL 4HWEH 4H1LA 1I1FA 4S0TD 4S0SD 1JV5A 1EERB 1FIGH 1Q0XH 2BXYA 1KIPA 2LQRA 3GHEL 2ZSVB 1KEMH 1NSNH 5JO5A 5CKAA 3TJHD 1ZTXL 5HY9A 1S7RA 3FMGL 5A2KH 4JREC 1EO7A 4EXPX 3KPNB 2HRLA 3EFDL 3F7QA 4PJ5D 3HMWH 3I2CL 3IU4L 5T5FL 2HVKA 2XACC 4WEBL 4L8CA 3OL2A 1HH6B 4JHAH 4K3JL 2C5DC 1LO4L 2B8OT 3L1OL 4JKLA 4Z95L 4Y5XA 4QRRE 3BD3A 1A7RL 4JANA 3O6KH 1ZK9A 2YD4A 4KUCF 5JZ7C 2IBZX 2W91A 3VGAC 1CFQA 3SE3A 1NGPH 4NKOB 1HIML 2FB4H 2HTKC 4ZAKB 1S9YA 4U6YB 3RWGB 3IDXL 1FNLA 3CFKB 5CBAB 5E1AB 1NBYB 3HZVA 4RA3A 4RAUB 1CLZH 5D7JA 3CX2A 3CLFL 5D70H 3SGDI 25C8L 4PRPA 1IGJA 4KJQC 1IAOB 3M07A 1FLRL 5CEZL 1D5XA 3RWHB 5TH2B 1QBML 5D5MA 5ID0B 3A6CH 5F9JB 4NWTL 3IVKB 4PV9A 3TVMD 5H2BB 4Z7WF 4ZXBB 4YBQC 3O8XA 1E27A 3FL7A 1T04B 4WW2B 1CGWA 1A3LH 2C1OA 2EC9T 1GYAA 5CJXA 4M8QB 5JOPD 4FTVA 2L0DA 3QO0B 4H25B 5T33H 3OX8A 1G9NH 1IC7L 1U92B 5E6ZA 3W5NA 4J8RB 3SDDB 2E7CA 3MRNB 4PRDA 4M5ZL 4ZD3H 1NMBH 3OAUL 4M6ML 5EOQL 2Z8WC 4PV8A 4WI8A 1NCTA 4HFWA 5DLMH 4PJ8A 3PWVB 1IAII 1LO3H 2NY3D 3VXUA 1M71B 1YEIH 4NBYB 5IMLB 1X5HA 2IAND 1JHTB 4L9LB 1I8MB 4XC3L 4UV7H 4IRSC 4O2FA 3O41B 2FATH 5L9DL 4C59B 3E0GA 4NQDD 3LKSA 3BKYH 3EKCA 4LVOB 1TZGL 4L8SC 4JZNA 1OW0C 3BOVA 4Q2ZB 5KVFH 1YEJH 1YQVH 1DQTA 1CICD 4HK3N 1ZLWK 5DD5L 4BA8A 1NUGA 1YUHB 2GJJA 3IT8D 5E8DL 2AXGB 5DK2B 2QV2A 3MRLB 4K07A 2HG5A 4MWFB 2OCFD 1KCGC 4XAWH 5JA8B 2XTJB 2WP3O 2K7QA 1EA9C 1G7LA 5LGJB 4RISH 3TCXA 1UYWL 3KGRA 4UDTB 4ZFOA 1P7QD 4JM4H 1UB5A 4GRWE 1FDLL 1PGRB 4N9GB 5DEGA 4AEHL 4LQ1A 2CMRL 1N64L 3ARDA 1GAFL 2UUDK 3MCLL 4V2BA 5I1LA 2Q86B 1LO2H 2ADIA 4MNQE 3WIHA 1GIGL 1VKXB 1EEYA 4KI5C 3X11A 2AEQH 5KSUA 3HI6L 3NMEA 1V7NL 3FB7A 4FNLH 1FNFA 3UO1H 4LEOA 2X9XA 4NRYB 1KNOA 4QXGH 4H20H 4GRLC 3ZE1F 4NQVB 5TE6H 5EBWB 3DRQB 3HCVB 4Z5RB 3P2TA 2OS7A 3FQNB 4V1DA 2ESVA 4OV5B 5IROA 4C57C 2RQ8A 3VFGL 3P0VL 3TBSA 4OJFL 1NJ9B 5DRWA 1QRND 2Q8AL 2XWTB 1Z9OA 1MIML 1HI6B 3TEUA 2GITA 2HJFB 4P4KB 1EJ6A 4D9RD 3RIAF 4IS6B 1S7VA 1AH1A 1GGYA 4LKXA 3C5JB 4Z8FH 5GS0C 1EH9A 4YDIL 3T08A 5B38G 3V6OC 3UTSB 2VQTA 1F3RB 4U1MB 1NDGB 4ZSOB 1AR1D 5DC0A 2P44B 2XG5A 1RIUL 5IKCB 4FZ8H 3RIFF 2VDOH 1IC1A 5ADOH 1T4KA 4U6VH 1I8IA 4HKJB 2DJUA 3QWOB 2UVFA 2VZSA 4M7LT 4U05A 5AYQA 2OQJA 2GAZA 2WBJB 2ENSA 2XI9A 3TIDB 2DD8H 2L7JA 4JFYB 2Z8SA 1N5AA 1S8DB 4NWUL 5FO7A 3PNWA 4HJGB 3GSNA 1KSRA 4LCYA 1U93B 5CJOL 3GMPB 4FMKA 4LCWE 4Z7OE 4JM2D 2BHYA 3KYOA 4KK5D 1F13A 2MHAA 3KHOA 4MHHG 3MUGA 4RGNB 3N9GL 3TLRA 3VXPA 2W38A 4JN1H 4I18A 1EMTL 4KK8C 2UYLB 4JY4B 3FN3A 4IHOA 4KJPD 2LVEA 1UQSA 2HMID 1CXIA 4OD1L 3L5XH 3REWA 1XGUA 4MDIA 1IGML 1I4FB 3U7YH 2E6PA 2BX5A 5BVJB 2AERT 5J9PB 4HWZA 4ZS6C 3H2WA 3MRHA 4M7LH 2XA3A 4O5LH 4YXLH 4LLYA 4C56E 4LRIA 1OP9A 4HBCH 5CZVH 4WFEE 2Z91B 1UM5H 2X4RA 1VGEL 3ELAT 4GRMB 5E0QA 4JG1H 4QF1B 2IPUG 3GKWH 4OLYL 4QWWD 2RJMA 4I77L 3VFWA 5IIEB 1SM3L 1DR9A 1LD9B 1T7YA 4PGEB 3HE6D 5E99H 1U9KA 5ITFB 5HDQH 2C3XA 4DVRL 5HGGS 3P40A 2FX9H 1W0VB 5E6YA 3EHBC 3BKJH 4PS4L 3IFPA 3LMJL 1QLEL 4NZUL 3VFVB 3TVMB 3QRGH 1CFNB 3MYZA 4XHQA 4APQA 1IKFL 1AC6A 2BRRL 4MJ5B 4FQLL 2FBOJ 3PWPE 4XPGL 5KS9E 3IFLL 5MENE 3RL1A 3AY4A 4Y1AE 1A7PH 2VXTH 3MRCB 3V5HB 2FX8L 4L8DA 1C5CH 2EYRA 4CUCA 4NPYB 3OXRA 1L6ZA 4HIJA 3BEWA 3V79C 1BD2B 3D25B 3UC0H 2VOTA 2PCPB 4V3DB 3NA9L 1NDMB 1FVCB 4OIBA 2XG4A 5CGTA 5DUMH 5DEFB 1CS6A 4NO2A 4D94A 5FUCC 4PJXF 4G8FB 1HQ4B 3U9PL 2IANB 2R56H 4FQHA 5C0IA 4G6KL 4I3SH 2JELL 5CJ5A 3KYKH 4NQDB 3QUXA 2VNCA 2NY2B 1S9XB 3CK0L 3J7HA 5IHLB 5J12B 3FT2B 4JG0L 4OLWH 4WEUD 3VFNA 2A2QT 2V5MA 2Y5TA 2DL9A 5I1IL 3MRMB 4MNQD 1D9KB 3HC3L 4OZFG 4HIIB 2Q7YB 2FSEA 4ZDHA 1C08A 5IQ7L 1JYWA 5C0BE 4QCIB 3S35L 5JW3L 1RIVL 3HI5H 3X12A 2QTEA 4NN6C 5DT1H 3ROLB 3T2QA 1G7IB 1HH9B 1QFUL 2GJZA 5KJRL 1VERA 1P7QB 2OK0H 1FYTA 1KULA 4K3HA 3FRPG 3HC4H 4QHLA 2W65A 5HHPB 1ROWA 1UA6H 4P2RE 1M7IB 2XWJA 3D87B 4NSKB 3IB4A 3QI9D 4O2EB 3BKMH 4Q74A 1MCOL 4DGVH 5GGVY 4X80H 2XZAH 5GRVL 3UZVB 4PTTB 2FO4B 3QDGE 3RY4A 4PJDF 1BZ9A 2VDML 3EGSB 4QT5A 5HYJB 4GAYA 2NY6D 3MBED 1DEDA 1U2CA 4MMXC 2V7HB 4K8RH 4QRTB 1KC5L 2NX5A 1P9MC 4QGTA 3TO4D 3JWDC 1CLOH 5F7EL 2CDFB 1QRNB 1AGEB 5DZOA 3ZT7A 1RK0B 5C8JB 4JRXE 3QIUC 2ZCKL 5HXMA 4F7TB 4IEFB 3QDMA 4P49A 4JKPL 3DTXA 2AI0H 4RQQB 5IBTH 3ARGA 3NZ8B 3CXHJ 2VXUH 1LK3L 2AJVL 1QG3A 3EYQC 3ARQA 2CRZA 1MFDH 1JGLH 5IHUH 5LWYL 2ZNXA 1E4XH 3LDBB 2OTUA 4HUXA 3PP3K 1IL1A 3BPCA 5GS1A 4MJ6B 1MY7A 1QNZH 5J0BA 4M1GH 1LDPL 1DN0A 1SY6H 4ZOCA 1E0OB 5FM5O 4WO4A 2PETA 3MJGX 4FP8L 4GSDL 4MA3A 5JXEA 12E8H 4BSWA 2EE2A 3U0PB 4BSVA 1NL0H 2FHBA 4U6HA 2EDKA 2OJEB 2H45A 2VIRB 1R24A 4G8EB 4RAVB 4HZLB 5FHAL 2PW2A 2CRIA 5LG1A 1WAAF 3O6ML 3MCG1 3DX9A 1HXYA 4QRRB 3GSWA 4GXUN 3D2UD 4LSQL 4XPHL 5CJQH 3MLPA 1BBJB 1I7TA 1AXTL 1KTDB 3CXDH 2NY0B 3G5ZB 3H3PH 3QUKA 1KLUA 4TUOB 1MEXL 4C56D 2CIKB 3QT2A 4WFED 2I07A 1Y6NR 1XGPB 3NFSL 4IMLB 4IDLA 1RUQL 2K3TA 4ZUTB 1HCFX 3ULSA 1FORH 5BQ7A 3MA7A 2XT1B 5D93B 1RZIB 2F54E 3PDGA 1CFVL 5JNYA 1QSEB 4CVWA 1JPSL 1LE5A 3WIFB 1G9EA 2VTFA 2NW2B 1XF3A 3KPQB 1V3JA 5C0RH 5MEND 2CUIA 3F12A 3P73A 2H6PB 2UZIL 4Y1AD 5K59F 3TP4A 4ONHA 4Y16B 43C9A 4J3UA 3HNVH 5HI5C 1RD6A 5EU5B 1RFDH 2HT4D 1BQHA 1A6UH 4IDJL 2DF3A 1L9NA 5DRXA 1A4KB 5AAMA 2NY7L 1RZJL 4RFEB 5HPMB 5DUBB 1DUYB 1OSZB 2DQGL 2HFGL 2D7QA 3EFFA 2P5EA 2DLTA 2MCG1 5BRZA 2PW1A 5IFJB 1MREH 1UXSB 5CLWA 3VWJD 1N2RB 2VERN 3TBVA 4YPGA 5EU6A 4TTDC 1MHEB 2LTQC 4I48B 4JDVB 1X5AA 4ZFGL 4FABL 4B50A 2ZSVA 4HUKB 2Z35B 4HQQH 3ZL4L 4YEFA 3LHPL 3LB6D 1BAFH 2Q3ZA 3EOYG 3KPNA 3F58H 2A6KB 4DTGH 4ELMF 4F2MB 4HJJL 4ERSH 3SDCC 1T1WB 1H5BC 1A7OL 1LQSR 4YGAB 3SOBH 1HH6A 2WQRA 1XR9B 3HE7D 4BYHA 1UENA 4UTAH 4UBDC 5EA0L 4YHMH 1NGZB 4JKMA 3RWCB 1DBKH 4FQXD 4AEIH 4NDMB 2X40A 5FYKH 3SKNB 5SX4H 3BQUD 4NKOA 4GRWB 1MJ7L 4ZAKA 3RWGA 4U6YA 1FL6B 3CFKA 5CBAA 5E1AA 1NBYA 1NANH 1WGOA 4P2RD 4RAUA 4ONGL 4R26H 5DD3L 1U8OB 4MNQB 1IAOA 3O2DH 3RWHA 5TH2A 4B7IA 5ID0A 3QDGD 3MLXH 5F9JA 2NLJB 1HILB 3IVKA 3LQZB 3M45A 1IAIL 4QRUB 5H2BA 4ZXBA 3C6LD 4HD9A 2AK1H 4B7LA 2Y4SA 4TOYL 3NH7H 2BSSB 4WW2A 1ZLUH 3UJJL 3QWRA 5I71B 2PO6B 4H25A 1V05A 5EG6C 2L7UA 3OKEB 2BOBB 3RKDD 3FN0H 3DO3A 1U92A 1B0WA 1SHMA 4YWGL 4N0CD 4J8RA 3OBAA 3SDDA 4PR5B 3HAEH 3D18B 4BFGA 1KCRL 1P4BL 3REVB 4JRXD 5DWUL 3MRPB 4LCUB 3PWVA 3ZTJG 2AJSH 4W68A 1NCAH 3PL6B 4PJ9C 5B39G 3QIBD 4GT7A 1M71A 4F15C 4GMSL 1PLGL 1L4IA 5IMLA 4JO1H 1PAMA 2ZUXA 4PJ7F 4L9LA 1I8MA 3MACL 3MBEB 4DKEL 3O41A 2QADC 1RZ8B 4TPRH 3LKQB 1A14H 1VSCA 4NM8L 4OCMC 1PVHA 4Q2ZA 4KRPB 1LEGB 1IBGL 5J3HC 5D2LF 1FL3A 1JBJA 4OGXL 1YUHA 1FLTX 1KB5L 5I9QB 2AXGA 3LN5B 4WI6A 5DK2A 3NCBB 4MWFA 5B8CB 2YS4A 5ESQB 1T2JA 3VXQB 2FEEI 1U3HC 4U7SA 5LGJA 4LCWB 4GO6B 4UDTA 1DBAL 1BQLH 1HHGB 4N9GA 3NTCL 3HB3D 5C2BH 2MKWA 4LLMB 2Q86A 1LP9E 2C3HA 4K9EH 4UMGA 5J1AB 2Q8BL 1T1XA 4CGTA 3EJZC 1VKXA 3S4SG 4GAJL 3GI8L 4XVTL 2VZTA 4PJBE 2Q6WB 2F54D 4NRYA 3E3QA 3SDAD 4NNPL 4NQVA 1KCUL 1DLFH 5DRNB 5EBWA 3DRQA 2OZ4H 5DZNA 3FQNA 4OV5A 2DIBA 3QHFL 3PABB 4YHNB 5C3TA 3OKMB 4YHOL 4C56B 5D7IB 3LEVL 1NJ9A 4K7PL 1K4CB 3O2DA 2R2BB 2XWTA 1P6FA 1HI6A 3QCTL 2HJFA 3UEZA 3MRIB 4P4KA 1Q72L 3IJSB 4X9BA 1IVLA 4IS6A 1MCDA 1HK6A 4J4PA 3GSVB 1MNUH 1JP5A 4Q9RH 3DSNA 5DI8A 3C5JA 1ZANH 4KTEH 5FKAB 1T2QL 3X3FH 1ZHBB 3K8KA 3UTSA 5JR1H 3MLTB 4U1MA 1NDGA 1WISA 5EO0B 2I26N 4MSWB 1WC7B 4ZSOA 3JZ7A 2WLYA 3LQAC 1K8IB 3UZQA 3X14B 4UILL 5IKCA 2E27L 3PWPB 5MENB 1MJUL 1AJ7L 4TNWK 2I5YH 1A5FL 1RPQA 4OF5A 1FBIH 1SMOA 1XIWB 3CLEL 4M7KL 5I30H 4LASH 4J7RA 3VD7A 1UWGH 2YA1A 4HKJA 1C7TA 3QWOA 1JHLL 4A2LA 5FGSA 3LRSB 4XI5D 3HPJB 4Y8DC 4OZGF 3TIDA 5GZOD 2IQAB 4JFYA 4DKDC 2OI9B 1A2YB 4NCDA 4EEEA 3V8CA 4HJGA 1HQRA 3BVNB 5FHBH 4M7JL 1U93A 2QR0B 1VEPA 3GMPA 4JN2B 4JRYB 2XQBH 3MJ7B 3S34H 2Z9TA 3TJHA 1H3UA 5DHVH 1INEH 1NBZB 4YHLL 3O9WC 5T1DL 1FH5L 5C07E 4PD4J 2UYLA 3CFDB 4JY4A 1ZMYA 1ZA3B 4UNTA 1DEEB 2NXZC 2UZYB 3OQ3B 2IAMD 1AE6L 3LN4B 4LPXA 4WCYL 2MQ3A 2GY5A 5C0BB 2QHRH 1I4FA 4POZD 3VXTB 5BVJA 5DMYA 5J9PA 1A6VH 2NTSP 4EUPB 3NCJH 5KOMC 3RI5K 4HLZH 1DQJB 4C4KT 4RNRB 4PP2B 1AXIB 2Z91A 1U0QA 4YC2C 1NMCB 2WUCH 3F7PC 4GRMA 4QF1A 1MCWM 1UZ6E 3MJ9L 5IIEA 3VG0H 4OTXH 2J6EA 3VXMB 3RHWF 4OCLC 1LD9A 2PXYC 1GVIA 4PGEA 1JNJA 1E4KC 1PSKH 5BW7A 5ITFA 3LSOB 4WY7L 1W0VA 3L5JA 3QDGB 5D2NE 3LS5H 3VFVA 4LSPH 3TVMA 1DP0A 4HWBA 2OZ4A 3ARYA 2FR4B 3C6LB 2D03H 1CFNA 1EUUA 3ULVC 1F6AB 2DQTL 4WHCA 3WSQL 1F42A 3AFLA 4OZIB 2WUBH 4MJ5A 4NN7B 1IAKB 5IVXF 1EHLL 2GKIA 4JHWL 3G08B 3B5TA 3SDXF 3W2DH 3TZVD 3MRCA 1INQB 2EYTB 3OKKB 4YFDB 3T77B 3V5HA 5K9KB 3O3UN 4NPYA 3FO1B 4G5ZL 3UROR 2JJSA 1BD2A 3D25A 4EI5B 2PCPA 4PGDB 1WEJH 4ZOAA 1NDMA 1P5VA 1CN4A 3STLB 1DBBH 5E6ID 1WWCA 5DEFA 5CEXB 4YZFE 3F8UB 1CLYH 1NKRA 3CVHH 4IRJC 3UJIL 2ZKHH 4DN4L 5HDBE 3GJFK 1HQ4A 4OFIA 3PDOB 2IANA 1CR9H 1MCCA 1DFBL 4JFEE 4UDUB 5FV1L 2E7LC 3BE1L 5SWZE 5GRUL 1G0YR 1S9XA 3VMPA 4W4OA 4Y4HC 3MRMA 3T2NH 3UBXB 1D9KA 5JA9A 3QUMB 4HIIA 2Q7YA 2H2PD 4HHAB 2RGSA 2CXKA 1MVUB 3NZHL 4FQJH 4KH2A 3GJFB 4LVHB 2GJ6E 4PRAB 1GPOL 4HMEA 3ROLA 4PP1D 1G7IA 2COQA 3DVFA 3H9HB 2ZJSL 1JTTA 1EEZB 3LPFA 2GTWB 1IQDB 1P7QA 3RQ3A 1BFTA 5HJ3B 2X4NB 5A2IH 1M7IA 2VE6B 4X4YB 4NSKA 3O2VH 5EU4B 4O2EA 3V4UH 5IG7B 5KG9B 3LH2L 2BFVH 4GAGH 1EO8H 5JHDE 1C1EL 3FKUS 5GRYA 4PTTA 2FO4A 4K3DH 1JYVA 3X3GH 5D7KE 1EJOL 3TN0D 4QRPE 3VGGA 3EGSA 5HYJA 2X1XR 1Z0MA 4UV4H 5KW9L 2V7HA 4QRTA 4R90L 4KKNA 4ODUB 5DJ2B 5DJAB 3ZSSA 4HLJA 3BIKB 5EWIL 2DKMA 4X9IA 4RGOL 2IMMA 2CDFA 1QRNA 5DR5H 3RPIA 1ZGLB 4HXAL 1AGEA 3RWFB 4K3EL 1RK0A 2A74B 4OIIL 5C8JA 4F7TA 2VR4A 2V2WB 4UI2A 1ZHKB 4RQQA 3QXAB 2UZXB 2FD6L 3WHE1 3RVVD 2HTLD 3NZ8A 1Q1JH 5ALBL 5AD0B 3JSSA 3FOLB 5F88B 4RX4D 1WWBX 5F96H 2R0KH 3DOSA 1XAUA 4MJ6A 5MI0C 5GRJH 1OPGH 1F3DJ 1FRGL 4OLVH 1D5ZB 2BY1A 4EN3C 1F90H 5C07D 4BH8B 1A0QH 4YX2H 4KGJA 4GRWH 5DF0A 5I1HL 3JV5A 1ZT4B 4PJHB 2WV3A 3U0PA 5EOCH 2VIRA 4U3XA 2ERJC 4G8EA 4RAVA 4HZLA 4XMLL 1KN2H 5ALCL 5I1KL 1A3RH 4S10A 4FHBD 1RZKH 1J1PH 4QRRA 1BZ7B 3L95B 2EXYD 3QHZH 1BBJA 1S5IL 1KTDA 3G5ZA 4KY1L 4EVNB 4BQ6A 1CIDA 3FO0L 3H0TB 4TUOA 3ZZ1A 8FABB 4LCIH 2CIKA 3HZYA 4HZAA 1TXKA 4GBXD 4KZDH 5E2JA 3EO0B 3RGVD 1N6QL 1D5BB 1XGPA 4IMLA 3SPVB 1EHXA 4CW1B 5EBLA 4PJEF 2YPVL 4M1CC 2R29L 4Q6YA 2IAMB 5F97E 2YMXL 4WW1B 1RZIA 3B9KB 3A67H 1QSEA 3SY0B 3C8KB 1ZXQA 3K8LA 4FFWC 1ZV5A 3WIFA 1DQDL 4ZYKB 2VRAA 2NW2A 3KPQA 5T1KB 4U0RC 3DWTA 3E6HA 2H6PA 1T89C 3JVGA 4Y16A 4TUKH 4A6YB 3I3EA 6CGTA 1FGVH 5EU5A 3QR2A 5DD1H 4FQ1L 5DGRA 5E7BA 4F33B 3BP6B 4HIXL 5AWNH 3B3IA 4RFEA 5HPMA 4MD0B 5DUBA 3KLAB 2A1WH 4RA0C 1DUYA 1OSZA 1X5FA 1Y0LB 1AIFB 5HD8D 3PE9A 1AI1H 5D1QD 1UXSA 5L7XL 5IFJA 1N2RA 5JMOC 1QLRB 3P0GB 2JJTA 1MHEA 4JFED 4JDVA 2QQNH 3RAJH 1JZ2A 4Y4KC 3NACL 5SWZD 2Z35A 3RBSA 3IFNH 5MERB 5FO9B 5L6YL 3TZVB 4MJ4A 2OR9L 1A6WL 4UOW1 3PWUB 4G59A 2A6KA 2N1KA 3KNBB 3LEXB 1MCPL 4F2MA 4XNZB 1JPGB 1BJ8A 1T1WA 5JTWA 3FO9B 3EIFA 1MAJA 2YSSB 2IQ9H 4MGXA 1ZA6B 1XR9A 2EZ0C 4Z78B 1NGZA 3RWCA 3ORJA 2YD1A 4OCXL 5DMKB 5C08E 4NDMA 2C3GA 1BBDL 3SKNA 1U8QB 3OKNB 5GHWL 1FL6A 1EHNA 4MS8D 1CU4H 1I7ZB 2DMKA 1FFPB 1NLBL 1G9ML 2DQCH 3MUHL 1U8OA 2Z31B 4MNQA 5DJXB 3ZLQC 5FV2A 1WICA 5JHDD 2X1OA 1FO0B 1T7VA 4G3YL 3VD4A 1R0AH 2F5BL 5D7KD 1HILA 2NLJA 2MPAL 1ADQL 4P5TD 1SBSL 3LQZA 3NIDF 1UCTA 4QRPD 4QRUA 4PLNC 2JB6B 4U1LB 1BM3H 3U1SL 5CCKH 2OMBA 5FYJE 2VDRH 4XCYB 3P77A 2VISB 5IOPB 5J13C 4RMRA 2J4WH 4OCSH 2CR6A 2BSTB 4PYHA 2PO6A 4JPWH 2Y6SC 3D3VB 3OKEA 2BOBA 4Y5VC 1MCNA 2DI9A 4MA7H 4NGHL 4GOSA 3BAEH 5IM7B 4O58L 4PR5A 2MNUA 3D18A 1JWSB 4R2GB 4E0RB 3REVA 2WW8A 3MRPA 3QQ3B 4GUPB 3VXRE 4LCUA 3Q6GL 1I9RH 3K1KC 4F7CB 3WNKA 1N0LA 4QTIL 5IFAH 1N7ML 3G6JE 3PL6A 2VKXA 5J8OA 3VRJB 1CFSB 4OGZA 3TN0B 1PKQB 5L2KB 4KV5F 1YJDH 3Q5TA 2FEEL 1IKNA 3T4YB 5E9DE 2KL6A 3MBEA 1FPTH 4NJAH 2R69L 3W39B 3KXFD 1RUPH 1RZ8A 5JDJA 3LKQA 1JRHH 1UZ8B 2QSCL 3IDNB 4XCEB 1V3KA 1LEGA 4DVBB 4RCAA 1MWAL 2EDFA 3WNMA 1G6RH 1FZKB 3MODH 5D71L 2RB8A 3LN5A 1PBYA 5HHVH 4DEPC 3B4NA 4Q7DA 4PLJD 5B8CA 3AM8C 5CSZB 4HXBL 5ESQA 3Q5YA 1J05B 3VXQA 3WS6A 5ICYB 3EDJA 4AM0B 4LCWA 3ARRA 2IFGA 2P46B 5D1ZD 1HHGA 2DICA 5IMKB 5FECB 4Z7UE 3ESUF 3DROB 3KR3H 3RVXD 1RJYA 2YRPA 5C07B 3VH8G 4LLMA 5GSVB 1QD0A 4LAQH 4DOHE 5J1AA 4YUEL 1ZVYA 3MV8E 2HLAA 3V0WH 5IEKB 1C5BL 1S3KL 1H3TA 4L4VE 2Q6WA 4HPOL 3ZKMD 3MXWH 1H3WM 1ZTXH 4UAOC 3FMGH 3VD5A 4YXKH 5DRNA 1FFOB 3V5KB 3BJLA 4NC2B 2ICWB 1WVZA 3PABA 1EGJA 1WZ1L 4YHNA 3OKMA 5E8NB 4C56A 4EI6B 5D7IA 3IU4H 3EOTL 4GBXB 1K4CA 3RGVB 2R2BA 4G7YL 4WEBH 3QAZC 3U4AA 4KKAD 2X5PA 4F7PB 5KBNC 5TF1L 2XWBB 3MRIA 3IJSA 4XBPB 2V7NB 1AO7D 1LO4H 3L1OH 3GSVA 4JGJA 2YHGA 1A7RH 2NY1D 5DMIH 5D2NB 5D72H 1HKFA 1N26A 1MFEL 5FKAA 3JV4B 1ZHBA 3MLTA 3QB7C 2ED8A 5EO0A 4MSWA 1VEMA 1WC7A 3H7BB 5JZ7D 1DBJH 1UWEL 1K8IA 5F7LB 3QXWA 3X14A 4DGYH 3PWPA 5GJSH 5JUEL 3T0EC 2HTKD 1QHOA 1B9ZA 2EIDA 25C8H 1QQDB 1XIWA 1FLRH 1FNSL 5LJYH 4KDVA 4XNUL 4D9LL 2IFFL 1LO5B 3U30C 3TPUE 2OSLB 1H3XA 1JZ7A 3LRSA 3HPJA 5ANMB 4BQ8A 1KN4L 2OJZL 2AEPH 5FCUL 2IQAA 5BV7H 2OI9A 1A2YA 1NAKL 2JF1A 2X2YA 5C0GA 5D1QB 5HHNB 2APBA 1NCCL 4DK3A 2BC4B 4P46C 2QR0A 4Y7MA 3O6FB 5C08D 3O3DB 4JN2A 3OR7B 4JRYA 3HZMB 1OP5K 1OTSC 4YHIB 3MJ7A 2P5WE 4JFEB 5E7FA 1AD0B 4I9WE 1E28B 1NKOA 5SWZB 4M6MH 1E4XI 2VSDA 1NBZA 2NY4B 4LFHD 2Y7QB 3V4VL 3TPKA 2HFFB 4U1GC 1AHWB 1ZA3A 1DEEA 2R1WB 2J7LA 3WJJC 4F9PC 5F9WC 3DSFH 4JR9H 4NKMB 5EOTA 4XPAL 3I02B 3ZDYE 3LN4A 4PJFB 1LO0H 5C0BA 2CO6B 4PBVC 3CSYB 2GJ6B 2M2DA 3VXTA 2JJUA 4AMKL 2R39A 4EUPA 2VDPH 5LVEA 2KZWA 1ZGLM 3HTLX 1G7HB 4RNRA 5DD5H 4PP2A 5E8DH 1FZOB 3AB0C 4PLKC 3B5HA 2ZOLA 3DMMC 3N85L 4AEEA 3TH3T 5KSBB 3I9GL 5GRWA 3TBWB 5TE7L 3VXMA 1L6XA 3C2AH 3VXRD 4H88L 4GKSB 5JHDB 2H26A 2VUOA 3LSOA 5E4EB 3S98A 1UYWH 2P8MB 3QDGA 4P5TB 3PGFH 2ZOKB 5KSVB 2D0HA 3BWAB 2FR4A 4KUZL 3C6LA 2VABA 5FUCE 1F6AA 3U4EB 5E9DD 4UINL 4U1NB 4AEHH 4NKQB 4OZIA 1GAFH 1OY3B 1IAKA 1OTTD 3D9AH 3F5WB 1B0RB 3G08A 1IILE 4OZ4B 2X4TB 1INQA 2EYTA 3OKKA 2Y36L 3T77A 3DX7B 4HWEL 1BP3B 3QCVH 5TGBB 1FIGL 1Q0XL 3FO1A 5H37H 2F8XC 1V7NH 1KEML 1NSNL 3V6ZB 5D8JL 5TF0A 4EI5A 4PJAE 1M1SA 1YEKL 5DFWH 1M7DB 3STLA 2XZQL 3VD9A 3QEQA 1ED3B 5CEXA 3U7AA 1CTNA 2BY3A 4X98B 5FK9B 5C9KA 4W81A 3VFGH 4UIKH 4GRLD 4CN4A 3PDOA 5I75B 4XBEL 4OJFH 5IB2B 2MTPA 4UDUA 3QPXH 1FCGA 3U7WH 3WIHL 2DTMH 2Q8AH 4JHAL 3MROB 3OJDB 1MIMH 1UKSA 4K7FB 2AQ2A 1KYOK 5DUPH 3SGKC 3O6KL 4LRNH 3UBXA 3QUMA 3MV8D 5E03A 2N4IA 2DS4A 4YDIH 3BO8B 3ZE2F 4EDXB 4HHAA 3FONA 4OUOA 5HHXL 4L4VD 1MVUA 3BPOC 1OOAA 3GJFA 4Z7VF 4CMMA 4PRAA 4HKXB 2VR5A 1RZ7H 3H9HA 1EEZA 5I0DA 2GTWA 3K2UH 1IQDA 4OLZH 3UXFA 3U4BH 5HJ3A 5SWQB 4HX1B 3TF7C 2X4NA 3P11H 5LKNA 2VE6A 5SX4I 4TSCL 4X4YA 5EU4A 3UTOA 5IG7A 3QRFM 4A6YH 4ZUUB 5KG9A 5T33L 4NWUH 1NANI 4N8CH 1G9NL 4RMTA 3T0XA 3VI3E 4LVEA 3C5ZD 3CFJB 3FO2B 3O4LE 4ZD3L 1P7HL 1Z3GL 4MQXD 3EDKA 5EU7C 5SWSE 1JTOA 4RRPA 5DLML 1KCVL 3RVWC 4XP9H 3VXNB 3GHBH 4ODUA 5DJAA 1EMTH 2EE3A 3MLVH 1RUML 1YEIL 4JREB 5E1HB 3PIQB 2Y25A 4OD1H 3WNPA 1ZGLA 4UV7L 3RWFA 2A74A 2FATL 3FB8B 4MA1C 1NEUA 4S1SL 4JQXC 4V2CB 4GXUM 4ODWB 2V2WA 1ZHKA 2NY5H 1J0JA 3BDBA 3QXAA 1YEJL 5DFVD 2FECI 3VA6A 3LKRB 5AD0A 4ELKB 3FOLA 5F88A 3WE6B 4WI2A 2P5WD 1MAKA 4PJCE 3MRRB 4I9WD 4XAWL 5DTFA 1I3UA 3OG4B 1S7SB 3VGAB 2CLZB 3C60D 3KG5A 1D5ZA 3OB0H 1YEHL 3G9VA 5DRZB 2X44D 4RISL 2XFXB 4LVNC 4WENB 4JM4L 4PS4H 1ZT4A 4PJHA 4NZUH 3LMJH 4M93C 3QUZD 4S1QL 1KJ3L 3WV0A 1IKFH 2BRRH 3EHBD 4HCRH 4F58H 1LO2L 3NCYS 4BQBA 3ZHLA 1FGNH 4WW2F 2AK4E 5GRXG 1FO0H 1IM9D 2E3VA 1BZ7A 2GY7B 3L95A 4Y2DD 5LXGH 1Z5LB 2ED7A 4JFDD 1L7TL 3K0WA 1M05B 4EVNA 5ADPH 3H0TA 8FABA 3SCMD 3UO1L 5CIPH 5C2UB 4NNXB 2CKBH 2O5XL 3EO0A 4NJ9L 4QXGL 5TE6L 3NA9H 1D5BA 2YRZA 2YA2A 2I60H 2DAVA 3T3MF 3SPVA 1H8OA 5DMGC 3V7AG 4CW1A 5ICZB 4GH7B 5DJ6B 4KRMB 4R4BB 1ONQA 3MV9D 3W9DB 1WLHA 3U9PH 4YLQT 4WW1A 1VFAB 3B9KA 2JELH 2F74B 3SY0A 5LGKA 1BMGA 3C8KA 3CK0H 4ZYKA 4JG0H 1TJHL 5T1KA 5E95B 3VFTB 4IRSB 1SJVA 5I1IH 5E8EB 4Z8FL 2J8UF 4LKCB 4A6YA 1FL5B 4L8SB 3UPAA 4KXZI 4HC1A 4M3JA 3ARED 5D1XC 5F7NC 5IV2B 1I8KB 5IQ7H 1MCLA 3BP6A 4F33A 3U9UA 1FQ9C 4FZ8L 4MD0A 3KLAA 1RIVH 1OQOA 3FQRB 2CO7B 2X05A 1E6JH 1JFQH 1NC4D 4OLEA 5C09E 5ADOL 1AIFA 3G6JB 4U6VL 5GGQH 5KJRH 1OTUD 2DTSA 2VLJE 1QLRA 5D6DA 2D4FA 2QSVA 2YKLL 4MB4A 3FT3A 3PWNB 2EDEA 4Z7QF 2YA0A 2DD8L 3VJ6B 4GKZB 4M8VA 5FO9A 2VLRA 5MERA 1KJVB 3RKPA 2RHEA 3ARFC 3W9EB 4OFVA 2X89D 2ZUVA 3PWUA 3WFZA 3KNBA 3LEXA 1URLA 4WFGE 2EDRA 5LGHH 1JPGA 2VZUA 4O4YH 3FO9A 3IAGC 2YSSA 5CHNB 4BQCA 1ZA6A 3MJ6A 4PLOB 3WNNA 2DWEB 3EYSL 1EHAA 5EZOH 3OKDA 4Z78A 1U8KB 2C1PB 3NFNB 4P23C 4XXCC 3T04D 3FB5B 5DMKA 2R9HC 1ZLVK 3TFKD 4Z0BL 4GRLB 5A3IC 1U8QA 4EDWH 1GOHA 4I0PD 3L9RA 1G0XA 2KQMA 3OKNA 4NHUE 4QXUL 3U7YL 5F3HB 4Z7UB 2B7DT 2ZCKH 3KPOB 1I7ZA 1BQSA 1RIHL 4ONFL 4P2OD 1FFPA 4JKPH 5DD0H 2Z31A 2Q1EA 2HLFC 4M7LL 1FZJB 4HCRA 4O5LL 4YXLL 2AJVH 2P48B 3MV8B 5DJDB 4HBCL 4R9HA 5LWYH 4LOUD 4RWYL 1UM5L 5MHSE 2IG2L 4L4VB 3MRQB 4JG1L 5EO9A 2JB6A 5SWSD 2FNBA 1D6VH 1PZ5B 3STZB 4U1LA 1UFUA 1VCAA 4QOKE 3EO1B 1LDPH 2MJWA 4Y89A 4XCYA 2IF7A 2VISA 4LEXL 5HDQL 5IOPA 5J6GB 2BSTA 2K1MA 3NBNA 3D3VA 5D7JC 1UKTA 5E94B 1EZVX 3CDCA 5IM7A 5FUZH 2GQHA 4R0LC 1AQDB 3FOMB 1JWSA 4E0RA 1Z2KA 5FHAH 3CGTA 3QQ3A 1CXLA 4GUPA 4Z77B 1A7PL 2VXTL 4YFLI 4F7CA 5HSFA 1MFNA 1C5CL 4NQTA 2ZUUA 4M9OA 1YPZF 3VRJA 5D5ME 4KK9C 3TN0A 3BD4A 1PKQA 5EZLA 4ENED 5L2KA 3UC0L 4I5BB 3T4YA 2EKJA 2R0LL 1CVSC 1OD9A 3W39A 3IDYC 1NBVH 1R3KB 5HTSA 4N8VG 1UZ8A 1IGYB 4XCEA 4FTVE 4G6FD 3VFRB 4WGVB 4XP4H 1RUQH 4NUJB 4OF8A 4PJ8C 2DQUH 1FNAA 5DJZB 2OP4H 4I3SL 3TPUB 1FZKA 3KYKL 1CFVH 4YJZL 5GGRY 4OLWL 3R06B 3MFFB 4C4KO 1IC4H 4RBPK 1IE5A 3KPTA 1J05A 1A1OB 2AXJA 1YZZA 4OF6A 1UKQA 5ICYA 5HI4C 4AM0A 1C16B 3FFCD 2X1WL 3JWNC 4IDJH 3P30H 5IMKA 5FECA 1W72B 5DT1L 4I0KA 3DROA 2CRMA 2DQGH 5HI5D 2ZPKH 5GSVA 2HFGH 4UB0H 5C07A 3BZDA 4K94C 3HAEG 5CGMA 4X7FC 1QSFE 4WEMB 3ZYJA 5IEKA 1U58B 3LZFH 5EUOE 3HC4L 1HNGA 2ZUQC 2P45B 4NZTH 4CADB 4ZFGH 3FQXB 1G7MB 3I6KB 1QHPA 1BF2A 2EDNA 2FJGB 2E9JA 4TTDD 4X9GA 2QJDA 1FFOA 3V5KA 4DGVL 4MDJB 4X80L 2ICWA 1D7FA 1CK0L 3F7RA 3SO3C 5E8NA 4EI6A 1GCFA 1ULVA 2O26U 2XRAL 3RGVA 3SGDH 1FE8H 4K8RL 5AG8A 3UZEA 4F7PA 2QEJA 2XWBA 4WIQA 4XBPA 2V7NA 3K74B 2EO1A 5C09D 3U46B 1CLOL 4H8WH 2QKIB 4MXWH 4X7EC 5D2NA 2QSTA 3RWDB 1GL4B 3AGVA 3JV4A 3CZJA 3S96B 5MEQB 1A9BB 1IAIM 3OJ2C 4L8BB 3H7BA 3U82B 2AI0L 4WDIB 3QFJD 5DD3H 2DDQH 4V1DE 2ESVE 2BDNH 1R5IB 4MZ2A 1QQDA 1A9EB 1U3ZA 1JGLL 5HGAB 1E4XL 1HXMB 4WFGD 5TDPB 1LO5A 2OSLA 4I8DA 1P2CA 1IAIH 1OD7A 4FFEX 3OAZH 4U1HB 5ANMA 2LU4A 2E5EA 4M1GL 4PJAB 4R97C 5FO8B 1XR8B 3UJJH 3OAYH 1PEZA 1D6EB 1UWXH 4RMQA 5BJTB 1T0NB 1OHQA 3FB6B 4XP5H 5D1QA 5HHNA 4IMKC 2Q7NA 2BC4A 12E8L 3BISA 1FAKT 5FDYA 3O6FA 3O3DA 3OR7A 3HZMA 3CNKA 4YHIA 2H32H 4MXVF 4JFEA 4CVZB 4NFBA 1FV1B 4BH7B 1AD0A 1E28A 4G6AD 1KCRH 5SWZA 1FNHA 5DWUH 5TDOB 5E4IA 3VD3A 2Y7QA 5FXCH 5I8KL 2HFFA 2IALB 1MFBL 4LLUB 1AHWA 5CJQL 4N0YL 3ARBC 2MKLC 5GZND 3ULUF 3AS3A 2R1WA 2W60B 1PLGH 1YMHB 5C0AE 5MEOB 4D0DB 4NKMA 4MXQD 2XY1A 5MHSD 3I02A 5GQBA 4PJFA 5IBLC 1TJGL 3MACH 3CSYA 2E9IA 2GJ6A 2IBZY 4QOKD 3WJLA 4BZ1H 3HUJB 3QDJB 3GMOB 4OZHF 3ULVE 3QULB 3FTGB 4YFLF 4CKVX 4XGZB 4TVPL 4FXGB 4LHUD 2WINB 3KPSE 3O3BB 1G7HA 2DMCA 4I18C 3QQ4B 4P2QE 3TO2B 1FZOA 5IP4A 3SO5A 3M1BB 2V5TA 2LAGB 5IF0B 5EFIB 1MFCH 2ZUTA 5KSBA 3TBWA 4HPYL 3IJYB 4RMWA 2VZ1A 3QIUB 4PRPD 4GKSA 2PTUA 5JHDA 1EK3A 3O4LB 2P8MA 4JZJC 1X4YA 7CGTA 1A6UL 1DBAH 4P5TA 2ZOKA 4Y19B 3SEPA 5KSVA 3BWAA 1BOGB 1QP1A 1OGTB 1GGBL 3F7VB 5F7WC 5SWSB 1A02N 3U4EA 3O8XD 2NMSA 4U1NA 2N56A 4WNQA 3B6SB 2DBJA 1B0RA 4XZUB 4GAFB 2E7LE 4OZ4A 1MREL 2X4TA 4FTVD 4LBEB 2Q8BH 3KPPB 3OR6B 1JWMB 3DX7A 1MHPL 4GAJH 4XVTH 1Q9OB 5TGBA 4S1DC 3V6ZA 5JQ6H 5EORH 4HQQL 1DBML 1HEZB 3RX7A 1BAFL 1I85A 1M7DA 3F58L 3CFIC 5KZCD 4D0CB 1LE9B 1ED3A 4CRPA 1A3QA 1MCEA 5FDWB 4X98A 5FK9A 4ERSL 3RBGA 4YHOH 4JM2F 4QRSB 3SOBL 5IB2A 3LEVH 4K7PH 4PJCB 1SVCP 4UTAL 3MROA 3OJDA 3PGDB 3MZGB 4YHML 4HLZG 1DBKL 4K7FA 5IQ9B 2DQHH 4F7MA 1I3RB 5BS0E 2AV1B 5FYKL 3VMNA 1WCQA 4D0BB 1MQ8A 4EDXA 3BO8A 1T2QH 4GW5B 3QDHA 2AW2A 5LCVH 4RMVA 2ICES 5DO2C 1YY9D 2F58H 3WKNA 1CE1H 3RPKA 4HKXA 3D39E 1Q9WB 1S7XB 2AK4B 1AJ7H 4MA8H 1J11A 3DVGA 1A5FH 3O2DL 1TZIB 4PGCB 1BEYL 4M7KH 3MLWH 1OT2A 3VFUA 2KUTA 2QLVB 1FHGA 2AK1L 5SWQA 4HX1A 3FN9A 3NH7L 1MLCB 3ARDD 1BVLB 2V9TA 5EUKB 2VWEE 4ISVB 4M00A 3LS4L 4ZUUA 1JGDB 3BMVA 3FN0L 5L88L 1JIBA 1BWMA 3MRBB 1WQVT 3CFJA 3FO2A 4O02H 3AXLB 5TE4L 4UQ2B 3VGEA 5JLZB 1IGIL 1I9EA 2FECL 2WK2A 2A9MH 3VXNA 5CS7A 2LTQB 1RHFA 3RZCD 4JFFE 3AC0A 2H1PH 2IC2A 2ESVD 4V1DD 5E5UB 4JO1L 3O9WD 3PIQA 4MNHB 1LHZA 1I1AC 5HYFA 4PB9H 4U0QB 1AE6H 3SKUD 4A2MA 1NCDH 4KK6D 2DI7A 2FLRT 3SDCB 4ODWA 1H5BB 5L0QC 4XWGL 1WBYB 5C09B 3TV3H 3LKRA 2W0FB 2F15A 2VLJB 2C9AA 3BN9C 4ELKA 3WE6A 3RU8H 5F1IB 3MRRA 4GRWF 4H0GA 3GMNA 3A6OA 1S7SA 2YD5A 2CLZA 4R8WH 3MJ9H 1INDH 2NX5E 4XCFH 2VDKH 1JRHI 4WY7H 2BVPB 2XFXA 3ZDZE 2YD8A 5B4MC 2AEIT 4PUBH 2NZ9D 4PGBB 5C2BL 2DQTH 5HHQB 1IRAY 3WSQH 2CK2A 2J1KA 1CT8B 1K4DB 4L4TA 4K9EL 1KCSL 1EHLH 4PRIB 1AGBB 2PR4L 1TVHA 1S5HB 3ULVD 3RWIB 1Z5LA 3I85A 4H1LB 3KPSD 1M05A 4WO4C 2NPLX 4NHUB 1K2DB 2XZCH 1WIOA 4NZJA 4P2QD 5HDOA 1C8PA 1DLFL 4ZUVB 3CIQA 4NO0B 2OZ4L 2YPLE 1M6OB 3ZKQD 5ICZA 1EAPB 3X13B 4NQEE 5DJ6A 1WFNA 4D3CL 2AGJH 1YC8A 1T22B 4Y0GA 3W9DA 5I15H 1KTLB 1OAUL 1YNKH 1VFAA 2ZG2A 4MAYC 5JIIA 4PJ9B 4G43B 4IRJD 2F74A 3BE1H 1J12A 5GRUH 4QOKB 3CFEB 1MNUL 2HWZH 3VFTA 4IRSA 4Q9RL 4LHUB 5E8EA 2QADB 3M8OH 4KKLC 1FNEB 4LKCA 1FL5A 4L8SA 1NGXB 5JR1L 1OW0A 3NCYP 3AUVA 35C8L 5IV2A 1I8KA 3NZHH 5T3XL 2IJ0C 2I5YL 5F8RC 3FQRA 5H35B 3DYPA 1MHCB 4LASL 5I30L 3G6JA 3UAJD 1UM4H 1TETH 4Z7OF 4U2ZA 2V2XB 1U3HB 4UT6L 3PWNA 4APQD 1EUTA 2XQYG 2G60H 4MYWB 3VJ6A 2DQJH 4GKZA 3RDTC 2WAHA 5A16B 1KJVA 1ZKAA 3KS0J 3KLSA 2RR3A 3W9EA 5BS0D 3IRZA 4HFUL 5FHBL 3LH2H 1J1XL 4XMKH 4CMHB 4LGPB 3HS0B 4KDTC 2XQBL 3CMOL 3S34L 3TWCL 4M61B 5HVGB 3ESVF 3H3KA 1GRWA 1EJOH 2ITDB 1QTYT 3HPLB 4K8RC 1INEL 4NO5B 5CHNA 1ND0B 4KJWD 2DWEA 5KZCB 5KW9H 1U8KA 2C1PA 1IT9H 2P5EE 3NFNA 1CI5A 4KHTH 5BRZE 2AJZB 3FB5A 5HYSG 3UBXI 4PJIE 5EWIH 4GRLA 5EU6E 3DLQR 3T3PE 3V8OA 1MAMH 4HXAH 3EDFA 1P4LB 3S3JA 3ARSA 2AXHA 3ULUL 3LKSB 5F3HA 2QQQA 2R0WH 3KPOA 1QOKA 3GO1H 1GXEA 3CH8A 3GK8H 4JQIH 3WO3B 3RX8A 1QSFB 1FZJA 2FD6H 2YRLA 3FCTB 1U95B 2CJUL 3MV8A 5DJDA 5DYOB 5EUOB 1R5WB 2OL3H 3MRQA 3PHSA 3RNQB 2A38A 2A0LC 4PJGE 5GGTH 1PZ5A 5GGRB 3STZA 3VG0L 3VXOB 5E00B 3SGJC 2QL1A 3EO1A 4ODXB 2DQIH 3B8YA 2XKUA 2GK2A 3V6OA 5GRVK 5J6GA 1BWWA 3H6JA 5KS9F 4LSVL 4JFFD 4XNYL 4MAUH 3LS5L 5I1HH 3PG2A 5CLTA 2HT2C 1FYTD 2YPKB 5E94A 5DEGB 1QPPA 1AQDA 4S11A 3FOMA 1A7BA 3ARDB 3GBNL 2WUBL 4C55A 5ETUB 4HJ0D 4Y2OA 1OL0A 2VDNL 4GFTB 3W2DL 4YBLC 1MCSA 1QFPA 4Z77A 5D96C 3DETD 1CGSH 5ELIA 4GJTB 1MQKL 4WW2C 1S5IH 4ZO8A 4Z7WB 3GFUA 1KLGB 2W1NA 2FIRT 3FB7B 3FO0H 3RVUC 1A6ZB 3BEVB 3H9SE 1YN6B 2LE9A 1WEJL 3T65B 1Q8MA 2J88H 1N6QH 1XCTB 4DFHA 1R3KA 2NX5D 3RZCB 3CVHL 1IGYA 1CCZA 2ESVB 3VFRA 3AU1B 2EIZB 4XP1L 2V17H 3MPCA 3O9WB 4NUJA 1CR9L 3KLHC 5DJZA 3O11B 1WBZB 2YMXH 3TPUA 2Z93B 4Q97A 2VXVH 3QHTC 5GPRA 3GIVA 1FC2D 3CMGA 1J87A 2NXZB 1PJ9A 3R06A 3MFFA 1G7JB 4M1DH 2ITCB 1A1OA 3ARGD 3T2NL 5CD5C 1W0YT 1BFVL 3J8F7 1QBBA 3T2OA 4JVPA 5FYLE 1C16A 5E8PB 1UJ3C 3HMXH 4GS7C 1ACZA 2NCMA 1JL8A 4FQ1H 1O5DT 1R3JB 2AS5M 3HRZB 1IARB 1W72A 1Z9LA 5CP3A 1CGYA 3BHBA 4LPWA 4YC2B 2O5YH 4L5FL 2YPLD 3QG6B 1T7ZA 5B38B 5IESH 2A6IB 4N0UB 4NQED 1I8IB 4IOFC 1ETZB 5L7XH 5JXED 1D5IH 1U58A 5C0AB 1QR1B 1ACYL 4CADA 3W11C 3FQXA 1AGFB 1IEHA 1G7MA 3I6KA 3V4UL 3V52L 5L6YH 1I3GH 3MOBL 2FJGA 4GAGL 1EO8L 3QNXB 4MDJA 5C0NC 2OR9H 2F8VA 5GJTH 2NXYD 5C0EA 3X3GL 3KPSB 4JY6B 4P2QB 4KI1A 3FQTB 2EDDA 1CDUA 4YGVB 4F37F 5KSAD 2GIYA 5GGTA 4OCXH 4IHOB 3T0AA 3RIAK 3U46A 2Z8RA 2HA1A 1EV2E 4GQ9L 4EQ2A 1NEZA 2QKIA 5DR5L 5C0FB 2I9TB 3RWDA 1AXSB 1HHIB 2VN4A 3T09A 1KJ2A 4IRJB 1LEKB 3LY6A 3S96A 2YD6A 5MEQA 1A9BA 3EJYD 2IPUK 4BFIB 4WDIA 1Q9KB 5IJVB 1G9MH 4XWOD 4CDGC 5K93A 3SKOB 4MB3A 1Q1JL 5CFHA 1R5IA 1A9EA 3RIFK 5HGAA 4LLYB 3P4NB 4XXDB 4HG4K 5TDPA 2R0KL 2MPAH 1SBSH 4Y4HB 5FGRA 4U1HA 1OPGL 1JNNH 4PJAA 2N7BA 5FO8A 3L6FB 1XR8A 1E4WH 1MFAH 4YX2L 5B22A 4OD2B 1D6EA 2P5ED 5IVZB 5BJTA 3JV6B 3RZWA 5BRZD 3FB6A 4Q0XH 4Y4FD 1OP3H 2XA8H 4NGHH 5EU6D 1YDPB 2F8OA 4JEGB 5D4QA 3UTSE 4R4NC 4O58H 4X7SH 4CVZA 1FV1A 2HFTA 4ZSOE 2Y6SD 2J12B 4HUVB 1J8HE 5TDOA 1VGKB 4J3OC 1J1PL 5BS0B 3SQOH 3GZKA 2X89A 3U6RB 2IALA 3QHZL 4LLUA 5HBBA 2WBJC 3ZHDA 2W60A 4LCIL 4ORZC 1YMHA 1ZHNB 5MEOA 4KZDL 3HMXA 1HOCB 1N4XH 4JO4L 4OIAA 3D39B 2CDEB 3HUJA 3QDJA 1HZHL 2QSCH 3GMOA 5C6WH 3QULA 3FTGA 4LPVA 4XGZA 4FXGA 2WINA 4MCZB 3O3BA 4FFVD 1EEUA 1GZQB 1MJJB 3A67L 1ZS8B 1P9MA 3QQ4A 1S78D 2HRPH 5D71H 3M1BA 4U1KB 5T1LB 2CIIB 5IF0A 5EFIA 1H0DA 2EXWD 3WS3B 5AUMB 3IJYA 4X6FB 4NN5C 3QIUA 1E6OL 2CRYA 2FSEB 1FGVL 3O4LA 3O6LL 5A40E 3UBXG 4Y19A 1C08B 5DD1L 2BXZA 1BOGA 5AWNL 1OGTA 3F7VA 3H9SD 2A1WL 5FEBA 3X12B 4P59L 4K9EC 5C9JB 3FRUB 3B6SA 4E41E 3QFDB 3MNVB 4XZUA 4X6CE 2AABL 4ZODA 4JFFB 1RVFH 1AI1L 4BZYA 1CL7I 4LBEA 3KPPA 1CDYA 3OR6A 1Q9LA 2WNGA 1JWMA 4YE4L 1XZ0B 1EBPA 1DQMH 1Q9OA 4EN3B 3BKCH 3SDDD 4QHLB 2QQNL 1XGRB 3RAJL 5C7XH 3T0BA 5IGXH 4TVPD 1HEZA 3IFNL 1JF5A 3DARA 2WANA 1LE9A 2ERJB 1T66D 5FDWA 2W59A 1CD8A 2F19H 4UTBH 1XF5B 5DJYB 4QRSA 4PJCA 1RU9L 1TNMA 1O7VA 3PGDA 3KWWB 2YEZB 5TF1H 5IQ9A 1I3RA 4H1LH 5FYJU 2AV1A 3BWUC 2NY3C 3HG1E 1OM3L 1MFEH 3NIGE 3VW3H 5J7CC 1FC1A 1CU4L 3CXHK 1V3LA 3PV6B 1EGJL 4YHKH 1W8OA 2MQ0A 2DQCL 3IRPX 1UWEH 1Q9WA 1S7XA 2AK4A 2WIIB 3VG9C 4WTWA 4IIQC 5T3XE 1TZIA 5I16B 3BMWA 3QXTA 4PGCA 2WSKA 4OF0A 1R0AL 1G7QB 4XNUH 4D9LH 4U0RB 1GJIA 2C26A 1CICC 5CCKL 2EO9A 1MLCA 2VDRL 3OWEA 1BVLA 1DN0B 1G0DA 4ZTOH 2A6JB 5EUKA 2J4WL 4ISVA 4BSJA 2YPLB 4JB9H 2ATPA 4JPWL 3CFCH 4NQEB 2V9QA 3BGMB 4FOMA 5H37G 3MRBA 4ZO9A 5TPWH 3AXLA 4UQ2A 2BSRB 5JLZA 1QSVA 5C70A 1OARH 1JGUH 4P46D 4YDLB 1F5WA 3PUCA 1I9RL 5I1CH 2X4OB 1OTSD 3L3DB 4OB5L 5CILH 1HXYB 5IFAL 3V4VH 2NXYB 4XC1H 5CGYC 2BCKB 4AIOA 4Y4KB 1J18A 1CYGA 2AJ3B 1YJDL 1QVOB 3ZE0E 4MNHA 5EH1A 1X4XA 2HKFL 4XPAH 4OD3L 2G5RA 1RUPL 3ETBF 1JRHL 2YWYA 1XMWA 3SDCA 5KSAB 1H5BA 2CUHA 3LKPB 2BNUB 2C3WA 4AMKH 5C09A 2W0FA 4RAHA 2ARJB 2VLJA 3MODL 2WWKO 4JZOB 4X0KB 4MJ2A 3UTSD 5HYJE 2KDGA 4S2SB 2DLHA 2YK1L 4N90E 4HS3A 4LPUA 1J8HD 4NC0B 1FFNB 4OGYL 3IU3B 1LP9F 4ONHB 4PLKD 4FS0A 1C7SA 2BVPA 3DMMD 2APFA 4C58B 3ZKND 1CIUA 4DKFH 4PGBA 4PJBF 4WI4A 5KOVC 5HHQA 3KR3L 4U49A 4UINH 1U42A 1CT8A 1K4DA 4LAQL 4XAKE 2DQDH 2P5EB 4PRIA 5FF6B 1AGBA 2VLKB 1R5VA 1AR1C 1S5HA 1YY8B 5B3JE 3RWIA 4PJIB 4Y4FB 3V0WL 2Y36H 5I8EB 3CH1A 1AKJB 3P3YA 4O9HH 5J13B 3NCMA 2OR8A 4NHUA 1K2DA 4ALAL 3MREB 3MXWL 5KN5B 1HHHB 4OKVB 5D8JH 4YXKL 4RGND 1YEKH 4ZUVA 2XZQH 4NO0A 3UYRH 1M6OA 1EAPA 1N6VA 3X13A 4XB8A 2R8SL 3G6DH 1J1OL 5EO1B 5EU3B 1T22A 4MXQA 1KTLA 4XBEH 3DUSB 2A6DB 2AJYH 4PJ9A 4G43A 4JM2C 3WIHH 1TQBC 4PJGB 2XKNB 4KK5C 4QOKA 2R4SH 1TCMA 3ZO0A 4XNMB 1KGCE 3CFEA 3L7FB 4E41D 5DD6B 3MGOB 3A6BL 5DMIL 4LHUA 5D72L 1FNEA 5K9JH 5F44A 4FG6D 3BYYA 4NUGH 1NGXA 1IZKA 1MELA 4KJPC 2WBWB 3BP4B 5HHXH 5GGVL 2HKHH 1DBJL 2HMIC 4JFQB 3SBWC 4DGYL 3EW3B 5GJSL 3QQNA 3EO9H 3UDWC 4HGWB 1KB9J 1BGXH 5H35A 4DEPB 1MHCA 3WD5H 1YYLH 3EYVB 4UU9B 5IJKC 2ADJB 2V2XA 3H9SB 1U3HA 1CD1B 1QSEE 3WLWC 2AEPL 5AEAA 3CCHB 5BV7L 3BT2H 4TSCH 2AXFB 5A16A 5BVPH 5JPNB 4KJYB 4ZOEA 3V4PH 3HS0A 4YHYC 2AV7B 4YXHH 1FAIL 3CSGA 4M61A 3HE6C 4GMTL 3HG1D 2ITDA 1F11B 3HPLA 4FZEH 1Z3GH 1BD2D 4NO5A 1ND0A 3SE4C 1KCVH 2JIXB 3MQIA 4OQ1A 2BHUA 4ORGB 3ET9F 4HMDA 3QQ9D 2AJZA 2B5IC 4KPHH 2SEBB 3RUGE 1RUMH 5T3XD 3DSFL 4UAOB 4JR9L 3ZMRA 1KENH 5EBMB 1LO0L 1P4LA 4KKBD 2FEDD 3R8BB 5I18H 3GSNH 3ULVH 2P7TA 2NY2D 4S1SH 3MZTA 1UZ6F 3QZWG 4KKCC 4ELMB 2VDPL 5A1AA 9CGTA 2MSPA 1QSFA 3FCTA 1U95A 1D9KD 1IC5L 5DYOA 1FL3B 1EVUA 5EPMB 5EUOA 1R5WA 4U31A 4JFZL 2C4FU 3JTSB 2X70B 3RNQA 1KXTB 2B1AH 2DN7A 4WGWB 5GGRA 3VXOA 5E00A 3C2AL 3WIIL 3ZT6A 3DYOA 4ODXA 4OT1H 2XIDA 4GG6E 3QUYD 1YEHH 3H42L 5IUSA 3PGFL 4KQ4H 2V2TB 3N06B 4KWUA 2YPKA 3MJ8B 5C0CE 3T0EB 1LEIA 3HR5B 1L0QA 1YMME 3IS0X 4ZFFB 4S1QH 1HSBB 1KJ3H 2WIMA 3SHSA 5ETUA 1RZKC 3D9AL 3O4OC 1MF2L 3U30B 3AVEA 2IH1B 2XYCA 1LQVA 1T1XB 3BW9B 4DUVA 4YZFF 1IAMA 3ULUD 3QWQB 2UY6A 3C6SB 3QCVL 4Z7WA 3KYMB 1KLGA 1L7TH 1S7WA 3K4DA 4OQTA 5HDBF 1A6ZA 3BEVA 1YN6A 2EH8H 1FN4B 4ODHL 5E56A 4P46B 3T65A 5HYJD 1PZUB 2O5XH 4NJ9H 1JJUA 4F7EB 3C87A 4N90D 1XCTA 2ICWJ 3P9MB 3DPBA 4JPVL 4ONOA 5JIKA 5I0ZA 3RZCA 4NRXB 3AU1A 5IWLC 2EIZA 3QI9C 4AJ0A 4UIKL 2APVA 3O9WA 3O11A 3G5YB 5CUSL 3QPXL 3U7WL 1WBZA 2DTML 3ARTA 2Z93A 4FFYH 4U1GB 1CD0A 5DMGD 4W6WB 3U83A 4BUHA 2BNQB 3B2UD 2B2XH 4M6AA 5F9WB 5DUPL 1G7JA 4XAKD 1TJHH 2ITCA 2NY6C 4LRNL 1TCRB 5DI8B 3WNOA 5E8PA 1HWHB 4O00A 2D0GA 4ODTL 3OXSB 3TO4C 4U7MA 4QXWA 1R3JA 3HRZA 1J8HB 1RZ7L 4N5ED 4Q6IC 5I9QC 3IFOB 3AB0B 2DYPD 5KVMC 5D1XD 3QG6A 5B38A 5D2LB 3DMMB 1GC1C 3K2UL 2W92A 2A6IA 4N0UA 4WTZG 3GBLA 2AEWA 1JYNA 1P1ZB 4OLZL 1ETZA 5KAQF 3U4BL 5C0AA 1HE7A 3WS6C 1PFCA 2VLLA 3P11L 2YKLH 1QRKA 4LNVA 1RSFA 5I74B 1QR1A 4FN0A 1AGFA 1KEGH 4X4XB 3ZKSD 4A6YL 2X4QB 4HC1L 2R1XB 4N8CL 3QNXA 1HQRB 1KGCD 4QRRD 1C12A 1AY1H 3CSPA 4U33A 1UADC 2FL5B 2NY0D 2GFBA 3KPSA 2L4OA 5JQHC 1EPFA 1CF8L 4JY6A 4P2QA 4PD4K 3F6LA 4XP9L 3FQTA 4HUNB 3GHBL 4BFEA 3FFDB 4YGVA 3EYSH 3V0VB 5IB3B 3RA7H 3MLVL 1EFXD 3E8UH 3RVTD 4X9FA 4K7PX 5F21B 3KPMB 4NBXB 4Z0BH 2I9TA 5C0FA 2X4SB 1AXSA 1HHIA 2FJFB 2ICEB 3NPZB 4IRJA 1LEKA 4QXUH 1QSED 3UCRA 4Q9QL 3QPQD 4BFIA 2NY5L 5A3ID 1RIHH 4E41B 4ONFH 3W82A 4L3CB 1Q9KA 5IJVA 4X6CB 2E7LA 2EH7H 3SKOA 2Q87A 5JIHA 4Y16D 4KMTL 5D7IE 2B4CH 3P4NA 4XXDA 5DJCB 1T0MB 1RUKH 1ZWIB 1O0VA 4RWYH 5GISH 1MCFA 2IG2H 4Y4HA 1JF1B 5I17B 4JGUA 3L6FA 4EKXA 1QPXA 4LEXH 4OD2A 4KROC 4Q9CA 1IQWH 5IVZA 3JV6A 3BPOB 3OF6A 3R0MA 3INUL 4LSUH 3GM8A 1UG9A 1YDPA 5HVFB 5J11C 5KAQG 2DQEH 3B5GA 1IMHC 4HCRL 4F58L 5D6CB 1FGNL 1VEOA 4HUVA 1VGKA 1FO0L 5BS0A 5F8QC 3U6RA 5LXGL 1I1CA 1YJDC 5ADPL 4LP4A 2HVJB 3HG1B 4OZGB 1ZHNA 2CKBL 3VWJC 2R0LH 2I60L 1HOCA 2DMBA 3RNKB 3FZUD 3D39A 2CDEA 5D7SH 5C6PB 1N0XL 1U2HA 2Y9RT 4P9HC 4JRYE 4MCZA 3AS1A 1GZQA 1KV3A 1MJJA 1ZS8A 5C0CD 1WFOA 2XPGB 5DA0B 1YMMD 1CL7L 4U1KA 5T1LA 3PGCB 2CIIA 3WS3A 1EAJA 5AUMA 2E6QA 2M26A 3WL9B 5I73C 4X6FA 3NAAH 4MA1B 4TN9A 3RHWK 3HE7C 3DRTB 3LD8C 4MZ3A 2R23B 2HAZA 1SBBA 3U0TB 1JPFB 3RGHA 4FQXC 5FGBC 1KIRB 5HI4D 3BQUC 4P3WA 2FJHB 4KDWA 3I6LE 5C9JA 3FRUA 4RZCA 1E6JL 1JFQL 3QFDA 3QUYB 3MNVA 4L1HA 1U8MB 5GGQL 4DUWA 4JFFA 4KHXL 2PO6D 5CMAB 1I1RA 3GSRB 1KYOJ 3DI2B 1XZ0A 4EOWL 5C3LD 4EN3A 3QO1B 3O45B 1XGRA 4LLAA 4LVNB 3WUWG 3CFBB 3S5LG 4JJ5B 3VXME 5JHLH 4M93B 1NCBL 3PL6D 2W0LA 1CK0H 3S3SA 5LGHL 4MD5B 1CLCA 4O4YL 2RBLA 1JK8B 1XF5A 5DJYA 4I4WB 1I1YB 3RKDC 2XRAH 4OZIE 4N0CC 5DHYB 3SDXB 3LEYL 5EZOL 3KWWA 2YEZA 4JDTH 2NR6D 3FT4B 4XPFH 1MY5A 3O2WH 3BPNC 1MRCL 4KRPD 4EDWL 3KPRB 4PPTA 3RPIB 3T0DA 3QIBC 5C0JB 1BECA 5TQ0L 2VKWA 4BUGA 4F57L 3EYOB 4KMQA