3TBVA

Crystal structure of the murine class i major histocompatibility complex h-2db in complex with the lcmv-derived gp33 altered peptide ligand (a2g,v3p,y4a)
Total Genus 67
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
67
sequence length
276
structure length
276
Chain Sequence
b'GPHSMRYFETAVSRPGLEEPRYISVGYVDNKEFVRFDSDAENPRYEPRAPWMEQEGPEYWERETQKAKGQEQWFRVSLRNLLGYYNQSAGGSHTLQQMSGCDLGSDWRLLRGYLQFAYEGRDYIALNEDLKTWTAADMAAQITRRKWEQSGAAEHYKAYLEGECVEWLHRYLKNGNATLLRTDSPKAHVTHHPRSKGEVTLRCWALGFYPADITLTWQLNGEELTQDMELVETRPAGDGTFQKWASVVVPLGKEQNYTCRVYHEGLPEPLTLRWEP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords H-2 class I histocompatibility antigen, D-B alpha chain
publication title Conversion of a T cell viral antagonist into an agonist through higher stabilization and conserved molecular mimicry: Implications for TCR recognition
rcsb
source organism Mus musculus
molecule tags Immune system/agonist
total genus 67
structure length 276
sequence length 276
chains with identical sequence C, E, G
ec nomenclature
pdb deposition date 2011-08-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00129 MHC_I Class I Histocompatibility antigen, domains alpha 1 and 2
A PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3tbvA02
3.30.500.10 Alpha Beta 2-Layer Sandwich Murine Class I Major Histocompatibility Complex, H2-DB; Chain A, domain 1 MHC class I-like antigen recognition-like 3tbvA01
1OAXH 3QUKB 1HCVA 4CW1B 5F3HA 2QR0B 1DEEB 1GZQA 1LO4L 1MJ8H 3OXRA 3QIBA 1JFMA 3C5ZD 3MNZB 2GT9B 3HRZB 1IARB 1I8KB 3VRIA 4ETYA 1U92A 4NHCH 1U2HA 4UIKH 4LIQH 5INCB 3V7AE 4Z7NE 5GS0D 3LY6A 1JPFB 1NMAL 1U8JB 4CVUA 3EYQD 4IRJD 2XZAL 4D9QD 3KPLA 5HVGB 1U6AH 3KXFB 4X4MA 2RFXA 3P4MA 4MQXD 4JFQA 1QLEL 1FV1B 4MS8C 1I9EA 4UDTB 3SOBL 1MJUH 4HZLB 4PJ9B 4NT6A 3RP1A 1A7QH 1ZHBB 4GAFB 4H25A 1KELH 4QT5A 1A3RL 5HYQA 1O5DT 1TTFA 4KUZH 4IRJA 1CFNB 4KMTL 4X80H 3RPIA 4L8SB 4GMSL 4DZBB 3IDMB 2WUCH 3P9LA 1K8DA 4NPYA 3MC0A 3OZ9H 4TSAL 2RIKA 3DARA 3ELAT 1UWEL 3T2QA 3WS3B 2QBWA 4EN3C 3BIKB 3QFJD 3RWGB 4WU5A 4FQIL 1MFBL 4XX1E 3VXUA 3F7VB 4FFWD 1WCBA 5I1HH 1BFSA 5I73B 3ZKXC 2XWTB 3QPXL 2ESVD 3P4NB 2APFA 4HF5H 5GIRA 3BGFC 1BJMA 3MROA 3O3AB 1IT9H 1EAPA 5C0CA 4KUCD 3UBXB 4P9HL 1JV5A 3ECBA 12E8H 3MFFA 2MTPA 3BD5A 3HAEH 5HI3C 4PGEB 1HEZA 3BDYL 5E5MA 1FIGH 1IGYA 3VMNA 3FQRB 4LASL 2ESVA 4KI5C 2CDFB 3B4NA 1QRKA 2PF6A 1PG7X 4MS8D 3HNVL 1FLRL 4Z77A 5GGUB 4WGWB 1FIEA 4Y19B 2AJUH 1M6OA 1A14L 4XP4H 3H9SD 1LO5B 1UM6L 4MQSB 1LK3L 4X4XB 1A4JB 4ZXBC 1PKQA 1YEKL 2K7QA 1N2RB 1JGEA 5I0ZA 3SDYH 3VE0A 2GUOA 4G80A 1EV2E 3VXRE 4OLYH 3CH8A 3G6JF 1C1EH 1VGKA 3MUY1 3N1FC 2A73A 43C9A 2YD4A 3TM6A 4DUXA 4LPYA 4MS8A 2GY5A 2HFEB 1OTSC 3O9WB 4XC1H 4EN3D 5I1CL 4WFEE 2GQHA 5IVXE 3LRHA 5TDPA 1RFDH 1OAKH 4NQXA 1T6VN 4KZEH 1QRNB 4HWEH 3MNWB 1WAAE 3S3PA 1U91B 1ND0A 1KCKA 4XXDB 1FZOA 4YBHA 3GMNA 4I1NB 4F80A 1I7RA 2P8MB 2BVOB 3FZUC 4JRXD 2GITB 4WV1C 1DVFC 4HZAA 3GSNB 4EN3A 1Q9LA 1P7QD 4F33A 2BNQD 5CKGA 2HKHL 3CX5K 4R4FL 2RHEA 3DUUB 1ORQB 3DVFA 2AEQH 4OLUH 2NX5A 3DVGA 3KYNB 3DOSA 5BV7C 3BHBB 3V5KA 4JO2H 3HZYB 4OFIA 2R4SL 5CINH 3D0LB 3B2VL 3QT2A 3DI3B 3IKKA 2D3VA 3O2DH 3PWVA 3PHQB 1QG3A 3WD5H 4PV8A 4HIIA 1J8HD 1FC1A 4JRXA 4V2CB 5D5ME 3C09C 5L2KB 5MEOA 3O6ML 1P7QA 2HJLA 2H32A 2BNQA 4GKZA 2OI9C 4ZXBD 2V9RA 3T3PF 2XZQH 3MRJB 4NUJA 4D9RE 5FGRA 4I0CC 3U30C 1XGTA 3GGWB 4X6CA 3BH9B 4N1HB 4PJXB 3Q6FB 5ECJE 4ZYKA 1DN2A 1KIRA 1OD7A 2VLRB 5B39G 3N85H 1F45A 1CWVA 1J8HA 4P5TB 1FPTH 2DQGL 3L1OL 1OCWH 5IF0B 1KC5L 4NWUL 2GK0A 4G8GB 3H9HB 1NGXA 1FLTX 5DJAB 4ZXBA 4P2QE 3O4LE 1QUNA 4JFOA 5E2WH 3WNOA 2V2WB 4HSQA 5GGRY 3SDXA 2AS5M 5FK9A 4Y4HC 2F5BH 3FZUD 1Q72H 3V0WH 1T1ZB 4YHNB 5EOCH 1DVFD 3BESR 4KWUA 4Q9CA 4LSVH 3RQ3A 4L3EB 4A6YL 3RY5A 4KK5C 4HWUA 4YHMH 3KJ6L 4KTDL 1JHLH 4TPRL 4YC2B 2C7UA 5DJ2B 3TA3C 1IC4L 1T21B 4X6FB 2EC8A 5DI8B 1ACYH 3VFGL 1SJHA 1V7ML 5ICXB 2VIRB 3RAJH 4JG1H 2HJKA 4B5EA 1YPZE 1JPTH 1BFVL 1T2JA 1DVFA 3RX5A 2G60L 4C83A 2PO6D 3KPTA 3IAGC 3O3EA 4RZCB 3NIFF 2WIMA 3RNQB 4N8VA 3WIHL 3IVKB 1CFQA 1YN6A 3PXJA 3MOAH 1CICC 1MQKL 3HNSL 3SGKC 1A9EA 1X6LA 2GCYA 5JW4N 5C08D 5GJTL 4G7VL 4LHUB 2V5MA 4XXCC 4XT1C 4AY0A 2FHFA 2PO6A 4QRSA 2UY7A 4MHHG 4MJ6A 1NEZB 3IF1B 1AIFB 4XVSL 1GAFL 2WBJD 3EFFB 4OFYD 4V1DB 2QSQA 5ESVA 4UQ2A 2R2EB 3MRMA 3CLEH 4MNQE 4Y4HD 4ZPTB 3K2UL 5I1JL 5EO0A 4I2XA 3GMLB 5GZOD 4YHPA 1I8IB 3OKLB 2KH2B 3VFOB 3PWJB 4KK9C 4R90H 4UTBL 4MNGA 1KCSL 1SYSA 3CLFL 3TA3D 4NCDA 2Q8AL 5C0DB 2HLAB 2WBJA 3DURA 3G6AB 1HOCA 1NDMB 4XP9H 1NFDB 1D5IL 3UC0L 1YEIH 4Y4HA 3E8UL 2UYLB 4KKBD 1FVDB 1JHKL 3U7WH 1IGFH 5CLTA 3RVUC 2BSSB 4LLUB 5HTSA 3TA3A 1BPVA 2BOCA 4HS6B 1CICD 4KH2A 4Z8FH 5J11C 5D1ZB 2VR5A 2F5AL 3NGBC 4P59H 2W60B 3HFMH 1IEBA 1S7RA 1FFQA 3OAYH 4OLZH 1UVQB 3SOBH 1K85A 2QQNL 4CDGC 4KXZH 4O2EB 4M5YL 4OM0H 1GPOL 1MFEL 1EXUA 1TPXB 3BGMB 3OF6D 1BWMA 5D8JL 5CEZE 2DLTA 1BIHA 5FM5O 4PBWD 3HI6H 3HN3A 1FG2B 1CICA 2J8UF 2CRZA 1AXSB 5MEQA 3QA3A 1I4FB 3SGKA 3T1FB 32C2B 1H3GA 3ESUF 1UWEH 4XMKH 2G5BA 3RDTC 4XXCA 1MFBH 4PJFA 1T1XA 4PJIA 2ID5A 5DUMH 5FGBC 4PRNB 3OF6A 4G7YH 2YZ8A 3G5ZB 4NSKA 4MHHI 3B3IB 3TH3T 1T04B 1BFOA 2L0DA 4JZJB 3CFJA 4P9HH 4U6HB 4OF8A 3SKNA 1HNGA 2DQFB 5BO1L 4K3EL 3C8KA 4QTHB 2G2RB 4YHLH 3BKJL 4DN4H 1KENL 2EDRA 5KTEH 4OFPA 4ONHB 3DV4A 1HWGB 3WFCL 1QTYT 1IAII 2VKXA 2Y06L 2XY1A 4MX7A 4M62H 1F58L 2XQYG 1ZKAA 4JPVL 1FLRH 4JHAH 3ULVE 5ANMB 1Q9WB 2QV2A 1RAMA 1OAYH 3V79C 4L9DA 2ED8A 2E8ZA 4YZFE 1LK3H 3CSPA 4PLNC 4IJ3C 2P24A 3EYFB 3RJDA 4PRPB 5DHXB 1SEBB 2EDHA 4PRIE 1U58A 3N9GL 3KYKL 3RDTD 3NFSL 3WUWG 2AV7B 5DUPL 4ZFOL 1RK1A 3JV6B 1JZ8A 4NO5A 3RIFK 1L7IL 1VGEL 1UACL 1G9NH 4Q9QL 3O41B 2R23A 4H26B 5C0EA 4M7LL 2O5ZH 1AGCB 1I3RA 2CSPA 1MUJB 3BP5B 3KPMA 4JPWH 4JG0L 5C0AE 3T77B 4ZOBA 2WBWB 4I3GA 3KPOB 4KK8D 3RDTA 2Z93B 3EYUH 5FGBA 4F3FB 5IEKB 5F1NB 3L3DB 5BRZE 5D96B 1HKLH 2R4SH 4PD4K 1BD2E 3B2VH 4TNWK 3FFDA 4EUPG 2HRLA 4U2YA 5DUBB 2L7UA 5E1AB 8CGTA 1CLOL 5GPRA 3ZE1E 3AXLB 5E6IB 5HDOA 3O6MH 1HQRA 1IC5L 4GBXC 2ZCLL 5DS8B 1UEMA 5D1XB 4G6KL 2NPLX 4HG4J 5BXFA 1OWWA 2CO6B 1J9CT 3C8DA 2YUVA 4NGHH 1YYLL 1Y0LB 3D39E 4NZUL 3HI1B 3EO9L 5EU4B 5DJXB 4R97C 5C0JB 3GNMH 2DQGH 2EO9A 5F7EL 1C16B 4RAUA 1KC5H 1CE1L 4OUUA 5BMFL 2JJTC 5DDHA 2V7NB 1T03L 4P2RB 1TQCC 1IJ9A 1Q94A 3OB8A 3BUTA 5KSAC 1A6ZB 3HI5H 1M7DB 5IVNA 3VG9C 3FTGA 5JO5A 1U93B 3PWPD 4KMLB 4KRLB 5CP3A 2VSDA 3KJ6H 1DBAH 3KR3L 4KTDH 4TPRH 4WEUD 1VPOL 3TNNB 4PJHF 3PV6B 1IC4H 4M00A 1X5JA 4JPIA 1S78C 4Q74A 3S35X 4RFNC 4YHIB 1VFUA 1T0NB 4J23A 3SY0B 7CGTA 5ISZB 3LQZA 4F7MB 1OB1B 2P48B 3FHQA 4IRSC 3L3HA 4PLJC 3SO5A 4Z7WB 1P4LA 4PG2C 2IANE 1UEYA 3PWPA 1FN4B 1VDGA 4AM0A 4IMLB 1KEGL 4MDIA 3MRPA 3UP1A 1DL7L 2VJXA 1R3KB 2AK4D 4WTZG 1MQKH 5SWZD 4YGVB 1RMFL 4JPKL 3WJJC 4G7VH 5EUKA 3I6KB 4PJCA 2AJXH 3QB7C 1U95A 3QO0A 4O4YL 3B6SB 4WUUD 1U8LB 3SQBA 3U4EB 4EQ3A 3ARTA 5CUSL 3VMPA 1TJIL 4Z0BH 3V4PL 5BOZG 1GJIA 2VUOA 3BZEA 2AK4A 1WEJH 1UKQA 5DR5L 5KBNC 1RHHA 5SWZA 5C0FB 2BFVL 5IB2B 3QDGD 5E00B 4NBZB 1I9RH 1WK0A 2VDML 4KROB 3T3ME 1S9KC 2ICCA 2P5EE 2A83B 4LRIC 1FNGA 4WUUA 2JJTA 2NY0B 1S78D 1QR1B 3G5YA 3T2NH 1EBPA 3ULUL 1J11A 1Q0XH 4NKDA 5DRXB 3E8UH 5K9OB 2BJMH 1R5IB 1YY8B 4BM7A 4PP1C 4KU1A 4GG6F 1JHKH 4NNXA 2GK2A 4OGAC 4PLJD 4Y2DC 3SDDB 2LAAA 4HLZH 4HV8A 4XAKD 1NAKL 1KPVB 2IFFL 5HHOE 2EDYA 4KZDL 4HUKB 1UH2A 2D7MA 3TT1L 2D7OA 1AKJD 3MGTA 4XWGH 2ZUQB 1CVRA 1XGRA 4JHWH 1K4DB 2NY4B 1GPOH 3EFDL 1R3JB 1ZVHA 4NUGL 1IM3B 2XTJB 1X5AA 4IRZH 1CDHA 1IAMA 3F7RA 1I8LC 4GAGL 3WO4C 2H1PH 2DI8A 4LLVB 4QYOA 5AD0B 5KSUA 4TRPL 1DJSA 2ATKA 3BDBA 3WJJA 1AKJA 4BSJA 3ET9F 4KGJA 1NL0L 4QOKD 2IMNA 4YFLF 3A6OA 5FKAA 4OGYL 1PYWB 2CPCA 1NBZA 2BHYA 1UQSB 2VN4A 2I9TB 2CMRH 2C26A 5D70L 3DX9B 1SEQL 4FZ8H 4OGAD 4Y2DD 4Z7OE 5BO1H 5D7IA 4LARL 1ZLVH 2BXYA 2EDOA 2WINB 2R0ZH 3BKJH 4GO6B 4QOKA 2JJWA 3KAAA 1MHCA 1ZA3A 5K9JL 4LRIA 3NVQA 5F7WC 5INDA 4POZC 5FOJA 4WFED 1QSFB 1WTLA 3QO1B 5SX4I 5EORH 5D7JB 1F58H 1NFIA 3RKPA 4PG9B 1G7IB 3TCLA 2MCPH 4BYHA 1S9VB 1E4XI 1LK2A 4Y2DA 5DQDL 3VXRA 3H0TA 1ZT4B 1QLRA 1AGFA 1FZJA 5I8CB 4U6XB 1JJUA 1R5WA 2PKDA 4XPTL 3ZKMC 1KCGC 2LABA 3R06B 4GW4A 1U42A 4OT1H 5IVXA 2OR7A 1CLCA 1NBYB 5D93B 3KYKH 4OZGE 1DE4A 2V7HB 3OKOB 3QEUB 3K1KC 4MWFA 4Z7UE 1ZLSL 3MZTA 4EVNA 1L7IH 5DVNA 2DQCL 1VGEH 2FX9H 1UACH 3U36B 4K7PL 4DQOL 4X4YB 1A2YB 1I8LA 4M7LH 5CEZH 1E0OB 4RWHA 1MCKA 3CZFB 5EC2B 1LO2L 3S5LB 3MNVB 3E3QC 1AO7B 5JUEH 3RBSA 2C3HA 1A6VH 3CK0H 4Y4KB 4X8XA 2LVEA 3WL9B 4POZD 3PE9A 1YMMB 3OX8A 1Q1JH 1I8MB 4Z95L 3W0WD 2JTDA 3FO9A 2R2CA 3NACH 4Y16C 5TQ2L 3A67H 1CLOH 3MR9A 2PTVA 4G8IB 4OD1L 3QWRA 1BQHB 2XY2A 3LKPB 1A9BA 3OAYK 3PDOB 3MJ7A 4PTTB 3PWNA 4M4RA 4NP4L 5EWIL 5BZWA 5KSBE 4JQXC 3BP4B 4OF7A 2QSCL 4G6KH 3HG1D 5DWUL 1BM3L 1TTUA 2XNAA 4MZ2A 5JTWA 1XR9B 3W0WA 4S1QL 2DM7A 4NZUH 1JNNL 3IFLH 3MV8B 3PUCA 4P2QA 5F8QC 5CBEA 5DFVD 3WHE1 3QZWB 2NY6C 4M6OL 4F7TB 4U1MA 4M61A 4YXKL 4PJBF 3MLYL 2ICEA 1WWWX 4ISVA 4U0QB 5DEZA 1A7RH 3VGEA 5AZEL 5D71H 2JCCB 4NQTA 2W0LA 3F7YB 1T03H 2R0WH 4XNXH 4POUB 2E6QA 1E28A 2Y1VA 4P2OD 1FO0H 1ZTXL 4OD3L 2LQRA 1EEYB 1P5VA 1KJ2B 3CDGA 2FIKA 4JN2A 4XBGA 4IIQB 1YPZA 1VPOH 1AGEA 1F42A 5F72S 3HPJA 4ZMAT 2YWYA 2B8OT 4XI5D 5TQ0H 3U4AA 5TH2A 2B0SL 1W8NA 3JWDL 3G6JE 4NQVB 5AWNL 4C57C 4Y16D 1P1ZA 1ZXQA 2P45B 1WIOA 3E3QA 3L3JB 1RZIB 4ZUWA 2A2QT 3WFHB 1EO5A 4D0BA 4OB5L 4P2OA 1FYHB 4Z9KB 5KW9L 1CN4A 4PGCB 3BYYA 5D6CB 5F7LB 1KEGH 1I1RA 2B1HL 5J1AA 3HA0A 5F7DA 1DL7H 1F11B 5FM8A 5FCSH 1HILB 3FT3A 1KGCE 1ED3B 1JWMA 3FOLB 4HMDA 4Y16A 3B9DA 4G5ZL 4LCWD 3CD4A 3DYOA 3TIDA 3CIQA 4D3CL 2FEEI 1FRGH 1T4KB 3ZLQC 1CFTB 2NY6D 2Q76A 3P30L 1CIDA 5DT1L 3O3UN 1BZ9A 1NC4B 4NC0B 4JQXA 3C9NB 1KJVB 3E6HB 2MMXA 3A6CL 4DKEL 4KKAD 1SHMA 1UZ8B 2WAHA 4ZS6C 1FDLL 3ALPA 1QFOA 3QCTL 1LVEA 2XRAL 4PJEF 3VRIB 1N5AB 4OZ4B 2ADJA 3EJZC 4LCWA 3TYGH 2APVA 1U0QA 4R7DA 4DW2L 5FCUL 3ARDB 1PY4A 4S10A 3M45A 1MCWW 1MRCL 1YN7A 2FSEA 3ULVC 1LP9A 4YDIH 5ADPH 1NBVL 1LHZA 3VXSE 3ULUH 3C5ZB 2ZUUA 3AS0A 3GK8L 5CEZD 3UEZA 3RVWC 2R0KL 4X5XB 1DFBH 1MSPA 5D1QC 5JR1H 4YDKL 2UY6A 1NAKH 4LAQH 2F15A 4JM2C 4NPYB 5FYKE 4KZDH 4CMHB 4MXVE 5D7LE 5B38B 5F88B 3QG7L 2CIKA 2NY1D 3TT1H 3NCFB 1CL7L 1INDL 1F2XK 1ZHNA 3QHZH 1JYWA 4RA0C 2WWMC 1QPXA 3D5OF 4WI2A 5FB8B 4PP2A 1CG9B 2BY0A 3D87B 3GSUB 3WFBH 2GFBA 4GAGH 1FL6B 3ES6A 4N9GB 4EOWH 3X3GH 4HCRL 4HXBL 4X98A 4TRPH 5BJTB 1N0XH 3QNYA 1OGTA 4Q0XL 1ZS8A 2NY2C 3S98A 1JV5B 3QFJB 3MFFB 4WI6A 4JFXA 5T5FL 3QEHB 3QXDB 2AJSL 1UCBL 2C3WA 1CXIA 3GMPA 3NCYS 3FRUA 2D03L 1Z2KA 7FABH 1FQ9C 5E8EA 2ESVB 1FYTE 4WW2C 4JVUA 4Q6YA 3Q1SH 4KKLD 4XNQA 3MJGX 4Z77B 2YXMA 3FT4A 5KVFH 5HHMD 4HT1L 2ZUXA 3X14B 1KG0A 1VFAA 1EHLL 4MJIE 1ZEAH 5CD3A 3EUUA 2NR6C 3BN9D 2Z8RA 3EZJB 4JM2D 4ZDHB 4U4BA 3MACH 2P49B 3MLWL 3ZHDA 5D6DC 2YD6A 3VDBA 4GRWH 2Z92A 1JZ7A 4K7FB 5DRWB 4OIIL 3D69A 1FFNB 3BZFB 3CPLB 4PJ7A 3H9SB 1CK0H 5DQDH 5F6HI 2WWMD 3TBWA 5IP4A 3G6DL 5HHMA 1OOAA 5D1QA 1BBDL 2W59A 1H8OA 1RZ7L 4PRIA 2EE3A 5FM4A 5A2IH 4XPTH 4JM2A 1FO0A 1P7KB 1R5VA 2DQDH 1FHGA 2ITDA 1I7RB 3VGAC 4BKLA 2NXYC 5CEXA 2NY2D 3DV6A 2NY5C 3ABZA 3BPCA 3SJVD 1BD2D 4ONFH 1UT9A 3BPNC 3B2UC 4G9FD 4OIBA 4XBEH 2DQCH 5E5UB 5IB1B 5C0AA 3UTTD 3V5KB 2EDDA 5E2VL 4K7PH 4DQOH 1HDMA 3LKSA 1S9WA 4PV8B 5L2JB 2R9HD 5BRZA 2YK1L 1V05A 4OGXL 1P7QB 2DRUA 3KLHC 2HJLB 3SJVA 1BD2A 2BNQB 4H0HB 1AQKL 4TUJA 1W0YT 4G9FA 4X6DF 1IAKB 2NR6D 3D39D 4X7CC 2PTUA 5CBAA 3UTTA 5FDWA 1XGTB 3RWHA 2KZ1B 3QUZD 1WBZA 3MJ9L 5JIKA 1JRHL 5GSRB 4Z95H 3BJ91 4GRMB 4NOBA 1J86A 1YEJL 4WFHD 5H2BB 5TQ2H 1RZGB 4P49A 3ULUD 5DGQA 1TZHA 4NP4H 5EWIH 5DZLA 3ZKNC 1I1FB 5C6TL 3D39A 2AXFA 4YXLH 2QSCH 2LU3A 5D6DA 1N8ZA 4MGXA 2YOCA 2NXYD 5I71B 3LPFA 4U1SA 1JZ4A 2DS4A 3IETA 5LGHL 4BK5A 3FAWA 5JIIA 3BKML 1G9MH 1UWXH 2ITCA 3P2TA 1X5GA 2OL3L 5E08H 3WXVH 1YNLL 3MLYH 1RZKL 2BVPA 1SJHB 2IAND 4WIQA 5JW4R 2Y36L 5DLML 4K8RH 1RUAH 2JJVA 2Q7NA 3Q48A 3KLHD 3DJ9A 5I74C 2J6EL 2OP4L 1I7TB 1ZTXH 4I5BA 4OD3H 4EKXA 3X12A 1ZLVK 5CJ8A 3GZKA 1XF4A 2QEJA 3I75B 1A9EB 2GCYB 2IANA 1WZ1L 3MRHA 3SE9L 3UTPD 4OLWH 5AWNH 2CKBH 5F71A 2IQAA 2A0LC 3CJJA 4HEPG 2PO6B 1MNUH 2V2TB 4X5WA 2AQ3A 3ZKND 4RBPK 5HHQB 1PQZB 2B1HH 4YHZL 2X4SB 1S7SA 3HAEB 3O6FC 3RWJA 1MFAL 4V3EB 4JCLA 2O5XL 4LKCB 5J1SC 4MXQC 3MLVH 5C08B 2A1WL 5C0IB 3G5VA 4G5ZH 4U49A 3P30H 5DT1H 4M3JA 1CBVH 2YEZB 5D2NE 3HKFA 3I3EA 4M48H 3QDJE 1A4KB 4AQ1B 2WBJB 4YJZL 4U1JA 1IGJB 3B9KD 3KS0J 5IMOB 2E6JA 4Y1AE 3Q0HA 3ESVF 3BPOB 3OXSA 3QCTH 2P5EA 3MRCB 5F3BB 2VTFA 3D18A 4PLKC 3WN5B 5MENE 3CUPA 3EYOA 1S9XA 2VAJA 5BZDB 4DW2H 5CZVL 3BZ4B 5DC4B 4KVCH 3OKDA 4LOUC 3DRTA 1FGVL 3M8OL 4FMFA 1NBVH 5HGHB 2FH6A 1G9MC 2EH8L 4Z7WF 3KPQA 1IEBB 4UDUB 2EIBA 1MEXH 4DWHA 1A1MA 1ZMYA 2R0KH 2VITB 2VDLL 3VD7A 1EXUB 3NA9L 3N06B 4K8RC 4I48A 4NO0D 3UYRL 4RMVA 4MAYC 4XVUD 1BJ1H 3I50L 3BXNA 5B3JF 1ZGLA 2APBA 3LHPH 1S5HB 5J6HA 5IQ7L 3MA9L 1CICB 3O6FD 2GSIB 5MEQB 3QA3B 4J1UA 1O0VA 1RUQH 4MXQD 2MQCA 3HMXH 1RUML 5I8OL 1AD0A 4CVZA 5DQ9B 1CGYA 2RQ8A 3ORJA 4OF6A 1NC2A 1Z9OA 4ZFZB 3GKWH 1GVIA 1TFHA 3BKYH 4XH2A 1I3VA 1MI5D 4PJHE 4R4NC 3U4BH 2W91A 2VXSL 3O6FA 4XCYB 3OJDB 4HCRH 4OSUH 4MXQA 4HWBL 4PLKD 1FGNH 4OZIB 3EIFA 4YBQC 3WSQH 4NYLA 3FQXA 3GM8A 1NLBH 2AJSH 4BH8B 2D03H 3BO8B 1S7XB 2Y23A 5LBSL 4F7PA 3CC5A 4R7NB 4KVNL 3SDCC 4LP5A 3VFPB 1LE5A 5A2KH 4QKXB 1CDBA 3LN4B 2X4TA 4S0UC 1H3VA 4JFFB 1R24A 4H20L 2E5EA 4K8RD 2D2OA 3VA2C 2NXZB 1P6FA 2ZJSH 4MAYD 2VKWA 4OI9A 4OTXL 3UX9B 4XPHH 3T1WA 1U8OA 2B1AL 4W81A 1GGCL 1A7PL 1QKZL 3OWEA 4DGYL 4RMRA 1U58B 1A0QL 3DVNA 2CXKA 4P4RA 4U33A 5C9JA 1GGBL 4JZOB 2F8VA 2XA8L 1I3GL 4NO5B 4JQVA 2DAVA 1BBDH 1OSPL 2OTWB 5ID1B 1I85A 1RZ7H 4WHTA 1RIHL 2WY3A 3KNBA 2ORBL 4MAYA 1FNSH 4OZGA 3ZDZF 3BX7C 3C08H 3TJEL 4PRHD 5I8KL 3KPMB 2BNRD 1UWGL 4Z7UA 4DEPC 1JMXA 4FFYH 5DFWH 2A9ML 4HPYL 4LQFL 1MWAL 3RDTB 3FCTB 5IBUG 1GGUA 1MCOH 4GUPA 4GG6E 4YH6A 3ILQD 5ADOH 3QQNA 1KT2B 2CD0A 1JF1B 5KS9B 3GI8L 1DQLL 2VMFA 4TOYH 4DGIL 4PRHA 4G9DB 2ZUTA 3MBEC 2DJSA 3SDCD 2EYRB 5B21A 4EDWL 5EU3B 3U9UB 5I2IB 4OCWL 1P2CA 4O00A 3CFKB 5L9DH 5DO2C 4QRPE 3C2AH 3QH3A 3G9AB 2GAZA 4XPFH 3DO7A 3KPRE 1CD0A 4UAOC 2G5RA 4TULL 3PWUA 4K94H 4M1CC 4U0RC 3NCJH 2FEDC 2AW2A 3MV7E 5IFHL 3U9PH 5JLZB 1QR4A 1HH9A 3I6LD 1KLUB 4O5LL 1YEJH 5TGBB 4LLYA 3SDCA 2FBJL 4OLEA 5KSBA 3AAZA 2CUMA 4R4BB 2HH0H 4NKIH 3GMMB 5TDOA 2IALA 5C6TH 1OWRM 3OQ3B 5KOVC 5HGDA 1T20B 2FD6L 5FUOL 2Q1EA 3H3KA 1Q94B 2DDQL 3MLUL 5ACZB 4U1NA 4Y0GA 3NPSC 4HUWB 4MXWL 3BKMH 5C07D 1A1OA 3T65B 5IHZB 2OL3H 3KXFE 2EIEA 4CMMB 1YNLH 2N7AA 1RZKH 2BZDA 3AROA 1X3DA 1RPQA 1BVKB 3MBED 5TF1H 3BP6A 2Y36H 1VESA 1YYML 1WLHA 1PD6A 4G3YL 4X99B 5DO2D 2J6EH 2OP4H 4P5MA 3V5HB 3HMXA 1U8PA 1FNAA 3G6JA 5C07A 3QG6A 3LVEA 4M1CD 1AD9A 3MYJA 2FEDD 3E0GA 3I85A 2Y07H 5I30L 3MBEA 3DGCR 2X4RA 2YUZA 4S0SD 2P8PB 3P0VH 3B83A 4MJ5A 1E27A 4ZODA 1X5LA 1BQLL 3RWFB 4OCXH 4KTYA 2X2YA 3BZEB 1B0GA 3VD9A 5SWZB 4LHJB 4K94C 4RISH 2PYFB 3I02B 1M1SA 4PRDB 4I9WE 4OCSL 3G04A 2VDNH 3VXSD 4AK1A 3FQWA 4LCUA 1FNGB 1V3JA 4WU7A 2J8OA 2XKNA 4WUUB 4WY7H 5FA3B 2EEDA 1WQVT 2FATH 4UT9H 4FNLL 1IZJA 5ICYA 5MI0B 2PN5A 4MVBC 2AABL 5IGXH 4NKOA 4GW1B 3F62A 1PG7L 3C6LC 2DIBA 3QDGB 3TP4A 1ZV5A 3O8XD 1HXMB 3VXSA 5GSVB 4WJ5A 4OF5A 1AQDB 2E7LE 4W70A 5JPNA 1DCLA 2VLJB 1J8KA 4CUCA 3F12B 2HFFA 5JQHC 1EAJA 4ZFGH 5F89B 5DSCA 1IRAY 3PWLB 5B3NA 2J4WH 4HIJA 3B8YA 2VDLH 1E6OL 1Z3GL 2XPGB 4FXLA 1QRNE 2DMKA 1G6VK 3VW3H 3FN3A 5ETUA 4D9LL 4LSTL 3DRQB 3G08B 3MA9H 4UUJB 4HHAB 4QYOB 2J8HA 5IB3B 4U3CA 5KSUB 1H0DB 5I8OH 2CLZA 4MCYB 3LEVH 1FFOA 3HZMA 4H1LG 2C3GA 3ARQA 5FKAB 1ZA6A 1XZ0B 3MMEB 5D4QA 2P43B 1GOGA 4BSWA 4J4PD 3VRJB 5HHNB 1UWXK 4MJID 3WHXA 1EFQA 5IMLB 5FECA 2K1MA 4QRTA 5EOQL 3ROLA 4F7CA 5L2KE 1BZ7B 4HWBH 5E4IA 3D2UD 1J7VR 4P57A 5E7FA 4N8VG 1N26A 3SPVA 3KGRA 1P9MC 1DLFL 1FYTA 1WIUA 3QEQD 2XIDA 2Q3ZA 4PJXE 2FYYB 2Z9TA 4NQSB 4RGNB 5B4MC 3QWOA 3SGJC 1S5IL 2YR3A 5I75B 1A6UH 4KVNH 2XI9A 2CGRL 1NFIB 1IFHL 4XZUA 4MVBA 4MJIA 5DHVH 4QHKI 4M6AA 1HHGA 4ZO7A 4BFBD 5CGYD 3NFPA 2OK0L 3C6LA 4R3SA 4YK4C 3AB0B 4G8GE 1OVZA 4H20H 3U48A 3CXDH 2F19H 3HZKB 3MJ6A 3DGGA 1FZJB 1XFPA 3QEQA 4HXAH 4NFDA 4XPGL 1NCCH 4A6YB 2ZNWA 2R0LL 2BXZA 5I17A 1I9IH 4AJ0A 3PV7A 1A7PH 2BVQA 2FDBP 3TPKA 2BRQA 2AI0H 2C1PA 3S4SA 4X7DC 4L3EE 5GZND 5EFIB 5IV2A 5CILL 1KNOB 1NMBL 2YPVL 2OBGA 1I3GH 3IXTA 1D5XB 2HVKA 5ALCH 1HI6B 1F6AB 5T3ZH 1RIHH 2ORBH 5EZOL 5CKAA 3CDFA 3MRGA 3V5DA 4G6FB 3SGDI 4P9MH 1B2WL 5I8KH 3ULVL 1UWGH 1FAIL 4NNPL 1WFTA 5JXAL 1YNKH 4PJDB 1HNFA 1RIVH 4BFIA 4YPGA 1V7NL 2A9MH 4Q2ZA 3WNKA 1MWAH 2VZ3A 4FA8A 1F3DJ 4HG4K 3VXNA 2E9WA 2Z31C 1ZANL 3RWIA 3SE3C 4E0RB 1DQLH 4KUCF 3PGDB 3CZJA 5KSVB 2D31A 1J1OL 3V6FA 1TLKA 3V6OE 4FQ2L 4UI2A 3ZYIA 5DVOA 3SGEH 1FVCA 1G6RL 4OCWH 5ENWB 3JTTA 4MQ7A 1P9MA 1A9BB 2DI7A 3ZE2F 4XMLH 1X5YA 2QADD 5HGAB 4V1DE 1MHPH 2WP3T 2I25N 3SGJA 4OZFH 3V6ZB 5FF6A 4N1EA 2XNAB 3F7PC 4LDEB 1MCFA 5IFHH 4NN6C 1Z0NA 1T7WA 4Q6IB 3JV4B 1BVLA 4KJWD 3SKJL 2AK1H 3CFBB 5J8OA 2EXWC 3K81A 4PGDB 4UV4H 3BT2H 1I7ZA 4XNMA 2GW5A 3GSRA 1Q9KB 3TVMC 3QI9D 3HPLA 1NFDE 4ISVB 3HG1B 5FUOH 1C12B 2VL5B 1OAQH 3O3BA 1EIBA 3WIFA 5LAXA 2X89D 3MLUH 3EGSA 1IGML 4JFED 4AIZB 5T3XE 1QA9A 4B50A 1MREL 3U7YH 3VXMD 4JN2B 3RHWK 4O2FA 2BSTB 4URTB 2FZ3A 4JO4H 4Y5YB 5JOFA 1PKOA 3EAKA 1XGPA 4IOIA 2EE2A 3T8XB 3DBXB 3RIFF 4NKQB 4P3DB 1CL7I 4PGZA 3WNPA 1PVHA 3MRFB 2X89A 3KPSE 4FQXC 4X6CF 5E8DH 3T0WA 4P2OB 3EOBB 4JY6B 2Z31A 1VEPA 3VXMA 4KI5F 3L7EA 2ADIA 3KPPB 4UB0H 3SHSA 4WI3A 4HUXA 1VFBA 3STZB 3QCUH 4U6YA 1CE6A 5MP6L 3P4OA 5F7YC 1VB9A 4Y16B 1ADQH 4LGPB 3TIDB 4DVRL 5HVWA 4PREA 3THML 2NY5L 5F97E 4AEHH 4Y1AD 1OGAE 3SDXF 3L5IA 4MNHB 4PUBL 4TNWF 3TVMD 3WBDA 2VUYA 4XCFH 3RKDD 3LIZL 1TTGA 2OXHA 5HYEA 1QEWB 2VDPH 3VXOA 3EJYD 1QVOB 2PW1A 4KKCC 3O2VL 1JHTA 2Y5EA 2ZUSA 3QDHA 2XWJB 4Z78A 3DTXB 4LCWB 1OW0C 3H6JA 3OAZH 1MCHA 4Y1AA 5F9OL 4U7MA 4ELMA 1NGZA 1CYGA 3TVMA 1TZGL 1LP9B 4GMTL 4HUUA 5T3ZD 2BC4B 4RAVA 4LSQL 5ANME 4ODHL 1WBYA 1TZIB 3CFDA 1EGJL 3SE4C 1QBML 4FQXD 5HYJD 3FQTA 5HVHC 1KTDA 6CGTA 5DVLA 4Q58C 1N6VA 1EEUA 4PRPE 4Y4FD 3VH8A 1FNFA 1S8DB 4M5ZH 5ILTL 1CFSB 3U0WL 5E4EC 1T5WB 1DANT 4WHYG 2ZCKH 5KVEH 4JKKA 4I4WB 3MO1B 5DURD 4YFDB 4L4TB 4G42B 4NFCA 4YE4L 4L4VD 2OXGA 3LN5A 2PR4L 4RWYL 4FQXA 1E6OH 1Z3GH 5HYJA 4AH2A 4RRPA 1F4HA 4HBCL 2AQ1A 4Y4FA 2DL9A 5E94A 1KBGH 4KJQD 4UINL 1DUZB 2AV1A 4LSTH 2H2PC 1JGLL 4ZUTA 3DSFL 4NQCB 4WDIB 4KKCD 3EBAA 1OP3H 1JUFB 1T1WB 1OGTB 1SQ2N 2NY1B 2NY7L 5C9KA 2GTWA 1G0XA 3ISWA 4PJGB 3RL1A 1X7QA 5CWSB 1ODAA 1TQBB 3GMPB 1XCTA 3A6BL 1NUGA 1U8MB 1JRHI 3JWOH 3ARBD 2G75A 4XNQB 2VXTL 1OT1A 5EOQH 4N0FA 3W9DA 4OFDA 4OZFA 2IPTL 2B20A 4M6MH 5C2BL 2VZTA 4OCRL 5ALBL 1OW0A 5DZOA 4XPBH 2B4CL 4WNQA 5CD3B 1XR8A 4E41B 3P9MB 4ODBD 4M6NL 1MFNA 4YAQA 4ZD3L 2VLME 1QFUL 5C09B 2I24N 4E42B 5IG7A 2CGRH 3TZVD 3ARBA 3L9RB 4UBDC 1OAUL 5HDQL 2FO4B 1IQWH 1W0WA 4O51B 3TN0D 4XRCA 3D69B 5KG9A 2OK0H 3GB7A 4PJ7B 2WM0A 3C60D 3Q5TA 4WWID 35C8L 1M05A 3CU1A 4BUHA 4LMQI 3PHOA 4LNRB 3C6SB 3O11A 1FO0B 3OBAA 2GJJA 1QO3A 4HIXL 5IB5A 2R39A 3V7MA 5FHAL 4GS7B 4P2RE 2ITDB 4BKLB 5GGRA 4PJFF 4PJIF 1Y6MR 1ETZA 4NBXB 5CILH 5KVMC 3HUJB 2EYTB 4ACPA 2YPVH 3WCYA 1U41A 2BDNH 3V7AG 3ARUA 5EZJA 5T1MB 5I19L 4PJ9C 1FC2D 4KGLA 3V8CA 4JFYA 1IEAB 1B88A 3KDMB 5IHUL 1S7VA 1C7SA 1J05B 3SCMB 4GG6A 3MLXL 3R4DA 1FAIH 5ISZE 5T1LD 1IGIL 1T5XA 2H9GA 4L8SC 2OYPA 4Y88A 3S35L 4OD2A 1V7NH 5TE6H 4Z7WE 3GSNH 4JDVA 2DQHH 4HS8L 4AQOA 3SJVB 5HY9B 4G9FB 1KV3A 2YD5A 4QTIH 4XAWL 1ADQA 2D4DA 5CBAB 1CLZH 3HS0B 5FDWB 3UTTB 5IFJB 2IPUK 1W2KT 4U3HA 3O2WH 4O58H 1WBZB 4Z76A 4FQ2H 5I73C 4UBDD 4TUKL 4NQEB 5T1LA 1TVDA 1FZMB 4L8BA 1G6RH 3TBVA 3Q5OA 3JWOC 3QQ3A 2CLVA 5GS2H 1N7MH 5HSFA 1TZHB 5I76B 4XX1G 3LEYL 5IQ9A 5C0ND 3LV3A 1AGDA 3QUZB 4RMSA 4GFTB 4RFEB 1D5MB 4U1SB 3KXFD 1NCWL 4CW1A 3SKJH 2QR0A 1XEDA 1DQJB 4H0GA 4FRWA 1DEEA 4AIXA 3EOAB 3MNZA 1UB5B 2GT9A 3HRZA 5HJ3B 1I8KA 1NGWA 4BUGA 3GJFH 3WV0A 2XG5A 4MD0A 4M7JL 5FYJE 1UA6H 1SVCP 4QXUH 5I9QB 2DQJL 1U8JA 3E6FB 3T0DA 1KPUA 4XC3H 3FO0H 2E7LC 1ZGLP 3KXFA 5DRNB 1IGMH 2PCPA 2MPAL 2DYPB 4I5BB 4UDTA 1CDJA 3O9WC 4NWTL 3X12B 4HZLA 4PJ9A 3VFVB 5F7FA 1ZHBA 4NM4H 5DJ6B 3UYOD 1XF4B 3STBA 3TPUE 4M02A 4MJ4A 1UGNA 1CFNA 1Z9MA 3QSKB 2C9AA 4DZBA 4ENEC 4QRQA 2P42B 5E99L 2XTJE 2FHCA 3CFCH 4X5WB 3WS3A 4E5XB 1FH5L 1JNHB 4JDZB 2V5YA 3RWGA 4PPTA 5M95B 3F7VA 1MFDH 2FHBA 2R69L 4PYHA 3W11D 2XWTA 2DQUL 2Q87A 1TENA 4O9HH 1K6QH 5EG6C 3B9VA 2V5RA 5CIPB 5EZIH 2HT4C 3O81A 4KRMB 4DVRH 1C08B 3DYMA 5HBBA 4Y19D 3UBXA 1UG9A 2M1KA 5KVGL 4AMKL 3EOTH 3MBXL 3DNKA 1H3PL 1CU4L 1NPUA 4KHXL 1VSCA 4PGEA 2DBJA 4KI1A 1EH9A 1A47A 2DWDB 3FQRA 1S7QB 5DJCB 4YQXL 4HIHB 1TETL 4QRRB 1Y6KR 4DOHE 1L6ZA 5CS7A 4GRWB 4GJTB 3LKNB 5GGUA 1MJ7H 2NZ9C 4P5TC 4Y19A 1IC7H 1DZBA 1LO5A 1QSFE 1N6QL 3DRTB 4NJ9L 4EXPX 3MLRL 1TIUA 4X4XA 3B9KB 1A4JA 1N5YL 4LSQH 3MODL 4ENED 2E7LA 1UKSA 1EGJH 1B90A 2ZKHL 1X4YA 2P8LA 4DAGL 2HFEA 2BP3A 3O9WA 3TBYB 5SV3A 3DWTA 1N64L 1JWUB 1PFCA 1ZGLB 3AS3A 4YHKH 4OM1H 4MLIA 5LQBL 4J1UB 4YC2C 5FFLA 1QRNA 3MNWA 4NRXA 4PJCF 4M7KH 1U91A 5F93C 4NNYB 2YRPA 4QWWD 2NW2B 1AP2B 3TFKD 4XXDA 2CIIB 2PR4H 2JJSC 5DMGC 2P8MA 5DJZA 2BVOA 4NO0B 2GITA 2CQVA 3GSNA 5GS2D 1DLHB 3LD8B 3DUUA 1JGLH 3KYNA 3BHBA 1AO7E 2N4IA 3HZYA 2NY7H 5SWSD 3TT3L 3D0LA 1DUYB 4PRAB 2VLRD 3NABL 3FQXB 3PHQA 3JUZA 4P3CL 2HKFL 2WANA 3PP3H 4P5TD 1F5WA 5FYKL 3MGOA 4NZRL 1YMME 1QACA 1RJCA 2A6KB 3CAFA 1FFRA 1NSNH 3O3DB 4G8GD 1JGUH 1MI5B 1LNUB 3V95A 2DQTL 4N0UA 3P0YH 3MRJA 5B22A 2VXTH 3H2WA 4CJ1A 3GGWA 4L9LB 3BH9A 3RZWA 4PJXA 2IPTH 3IDGB 3Q6FA 4LGRB 3D85B 5CGMA 2VLRA 4L1DA 1CGXA 2B4CH 4P5TA 4L3ED 3DHJA 3PGFL 1YECH 1U8OB 5HHVL 5IF0A 1QFUH 4G8GA 2FGWH 3H9HA 3TO4B 5CD5C 3AY4C 5DJAA 1OHQA 1OAUH 3IU4L 4P4RB 5HDQH 2WSKA 1KLGB 3NZHH 2J2ZA 2IEPA 5DMGD 2MWCA 3TEUA 2APXA 35C8H 4YHNA 4L3EA 4GAYB 4LDOB 3RZCB 5JPMB 4I77L 4HIXH 2JCCE 4ZNEE 3SKUD 4JJHA 5DJ2A 4KDTC 5IEHB 3ARZA 4X6FA 5DI8A 5ICXA 2VIRA 5MHSD 1DBJL 1EFXB 2JJSA 4GG8A 2CKBB 3JTCA 2UV3A 4HKBB 2V17L 2FX7L 2VXUH 3OAZK 4RZCA 3RFZC 4N8PA 1TPXC 1OLLA 5EU6D 1DBBL 5D7IF 2DBLL 2BNRB 3MLXH 4UNUA 1IGIH 3IVKA 4X7FC 2JB6B 4OLVH 5JZ7D 5L6YL 1ZLUH 2RAMA 4AZ8A 1X9QA 1UH3A 3ZSSA 3IRZA 2GAZB 4OZHB 4LHUA 4RFOH 3RI5F 4J3OC 2AQ2A 4JR9L 1MY7A 3F5WA 3UMTA 3LEXB 1NEZA 3BGAA 3FN0L 3IF1A 5CD5D 4ZUSB 1AIFA 2PETA 4BQ9A 4ELKA 3EFFA 4V1DA 1DR9A 5EO9B 3AAZB 2R2EA 3I2CL 3F58H 5FUZL 1G7JB 4KC3B 4ZPTA 4JZJC 1V8HA 1ZAGA 5IVXF 4OQTL 3TJHC 1DN0B 3GMLA 3ZDXE 1IGCH 4LP4A 1I8IA 1REIA 2CKNA 3VFOA 3PWJA 4U1LB 5EOTB 2EKJA 1FE8L 3AY4A 3L5WB 3MREB 4H8WC 3G6AA 4I13B 1NFDA 5F7UA 1MAKA 1EMTL 1FVDA 4X4ME 4QHNB 3AMKA 1BVZA 4MJ2A 4NQDD 3S36H 4C56D 1JI1A 3MTRA 2UZIH 4LLUA 3AM8C 3V0AC 4KDTA 3EO0B 3ALXA 3IRPX 4HS6A 3WYRA 2MNUA 4DZ8B 3RTQD 4LU5L 4P5MB 2MFNA 4XCCL 1S3KL 1U8PB 4QXGL 4D9QE 4U2ZA 1UVQA 4XNYH 5C07B 4GKSB 4R8WL 1MCLA 1U3JA 3MYJB 2R1YB 4JO3L 3QDMD 4KMQA 4NQDA 1LD9B 2OSLB 4HPOL 2ZPKL 5IJKC 4OKDA 2FNBA 1CLYL 4XP1L 1FG9C 1CQYA 1QZ1A 3GRWA 3T1FA 1EHAA 3PDDA 32C2A 4B41A 5JOEA 4Z7VB 1HSBA 5GJSH 4FQ1H 3TJHD 2X1QA 4LSDA 5L7XL 2QQKH 2FX8L 4U0RB 3V4VL 2R69H 2ZSWB 2DQUH 5D96C 3QFJE 5BVPL 4XP5L 1JL8A 1CF8L 2ZUVA 4A2MA 3G5ZA 4P23C 4JKPL 4HH8A 5DD0L 1FJ1B 1MCNA 1T04A 1H15A 2P4AB 4JZJA 3MRRA 4U6HA 3TJHA 2ESVE 2DQFA 3MBXH 4YEEA 5E6IC 4QTHA 1CU4H 2G2RA 5ICYB 4ONHA 5D1XC 4PRPD 5JOPE 3ZYZA 3CSGA 3BVNB 2M2DA 4YQXH 1YPZF 1TETH 4QF1B 5EOCJ 5GRJL 2BOBB 1F4WL 2I26N 1PKQE 4RIRB 3M1BB 3AS2A 5J0BA 5ANMA 3BD3A 5J56B 1Q9WA 1N6QH 4NJ9H 4S1SH 1UB6B 3T0ED 3EYFA 5DSCB 3AM8A 1YEEL 4PRPA 3MODH 3H9SE 1NGYB 2E9IA 5DD5H 2ZKHH 2H2SC 4NRZB 5J89A 4K7PY 5HPMB 3F8UB 2NY3B 2Q8BH 3O8XB 1CDIA 1QSVA 2AV7A 3TWCL 4G8EB 3CH1B 1NCNA 5H94B 3TH2T 3NFNA 3O41A 3HR5B 3ARXA 2CLZB 4WW1A 4H26A 1MUJA 4P23D 2ZUYA 3BP5A 4IDJL 2VISB 3T77A 2AP2A 4KKNA 5E6ID 3KPOA 5CLWA 1AJ7L 2Z93A 2I07B 2D7QA 3TGXA 3WHXB 4F3FA 4JRXE 2X4UB 5F1NA 3L3DA 4QRTB 4JDTH 1NCBH 3TT3H 2BNQE 2YKLL 5C7XL 4P23A 2OTUB 1LP9F 3LKRB 4Y5XB 5E1AA 5I6XB 3AXLA 5E6IA 1OLZA 4JHZA 1T7YA 1G7HB 1SJXA 2Y72A 2DQTH 1J8HE 5D1XA 3UJJL 1JNLL 1IAIL 3D2UB 4FXGB 5DK2B 5FYLH 2D9CA 5TE4L 1Y0LA 4LIQE 3PG2A 1XGQB 2YD9A 3HI1A 3QEQB 5DJXA 2E27L 5EU4A 5LXGL 3UJIL 2EXYD 5C0JA 2R2HA 5DHYB 1C16A 1U8IA 4KROC 2BVQB 2BY1A 2OL3B 1Z9SA 2NY0C 2K7PA 5IV2B 2V7NA 1YEDB 2XZCL 3ZTJH 3MXVL 5D72L 2HVKB 4MCZB 2P5WB 2APTA 3QIUD 3SDDC 1A6ZA 1WISA 1LDPH 3V5DB 1U93A 5EN2B 4ODVL 4S1RL 3TNNA 3HC4L 1JCKA 3PV6A 5JDJA 3MGAA 4YPGB 3BMWA 1T89C 4LVHB 4Q2ZB 4Q7DA 4WHDA 2ATPA 4PB0H 4YHIA 1DBJH 4M4PA 4OFVA 1T0NA 3QEGL 5ISZA 4F7MA 1OB1A 2ZUQC 4HKXB 3QIUA 1NUDA 2NY4C 4JKLA 2VDKL 4Z7WA 5FKPB 1FN4A 2XTJC 2DBLH 2PNDA 4J6RH 4IMLA 2EDQA 2NTSP 3WKML 2PYEB 3ARRA 3KG5A 5L6YH 1PY9A 1R3KA 2OM5A 1YJDH 3L3IB 5J6GB 2EE9A 3OHXB 1SBSH 3AMLA 2D7TH 1LO3L 4KROD 1SBBA 1RZFL 5DYOB 4PJ7F 5C08E 2H26B 2X05A 3B6SA 1J88A 1BP3B 4I2XE 4JHBA 1U8LA 1G84A 3NTCL 3U4EA 4I18B 3WXWL 3LS5L 5FUZH 4JM2F 4MNGE 3F7QA 3HR6A 5C0FA 2F54B 2QADB 4OQTH 3SDDD 5IB2A 2X5PA 3GSRB 3KLDA 4ZO9A 5A1AA 5E00A 5D2LB 5EU5A 3VFRB 4UILL 4M43H 1RI8A 2A83A 1FE8H 2MOVA 5AEAA 2EKSB 3AC0A 3BKCH 4FQCH 5D7JC 3NAAL 1S7UA 5DRXA 4YX2L 4HKZB 2OR8A 3L6FB 1R5IA 1YY8A 4HUMB 5FO9B 4O2CB 2UWEB 2XXCB 3SDDA 4NO2B 5I66B 2A6IB 1L4IA 3GSXB 1BAFH 3SE8L 2FZ3B 3QI9B 5JOFB 2NW3B 1RIUH 2XTJD 2VLKD 4NBYB 2ZOKA 5HHXL 1H3XA 5IROA 5EH1A 1WIPA 2B5IB 3EHBC 4LU5H 4MZ3A 2FLBT 5D93C 3NMEA 4DTGL 4RDQG 4JFEB 4RGOL 4XCCH 3ZE1F 4NN7B 1S3KH 1KJ2H 3L7EB 4Y5VB 3FRPA 1CDYA 4EIGB 3C5SB 1K4DA 2IQ9L 3BH8B 2C4FU 1VFBB 2BVUA 1IM3A 3K4ZA 5J12B 4HPOH 5EU7E 4AEEA 4LSSL 2YS4A 4XP1H 4FQQB 1J10A 5E8OB 1T1YB 4M1GL 2B39A 4LLVA 5AD0A 1QBBA 4AG4L 1U8NB 3TNMB 1GCFA 1BGXL 5FYLD 2OZ4L 1FL5B 3LDBB 5L88H 4Y4KC 1PYWA 1Z0MA 4OZIE 2PW1B 4ZAKB 5BQ7B 1QSFD 1D3CA 5BVPH 4XP5H 2HWZH 1UQSA 1OT2A 1XCQB 5D7JD 1CF8H 1MFCL 2Z91B 4WCYL 2I9TA 3EYVA 3DX7A 1PZ5B 4JKPH 3CXHJ 5DHVB 4HGKC 3DX9A 4J8RB 4PJ8C 2F8XC 5LGJA 4BQBA 5E2UH 4X7TB 1NANH 2WINA 4YHOH 3PP4H 5HDBF 4HUUB 5GISL 1NLDL 1PAMA 4TUOA 4LPVA 2ZP0T 3EHBD 1QSFA 3QO1A 2VYRE 5F8RC 5TE7L 4JFHD 5D7JA 3U6RB 4JO1L 4EDXB 5HYSA 1KTDB 1KCUH 4PG9A 4G6AD 1G7IA 1PG7W 1ZLUK 5K9QG 1S9VA 1ZVYA 5E9DB 3RVTC 1ZT4A 3HC0B 5I8CA 1KN2L 3IFNH 3PQYD 1YEEH 3R06A 3RJQB 3FONB 2QQLH 4I3RL 1NBYA 4TSCH 4QHUB 3ERYA 3BEVA 1MWAB 3DMMD 2V7HA 4Y4FB 5CZXC 5T5NF 3FMGH 3TWCH 3MPCA 3TF7A 3QEUA 4HKJB 2AV1B 4RMTA 3ETBF 1AXTL 4Y4KD 4IIQC 4JLRA 1IVLA 1U3YA 2FJGB 1B4JH 3S9DB 1A2YA 3T04D 3GMOA 4L4VB 2CRYA 3U46B 5JXEC 5KS9E 5ESAB 5EC2A 4PJ8D 1XGUA 3RY4A 2CUHA 3S5LA 3MNVA 1AO7A 1SYVB 2MHAB 1K4CB 4N0CC 1RVFL 1AJ7H 3DMMA 3T3MF 1QBLH 3IU3B 3CVIL 4I3SL 1LDSA 4JKWA 4TVPL 2G75B 4Y4KA 4GRWF 4TQEL 5HI4D 4QEGA 3WL9A 1ROWA 3B5HA 4N0FB 3TBSA 5HDLA 3QJFB 3LB6C 3U83A 3HNTH 1I8MA 2YKLH 4DGVH 1SY6L 3MV8D 4PJ8A 5CMAA 3RVTD 1BQHA 5FOBB 3LKPA 3MLPA 4KJPC 4PTTA 3UJTL 4JFZL 3OAUH 2ARJQ 4FABH 3ARBB 3BP4A 3UJJH 1JNLH 1HQ4B 4M7ZB 3IFOB 5D5MB 4BZYA 1XR9A 4K3JH 6FABL 1GHFH 3MV8A 3PHOB 2E27H 3UJIH 2I60H 1WZMA 1RUKL 4PTUB 2CRIA 1JP5A 3QZWA 3ARDC 4F7TA 3BOVA 5CEYA 5E03A 3KLSA 5KANG 1OQXA 3TZVB 2Z4QB 1N4XL 5K9QI 3TN0B 4L5FH 1NGPL 2IBGA 2JCCA 2XZCH 3C60B 4ZNEA 1T3FB 3L5XH 3C5ZC 4XCEB 2V9TA 5AAWA 4C55A 3O4LB 5HD8C 1EEYA 1S7VB 1KJ2A 4ODVH 4N0YH 2HRPH 3F65A 4IIQA 1T5XB 5FIEA 4OD2B 5DMKB 4CMHC 4P2YA 4MQXC 5JXEA 4NQVA 1WV7T 4ETQB 2A77L 3L3OB 2WUBL 1K2DB 4ODXA 2VXQH 4N0CA 5I15L 1RZIA 2VDKH 5T1KB 3PGCB 1EUTA 1FP5A 3FB7A 4PGCA 3WKMH 4UT6H 3HE6B 1F11A 4PJCE 1G7LB 4I0PD 1HILA 3VGDA 5L8JB 4RDQF 4XPAH 5I1LB 1ED3A 5JHLL 3FOLA 5C0GB 1U8KB 4HULB 1F4YL 5A2JH 4M93B 1T4KA 2FWOB 2VQ1B 4PRBB 1CFTA 3BDXA 3ARDD 4F9PC 1U8HB 4FFWC 5AZ2H 5SWZE 2GEEA 5GGSA 1RZFH 4AENB 4U7SA 1NC4A 3C9NA 1KJVA 3A0OA 1KCVH 3E6HA 1JTPA 1UZ8A 3LS5H 4CNIB 1FBIH 4OZGF 1CR9L 4YO0B 1IBGL 2RCSL 2YMXH 1NGWB 1JNJA 1N5AA 4WUUE 4HBQA 4OZ4A 4Z7UF 4MD0B 3FL7A 1LMKA 1T7XA 3PJSA 3INUH 3K7UA 5HD8D 5TJWK 4YLQT 1I7UB 1DBKL 3ARDA 3C5JB 5IIEB 1EBAA 1KPUB 4MNQB 1YEGH 3I6GB 3QDGE 2ARWA 2E8YA 2ICWB 2PCPB 3OKNB 3NAAH 3DIFA 3VG0L 5J9PB 1FNHA 2VLJE 3C5ZA 3QWQB 3QUML 3S8WA 4K9EL 1MRDL 2W9EL 2HFGL 4APQD 4X5XA 4KY1H 1F8TL 3HB3C 3X3FL 4UNTA 5F9JA 3ZO0A 1CIUA 4FFZH 8FABA 4QRQB 1H8NA 1EO7A 2E6PA 1QPPA 2ENSA 5B38A 3N1QC 5F88A 3S37H 4XAKE 4DTGH 1CFVL 2DTML 5F96L 4U1KB 3WEXB 5CJOH 3S4SG 4PJ5D 2IQ9H 5KSBF 1FCCA 3O45A 5FB8A 1CG9A 2QHRL 1KB9J 3GSUA 5D7KD 1J5OL 1FL6A 1HK6A 4N9GA 4M1GH 1V5JA 3GIVA 4U1GB 4AG4H 2I5YH 5BJTA 5JOPD 4YR6B 3IKCB 3DX8B 3I84A 3QFJA 1G7PB 2VR9A 2FEEL 1A5FH 2OZ4H 3QEHA 3QXDA 4F9PA 5ITBH 2F53B 4RCAA 4EUPH 3T4AB 1MHHA 4Z18A 3UCRA 5CJXC 3WDJA 2QKIB 1RULL 5D7IE 2A6JB 2CUIA 1IM9B 4QOKE 3DUSB 3O4OB 5CAYB 1QFWH 2IGFL 2C3VB 1JPGB 4CVXB 3MUGB 3X14A 3HB3D 5IK3B 3PABA 3L95B 3P0GB 1KF9B 2X4NB 1NLDH 4WGVB 4ZDHA 2F58H 1L9MA 5KVDL 1QNZL 1KJ3L 2VH5L 2P8LB 2XACC 4JO1H 4CDHA 5I71C 1C5BH 1A8JH 4K7FA 5DRWA 2YA2A 1FFNA 4OJFL 4YXHL 3BZFA 4YWGL 3W2DH 3CPLA 3H9SA 1OP5K 3D3VD 5IOPB 1T2QL 2BRRL 4XMPH 3B9AA 4NRXB 1OARH 1P7KA 3L7FB 4GRLB 4I3RH 2EDJA 3RHWF 2IPUG 4GW5A 5DJZB 2H41A 5DD1L 3VGBA 2ZCHL 2OMNA 1F90H 3JV5A 1WWBX 2A9NH 5A16A 1L0QA 1AXTH 4PJDE 5IB1A 4LSPH 5I18L 4PDCE 4C4KO 3DXAD 3T0AA 5IB4A 3WNMA 2XQBH 4F58H 1B6DA 3QNXA 4U05A 5L2JA 1G6RB 2LFGA 3MGOB 1RVFH 4MQTB 3ZT7A 1EHXA 2PO6C 1YY9D 3CVIH 4I3SH 2IAMD 4MB4A 1IAKA 3O6KH 2XFXB 1P7HL 1JF6A 4MB3A 4N0UB 3ALWA 3FO1B 4TQEH 5CJXA 2WIIB 4YNYB 1AGBA 5SWSB 3RX7A 5CP7B 3CDCA 2YPLD 5GSRA 1SY6H 1KIQB 4GRMA 5H2BA 4X7SL 1MLBA 1RZGA 5JW4Q 4PV9B 2ZNXA 2FR4B 1RURL 3W0WE 3BE1H 3GJFB 4LFHG 2IAMA 4ZS7H 4EJ1C 1I1FA 1WBXA 2VDRL 2Q20A 4JJ5B 4MXVF 2WBJC 3EYSH 5GRZA 1RZJL 5SX4H 3BPOC 1KSRA 1MELA 1YQVH 4Z7QE 6FABH 4FP8H 3WN5C 3VFUB 1OL0A 3HG1E 1E4XH 2J88H 5GZOC 3WIIH 1RUKH 4HJJL 1XF3B 5F7MC 1NJ9B 1JGDA 3GSWB 5JQ6L 3MCG1 2EYSB 1J18A 4ONOA 4GG8B 3VWJD 4LLWB 1J1PH 4LCIL 1NAMH 4KKBC 3LH2H 4LSRH 1DQML 2QTEA 1WWAX 1I7TA 2AJVL 4G6JL 3U1SL 4C4KT 2YD8A 3E3QE 2R56L 3VH8G 1BOYA 3DHMA 3I75A 3JXAA 3IJYB 4GXVH 5EU7C 2A77H 2CDEB 1C5CH 3VD3A 2WUBH 3MLZL 5I15H 1T2XA 3E2HB 3F5WB 1WJ3A 2X9YA 4NJAL 2V2TA 5K33A 2VZUA 5EU6B 4ELKB 5HHQA 1PQZA 3RRQA 4RRPG 2X4SA 1RQ5A 3HCVB 3HAEA 4JB9L 5LCVH 4JFPB 4LKCA 1XAUA 5C08A 5C0IA 3GSQB 1KN4H 1F4YH 4R2GB 3EDEA 1MLCB 1S9YB 2YEZA 3LS4H 1R3HA 3RBGA 1A4KA 4LCWE 5A40E 4OFYA 1IGJA 5LVEA 5IMOA 4F57L 1LO4H 1CR9H 2RCSH 3MRCA 5F3BA 1LP9E 2KKQA 3WN5A 2CLRB 1W72L 2X4QB 4OZFG 5BZDA 1NMAH 1DBKH 3KYOB 2NYYC 3BZ4A 3WFEL 1KTKE 2NXZC 3V8OA 4CVWA 2XZAH 2N7BA 1OAZL 4P46D 3W5NA 2AEIT 5HGHA 1EO8L 1LQVA 1QLEH 4UDUA 3QUMH 1D7FA 3R8BB 1MRDH 2HFGH 1GGYA 2VITA 2ARJB 1KB5L 1A3RH 3STLB 4NQDB 4L4TE 5J57B 4C56B 3X3FH 4K2UL 2HA1A 4KMTH 1I75A 1FZKB 4GMSH 4P46A 1S5HA 1YNTA 5I1IL 4HC1L 1Q38A 2GSIA 4N1CA 4TSAH 3RTQB 2JELL 1HSBB 2FBOJ 2DTMH 5F96H 4IOFD 2IFGA 4D94A 1U3HB 1WFNA 2Y9RT 1WWCA 3OKEB 3O2DA 5DQ9A 5EZLB 4NQCE 1YQ2A 5HHOB 4FQIH 4B7LA 3QDMB 4JFDB 2QHRH 1FNEB 4ZFZA 2GJ6D 3QPXH 5EBMB 5CCKL 3IFPA 1OQOA 4PJGE 2KUTA 1AY1L 1OSZB 2DLHA 4XCYA 3OJDA 1JWSB 4L3AA 1X5IA 1H15B 5F1IB 1DSFL 3MRRB 4OZIA 1ZHKB 4JFFD 5IKCB 3SQOL 1JGVL 4KK8C 1RU9L 2NYYD 2NXZD 4H88L 4EXKA 3BDYH 1FAKT 2ERJB 4BH8A 5T33L 5E5RB 3BO8A 2NCMA 1S7XA 4LASH 1MF2L 5C70A 1QP1A 4R7NA 3W9EB 5FYJU 4YDLB 2JKXA 3QXVA 4LVEA 5JDSA 4E41E 3BWUC 3HNVH 1QBAA 4A2LA 3VFPA 4HGMA 3LN4A 1A14H 4MD5B 1UM6H 2EDEA 3SGEI 4JFFA 1M7IB 4P2CG 5C09E 15C8L 1HHHB 1YEKH 3AU1B 4C58B 1U8QB 3UDWC 4PJ7E 5HHME 4ALAL 2R15A 2VH5H 5IVZB 5E2TL 5I1CH 5FO7B 4YXHH 4JZOA 4NZTL 4PJAB 2BERA 5ID1A 2OTWA 1NAMA 2BRRH 4HJGB 3T0EB 2VC2L 3NFNB 3OJMB 1K8IB 4M1DL 1KEML 3HUJE 3QUYD 4WW1B 1ACZA 2R8SL 2P47B 1R0AL 1UJ3B 2ZCHH 3FCTA 5H37G 2P7TB 2HKHH 1T66D 4R4FH 1KT2A 2AJ3B 1JF1A 5KS9A 5I18H 4RMWA 3SBWC 3WLBB 5F1SA 2VQUA 2GJZB 3FQNB 4ELMF 3ULSB 3SJVE 4QXTA 2JK5B 1AH1A 2V6HA 1VFMA 4G9FE 4G9DA 4P23B 4AIOA 3FJTA 1OTUD 2EYRA 4K7PX 3UTTE 2LE9A 5EU3A 3U9UA 5I2IA 3EDJA 1A3LL 5AYQA 3CFKA 4KRPD 3OSKA 2GY7B 3I3DA 4P9HC 4FFVD 1HHIB 4FHBD 2Q86B 1MH5B 4U6TA 5TF0A 5JLZA 5TGBA 1KLUA 1LO0L 5GGTL 4X7SH 4LEXL 4R4BA 1KJMB 2R2HB 3L1OH 3GMMA 3GSOA 1U8IB 1ZT1B 4NWUH 1H8SA 4WFHE 1MJJB 5GRXG 3UBXG 3UDWA 2EDFA 4EI5B 3ULUE 1GC1L 1T20A 3QXUA 3ARED 1RZJH 1UADC 3REWA 5MI0C 3CVHL 1CD8A 5MERB 4MA1B 3UTSD 5ACZA 4A6YH 2ICES 1J0YA 4HUWA 2GSGB 4TSBL 1TVHA 4HQQL 1BJ1J 5IBTL 1X4ZA 3T65A 5IHZA 4HMCA 3KPNB 5HDBE 5JQ6H 4CMMA 3VFGH 3AVEA 3S88L 1V7MH 1BVKA 1G9NC 2ATPB 5E0QA 2EDWA 1I1YB 4YFLI 4BH7B 2XWBB 3NH7L 4DK6A 1BFVH 4G6ML 4LCIH 1YEHL 2R2BB 5D7SL 3WFDL 3QIUB 4R26L 2G60H 2MSPA 5E70A 4X99A 3UTSA 4MDJB 3V5HA 5IR1B 3UO1L 4OV5B 3U1SH 5GRUL 3SBWA 2D0FA 3WIHH 3LQAL 1X4XA 3HNSH 5ITFA 1G9EA 3QYCA 5GJTH 2P8PA 3RIAF 2G9HB 4NCC1 1RZ8A 5JA8B 1G7QB 3RWFA 3UTPE 5DJDA 4XVSH 1GAFH 4CL7A 4AEIL 1BX2B 3K2UH 5I1JH 3QHTC 2PYFA 3I02A 3VXPB 4PRDA 3BRDA 3MRDB 5EU5B 1DDHB 2VLJD 4UTBH 4X6EB 1KCSH 3CLFH 2NNAB 5EA0L 4KHTL 4RGNC 5FA3A 4HFWB 2Q8AH 4GRWE 5I75C 1D5IH 3UC0H 3DYPA 4FN0A 4F57H 1S7UB 1X44A 4GW1A 3MLTB 4WUKL 1A7NL 3QDGA 3UBXI 3AB0C 1NDGA 1W72H 1HHJA 1HXMA 4XTRC 5GSVA 1ZT7B 1AQDA 2ZOKB 3VXTA 1QFWM 4XWOD 2VLJA 4WEMB 3DECA 3F12A 4JZNB 3MLSL 4WWKB 1S7WB 1HINL 2F5AH 4WTWA 2WNGA 5F89A 1YEFL 3MOBL 3PWLA 4LF3B 1F13A 4N5EC 2QQNH 1I1AD 2NLJB 4TNVK 2D7PA 3EO1B 4M5YH 1MFEH 2V2XA 2VN7A 1KB5H 2XPGA 1G1CA 4NC1C 3FB5B 2VLKB 5D8JH 4FTVD 3V2AR 1B6UA 5I1IH 3DRQA 3G08A 4UUJA 4HHAA 2X4OB 1MVUB 1IC1A 1KTRL 5IB3A 1H0DA 3BW9B 2IADB 4MCYA 1I1AA 2IWGA 4K71B 3SEPA 3ZE0F 4BA8A 1B4RA 1XZ0A 1CQKA 3MMEA 4HAGA 5GS0L 3MRKB 4RGND 5D7LB 4FTVA 3FO2A 5DK3A 5CCKH 3VRJA 5HHNA 1AY1H 3EYVB 1OPGL 3DX7B 2CK0L 5IMLA 1EZVY 4UT7L 4X0KB 1BZ7A 1EVTC 3KWWB 2W9DL 5LGJB 2J12B 1BEYL 4K3EH 1JGVH 1MI5E 3VU2A 3B8SA 4XTRD 1KENH 4H88H 5LWYL 3U0TB 4WRLA 2FYYA 4TUOB 4NQSA 3WFCH 2Y06H 4LHUG 1J1XL 3OKYA 1P4BL 4HIEB 5FO8B 4LAJH 4OI7A 4F15B 5HYSB 4JPVH 4Q6IC 2BNUB 4N5ED 4UOJA 1NEZG 1PSKL 2OTPA 1XF5B 4AL8L 2EIZA 4F2MB 2Y7QB 2PXYD 1QOKA 3HZKA 4OCYL 15C8H 4LQ1A 1U36A 1NUFA 3K8LA 3LMJL 4PY7A 4A6YA 4G6FD 4ALAH 4ZPVA 3BPLB 3ARWA 3BSZL 3N9GH 3Q3GB 5E2TH 4N5EA 2DWEA 3BEVB 3NFSH 5EFIA 3FB6B 1KNOA 3LPGA 5DFVC 1QSZA 2YD1A 4JRYD 1KXQE 4NZTH 5DUPH 2JLLA 1D5XA 3MRBB 1HI6A 1F6AA 2IG2L 4JLRB 2Q7YB 1AR2A 3RGVD 4Q9QH 3PQYB 4M1DH 1KEMH 4Y5YC 1LGVA 5C6WH 3GMOB 4MA3A 3LKQB 4DN3L 4JG0H 1DP0A 3PL6B 4PJDA 1XGUB 1BWWA 2J5LB 3WIHA 5K9KA 3MUHL 2O61B 1F6FB 2NTFB 3DMMB 1A7OL 4JRYA 4PRHE 4P2OC 2BNRE 3P77B 4P99A 3MRIB 1JYNA 4PP8C 4E0RA 1MPAL 3PGDA 1HIML 5KSVA 3TBSB 1WFUA 1AFVL 5FV1L 4XI5C 4NM8L 3RWEB 4OZHE 4KQ4L 5DVMA 3IDIA 4PJ8B 5ENWA 1A3LH 3H3PL 5CMAB 2YC1B 3T4YA 3V4UL 4UMGA 4KTEL 1IC5H 5HGAA 2ZCLH 4MD4B 2R4RL 2H45A 2X1XR 2XG4A 4JQIL 1FVEB 5GS1A 1D9KB 1QLFB 1CT8B 3V6ZA 2A74B 5DGRA 3DVIA 4Y7MA 1YYLH 2AJZB 4Q6IA 3T0BA 3JV4A 3EO9H 5DMYA 3EDKA 4OBRA 3CFBA 5ICZB 1JK8B 4PGDA 5F7EH 2DQEL 3BQUC 3MJ8B 4NHUB 2AVGA 5CEYB 3I6LE 2HMID 1CE1H 1Q9KA 4NRYB 5FAAA 5BMFH 2Z35B 1JF5A 2J8UB 4KPHL 5SWQB 3HG1A 1A21A 4KKAC 5DJ8A 1C12A 5H8DA 2VL5A 3CVHH 1ZVSB 1MY5A 1OAXL 1RD6A 3U0PA 5CFHA 4AIZA 4HQQH 3KR3H 2BSTA 4NHCL 3NCMA 4DKFL 4Y5YA 1F3JB 3PIQB 4DKAA 5F9DC 2N1KA 3JTSA 5C07E 4J3TA 3IDUA 3T8XA 3NH7H 3DBXA 4P3DA 1CGSL 4NO3B 3M17B 1YEHH 4ODXB 2NQCA 3MRFA 4PIRF 3KVQA 1U6AL 4QCIB 5F6IB 3TC9A 4PJXF 25C8L 3EOBA 4JY6A 3UO1H 5LGKA 3FB7B 3KPPA 2VSCA 1FFPB 5GRUH 4PY8J 1F2QA 3NIDE 3LQAH 5F1OB 3STZA 1KELL 5DEFB 1UZ6E 2XN9B 4U3XA 1RMFH 2NY1C 4U31A 4JPKH 2HT2C 3OGOE 4X80L 2P44B 1RSFA 2WUCL 3MA7B 3BQUD 4PR5B 1TQBC 3OZ9L 5IJVB 5GGSB 4CU7A 5J7CC 3KHOA 2HT3D 4MNHA 4O4YH 1EHNA 3REVB 5C92A 2C4XA 3N1GC 4U1IB 4WFFD 1JN6B 5CUSH 5BV7L 4EEEA 1QEWA 1TJIH 3V4PH 4HDIB 5B39B 1QVOA 4AEIH 4I0PB 1NMCB 5DR5H 3FOMB 4WI4A 5FDYA 5I1HL 2BFVH 5E7BA 2XWJA 3DTXA 4L3CB 3G5XB 3PJSB 4HF5L 1XIWD 5IWLC 1A6AB 5JW5B 2VDMH 3BQUA 1TMCB 4WFGE 4L29A 4ZG1A 1ZE3C 3RVVD 2BC4A 2H3NA 3DIFB 3JZ7A 4L4TD 4KKLC 5I8EB 4RAHA 1FIGL 1BBJB 1TZIA 3JVGC 1A7NH 3MCKB 3PF2A 2Y4SA 5ACMA 3QDJB 2VOTA 2IFFH 1ZHLA 5F9JB 3BN9C 4ZFOA 1S8DA 4YDVB 5BVJB 1CFSA 2AJUL 3CCHB 3V0VA 8FABB 1T5WA 4NQCD 4OAWB 4GS7C 4I4WA 1HINH 3MO1A 3AGVA 4L4TA 4G42A 3GKZA 2HT2D 1QFPA 2J3SA 3SDYL 4APQB 2AGJL 1HH6B 3EFDH 3O45B 1EUUA 2VLLB 4NUGH 1D6EA 3CXHK 3EZ8A 2ZUWA 1ITCA 1DUZA 1EEZB 3SCMC 4NQCA 3RI5K 2AAVA 4WDIA 1RFDL 1OAKL 3GIVB 1JUFA 1T1WA 4KZEL 5BS0D 3OTTA 2Y5TB 1X5KA 2WV3A 4HWEL 4YGAB 1P84K 4PJ5B 1NL0H 4PJGA 5CWSA 4E41D 2X70B 1MHHB 1NFDF 2DLIA 4OGYH 5SX5H 2FJHB 1R3LA 1U8MA 5CIPH 5C09D 1M71B 1G7MB 1X6NA 1VFOA 2CK0H 1DQTA 5D70H 4UT7H 2AEQL 4OLUL 1SEQH 1D5ZB 1OTTD 2R9HC 3KHQA 2W9DH 1BEYH 4LARH 2RJMA 5CINL 5IWLA 1INQB 3PABB 4H5SB 4ODWB 4E41A 3WD5L 3P9MA 5K9JH 1TXKA 1G1YA 2FL5A 4AEFA 4J7RA 3QUZC 5C09A 3QEQE 4E42A 3L9RA 5HI5D 2FO4A 4O51A 2XZQL 1PSKH 4AL8H 4LRNL 3JVGA 4LK4A 4XNUL 3ULUC 2DJ4A 3GBLA 4LVNC 1E4KA 3N85L 2JF1A 4LNRA 1I1CA 3C6SA 1CDUA 1C5DA 3SCMD 1FPTL 1KPRB 5I9QC 1OCWL 2P5WE 4GW5B 5C1MB 3SKMB 3IDNB 5E2WL 3HUJA 2EYTA 1PX3A 2VZOA 2BSRB 1FL3B 5A16B 4DFHA 1ZLSH 5T1MA 1MOEA 3D3VB 2F5BL 3D48R 1Q72L 1PJ9A 3V0WL 2BMKB 4R9HA 4XB7A 1NGQL 2R29L 1IEAA 3ARPA 5IB4B 3KDMA 4LSVL 1J05A 3SCMA 3QNXB 4DN3H 3CFEB 4NQED 1JHLL 1LO2H 2OQJA 1ACYL 5HY9A 3BI9X 5DD6B 3RAJL 1Z5LB 4DUVA 3GHBL 4JG1L 1JE6A 1JPTL 2PYEE 3HS0A 5IFJA 5E24E 2OJEA 1AGBB 3FRPG 3DXAB 4UU9B 2OS7A 5HGBB 2PTTB 4NQEA 4KQ4H 1FZMA 1EERB 5E8PB 1MLBB 1NEUA 3IJHB 1YZZA 4XVTL 4P5KB 4ORGA 1IAOB 4ZSOB 4OD1H 5AUMB 5I76A 2IAMB 2R4RH 1WBXB 5D9SA 2EO1A 5DWUH 1BM3H 5E95B 3QUZA 3C2SA 4RFEA 2F54E 2YPLB 1D5MA 4S1QH 3NZ8B 1JNNH 4QRPB 3VCLB 5D2LE 4J2XA 1DQJA 2DYPD 1GGTA 3Q5YA 3EOAA 1UB5A 3CLEL 4M6OH 5HJ3A 1JGDB 3HE7D 3H3BC 1KCLA 4Z0XB 4YXKH 2ICWJ 2FECI 3IB4A 5LKNA 3B9KC 5AZEH 3E6FA 3F6IA 4R90L 5EC1A 3BISA 3WUWB 1SJEB 5DRNA 3G9VA 2DYPA 4XP9L 1B0WA 2VRAA 5ID0A 1TJHL 1YEIL 1T22B 1OF2B 3VFVA 3HE7A 5HYSG 2HG5B 5DJ6A 1KXTB 3U7WL 1IGFL 1CDCA 4DKFH 4JFEE 4F8QA 3SGDH 3IYLW 3VXME 4YBLB 3ZTJG 1K3IA 2B0SH 3JWDH 3VWJB 1CGSH 4N5UA 4FQPA 3S97C 3RL2B 4Z8FL 4OB5H 3QQ4B 25C8H 5L0QB 5KW9H 4P59L 3EDFA 3HFML 4E5XA 2AXGB 1JNHA 4JDZA 3SN6N 3ZT6A 4OLZL 1D6VL 4XVUC 2UVEA 3LD8C 3UTZB 4BQ8A 3ARFB 5GGSY 3FN9A 4X6BB 4EUPB 3ILPB 4Y89A 3V6BR 1AC0A 4OM0L 4H1LH 3VXUD 2FJFA 4QRRD 5CIPA 1Q8MA 2C1OA 1C08A 4D3CH 3HI6L 5C0CD 4LBEB 1YUHB 1R3HB 1CGVA 3DX6B 4XMKL 3B9EA 3S5LG 1H3UA 3A6CH 4DKEH 4N0RA 5A3IC 5BV7H 4W6XB 4Z5RB 1FDLH 1WCQA 4ELME 5DFTA 4DKDC 2XRAH 5B8CB 2DWDA 4L9LC 5DUML 1S7QA 5DJCA 3UZEA 5I1DB 4G7YL 4HIHA 2YPKB 4PB9L 4U7KA 5FA4B 4QRRA 4XCNB 3LKNA 5FCUH 4UIMB 5C6PB 2E7MA 1YDPB 1MRCH 4X83A 1T0MA 4JE4B 3B9KA 3TO4C 3T2OA 4FFEX 4YHLL 1BQHG 4DN4L 4OQ1A 3GM0A 3VGHA 5KTEL 3BRGC 5E9DE 4DJMA 1KB9K 3GK8H 2WMPA 4G43B 4JQVC 4M62L 1IMHC 5T3ZE 4YDKH 3H42L 3IDYB 1I85C 3TBYA 2FO1A 3MCLL 1JWUA 3RZCC 4JHAL 3OKMA 4P46B 4TTDC 1YNTB 5HYJE 4PLOB 1OAYL 1H5BC 4PGBB 4S11A 4CGTA 3QG7H 3QZWG 2XICA 4NNYA 1CL7H 1INDH 2NW2A 1AP2A 1L0YA 1MCEA 4V2BA 2AGJH 2CIIA 3JWDC 5EIIB 3RNKB 4NO0A 2EZ0C 3VJ6B 1DLHA 4L4VE 2W0KA 2W0PA 5A3ID 4N90E 3IFPB 5BOPA 2YSSB 4JY4A 4HXBH 2NX5D 1G9NL 4Q0XH 3D85D 4RQQB 1DUYA 4PRAA 2VQTA 3TESA 2O5ZL 5T5FH 3ILQC 1UCBH 4JPWL 2ADGB 3LKOB 1LEKB 4GOSA 4PJBB 1RV6X 5MEPA 1EPFA 2A6KA 3QAZB 2GJ6B 2VL4A 5EUOB 3O3DA 1MI5A 3TO4D 3FFCD 1LNUA 5JDSB 3EYUL 5HI3D 4L9LA 3IDGA 1HKLL 3D85A 4HT1H 2YWZA 2X7LA 2SEBB 1UXSA 1H3TA 4KI5D 1EHLH 2BHUA 4HWNA 3RZCD 1PX4A 2RGSA 4IS6A 5IMMA 2H6PB 4TTDD 1HE7A 3MLWH 5I1KL 5DJYB 4BJLA 3TO4A 3FFCA 2X9XA 3FB8A 2M8XA 4EZMA 1KUMA 1ZOXA 3NCBB 1KLGA 4OIIH 1GZPB 4LRNH 5TDNB 4XNUH 1EFXD 4JREB 3G6DH 2EZ0D 1NAMB 4NGHL 4HS3B 1OTSD 4OCMC 1KCRL 4GAYA 3RZCA 5JPMA 3UTOA 3GNML 5J06A 1H5BA 1G0YR 4YHYC 1UXWB 2WK2A 2VAAB 5IEHA 4JANA 2YZ1A 1BOGB 2ZOLA 3QHFL 4ODUB 3VFMB 1EFXA 3U7AA 2CKBA 4BSVB 1IE5A 5CHNB 2KZWA 5I16B 4HKBA 1P5UA 4LCCB 1NGQH 2R29H 5E2VH 3QUYB 3HI5L 4QXTB 4G8FB 4GLRI 2L7JA 1BFTA 2BNRA 4PJEB 2W65B 1DBAL 2JB6A 2R1WA 4W6WB 4KFZC 3RUGA 2YXFA 2YK1H 4OGXH 2LAGB 4H1LA 1AQKH 2DMCA 3GHBH 1J12A 5AG8A 4OZHA 5B38G 1DQDL 2X42A 1ES0B 4WV1A 3QJHB 3MJ9H 3LEXA 1JRHH 2DJUA 4WI8A 4ZUSA 3SO3B 5EO9A 5J13B 1CTNA 4XVTH 3GSOB 1IL1B 1G7JA 4KRPB 5C3LD 1WFOA 4D0DB 3KJ4B 3GFUA 3ZE0E 5ABDE 1DN0A 1QQDB 1OM3L 3CNKA 4U1LA 5EOTA 4HFUL 4J3WA 1DBML 1F97A 3REWB 2AJXL 4P4KB 2OI9A 3L5WA 3MREA 3VFTB 5LGHH 1TVHB 3GMRB 4Z0BL 1Q9OB 1WEJL 3QUMB 1W0VB 5F9WB 4QHNA 2IC2A 3BUYB 1MHEB 4OF0A 2LTQB 3K4AA 3RPKA 4KK5D 1NANI 1QSED 3AREB 3N50A 5SX5K 1I9RL 4ORZC 4HK3J 5DLMH 2VE6B 3P40A 3EO0A 1NFKA 5FUCE 4DZ8A 3IDXL 1Y18B 3UTSB 2J7LA 4S2SB 2NY3C 4EI6B 4OGZA 3V9FA 3O8XC 3T2NL 4WHYH 3VI4F 1Q0XL 1TJHH 4GKSA 2BJML 3IAQA 1HSAB 1MVFA 3ZHKA 2OX5A 2R1YA 5IMKB 1YC8A 1A1NB 2I9LB 1UYWL 1LD9A 1QSEA 2OSLA 1WZ1H 5ITFB 3SE9H 1AI1L 1JIBA 1ZLWH 1RZ8B 5GXBB 4HCRA 1GIGL 4Z7VA 2MCG1 1TDQA 5DTFB 4FS0A 5CP3H 5CJQL 5DJDB 3SDAB 4XWGL 1D6VH 4YHZH 2EDLA 4GT7A 4JHWL 1MFAH 3OR6B 2O5XH 1TNMA 2ZSWA 1GXEA 3KPSB 4XGZB 2A1WH 4WFGD 1VEMA 4IRZL 2F53E 1A6WL 3IS1X 1FJ1A 2H1PL 2Q6WB 4Y5XC 1WF5A 5I6XC 4HEME 2JCCF 3WMSA 2DI9A 2VO5A 4J4PC 4HH9B 1MQ8A 4Y19E 4KK9D 5IT2L 3LRGA 2FB4L 2W92A 1OGAB 1CXHA 3BVNA 4HAFA 1JZ5A 4QF1A 4PB9H 1NDGB 2NY3D 2BOBA 1HHJB 1UJTA 2GTZB 4RIRA 3M1BA 1N3NB 5CZVH 3ZL4L 1U9KA 4D8PB 2CMRL 3VXTB 1CDGA 4FZ8L 2HJFB 4HWZA 5DMIL 1FGVH 4F37K 3M8OH 1UB6A 3RVUD 2E7CA 3HLAB 4BZ2L 1RK0B 2R0ZL 2EH8H 4YFEA 4LNVA 4IOSD 4ZTPL 1NGYA 1RZKC 4DUWA 4FXKB 5CGYC 4RGMB 4NRZA 3T0VA 4X6DB 2V2XB 5HPMA 3NA9H 3Q2CA 3O8XA 5EORL 3H42H 3UYRH 1TCRB 3MYZA 3KLAB 2F74B 3MCLH 4XVJL 1AHWB 4QHMB 3I50H 4G8EA 2MCPL 3CH1A 1F4XL 5IQ7H 5H94A 1ULVA 5DEGB 1IQDA 2AKRB 3MV9B 3HR5A 1RUMH 4LVHC 5ERWB 3QFDB 5CSZB 5GZNC 3H9YA 4XHJC 1IKFL 2IH1B 4W68A 4L8CB 1I1AB 2PW2B 2VISA 4J3VA 4OT1L 3UPRB 3ZDXF 3HZVA 1TVBB 2RBLA 3ROOB 4FTVB 2I07A 3FO2B 2UUDH 1ZGLM 3QDAA 2VXSH 2X4UA 2FX9L 4ZQKB 3MJ9A 4PYGA 2EC9U 5IW6B 1UM5L 5E1HB 3QIWB 2OTUA 5CEZL 4LVOB 4N0UE 3LKRA 4Y5XA 2VZ1A 5SWSE 4OIAA 5JUEL 5LBSH 4YDJB 2WP3O 2VLRE 4J3XA 4J4PA 1G7HA 3OKKB 5A43C 1A6VL 3CK0L 1UC6A 4UZGA 4I18C 3H9ZA 4IHOB 3D2UA 2EIZB 4FXGA 2N56A 5DK2A 1Q1JL 5L8LB 2P5WD 3HAEG 1A64A 3CU7A 1XGQA 2QADC 4OBSA 3NACL 5FGCB 4OTXH 4PY7B 3WS6C