3TBVA

Crystal structure of the murine class i major histocompatibility complex h-2db in complex with the lcmv-derived gp33 altered peptide ligand (a2g,v3p,y4a)
Total Genus 67
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
67
sequence length
276
structure length
276
Chain Sequence
GPHSMRYFETAVSRPGLEEPRYISVGYVDNKEFVRFDSDAENPRYEPRAPWMEQEGPEYWERETQKAKGQEQWFRVSLRNLLGYYNQSAGGSHTLQQMSGCDLGSDWRLLRGYLQFAYEGRDYIALNEDLKTWTAADMAAQITRRKWEQSGAAEHYKAYLEGECVEWLHRYLKNGNATLLRTDSPKAHVTHHPRSKGEVTLRCWALGFYPADITLTWQLNGEELTQDMELVETRPAGDGTFQKWASVVVPLGKEQNYTCRVYHEGLPEPLTLRWEP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system/agonist
molecule keywords H-2 class I histocompatibility antigen, D-B alpha chain
publication title Conversion of a T cell viral antagonist into an agonist through higher stabilization and conserved molecular mimicry: Implications for TCR recognition
rcsb
source organism Mus musculus
total genus 67
structure length 276
sequence length 276
chains with identical sequence C, E, G
ec nomenclature
pdb deposition date 2011-08-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00129 MHC_I Class I Histocompatibility antigen, domains alpha 1 and 2
A PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3tbvA02
3.30.500.10 Alpha Beta 2-Layer Sandwich Murine Class I Major Histocompatibility Complex, H2-DB; Chain A, domain 1 MHC class I-like antigen recognition-like 3tbvA01
3SEPA 4BZ2L 4LSRL 3WN5C 2BC4A 1WJ3A 3GSXB 3K74B 4HDIB 4WI8A 4N5EC 1FVEB 2H32A 2WMPA 5TE7L 1ZHLA 3EDEA 3MJ9L 4ODSL 1NLBH 3ROLB 5EPMB 4HLJA 5TPWH 1T0NA 5F97E 1MCKA 1DEEB 1WAAE 3P4LA 3L9RB 1VFMA 4XNZB 5DD0L 1U8QB 2W9DH 5F3HB 5HPMA 4MDJA 4ZTOL 2VDRH 1T04A 5EOTA 4M61B 2F53A 4YH6A 4ZAKA 4EZMA 3QIBC 4W4OC 3B5HA 4RGOH 2VUOA 3VA2C 4GSDH 4I3SL 1OVZA 4NYLA 5D1ZB 4CU8A 4KDWA 4R97C 2MPAH 4G8EB 1Y18A 4WUUB 4X5XB 2YPLB 3H9HA 1J0IA 3KPOA 1A9EA 3L95A 1CFSB 1MCPL 2NXYD 3DX9A 3ZE1E 4F2MA 4HC1H 2XPGA 5J11B 4PJEB 5JXEC 3W11C 4YHNB 5DMGD 1RK0B 4FQLH 5C09E 1NC4B 4XTRC 4AIZA 4LKCA 3MRBA 5GIRA 5E7BA 3TJEL 1KXQE 1D9KD 2DLHA 4RFOH 4HLZG 3QNYB 3V4VH 4TPRL 1T03L 5F7MC 3IAPA 1V3JA 3C5SB 1JGDB 4ZFOB 5E9DA 4Z8FH 4WGWB 2FSEB 4U6YB 5I8EA 5KVFL 4KJYB 1R0AH 1FG9C 4J1UA 3VFVB 1WFUA 3D85D 2NY6D 3VA6A 2MOVA 3D69A 2DM3A 5I17A 4E0RA 3MTRA 2EO1A 5D7LA 4PRNB 3ZL4H 3MRJB 2OK0L 2ZCHL 5T1KD 3OF6D 2YRPA 2FEEI 1MH5B 4C83B 3MROA 4R4BA 5DMIH 4HWZA 4JO3L 4F58H 3FOMB 4BUHA 5E0QA 3QRGL 5C9KA 5GS1B 1BD2A 5T5NG 2NY5C 2PYFB 4JCMA 3T77B 1XGRA 1MUJA 3BEVB 2AK1H 5DK3A 4I0PD 3S5LG 3U9PL 4NQED 5D1XB 3SDXB 1CK0H 5ICZB 3FB5B 1H5BC 4NC2B 4WW2A 4PP1D 3O41A 5D7IE 3U2SA 1A6ZB 1HH6A 3LHPH 5FYLD 1UM6L 3H3KA 3GSXA 4HDIA 1UWEH 2ADIB 3TZVD 4OFYA 4HXBH 1UM5H 3QQNA 3ROLA 3QEGL 3SE3A 3MBEC 3EUUA 3SE9H 4MVBA 5CP3A 2VNCA 1U8QA 4GRLC 5GHWH 3E3QA 5F3HA 5HHQB 4JFOB 2EYTB 4Z5RB 5EOQL 1C7TA 4M61A 4NC0B 4GG6E 1OAKL 2FLRT 2VWEC 3DGGA 2OTUA 1NCUA 1YNKH 5JHLL 4KPHL 5D1ZA 4HD9A 4PLJC 4ODWB 1YEIL 4G8EA 4X5XA 9CGTA 1AFVL 2B8OT 4UILL 1CFSA 4B7IA 4G6FB 4PJEA 3NFSH 4PGDA 4X4MA 4YHNA 1RK0A 4J2XA 1WZMA 1L8JA 1QP1A 1NC4A 5C09D 3LEVH 3QNZB 1HXMB 4N0CD 2V2TA 3B9KB 1TQCB 3R1GH 3DV4B 1MIEL 4M4PA 5DMKA 4WEBL 5F1NB 4OCWH 1H8NA 2E7MA 2Z9TA 3QNYA 3MJ8B 5GGVY 4S1QL 4I77L 4I2XA 3U0PB 2K7QA 2OL3B 3C5SA 4NZUL 3ZKND 4ZFOA 1K8DB 2FSEA 4U6YA 4FG6C 3VD3A 4MNGE 3ILQC 4JG0H 5B3NA 5IMLB 1RZIB 1AGEA 2HMID 4OLYL 2VLJE 5IHZB 4BH8B 3W39B 2X4QA 4Y5YB 3BRFA 4FZEH 1NANH 5E70A 4PRNA 1P5VA 43C9A 2OXGA 2BNRE 3O3DB 1NAMH 4C83A 1MH5A 1EEQA 3FOMA 1N3NB 1VFBB 2OM5A 3SQBA 1FL6A 4R7DA 3G08A 5K9OB 4S0SD 3RY4A 4BUGA 5F44A 5FOJA 2PYFA 1HHJA 2DJUA 3BH9A 5ESAB 3T77A 1R3JB 1CT8B 2Z0BA 1UJ3A 4P4RB 1PD6A 3TPUE 2C1OA 5D1XA 3IAGC 4KJPC 4H8WL 2Q6WA 3REWA 1ZA3A 1G1CA 4XMPH 2V17H 1U58B 2L0DA 3G5VA 3QDGB 5D7JA 2V6HA 1DVFA 4R2GB 3P0GB 1P7KB 2MCG1 5CSZB 4N8CH 1HHHB 1MF2H 1JUFA 1B4RA 2WLYA 3MLPA 5E94A 1R3HA 5CEXA 1JGEB 3FZUC 5KVEL 3OJVC 2DLEA 4GKNB 4PJ8B 3IB4A 3QHFH 4JQVC 2NQCA 1OTSD 2F53E 4QTHA 4R96B 5HHQA 4Z5RA 4G8IB 1LK3L 1INEL 4L3EB 3JV4B 4EIZC 4KI5C 3KLSA 4JPKH 4NN5B 5EIIB 5JDSB 4HS8H 2WP3T 5JORB 4ODWA 4YAQB 5CJXC 4NM4H 5J56B 2O5YL 2YD4A 4OZHB 1T2JA 4TNWF 2XRAL 4RMWA 1RULL 4AIOA 3WDJA 2BVQA 2DYPD 1W72H 4U1SB 3L1OL 3QNZA 3PP3K 4CVZB 4BKLA 4M6ML 1SY6L 4R6UA 3DV4A 3OR6A 3EDFA 2XTLA 1JFQL 3T8XB 5F1NA 3N1MC 5E8DH 1U95B 3BH8B 5I76B 3C8KA 1EA9C 3JZ7A 5E2WL 4DGIH 3U0PA 2IAMD 5E9DE 2E6PA 2YZ8A 1JTOA 3ULUF 4Y1AB 2AERT 4D0CB 4HBCH 4LLAA 5TQ0L 5HDQL 5HPOA 2DRUA 3QDMA 4FFVC 3TESA 1RZIA 4L4VB 3VRLF 3WN5B 1I8IB 1TCMA 5D7LE 4QHMB 4JDZA 4Y5YA 2ORBH 5IB2A 4RMSA 2AV7B 2R8SL 4PJ5A 2MMXA 3QFDB 3F5WB 1N3NA 1VFBA 1BD2E 2J7LA 4TOYH 4J8RB 4PV9B 1ACZA 3O8XA 5DJ0B 3BUYA 3WLWC 4GBXD 3ZO0A 4EN3D 3S34H 4Q9QH 1R3JA 2XA3A 1TVDA 3GSRA 3QIWB 5F9JB 1MFAL 3QIBB 3EIFA 1NDMA 4XCCL 3AY4A 4N1CA 1I3GH 2E9BA 1U58A 4KHTH 2XOTA 4RRPA 4K7FB 5C07B 1YY9C 4BZ1L 5IG7B 4RGMC 2UY6A 1HHHA 4X6EB 4YE4L 3RWGB 1CDGA 1FPTL 1MCRA 5JQ6L 3R8QA 1CFVL 3BQUB 2OQJA 2OMNA 3CK0H 1PDKA 1NGXB 1JMXA 3E3QE 4GKNA 2J6EA 1GC1L 4V3DB 4R96A 5IEHB 2HFGL 4OZGB 3TCLB 2F53D 2QADD 3RDTA 4ZAKD 3STZA 4Y2DB 3P9LA 4G8IA 4OLXL 1KN2L 4U7KA 5CD3A 4L3EA 2P8LB 3V4UH 1I7UA 5EIIA 5JDSA 1T1XB 4WUUE 2YPLE 2WANA 3TF7A 1INDL 1YECL 1FNLA 4YAQA 4PJEE 2HKHH 4HJJL 4OZHA 1CN4A 1H3VA 1BJ1H 1LNUB 4YHKL 1MAML 4FQIH 4U1SA 5C0RL 1S9WB 2VR5A 4CVZA 4BQBA 3WXWH 5T1DH 2C4FU 3WJJC 5J12C 4FHBD 2DQTH 2WBWB 1CBVH 1U95A 4XHQA 3HZYB 1I85C 3QXWA 2AVGA 3D5OF 3RZCC 3T3ME 3B5TA 4NGHL 3D87B 3UTTA 2APTA 5E9DD 4HJ0D 5HYJB 1RFDL 4P9ML 2JELH 1IGCH 5F7HA 4JPWL 4Y1AA 4M6OL 2BOBB 2EDOA 4D0CA 2XQBH 4LP5A 3CFEB 2MWCA 1H5BB 5F7FA 1X5HA 3PQYB 4KRPC 4AEHH 1HEZB 3GJFH 4PLKC 4L4VA 5EZIL 5C6PB 2NY7L 3J8F7 2DQGL 1AQDB 4PTUB 5H2BA 1I8IA 2FX8H 2VQ1A 3WN5A 3V0VB 4QHMA 2WBJC 1M7DB 5D7LD 1NCCH 4N5EA 5EUOF 2AV7A 2XTJC 2XN9B 3CAFA 3BKML 1P1ZA 2X4NB 4MZ3A 4PRHB 3MBEB 3SKOB 3MUJA 3HB3C 3F5WA 3QFDA 5MP6L 3GHEH 2LAGB 2FLBT 1BD2D 2HG5B 1DP0A 2VXQL 2O5XH 5DSCB 3ZT5A 4P57A 2AW2A 5E2UL 4PGJA 3QQ4B 5D2LF 2UVEA 3LRGA 5D5MF 3SDXE 5CCKL 3QIBA 4W4OA 1IGJB 4L3CB 1LQSR 1BGXH 2Q1EA 4EUPB 4DTGL 3THML 3VE0A 3EGSA 4YDLC 4WENB 2GK0B 3CSBA 1KTLA 4R4FL 3HAEB 4K7FA 4KUZL 4HWEL 5IG7A 3HMXL 2VRAA 1DBMH 4X6EA 4OFYD 5JXEA 3BP4A 4U1JA 1EXUB 4XVJL 4LSDA 2G75B 1W2KT 4MVBD 3EYQC 1NGXA 3GSQB 1Q72H 2SEBB 5C0JB 4M5ZH 4NQSB 5IEHA 5T33L 4OZGA 5AD0B 1BBDH 1XH3A 2DBJA 3BXNB 3FO1B 3J7HA 5J6HA 3D48R 4DAGL 4RSVA 5K59F 3FAWA 4HEPG 4PUBH 4G8GA 3K2UH 1ED3A 1HNGA 5F7DA 1PY9A 1EMTH 2P8LA 3NIDF 5D1ZD 1F13A 1T1XA 4MCYB 1ND0A 2JCCF 1Z9MA 3MRFA 3GIVB 3QEQB 1MCHA 1F58H 1LNUA 2NZ9C 1NC4D 3C8HA 2QHLA 1S9WA 1J1XH 3U36B 4HCRA 5KN5B 2QSVA 3KGRA 3KPLB 4EOWH 5LGJB 4KKBD 3CU7A 4LSSH 1W8OA 5FYJH 3ZTJG 1VEPA 1KCRH 4NDMA 1QBLL 1RZFL 3HI6L 3QHTC 5HYJA 5JOFA 1QO3B 3P4OA 2FGWH 2NCMA 2BOBA 1MCJA 3AM8C 1UB6B 1H5BA 5FEBA 1RPQA 1RUAL 2CDEA 3UYRH 3PQYA 1CR9H 4UB0L 1H3PL 2DTSA 4C4KT 3BGAA 2D7TL 4WGVB 1SY6A 1HH9B 3V0VA 1H15B 1KCGC 4PJ5E 1UWXK 5FHBL 3RWCB 3LMJL 1TZGH 3O3AB 4PRHA 3MBEA 5F3BB 3VDBA 5C0IB 3QO0B 1MLCB 2HG5A 3Q6GL 3VWKC 4GRLA 1YJDH 4XMLH 1B4JH 3QQ4A 2YD1A 1A6AA 2JB5L 5D1XD 1I7TB 2CLRB 1P69B 3IJHA 4EUPA 3MGOB 3TNNB 5D7JD 2AEIT 1DVFD 3HAEA 4MAYC 1JE6A 1AGCA 4LDOB 4OCXH 3WYRA 5CEZH 5F70A 2DWEA 3EYOB 1LHZA 2YK1H 2HFFB 5C92A 5A16B 3UAJD 1NLBL 4XNQA 1VFOA 4HH9A 4QGYA 4PJAF 3GSQA 4RRPG 5C0JA 1NMBH 2W9DL 4JAMB 5GSRB 2VDRL 1B0GB 3KXFB 3BXNA 1X44A 3FO1A 4MSWB 4L3EE 4RGOL 2EXWC 4GSDL 3U83A 5EU7C 1A9BA 1TTFA 3OAUH 4GW5A 2AP2A 4YHML 2OTWB 4OZHE 1ZLVK 1K3ZA 4G6FD 5AYUH 2HT2D 2Q86B 3MXWH 2FJHB 3OJMB 1RZGB 2VAAB 4FQLL 1JWUA 3QPQD 4YDIH 4I0CC 1LDSA 2FECL 2AAVA 1CCZA 1S7RA 1PSKH 3REVB 1QYGH 4N8VB 3KPLA 4HPYH 1WFNA 4RFOL 4M9OA 2JJUA 2OSLB 4PJIA 4ODTH 3UTTE 2VDQH 1GVIA 1IKNA 3TJHC 1FG2B 4RISH 4Y1AE 5D71L 1JPSH 1QACA 1QO3A 1QVOB 1R0AL 1G7QB 4MJIB 3QDMD 2BZDA 4L4VE 2ICEA 3BDYH 2XNAB 3Q5TA 2VZ3A 1KLFA 5IFAH 5HJ3A 1XGUA 1PEWA 3CLEH 4RGMB 1HH9A 1IMHC 3ZL4L 3LRSB 4PJ5D 2W0LA 1VGEL 4FMKA 5DHXB 4OGAC 4XWGH 2EYSA 4LGSB 4NO5B 1N8ZA 2ICWJ 5DMIL 4F58L 2AQ3A 5C0IA 1MLCA 3O8XD 1YNLH 4ALAH 4JQVA 5CSGA 2AK1L 4I3RH 2CLRA 1WSST 1CICD 5GZND 4UQ3B 3MGOA 4Y0GA 3SDAC 3TNNA 3L7FB 5AAWA 4R2GD 4XBPA 1NFIA 1S7TA 1EFXB 5CJXA 2YMXH 4Y19A 4MNHA 2AXJA 2VQTA 1UWEL 3PE9A 3I6LE 2IH3B 4HXBL 1UM5L 5I1LB 5EBGA 2GTWB 3B2UC 3SE9L 3VG0H 2V9QA 4KHXH 5IVXB 4OZGE 5GHWL 5J12B 3G5YB 3WHE0 3QJFA 3RDTD 3LAFA 3RZCB 5I75C 1OARH 5HYIA 3UBXI 2FHCA 1BMGA 4ZFFB 3P77A 4L3ED 3RVTD 5EO1B 1YNKL 4P4KC 4CMHB 4ENED 2BY3A 2VIRA 1KELH 2E6QA 4YLQT 3ZKSD 4DZ8B 2OTWA 4YIQB 4MJ5B 1CE1H 1AKJA 4XPBH 3NFSL 3BKCL 2DJSA 3QQ3B 1G7HA 3MREB 3LEVL 2WBJB 5D9SB 5HYQB 4ODHH 3UTZB 3R1GL 3X3FH 2XTJB 3ZDZF 3REVA 4N8VA 5IESL 1FNAA 2GFBB 4JVWA 4KQ3L 3RVVD 2ZUXA 4OCWL 1OM3L 4HGKC 4HSQA 1KB9K 3UTTD 4HV8B 5HYJE 4RAUB 2BFVH 3EW3B 3GMLB 1A1OA 3WNOA 5ADPH 5JXAH 3JUYA 4Y1AD 4M3JA 2IFFH 4UBDD 1EO7A 5HYSB 3PQYE 4PRPD 1ES0B 3D0VA 1MI5B 2H8PA 4YDLB 5TQ2H 1GRWA 4JG0L 4L4VD 1MCDA 2AS5M 2IC2A 4BSVA 5LWYL 5MI0C 4FZEL 5MEQB 2ATKB 4N5ED 2R2BB 4PRHE 3TP4A 3S36X 1K2DB 4OZFH 1NAML 3ZE0F 3MJGX 3PV6A 3DVNB 1Z9OA 5DK0A 5I30H 4N0UA 4EQ2A 4OIIH 1BFSA 4G9FB 3QIBD 1L6XA 2VWEE 3NCMA 4OAWB 2V17L 1D3CA 3C2AH 3EYUH 5LAXB 1U6AH 3L7FA 3KHQA 4ZXBA 3KDMB 1R3KB 1HDMB 4JHZA 4LIQL 4PJFB 3CXHJ 5JXED 3W11D 5KSBF 2IH3A 3N1GC 3I6LD 5FAAA 4XTRD 3C08H 1OAQH 4EUPG 5GQBA 3SOBH 3MJ7A 43CAB 4ZUSA 3HAEG 3WJJA 3CFBB 4GS7C 3QHFL 4JFXA 4L9DA 3G5YA 4HKZB 3FT3B 1I85A 1T5WB 3RZCA 3BPLB 1WZ1H 4ZDHA 1WTGT 1JGLH 4ZFFA 1A64A 4G8GD 3NH7L 2CD0A 1U8KB 5EO1A 3HC4H 1JHLH 4JPKL 4WU5B 1OP5K 1R24B 4HS8L 4DZ8A 3DX6A 1RIHH 2ZUVA 4NM4L 4NWTL 4MJ5A 2FH6A 4WTZA 1JNNH 5B8CC 3QQ3A 3RBSA 3OAYK 2WBJA 5HYQA 3AUVA 3B6SB 1NBVL 1A7PH 4K9EC 2WQRA 2OX5A 3LKRA 3VI3F 1EHLH 1GOFA 3NACH 3W2DH 4DGIL 3IDJB 4HV8A 2OJEB 5HYJD 3VMNA 4CJ0A 2UV3A 4JDVB 5KVGH 4HBCL 2XKSA 2A9MH 5F88B 2AEPH 1ES0A 3PQYD 4HC1A 2DM4A 5TDPB 4MAYB 5EU5B 3DUHA 3IKCB 3VRJA 5ESVB 4LQFL 2ORBL 5MEQA 1SJEB 3V52H 1QA9B 2R2BA 3OGCB 4PRHD 1K2DA 4WFHE 3MBED 1FDLL 1MY5A 3KNBB 4TOYL 2AI0H 3QI9A 3MR9B 4LSUH 5I1EH 4GRLD 3RWJB 1CXLA 4XGZA 5CAYB 5C3LD 4JM4H 3DUUA 1ZA6B 4Q9QL 3VXMA 5DVLA 4G9FA 1NGZB 1RQ5A 2HN7B 3K7UA 2AJZB 3VU2A 4KI5E 2IBZX 5IK3B 1I3GL 4JKPH 4KHTL 4PGCB 4PLJD 2LV4A 3KDMA 4Y19E 4Y4FB 4YBQC 1R3KA 1YY8B 5CILH 4KK5C 1J18A 4X7TB 3VXNB 4Z18A 3WS3B 5TFSH 4OGXH 3CK0L 1AP2B 4XHJC 5ELIA 2X4RB 43CAA 4MA7L 3HRPA 1ITBB 2VDNH 1UENA 3KXFE 2VLRB 3BGMB 3QT2A 4JY4B 3GUTB 3U1SH 4YHOH 1T5WA 1MCIA 3VMOA 4F37K 3ALWA 3QYCA 5TE6L 1U8KA 4N5UA 5BVPH 3V4UL 5DS8B 1R24A 4X9FA 3AM8A 4WHTB 5L2KB 1B0WA 3BZDA 3ILQD 2HKHL 1PKQB 5HTSA 4FQIL 1FLRH 3DARA 2N56A 1UCBH 3WXWL 2NY3C 1FFQA 5C9JB 5T1DL 4MJ2A 5E7FA 4RGNC 2DQTL 4G8FB 3MLVH 3R06B 3R8BB 8CGTA 3IDJA 3VWKA 4XCNB 4C57C 5IUSA 1HQRB 2R2EA 3GSNB 5HHXH 2JELL 1B90A 1IGCL 2F8OA 1CDIA 1LD9A 4NNXB 3AXLA 2MCPH 3L5JA 4BQCA 1N4XL 2XQBL 4KJPD 1UYWH 3IXTB 4N8VG 1XF5B 1YYLL 2W59A 1I9JH 2OS7A 4AEHL 3BP5B 3SDAB 3DNKA 1W72B 4MAYA 1WBYB 3FQNB 4S1SH 5FGSA 5LKNA 1KPUB 5T5NF 2FX8L 5ESVA 1WWAX 5DD1H 4G7VH 1SJEA 1G0DA 1SMAA 1NKRA 3JV6B 1IAOB 2QJDA 2X70B 5DYOA 1ZLUH 3T0VA 4WFHD 3FZUD 3GHEL 3KNBA 3H42L 5CBAA 3QRFM 2WINA 3MR9A 5J8OA 4N0UE 2O5XL 3A0OA 3RWJA 3VH8B 5EOCH 4YNYA 5D2NA 4DVRL 4URTB 4U1NB 2N4IA 4ZMAT 3WUWB 1ZWIB 2CRYA 2PYEA 5SV3A 3S37L 4POZC 1BGXL 4YHPA 4IEFB 1OGTA 4KI5D 4P4KB 1DZBA 3GRWH 1VB9A 4OV6F 3ZYZA 3SKNA 1YY8A 4Y19D 1OPGH 4QRPB 1J87A 3CU1A 2LU7A 1U91B 4X7TA 3VXNA 1NAMA 1BIHA 5C0NC 3N06B 3W82A 3MLWL 2BCKA 3G9AB 1Q72L 2X4RA 4EXPX 1MWAH 1QFWI 2XWBB 4M5ZL 5EBLA 1IEHA 1XCTB 2VLRA 1BBDL 3BGMA 4AEEA 4KTYA 2WIMA 3IETB 3L5XH 3VFPB 5ADOH 4BQ9A 1KC5H 3U7WH 1TVBB 1QPPA 2Y06H 4PUBL 5A43C 3TJHA 2ENYA 3G5ZB 1Q0XH 4DJMA 5DS8A 2DMKA 3KPNB 3SDDC 2YHGA 1IAII 1JZ8A 2FYYB 3GJEB 2QV2A 3PL6B 4FFVD 4C54A 4MD4B 1AKJD 5FK9B 2X09A 3D0LB 3N50A 2YEZA 1PKQA 1F58L 1SBSH 5IVOA 4WO4B 2XTJE 5GRVK 4QRQA 5EBMB 1J10A 2ZUUA 4EOWL 1E6JH 3M1BA 4LSSL 2R4SH 4U1GB 3U4BH 1TJGH 4O51A 3BI9X 4QWWC 5FYJL 1KCRL 3D3VB 4WTZG 3WLWD 2NXZC 4XCNA 4XRCA 1EH9A 2FO4B 2FGWL 4NNXA 4HWNA 3VJ6B 4AY0A 3T65B 1MI5E 4MD5B 3N85L 1FGVH 3IXTA 3BYTA 5EU6B 1XF5A 3UYRL 4DEPB 5A2KH 1CR9L 4O2EA 3SDAA 4HULB 4JDTH 1YY9D 1W72A 4HKBB 1I7RB 3G6AB 1C1EH 4A6YH 1WBYA 3FQNA 1ZHKB 1KPUA 2X9WA 4LFHG 1L7TH 1JHTA 1QFUL 1PX3A 3JV6A 3AU1A 4LPVA 5HYSG 1RJYA 3MMEB 1DBBH 3WNNA 1KENL 2QHRH 2D2OA 3C8DA 4GS7B 3VXME 1YJDL 4XMLL 1C5BL 1B4JL 1ZK9A 4G9FE 3VMPA 1LEGB 5IVZB 3OB0K 3WUWA 1UACH 3GJFB 3V7AE 4F7TB 4P4KA 2ZSWA 5DLMH 4Z7WB 2EEDA 4ZXBD 4XPHH 1UA6H 5CIPB 3MLYH 5GRJH 3MRIB 4OCXL 1ADQL 1UXWB 5CEZL 2YK1L 1CZ8L 4QRPA 4DFHA 3QCUH 1DLFH 1U91A 1C5CH 1XGTB 2YA2A 2H6PB 3QUMH 3ZT7A 1P4LA 5DURD 5IMKB 3V7AG 3IRPX 3SKJH 2HVKA 2XWBA 1NMBL 4QRSB 3Q2CA 2DDQL 1AGFB 4KDVA 1XCTA 3RZCD 4X80H 3IETA 3VFPA 3BPCB 2BXYA 3ULVL 4S11A 5T5FH 4NBZB 3KLAB 3KPNA 2LTQC 4IHOB 2PO6A 4X98A 3MRHB 4KRPD 5ACZB 3GJEA 1S8DB 1ZLSH 5AYUL 4FQHB 2EIEA 4ELMB 3MXWL 3UJTH 4DN4L 1LQVA 3D0LA 5EIVA 3VFMB 4RIRA 1NEZA 2RFXB 2GSGA 2WBJD 3FQWB 2XTJD 1N7MH 1PSKL 5EBMA 1M7IA 4HPYL 3HB3D 3K0WA 1ZE3C 4ZNCD 1RD6A 4QCIB 2HA1A 1QD0A 2BSTB 3D3VA 5C7XH 2VDQL 4KGLA 3LKPB 5DRNA 1DQML 1JL8A 3K8KA 3RI5K 5T1MB 4EQ3A 3VJ6A 4PREB 1XIWC 2E6JA 3T65A 4UQ2A 4NQVA 3DURB 4KKCC 3KPQA 3QPXH 3BDYL 1AC6A 4HKBA 1I7RA 3G6AA 3HCVA 1CFTB 1ZHKA 4NN7B 2QR0B 5IW3A 1N26A 3HFMH 3VD7A 3UPCA 3M17B 4XWGL 1CLYH 1GGUA 1LO2H 3K4ZA 3QDAA 3EYQD 3FCTB 5DGQA 3QI9D 3P40A 4X7EC 2A9NH 1E0OB 1YNLL 2CIIB 4ALAL 3PP4L 3VXMD 1D5XB 4G9FD 2PYEE 1MREH 1LEGA 5F6HJ 4FMFA 4LASH 5DEFB 2IAND 5EB9A 1TCRB 5JO5B 3GJFA 3WFZA 3GK8H 5EU7E 4F7TA 1FZMA 1H8SA 3BW9A 1JF6A 4WI5A 4WW2F 3UO1H 1FNHA 1QLRB 3MRIA 1UXWA 3TWCH 2HFEB 2YMXL 1KEMH 5CSBA 5EIQA 2NZ9D 5B8CA 2HLAA 3BP6A 1PX4A 1ULVA 1T0PB 4KQ4L 1EHAA 1FGNH 3PWPB 3OBAA 1TZHB 1EUUA 2UZIH 3PWJB 4L4TB 3BT2H 2NY3B 5IMKA 1NCNA 2R56H 5F1IB 2D3VA 4KHXL 4F33B 1T4KA 2VLRE 4R0LC 1AGFA 3V6ZA 2DL9A 5DJ8B 3NN8B 1OARL 2ED7A 2B4CC 3BPCA 3E6HB 4FZ8H 1DANU 1D6EB 4WWKB 1JFMA 3TYFB 1KELL 4OZIA 2PNDA 3BDBA 5GRYA 3WS6C 1S8DA 1YEGH 1PKQE 3ABZA 2OBGA 4ELMA 5T3XE 35C8L 1MJ8H 3NPSC 5HVHC 2GHWB 4PJEF 4X8JA 1IGFH 1FAIH 1JYNA 3OKMB 3V9FA 3X3FL 2FX7H 4TRPH 1UKTA 1GJIA 3QP3A 5CWSB 5JIKA 3SKUD 4JY6B 3VWKD 2BSTA 2A6KB 1CFNB 4YHZH 2BFVL 5JXAL 4ZO6A 3P30H 5ADPL 1NCBL 1KCLA 1H3UA 3T3MF 1JWSB 3EOBA 5T1MA 2IFFL 2KQNA 4HZAA 1YC7A 1U8IA 4NOFA 5GGRB 1ZVSB 4H0IA 2ITCB 5IROA 3VXSB 5TQ2L 4MAYD 4MD0A 1FFPB 1NEUA 4JM2C 3GMMB 5HVFB 4WCYH 1HI6B 1CFTA 2DOCA 2HH0H 3FB8B 3TCXA 3LPWA 3OPZH 1UGNA 5I2IB 4U1HA 2Y07H 5FCSH 3LY6A 5ESQB 4HFWB 2VXTH 4CN4A 3JWDH 2H2SD 4GRWF 5I30L 5FCUL 1D5XA 4QRUB 2BY0A 3SGDI 1XF4B 2BHYA 2PYED 32C2B 4YFDB 2FRGP 4M1DL 5DEFA 1SYSB 1NKOA 1TCRA 2EXWD 1S7WA 3C2AL 4L8BA 3EYUL 1U6AL 3HC3H 3WKNA 3SDDB 2PTUA 4QRPE 3EDDA 1WBZB 5JW4M 2HFEA 1X5LA 3O2WH 5ENWA 4JKKA 4XAKD 3WUWG 3AREB 3C08L 1OAQL 4EXKA 3C5ZC 4NUGH 2GJZB 3SOBL 3MCG1 3NAAH 1DUYB 3LZFH 4L4TA 1F6AB 3QWRD 5JIPA 2VLRD 1CDYA 2P48B 5DJ8A 1AQKH 3OKNB 5IHLB 5SX5K 4MX7B 3WD5L 1EJOH 1WZ1L 2NXZB 3HE6B 1HHIA 3GFUA 4KROB 3HC4L 1JHLL 3TYFA 1FBIH 5L88H 4LHJB 2XG5A 1MLBB 3G6DL 2X4UA 1EEYB 1JNNL 1TPXC 2C5DC 2ICCA 2P5EA 4F7MB 2Y6SC 4QXGH 3OKMA 3BIBX 4OGAD 1A7PL 1PZUB 1AD0A 1LO0H 1DL7H 1NCAH 1UH3A 2A6JA 3BZFB 2FHFA 3D3VE 5CWSA 3U4EB 4OCSH 1FCCA 1Y6KR 3NACL 4JY6A 3W2DL 3VCLB 5J3HC 8FABB 3DROB 1A14H 5KVGL 2YPVH 1G7IA 2A9ML 4JQIH 2HT3C 2AEPL 3G9VA 4LRIC 4CMMB 1RJZA 1ZVSA 2ITCA 3SDAD 3VXSA 3TBVB 5DJAA 1HK6A 1FFPA 2QSCH 3GMMA 1QFHA 1CDCA 2DI7A 1HI6A 2EDTA 4X5WB 4JZJA 3FB8A 3H2WA 4F57L 3V52L 1JZ6A 5I2IA 2A6DB 4NCDA 5DWUH 3WBDA 3B2UD 12E8H 5ESQA 4HFWA 2VR4A 3B4NA 3VGEA 4HAGA 2AI0L 4LSUL 4ISVA 2ZG2A 5GS2H 5I1EL 5JHDA 1F45A 2VZVA 5HHPB 4LBEA 5IHUH 3DX8A 1AIFA 3FN3A 4NZRH 4QRUA 5AZ2H 4K7PH 4FFEX 1XF4A 3LKOB 1R5WA 32C2A 4M7KH 5I1JH 1SYSA 1YC8A 4P4KD 4FNLH 4JKPL 3T04D 3GGWB 5IBTL 4I5BB 3EKCA 2LTQB 3SDDA 4Y5VC 2F8XC 1WBZA 5CILL 1BLNB 3DGCR 2VDOH 1HWHB 1I8MB 3QIUC 4TUJB 4K2UH 4G6MH 1I3RA 5TFSL 2X1OA 4OGXL 4KK9D 4Y4HC 5IHBA 1S5IH 2DQUH 4EI5C 2VDNL 4ZO7A 5DHYB 4F3FB 3AGVA 1EHXA 3U1SL 4YQXH 4YHOL 5D7SH 1VHPA 1FNEB 2NZIA 4XCFH 1YUHB 3MCKB 3T4YB 3RKPA 5BVPL 1I9RH 5K9JH 2PO6D 4KI1A 3SGKA 1CWVA 4BYHA 4ELME 1MLBA 6CGTA 1AC0A 4YPGB 3NCEB 4CU7A 1EEYA 2J12B 3UJJH 1T3FB 5FDWA 5MEPB 4LCWA 3F65A 4QF1B 1OP9A 5I8OH 5I66B 5GRUH 2CK0L 5I74C 1UCBL 1K4CA 3CDCA 3T3PE 2EE6A 3MLVL 3Q1SH 4Y5XC 2DLFH 3D3VD 4OM0H 3V5KA 4IMKC 4OT1L 3MRRB 3KYOB 1T2QH 5JA8B 2YN5A 15C8H 4XBGB 1NGPH 3KYAA 5AZEH 5MEOB 5FYKU 3U9UA 2MCPL 3E6FB 3G5XA 1A3RL 1UYWL 4MAUH 1XF2B 2D0HA 3MRKB 5MHSE 1MQKH 1I9JL 4PJDB 4S1SL 3CDYA 1B9ZA 4G7VL 1J11A 4JGUA 3T2NH 5TDNB 3LQAC 2J88H 2A6DA 2ZNXA 5F9OH 4RMVA 3O2DH 4YBHA 3TIEB 1LP9A 2APXA 4RA0C 4JKLA 4R0LB 3QXDB 5EOCL 2QSQA 3MV8A 3HNTH 4OCMC 5GGTH 3SDCC 5ITFA 4PJ7B 3LKOA 1F4WH 3TN0C 3V7MA 1FZJB 1KPRB 5C8JA 3UTSB 4LLMA 2P46B 1EBPA 3GRWL 2JIXD 4NM8H 3U4AA 1F4AA 4QOKA 2H45A 4J3TA 5DQ9A 5DUBA 3GBNH 1BLNA 2EKSB 1OPGL 1QSFB 1I8MA 3OKEA 5KAQG 4YXLH 3NPSB 2EKJA 2AABL 3PWPE 4QNPE 3L3KA 4P5TD 4OQTH 4L4TE 1OWWA 2BXZA 4RGNE 2RIKA 1MWAL 1ZS8A 3F7YB 2Z92B 1A7QH 4F3FA 3O3UN 1DR9A 1HHGB 2DF3A 1DDHB 5CEYA 4Y89A 2R15A 1A4JB 4OZGF 4BSWA 5ADOL 4HQQH 1FNEA 3U7WL 3MCKA 1JJUA 3T4YA 4HJGB 4HLZH 1ZHBA 2PR4H 1SJHA 5EG6C 5CEZE 1Q0XL 2AEQH 3RVXC 3EOTL 1XIWA 3ARDD 3BRDA 1NFDB 5E2VL 2PW1B 4IOIA 3WL9B 3E8UL 1IGIH 2NPLX 4PG2C 4CAGA 4WUKH 5LGHL 1T3FA 4JFZH 4JM2B 5D93B 2P5EE 5MEPA 1I8KA 4QF1A 3BSZH 1SBSL 1H3TA 5I66A 4NJ9H 3KPRA 3CC5B 1XGPA 2W0KA 2W91A 5IT2H 3JTTB 1MCCA 3QH3A 3JUZA 3QWQB 4K07A 1E6JL 1J05B 1JZ4A 2DQHH 1ZSDA 2R4SL 2VDKH 1TJGL 4G43A 3GM8A 1UT9A 1GGCH 1YEFL 1N64H 2I25N 3KYOA 3MO1B 3VGBA 2HVJA 3GMQB 2WLZA 3IDGA 4XBGA 3WSQH 3VXSE 4MNQB 5FUOH 2V5RA 1KG0B 4JDTL 2ADJB 2R0LH 4A6YL 1C1EL 4PJDA 2DQFB 4YBQD 3MRLB 1MHCB 4KK5D 3SKMB 5CLWA 4I1NB 2ZOLB 1A7BA 1L7TL 5J4MA 4OB5H 3HPLB 4YFLI 4NUJA 1U8PB 5FYJD 3C5ZB 1NGYA 1DBBL 1ZT4A 2M26A 5JHDE 3ECBB 1EO8H 2QHRL 4D94A 1DQDH 1UKSA 3I02B 4GQ9H 2AJUH 1ZT7B 3DRQB 4RFNB 1FAKT 1UACL 1KPRA 4HEME 1OOAA 5DLML 3UTSA 3HNVL 1CGYA 3CX2A 5F93C 5IW6A 1S7UB 5CP7A 4XPHL 1UA6L 3MLYL 5GRJL 5DRWB 1XEDA 3WS6A 2EKSA 2EIZB 3QCUL 1DN2A 1DLFL 2HTKC 5I1IL 5FM5M 5HDOA 4LCYA 1Q0YH 4IRZL 3QUML 3DXAB 5E03A 3TA3C 4L4TD 4PJBB 4RGND 3SKJL 1NLDH 2NNAB 3F7YA 5HI4C 2OJZH 3Q3GB 5H94B 5T3ZH 1D5IH 4X0KA 1HHGA 4X80L 3PDDA 1FVDA 3MODH 1A4JA 2J5LC 4Z7QE 1IVLA 5T5FL 1WFOA 4M02A 1LO4H 5CEZD 2ATPB 1L7IH 2DLTA 4CRPA 3LRHA 2VXUH 3SDYH 1D5MA 2KKQA 5BV7B 4LCWE 1AGBB 1ZLSL 4P2OB 1FFRA 5IOPA 5E8NA 2DJ4A 1ZLVH 1AXSB 2P5ED 1GHFH 2XY1A 1I1YB 1IARB 3PWLB 3CC5A 3JWDC 1N7ML 3EHBD 4P2QB 5HDLA 4LSTL 3RX7A 4PJIF 5C7XL 3QZWB 4L5FH 2DLGA 3MO1A 2Z8WC 2Y25A 3GMQA 3BWAB 2Y5TB 1DQJB 4XB7A 1YA5A 2VSDA 4MNQA 3VXSD 4UZGA 1RHHB 2CDFB 2ADJA 3GSUB 4Y5VB 2DQFA 3MRLA 3DYPA 4OF3A 2HKFH 1CFQB 4JO1L 3QIUB 5C0ND 1KIQA 3HFML 2BVUA 3LEXA 3HPLA 1CLYL 1U8PA 1LO3H 2R1YA 5IFHH 1C12B 3C9NB 4Y4HB 1LO2L 4TVSa 3BJLA 2QTEA 4G9DB 5EBWB 2VZTA 2A9NL 3ECBA 5JHDD 4KV5F 4EI5B 3GKZA 3HMWH 3MV8E 4JFPB 1MREL 4G6JH 1WCBB 4POYA 4LASL 1FO0H 3GK8L 4HUXA 3B9DA 4QOKE 2GEEA 3SDDD 1V3KA 2H32H 4KI5F 3UO1L 1FNGB 2ENSA 2DKMA 1YZZA 3TWCL 1KEML 3ZTNH 4LSPH 2CGRH 4JFDB 5K33A 1G7LB 2X4SB 3DXAA 5IBUB 1TVHB 1FGNL 1OWRM 5I74B 1CGXA 3HTLX 2UZIL 4AMKH 1Z0MA 4LCIH 4E42B 5SWQA 3T2QA 2R56L 1GPOH 3RGVB 2NNAA 2NY1D 4Y5XB 1RK1B 3Q3GA 5EA0L 5H94A 2YN3A 5E99H 3RUGA 2NXZD 1NQBA 5BZWB 2E27H 3VFGH 1Q8MA 3PWNB 3GRWA 4FZ8L 4JR9H 1ZHNA 3EOYG 4XZUB 1G6RH 5FYKH 1G7JA 3S3PA 3CSYB 2ATPA 2VMFA 1HSAA 3PABB 5FECB 4NKIL 4LRIA 4Y88A 1AGBA 2UWEB 2ZG3A 1KIRB 4LCWD 1QHPA 2XZZA 6FABL 3KPRE 1IGFL 4MXWH 1FAIL 2QQLH 3PWLA 3MRDA 4E5XA 3MUY1 2FX7L 1KLGB 4P2QA 2GT9A 3M45A 4TRPL 3GHBL 5TE4H 1N59B 3GSVB 5D6DA 4XI5C 2D0GA 3JVGC 4YHZL 5SV4A 1SEBB 2E8YA 1F8TH 4PYHA 5EUKB 3Q48A 4GRMB 3BWAA 3HR5B 4HXAH 3SDCB 4XP6L 1UC6A 1T66C 3TN0B 4HUKB 1NDGB 1LMKA 4PJDE 1RHHA 4J3UA 1MSPA 3PV7A 4WCYL 5C6TL 5CJOL 4Y5VA 1CI5A 1G0XA 3L3JA 2Q87A 1IM3B 1QR4A 3ARXA 3QIUA 3QUYC 4OF5A 3VFSB 1WZLA 4MB4A 2ZJSH 1TZIB 2Y07L 3NCYS 3C9NA 4Y4HA 5EBWA 3GJFK 2CPCA 3JWDL 1NC2B 3W9EB 4EI5A 4JFPA 3MV8D 4PJ7E 1G9EA 1WCBA 4F7CB 3UTSE 2GITB 3M07A 1SBBA 4A6YA 4HIJB 4D9LL 2X89A 1BVKA 3HC3L 5E6ID 4QOKD 1FNGA 3N1QC 1S9KC 1CDUA 4AIXA 3QAZC 5EH1A 3BIKB 2PXYB 4JANA 4AT6B 2AJ3B 2EYRB 3O2WL 4MMXC 4JFDA 4YDKH 5DJYB 1OLLA 3I50H 1G7LA 2X4SA 4UNVA 1TVHA 3IVKB 4NUGL 5KZCD 4OKVB 3NAAL 4YWGH 4E42A 3LZFL 1EV2E 2P4AB 1DE4A 3TO2B 1F11B 1I3UA 3UZEA 1RK1A 1AQKL 5EULV 1EJOL 4IMKA 2RAMA 3SE8H 2E5EA 5BZWA 4FQPA 5IM7A 1EK3A 3O6MH 2VXSH 5FGCB 5I19H 1FBIL 1XIWD 1CD8A 2IBZY 3CSYA 4JLRA 4RBPH 1S3KH 5L88L 1E6OH 2A38A 2P7TA 4KKCD 2OI9B 2AXFB 1ZTXH 4I48B 4OBRA 4OD2A 2D03H 3OXRA 4CADA 2AJXH 1VPOH 4N0FB 3QUZA 3QUMA 3VI4E 5IQ9A 3KPRD 4Z7UB 2H3NA 5GGSY 4QXGL 3ZKMC 1KLGA 3EO0B 5BQ7B 3O6LL 5EN2B 3F7VB 1YQVH 1DL7L 1NCAL 1N59A 3GSVA 1BQLL 3LV3B 4LNRA 3TBYB 1B0RA 4V1DB 4X9GA 4L8CB 3JWOH 3GI9H 4BQ6A 4M7ZC 1A14L 3SO5A 3FRPG 5EUKA 2NW3B 4MS8C 3GBMH 3SDCA 3NCBB 2YPVL 4MNQE 1RZJH 4JQIL 4OF0A 4NO3A 4XMKH 1RU9H 1NDGA 1FVCB 4XXDA 2QSCL 3HA0A 4YEFA 4P49A 1VFAB 4QT5B 2FL5B 5FXCH 1IM3A 3IDNB 4PRDB 3V2AR 3G6JB 1YEJH 1WEJH 5DWUL 1TZIA 3QA3A 12E8L 3TA3B 4XCEA 3W9EA 4P23A 3BIAX 1MEXH 3IGAB 5IHUL 4ZPTB 4NZRL 3UZVB 2DLIA 5AZ2L 4RA3A 4K7PL 4KKAC 3WUZA 5I1DB 2J5LB 1H0DB 4PJ9C 2GITA 5I1JL 3QISA 3UTSD 4TTDC 3CDFA 4FNLL 3Q5YA 2J8UB 4HIJA 5FDYA 3GB7B 5I9QC 1MHHB 3BIKA 2VDOL 4PG2A 5FIEA 4AT6A 2AJ3A 2HJLB 2EYRA 5IMOA 4M8QB 4G6ML 4PJHB 1TJIH 2HJKB 3DXAE 3DYOA 5DJYA 4U2ZA 3FTGB 2X1XR 1S5IL 2BSRB 2DQUL 1F11A 1LE5B 3RUGE 5HGDB 2DD8H 1U8MB 5D7SL 3S96A 2V7NA 4X6DB 1KTRL 4HUVB 4J3WA 4XCFL 1A21A 2Z31C 4WI2A 4FQ2H 1I9RL 1LK2A 3ZTJH 5DQJB 5K9JL 4WI4A 5I8KH 4BFIB 2AXFA 5DA4A 2F5AH 4I48A 4N0RA 5JOPE 4ZS6C 2I9TB 5ID0B 3UJJL 1A6UH 2E9JA 4N0FA 3VXPA 5I8OL 4N68A 3ALXA 2FX9H 1ZV5A 4Z7UA 3P0VH 5J13C 5HHNA 4P2QE 3RTQD 3EO0A 1EUTA 3GEWB 5BQ7A 1EZVY 3JXAA 5EN2A 3F7VA 1O0VA 3RFZC 4TUOB 1T1WA 5JZ7C 2OL3H 1VADB 2DLFL 5DFVC 4MHHG 4CDGC 5GZOC 4OM0L 3H6JA 4V1DA 4L8CA 3O6FB 1I1FB 1T2QL 1CL7I 15C8L 1OSPL 1NGPL 5AZEL 2NW3A 1N6UA 2V2XA 4MAUL 1OSZA 4RQQA 5JTWA 1U8LB 1MQKL 1FVCA 2M8XA 3VD9A 4ODVH 1V7MH 5DZNA 5DC4B 3QEHB 5HI5C 4WFFE 5D72H 1REIA 3WFHB 1EEZA 3QZWG 1C8PA 4QT5A 4LMQE 4CN1A 2FL5A 4GW4B 3T2NL 3IDNA 3RWHB 5F8RC 2CKBB 2J88L 3G6JA 1DBKH 5F9OL 2R29H 3IAQA 4GAYA 3O2DL 3KS0J 3TA3A 1Q9KA 3A6OA 3LN4B 3UPRB 1V8HA 1IRAY 3S35X 1FYTB 4QRTB 5I1HL 2EH8H 4L1HA 4U1LA 4ZPTA 4XC1H 5DD5L 3KYMB 1HKFA 1H0DA 1KB5L 3RKDC 4L9LC 5GRZA 4NM8L 3RU8H 1E4WH 3O45B 3GB7A 3GBNL 2X2YA 1MHHA 1MPAH 4JFDE 2EH7H 2HJLA 4ZO8A 4KK8C 4YXLL 4LARL 2HJKA 3TO4A 2NTFB 2J6EH 3DXAD 3FTGA 4OQTL 4HHAB 1F4YH 4CVXB 1SM3L 4YBLC 2VB5A 4G6KL 4OKDA 5IQ7H 1P6FA 1HSBB 1BFOA 4HIEB 1A7QL 5DTFB 3BE1H 1IEBB 4G42B 4X6DA 4HUVA 5J3HD 4HQQL 2A1WH 3EOAB 1YEKH 4OD1H 4ZFGL 2MFNA 2PR4L 3FFDB 5IIEB 2AEQL 5IBUG 5E56A 2PUQT 4GKSB 5DRZA 3VFOB 3OG4B 1CGSL 4NOBA 1FJ1B 4BFIA 3FN0H 3AC0A 1IGIL 5JOPD 3DMMC 4WUKL 2W60B 4CN6A 4JFZL 5KVDH 1DFBH 1YMHB 3BSZL 3UMTA 4NJ9L 2Z35B 1TETH 2W65B 4P2QD 1BJ1J 3DUSB 3FMGH 1FN4B 3EYVB 1FNFA 1G9MH 4LHUA 1N64L 1I1FA 3LD8C 1Q9LA 5KANI 3RL2A 1BP3B 1VSCA 5ISZB 3WSQL 1IZJA 3O9WC 3T0XA 5FUOL 3MRMB 5IBLC 3MZTA 1K8IA 4OZ4B 1FV1B 3QEHA 2R0LL 5JIIA 4WFFD 3WFHA 4WY7L 3QAZB 4GH7B 3NBNA 3F7QA 2WAHA 3QIUD 1Z5LB 3S3JA 1NUNB 4GW4A 3X13A 4OB5L 4ETYA 1CYGA 3P4MB 4XP1H 3B43A 5H8DA 1U3HC 2KQMA 4Y4HD 3QULA 4C4KO 5INCA 4JZOB 3QO1B 1TJHH 4EI5D 1EO8L 2WIIB 1IT9L 1FYTA 3MJ6A 2HJFB 4HK0B 4EI6A 1KGCE 4IMLB 4BJLA 3U82B 1JV5B 4HS6A 2R4RH 4GQ9L 3RX5A 2AJUL 4K3JH 3FONB 3V8OA 2A77H 1BWMA 3OB0H 4NKOB 2Q20A 2GJ6B 2X89D 1YMMB 1TNMA 4H88L 3O45A 2H41A 1X7QA 4JPVH 2YKLL 2XQYG 1EJ6A 3CVHB 2CUIA 4JFDD 3WFBH 1WF5A 4NJAH 1Q0YL 4GG8B 4G5ZH 4CVXA 4NNPL 3L3IB 3FT2B 3I3BA 1S7SA 2YA0A 3GI8H 4HIEA 3Q0HA 1Z2KA 2VJXA 3HHRB 1IEBA 1FL3A 2NY2C 3MODL 1AE6H 4G42A 3JVGA 4KGJA 3EOAA 5FGCE 4X7SH 5D1QA 1LO4L 1A1MA 5JLZB 3CGTA 1FJ1A 4J6RL 2VXUL 3SDYL 1A6VH 4ZODA 2W60A 4MQXC 3QUZD 5EU3A 1VA9A 4Z7UE 1GHFL 1KJVB 5E1HB 2Z35A 4NQCA 5LQBH 3QUYA 4QHUB 4S1RH 1QSEB 4KVNH 2ESVB 1N6QH 3DUSA 1OT2A 1BFVH 1FN4A 1G9NH 3WIFA 2NY5H 4V1DE 3O4OC 3RL1B 1IFHH 2XV6B 3RPIB 3R0MA 3PIQB 5AWNH 3N1PC 2FATH 3ELAT 4L5FL 1QRNB 4N0YL 3HG1B 2YD5A 5ILTH 4XP5L 1XR9A 2YUZA 3CFCH 4FFYH 3SDCD 3K80A 1FFOB 4Z78B 2X1QA 4PJ9B 2RBLA 1RUPL 4OZ4A 4XNZC 1FV1A 1WT5A 2XZCL 4P2RB 4ZPVB 3VGFA 3UYOD 2VN7A 1BF8A 3OG6B 5CINH 5C0BA 2YD7A 3G6JE 4RAVB 1E4JA 2VABA 5BRZA 5JR1L 1HILB 3F58H 4RWHA 1LO3L 1U9KA 4Z6AT 3BHBB 3BISA 3QO1A 4GJTB 5EFIA 2QBWA 2PCPB 1Y6MR 1GZPA 4OM1H 2HJFA 4P23D 1A6TA 4IMLA 2WV3A 5HVWA 1JV5A 3T2OA 1IKFH 4EUPH 5A2FA 2CLVA 4G6JL 4U1IB 3EAKA 3PWUB 3CPLB 1PAMA 2EEBA 3O11B 3RVXD 1A5FH 4LLVA 3V5DB 3ARGB 4OGYH 4QHLB 4GLRI 4HKXB 1UB5B 3ZTNL 4LSPL 3RWEB 3L5IA 1MHPH 1P7QA 3EJJX 4GG8A 5J13B 3M8OH 3JWOC 3DRTB 4AMKL 1I8LC 1R5VB 2O61B 3FT2A 1GPOL 4RAHA 5GGTA 4X6DE 5KTEH 3ULUC 3NFNA 1F3JB 1M7XA 2ARJA 4YZFE 3H3PH 4MS8A 4N90E 5D96C 4NHUB 1TMCB 4OZIF 1IGMH 4NKMB 3HI1A 4U3HA 1OAXH 2W0FB 5GS1C 3WXVH 2W9EH 4ELMF 1FYHB 4HUWB 3QDJB 4KXZH 1KJVA 3ZDYF 2ZKHL 4YX2H 4MXWL 2QQLL 3MLSH 4WEMB 5CMAB 5FM8A 2A74B 4QHUA 4FFZH 5FKAA 4NZTH 1QSEA 5A2LH 2ESVA 4HT1H 1V7NH 1BZ9A 5TE4L 1MCNA 3B8YA 4NKDB 3T3PF 3RQ3A 4V1DD 3RPIA 1T20A 1YN7A 3PIQA 3RIAK 1HYRC 1E4XI 1QRNA 1F8TL 3HG1A 4HXAL 3HS0A 4PRIB 2VITB 2D0FA 4L9LB 1MELA 4X4YB 4R8WH 3TT1H 4ZPVA 4JFQB 2QKIA 1FH5H 1PFCA 4QEGA 5D8JH 2HTKD 4Q0XH 1RIUH 4RAVA 3MUGA 4LF3A 1CLOH 1HILA 1WBXB 5K9KB 3I75B 4LAQL 2ZUQC 3TA3D 4HG4K 5IKCB 4D8PA 1FYTE 2PCPA 5DUPH 4NRYB 5HI4D 4X9IA 1KTDA 3TT3H 3HUJB 5KAQF 3DLQR 5HSFA 4YHYC 5T1LA 2BRQA 3PWUA 2OYPA 2Z31A 3B9KC 1TQCC 2WK2A 4WHYG 3V5DA 1JNHB 3EO1B 2GUOB 1G6VK 1KTKE 2IBGA 2KPNA 4HIXL 1S7VB 3DMMB 1UCTA 4UUJA 3RWEA 4HUNB 3TO4D 3H3BC 3GKWH 4APQB 3UPAA 1IAKA 4YWGL 1YPZA 4LEOB 1R5VA 2O61A 4QNPF 2B7DT 1QZ1A 4Q97A 4H1LH 3RVWD 4QHKJ 4JFYA 2WNGA 1FO0B 5D7IA 3SE8L 1U3ZA 3H0TB 2F9BT 5SX5H 1F3JA 5F7WC 1UJTA 3LD8B 3O6ML 5LCVL 5HY9B 5I19L 3UCRA 5K9QI 3WLBA 2X10A 4F15C 4NHUA 1E6OL 4DCQB 4IS6A 2D03L 4NKMA 5JPNA 4HS3A 2EE2A 2AJXL 2GCYB 2W0FA 4U6HB 3ARBC 3QDJA 4NQCE 1A7NL 1N6VA 2B5IB 4MLSA 3AS3A 5CMAA 2A74A 2IALB 3B9AA 4P2YA 1U3HB 2LQRA 5C0AB 4ZFOL 4LHUD 1P2CA 3JWOL 1CGVA 4QTIL 1PKOA 1G6RB 1IQDA 3NOIA 1C5DB 3GBML 3MV9B 1RZJL 3HRZB 3PHOA 1JF1B 1RU9L 2GKIA 4L9LA 4X4YA 1BWWA 4RMRA 3D25B 4PJ8C 3DVFA 4OSUH 4JFQA 4AG4H 2LAAA 4Q9BA 1U42A 5BRZE 1CGTA 4UV7L 3RWFB 2P8PB 2P47B 2EDBA 1YEJL 1WEJL 3I75A 3UTQB 1HOCA 1MAJA 5IKCA 2D7PA 1UG9A 3DYMA 3PGCB 4K3HA 1FYTD 4NRYA 2D7MA 1RZ8B 1MEXL 3FL7A 4MNGA 3BD3A 2NY2B 3HUJA 2VLJA 4LLQB 3HPJB 1QOKA 1D5ZB 4Z7VF 1H8OA 3STBA 4ETQB 1XF3B 5SWZB 1JNHA 3EO1A 2GUOA 2I24N 4NRXA 4PIRF 2BNRA 1CXIA 3FOLB 5GSVB 3DMMA 4WI6A 7CGTA 1TJIL 5CGMA 5CGYD 1W8NA 2D9QB 5I1AA 1G9MC 5GS2D 1N5YL 4NFCA 4B0MM 4LEOA 5LXGH 4XVSH 2W9LA 5KOVC 2DD8L 3V95A 4LGPB 3O4OB 4U1KA 4XI5D 5B39A 1FO0A 2IQ9H 2PW2B 3H0TA 3JTSB 2Z93A 5D1QD 5E2TH 3LH2H 3EJZC 5HY9A 4FQ2L 4Z7QF 3FO2B 5I8KL 1T66D 4DCQA 5CFHA 3O9WA 2G9HB 5SX4I 1MRFH 5B3JE 4M62H 1Q1JH 1A6UL 2EDRA 3A67L 4PJXA 1P4IH 2FIKB 2FX9L 1HN1A 1RURL 3IU4H 3P0VL 3CMOH 4NQCD 3QUYD 1QSEE 3QIWC 2ESVE 1IEAA 3DIFA 1I3VA 3A6CH 4LOUD 2IALA 4EDXA 1D5BA 1U3HA 2ERJC 2OL3L 5I16B 5CBEB 3AB0C 1QRNE 3HG1E 3OKOB 1G6RA 2Y9RT 1G7MB 2DWDA 1AO7A 5DJXB 2X4PB 3HRZA 1BEYH 3BQUC 4HZLA 4JQXC 2D31A 4IRJC 4PS4H 4PGZA 3P9MB 4ODVL 2AJVH 4AM0A 2ICWI 1JPFA 3D25A 5C0BD 3S9DB 1ZVHA 4P46C 2MKLC 1A6WH 4NCC2 1HHKA 2P8PA 4Y2DC 5BRZD 4ZSOB 4RX4D 4G80B 2XQYK 1DBKL 2R29L 4OJFH 3VXRB 4GMSH 2FWOB 3PGCA 5DEGA 5JQHC 1KCSH 2Z91A 1LP9F 1WIUA 2DN7A 2EH8L 3ZHKA 4F7PB 3HLAB 1VACA 1Q94A 3EFFB 4XC1L 5KSAC 1QTYT 5M7QA 4R9HA 1OGAD 1RUMH 3DPBA 3RY6C 3CSGA 4ETQA 3V6FB 3CZJA 2DIAA 4FXLA 3MOBH 5D96B 5JPMA 1E4WL 4KUCD 4CW1B 2CRMA 3FOLA 1BZ7B 5DO2C 4DKEH 1MPAL 4UDTB 3WNLA 3DETC 2CXGA 2EH7L 2VLME 1G9NC 1BQSA 1P7QD 4OV5B 2J6EL 3MA7B 4NNYA 1IQWH 2WWMD 1YPZE 1F4YL 3ZKMD 3UP1A 1N5AB 4KMQA 4BFGA 2E7BA 3KWWA 1OW0C 5IB4B 1JZ2A 5F7EH 4FXKB 1KCUH 2PW2A 2A1WL 1YEKL 3JTSA 3DO3A 1FVEA 1WIPA 4DQOH 4NHUE 4NIKB 3FO2A 3N9GH 5EPMA 4X6BB 1DEEA 4RCAA 2AJYH 3L9RA 4M7LH 3QDJE 2FIKA 1DFBL 3B2VL 5KSUB 1PJ9A 2P42B 1TETL 3BDXA 3C6LC 5T3ZE 1IL1B 2ESVD 3FMGL 2ZCKL 2ZUQB 1W0VB 5GRVL 1GGTA 2JJSC 4E41B 5I16A 5EO9B 1G9ML 4EJ1C 4WUUA 2YPLA 1DBJH 1QRND 4J3OC 1OF2B 3HG1D 4ZTPH 4KKAD 3CXDH 3QEUB 4YHYB 5DJXA 2X4PA 2BRRH 1KACB 4IRSB 1R3IH 3P9MA 2NW2B 1II4E 4HG4J 5HBBA 1UFUA 1UADC 4RNRB 4AL8L 3EYSL 3ORJA 3FHAA 1J5OH 4ZSOA 4G80A 25C8H 1MCQA 4XP1L 1FIGL 1LDPL 2IJ0C 1JGDA 2RCSH 5DGRA 3GDBA 4KJYA 1I8LA 5HGGS 3AS2A 3VFVA 1TJHL 4OCYH 3DHJA 1JRHH 1QKZH 4QXTB 3HUJE 3S36L 3HLAA 4K3JL 5T1LD 2B39A 3QWOB 5EOCJ 2A77L 4OLWH 5C0GB 1P53A 2Z31D 3V6FA 3MRJA 4F15B 1HKLL 1KJMB 4UDTA 1JWMB 5GS1A 2YXFA 4O4YH 4WFGE 2VLMD 3WFBL 3ARBB 5GS0H 3F62A 4O9HL 3MLUL 1KJ2B 3BEVA 4G5ZL 4MMZC 4P99A 4LVEA 5DMYA 5JUEH 4G7YH 3SDXA 5ICZA 3FB5A 5DFVD 5IB4A 4FFWC 1TXKA 5GZOD 5JNYB 4O5LL 1X6LA 5D2LB 1AE6L 4LKXB 4FXKA 1A6ZA 5D5MB 3N0PB 5A2IH 2CO7B 3ARVA 4X7SL 1QQDB 1MIMH 2ADIA 4PGBB 3KR3H 3LEYH 2EDEA 3ILPB 2DS4A 5T3XH 4PJXE 1A6VL 5HI5D 2XICA 4HCRL 4UT6H 5B39G 3QDJD 3ARFB 5KSUA 1MCLA 4JFOA 1M6OB 2EYTA 2XZQL 3CNKA 3L5WB 1F97A 5LQBL 3VI4F 5T3ZD 1IL1A 4S1RL 4LVOC 4KVNL 1N6QL 2BMKB 1BFVL 5E8PB 5FO7B 2NY5L 2J8OA 4E41A 3GSNH 5FYKE 5AWNL 3RA7H 4KU1A 4MA8H 1KLUB 4XPGL 1MCSA 2XFXB 1AO7E 5ILTL 3MV9E 3CFCL 3IDXH 4FFYL 4L29B 4EDWH 4Z95L 3QEUA 4GXVH 3ES6B 1YNTB 1Q9WB 4IOFC 4P48A 1HXMA 1AHWC 2JCCB 3B9KA 3O6KH 3D6GA 2NW2A 1NSNH 3T0WA 4RNRA 3MLTB 2B2XH 3F12B 3DSNA 3MJ8A 4KK8D 3S88H 1ZVYA 2CO6B 4NQDB 3F58L 1LILA 2OL3A 3MUHL 2AEWA 1K8DA 2R2CA 4YO0B 1RZ7H 3RNKB 5JA9A 3HC0B 5IMLA 5IEKB 5IHZA 1PYWB 1WCQA 2VLJD 4JJ5B 4BH8A 2CRZA 1YDPB 3CUPB 3W39A 3QWOA 3IJYB 4O58H 1BX2B 1ZKAA 5C0GA 3GZKA 1ZMYA 3QDHA 1A5FL 3KJ4B 1KFAH 2X9XA 3FRUB 4OGYL 4KKLC 2BNRD 5IFJB 4PJGF 3O3DA 5DD6B 5I1GH 2NXYC 4Q58C 1KJMA 3DMMD 2KBGA 3EO9H 4XXCC 5K9OA 5DMGC 1MHPL 4YC2C 1W0YT 4WFGD 4DW2L 5ESAA 2VYRE 3M8OL 4LDEB 3T09A 1CT8A 1KJ2A 5C08B 3O0RH 4P4RA 4EVNB 2ERJB 4M7LT 1RZKC 4N1HB 3QDGA 4YK4C 5JNYA 3AB0B 4U0RB 5D2LA 1P7KA 3RUGF 4M1GH 1YEHH 5CSZA 4NQTA 2C3VB 2X6MA 4FQJH 4OFKA 3P73B 5F89B 3H3PL 5FHAH 5FUCC 1ROWA 3O9WD 3L6FB 3WEXB 1IGML 3WO4C 4IRJB 4XAWH 2ZZUT 5CLTA 1JGEA 2B1HH 3PXJA 2VDPH 1M05B 1A3QA 2DQIL 3ZE2E 3WXVL 2W9EL 2P49B 4PJ8A 2F58H 4WVRA 1MJ7H 3OX8B 2MSPA 1J12A 3L5WA 4P46B 1MVUB 3MLSL 5J1AB 2YWZA 4FFZL 4NZTL 1U3HD 1JRHI 2IWGA 4JFFB 4HT1L 3JV4A 5E8PA 1OLZA 4HMDA 1A7RH 2IG2H 2NY4B 3H9ZA 5JORA 1LO5B 2NX5B 5FYKD 4GKOA 3VXQB 5KBNC 2XFXA 1GH7A 5KSAB 5FA3B 1AO7D 2F5BL 1WITA 5DD3H 3ES6A 1CVSC 1YNTA 1Q9WA 5DI8B 1A4KB 4OLUL 2HYMA 4ORGB 3QCVH 2C7UB 2BSSB 2VXVL 3T8XA 2DBLH 3BH8A 5I76A 1FH5L 4HMCA 4L8SC 4ZSOE 1JVKA 2BJMH 5D8JL 4ONFL 3F12A 1RIUL 2G5BB 3N1FC 4NQDA 1CLOL 4H26B 5C2BH 3ARRA 4MJ4A 4CMHC 4NFBA 3MRCB 4HF5H 3CH1B 3RNKA 5DUPL 5CJBA 1BJ8A 1PEZA 1G84A 4V3EB 2BVOB 2OR8A 3WFCH 3HC0A 3CJJA 3ULUE 2NY2D 3FB7B 4HGMA 4CNIB 4XC3H 5IEKA 4H0HB 1YDPA 1KT2B 3CUPA 5CIPH 2BX5A 1BX2A 3BPOB 3I2CH 1X5ZA 3FRUA 3VRLE 4QXUH 5IFJA 4OIBA 5CJ8A 2YD2A 3MV11 2YBRB 4MQXD 3DOSA 4J8RA 4PV9A 4CVUA 2BHUA 5DJ0A 3T1WA 3SGEH 4K9EH 1CXHA 2ADFH 4P3CH 3NMEA 4N0CC 4I18C 3C6LB 3QIWA 5F9JA 5C08A 2DICA 5LBSL 2UZXB 4MXVF 1RVFH 3RGHA 3VGHA 5C07A 2YPKB 2W07A 1CVRA 2C3VA 1FC1A 5MENB 3RWGA 5INDB 5DJ6B 3PHQB 1JGUH 4N8PA 4O2CB 3BQUA 4ODXB 2YRLA 4JQXA 1U93B 5HI3D 3U7AA 2DMCA 2F15A 5I6XC 2V7HB 4BZ2H 1NH6A 5ICXB 2FEEL 1JMZA 2LABA 3PF2A 3OX8A 3TCLA 4P46A 5KANG 1MVUA 1HINH 1Y0LB 3NA9H 4Y2DA 2YD3A 5J1AA 3L3DB 5HGHB 4M93C 4PYGA 4JFFA 4E41E 1RV6X 1X5FA 2R9HC 4XBEH 2R1WB 1MJUH 4WUUD 2YPLD 1LO5A 2DMBA 3QR2A 5IWLC 2BDNL 4ZTOH 2NX5A 1KSRA 5FM5O 1B3JA 1MCOH 3NCCB 3TVMB 4WJ5B 1PG7X 5KSAA 5FA3A 4PLOB 2EDJA 2IADB 5B21A 4ERSL 5DI8A 1JK8B 3S3SA 4LDLB 4HMEA 2V5YA 2JKXA 2C7UA 2C1PB 5IW1B 2ZUWA 4GT7A 4AG4L 4FA8A 3HZYA 3BPLC 2G5BA 4ZOBA 4UTAH 4H26A 1JZ3A 5EORL 1YYML 2E7CA 3NPZB 4U1MB 1ORSB 3MLRL 3CFEA 3CH1A 2HRLA 4H5SB 4OCNC 1HEZA 2BVOA 4TPRH 1D6VH 5SWSB 4JFHE 4R4NC 3FB7A 1KXTB 3OZ9L 3TH2T 1AQDA 4PTUA 2FNBA 1KT2A 2R0WH 1JIBA 1JF5A 1M7DA 1T80A 2XN9A 1BOGB 2MTPA 2X4NA 2IPKB 1VCAA 4X6FB 3SKOA 1OTUC 1JPGB 3MYZA 5E08L 5DSCA 3GNMH 1XFPA 2R39A 1F42A 3H9YA 1T7XA 1XR8B 3C6LA 2OK0H 2ZCHH 1B6UA 4LVOB 1IGJA 4L3CA 3QDGE 4XVSL 3BKYL 2JJSA 3FQXB 2GK0A 3QRGH 5D2LE 5D5ME 3RJDA 2IQ9L 2YPKA 2XKNB 2GYSA 5E2TL 2Z4QB 3UZQA 5MENA 5INDA 2C3XA 5FF6B 1EXUA 3PHQA 4O2CA 5TPWL 2G75A 4ODXA 4WU7B 2J8HA 1AHWB 1MRFL 4M62L 4OQ1A 1Q1JL 2ICWB 2SEBA 5L8KB 1P4IL 4NQSA 3NVQA 5ICXA 1P4BH 1P7HL 5AD0A 3IU4L 3CMOL 1Y0LA 3PDGA 4Z7UF 4Y8DC 3L3DA 2WW8A 3A6CL 5HGHA 1L6ZA 1FP5A 2BVEA 4H1LB 4JVPA 3WNPA 4ZYKB 1Q38A 4E41D 2VDMH 4MCYA 4Y8AA 2R1WA 2MPAL 3HNSH 4Y4FC 3VGDA 4XWOD 2R2HB 4HC1L 3BJ91 3GIVA 3QEQA 5TH2B 1ZOXA 3FN9A 3CX5K 3DSFH 3QUKB 2OR7A 1BEYL 2JCCE 3HZVB 3B9KD 4PS4L 3U36A 1A6PA 1JK8A 1ZEAH 2AJVL 5KN5A 4K71C 3SGEI 1DQTA 5IW1A 1AFVH 4WW1B 5GS0C 2GAZB 5LGJA 1XZ0B 2NXYB 2V9RA 1G7PB 3RJQB 3V4VL 4NQDE 1A6WL 2VL4A 4YC2B 4ACPA 4JVUA 4OJFL 3G6JF 5F6HI 1LE9B 4Z8FL 3RBGA 5ICYB 4GMSL 1ORSA 4U1MA 1KCSL 1UB6A 1YEDB 4LCUB 5JW4N 2R0KH 4H5SA 3OXSB 4XPFH 2P44B 3BD5A 4YK4B 4OFIA 2K1MA 2X1WL 1WISA 4JFHD 1RUML 4HIIB 2H26B 1H15A 4PD4K 4L3AA 3MOBL 3MV7B 1BOGA 3RWCA 4M6NH 3O3AA 2IPKA 4X6FA 3WO4B 3OHXB 4OFDA 5F3BA 4DKEL 3QO0A 5FOBB 4OLYH 4Q74A 4KKNA 5HHMB 1IQWL 4PY7B 5C08E 1EIBA 3QUXC 1I7TA 5T1KB 1CK0L 3KYKH 2FZ3B 4UV4H 3QDGD 5C07E 3FQXA 3CFKB 2BOCB 4EKXA 5F7EL 4LPXA 2YD6A 5GS3A 2K7PA 1KCUL 3LHPL 3X11B 4X6DF 4HJ0C 3EYOA 2HFFA 2VC2H 4I0PB 4DQOL 5A16A 3K2MC 4H8WH 3N9GL 4WU7A 4YZFF 1CXEA 1AHWA 2AJYL 3BO8B 4IIQB 1M71B 3JSSA 4M7LL 4Q9RH 4PJ8D 2GK2A 3EDKA 1I75A 1M1SA 1E27B 2GY7B 3FHQA 4JAMA 4L8SB 5GSRA 3TZVB 1B0GA 3KXFA 4MSWA 4HGWB 4JFFE 3Q5OA 4W70A 2E3VA 3CH8A 4LLYB 4H1LA 4JEGB 4PR5B 4ZYKA 4O02H 1K4DB 2NX5E 1TNNA 4W81A 1DBJL 3TNMB 2R2HA 4ZTPL 1CD0A 3WFDH 2Q86A 3OGOE 5TH2A 2FJHA 1RZGA 1HQ4B 2VAAA 1INEH 4HUUB 2QQNH 4X7DC 1R3IL 4JRXB 1UXSB 3ARQA 1DN0B 4HIHB 3NIFE 4WW1A 2AXHA 2GAZA 5IB5B 1XZ0A 2OSLA 4U6TA 1G7PA 1RAMA 4Z7NE 3ZYJA 4XXCA 4NQDD 25C8L 5C09B 1IILE 3L1OH 1FG2A 4LPUA 2RCSL 4I18B 1LE9A 4P9HH 5FO9B 5ICYA 1QVOA 1T5XB 1IE5A 1G7QA 4MJIA 3B9EA 3KPMB 4LCUA 3PL6C 1QKZL 4RMUA 1J0JA 1ONQB 2XNAA 5CKAA 4X7FC 2Z8VC 4WO4C 1NJ9B 3EJZD 4HIIA 2XN9E 4OLWL 1EPFA 3UEZA 5TQ0H 4OGZA 3UDWC 1KUMA 3LRSA 3MV7A 1A2YB 4AEFA 4NO5A 3FFCB 1CLZH 1F4XH 4U1GC 2UZYB 5I6XB 1TQBC 4U3CA 3RP1A 4O4YL 5HHMA 4KVCH 1QR1B 2JF1A 4PY7A 5GS0L 3QIWD 5C08D 4Z0XB 5K9QG 3ULSB 4M93B 4G7YL 3VW3H 2RQ8A 4DEPC 4UQ3A 4XMPL 3SCMC 2OXHA 3CFKA 5C07D 1ZLWH 5FO8B 3MNZB 3O3BB 1EFXA 4N8CL 4YEEA 2HTLC 4ONHB 5MENE 5F9WB 1MF2L 3LN5B 2IH1B 1MIML 2R69H 3KR3L 4XPTH 2YD9A 5I1LA 4RWYH 4WHDA 3BQUD 4IM8A 4X6CB 2UYLB 2CRIA 2GTWA 4J3SA 5T3XL 5CD5C 1QBAA 2CR6A 4BZ1H 1RHFA 4UT6L 4KRLB 5IVXA 3L3OB 4UOW1 5E24E 1E27A 3VD4A 3KPTA 4L8SA 4P46D 4Y2DD 5JQ6H 4FN0A 2WBKA 4HGWA 4RBPK 4JFFD 4PR5A 3IDIB 3L3GB 3GSNL 4MWFB 1RMFH 1GC1H 1K4DA 4W68A 1F6FB 3QNXB 3RA7L 2NX5D 2CUHA 4MA8L 4YIQA 3QB7C 3QEQE 2DAVA 5AUMB 1JP5A 1J88A 3IDXL 3FO9B 4EDWL 1JPST 1GYAA 4GXVL 5DF0A 3VDAA 1W72L 4JJHA 3MREA 1X3DA 3TBWB 5D9SA 3T4AB 1JNJA 4WTWA 3O6KL 3UTZA 2KZ1B 4JRXA 1UXSA 2B1AH 1UM4H 2DIJA 1DN0A 1INDH 1CLCA 2GFBA 2NTSP 1GXEA 4QRRB 3OKLB 5E8DL 5IB5A 5DO2D 3GSWB 2XT1B 5CJ5A 3DETD 3K1KC 1H9VA 4PTTB 3S88L 1MAMH 2DYPB 5C0RH 1QFWH 4RAUA 3GMLA 2XXMB 4N0CA 4I18A 1ZGLP 1S5HB 2F8VA 1QLFB 1MFBH 1RZ7L 3OJDB 2AXGB 5HYSA 1T0MB 2B4CH 1MI5A 2L7JA 3V6BR 1CDBA 5L0QC 5DDHB 1LEKB 4WIQA 3LKQB 3FQTB 4YHLH 4NBXB 1IAIH 1NJ9A 2ATKA 2W92A 2XN9D 3KPSB 1KFAL 3VXTB 1A2YA 4JRYB 3FFCA 5I1GL 4S0TD 2HT2C 3LPFA 4KUCF 3EO9L 3HI5H 3DVNA 1WWBX 3QPQC 2EDWA 4I8DA 3S34L 3NIGE 1QR1A 3VFNB 4LLWB 3C6LD 2FBOJ 2UUDK 3O0RL 4UIMB 2WZPD 1MCFA 3ULSA 4LEXH 4OAWA 1ZGLB 5LAXA 2VXQH 1XMWA 4OUOA 4TN9A 5IJVB 5IWLA 4R7NB 3BP7B 4M1GL 1YEHL 2X7LB 4NN7C 1HDMA 4FQJL 4PJFA 5MEND 5CCKH 3LN5A 5FHAL 1MCWM 3TBSB 3TPUB 2HAZA 4X6CA 2UYLA 4WNQB 4XAWL 4R4FH 2B1HL 4JE4B 1KULA 4K71B 4DKAA 1WUNT 5GRXG 3CFBA 2E7HA 2RB8A 1OQOA 1WAAF 4B53A 3L3OA 2F58L 5B3JF 4HKZA 3FT3A 1MJ7L 5L7XH 2XYCA 1ZHLB 3HZKB 2F74B 3BESR 4JGJA 5C0CB 4WU5A 1A7RL 4FG6D 3IDIA 3ZDXE 4MA3B 4MWFA 4UIKH 4CVWA 3QNXA 1T04B 5E8OB 2VERN 3QEQD 5AUMA 4DAGH 3FO9A 1BPVA 5DD3L 1CICC 3AROA 3ZE1F 1FE8H 5CS7A 5GZNC 2EDKA 4H1LG 1QNZH 4NYLB 3T4AA 3ZLQC 2H1PH 3B6SA 5JMOC 1Y18B 1AI1H 3H9HB 3KPOB 1X6NA 2GIYA 3DX9B 2DBLL 2N1KA 5HDBE 2MQ0A 4QRRA 1CBVL 4F2MB 2XPGB 3GSWA 2AGJH 2BJML 5F1SA 4F9PC 2XWTB 3EJYC 4PTTA 3C09C 4AIZB 4LKCB 2OJEA 3MRBB 4RMQA 3P4NB 5GIRB 1IGYB 4WWKC 4MJIE 3T0BA 1S5HA 3QUXB 4JDVA 1QLFA 4HF5L 5F88A 1T0MA 3WKMH 1L4IA 1A22B 3QQ9C 1J1OH 3GMPB 3RDTC 5TDPA 3WFCL 1JZ5A 5DDHA 3FJTA 5EU5A 4XC3L 3HI6H 4XPAH 3VGGA 1I1RA 3IKCA 3FQTA 1NCDH 2OTPA 3S35H 3LN9A 3B9VA 3LKSB 1NCCL 3I2CL 1LWRA 3MV7E 5FUCE 1QA9A 5I8EB 3KPSA 4RZCB 4NC1C 3MRPB 3OGCA 4QXUL 4JRYA 5DC9B 4UB0H 2DB8A 1NL0H 1AJ7H 5HHME 5H37G 1QRKA 3D69B 3VWJC 4TTGA 5I17B 4PLNC 4E0RB 1ZA6A 4K9EL 4QY8B 2ADFL 4P3CL 4LLWA 3HZMB 1NGZA 2HN7A 3ZMRA 4UIMA 3LMJH 2AJZA 2HP4A 4R4BB 3PXHA 4HWZB 1J86A 4IOSD 1YPZF 5IK3A 4WTXA 4ESKA 1ZGLA 1RVFL 1J0HA 4PGCA 5DA0B 3Q6GH 4LQ1A 4P5KB 1L0QA 5IJVA 4R7NA 3BP7A 4Y4FA 1PBYA 2X7LA 5E5UB 1XGRB 5D7IF 1MUJB 2XXCB 1DBML 4QXWA 5BV7H 4UBDC 3TBSA 3WS3A 4PP2B 4IOFD 3R4DA 4WW2B 4WNQA 1CIUA 1AP2A 3O41B 4PDCE 4X9HA 5IVXE 4CDHA 3U2SB 4K7PY 5FYLE 1HH6B 2DQEH 4X99B 3CVIH 3KXFD 4JY4A 3GUTA 1HINL 3NA9L 3HZKA 2F74A 4PJCB 3RPKA 5C0CA 3K2UL 4FP8H 2G2RB 1RI8A 3MOQA 1EMTL 5TJWK 4GG6F 4MA3A 1BJMA 4XBEL 1MJUL 2WQ8A 4WHTA 5E8OA 5L2KA 4PG9B 1MCOL 1SYVB 5KJRH 1WV7T 1DBAH 3DGGB 2OTUB 2EZ0C 4O2FB 3AREC 3V0AC 1Y6NR 5IF0B 5CJQH 2ZPKH 1J1XL 4JRXE 1KB9J 4KKLD 4YHMH 5C9JA 4CUCA 3BKJH 4GFTB 4TYUA 2BERA 4G8FA 3R06A 2VLKB 4LLDB 4PGDB 1TQBB 2XWTA 4KJWC 1FORH 3HE6C 4UTAL 1HQRA 3P4NA 4KROC 2V2TB 3GSNA 1IGYA 3NCFB 1H3WM 3QUXA 4MJID 5DMKB 4D0DB 1T22B 4OLZH 4H25B 3RX8A 3SCMB 3GMPA 3BP5A 1Z3GH 3DWTA 3MNWB 4H8WC 1D6VL 1XCQB 4TQEH 3VGAC 4I2XB 3HUJF 2R0WL 5D71H 4UNUA 3LKSA 2LE9A 1WICA 5FV2A 4RZCA 3MV7D 3FFCE 3HR6A 3VFWB 3ZHLA 1IAOA 3MRPA 2X70A 1TZGL 3WDIA 4NT6B 3AVEA 1AGEB 4JHBA 4KZEH 5HHMD 3W81A 3ESVF 3GNML 2X4QB 4QY8A 4U1NA 43C9B 1JYXA 2IMMA 1VGEH 3HZMA 2PTTB 1ZWIA 3GO1H 1VEOA 5CUSH 1FL6B 4R7DB 3G08B 4GRWB 5ALBH 1EFXD 5GRWA 4P5KA 4PJFE 1HHJB 2NYYC 3BH9B 4KDTC 2ZWLT 3H7LA 1ETZB 4U7SA 1UJ3B 2C1OB 4X6CE 1DUZB 2JJWA 2Q6WB 5JW4R 4OCLC 3REWB 1ZA3B 4PP2A 4PP8C 2Y1VA 3G5VB 5DZLA 5BZDB 2DIBA 5D7JB 3V5HB 5A40E 1DVFB 5DVMA 5B4MC 5EC2B 2VL5B 4P3WA 1SEQH 3LQAH 4P9HC 4PJXF 4X99A 1P4BL 1JUFB 2P8MB 5E94B 4PJCA 1R3HB 5CEXB 1TVBA 1MVFA 4QHNB 1KYOK 2G2RA 1T6WA 3G5ZA 1T89C 2VDML 4J3XA 3OAUL 3SGDH 4HWBH 4QTHB 3HNSL 1A1NB 2FYYA 3PL6A 4KTDH 4PLKD 5IMMB 4MD4A 3IFPB 1O5DT 4PG9A 5L0QB 3IJSB 3NABH 1SYVA 5FK9A 1IBGH 5FV1L 1CXKA 3DSFL 4O2FA 4YDIL 1UZ6E 4WO4A 5IF0A 2DKSA 3MGAA 4JRXD 1ZEAL 3UDWA 4YFEA 4QRRE 2A73B 1QYGL 4LSVH 5DQDH 4M43H 3WNKA 1KCVH 2VLKA 4LLDA 1A0QH 4FQCH 4ODTL 3BKCH 2BVQB 2A0LC 2I9LB 4LFHD 2DQJH 2FGZA 2ILLA 4BKLB 2FO4A 2ZCLH 4RISL 4Z7OE 1PW3A 2MHAB 1JPSL 3OR6B 4S2SB 5I73C 3BEWB 4PRBB 5IESH 4FXGB 4KQ3H 5J7CC 4MD5A 4D0DA 1T22A 4LU5H 1MI5D 3C8KB 2JJTC 4KK6C 5EU6A 2R0KL 2P1YA 1OM3H 4LCCC 4H25A 4XPFL 4N9GB 3SCMA 3MNWA 5ALCH 4BK4A 1XCQA 2ITDB 5IFAL 3OKKB 5BCAA 3CLEL 3KPSE 1A8JH 1NFKA 4JRYE 3VFWA 4AEIH 2A83B 3QDMB 3FFCD 4M6NL 1DTUA 1U3JA 4NT6A 3MMEA 3R0NA 5LWYH 4JDZB 5IB2B 1GC1C 1ORQB 1S7XB 3UBXB 1OCWH 4PJ5B 5IVZA 5EU4B 1OAZH 2PTTA 4I3RL 4KMTH 4XH2B 4NN6B 3KYKL 4PY8J 3ISWA 4UV4L 2YUVA 3T0EC 4WEUD 3VG9B 3O8XB 2R9HD 5FYJU 3BUYB 4Z7WA 5CIPA 1IKNC 3GSRB 1ETZA 1NDMB 4W4NA 2VC2L 1XGTA 2Q3ZA 3QXVA 1DUZA 2H6PA 1CICB 3MUZ1 5BZDA 5L9DH 3V5HA 3VG0L 4PBVC 1H3XA 5EC2A 3W9DB 4Q9RL 2FECI 2VL5A 4QRSA 4LIQH 2P8MA 3ZE2F 5L6YH 3QJHB 2X4TB 3C09B 3A6BH 5C0CE 2OQJB 2GQHA 4QHNA 4LSQH 3ZHDA 4IJ3B 4O02L 3KLAA 4IHOA 3JTCA 2H2PC 5L2KE 3MRHA 1A1NA 2IFGA 5FGRA 5ACZA 3RDTB 3STZB 3WFDL 2OP4H 1CE1L 3IFPA 4FQHA 5IMMA 4XPBL 3IJSA 3P9LB 3PG2A 4R4ND 5HGBB 4LNVA 1HWGB 3NH7H 5CD3B 3VFMA 1I7UB 2RFXA 2QQNL 4OI8A 3U0WH 3FQWA 3C2SA 4ODHL 5F21B 2AV1B 2A73A 4QRRD 3I84A 4X7CC 3MJ9A 4NWTH 1OTUD 4QCIA 3VWJB 2I9LA 2D4DA 4XVTH 3LKPA 2NY0C 2MHAA 4P9HL 4S2SA 1NBVH 3BEWA 4XCYB 4PREA 4PRBA 4FXGA 5CZVH 3DURA 4DUVA 4M03A 4N9GA 1ITCA 2ITDA 5D93C 4MCZB 3UTTB 4M8VA 3OKKA 4OTXH 2QR0A 3KJ6H 1JHKH 5JW5B 3KPSD 2XY2A 4JN1H 4MA1C 1I1AC 3WMSA 3M17A 5I15H 2VZUA 2A83A 1MNUH 4JRYD 4PRPB 5FA4B 4EBQH 4KZDH 1FIEA 1CLZL 1F4XL 3FCTA 4OF6A 5TF0A 2C4XA 3SBWC 4M1CC 4Y2OA 5H2BB 2CIIA 2VQ1B 1MCWW 4KVCL 4LQFH 3KS0H 1TIUA 4OIIL 2FBJH 3MXVH 1X5AA 1ORQA 1S7XA 3UBXA 1P1ZB 5EU4A 4XH2A 3VW3L 1FDLH 4JHAH 1EAPB 1K5NB 3MX0A 5JO5A 3SDXF 1QFWM 4P57B 4DK3A 4Y4FD 1QLRA 4WI9A 5E95B 2R69L 4XPTL 4RWYL 5EWIH 3VE0B 3EGSB 1CICA 3QXTA 1EDQA 1KTLB 3PWPA 1TZHA 4Q2ZB 3PWJA 1IAIM 1FLTX 4R97B 5F1IA 5I1CH 3W9DA 5GS0D 1O7SA 4F33A 4YXKH 2COQA 4D3CH 3NN8A 1MFCH 3BP4B 4PJCE 4U1JB 4F9PA 4RFNC 3QJHA 1J1PH 2X4TA 1JGLL 3E6HA 5C0CD 3TJHD 1D6EA 4WWKA 5K93A 3IDUA 5JW4Q 4MA7H 5F72S 1RMFL 2CXKA 4C55A 1RIHL 5L2KD 1XH3B 3D39B 4Z76B 4UOJA 7FABH 5FUZH 4YXHH 4F37F 3VGAB 5J6HB 5HGBA 5ANMB 5TE6H 5T3XD 5C2UB 4G8GB 1ED3B 1U2CA 2V2WB 5F7DB 3DV6B 3ZSTA 2ICES 3MGTB 2PTVA 3IFOB 5JMRA 1ND0B 2AV1A 2VKXA 4ZXBC 2B1AL 1UM4L 1NANI 2VLKE 2CKBH 4R90H 4WWID 1EHLL 4X4ME 3MRFB 3O4LB 4WHYH 4DN3H 2BVYA 3VWJA 2D9CA 2A6KA 1CFNA 1QFWL 2OR9H 4BA8A 1JWSA 1B6DA 3FQRB 3OB8A 4U6XB 3QUXD 4XCYA 5EU6E 1MFBL 5GGRA 4CGTA 2B4CL 1P6AB 4AQOA 4DVBB 5BV7C 5D6CB 4I2XE 3PHSA 4P2OC 2XZAH 4NDMB 5F8QC 4TVPE 3WIHH 4MCZA 4YHLL 5JOFB 1AY1H 1IAIL 3P4OB 5JW5A 1N4XH 2W0PA 2CDEB 1YYLH 4PRPA 5FA4A 4YR6B 2V5SA 3HI5L 1TTUA 4JM4L 4GAFB 2KH2B 5GPRA 2KZWA 2D7OA 1K6QH 4ZUTB 4LEXL 1EAPA 1K5NA 4GRWE 2E7LC