2GAZA

Mycobacterial lipoglycan presentation by cd1d
Total Genus 79
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
79
sequence length
273
structure length
269
Chain Sequence
NYTFRCLQMSSFANRSWSRTDSVVWLGDLQTHRWSNDSATISFTKPWSQGKLSNQQWEKLQHMFQVYRVSFTRDIQELVKMMDYPIEIQLSAGCEMYPGNASESFLHVAFQGKYVVRFWGTSWQTVPGAPSWLDLPIKVLNADQGTSATVQMLLNDTCPLFVRGLLEAGKSDLEKQEKPVAWLSSVPSSAHGHRQLVCHVSGFYPKPVWVMWMRGDQEQQGTHRGDFLPNADETWYLQATLDVEAGEEAGLACRVKHSSLGGQDIILYW
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords T-cell surface glycoprotein CD1d1
publication title Structural characterization of mycobacterial phosphatidylinositol mannoside binding to mouse CD1d.
pubmed rcsb
source organism Mus musculus
molecule tags Immune system
total genus 79
structure length 269
sequence length 273
ec nomenclature
pdb deposition date 2006-03-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2gazA02
3.30.500.10 Alpha Beta 2-Layer Sandwich Murine Class I Major Histocompatibility Complex, H2-DB; Chain A, domain 1 MHC class I-like antigen recognition-like 2gazA01
5I8CB 3CMOL 3CDGB 1LK2B 1AXSB 2F5BL 3FT2A 4OGAD 4U6HB 1NCCH 5HI5C 4XRCA 3GMOA 4DQOH 1QO3A 4JZNB 2HKHH 3LPGA 4X0KA 2L0DA 3HAEA 4XI5C 2VZ3A 4XPBH 3EOTH 2VAAA 4MNGE 4UILL 4Z95L 6CGTA 1NQBA 4U1JB 1EHLL 1AI1H 2AEQL 4LPYA 1X44A 3MRLB 4AEIL 4XP5L 5DZOA 4OCRH 3F12B 3RWFA 1VHPA 5D1QD 3CGTA 5CHNB 5IUSA 3QO0A 1U2CA 1SJEB 3SCMB 1Q9WA 4P9MH 1E28B 3QUZB 2W07A 2XFXA 3NABH 2VXSH 3H9SD 1RIVH 3NGBB 5FYJL 4TNVK 1D5MB 2XPGB 3U6RB 4X99A 5CS7A 2CR3A 3EDKA 5JORA 1AP2B 3EOYG 3DX8B 3FQUB 4R4BB 4G42B 4X6CE 5JXEC 2CIKA 4ODXB 1S8DA 2UZYB 5KN5B 3E8UL 5JPMA 3KLSA 2KKQA 2A9NH 4KHTL 1KLFA 1OPGL 4IOFC 1RUKH 2DKSA 3QBTB 4L4VE 4IIQC 1CU4H 1NANI 4NBYB 5DK3A 2D2OA 3HS0B 4Z0XA 4R0LB 4X6EB 3LKPB 2YA1A 3F7YA 5CJOL 3FO0L 3U4EB 15C8L 2XN9E 3T1WA 4X4XB 4NKMB 4GG6B 2DQDH 2PTVA 1AD0B 4L3CA 2ICEB 4KROD 3CFEA 3BJ91 5C07E 2KQNA 1TQCC 1QD0A 3IJSB 1WFUA 3U4BL 2W65A 2VO5A 2BNUB 2HG5A 5L8LB 1CDBA 4PREB 4N0CD 4ODVH 3OJMB 4X5XB 2YS4A 4AT6A 1T80A 3RA7H 3VI3E 5E99H 2AJUL 4K23H 4NRZA 5J3HD 3MJ9H 2WBJA 2K1MA 3HC0A 2XQYK 3WHXB 3BGFB 3QXAB 1J1XH 2BNRD 3G6AB 1BFOB 5ELIA 1OVZA 3CNKA 3SGKA 5JHDA 4O5LL 4XNYH 3HKFA 4CMHC 4HIXH 3RWDA 4WUUD 5IFHL 2FL5A 1H3UA 2B5IC 3MGTA 4ONFL 5IIEB 1KLUB 4NBZB 1QFWL 1BVLB 1MREL 1KC5L 1MSPA 25C8H 5E8PB 4MHHI 4A6YL 1J86A 2IG2H 3LQAL 2V2WB 3UJJL 3SKJL 5LBSL 5DD1L 3PQYB 1F4AA 4BJLA 5EC1A 1JTOA 4HPYH 1E4XH 1BD2E 1IGTA 4KJQC 4PB0H 5D1QC 4TVPH 1BGXH 3GSOB 5D6DA 4N5EC 4PJHA 2AV7A 4YPJA 3S4SG 1KCVH 3ARPA 4YC2B 1RK0A 5FKAA 4LCUB 3QHFL 1ORSA 2GJ6A 3BAEL 2PCPB 1VFAB 3BKYL 4Y0GA 4LVHB 1YEKH 3B9DA 4GOSA 2ITCA 4Z77A 3V9FA 1DEEB 2CMRH 2UUDH 1GC1H 1PKQA 2BSTA 3QULA 1YPZB 4U3XA 3QO1A 3GBMH 3HMXA 5F71A 1C5DB 4HC1L 2GKIA 2PTUA 5C08E 4JM2D 3TVMC 3LN5B 4O2CB 4X6DA 1BLNB 3MNVB 1F90L 4D0BA 3X3GH 5CAYB 1A6UH 2I07B 4X98A 2DB8A 1YEDB 5F72S 3W9DB 5CZVH 5JR1L 3CLFL 2Y1VA 1LEGA 3W9EB 4XMPL 1FVDA 1QFWI 4WI5A 5HD8D 4BH7A 3BIKB 1X7QA 4HKXB 4LF3B 3Q6FA 3RL1B 2NXYB 2V2TA 1B6UA 1QSEA 5IV2A 3OGCA 4ZO6A 1VFMA 1A6TB 4ELMB 4YAQA 4GH7B 4LCCC 3MLPA 2VDQH 2JCCE 4YHOL 4XWGH 1CXFA 3REWA 1D5XA 5T1KB 3WUWG 4YO0A 1SJVA 2R69H 4LHUB 5HPMB 3LS4H 3DXAA 4FMKA 3VFVB 4K3JH 1FGNL 5I1LA 3LQZB 2OJZL 3IJHB 1FLTX 4P2QA 1GRWA 2XWJB 1D5IL 4NWTH 4GRMA 4HWZB 4ZUTB 2GSGB 1T2JA 3MUGB 4JN1L 1S7RA 1XF4B 3L3GB 1R0AL 5DJXA 4LHJB 5ADOH 4KKAD 3EFDL 4KKCC 3OKYA 1XGQA 4WVRA 1QZ1A 4YDKL 4OV5B 3DROB 3OB8A 1PAMA 1YNTA 4RFNC 1N4XL 2VWEE 4WHTB 3V7MA 1A1OA 1KEMH 4N9OB 3U7AA 1KG0A 2GIYA 3CVHA 4IIQB 4N0UE 2WQ8A 4YHPB 1HDMB 3S9DB 1OAUL 1QBAA 3OXSB 4NQDA 5TE6L 3RWJA 1I9RH 4YIQA 3ZTNH 4RZCB 4F37K 1ZEAH 4DN3L 3RNKB 1U8NA 3SKMA 3VWKA 3AMKA 1TQCB 4ZFFB 3OZ9H 3RY6C 1Z5LB 5C86A 3EO9L 2IWGA 4OIIL 4K7PH 5DLML 3KXFD 3RX7A 4LCIL 4HIIA 4JM2C 2XG4A 1JPTH 2X09A 3N1MC 1GGUA 1FYTB 1TENA 3VGFA 5H35A 1XEDA 3CPLB 3BEVB 3NZHL 2IBBA 3ALPA 4IMLA 3PP4H 2GFBA 4ZUSB 1NDMA 1NGPH 1MWAL 1VPOL 4CMHB 4NOBA 5DDHA 2PF6A 3UP1A 2FYYB 2B5IB 4OZGB 1AGEA 3KYNA 1KB5A 3LVEA 4NFCA 4UINH 3TV3L 3VI4E 3X14B 3MA7A 3RI5K 1JI1A 2BOBA 2R9HD 4GBXA 2WBKA 1EK3A 4HMDA 4PJGA 2APXA 3BFOA 1NCNA 2DOCA 5J12C 1BBDL 3U1SH 5ICYB 3DO7B 2O5YH 4XAKD 4W6XB 5IVNA 5D1QB 1KGCE 3K81A 5I2IA 1MHEB 3H3KA 3PG2A 4FP8H 8CGTA 3UPAA 4J1UB 5D7SL 1JBJA 3N1PC 4I5BA 4ENED 4OAWA 3C60C 3NA4A 5J6HB 5I8CA 3CDGA 1LK2A 1AXSA 1P6FA 4U6HA 1XCQB 4FRWA 4I77H 4KKAC 3N85L 4JZNA 2HTLC 2PW1B 4ZS7H 1KCRH 4QXUL 1FAIL 4EBQL 3L3JB 4Q9BA 1JMXA 4YFLI 4ODSH 3UO1H 1J8HE 5JLZA 2DBLL 3MV8D 2HA1A 3MRLA 4HFUH 3TVMB 4MJ4A 4EDXB 3QDGE 4ZG1A 5KVDH 3F12A 2Z4QB 5D70L 1SJEA 3SCMA 4JFFD 4U4BA 2WINB 1NMAH 3U4AA 4BA8A 4MAUH 2J5LC 3T2PA 3FTGA 3TT1H 3U6RA 1JNLL 2BY2A 2D7TL 5LCVL 4C57C 3IYLW 2FEDD 3PGFL 2D4FA 2H32H 1AP2A 1NSNH 4R4BA 1AY1L 3T4AA 3O6MH 4AH2B 2VDPH 3HNVL 5KN5A 3JUYA 4KUZL 1SBSH 4LDEB 4LCCB 1WZ1H 3FN9A 3RZWA 2OMNA 3A67H 3ZMRA 2BNRB 3EAKA 2AJZB 2CR6A 3MV7D 2B8OT 1OTUD 4WUUB 3WIIL 1P4BL 2X44D 3HS0A 3NFSL 1OLZA 4R0LA 4X6EA 3LKPA 1QFHA 3U4EA 3I6LE 1NEZB 1KN4H 1FNSH 5CLWA 4X4XA 4NKMA 4HCRA 4GG6A 4E9LA 4OLZH 2VDOL 3MXVL 3FQWB 3QFJB 3TIDB 2MPAH 2ICEA 4CNIB 2A77H 4FABL 4KGJA 4F58L 2ATKA 1LO3H 1M7IB 4JQVC 3IJSA 4WTWA 4LVEA 3DVIA 2BNUA 4TYUA 2P4AB 1EO5A 3UPCA 4PREA 4N8CL 5EBLB 5DHVB 2Q6WB 4RFNB 1OAXL 1QLEL 4F33B 4AY0A 4X5XA 1BOYA 4HPOH 3WHXA 1BECA 4V1DD 3QXAA 5BOZG 3E6FB 2Q8BL 3PHOB 4LPVA 4OI7A 1BFOA 1HHIB 3O2WH 2FR4B 5SX5H 4PJ5B 4WI9A 3TBWB 2FJGB 3I6KA 1YEHH 4OGXL 1KLUA 5IIEA 3IFLH 1BFVH 1BVLA 1BQHG 4JFHD 5E8PA 3FQNB 2AXGB 1IZJA 4G5ZH 2V2WA 3V5HB 2VLLA 4XP6L 4JM2B 3V4UL 3PQYA 5EZIH 1JZ7A 4PJEA 4U7MA 2AS5M 1A7QH 2R39A 2C26A 3SHSA 1HWGB 4GQ9L 1KFAH 1CLCA 2QQKL 3GSOA 3O4LE 3EJZD 1RI8A 3OGOE 2VB5A 3VG0L 3SE8L 1ZKAA 4LCUA 2DQFB 3NCJL 2PCPA 5EOQH 1JMZA 2EYTA 3MTRA 5TFSH 1CFQB 5EO1B 4BKLB 5DWUL 4NGHL 2ARJQ 5DUMH 2IAMC 4OCXH 5GGRB 1RURH 1UXSA 3OAZH 2W0LA 1BMGA 1S7VB 1DEEA 5J12B 3I2CH 4WI8A 1C5DA 2CKBH 4U6YB 5IVXB 1JI2A 4QRQB 4NP4L 3VXSD 1ZGLP 2HKHL 1HIMH 4N90D 4OBRA 3LN5A 4O2CA 3MNVA 4PP1D 4DFIA 1ZLWK 1CE6B 3MACH 1C5BL 5B38G 4BQ6A 2I07A 1AI1L 1YEDA 5E7FA 3VW3L 1KIUA 3W9DA 3VXTB 4OCRL 3LH2H 4DKAA 1G1YA 1F3RB 4JKKA 4JKPL 3MRCB 4LLVB 2GI7A 3BIKA 2XY2A 4HKXA 2BNQE 4LF3A 1FZJB 1RIVL 4I4WB 3RL1A 1NH6A 4NQCE 1GVIA 5F1IB 1A6TA 4ELMA 1OM3H 1KYOK 5T1KA 1Y6NR 4WY7H 4LHUA 5HPMA 3HFML 4CJ0A 2VLJE 4G8FB 1DQJB 4XPAH 3WXVL 4ONGH 3VFVA 4F7MB 3LQZA 2A9NL 1I9EA 2J5LB 3LKOA 3IJHA 1RUKL 1A1NB 3VFGL 5GS0H 4KZDH 5TQ0H 3O3UN 1WGOA 4HWZA 5D72H 2GSGA 1J1OH 1FNGA 1TDQA 3MUGA 4JPIB 1XF4A 3L3GA 1CU4L 3B5TA 2FX8L 4TRPH 1CGWA 1NGWA 4BQBA 3MV9D 3FB8B 2Y23A 3MBXH 4K3DL 5JXEA 2WBWB 1EHAA 5FK9B 3EOAB 3O3BB 4CW1B 4JO4H 3D39B 4FQ1L 3UPRA 4IIQA 1GJIA 3QQ4B 4YHPA 1HDMA 2NMSA 4OGZA 5F9OH 3OXSA 4RBPK 2NY1D 5IGXL 4FOMA 4RZCA 5EDXA 2EDKA 2H2PC 4NC1E 1FFOB 5CGYD 4JHZA 3STBA 3RA7L 3RNKA 4XBPB 5E99L 1WVZA 1LHZA 4JY6A 3MJ9L 2B2XH 5C0CD 4ZFFA 2FBJL 1KJMB 1J1XL 4HUNB 1Z5LA 3V6ZA 4QGYA 1MJ7L 1JHLH 5GISL 3K74B 4U6VH 4HWBH 3FRUA 1FYTA 1UACH 25C8L 4G8IB 1DE4B 3P73B 4YGVB 4XVTL 4U0RC 3BEVA 4YQXL 1J8KA 4LSTH 4J3UA 4NN5C 1KTRL 4PG9A 4ZUSA 1H3TA 3L3IA 1CN4A 2VXVH 1BGXL 1CS6A 2FYYA 2J2ZA 1DL7L 3NCFB 4PUBH 3X14A 4UIKH 5CD5C 3MQIA 1A6WH 1JNHB 4R3SB 5FYKD 5E1HB 3KPPB 3MV8B 3VDBA 3DO7A 3BWUC 1RZFH 2V17L 4XB8A 3QJFA 1BPVA 1FSKC 5D1QA 5IESH 1YEKL 1DTUA 3OKKB 4XH2B 1MHEA 4GXUM 3LRHA 3N9GH 4Y1AD 4MVBC 1JGVL 3MPCA 5IJVB 4N5EA 2Y5TB 1C8PA 4U2YA 5KVEH 1GC1L 1LD9B 1CGYA 4K55A 4J1UA 1O7VA 3BISA 5D9SB 5J6HA 4HLZH 2V5MA 3V6BR 3C2AL 1XCQA 5A3ID 2VZSA 1ETZB 1HE7A 2IAMB 3E2HC 3P4MB 3X3GL 3QDME 1A6UL 1V05A 2PW1A 5GS3A 4OQTA 4KTYA 5CZVL 4UNTA 4L4TD 5DC0A 1LEIA 1ULVA 2XA8H 3AROA 3L3JA 1U3JA 4QOKD 1KPVB 4TQEL 3T0AA 5B39G 3TVMA 4EDXA 2E27L 2HJKB 2RB8A 2XWTA 1A7RL 2Z4QA 1K3ZA 3MUJA 3DO3A 3QP3A 1E4XI 2VZOA 3KR3H 4JQIH 2VDQL 4N8VG 1I9JH 2VXTH 2AABH 4NQEE 5DRWB 4HW6A 2I9LB 3ZT6A 1JPFB 1VFUA 1HQRB 4OM1H 1X5HA 2RFXB 4K2UL 4FQXA 3OMZA 5CKAA 3LKQB 4MCYB 4AH2A 4NWTL 4EKXA 4LCCA 1WWBX 4PJ8C 4QXWA 4Z7NE 2YKLL 3QUXC 5KBNC 3FB6B 1MFEL 2AJZA 4P5KA 2VN4A 2VJXA 3K0WA 4ZUVA 2ZPKH 5FYLD 4P23D 3HAEG 2VLMD 3LDBC 1NEZA 3GSNB 4M02A 5C1MB 3D85B 5F9AC 3DHMA 3FQWA 3QFJA 3S36X 1QRND 1DANT 4NUGH 5ETUB 1M7IA 4TSBH 1ZEAL 5DRNB 1S9KC 5KOVC 5EBLA 1FFPA 3UTPE 3ARTA 5DHVA 2VQUA 2Q6WA 2BHYA 4F33A 3KDMB 1TPXC 3OZ9L 5JOPD 4MQTB 5KAQF 4IMKA 4P99A 2DJSA 4JFPB 5IB1B 4PBXA 5GSRB 3TNNB 5BZWB 3PHOA 2DJ4A 5DQDH 1AFVH 4XAWH 1HHIA 4CGTA 4GS7C 4PGBB 1QEWB 4PJ5A 3HTLX 3TBWA 1BZQK 1ADQL 1LE9B 1T6VN 5JUEH 1L9NA 1NGPL 3RY6A 2AXGA 1RK1B 4XVUD 2CSPA 4P9HC 5BJTB 4JM2A 4PRIB 2OTUB 4DCQB 2HVKA 1IAIM 3PHQB 3RX5A 2IPUG 4O51B 1MIMH 4IRSC 5ANMB 4FFEX 3BKCH 4CN6A 1FQ9C 3VFPA 2VC2L 4U0RB 5B3NA 2BK8A 2DLFH 4NN5B 4KMTH 4J3SA 2OL3H 1CGUA 3DSFH 3LEYH 5HYFA 5DO2D 1UZ6E 4Z5RB 4U3HA 4XXCC 4M6OH 2A9MH 1CFQA 3VDAA 4PR5B 3EO0B 5EO1A 4BKLA 4FP8L 5HHVH 3GM0A 5GGRA 4H5SB 2ED8A 2CRYA 5E2WH 1S7VA 4XXDB 5IVZB 4NFDA 1V7ML 1YQVL 5IB5B 1MNUH 5CWSB 3VA6A 2CRZA 5JMRA 4I77L 4JGMA 3T65A 4NC0B 4U6YA 5IVXA 1FSKB 2IADB 2NR6D 4QRQA 3O2VH 4L3ED 5BO1H 4D9RD 4JN2B 3QUMB 5ACMA 4JHWH 2DQTH 1CE6A 4I3SL 1YJDH 4ODTH 3C60A 5JHDE 1E4WL 5DJAB 3UO1L 3MNWB 4B0MM 1BWMA 1IFHH 1OWWA 4HFUL 4YK4C 2YHGA 3VXTA 3AS1A 3IU3B 5KVDL 3WD5H 4Z0BL 4OZIB 1U8MB 3HB3C 3E2HB 4LLVA 3MRCA 4JDVB 4MZ3A 4G6AC 1F4HA 1FZJA 3RTQD 4I4WA 3GBNL 3ISWA 2YN3A 4MAUL 2YD2A 5F1IA 5DUPH 2EIDA 1WBYB 3IB4A 3D1MC 3MJ8B 5E9DD 4PJHE 1IGCH 1AXIB 3MV01 3IFOB 2RCSL 2VDPL 2GJ6E 1DQJA 5F6IC 1SBSL 5IJKA 3DUHA 4G7YH 4F7MA 1WZ1L 2DI8A 3MLWH 3HZKB 3A67L 4S0UC 1N64L 1A1NA 1CICD 4RAUB 2X1PA 4JPIA 3HAEH 4YXLH 4EIGB 2J6EH 1PKQE 4DJMA 2BVUA 4NDMB 5HHNB 1IAKB 1KN4L 1FNSL 3FOMB 4RA3A 4OLZL 3BEWB 3UYPA 4LLUB 4QXTB 4CL7A 1N2RB 4PFEA 3O3BA 4PJ8B 5HBBA 4X6DE 2WZPD 4LSRH 4CW1A 3D39A 2HH0H 3QUXB 4G6JL 2EXYD 5CP3H 3HNTH 4ZMAT 4Y16A 4PG2C 4JRWA 5D2NC 1Q1JH 2RGSA 5T1DH 1QSFB 2MQ0A 3LDBB 4LASH 1FFOA 3S35X 4XBPA 2VNCA 1MFDL 3RKDD 3MZGB 2VXUL 1UCTA 1R5WB 1I3VA 4OZIF 3SDAC 1QSEE 4QRTB 3VFNB 3AU1B 4JQVA 5TDOB 1CYGA 3QXTA 3ZE0F 3KLDA 2YRLA 4ZODA 4ESKA 3PIQB 4JO2H 3TYFB 2BC4B 3DV4B 3IFLL 1BFVL 5D1XC 4NRXB 5BW7A 4JJ5A 1TPXB 4G8IA 3P73A 4YGVA 3G5ZB 3P4OA 3DXAE 5J06A 2FNBA 4Q0XL 5EZIL 4NM4H 3RUGB 3VFOB 1A7QL 3VXMD 2AJVL 2Z92B 3C5ZC 5GRVL 4JFOB 4DUXA 4GS7B 3GMMB 1MCBA 1KFAL 1E6JH 5I19L 3K8MA 4G3YH 5DJDB 3C87A 4FTVB 3TBSB 1JNHA 4R3SA 5J6GB 2XXMB 4PGJA 3ULVD 4MA7H 1Q9LB 4QOKB 3MGOB 2AAVA 2DQIL 3KPPA 4IRSB 5HHOB 3ZYOA 2E6QA 5C6PB 5F7NC 1CTNA 3AMLA 3PL6D 3BPOB 3OKKA 4K3HA 4OCXL 4XH2A 3U7WL 1WFTA 3NTCL 5IJVA 2Y5TA 4E42A 4NQDE 1M05B 1NL0H 5D9SA 3J7HA 3I2CL 3MOAL 4Q97A 3JWDH 2J3SA 1CICC 2D9QB 2P42B 1LQSR 1HIML 1ETZA 4N1HB 3ZYIA 2IAMA 3GMRB 3P4MA 3S37L 4CBPA 4OLWH 5L9DH 3JWOC 2YMXH 3N50A 2YBRB 4PJDF 1JF5A 5GGUB 2F8VA 4C54A 4DOHE 3LH2L 5HYJB 4WEMB 5F7WC 5DMJB 2XXCB 5HYSB 5FUCE 3WNKA 2HJKA 1BJ1H 4LRNH 2XTJD 3U7YL 4XWOC 5IBUG 2P5ED 4YK4B 4NKDB 2W0FB 2WIIB 3JVGC 1D6EB 2E7CA 1OM3L 2EDHA 2FX9L 1BZ9B 3EYSH 1BWWA 3WS3B 5I1KH 5DRWA 1FCGA 4PJGE 5DA0B 2ZCLL 1JPFA 2VZVA 1XR9B 1HQRA 3QUKB 4ONGL 1B4JL 5K9QG 3MLZL 1LNUB 2OP4H 3LKQA 1NBZB 4MCYA 5GS0L 4KZDL 1KCLA 2IQ9L 2IQAB 5FA3B 2EEDA 5FYKU 5F9DC 1I1FB 5TF0A 3NIGE 1IM3A 1B0RB 5HHQB 3MBXL 4MWFB 3JV4B 5F6IB 1ZTXL 4NQXA 3MA9H 5FXCH 3GSNA 4JO4L 4TUOB 3D85A 3ULVC 1QFUL 5HVHC 3FT4B 1AE6H 1JGLH 5C0BB 5DMGC 5ETUA 5LXGL 5AWNL 1IILE 1MJUH 2B0SH 3PL6C 5DRNA 2NTSP 4Z78B 1K9TA 4M3JA 1EFXB 2IFGA 3KDMA 1RZJC 1RZIB 5ALCL 3UDWC 1JHLL 4JFPA 5IB1A 5I1HH 2VDMH 5I6XC 5GSRA 4J12A 1QYGL 3L5XH 1NGYB 1W72B 1CF8L 4HWBL 3TNNA 5BZWA 4J2XA 4L9LC 1YY8B 2CLVB 1UACL 1X6LA 4LPCA 4PGBA 1QEWA 4RMVA 1M6OB 3EJYC 2DM4A 1LE9A 3LPFA 1Q9OB 3ULUF 3SDAB 3O9WD 3RAJH 1RK1A 1ND0B 3M1BB 2N56A 5GZOC 5BJTA 4PRIA 5DMIH 2PO6D 3H3BC 4RFOL 4XCFL 4DCQA 2JELH 4PUBL 4O51A 5ANMA 4GXUN 3VXRA 1A6WL 2EXWD 5F6HI 2XTJC 5SX4H 4ELKB 4MZ2A 2NW3B 2WSKA 4OLUL 1RZFL 1A6AB 4GG6E 1LEKB 4Z5RA 1EEZB 4JCLA 3N9GL 2R56L 4PR5A 3EO0A 4G9FB 5KVEL 4WHYG 3LKSB 3W11C 1E6OH 3M17B 1WK0A 4QRRD 1EJOL 3MNZB 3MLSH 4H5SA 2EC8A 1YA5A 1U8PA 4PRPD 1ZLUH 4MQXD 1KTLB 5HDLA 5CWSA 4N0RA 3VH8B 1SY6A 1CIUA 1CK0L 4X7EC 2IADA 3ARSA 4QHUB 3ULSB 3H2WA 4JN2A 3QUMA 3GRWA 4MVBA 2EE2A 4YHKH 4CU8A 2C1OB 5T3XE 2E9WA 2XA8L 1XIWD 5DJAA 5DVKA 1LO4H 1W8OA 3MNWA 1CICB 5IFAH 2IALA 1WZLA 1KB5H 4KKBC 3IU3A 2MTPA 3O6LL 1U8MA 3LKRB 3E2HA 4JDVA 3MO1B 3PQYE 4PJEE 5I8OH 3TZVC 3BQUC 1MELA 1WBYA 3ZE1E 5DVMA 4NQUA 3IDYC 4UT6L 2X40A 4LKCA 5LKNA 1DUYB 4XVSH 2GYSA 4PD4J 5GRJH 4P49A 4Y2DA 3WFHB 4UT7H 1EHNA 3HZKA 5ABDE 4BUGA 1A21A 4RAUA 3MRQB 4KTEH 2ZPKL 4Z7UB 3HUJF 3IKKA 1NFDB 1KCUH 4NDMA 5HHNA 1CBVH 1IAKA 3FOMA 3KPOA 5SV3A 3BEWA 5CGTA 4LLUA 2D0GA 4QXTA 1N2RA 2YUXA 3LIZH 4IHOB 4PJ8A 1A4JB 4GG8A 4K8RD 3QUXA 1PGRB 1SM3H 3TGXA 4NZJA 1QSFA 1DJSA 3G04A 4YHLH 1AIFB 1IM9A 5HVHB 4YE4L 4MQXC 2OR7A 1JN6B 4QRTA 3VFNA 3AU1A 4XNXL 5TDOA 3IDNB 3BSZH 4GAYB 3PL6B 1WQVT 4ELME 3PIQA 5SWSB 2BC4A 3DV4A 4J3VA 4NRXA 2DDQH 1MJ8L 1F6FB 3AS3A 4PJCF 4ZO9A 4JM4H 1P84J 4Y19D 3QIUC 1JYWA 3G5ZA 5I6XB 4U6XB 5BV7L 1Y6MR 3AY4C 2ZNXA 3CFKB 4L9LB 2X1XR 2Z92A 3DRTB 4JFOA 4S0SD 5IQ9A 3GMMA 2DQEH 4HCRH 3EYFB 4JLRB 2ATPA 3RKPA 2Y06L 5DJDA 3TH4T 1JZ4A 2CK0L 4FTVA 4C56A 5J6GA 3DSFL 1Q9LA 5JMOC 4QOKA 3MGOA 3V4PH 4XNUH 2WY3A 2C3GA 4J3OC 4M6OL 2A9ML 4WHYH 4JFZL 3NFPB 5A1AA 3O45B 4J8RA 3ILQD 4IRSA 5HHOA 5ALBH 2YPLD 1WT5C 3H3PL 2HP4A 4Z7VF 2XTJB 4WEUD 5EU4B 4DW2H 4JPVH 4XPFH 1Q0YH 5E2WL 3V5KB 1UH3A 1M05A 1GZQB 1CDYA 1WF5A 5GJSH 3VFRB 5GGTA 5C0FB 1L4IA 1Q8MA 5TE7H 5D7KD 4FQLL 3OKEB 4S1QH 1ZANH 3CFJB 4XXCA 1DR9A 1MCEA 5F7YC 2QHRH 5DHXB 3OG6B 5ICZB 4JHWL 2ADGB 2DQTL 3ARED 1YJDL 3GMRA 3RPKA 4QRPB 2NPLX 1IFHL 2YBRA 3ROOB 5GGUA 3GSQB 1YY9D 3NN8A 5F89B 5HI4C 3TJEL 1FYTE 5HYJA 4M1DH 4YZFF 4KZEL 2J8UF 1F4WL 3L95B 4F7TA 1BFSA 2XG5A 3KNBA 3B5GA 3E0GA 2BVQB 1G84A 1HCFX 4U1NB 4NKDA 1I9IL 2W0FA 1QBBA 1D6EA 2WIIA 1IGCL 1F3JA 4KI5D 4U1GC 4R7DB 3WS3A 2YD5A 1AKJB 1MCPL 1G7MB 3BX7C 4DUVA 2FATH 3QUKA 4FNLH 3MLWL 3TZVB 5C09B 2C7UB 1IEBB 2YSSB 4H8WH 1AJ7L 1J7VR 5M7QA 1LNUA 3BQUB 3NCEB 4FQPA 2IQAA 5FA3A 4LQFH 5IHZB 1R5VB 4LLQB 2FH8A 1I1FA 4A2LA 2N1KA 1MCHA 2J6EL 3IDYB 5C6TH 4TVPD 3WKML 2EE6A 1B0RA 5HHQA 1AR1C 4KPHH 3WFDH 2MQ3A 4MWFA 3JV4A 4ZS6D 3NFNA 3B8SA 3JV5A 3PGCB 3OKMB 4LSRL 5GPRA 3O9WB 4YFLF 1IT9H 4TUOA 3QCVH 3UZEA 1TCRA 4O2FB 3HNTL 1NUNB 5D6CB 2P5WD 2QADC 1K4CB 3BIBX 5C0BA 1IGYB 4O02L 1JF6A 5T1DL 2FECI 2Z91B 3ILQC 2NNAB 5FFLA 4Z7OF 4O58H 1PD6A 4Z78A 1AXTL 5IOPA 1DQQB 1EFXA 4R26L 5HYEA 3B43A 1HINH 4HD9A 4WFEE 4DGVH 5EOCL 2BFVH 5CJQH 1RZIA 3QCUL 4M5YH 2Y07L 4OFKA 1HNGA 1S7TB 4Z7QF 3U9PH 1NGYA 4PG2A 1W72A 3MROB 5D2NA 1W0YT 4QY8A 2CLVA 3BD3A 2I27N 3PDGA 3NACH 4QRRB 1AC6A 5F7UA 5HHXH 4KK9D 1M6OA 1BIHA 1W0VB 5KSAC 3NPSC 3FMGH 4WHCA 2BJMH 4PRPB 1Q9OA 3DBXB 1Z0MA 4ZNCD 3SDAA 5IMOB 2PYEB 1ND0A 2HT2D 4OLXL 1E6JL 2J1KA 3C6SB 4YWGH 5EUOB 1I1YB 1IC5L 5D1XA 4DWHA 2AI0H 3QIUB 1GHFL 2NW3A 3TBTA 4L4VD 4L8SC 2H8PB 1U9KA 2IC2A 4LOUC 1INDH 3C5ZA 1Y0LB 1FJ1B 1N6QH 1EEZA 3P0YH 2FLRT 4GRLD 1YNLH 3QFJE 2XN9D 2MOVA 4G9FA 3LKSA 3VWJD 1M1SA 3VGBA 1NL0L 4NKQB 3M17A 4R2GC 1OF2B 1XT5A 5I1EL 3MNZA 3BD5A 5C07D 3JWDL 4X7DC 5F7EH 4FFZL 5F7MC 1KTLA 1QP1A 3QEHB 5JDJA 3WIHL 3SJVB 3VH8A 5SWZA 3CX5K 5D7LA 4J3XA 4QHUA 5L9DL 3ULSA 4C59B 2YMXL 1V5JA 1WAAF 2ESVB 2X70B 4KJYB 3WFCH 2C1OA 1A5FL 1EH9A 4ONOA 3BUYB 4M43H 4PJ5E 2GCYB 5GSVB 3KJ6H 1I7ZA 4KKLC 3D0VB 4MDIB 3GBLA 5A2LH 1TQBC 4LRNL 1G1CA 3IXAB 4OF6A 5IK3B 2J88H 4EUPA 3LKRA 4XB7A 2UV3A 1J0YA 3MO1A 3PXJA 1X5YA 3UJIH 4YFDB 5J89A 3AS0A 5ADPH 3EYSL 5I1KL 4JKMA 3KPQB 1BD2D 1XGUB 1UM4H 3RWGB 3GIZH 4QHNB 4V2BA 1NBQA 2XI9A 4NHUB 1NFKA 4PJBF 2OP4L 1DUYA 4KK9C 5DJZB 3MRGB 3S5LG 5E6IA 3BRFA 3D25B 3WFHA 5MERB 1NCAH 3K8KA 3JVGA 1FZMB 1MUJB 4Y5XC 1S7UB 4U1GB 2FIKB 4OQTH 4Z7UA 5B3JF 1NFDA 3BYTA 5IVXE 3UZQA 4EJ1C 2WM0A 3VRLE 1NBVL 4IHOA 2APFA 1JGLL 4MNHB 4F3FB 1A4JA 1F4YH 1LE5B 1OP9A 2WQRA 1BJ1J 5C08D 3RJQB 1NAMB 4XCNB 3JTSA 3QZWG 5JQ6L 2BX5A 1YEFH 2AJXH 2Y5EA 2A0LD 1BM3H 5I1AA 1ZVSB 3AUVA 4D9LL 2BXZA 4YGAB 1MQKL 5E24E 2HKFH 3RIFK 3S96B 1AIFA 3RWCA 3RL2B 1ONQB 1UYWH 3IDUA 4Y4FD 3W2DH 2QADB 2V9RA 1Z3GL 4Y88A 3L5XL 1A6ZA 3IDNA 2PNDA 2YPLB 3KVQA 4QTIH 4R90H 1MH5A 4GAYA 3PL6A 1D5BB 4HK3N 5SWSA 2HTKC 4X9HA 4APQC 1PBYA 1UFUA 2QSVA 3UDWA 4MXQA 5DMIL 3T0DA 4NN6C 4U6XA 3O4OC 5FGRA 3V0WL 1JHTB 4NM8H 3DGCR 4L9LA 3CFKA 3DRTA 5EU5A 1TZIB 4JRXB 1MFCH 3EYFA 4L5FL 2E6PA 3DLQR 4JLRA 5J1SC 4OKDA 2XV6B 5KSAB 3NPSB 2E8ZA 4NOFA 4KY1L 1L7IL 2DQUH 1AGFB 4PDCE 1EVUA 1VDGA 5DHVH 3NFPA 3O45A 1DLFH 5MEPB 2HMID 3KPMB 1E6OL 3D39E 5KOMC 5EU4A 1S9XB 4MA3B 4D2NA 3V5KA 2HYMA 1Z6JT 3SKNB 4L8SB 3SE4C 4QYOB 1JFQL 2BVPB 4GW5B 1YNKH 4UDTB 3MJGX 3OKEA 1F8TH 3CFJA 4RX4D 3ARYA 1AGBA 3WCYA 2VQ1B 4QHKJ 4W4NA 5ICZA 2G60L 4KI1A 4YHKL 2ADGA 3DMMD 1INQB 3QEGL 4R2GB 5TPWH 4IEFB 3P4NB 3X11B 3O8XD 4QRPA 1CD1A 1LO4L 2V9TA 5I73C 1S5IH 3F58H 4X6FB 3ROOA 5IFAL 1K8DB 3GSQA 5F89A 5FHBH 3T3PE 1Y6KR 3INUL 4QHKI 1VSCA 4H1LB 3ZDYE 3L95A 2WANA 3O2DA 1MAJA 1MCSA 1U3ZA 3OAYK 5DI8B 1Q94B 1CLZH 2R0KL 1S78C 4KJWC 1Z9OA 2BVQA 3N1GC 2W60B 4U1NA 2VZ1A 4JRYB 1SEQH 5J1AA 2P5WB 2V7HA 2E7LC 4I8DA 1TQBB 1LO5B 4R7DA 1UH2A 1AKJA 1G7MA 4HUMB 3F6LA 3TYGH 4ZOCA 2UUDK 2ED7A 2JTDA 3TZVA 5C09A 2C7UA 1IEBA 2YSSA 1G9MH 4M4RA 4MSWA 4RGOL 2A6JB 4YBQD 2AJSH 3BQUA 2VLKB 4QLRA 4KTEL 5IHZA 5GZNC 3AGVA 4LLQA 1WWCA 4WCYH 1KGCD 1KCUL 3SO5A 1CD0A 5F21B 1HHKB 2H2SD 4A2MA 4DKDC 1U6AH 1BBJB 3MOQA 3PGCA 3OKMA 3W5MA 3VCLB 4KI5F 4XPGL 1A6VH 3SDDD 4MMZC 4N8PA 4Y5XB 1RZ7L 4O2FA 5D6CA 1E27B 3PWPD 1IGYA 4FFYH 5FV2A 3VD9A 2G5RA 3HZYB 3PP3H 2HMIC 3L5IA 5EA0H 4YHLL 2NNAA 2VAJA 1EAPB 3U0WH 5BVJA 3HPJB 1T1WB 3CLEH 5DVNA 3RVTC 4XMLL 1DQQA 2FWOB 4U05A 4L4VB 1J8HD 2IH3B 3H7BB 1KN2L 4X5LA 4F8TA 3T09A 2X7LA 3MROA 3OF6A 3DMMC 3VD5A 3VWJB 1CT8B 5FHAL 4WO4D 2FX7H 5DD0L 3RDTD 4HXBH 1UVQB 4PRPA 3DBXA 5GJTH 5IMOA 1JYXA 3ZDZE 2PYEA 5C71A 1F4XH 2DQEL 5BMFL 4QF1B 3ZL4H 3C6SA 3NIDF 3RU8L 5EUOA 1I1YA 2R1WB 3BT2L 4UB0H 4APQB 1RUPH 4E0RB 2XZAL 3UYRH 1P2CB 4S1DD 3TFKC 2AGJH 3QIUA 3V4PL 3E1F1 4ZAKC 4NN6B 1EGJH 3O4OB 4NKIH 3AY4A 2H8PA 3LEXA 1Y0LA 4JFHE 1FJ1A 1A2YB 2X1QA 4TN9A 5BRZB 2ED9A 2B1HL 1GPOH 4HKBB 2RQ8A 4JPVL 4XPFL 3I6LD 3GNML 1UM5H 4AQ1B 1TVHB 1OF2A 4J4PD 5TE7L 5E70A 1MQ8A 4GFTB 3THMH 3BO8B 4OF8A 2QHRL 2R8SL 2AJYH 3F65A 1BD2B 3QEHA 4X6CF 4BSJA 3SJVA 1ACYL 1GGCL 1WT5A 3N06B 3HE6D 1VFOA 1Q72H 3PF2A 3JXAA 2ESVA 2CQVA 2X70A 4KJYA 2MKWA 4S10A 5ICXA 1F6LL 3SDDC 3SDXB 4OSUH 3BUYA 1R3JB 3CFDB 2K7QA 2LAGB 2GCYA 1YEGH 4BYHA 5JIKA 1CR9H 2ADJB 3IFPB 3D0VA 4MDIA 3IXAA 3V5DB 3BHBA 2CDEB 2ICES 5IK3A 3DECA 2R2EB 1N6UA 3W5NA 5I73B 4LNRB 3KG5A 4WTZA 3ALXA 4PRIE 1NUFA 1UGNA 5T5NG 5EULV 4M93C 5ANME 5B22A 3VXRE 3MRPB 1F5WA 1B4RA 4KRNA 2Q20A 1VEMA 1XGUA 2FATL 3RWGA 3VI3F 4QHNA 4FNLL 1SJXA 3O4LD 4H8WL 4NHUA 2F9BT 4YHNB 3GGWB 2X89D 4JDTH 4YHZL 2P44B 1T7YA 5DJZA 3MRGA 4NJAH 4LQFL 1F11B 3C8HA 1FZMA 5C0AB 1MUJA 2ZOLB 5C6TL 2YRPA 4EI5D 5B21A 3WNNA 2FIKA 2HFGH 1A02N 3GMNB 4S1DC 4K7PX 2HLFC 2WUCH 1NC2D 1IT9L 2Y25A 3H9ZA 3QCVL 1D6VH 2NY5H 3ARUA 4MNHA 1OAZH 4F3FA 2IGFL 1H8NA 4PV9B 5D93B 1K8IB 1LE5A 1B2WH 1NAMA 4FQ2H 4XCNA 4XP9H 1J9CT 1EMTL 3OB0H 1CWVA 5CD3B 4O58L 5I8KH 1ZVSA 3KHQA 4KDTC 3WUWB 1OB1A 4DGVL 3S96A 2BFVL 3RL2A 1ONQA 3PV7A 4X7TB 1RY7B 2YD3A 4UU9B 4HXAH 4BM7A 2BNQD 5HHXL 1D5BA 5C0IB 5ENWB 4NQCD 1EIBA 1OAYH 5KW9H 3WKNA 4N0UB 1G9NL 1X9QA 4RISH 3GSUB 1NC4B 5HI3D 3HC3H 1LWRA 4ZTPH 1JHTA 1H3GA 2A6IB 1I1AD 1IGFL 1TZIA 3B5HA 3DMMB 3GSNH 4JRXA 3OKNB 4ZOBA 1OLLA 4HGWB 4MA8H 5KSAA 4WNQA 1P4IH 1FGVL 1OP5H 1BHGA 1INDL 1B90A 1BIIB 1LVEA 1YNLL 1ZLVK 3KPMA 4U1HB 3MUY1 1I3RB 1S9XA 4MA3A 2JCCF 1UM6H 3SKNA 4L8SA 1QSFE 3BGAA 4QYOA 4MXVE 2BVPA 4GW5A 4UDTA 2JF1A 4KTDL 4WGWB 4EI5C 2B1AH 4XPHH 2VQ1A 4MJIB 3C6LD 2ICCA 4KDWA 1INQA 3X11A 3VFWB 3RVVC 2W9DH 1GOGA 3IKCA 4M43L 4X6FA 3KJ6L 1K8DA 3DYMA 2Q8AH 2GJJA 4PP2B 4DK6A 5GRVK 4H1LA 5HGHB 1IQWL 3H42H 5DI8A 4PGEB 1PQZB 3CSYB 1Q94A 3T04D 2UZIL 4LP5A 3UJIL 3TWCH 4E41B 3SDDB 4N0YH 5ADPL 5EORH 1Q9KA 2W60A 1FNEB 1QTYT 4JRYA 2P5WA 3O0RH 3PWPB 2GT9A 3GIZL 4FTVE 1LO5A 1WBXB 3WJJC 1W0WA 5TE4L 1JL8A 5L88L 2OTPA 4QOKE 3P30H 4H0GA 4LLMB 2JJTC 1KJVB 3SQOL 2C1PB 1B0GB 5HHOE 4LNVA 3A6OA 4M93B 5K9JH 2VLKA 3ZHDA 4FZ8L 3BVNB 4L1HA 4MD4B 3QUMH 5C0NC 2X1OA 5HI3C 1RZKL 4NCC1 3TO2B 3HMWH 1K85A 1I1AC 1BQUA 2B39A 1HYRC 1UT9A 4HWNA 1HHKA 5T5FH 3DX6A 5BCAA 1KACB 1BBJA 2DMCA 3B6SB 3ZTJG 4OZHB 4N1EA 5F96H 4X4MA 3F8UB 1F4YL 4M6NH 4PS4H 4Y5XA 5ILTL 1FL6B 3VI4F 2ICWB 1A8JH 1YEFL 1E27A 4TTDC 3QUYD 1BM3L 3LQAC 4Y5YB 5DRXB 4HKJA 1RPQA 3HZYA 3QDMD 4OCYH 3FAXA 5HYJE 1EAPA 4Z7WB 4WIQA 1JUFB 3GKWH 1T1WA 3TO4D 5DGRA 5F8RC 3X17A 5FYLE 2FWOA 4Q6YA 1NLBH 2IH3A 4KVNL 3H7BA 4PJFB 2NCMA 4QTIL 5DEGA 4LCYB 5LQBL 1FIGH 3OX8B 2DQJL 2V2XB 1P7QB 4GO6B 1FVCB 1GGYA 1D9KD 1CDUA 1JP5A 3L1OH 1UVQA 3E3QC 3MLYL 4MB3A 3QHTC 4QEGA 4NQED 5DEZA 1MFCL 4QF1A 2HWZL 2J4WL 4HUUB 1VERA 3VFMB 2R1WA 4APQA 2DQUL 4E0RA 1P2CA 5JHLH 5INCB 2EDDA 4HIJB 4HWUA 3S3SA 1CLOL 3F7QA 2VR4A 5MI0C 3S37X 1A2YA 5FYKH 2DBJA 1YZZA 4HT1H 5BRZA 1U93B 3OJDB 5C0BE 1X4YA 1DBAH 1FFQA 1YYMH 1TVHA 1YNKL 3HNSL 1F8TL 4PJXA 2AVGA 3BO8A 3IJYB 1NGQH 1HKFA 3ZT7A 1VGKB 2EKSB 2ILLA 5TPWL 3UTPD 3V4VL 5FUOH 3GJEB 2Z8RA 4DKEH 5IW6A 1JYVA 5KSBB 4IRZL 3UTZB 3F58L 5D2NE 1IRAY 4XBEL 5FHBL 3SE4A 4NT6B 3SDXA 1R3JA 2V5SA 3CFDA 1PEZA 1T7XA 3OJ2C 1V7NL 4EI5B 1MPAH 5J56B 3OWEA 1RFDH 2ADJA 3IFPA 1KSRA 2ZG2A 1BQLH 3V5DA 2CDEA 2R2EA 3R1GH 2AQ2A 4LNRA 3FO1B 4D9RE 1ZHBB 2PR4L 4GRWE 3DARA 3MRPA 5GGVY 1U95B 1K3IA 1MRCL 1QQDB 3NAAH 1SMAA 5GGTH 1G9ML 3QWQB 1Z9SA 4YHNA 1BF2A 1TETL 2AJSL 3GGWA 4HX1B 4LDOB 3VFUB 2FIRT 3TCLA 1F11A 2WIMA 1C12B 5B38B 2E7LA 4G9FE 3P9WB 4RRPA 5C0AA 2BSRB 2ZOLA 2AQ1A 2NZ9D 4AMKH 2YOCA 2EDXA 2PYFB 4PB9H 3STLA 1XGTB 1A6VL 4KRPC 3GMNA 4LU5H 4ZDHB 5SWZE 1EX0A 3EGSB 3WS6C 5I66B 4XHJC 5D7LE 5EIIB 4MYWB 3QRGH 1FO0B 5FYLH 4X8XA 4GSDH 4PV9A 3GFUA 1K8IA 4GAJL 5J1TC 5KS9A 1I1AB 2R0LL 1E4KC 5CD3A 4EUPG 2WBJD 2P7TB 2R0ZL 4H88H 5JHDD 4OT1H 3WUWA 4G80B 2ORBH 2OSLB 2Z8WC 3VFTB 3NIFE 4URTB 3CXDH 4A6YB 2NY7H 3MC0A 4X7TA 1H3WM 2D7MA 4WFHE 3TCXA 3D18B 4UU9A 3A0OA 5CILH 1A0QL 1FH5L 4UBDC 5C0IA 2XNAB 3VJ6A 4E5XB 2DM3A 5GJTL 1V3JA 5B4MD 1B6DA 1A3QA 2F19H 1F4XL 3GSUA 2V5RA 1NC4A 4R8WH 4RX4A 3EJJX 1CXHA 4P4RB 1OAQH 2KH2B 3RY4A 2A6IA 1ZE3C 4UB0L 4ZUUA 5EN2B 4OFPA 3DMMA 3UYRL 2RJMA 3FQTA 3OKNA 3BP4B 4HHAB 2GJ6D 4HGWA 3LMJL 3VD7A 4Z7UE 2P24B 3IFNH 1EGJL 2RHEA 3RHWF 1NFDE 1A7OH 4RWYL 5FO8A 1MF2H 3DGGB 5H37H 1BIIA 4EVNB 3V6FA 2DQHH 4U1HA 3BW9B 5FYJU 4F9PC 1G7IB 3TFKA 3DTXB 1I3RA 2Y36L 1KJ3H 1MEXL 1TVBB 1CG9B 1HHHB 3THML 1EXUB 3WN5C 3HE7C 1W72H 1WZMA 4ZAKA 4PRDB 5IROA 5MI0B 5HPOA 1T3FB 1RHFA 2APTA 1OP3K 4UDUB 2DLTA 1UXWB 2CXGA 2D03H 2G9HB 4MJIA 3IDIB 3I50L 2OXGA 5L2KB 3VFWA 2ZCKL 3GI8H 5J9PA 2ENYA 5E8OB 4OSUL 4ZUWB 3RZCC 3EYOB 4EN3C 4Q9QH 1QSED 3RBSA 5I75C 5SWSE 3BZEB 1CR9L 4CDHA 1PVHA 5DT1L 1MJJA 2NLJB 2GSIB 4OGYH 5HGHA 5DFVC 2WBJC 2IPKB 2NXZD 4S1RL 1UA6H 3BN9D 5EU6B 5T1MB 4PGEA 1PQZA 3CSYA 2I24N 4I0PA 3CDYA 4E41A 3WFEH 3DXAD 1XH3B 3DSNA 4FZEH 1FNEA 4K3EL 4JY5H 2FHFA 2JJVA 4FFVC 4QRUB 4ZFGH 4GMTH 3PWPA 4P2QD 1H3XA 2YA0A 1MI5B 4PTUB 1D5ZB 4X7FC 3S36L 4LLMA 4F7PB 1U0QA 4NJAL 1KJVA 2OR9H 1B0GA 3P11L 2XTJE 3BVNA 4F9LC 4MD4A 4IOIB 1M7XA 3TO2A 1DBMH 4BSVB 5IMKA 1A47A 5IWLC 4OLVH 1BOGB 1IEAB 4NQDD 2BVEA 1D6VL 3WE6A 3B6SA 4OZHA 3SO3C 2NY5L 5LGJB 1OAZL 3SPVB 5HY9A 1B2WL 2VIRB 4FQ2L 2X1WL 1FL6A 1E4JA 2ICWA 3JWOH 2XY1A 3QDHA 4QRPE 1I3UA 3VWKD 5I8KL 3BD4A 5DRXA 5E2VL 4KRPB 3WLWC 4PPTA 4Z7WA 3U30C 1N7MH 3NH7H 4D3CH 4ZOAA 3S97C 3T0WA 4PJFA 5E2UL 4Q7DA 3LQMA 4LCYA 4X6BB 1UJTA 3OX8A 3L5HA 2V2XA 1MWAB 1P7QA 4KDTA 5KW9L 1FVCA 4JG0H 1U41A 3GIVA 4X0KB 4UNUA 5KANG 2WUBH 3P9MA 1HI6B 4GBXD 4HG4K 4KRMB 4EQ3A 1U8IB 5C09E 5HGAB 1ZHNB 4MA8L 4IBLT 5T1LA 4HUUA 3TC9A 3VFMA 5INCA 3QO0B 1VACA 4HIJA 1A3LL 4NNYB 4BZYA 2IMMA 2CDFB 5IP4A 2QQNH 2OZ4L 4ZPTB 4KQ3L 3T0XA 3S8WA 5HVGB 4M5ZH 3ULVH 4TNWF 3QQ9C 3H7LA 1U93A 4FHBD 3OJDA 3K7UA 2HT3C 5JORB 1SVCP 5BVPL 1RZGB 3N1QC 3LZFH 3PGDB 5CZKA 1S8DB 1PX4A 4WI6A 1UKQA 5DK2B 3IJYA 2EYSB 4CVZB 1F2QA 2UVEA 3T0EA 5HGBB 2EKSA 5JW3H 3GJEA 5IT2L 3K46A 4WW2F 4Z7NF 4X80L 5KSBA 2PXYC 3UTZA 3HLAA 3PDDA 2P1YA 3WN5B 3ET9F 3HE7B 5FGBA 4GW1B 2Q8AL 4Q9RH 5CZXC 3SCMD 4M1CD 3BH8B 2FEEL 4DK3A 1OOAA 3WUZA 4W4OC 4I3RL 1WCBB 2BP3A 4PRPE 5T3ZE 3TWCL 1IJ9A 2PYEE 4CUCA 5CIPB 2FD6H 4POZC 2Y4SA 3DIFA 5EORL 3ZDXF 3RZCB 3FO1A 5C9KA 4FFWD 4EN3B 1ZHBA 3UYOD 5EUOE 5I75B 4ERSH 4I0CC 3O0RL 5TQ2H 4AT6B 5E2TH 4GT7A 4NRZB 1BAFH 2JJSC 1IKFH 1KCGC 1U95A 2WBJB 3CXHJ 2HJFB 3IDXH 3G9AB 1QQDA 1TJHL 4XC1H 1DEDA 4RMRA 4M1GH 2IBZY 4HX1A 4ZXBA 3VFUA 4OF7A 1U36A 5LAXB 5L8JB 5MENB 4M6MH 4Y4KC 1C12A 5B38A 1VEOA 2H9GB 2BSRA 2QHLA 5CSGA 4WEBL 2IPTH 3WJJA 1OHQA 5T5FL 2PYFA 5EC1B 1FE8H 4H0IA 2JJTA 4DFHA 1IGTB 5F96L 2P43B 3SJVE 4ZDHA 3EGSA 3UBXG 5I66A 3MJ6A 5EIIA 3O2DH 2M1KA 2FJFB 1JWUB 3LS5H 2ESVE 5FDWB 1RK0B 1I1AA 4DN4H 5I0DA 1MHHB 4PJAB 2P7TA 3GKWL 4QGTA 3ZSSA 4WTZG 5T3XD 3SO3B 2FEEI 4P5MA 1UZ6F 4G80A 4UMGA 2OSLA 3VFTA 2BSED 2DLIA 2B4CL 4PY8J 4A6YA 2MJWA 1PKQB 3EOBB 3D18A 4WU7B 2GK2A 1ED3B 4TSAH 3PQYD 3ZKMD 3WO3B 2XNAA 3U30B 2YD7A 1BZ7B 1QR1B 3ELAT 4NHUE 1KB9J 4NYLA 4K07A 1ZLSH 3V0VB 1INEH 4LPTA 4LP4A 4P4RA 4I0KA 3KLHC 1AO7D 4JZOB 3EHBC 1U8QB 5EN2A 1ODAA 3I9GH 4HHAA 4KAQH 5JOFB 1WEJH 3E3QA 2DICA 1QKZL 3FKUS 2NYYD 3DGGA 3RIAK 5FYKL 4HT1L 4MS8C 3G6DH 4HC1A 2QQLH 4OCWH 1B0WA 4KK8D 5IW1B 1DBAL 2ADIB 1V3LA 3BW9A 4YO0B 1G7IA 3DTXA 4PJHF 5C9JB 5D7IB 1TVBA 3DXAB 1VESA 1CG9A 1HHHA 2ZJSL 1EXUA 5I1LB 1NGQL 4PRDA 2VL4A 4P59L 1J0IA 4UTAH 5C3LD 3OTTA 4LGSB 4P2QB 4UDUA 2O5ZH 5HDQL 2SEBB 2WWMC 4X9FA 1UXWA 3BE1H 4LSPH 2G9HA 5HI5D 3GUTB 3IDIA 5T3ZH 1SHMA 5L2KA 1XGQB 4POUB 3WMSA 4K3GA 5E8OA 2YK1L 3EYOA 3CDFA 5CEZE 4UOW0 4F2MB 1MPAL 5A43C 5C3TA 3DPBA 3BZEA 3F5WB 1HZHH 3JTCA 3F7PC 2DM7A 2NLJA 2GSIA 4IDJL 3VXQB 4U7SA 4X6DF 3R1GL 2IPKA 2PXYB 1KENL 4NQDB 5EU6A 5E5RB 5T1MA 1MCOL 3KPRB 5T1KD 2EEBA 5GHWH 4LHUD 1KIQB 1WWWX 4JRXE 4AEEA 4U49A 1XH3A 3D3VB 4MMXC 3SKMB 4HWEL 4QRUA 4RFEB 2J7LA 3GSWA 1MI5A 2R29L 4NO3B 4PTUA 1D5ZA 3LB6D 4F7PA 1ZLUK 4AEHH 4DZ8B 2Q1EA 5JXED 1UWGL 5DD5H 5ITBH 2IF7A 4IOIA 4IOFD 1PZ5B 2EECA 5K9OB 4BSVA 1B88A 2EH7L 5JOEA 4YBLC 2OLDA 2Y9RT 1BOGA 2DWEA 2F15A 5MEQB 3UTQB 3LOWA 3QRGL 5GQBA 4DAGH 5INDA 5FYLL 5LGJA 4WUKL 2X42A 4WFGD 1UC6A 1TTUA 4GBXB 3SPVA 2XKNB 5IBUB 3PV6A 2NYYC 1FIEA 3SE3C 2VIRA 1H9VA 4RGNC 1DSFH 4PJ9A 1A7NH 1L7TL 3A6CL 2E9JA 3ARQA 4OT1L 4XGZB 1T03H 3RRQA 3WS6A 5EBGA 3QJHB 5FCUL 2UZXB 3CXDL 1FYTD 3IVKB 2ZUXA 1HH6B 1KPUB 5IHUH 2OX5A 1E4KA 5CILL 3RPIB 4X6BA 1D7FA 4JRYE 1MWAA 5LGHH 1REIA 2P5WE 5L6YH 5I8EB 4PJIB 2YPVL 3B2UD 3C2SA 3S3JA 5GIRA 4PLJC 5EWIH 1HI6A 1T7ZA 4GUPB 2R2HA 2DAVA 1U8IA 2W9EH 2PETA 5HGAA 4UQ3B 6FABL 1ZHNA 5JLZB 2VLKE 5FM5M 3K2UH 3RVWD 1H8OA 4ODBD 1ZMYA 4CJ1A 4KK6C 5GRUL 1JPSH 4KJQD 2DLGA 3GJFK 4JJHA 4RMWA 1NAMH 1A7OL 2G2RB 1MF2L 4NNYA 4N5ED 2CDFA 3IAQA 2Q7YB 1YQ2A 4ZPTA 5CGMA 5DURB 2DQHL 1T20B 3FTGB 3WDHA 4X4ME 4LBEA 3AM8C 5H2BB 3SOBH 4CVWA 2X9YA 1ZLWH 3ARGC 5D2LF 3QDJB 3LB6C 3Q6GL 1RZGA 3QA3B 4LHQB 2AXFB 2W9LA 4KHXL 4PJGF 3STZB 2FGWH 3PGDA 3T4AB 3MUZ1 4AM0B 5CEZH 5I1JH 5DK2A 4OFYA 5A2JH 2EYSA 1HSAB 3HA0A 4CVZA 2XOTA 2CO6B 2WNGA 5HGBA 3GSVB 4X4YB 4F9PA 1EVTC 1IMHC 4K94L 3TVMD 3AFLA 1UEMA 2Y7QB 5KAQG 4WFED 3NIGF 3WN5A 3HE7A 4M3KB 1C7SA 5CSZB 1EFQA 4GW1A 4KJPC 2E3VA 1L6XA 3VG9C 3BH8A 2LU4A 3QPXL 1JGUH 3HC4H 2B7DT 2D0FA 1WCBA 1SEBA 2ATKB 2L7JA 2QBWA 5FUZL 1RJCA 3WFEL 5CIPA 1NPUA 5DUBB 4FQCL 5HXMA 3RZCA 4JY5L 4EN3A 3OBAA 4FQXD 4ZFGL 4AZ8A 4OJFH 4YXKH 2QSCH 1AC0A 4YPGA 4HF5L 1NLDL 4XPTH 2HAZA 2ZUVA 2HJFA 1WC7B 3DURB 1HQ4B 4DGIL 3I6KB 3LRGA 5GRXG 5BRZE 5LAXA 5MENA 3B2UC 4MDJB 5C7XL 1FZKB 1DBML 2H9GA 4JHAH 4QCIB 3F62A 2P47B 3M45A 4RBPH 5GGVH 2VLLB 1TMCB 3QFJD 4OLVL 3BP7B 3QIBC 5JZ7D 3RVWC 1MFBL 1QNZH 4PJXE 4PJEB 2VDRH 1WITA 4KKCD 4YHML 1EO8H 2IANB 1BVKB 4H1LH 3CFBB 4F9LA 3V52L 2FJFA 3D69A 1JWUA 1RUQH 3MXWH 2OTWB 5AZ2L 1AO7B 5FDWA 5JW5B 1KCSH 1MHHA 4YBLB 3SDXE 3VRJB 5IWLA 1U3HC 4PJAA 2EYTB 3CSGA 1WJ3A 1RIHH 4UV4L 4GG6F 2AK1L 4PJ5D 1UXSB 4RGNB 5LGKA 4MGXA 2EDRA 5FO9B 3EOBA 4WU7A 4YHIA 3MRHA 4R6UA 4JG0L 2LTQC 1ED3A 3L9RB 3B83A 4NZTL 3X3FH 3DI2B 1X5XA 2QL1A 4XCEB 1BZ7A 4LGPB 1QR1A 4PGZA 4RRPG 4G7VH 7CGTA 3QCTL 3TJHC 1RMFH 3V0VA 2ZWLT 1PW3A 4M8QA 2JLLA 4JZOA 3MLXH 1RUAL 1U8QA 1OAKH 2E7LE 2XYCA 5C0AE 2N4IA 3FCTB 2XACC 3KJ4C 5JOFA 1YYLH 1MAKA 4W70A 1II4E 2XZZA 4FQXC 4P2OC 5FGCB 4JR9H 4KQ4H 4PJEF 3SDCC 3ULVL 4HJJH 3UC0H 3IXTB 8FABB 2XQBL 7FABH 5IW1A 2ADIA 5LWYL 3P9LB 4PY7B 5KS9E 5BQ7B 1WZKA 2XZQL 3LZFL 5C9JA 5D7IA 4KK5D 4ZD3H 1QG3A 4HUKB 2X4TB 3LKOB 3C60D 4YXHH 5BZDB 5JW3L 2SEBA 1FNGB 2O5XH 5F97E 5JZ7C 2ADFL 4FXKB 3VMOA 3GUTA 1NGWB 5CCKL 1I3GL 1RU9L 5DFWH 4N0FB 1HKLL 2HTLD 3OG4B 3ZSTA 4Q9RL 1YPZF 1DVFA 4F2MA 1KEGL 4U33A 3MLUL 4M9OA 3MRMB 3F5WA 4ODHH 3O3EB 5FKPB 3UPRB 4PRHA 4IMKC 2XRAH 1EZVX 3VXQA 3K4AA 2PXYA 3KPRA 1YN7A 5GGQL 4ERSL 5J0BA 4TTGA 4IM8A 1QHOA 3BMVA 1FNAA 1KIQA 3VG9B 5E2TL 3QG6B 4W4OA 3D3VA 4JY6B 4O9HH 4RFEA 4OCSL 3W0WD 3UJTH 3F6IA 3V6ZB 4NUJB 3QNYB 4U1SB 4ZNEA 4M1GL 2VZUA 4NO3A 1JTPA 3UROR 3FRUB 5LG1A 1ZSDB 2IFFH 2H45A 3QG7L 1FP5A 1Q0XH 4DZ8A 4ELMF 4OZFG 2IPTL 1VEPA 2JJSA 3L3DB 4PG9B 4O2EA 2LU7A 1XCTB 3VXNB 5KVFL 1PZ5A 1ZHKB 1FE8L 3D39D 4MX7B 5K9OA 5E08H 3FHAA 4S2SB 3L3IB 2R0WL 4Y16D 4B7IA 1TTFA 4R4NC 5MEQA 4X9GA 2X4OB 3UTQA 4H25B 1DBBH 1HWHB 5DFTA 1N6VA 4Y4KA 1T83C 4XMKH 3LS5L 2HLAB 1CQKA 3G5VB 4MJIE 2XKNA 4V2CB 4J6RL 4DN4L 1I85C 3DX9B 3MJ9A 3GMQB 5DD6B 3O6KL 4HBQA 4JFXB 4HS8H 3QJFB 1J0ZA 4XGZA 1JWMA 4G6MH 3QJHA 2NQCA 4KK5C 5GS1C 1KBGH 5C0DB 4GKZB 2VR9A 2KDGA 3IVKA 1HH6A 1KPUA 4FS0A 4E41E 3RPIA 1IC4H 1U3HB 4Z18A 4LIQE 1ORQB 1L8JA 3BWAB 3GHBH 3PWPE 5LJYH 4EOWH 2VSDA 5I8EA 1Y18A 3MLTB 4PJIA 1HH9B 3CU1A 1VB9A 2X5PA 2R4SH 4MXWH 4OM0L 4UNVA 4GUPA 1LEIB 2D0HA 4UQ3A 4R4FL 1OGTB 1AQKH 4KAQL 1R3LA 2LTQB 5FV1L 3C5JA 4QXGH 2JJUA 3BPLC 1WEJL 2XWTB 1CL7H 2YRZA 2G2RA 5IJKC 2Q7YA 4RA0C 1OCWL 4OZHE 3SGJC 1T20A 4OCWL 1N0XH 3PJSB 4K9EH 4OZGF 2F5AH 1MCDA 3SE9H 5H2BA 3KJ4B 1CZ8L 4S1SL 1XGPB 3Q0HA 3QDJA 3VXUB 4M48H 1CD9B 3MLRL 5M95B 3QA3A 4FQXB 2IAMD 2AXFA 4P2OB 4S0TD 3STZA 4UTAL 3S35H 2VDLL 4AM0A 1WIPA 5HVWA 4Z7WE 2ZCHL 4EXPX 3RVUC 3SDCB 1I8IA 4DKFH 4LSPL 4MS8A 3BKJH 4JPKH 1HSAA 2OMBA 3GSVA 4P5KB 4X4YA 2QSTA 3B9KC 4Y16C 4PJFE 4ZUVB 4LEOA 5IEKB 2Y7QA 3G5XB 5CSZA 1C5CH 3MLVH 1TJIH 2X6MA 2D31B 4PGCB 2GW5A 3P40A 1XF5B 1KPRB 3MJ7B 4PLNC 2VDKH 4C55A 3QPQC 1F58H 4RIRB 3UX9B 3UTSB 4CN1A 5DUBA 1FFPB 2Y6SD 1NCDH 1UCBL 5BW7C 2H41A 3T3ME 3KPSB 5CJXA 1UB6B 3ULUE 3NPZB 5E8NB 2LE9A 3AVEA 2R23B 4BZ2H 5FDYA 3U83A 1H0DA 3SQBA 3T0BA 5EC2A 1WC7A 3OPZL 3DURA 1HQ4A 4Q58C 4P4KC 2ZOKB 5DD5L 2RBLA 5ITBL 1MCJA 4MDJA 1BF8A 1FZKA 4KXZH 4QCIA 3B9AA 3D85D 4AG4L 1DQLL 3GMPA 1TMCA 3BP7A 3L3HB 3M8OH 4TPRH 4N5UA 2HVKB 3CSPA 3IU4H 3HI6H 2IANA 3RBGA 3T0EE 1BVKA 1QLRB 3VFPB 1MFAL 3CFBA 5EBMB 4YEFA 3WIFB 1GSMA 1T66D 5KSBE 2P48B 1I75A 4KMQA 1MIEH 2OTWA 4BSWB 3KYKH 3L5WB 3CZJA 1AO7A 5JW5A 2Z35B 4K8RL 3VRJA 4LIQH 2GQHA 5BV7C 3HZMA 3HZVB 5FYJE 3BMWA 5CINH 2YEZB 2H2PD 3SE3A 5ISZB 5IHUL 1ADQA 4NQTA 3S5LB 2EDWA 1YDPB 4PLKD 1NCCL 5FO9A 4DQOL 3T65B 4Y89A 3L9RA 4PRID 1J5OH 5GS1B 5DHYA 4XPBL 3EOTL 3VXRD 2VE6B 4XCEA 3ORJA 3C60B 2W9EL 1QUNA 3QI9C 3K2UL 1FBIH 4H20H 3IGAA 1P53A 3WL9A 5CEXB 1RVFH 2EDTA 2DD8H 3QZWB 4FN0A 5AZEH 4Y5VC 3FCTA 4P9ML 1LP9B 3UMTA 1HYSC 1T2QH 3NABL 2VXSL 2Y6SC 2CKNA 5CD5D 3V7AG 1YJDC 3RVXC 2Z9TA 1MOEA 4JDZB 4JM2F 3I3BA 3MR9A 3IXTA 5AG8A 8FABA 1P1ZA 3BPLB 1C08A 1XR8A 5I1IH 3P9LA 4PY7A 5BQ7A 2FGWL 5CBEB 2EO1A 4MVBD 1KELH 4P0DA 5IG7B 4X7CC 3ETBF 5AUMB 4DTGH 2X4TA 1CFTB 2HFFB 3W0WB 2UWEB 5BZDA 1CFBA 2EE3A 3AM8A 1A64A 4QHMB 4FXKA 3ARGA 5J57B 2EDLA 4MB4A 5CLTA 4N0FA 5M94B 2W0PA 4X4ZA 5D7JC 5DSCB 2DQDL 2XZCH 3DETC 4BFIB 1MRFH 3FFCB 2R15A 1AR2A 1T66C 3G6JB 4HZLA 1IAIH 4RAVA 5IVXF 4HQQH 2DLHA 3MRMA 4ZYKB 1JGEB 1QACA 3O3EA 5FKPA 3VRLF 3B9KB 4Y16B 2PW2B 3P4LA 2EZ0C 4J7RA 4ODVL 2KBGA 4GKSB 3Q5TA 4JO3H 1OGAB 5BS0B 2XIDA 4OJFL 4YXKL 1OQOA 2F5BH 3QG6A 4K23L 4YDVB 4Y2DD 1ZVYA 3L3KB 4PLKC 5F1SA 2XKUA 3E3QE 1SYSB 2ZSVB 4NUJA 4XNYL 1KV3A 3QNYA 4U1SA 4HIXL 4XP4H 2F8OA 1IAMA 1G7LB 1O0VA 1ZSDA 1G0DA 5IHLB 4JJ5B 2AEQH 4HAGA 4QRSA 4KUCD 3AC0A 2IG2L 2H1PH 4AEIH 5B8CC 2CDGB 4XP5H 4NSKB 3L3DA 4PJ8D 3P4OB 1XCTA 3VXNA 4MX7A 1ZHKA 3QUXD 4HH9A 3OHXB 1E4XL 4HPYL 4S2SA 3B9EA 5E0QA 3CU7A 4PB0L 4TVPL 3Q1SH 3TN0C 4P4KB 3MGAA 2X4OA 4H25A 1QSFD 3ESUF 1KYOJ 2HLAA 1KCVL 3D9AH 3G5VA 4I18C 2DIBA 5L2KE 3O41B 1N59A 1IM9D 2HVJB 3DX9A 1KCSL 1KOAA 1HSBB 5I16B 4GMSH 4MJ5B 3GMQA 5DD6A 3QIBA 2DN7A 4JFXA 1RIHL 4PV8B 1MCRA 1N5YH 1XMWA 3TPKA 1QHPA 3JV6B 2AP2A 3E8UH 2UY6A 5DJ2B 4X8JB 5C0DA 3KGRA 2CMRL 5EU6E 4E42B 4GKZA 4NFBA 3GBML 4EDWH 1CGTA 5KJRH 1RZ8B 1U3HA 1UZ8B 5FIEA 1ORQA 5BV7B 3BWAA 1RHHA 4H26B 15C8H 1KNOB 3QIWC 3MLTA 1HH9A 1RV6X 3P2TA 4G7VL 1MI5E 1RMFL 2EDQA 3UTOA 1VGEH 4FTVD 4C56D 3U4BH 3MLXL 3WXWH 3JWDC 1I7RA 1OGTA 1WIUA 3ZZ1A 5MEOB 3MYZA 3WO4C 3T3PF 1I1RA 1FO0H 2NX5B 4IRSD 3QNZB 5HHOD 4N9GB 1U2HA 5CMAB 2AJUH 2YZ8A 3U0TB 3QI9B 2YD1A 4NNXB 3TJHA 3FZUC 1EZVY 3LHPH 4HJJL 4Y2DC 1RQ5A 2FH6A 4XWGL 4CKVX 4LRIC 3PJSA 2XICA 2R69L 4Y5VB 1SVZA 2DIJA 3LS4L 4PYHA 1XGPA 4A6YH 3VXUA 5DJ8B 3U0PB 4K3JL 3LQAH 4P2OA 3UJJH 3SKJH 1S5HA 5DD1H 1T7VA 4AK1A 2VSCA 3SDCA 5D5MB 5GRZA 2EDEA 3ROLB 5DA4A 5ADOL 5HYJD 1I7UB 4I3GA 1IM3B 3NCMA 4ZFOL 2X05A 5IEKA 3QAZC 3G5XA 4NQXB 1U8HB 1QLFB 1KEML 3QEQB 3DHJA 2D31A 3BAEH 4PGCA 2XRAL 2BHUA 1XF5A 1KPRA 2D9CA 3MJ7A 3UCRA 1I9RL 4RIRA 4ODWB 3ZTNL 3UAJC 3UTSA 4NRYA 3HB3D 1JJUA 2GTZA 3R4DA 1S7XB 1KXVC 4G6AD 2F74B 4HC1H 4LGRB 3KPSA 1T5XB 1UB6A 5E8NA 4K7PL 2R23A 2BRQA 1FC1A 4XX1G 1JPTL 2AKRB 4HJ0C 2IFFL 4NHCH 4BK4A 3GK8H 1Q0XL 4ZPVB 3EKCA 1S7WB 5JIIA 2A6DB 1YMHB 4XX1E 2ZOKA 2ZUQC 2Q3AA 2COQA 1G9EA 1IVLA 3PP4L 4FXLA 4MD5B 5JA8B 4XMPH 3ARBC 3L3HA 3ARXA 5C0BD 4Z6AT 4UINL 3VXRB 1QLRA 5D1ZC 2W38A 5B8CB 5EBMA 3WYRA 3WIFA 1EFXD 4OZ4A 3U1SL 4PJ7B 1UKTA 4BSWA 3L5WA 4HS8L 2O5YL 4ZTOH 5F3BB 5DS8B 2Z35A 1PX3A 4MCZA 4PRNB 3S3PA 4MNQB 2YXMA 3MSPA 3FQRB 3TA3C 3TN0B 4HWBA 5L7XH 1EEYB 3ARZA 3HZVA 2CUMA 4ZFZA 5JW4M 1A9EA 1T83A 4I18B 2AEPH 5CUSH 2YEZA 4HUWB 1D5IH 1CXKA 3U82B 5ISZA 4JN1H 4MQ7B 1I85A 3S5LA 1U8PB 2CIIB 2E6JA 4CVXB 1YDPA 5DTFB 1OTTC 5EB9A 3SDAD 3TNMB 5JW4R 4RWHA 5E8DH 3QWRA 1CI5A 2H26B 2K3TA 1FV1B 5DMYA 2OQJB 4NZUH 2P8PB 3X13B 5AD0B 4ZS7L 5GS1A 5IVOA 1KCRL 5D1XD 2R4SL 4JANB 4R96B 4YDIH 2C3VB 3GO1H 2VE6A 2E5EA 4ZQKB 5F8QC 5IW3A 2M26A 1KB9K 4ODSL 4UQ2B 5EZOH 1OAUH 3TIEB 5TE6H 1P6AB 2IALB 2D7OA 5MENE 4QXGL 5IKCB 5CEXA 3C5ZD 1QRKA 3QIWB 4DN3H 1CL7L 3QZWA 2OI9C 5J11C 3RGVC 1LP9A 4LVNC 3ZYZA 1NMAL 4G9FD 2FLBT 5EU7C 1P7HL 4WJ5B 4OIIH 2LFGA 5DLMH 4JDZA 4XTRC 4C83A 1N0XL 12E8H 4LCIH 3TT1L 4K9EL 2MSPA 3DV6A 4G59A 2BY3A 3WO4B 5SWZD 4M48L 1JVKA 1NSNL 3IRPX 5D7LD 4LKCB 3NZHH 5CBEA 3PNWB 1T04B 2IJ0C 3O6ML 4PJAE 5E56A 5IG7A 4K7FB 3WEXB 1JF1B 1VPOH 1MWAH 3LCYA 4Y2DB 5AUMA 3BKJL 3SGJA 2DI7A 1CFTA 2HFFA 3W0WA 2UWEA 4JFQB 1T0NB 4QHMA 1DANU 3KPOB 5DSCA 1MHPH 4BFIA 1EUUA 3FFCA 2MPAL 3V6OC 2VDKL 2VOTA 3G6JA 2A77L 4WFHD 4LLAA 2JIXA 4GG8B 1LO3L 4ZYKA 1JGEA 2NY2C 3C8KA 2G5BB 1NFIB 3B9KA 2CLRB 2PW2A 1JGDB 1L0XA 5EO9A 5D7SH 4GKSA 1OGAA 5BS0A 4GLRH 4OB5H 3G04B 2DIAA 4XWOD 4C58B 4LQ1A 1QFWM 1IM9B 4PTTB 4YDVA 4U2ZA 4L8DB 5E6ID 4HPOL 1MAMH 1I8MB 1CL7I 2HT4C 3L3KA 4YUEH 4AIOA 2X4QB 4UI2A 1SYSA 3O2WL 2ZSVA 4G6FD 3QUZC 1VKXB 4QXUH 1G7LA 1YEHL 1FAIH 3BI9X 2VUOA 3MRJB 4G5ZL 2CPCA 1PY9A 2CDGA 5EO0A 4NSKA 5D7IE 5KZCB 3IDMB 3OSKA 4NO2B 3IU4L 3T2NH 3O6FC 3OHXA 3V79C 5DZLA 4MAYA 43CAB 5IQ9B 4P2QE 4P4KA 3K1KC 2ATPB 4UT9H 2NZIA 2ZUQB 4KH2A 4LFHG 1MIEL 2APBA 3KYKL 4C56B 5J13C 4P5TC 3AAZB 3O41A 1LGVA 2GAZB 2D7TH 1HN1A 2HVJA 5LCVH 2EICA 3ARBB 5CIPH 1HSBA 5EZJB 5I16A 3PGFH 4MJ5A 5EOQL 2D3VA 5TFSL 5DMGD 3HG1B 1WTLA 2L4OA 4J8RB 3L7FB 4LAQH 1AY1H 4PV8A 1T5WB 1MCQA 5CINL 5DUML 3JV6A 4KUZH 4PRHE 5D1ZB 1RURL 1DBJH 3ZLQC 5SWSD 5DJ2A 3QISA 3LD8C 4X8JA 3SKOB 1I8LC 3KPRE 4WW1B 1DQDH 2CKBL 2NY4D 3V8OA 1RZ8A 3TA3B 1UZ8A 4MXQD 3NFSH 4TSCH 3D3VE 4H26A 4MXVF 1KNOA 2HJLB 3MACL 3EYQD 2VDOH 3MXVH 1TFHA 2DS4A 3EJYD 4ZNEE 3SN6N 1FBIL 1RIUH 3BZDA 3NN8B 1RVFL 3ABZA 1U8JB 4UTBH 3ECBB 4N8CH 5GGRY 5GZOD 1S9YB 4XP1H 5GS2H 5MEOA 4F7TB 4KXZI 1OAXH 1QLEH 1T2QL 1QR4A 2NX5A 3QNZA 3KNBB 4N9GA 5CMAA 2Z31C 2I5YH 4I1NB 1UWXK 3KYOB 3U0TA 3QI9A 4NNXA 3RUGF 2Q8BH 5E6IC 1P5UA 1AH1A 1F3JB 5I1IL 1AQDB 4KV5F 2OI9B 4WY7L 4OGXH 4FMFA 4XCCH 4Y5VA 1X3DA 5J11B 3RGVB 2GY5A 4XPAL 1N26A 3W11D 5DJ8A 3U0PA 4DTGL 3HMXH 3ERYA 1U91B 4QRPD 4ZO8A 5TQ0L 5EFIB 3V4UH 5D72L 1I1CA 1J1OL 5FGSA 2ZKHH 5D5MA 2MHAB 4D0CA 3ROLA 4TRPL 4X9IA 4GQ9H 2D7QA 1I7UA 1EBPA 1FHGA 1A6PA 2XZCL 5TH2B 4AENB 3NFNB 3VG0H 1MRFL 3SE8H 1U8HA 1IAIL 4X9BA 4NO0B 1QLFA 3QEQA 4HQQL 2AK4A 3NCJH 1YEJH 1VCAA 1TCRB 4PJIE 1GCFA 3WDJA 3D6GA 4UUJA 5F9OL 2ICWJ 4NQSB 5DWUH 4KKBD 2NY0C 4ODWA 1EERB 1OTSC 2KQMA 3GI9H 4RSVA 1AKJD 5FEBA 5D7JA 1S7XA 4OCLC 3MRNB 5IOPB 2F74A 3TZVD 5C09D 2B2XL 4NP4H 1T5XA 3IS0X 3TEUA 2ICWI 3BQUD 4XNMA 2MCG1 2NY2B 2X41A 2NY4C 3SKUD 4XP4L 2NXYC 4MXQC 1NGXB 4U6VL 2J6EA 5D2NB 2AKRA 4QY8B 1C5BH 3WNMA 3NIDE 2P8LB 4G8GB 4IRJC 2WP3T 1CCZA 2HRPH 3EYQC 4ZPVA 3VW3H 1S7WA 2A6DA 2ARWA 2H1PL 1YMHA 4PGDB 4LSTL 4HMEA 3KLAB 5F6HJ 3GJFB 3MBEC 1J18A 1ERNA 3QDJE 4MD5A 3Q2CA 4JKPH 5CP3A 1FL5B 2FSEB 3MRKB 2VXVL 3Q1SL 1BREA 1F3DH 1FNLA 4GRWB 1NJ9B 4UIKL 4WI7A 5D1XB 1T0PB 3D9AL 3CVHH 5DVOA 5B8CA 4I48B 5FECA 4GMSL 4PJ7A 3TBTB 4WI3A 1G9NC 4DEPC 1RSFA 4NKOA 3O6FB 3C5ZB 4HS3B 5F3BA 5DS8A 4PRNA 5K59E 1N5YL 4MNQA 3HFMH 5IESL 4NIKB 3FQRA 1OSZA 4LSUH 3TN0A 3WBDA 1IAII 1IAOB 3WXVH 1EEYA 3OF6D 4I18A 4FQQA 3VFGH 4HUWA 4Q6IC 5MP6H 4FQJH 4P5TB 3ZKXC 5H94B 5J13B 4OFDA 4EDWL 4MQ7A 2QSQA 2WMPA 5KJRL 2FX8H 2CIIA 4CVXA 5T3ZD 5DTFA 2PYED 3TNMA 5SWZB 4K3DH 2H26A 1FV1A 5JDSB 2OQJA 3DUSB 5D7LB 2P8PA 3X13A 5AD0A 4JFEB 1TLKA 5AAWA 3LD8B 4JANA 3S6CA 4R96A 1VGEL 1WBZB 2C3VA 4FQ1H 4ZQKA 2F53D 3WXWL 4OI8A 2VR5A 3PE9A 3QIUD 3VRIB 4UQ2A 3TIEA 4JCMA 2FCBA 5IGXH 1I7ZB 5FF6B 1FO0L 1YMMA 4LCWB 5IKCA 1NKRA 5HHMA 3QIWA 3FONB 4Y4HD 4EUPB 1MCKA 3F7RA 5I76B 4OGAC 3LHPL 2FBJH 4JQIL 3KR3L 5AAMA 4WJ5A 1I9JL 4HIHB 1MJ7H 5GISH 2IANE 1MCLA 2VXTL 4OF3A 2AABL 4TNVF 4GRWF 5ID1B 1CGSH 3WIHA 3SJVD 3EO1B 4OM1L 3GZKA 3W81A 4XVTH 1AO7E 4YQXH 3ARDD 2Z31B 1UQSB 1OQXA 3PNWA 1T04A 2R2BB 2C3HA 2ESVD 4K7FA 5GGSB 5E6IB 1JF1A 3WEXA 1OT1A 4LVOC 1ZOXA 3A6BH 3UTTB 4MD0B 4JFQA 4LRIA 4G6FB 4Q9CA 1T0NA 1DL7H 1H5BA 3OAYH 4RGNE 4WU5B 4HMCA 3FB5B 2A2QT 4GAFB 5IF0B 1HILB 4JVWA 2X9XA 1FN4B 1QFOA 2P45B 2V17H 1HNFA 4NUGL 4GKNA 5HI4D 1VFBA 4L4JA 5IFJB 3K4ZA 2G5BA 1NFIA 3JTSB 4TSBL 1JGVH 2CLRA 1RZKC 1TIUA 3MRRA 1JGDA 4G6KH 3QXUA 5FM5O 5I1AB 1OL0A 4V3DB 2YA2A 1GXEA 1PG7W 4OTXH 3RWCB 1RJZA 4JAMA 4PTTA 3C2AH 4Y8DC 2BERA 4L8DA 3ZKND 1I8MA 3J8F7 4AIXA 2NY0B 1A6ZB 2X4QA 5DQDL 1AFVL 3VGDA 4NHCL 3NIFF 4XAWL 5F1NB 3GK8L 3DNKA 5FGCE 1VKXA 1MH5B 3EYVB 2Z8SA 4P57B 4KROC 4OF0A 3HI5H 4DGYH 5JUEL 2PTTB 3MRJA 4JZJC 4TQEH 4P2RB 2VUYA 3IF1B 2NY4B 4N0CC 2E27H 1A7RH 3IDMA 5HTSA 4M7LT 4NO2A 4JE4B 2QLVB 1MIML 1L9MA 4JFDB 4IRJB 5EU5B 5JPNB 3BKCL 43CAA 1AR1D 4Y4HC 5J3HC 3IDJB 5JW4N 2ARJB 2VLRB 2MFNA 2DLFL 1G7JB 3RWHB 3MBEB 3CC5B 1KIRB 4KMTL 3AAZA 1PY4A 4ZTOL 2DRUA 2GAZA 1S9WA 2OL3L 3LEYL 3ARBA 4G43B 5EZJA 2QADD 4QO1A 4Z7UF 4K2UH 5L7XL 1NFDF 3HG1A 3L7FA 1T5WA 5HHVL 2AEPL 5CUSL 4ETQA 5CEZD 3ARDC 5D1ZA 2EYRB 3MV11 2YKLH 3SKOA 4IJ3C 5F7KC 1MNUL 3OR7B 2VL5B 4DEPB 1MFEH 4WW1A 5T3XH 5E8DL 5A2IH 4WFGE 1MCCA 4KMLB 3O2VL 4NZUL 3K80A 3TA3A 5BO1L 2AW2A 1OARH 1AGBB 4V3EB 2YUWA 4WI4A 4YDIL 3GO1L 3KYAA 1R5IB 2HJLA 4JRXD 3W82A 4Q6IB 3ZKXB 3ULVF 3QXDA 1DLHA 2KUTA 4ODTL 5KSAD 1CD1B 2FECL 3O3AB 1KTDB 5EZOL 2E8YA 2BHZA 2YD4A 2YXFA 4YDLC 1U8JA 3OV6A 3WD5L 3MCG1 3I84A 2CUIA 3ECBA 1S9YA 3EUUA 1OW0C 1LDSA 4JY4B 1R3KA 2DYPA 3KYOA 1OWRM 12E8L 4K71C 5DUPL 4TUJB 5FCSH 1P7KB 2X4RB 3ZKNC 5J1AB 2V7HB 3U48A 4Y2OA 2BMKB 2AQ3A 3FOLB 4LOUD 4L29B 1AQDA 1ES0B 2OI9A 3FN0H 1ADQH 3RGVA 4G7YL 5T33H 4R2GD 2X4PB 4MSWB 4Q2ZB 1U91A 2GTWB 5EG6C 3VXOB 5EFIA 5HD8C 3BXNA 3HRZB 4YXLL 3PWVB 2MHAA 1A3RH 1HCVA 5D2LA 1UWEH 2VC2H 1S9VB 1MVFA 1PSKH 2D7NA 5TH2A 4AENA 1MHPL 4UOW1 1G9MC 4ZSOB 4LVOB 4NO0A 1DN0B 4P46D 2HH0L 4LKXB 4D9QE 4BUHA 4JRYD 1Z2KA 4KKLD 5I1DA 3H9SB 4NQSA 1Q1JL 1T22B 4XT1C 4LASL 5IMLB 1M71B 4OB5L 4ORZC 1OT2A 3G08B 4AQOA 2V6HA 3IAPA 4F37F 5C2UB 1V7MH 1YQVH 3MRNA 5BVJB 5D96C 1MAML 4M7ZC 3V6OA 4YUEL 2F58H 5KVGH 3QHZH 3BDXA 3T77B 3KAAA 2VLKD 3BJLA 1JFMA 4M7LH 1NGXA 3JBG7 2X7LB 4JO2L 4YX2H 4I3SH 2XT1B 4U1JA 1C7TA 4OFIA 1E4WH 2P8LA 4G8GA 5AYUH 4XVJH 1GGIH 4LL9A 1QPXA 4PGDA 4TVSa 3KLAA 3MREB 1ZK9A 2DTMH 1X4ZA 3GJFA 4Z0BH 1JZ6A 4NM4L 3VXUE 5CHNA 3T2NL 1FL5A 1EHXA 1E28A 3QUZA 2FSEA 3MRKA 3U46B 1U8KB 2J8OA 1K5NB 1GAFH 3GBNH 4G3YL 4UT9L 4KROB 2JKXA 5EBWB 1NJ9A 2VN7A 1D5MA 1DP0A 2XPGA 1MLBB 4JZJB 2F53B 4HK3J 3RI5F 4MA7L 4I48A 4ZO7A 3N0PB 5E4IA 2VABB 3L5JA 1A9BB 3DX8A 4PIRF 3FQUA 4LAQL 3LEXB 3O6FA 1CD8A 2RCSH 4HS3A 4G42A 2H6PB 3RQ3A 3IAGC 4ODXA 4Y4HB 1IAOA 2EDOA 1DBJL 3Q5YA 1S7QB 3D5OF 1ZGLB 1P5VA 1N64H 2YC1B 1FPTH 3QT2A 4P5TA 5H94A 3UTSE 2Z0BA 1DQDL 2I25N 4LAJH 5JXAH 4FXGB 4LSDA 1V3KA 4GLRI 4TSCL 2R9HC 4Z9KB 3KPSE 3P77B 1GOFA 2UVFA 5JDSA 3DUSA 3ARDB 4OLWL 3V0AC 4ALAH 1AD0A 4JFEA 2HTKD 4APQD 3EFFB 3DX7B 4OD2B 1RIUL 1I8LA 1WBZA 4IJ3B 4G6JH 2WWKT 5ICXB 1H3PH 3UBXB 5HSFA 3QWOB 4P46C 4UTBL 3VRIA 4N1CA 1EUTA 4XP1L 1ZLVH 5IEHB 5FF6A<