2GAZA

Mycobacterial lipoglycan presentation by cd1d
Total Genus 79
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
79
sequence length
273
structure length
269
Chain Sequence
NYTFRCLQMSSFANRSWSRTDSVVWLGDLQTHRWSNDSATISFTKPWSQGKLSNQQWEKLQHMFQVYRVSFTRDIQELVKMMDYPIEIQLSAGCEMYPGNASESFLHVAFQGKYVVRFWGTSWQTVPGAPSWLDLPIKVLNADQGTSATVQMLLNDTCPLFVRGLLEAGKSDLEKQEKPVAWLSSVPSSAHGHRQLVCHVSGFYPKPVWVMWMRGDQEQQGTHRGDFLPNADETWYLQATLDVEAGEEAGLACRVKHSSLGGQDIILYW
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural characterization of mycobacterial phosphatidylinositol mannoside binding to mouse CD1d.
pubmed rcsb
source organism Mus musculus
molecule tags Immune system
molecule keywords T-cell surface glycoprotein CD1d1
total genus 79
structure length 269
sequence length 273
ec nomenclature
pdb deposition date 2006-03-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2gazA02
3.30.500.10 Alpha Beta 2-Layer Sandwich Murine Class I Major Histocompatibility Complex, H2-DB; Chain A, domain 1 MHC class I-like antigen recognition-like 2gazA01
4G8IB 4QNPF 1FFQA 4XP5L 4XP9H 1NAMH 4DKEH 2IF7A 3H7LA 1HINL 3K8MA 5FYLH 4NWUH 3G08B 4ZUTB 4U3XA 1RJYB 2CDEA 1OT1A 4XPAH 3ARFB 5J13B 5D1ZC 1INDL 3GUTA 1L9NA 3D1MC 4LARH 2F53B 5E1AB 5CSBA 4OCSH 5EO0A 2F74B 2GHWB 4I5BA 4PV8B 2E27L 3VI3F 3DVNA 3IXAB 5I71B 5JXED 4DGIH 4PY8I 1BZ7B 5INCB 3RTQD 4BFIA 4JM2D 4MQXC 1EEQA 5LQBH 1N64H 4CMMA 5CEYB 3HLAB 4WNQB 5E2UL 2B7DT 2C5DC 5C0CA 3IJHB 4JREC 2O5XL 2BNQE 3LMJH 3ZLQC 5HGHB 4FQHA 3QXTA 3RWCB 4PRIB 1RURL 3QQNA 1TJGH 1XGQA 1YN7B 4IRZL 1CGWA 1WCQA 3HI1B 3RDTC 3L5HA 3T08A 4OGXH 3DARA 1LP9F 1FE8H 4AZ8A 1DEEA 2X6MA 4FQPA 4XRCA 1F58H 5GJSH 4XC1H 1U8OA 1CD0A 5DHYA 4ZQKB 3ZE1E 4Z76A 3KPNA 3MZGB 2Y07H 3QXWA 3WNLA 2AJUL 3UC0H 3WLWD 1JMXA 5HYSG 1EZVX 4NSKA 3MRPB 5HYFA 5IB4B 5EU6B 3R1GL 5D1XB 3QUYD 4C4KO 4N0YL 4MCZA 5EBLB 2FL5B 3LD8C 4O58H 4GQPH 2VLME 4U3HA 5EU7C 4OLYH 5DA4A 5C0AD 1OB1A 3ZKQD 4ZQKA 4MZ3A 1R3HB 2ESVE 3RGHA 3LS5L 2APBA 5HYIA 2Y6SD 1ORQB 4RDQF 2ADFH 5I1HH 5A2KH 1GHFH 4B7LA 2NY4B 4DZBB 1JYVA 3SPVA 2EKSA 1V8HA 5E8PB 4FOMA 5SWQB 2HFGL 1T3FA 1KOAA 3C5SB 3BN3B 3L3JB 4YHLL 3GBNL 1W72H 4V1DA 5D7KE 1AE6H 5IK3B 5DK2A 4I3SH 2XRAH 3WXVH 3BZFB 1RZ8B 2J88H 5IQ7L 2GT9A 2V17L 3IDGA 5E2VL 3KLHD 4X5WB 3QCUL 1IKNC 2DI8A 5T33H 4GT7A 3E0GA 5K9QI 3ZTJG 3KJ6L 1CXIA 5GS1A 1AQKH 4LSDA 4HLJA 3JTCA 3D69B 1SBSL 1FQ9C 1YEFL 2ZG1A 3T3PE 4OF8A 4NZUL 2FX8H 4OFPA 3WE6B 3BJ91 3TZVB 5IIEA 4OZGE 1DBJH 1T83A 3MLZL 3OQ3B 5F8QC 3WNOA 3QNZA 3OF6A 3TJEL 4BZ2L 4O2EA 4MXVF 2B5IC 4FNLL 4W6XB 4AEIH 3A67H 1P4LA 1B0RB 3O3DA 1KJ3L 4QHKJ 1ZLSH 3NZHH 1JWSB 1PX4A 4TPRL 5GSRA 2DQFA 2PW1B 2ADGA 1JRHI 3ULVF 1MHCA 2FD6H 1GC1L 3OAUL 5CUSH 1WBYB 1ZT4A 3T8XB 4PJBF 2CIKB 3GJFB 1NL0H 4QXUL 1A47A 4UINL 1T6WA 4U6TA 3UJTH 4PJIF 4Q9RL 1P7QA 4I0PB 1VGKA 5LKNA 4RAUA 3U36A 3QUKB 4NO0D 4NT6A 1JZ3A 4LKCB 2BNRB 1L7IH 1B2WH 1CFSA 3LEVH 4WWKC 4YAQB 5HPMA 3INUL 4NWUL 3VD4A 1QLFB 4U1JB 3WO4C 4G8IA 5HDOA 15C8H 1WAAA 3D69A 1MCIA 3O9WA 4H5SB 2OBGA 1F4YH 5DO2C 2F54A 1OSZB 3NVQA 2BMKB 1PY9A 1FNEB 1HHIB 3SHSA 1M7IA 1PQZA 4V2BA 1D9KB 4K8RH 1JF1B 4NHUA 5HGDA 5BV7B 4GG6A 1BIHA 1CD9B 4EUPH 4UOJA 3C2SA 3FZUD 2O93L 1EAPB 4XMKL 1UH3A 2ZWLT 5FM5M 4DAGL 2MCPH 4EBQH 3QIUC 3TNMA 1K3ZA 4IJ3C 3WFBL 5DEGA 3HC3H 3AMKA 5L9DL 2YD4A 4Z7VB 1FZOB 3PP4L 3D3VA 4D0DB 4FRWA 1NFDE 4DWHA 2CRYA 5ACZA 4NKIL 4ZPTB 2P5ED 4KQ3L 4OFKA 5I30L 3SDAA 3O3AB 1EHLL 3LZFH 5ESQB 4IRZH 1ADQA 4JEGB 3RZCB 1TITA 4N8CH 4ZS6C 1NAMA 3MNZB 1SJVA 3IFLH 1I1AB 2NMSA 4R2GC 4X8JA 5DUPL 4BQ9A 4UIKL 1EMTH 3SJVA 1IGCH 3OX8B 1SEQL 3K2MC 4HXAL 5DXWA 4PRID 4TULH 1UXSA 3SKOB 4MA7H 3TVMA 1T66C 2IWGA 2GCYA 1KYOJ 4LCYB 4L3ED 3U4AA 5FYJH 3U2SA 3C09B 3UTPD 4PJEA 1A6ZB 4W68A 3LS4H 4WJ5A 4KK5D 4YUEH 3MRDB 3ZKXB 2AJVL 2FLRT 4OGAC 5SV4A 2OJEB 4EN3A 2GJ6B 3JWOC 1E4XH 2RCSH 3RPIB 1LO3L 5TF1H 5C08D 4JQXA 1XIWC 3QQ3A 3VWKC 1OVZA 4JFFA 4XPGL 5DFWH 3HRZA 4K9EH 2OR9H 2B0SH 3I85A 1KCRH 4NKDA 3JVGA 2WLZA 3QEUB 1GZQB 1YEGH 1IKNA 2ZZUT 3L6FA 5LGJA 2I9LA 4G7YL 1GL4B 2NY6B 3IETA 3IDMB 5MEOA 3VCLB 4TSBL 1IAIH 4TNWF 4DGVH 1T1ZA 1G1YA 2VSDA 4N0FB 3TBTB 1G9MH 1WC7A 3VFOB 2Y5TB 2DLTA 4X7EC 2A6JB 5E0QA 5GIRA 3AU1B 1BZ9A 3QIWD 5EZIH 1KIRB 3B8SA 1AD9B 2HVKA 4XP4H 5T1LB 5B3NA 2DQDH 4GKNB 4YE4H 1IT9L 4Y0GA 4DK6A 4ZS7H 4M9OA 5DJDB 4XBEL 4WI7A 3PWVA 5DQDH 2NPLX 1JZ2A 5EIIA 5DFVD 4PRNA 1FL5B 1DQJA 3MBEB 1CGSL 1G0YR 5CIPB 1DQML 4MA1B 4I0PC 4H8WC 5HHVL 2VDQH 4HPYL 3F7VB 3HG1B 4UDUA 5JHDA 4GBXD 3JUZA 4U6HA 1ERNA 3U0WL 5BS0B 4G9FB 4LLDA 3ARYA 3BGMA 4WTZA 1WZMA 4HUWB 1T20B 4ZUSB 4UV7L 3BEVA 3ZT5A 3FQNA 4PJ9C 1MSPA 3HZMB 1W72L 2IAMD 5FGBA 4EUPB 4F9LA 3C5JA 3DX7A 4F8QA 4FN0A 1VEMA 4XPTL 3BKCH 4M8VA 5H8DA 3RU8L 2UZIL 4JJ5B 4Q2ZA 2NTFA 4M1DL 2F53D 3IAQA 1SM3H 5DMYA 3VGFA 4GMSL 1RUMH 4HS3A 4Z0BH 1GZQA 2YA0A 1QRKA 4WFGE 5D7SH 1SHMA 4Z7UA 5IP4A 2VB5A 3LVEA 1WZ1L 3QZWA 1A4JB 1KCUL 4HBQA 2BNQA 3ZL4L 4NT6B 1AGBB 1UVQA 5JZ7D 4P5KB 2ZSVB 1HIML 5B8CC 3V5KB 2B1HH 4NRYA 1DBJL 4YGAB 5C0BA 2SEBB 4LSPH 5C0ND 2OJEA 1Z6JT 1B90A 1W0WB 4TQEL 5E2WL 5KSAA 2VDML 3T65A 3VGAC 3DJ9A 1BVLB 5HYJB 2K1MA 3S36X 1F4HA 3OKYA 3NCYS 12E8H 5ESAB 1U8MB 4U3CA 1NGWA 4WEBL 5AZ2L 4LLQA 4L1DA 3S9DB 1CLOL 2VKXA 1LE9B 5DK2B 1QFPA 3BP7B 1F6AB 2B20A 4P46D 5EU3A 4YO0A 1PLGH 1XF3B 2V9RA 3EYOA 4G59A 4RBPH 3OSKA 4Z8FH 2R4SL 1EFXA 3WXWH 3LKOB 3WEXB 4JPIB 5I15L 1LE5B 1NUFA 1LO4H 4NKIH 5BV7C 3PABA 5HHNA 4JRXB 4XVUD 3ARBA 2GSGB 4WI9A 3O4OC 4HUVB 1WAAF 5GRYA 5GRZA 1RZKH 1F90L 4PJEB 5K9QG 4NDMA 4PJGB 3HZYB 2A38A 2UY7A 2RHEA 1FFNB 1N4XL 1NC4D 3AXLB 3FO9A 1WV7T 4HHAB 1FAIL 3HCVA 4QRUB 3KXFB 4R4BA 4JFQA 1T0MB 3BH8A 2A77L 1A5FH 1AGEB 1G9NL 1Y6KR 1QHOA 5IHLB 2UWEA 4JB9L 1KPVB 3P0VL 3MR9A 2R15A 4YWGL 2FEDD 5JOPD 4LCCC 1BBDH 5IFHH 4RZCA 3MLWH 1S9YB 3ALPA 1PZ5A 4NHCH 4NRXB 3HKFA 5JW4R 4HUXB 3T3PF 3BIKB 3WIHL 5EOCJ 4YDVA 4MXQA 1UEMA 3D39A 3M17B 1UM4H 3J7HA 5I6XC 4U1NA 4JY5L 4OGZA 4GG8B 5EU6D 5C8JA 4CKVX 4IRJC 5JQ6H 2VDOH 3QEHB 2VSCA 3MLRH 4PJFA 1RMFL 1AR1D 5F7YC 4JPWL 2FH8A 3O6LH 5D1XA 1FFRA 3I6KB 5DUML 2AXFA 2Z4QA 2Q20A 2DJSA 5LCVH 4WUKH 2JLLA 5HDBF 3HCVB 5IT2L 5KJRH 2IQAA 4XVTH 2OTUB 5FHAL 4DVBA 4KI5C 5JDJA 3RWFB 1LQVA 4WW1A 4TUKH 3QNXB 4Z7VF 1FVCA 3GHEL 4KK8C 3VFGL 4PV8A 1LGVA 1N2RA 1EJ6A 2DQEL 3F7PC 2R56L 3CVIL 3AB0B 4NQXA 2ZUSA 5FKAA 3ILPB 2Z31A 2X4NB 4J3XA 3N1PC 1S8DB 5ISZD 5E8NA 2W65A 2WLYA 2AXGB 2RJMA 3QDGE 2CSPA 1I3UA 1CL7H 1IARB 4KC3B 3PGFL 1EA9C 2Q6WB 5DJYA 4LFHD 5ICYB 4KGLA 5ACMA 1J12A 5EOQH 4WU5A 4LSQL 5FYKE 4JG1H 3O41B 3OKLA 3O8XB 1AGFB 5DURB 5DJYB 1T2XA 1YMHB 4ZUSA 1AR1C 2CRIA 2Z4QB 5C6WH 1WF5A 2CJUH 4NUJB 5I8KH 4F3FA 3QCVL 5E7FA 5HY9B 1MJ8L 1JPST 1EO8H 1G9NC 1AJ7H 3D85D 4AIZA 5CJ5A 4PJFB 4Y5VC 1DUYB 2WQ8A 4YK4B 4MXWH 4QTHB 3ELAT 1SQ2N 4M00A 2PXYC 5C07D 1IGTA 2ICWI 1MFCL 2JCCE 4YEFA 1FVEA 2X42A 3FB5B 5F93C 3FQTA 2Y07L 1C16A 2FBJL 1QSVA 2H26B 3FOMA 4OD2A 1C5CH 1NSNH 3Q0HA 4XCNB 3SDXB 4LKXA 1ITBB 2NY0B 2E9JA 3U6RA 1S7SB 4DTGH 1JPGA 3HNSH 1IM9D 5E00A 3S96A 1XF4B 2W0KA 3W0WB 1RZIA 2NW3B 5JPNA 5KVFL 3KLSA 3QFDA 3ULUD 4YDIL 1CDGA 3IDMA 1MAMH 3IETB 4XVJL 1G7HB 2GTZA 2WUCL 4PY8J 3QHFL 3G6JF 2XZAL 2Y23A 1XF5B 3RZCC 4X4YB 5J11B 1FG9C 1QA9B 3DMMA 1NCNA 2J4WH 2WK2A 4NQSA 1XH3A 3WL9A 1T7XA 4N8PA 1NBZA 4NJAL 3MRRB 1RUML 1HCVA 3S88L 4JFFB 1X9QA 2DQTH 4OGYH 1YJDC 1OCWL 4PJDE 3QAZC 1OHQA 3ZE1F 3MGTB 1U36A 3WKML 2BOBA 2PTTA 1VDGA 1QEWB 4YXLL 5B38B 4UTAH 1JZ5A 4CU8A 2FZ3B 2GITB 1A6ZA 2PETA 4JVUA 2XN9E 4LVHB 4ZO8A 3QPQD 4CW1A 4NZDA 5FXCH 1BREA 4GBXC 4WI5A 5A43C 4APQA 3VFRB 3LQMA 4S1RL 3O3EA 5JW4M 2NXZB 3FO0L 5KSUB 3L3GA 3BKML 3ULSB 1FRGL 2Q8BH 1JTPA 5DRXB 4O00A 2IBBA 4MGXA 2SEBA 4WW2A 3SGDI 3O9WD 4NYLB 3PXJA 3V5KA 4U7KA 2VDKH 1OWRM 4PJGF 2HT3C 4KAQH 4OZHF 4Y89A 4PYGA 1FDLH 5K9OB 2HFTA 3MXWL 2R8SL 4NUGL 3VH8G 3JWOH 1MCEA 4JFEA 4P2OD 2O61B 2X1PA 4NM8L 4XNUH 3PHOA 5DVKA 2X4UB 4LLQB 4U4BA 4H1LB 3DECA 1Q38A 3KPMB 4AEEA 1U8HA 5DQ9B 5GGUB 2XICA 4DVRH 3KWWA 5B39B 1HZHH 4NGHH 3VGHA 5LAXB 1F5WA 3GBMH 2GK0A 2F74A 1CICA 2VIRB 4JANB 4UQ2A 4NQDB 1DFBH 1JNLL 2BY1A 1AIFB 2DQHL 3B9AA 5FECB 2B39A 4JDZB 3SDAD 4YDKH 3BYTA 3BQUB 5J6GB 4PP8C 4MVBC 1RIVL 2BMKA 1R5IA 3FAWA 1ZGLA 1LQSR 1NBVH 4P4RB 3FO2B 43C9A 3QA3B 1NFIA 2UV3A 1FYHB 2EIBA 2VC2H 4UTBH 4JDVB 5F7FA 2AI0L 4I8DA 2MOVA 1FL6A 5IB1A 4YPGA 4JPKL 2BFVL 2HP4A 2C3GA 5DJAB 4I3RL 5F9JA 1T21A 1UGNA 2Y1VA 2YD8A 4O4YL 3IXTA 5AWNL 3JXAA 3U36B 1VADA 1JPSH 2Y36H 4I0PA 3IRZA 4MNQE 5DK0A 1GGUA 3S3PA 1J1OH 2BVQB 2RIKA 3CFKB 4BH7A 2O26U 2WZPD 1J0HA 3I3DA 5F72S 3GMRB 3TESA 5AUMA 1UZ8B 1NUNB 1X5LA 1I9EA 1T1WB 2COQA 3HG1A 4C57C 3P77B 1NCAH 1A02N 2ICEB 4QTIH 1GJIA 4XBGB 1EO8L 4NPYB 1S5IH 3HB3D 4H1LA 1NFIB 2VMFA 2YBRB 1C7TA 3CFCL 3QP3A 3VFPB 4JHWL 3BD3A 1TCRA 2FX7H 2NW2B 1DUYA 4BFBD 3FB6B 1MFCH 3QUKA 5D1QA 3GGWA 2YKLH 2W59A 3HNTH 4N9OB 3CX2A 4NHCL 2FGZA 4JKLA 4RRPG 5C0FB 4P2OB 3SDCC 3V6OA 4GKZB 3RKPA 2VE6B 5GZNC 4BZ1H 1N59A 5I1AA 4Y4KB 4UILH 3MRHA 3U79A 3DUSA 1KB5H 5LBSH 5TQ0H 2PYEB 3VG0H 5A40E 5I1IL 2AJSL 3TZVD 3D5OF 1P4LB 3PNWB 4Y88A 1A3QA 1ZHNA 1UH4A 5H2BA 1WWBX 2EH7H 2X1QA 2YPKA 3MRFA 5B38A 2HRPH 3QQ3B 5E8NB 4KTEL 4A6YH 4Q6IC 1X6LA 3GRWH 2DYPB 5I8KL 1V3JA 4XVTL 3QI9B 1HSAA 3OKNA 4XC1L 5TGBA 2JIXA 3QCTL 5C0RH 2VXVL 4G7YH 1RFDH 5E6IC 3MREA 5J3HC 1MFAH 3TYGH 1MJJA 5D2LA 3CFJA 4GW4B 4M8QB 1RZ8A 5JIPA 5AYUL 5JXAL 1ZOXA 1JVKA 2GK2A 3HE6C 3NGBC 2A6DB 1CN4A 1IFHL 1AKJA 2HT4D 4Y16C 4PRHE 2FJHB 5DRZA 1BD2E 4YE4L 4OCRH 4HIEA 1FZJB 3QAZB 2CQVA 1HHKB 2KH2B 5BVPL 3GJFH 4NKOB 2ZOKA 1D9KA 3KXFA 2HVJB 3HC4H 3M07A 3BZ4B 4LSSH 2X41A 4KJQC 5CBAA 1R3IH 5CCKH 1CCZA 3DXAA 1FN4A 2D0FA 1ZLUK 4XNXH 2ENSA 4P3WA 3RDTB 3P4NA 3QUZB 2ZOKB 5CHNB 1RZ7H 4GBXB 3O2DL 3MLTA 3ZHKA 1G7QB 4NQEB 4UNTA 1JV5A 3FONB 3LZFL 2J88L 5IQ7H 2A83B 3HFML 3GFUA 5JPNB 5DRZB 4J1UB 3PWJA 5GGVY 3MNWB 3MRPA 5IBLD 3BKCL 5C6PB 3QIUA 3MA7A 1A3RH 3KJ6H 4ORGB 2PXYA 3GSQB 3WN5B 2CH8A 1U0QA 1R24B 2DMBA 1U8MA 1AQDB 4OZFH 2X4SA 2DYPD 2MMXA 3QHZH 4PJDF 5GSVB 2JTDA 5DI8B 1EFXD 3LV3A 4H26A 1IVLA 4ALAH 2R2HB 5HDQH 1KJVA 2VE6A 1SJHA 1JWSA 4AYFA 3H9YA 3P11H 4YC2C 1C12B 2NXYB 1QR1A 2CMRL 3TBSA 1RIHL 1ZSDB 4BFGA 3D25A 3MRJA 1DBBL 3RWHA 2A6KB 5GRJL 5D1QB 4EI5A 3TA3C 5F7EL 5A2LH 1BZQK 5KVEL 1F3RB 3LAFA 4OGAD 1PSKL 1QRND 3C6LA 5CILH 3GMNB 3L95A 3H6JA 1AGFA 4Z7QE 4BM7A 2LU3A 1NGWB 3KPQA 1IAMA 4CVXB 2CGRL 1YMMB 4XBGA 4NM8H 5J1AB 4NQDD 2ADGB 3UJTL 4K3JL 4DVBB 3QDGD 4PFEA 2MTPA 2GJ6D 1MREL 4PJBB 4EN3C 5IGXL 3L95B 4Y4FB 3IFLL 4TRPL 3ARGD 4IHOB 3QIUB 3UTZA 1TQCB 5F96H 1BOGB 3RVUC 2NY2B 1I9IL 1C5DA 3L3OA 3I9GL 4L8SC 2X4NA 3DROA 3F7VA 4UDUB 2H2SC 1HKFA 4UAOB 2OMNA 4O2CB 5HI5D 3KS0H 3IJYB 2VLKA 4MNGA 3GI8L 4HS3B 5M95B 5C0CE 3S5LA 2Z9TA 2A77H 4KKAC 4R2GB 3DXAB 1UB6A 4DAGH 4D8PB 1B4JH 4OIAA 3UEZA 1K85A 3VXQB 1B0GB 4YWGH 3MFFA 3QIBD 2BDNH 2FRGP 4G8GB 4D9QE 4LNVA 4XAWH 1K4DB 8FABB 4ZPVA 5C07B 4GMTH 5D7LA 2QTEA 1HYRC 3C09C 1EEZA 1J05B 2BOCA 4E5XB 3M8OH 1IMHC 1FAKT 5T1LD 4Z7WF 1T03L 5ISZA 3LN5B 1JPTH 3KYOA 1O5DT 2CRZA 3AS2A 3P0YH 1PW3A 3OGOE 4GRLD 1JTOA 4I48B 3HRZB 2X70A 3RNKB 1MJUH 1L7TH 4UUJB 5DGRA 5KVGL 1U6AH 5BV7H 3KHOA 3O45B 3U4BL 4X6BA 4HUMB 2XKNA 1YN6A 5F3BB 5FGBC 3QDHA 1EHAA 2OTPA 3UTTE 1N5AB 5I1DA 4U2ZA 5I0ZA 4YO0B 4Q6IB 4N0RA 3RWJB 2ERJB 3CFJB 3JTSA 5BOZG 4G6FB 5C9KA 2BSED 3KYKL 3ZZ1A 2PYEA 3RVVC 2VZOA 3VA6A 4OZIE 4M61B 1HH6B 1GIGL 2DQCL 2R0LL 4C56A 2IGFH 2VWEC 4HK3J 1FLRL 4I5BB 5K93A 1DBAL 4P2RB 1PBYA 4X83A 2CDFA 3MRLB 5DEFA 4DZ8A 3R06B 4WO4A 5C0FA 3OKEA 1PKOA 2FJGA 1V3KA 2QSQA 5IBUB 2BVPB 4MB3A 1RD6A 5CAYB 1PLGL 2CLZB 4CDHA 5AD0B 2P5WA 2E7HA 3L3GB 4ZOCA 3DETC 3O2DH 3MJ7A 5EBGA 5FB8B 1FFPA 2VXQL 3TO4C 4AL8L 4CW1B 3GKZA 1UXSB 4JG0L 3O6FB 1UB5A 3BW9A 4MNQD 1RJZA 3ARUA 1QLRA 2LTQC 4NCC2 1YDPB 2J12B 4K2UH 4ZTPL 3PQYD 3BQUC 3HZMA 3GSVA 2YPLE 2EE3A 4OBSA 4OF6A 5F6HI 1T1YA 4M93B 3VWJD 4Z7VE 3PUCA 2HFEB 4RGOH 2WM0A 1XGTB 1S7RB 5HSFA 4HBCH 5HVFB 2XZQL 3T2NH 4HW6A 5BVPH 1C16B 4WFFD 4XCNA 5EBMB 1ZHBB 4Y5VA 5MEQB 3MV8D 4A2LA 1D6EA 4PRNB 3ZDYF 4MVBA 2EXYC 4M6NH 5TE6H 4J2XA 2AQ3A 1G0XA 3BZEA 2NTFB 2GTZB 1IC1A 3FFCB 4FQ2L 4CVZB 4JKKA 2X4TB 4FTVA 4L8SB 3L3OB 4JY5H 4OZIB 4I9WD 1U41A 4E41A 1NUGA 1K8IA 4TOYH 4HJJL 1OD9A 3T4YA 1CDHA 4RNRB 2VXVH 1JMZA 4NIKB 4JQIH 1HNFA 3SE8H 3QUML 4L8SA 5T3ZL 5D1ZD 3S35X 3PV7A 3TA3B 4OD2B 5FA4A 1BF2A 4N68A 1X5ZA 3F12B 2XN9B 4ZOEA 5CMAB 5MEQA 4YQXH 3B2UD 43C9B 4EIGB 1G9NH 5IB3A 1IAIM 2A9NL 1YY8A 5EUOF 5SX4I 1HYSD 2BSTA 1J1PH 3VFGH 1ZLVH 1XGTA 3OB0H 3KPSE 1H15B 1W8OA 4QHUB 3HAEA 3MRMA 2F19L 5C0AE 2VQUA 3X13B 3OKEB 1UFUA 3H42H 4UQ2B 2HTKC 2Z91B 4F7CB 1DQDL 3VFOA 1FGNH 4ESKA 2E9IA 2I25N 1ONQB 2CLRB 3BMWA 3FN9A 1ZGLP 3V6FA 3EDJA 3EOTH 1G1CA 5DI8A 3I6GA 4OUOA 1MAKA 3S7GA 1LO5B 2GT9B 3IDGB 5FO9A 1F00I 5FYKH 5CINH 1HXMB 5E94B 1IQWL 5BXFA 1YNLH 3MA7B 2W92A 4J23A 2QJDA 2E5EA 3G6JE 2ICWA 3C60C 4S1SH 4P9MH 4UU9B 5F3BA 3EJJX 4YX2L 3PL6A 5I74B 1R0AH 4HPOH 3LIZH 4Y5XC 5L8JB 4RA0C 5IEHA 2MPAH 4HIIA 2C4FU 1AJ7L 3QBTB 1A0QH 2XWBA 5TPWL 3CDYA 1YYLH 1AO7D 2YPVL 1MJ7H 4L4TE 5MENA 4KXZH 1IEBB 3P2TA 3DO7B 5D8JH 1ES0A 4XNQA 1G9EA 1P7KB 2E6PA 5DR5H 4WU7A 4X99B 4ORGA 4CMHB 4X6FA 5MP6H 3U9PH 3QUZD 2XG4A 2AJXL 4PTUA 5KG9A 2ADJB 1JIBA 3TPUB 5I1KL 5FHBL 3RUGA 1P2CB 4M62H 5FM4A 3SKNA 4LHUA 1I3GH 2J6EL 4BJLA 5EOQL 5GRVK 1JGUH 4ZFFB 5C07E 1DEEB 5EWIL 4NQCB 5E5MA 3DO7A 3I02B 5E5UB 4PJ9A 1TVBA 4HUVA 4V2CB 1E6OH 2NY0C 1QO3B 4NFDA 1CFNB 3CSBA 5BQ7A 1QBLH 2R9HD 4P3CL 3TNMB 4HV8B 4OV6F 5E1HB 5DFTA 5HI5C 5F7KC 2FL5A 3WFCL 5IFAL 3CXHJ 5J9PB 5EC2A 2MKWA 3UJJH 4WDIA 1AKJB 2JJTC 5TE4L 3EFDL 5DRNB 4NCC1 4OTXH 5I1GH 3V0WL 1G9ML 4U6VH 3U6RB 2FSEB 3MNVA 4JO3L 2JB5L 3EYVB 4KQ4H 2G9HB 1AR2A 3LKRA 4BYHA 4DUXA 2O5ZH 1A64A 2OQJA 3VXUA 4CRPA 1ODAA 4NQED 2G75B 3DO3A 1IGTB 1XIWA 1NPUA 3GMLA 1CS6A 2FJFB 3C6LB 3LSOA 4O2CA 3ALWA 3ARWA 1OARL 4QLRA 5GJTH 1H3PL 3WEXA 2EDBA 4U1LA 1RZGB 4DCQA 4JRXE 2ZOLB 1MCQA 2AQ2A 5TQ2H 1S7VA 5TFSL 5IIEB 5E4EB 1A4JA 3N1MC 4F80A 2I07A 3D2UD 4RMSA 3N9GH 4XGZB 1AY1H 2M2DA 2D7MA 3D87B 2V17H 5E2VH 1SJEB 4LP4A 3CMGA 3CIQA 4CADB 5IMMB 5CJOL 2EDOA 2QADB 5IG7A 2P4AB 1PG7L 3MRBB 3FO1A 3H0TA 1D9KD 5EO9A 5FUOH 1B3JA 4KMLB 4KK9D 1T7ZA 2BVQA 3CFKA 1GXEA 5IKCA 2MJWA 3BOVA 3DXAD 1SY6H 3NN8A 4OF3A 5HHQB 4V1DB 4PJXE 4OFYA 1DP0A 3NFPA 1Z9MA 2NY5H 1Z2KA 3NTCL 2M8XA 5GGQH 1PKQA 2GAZB 4KRPB 4JFOB 5IB1B 4M43L 3MGOA 4XWOC 4K9EC 1CBVH 4PV9B 4LK4A 1OAQL 2DWEB 4U0QB 3V52L 3QDJD 4UV4L 3STLA 3IDXL 1XGYL 4OM1H 4EDXB 3QIUD 2GUOB 2W07A 5EUOE 3GSNB 4NNXB 3FQNB 2GSIA 1ZHKB 2BCKB 2LU7A 2EDNA 3JV4A 4HG4J 1VFAA 4CVUA 3RY6A 4Y4HA 2H8PA 4LEOB 3KNBA 1NJ9B 1ZA6B 4HFWA 4QRRB 4GKSB 1H9VA 1FJ1A 1QFOA 1AD0B 3TC9A 3AREB 1IZKA 1P7KA 1JNNH 4DJMA 3HI5L 3HZYA 3LKSA 3QNYA 5C1MB 1A4KB 1KLGB 3QIBB 1QRNA 3C6LD 2P5WB 3TNNA 2XKSA 3VXMA 1R3HA 1IM9B 1C8PA 3GKWH 2DWDA 3MMEB 4GW5B 5JMOC 2K9UA 3F8UB 4XNYH 5FAAA 5JW4Q 1LNUB 3ZKMD 4TYUA 3T0BA 1T2QH 3IDNA 2PN5A 4D3CH 2XTJC 3GSNL 3NA4A 3B9KB 3F62A 1Q9OB 3TCLA 4NN5C 1OTSD 3L5JA 5F1NB 2VXUH 2Y72A 2DIAA 1UT9A 1PY4A 2X10A 4FFZL 4FQ2H 2VL5B 4X0KA 1NMCB 1HI6A 1UQSB 2RGSA 4NKDB 3BGFB 4DGYH 3QFJE 3QDJE 5BMFH 3OJDB 3SBWA 1K9TA 3G6DL 2J5LB 5LQBL 1HSAB 2Z91A 1DQTA 4DEPB 1G7LB 3WUWB 1QQDA 3VFWA 4JM2A 2OMBA 3LB6D 2XOTA 3TN0A 1DSFL 1I9JH 1EJOL 5D96C 2Z8WC 3MBXL 4PGJA 4NNYB 5I73C 4LPUA 4YFLI 2C1OB 3PE9A 1F6AA 1JZ6A 3VFPA 5J57B 1YEIL 4Y8DC 1RV6X 5E08H 1BLNB 2OK0H 1ZKAA 1MFEH 5FUCC 2NLJA 3VWKB 3T0EC 1S7XA 5ESAA 3IS1X 1CVSC 3UTOA 1DBKL 4YPJA 1FNGA 1HHJB 3OZ9H 1RUAL 3BRFA 4M4RA 5SX4H 5E6ID 3UTQA 5EU7E 3OX8A 2GTWB 1NBVL 4PRHD 2JF1A 2VOTA 1BM3H 1WFUA 3OGCA 4JGMA 2E7LE 1S3KH 1W8NA 1YMMD 3VDAA 4NFCA 1D5BA 3E2HC 1QPPA 2ZPKL 2Z8SA 3OG6B 4BA8A 4PJ7E 5FGRA 5FYJU 1GGCL 1U95A 3K8KA 2NW2A 1E27A 5EU4B 3OJVC 4H0GA 3AS3A 4OLVH 1R5VA 2PTVA 1NCCH 3I2CH 2GW5A 1NGXA 3VXSA 4ONFH 4PR5A 3Q6GH 3VA2C 5BCAA 2H32B 4P57B 1U8PA 5E9DB 1ETZA 1I4FB 3U7WH 4HS8L 1CDBA 3JTTA 4ZFGL 4M7JH 2P5EE 2NR6C 2QQLL 1U8LB 4G3YH 5FO7B 2OJZH 5T1MA 1E27B 2WWKO 3G04B 4PRBB 5EU4A 1EUTA 4X4ZA 3KPPB 5EC1B 5DMJB 2NNAA 4NUJA 1KTLA 4FQJH 3VFSA 1WISA 3OGCB 3BGMB 3IFNL 1VADB 2BRQA 4K07A 1QUNA 4NP4L 1NEZB 5FUOL 4PRBA 3K81A 6FABL 5TE4H 4LSVL 1XR9B 1NLDH 2VXTH 3VMPA 3RIAF 1HHJA 4NBYB 2BNUA 3STLB 2VISA 3QZWG 5K59E 3S36L 3ERYA 3BMVA 1IBGH 1UWGH 1MJUL 4NN7B 4WUUE 2B8OT 1YY9D 3EKCA 5SWSE 4X7TB 3SQOL 3V0VA 2BNRA 4ALAL 3FOLB 5DYOB 3LKQB 3FQUB 4JN2A 3DV4B 4XBPB 4GKNA 4U1LB 4MNHA 2Y25A 4HPYH 3AM8C 1H3PH 4WV1A 1FHGA 4F7EB 4G43A 3IDXH 1JGUL 1GOGA 1TVHA 4DZ8B 3OKLB 3KAAA 3MODH 4Z7NE 3F6LA 4NO2B 4M48H 2R1WB 4LEXH 3HA0A 4XP1L 4XNXL 2CPCA 1HH6A 3W81A 1UYWL 4H8WL 2FB4H 2WW8A 1DE4A 2J8UF 3HNVL 5D7JB 4XVSL 4P0DA 2EICA 5J6HB 4NZTH 2AAVA 3DRQA 1WIPA 1Z9SA 2AEQL 43CAA 4L4TD 2FHBA 3UBXA 3MLSL 4KY1L 4HX1B 3DHMA 4N1EA 4JO1L 4I3SL 3W11C 5FKAB 4KTYA 4AMKL 4LGSB 5L7XH 4HUKB 1F3JA 1HK6A 5DJXA 5KS9E 5CHNA 3KGRA 4S10A 1I9IH 1WWAX 2IPUK 2WV3A 5ESQA 2E9WA 3IU3A 3LH2H 1LK3H 5CP7A 4LAJH 4KJYA 5ECJE 2LE9A 3C5ZC 1D6VH 1T0PB 3I84A 3KPOA 4APQB 4QRQB 4LVOC 2IPKA 4KXZI 5I66B 2BOCB 5IM7A 3MLUL 1A1NA 3NAAL 2QHLA 3G5YB 4OAWB 5HVGB 3TVMC 2GYSA 2JJSA 3ARED 4N0UA 4M5YL 2VLJB 4M4PA 1DLFH 1R3JA 4ZUVB 5D1ZB 4XHQA 1ZHLB 5DVMA 1Z3GH 4JY4B 5IB2B 3BDXA 4PTTB 1MF2L 2WQRA 3O9WB 1E4KC 2CKBB 3T77A 3J8F7 3FB8B 4OQTL 2FO1A 5T3XL 2BY2A 3ILQD 3U0PA 4JFOA 4O51A 1IQDA 3BI9X 3HN3A 3QG6B 1L7TL 4LMQI 1MI5B 3QUMH 5C0IA 3GSRB 1ZLWH 5H2BB 2FIKB 3EJYC 2XI9A 3GSOA 4XNMA 4YFLF 1I8KA 5B3JE 1XF4A 1LO2L 4Y4FA 3PIQA 1T2JA 4FXKA 2VDLL 4B5EA 4GW1A 2EO1A 5JMRA 1MHCB 2NY7H 5GRVL 1S78D 2EXWD 3WDIA 4HKXA 4G8GE 3E3QA 5DO2D 1BEYH 5FYJL 3T0XA 1NUDA 2VH5H 5CS7A 4PRIA 5L2KE 4HIJB 3TH3T 4WFFE 4HWEL 3EO0A 3TVMD 1ZA3B 1FSKB 3SE4C 4BSVB 4KZEH 3LPFA 3DV4A 1MWAL 3OV6A 4NOBA 3TF7A 2YOCA 4QHLB 1KUMA 3O11A 5ANMB 4Z7WA 43CAB 1ZSDA 5JQ6L 5DZOA 1DN2A 1Q1JL 3QZWB 4G3YL 3O2VL 1RMFH 2YPLD 1LEIA 4LCUB 3L3HA 4WW1B 4X6EA 1IQWH 3AVEA 4K7PX 4ZYKB 4G80B 4XPHH 5F96L 3PWUB 4KROD 3EYVA 5A2IH 2ZKHH 4RFOL 3TBWB 3UZVB 1I85A 5JNYB 4G8FA 1I1RA 5DT1L 1RJLB 1QVOA 2RAMA 2X89D 4Z18A 4W81A 3T09A 1WTGT 1WZKA 5DMGD 1C08B 3CSGA 3UPCA 4F33A 1KEML 3FT3A 3HAEB 2AXGA 3GSNH 1TJHL 5DHVB 1BM3L 5FF6A 2W0FB 4LPTA 1OM3L 1FC2D 4R26H 2YD2A 3BZEB 4LRIC 3DV6B 3VFNA 3SGEI 3O6KH 4S0TD 4UNVA 4KJQD 1QKZH 4YUEL 2IGFL 5DQDL 4GMTL 3ARGB 3BQUA 4AT6A 4QCIB 1OW0A 3BSZH 3N85L 4YHNB 5IV2B 2LQRA 5DVNA 3Q3GA 4OF5A 5T1DH 1KTLB 1D5XB 4D0CA 3MUY1 4XCYA 1CICB 3K1KC 1H8SA 1S7QB 4U1SB 5GGVH 4OAWA 5I1IH 5LAXA 1IM3A 4KKCD 4LLAA 5DK3A 5A16B 2D4DA 1IQDB 3V7MA 5F1SA 2XQBH 1XIWD 5SWQA 3O6FA 5C7XL 2AABH 3BH8B 2VERN 1UM6H 1QO3A 3RDTA 1OAUH 3KPOB 1RAMA 3MV9D 4JY4A 2C1OA 1F2QA 3O2DA 2IAMA 2XQYK 1RZKC 4WW2C 4LAQH 1GGTA 2P5EB 5DVLA 1Q94A 3UZEA 1P9MC 4ODVL 4UQ3A 5IW3A 1U8KB 1WC7B 3MRLA 5DEFB 1QSFA 1G0DA 3ULSA 4HUNB 5FFLA 2UZXB 1QLRB 5F3HA 1L6ZA 4WEMB 3TA3D 4DQOH 4GSDL 3GIZL 3KDMA 4YBLC 5E94A 5BXFB 1I1YB 4QY8B 1U3HD 2IPKB 1JF5A 1U91A 5TE6L 4G9DB 3NPZB 2VZ1A 3QQ9C 4OFYD 5EZLA 4I18C 2NY3C 5F71A 4NKQB 3OB0K 1MY5A 3CVHH 3RIAK 5I2IA 2DQIL 1BJ1H 4O9HH 3EZJB 2VNCA 3B2VL 3C5ZB 4X5XB 5C6TL 4X8JB 4JR9H 4OD1H 3QEQE 4HWBA 5I19L 3MCLH 3DSFH 3R06A 5HYJE 4ZTPH 1P7HL 1ZHNB 4DUVA 1TZHA 1DUZB 2H2PC 4L8CB 4KUCD 4YIQB 1PG7X 1U91B 3IDIB 3ZL4H 3V4UH 4PJ7F 1XR9A 4I2XA 1JGVL 1E4WL 4N5UA 5F88B 3C08L 3QYCA 4FQ1L 4DFHA 3VE0A 4MJ5B 2R4RH 4HCRH 2JB6A 1N6UA 3RTQC 3NIDE 4LEXL 4P5KA 5HI3C 4MHHI 4Y2DD 1KCKA 3DX9B 2KZWA 4LLMA 2OL3H 1NCTA 1MCOL 1KPRB 3L7FB 1DLFL 4BUHA 3QG7L 5CEZL 4FQXD 2NY1B 3VRLE 2ZCKH 4GRWH 4HMDA 5CP3H 2DLHA 3QFJB 3RL2A 5ERWB 4APQC 5M94B 4Y19B 5HHOB 2ZCHL 4GAYB 3RBGA 4QTHA 4Z8FL 4LKCA 1DZBA 2W0FA 3WNMA 5ALCL 4LF3A 4ZNEA 3SGDH 4MXQD 4GRWE 3S98A 5GIRB 2NY4D 3AGVA 4LBEA 3TH4T 5JO5A 1A1MA 4N0CA 3QRFM 1UKTA 1TPXB 3MOBH 3RWGA 2QQNL 3IXTB 4OGXL 3O41A 5DT1H 3P4LA 3EYUH 3CNKA 1ZANL 1UM5H 2ZG2A 4DKEL 2FIRT 4X6DB 4F7PB 2PTUA 4XMPL 5ADPL 4PJXF 3L7EB 1U8HB 4EOWL 4X6CE 1SEBA 2PW2B 3OG4B 4RMTA 2D03L 2Z0BA 4LCWD 2ITCB 2RR3A 5DC9B 3FZUC 1XZ0A 3GI8H 5DJZB 3ARBC 3DX9A 4JDZA 1QBBA 2F8XC 3T0AA 5F1KC 2DM2A 2AKRA 1BIIB 3AU1A 4DN4H 4H1LH 2BY0A 3CFDA 1TIUA 5AG8A 4J6RL 1U8NB 4X9IA 3FO1B 3N85H 5E6IA 5F89A 3VDBA 3SEPA 4OKVA 2VDPH 4K3EL 2IQAB 5IVXA 4ODHL 4G8GD 1T5WA 4HPOL 4HK3N 2GITA 4OQTA 2BVOB 4JY6B 4R2GD 3O11B 3RWDB 3EOYG 2IANA 3DETD 1KFAH 4OF7A 3Q48A 1F45A 2AK4A 1U8KA 2C7UA 3NCJH 4ODUB 4TVPH 1XCTA 3JWNC 3WSQH 1D9KC 1YEIH 3WIFB 5HDBE 4I1NB 1XGUB 1UACL 2ZUUA 3PP3H 3VXUB 5L88L 1JWMA 4PJ5B 1UQSA 4JQVA 3QI9C 5MP6L 4M62L 1ORQA 3HE6A 3DWTA 1A7NL 2X4SB 4X0KB 2A6IA 1AHWC 5KW9L 4NQEE 3GMQB 4L4VB 4XCFH 5JOEA 3UDWC 1Q72H 4GSDH 3GHBL 1FZKB 1CQYA 4PJXB 4L5FL 4JM4H 2ZUTA 3TPUA 1GHFL 3P9MA 3SQBA 5H94B 3QRGL 5CD3A 4JRYE 4MMZC 5HD8D 3MNZA 3REVA 2JJUA 4G6JL 1IM9A 3WCYA 3FB8A 3FTGA 4YZFE 4XNZB 3VWJB 3IJSB 4KH2A 1AC0A 2X70B 4WUUB 1MRDL 2GJJA 3BXNB 3P4MA 4PJGA 2IC2A 2WUCH 2MCG1 3MYJB 1RFDL 1NDMA 1UM6L 2XTJE 4G9FD 1KJ2H 3GNML 1RSFA 5MERB 3HAEG 4NCDA 5A16A 1S5HA 5I1GL 2C3VB 1CFVL 1L6XA 4ZFOA 1T7WA 2EEDA 4LASH 4XCCL 1BOGA 3GI9H 3WKMH 4JFDE 4HJGA 1PX3A 2VXTL 4ODSH 2VO5A 2HTKD 5I17A 3B6SB 1WT5A 3MRQA 1RJLA 3U46A 3GMQA 3QI9D 1NLBL 1MJJB 4RQQA 4MJIE 1CK0H 3H9HA 1UWXK 3ARFC 4W6YB 5CP7B 4YEEA 1NCWL 4WCYH 3GMPB 3QUXD 5EO0B 1VKXA 3PABB 4P48A 2A1WH 5CZVL 2EEAA 3BKMH 3VD9A 4UAOC 3CX5J 4ENEC 5I15H 4XP6L 3SE9H 3K4AA 3OKKA 3C60D 3KLDA 3G6DH 4I0KA 3SCMC 2R4SH 1RZGA 2HFGH 2BVOA 1CGVA 4LVNB 3WD5L 5F9OL 5ADOL 4Y8AA 3UTZB 5I19H 3CCHA 1OAUL 1I1CA 4BKLA 1T4KB 2N7AA 1QVOB 4L1HA 1CLZL 1BP3B 5ALCH 1KCUH 3S88H 1S9XA 1U2HA 5C08B 3DIFB 5D72L 2YA2A 4U2YA 4UT6L 2ATKB 3HHRB 3IXAA 3GJEB 3SOBH 5FK9A 1DANT 4N90E 3GMRA 4P2OA 1U3YA 5C3TA 3RHWF 3VXNA 1BWMA 2VR4A 1DBKH 1E28B 4WV1B 5HDQL 4DEPC 3ARQA 1F4YL 3PWJB 1NBQA 2FX9L 1FYTB 4QF1B 1DBBH 2C3VA 1BWWA 3WS3B 5ESVA 3MRIA 4Z6AT 3HPLB 2XZCL 2CMRH 4JZNA 4YHOH 3CPLA 4JFPB 2VDRH 3MACH 1FO0L 1J87A 3KPSD 1CICD 1EHNA 2QKIA 2CKBA 5B21A 3T77B 3FT2B 5IMLB 4Y7MA 1A6AA 3W2DH 1CG9B 3RWFA 2P49B 4LSRH 5I71C 3U1SL 1RHHB 1AFVH 5ICXB 4MQ7A 3LD8B 4OM0L 1F4WH 4JN1L 3WJLC 4QEGA 1NDGB 1YEDA 2DQGH 3B8YA 3IFPA 2ED8A 3Q1SL 3EOTL 2CIIA 3PDDA 3BKYL 4TTDD 3BE1H 5C0JA 2H2PD 2YD9A 5L9DH 3DBXA 3VRJB 5DD5H 1BFSA 3ARDC 4ODHH 5KJRL 3B3IB 5IT2H 3FFCA 4O51B 3WO3B 3QUYC 4TVPE 1F42A 1FG2A 1G7JA 1QACA 1UJ3C 3C8KA 4HJ0C 4R4BB 3NA9H 4TUJA 1FBIL 3RL2B 1QTYT 1NC2B 2Z35A 1MRFH 3ESUF 5JHLL 5CZKA 3MUGA 3PHOB 1R5IB 1ADQH 1ZGLB 1D5ZB 4K3HA 5FYKU 3S4SG 5IFHL 4HEPG 3QDGB 4Q9CA 4E42A 2HVJA 3RVWD 2FEEI 1FV1B 4OLYL 4PJ8D 4HF5H 3BPNB 3EYSH 4NQTA 2OR8A 4PIRF 1KCSL 5I8EB 1XR8B 3V5HB 1XF3A 3MV7B 5F88A 5F9WB 4HWNA 2B4CL 32C2B 4IIQA 4X6CA 3VH8B 3KPRE 4RISL 4RMQA 2XPGA 5D9SB 4JFQB 3VRLF 3U2SB 4QRQA 3KPMA 5J0BA 4R7DA 4JRYD 1I7TA 2Q86A 2ICES 2ADIB 1L0YA 1U9KA 3OPZH 4IIQB 4X6CB 4BH8A 2APFA 5F6IB 4PYHA 4FXGB 2ARWA 4GLRH 2FLBT 3K2UL 3QSKB 5DD0H 2DTMH 4UMGA 1DBMH 4N8VG 2D0HA 1G7LA 3WUWA 3TBVA 5KSVA 2HRPL 3FRUB 3BP5A 3MLSH 4R9HA 3AAZB 3O3AA 1ROWA 1VFUA 4LNRB 3U4BH 4KHTL 1X5GA 4A2MA 4ELKA 1P84J 3S36H 5I1CH 2XG5A 1IC7H 1N8ZB 8CGTA 1JFQL 4Z0BL 1T5WB 5D2NE 1P69B 1H3GA 4MDIB 5FV2A 2C4FT 4OZ4B 3F12A 3P9LB 5D6DC 4XP4L 1INQA 3O2WH 3ZE2F 4OB5L 3MRHB 4JKMA 4AH2A 1FCCA 1RY7B 1BVLA 2JKXA 3ARSA 5C0NC 2JIXD 4X7SH 4U1SA 1RI8A 1X5FA 4ONFL 4ZO9A 4OZFA 4DKDC 5JXAH 1T20A 4OLVL 5EA0L 1YEHL 4NN6B 3V6OC 2A9MH 4YHNA 3UTTD 5IV2A 2AS5M 3MV8E 5DZNA 5DJZA 3TT3H 2H1PH 3GBNH 3MRRA 1AI1L 3V4VH 4LVHC 2VDQL 4QYOA 4XPFH 5E8DL 4P2QA 1RU9L 2V5SA 4KVCH 4OCLC 5JUEL 4Y4HC 2YXFA 2J3SA 4MJ6B 5JDSB 3BO8A 2QKIB 1BQHB 2XRAL 3WXVL 1ZVSA 2HN7B 4U1JA 3SDDB 3C9NA 3MO1A 2BNUB 1G7PB 1RUPH 3TA3A 4C58B 5DC4B 3ES6B 3KXFD 4PRDB 1RHFA 4MXWL 2W91A 2X1OA 2YD5A 3WDHA 2E7CA 2H8PB 5LWYH 1K4DA 2HWZH 1FORH 4Y1AB 1KCVL 4MB4A 4X6CF 2EO9A 35C8H 3RFZC 4MJ5A 3OXSB 4JAMA 3W0WE 1DJSA 2X4PB 4LASL 3O0RL 2ZNWA 2E9BA 4XCCH 3SY0A 5EN2A 5E70A 3PXHA 3X12A 3RKDC 2XT1B 4G80A 4AH2B 3MA9H 1UB5B 4HIXL 5GGTL 5FA3A 2DWEA 1M71A 4PJCB 1OGAB 4OFIA 3O3DB 4YIQA 5SV3A 1QSFE 3MLUH 1C5BH 1ZLVK 1JBJA 4JPVH 4PP2B 2IMNA 4TPRH 1CE6A 3MRIB 2EXWC 2QADD 3JV5A 4Y5XA 1YEEH 3RVXC 3KPLA 3M1BB 1EUUA 1GPOL 1OTUD 2CR3A 1E6JL 4OD3H 3WE6A 5BRZA 1UKQA 1NL0L 3U0WH 3P30H 4PJ5D 1H3XA 2WWMC 1AO7B 3OAYH 3TBWA 1RZJL 5JNYA 4YBQD 1KIPB 7CGTA 1HI6B 1Q9LA 1MFDH 1DN0A 1AQDA 4HQQL 5LVEA 3QQ4B 1EPFA 4OF0A 4ODBD 3TVMB 3DURB 3NCFB 4UZGA 1T04B 3WIIL 2I07B 5F7MC 4XNMB 3HR5B 4NQDE 4OD1L 5DS8A 4L4VD 5FUZL 5FYLE 1FSKC 1UZ6E 1RZFL 3MV7A 4O02L 1F3DJ 3FQXA 3MOQA 3NA9L 2OLDA 4YQXL 3BDYH 3MGAA 1OQOA 5D7JD 4OZGB 1G7QA 1LDSA 1I1AA 3RX7A 1L8JA 4M5ZL 1MCPH 2GJ6A 1WT5C 4OZFG 5GRXG 5J4MA 4NJ9L 1TJHH 4JQXC 3GMPA 2G2RA 4G5ZH 5DMGC 4KKBC 2NY2D 5A1AA 5C70A 1J1XL 3B9EA 1VESA 3EYSL 4HXBH 4JFZH 4ENED 3TBYB 3W9DB 4F2MA 1JYXA 1Z9LA 1G6RH 2PF6A 4WI4A 4LCYA 3VXPB 3MRQB 1KC5L 2DL2A 3PIQB 4FXKB 4LSRL 2BERA 1YMME 1AC6A 1I8KB 4JVWA 2VLKD 1H3WM 5FYKL 4DKAA 1XGPB 3MNWA 1JHTA 1N7ML 4LOUD 1KLUB 3NIFE 4MCZB 4KHXH 1I8IA 3ARVA 3NACH 4NC0B 1Z5LA 1HKLL 5D6CB 4BSWB 1UM4L 1NC2D 2NZ9D 4PGZA 4QRPB 4U31A 1T1XA 1F8TL 3VXOA 3CGTA 1RUQH 3MGTA 4L9DA 3SDYL 3GSNA 3LMJL 3IS0X 3QIBA 5ICXA 3M17A 3MREB 2FYYB 5C7XH 1JWMB 3A6CL 1FBIH 3IU3B 1DSFH 4PGDB 4WFGD 1EV2E 1CT8B 1YYLL 3UZQA 3CU7A 2VLKB 1VB9A 1MHPH 1FE8L 2HLAA 4WTXA 3BN9C 3QCVH 4M1GL 5EORL 4GQ9H 5DQJB 3I9GH 3QUXB 1T22A 1P2CA 3PG2A 4ELMF 3I3BA 3KPRB 3PWNB 4ODXB 1VFAB 3QFJD 1A1NB 2Q8AH 3WHE0 3ZT6A 5C0EB 4G8GA 4FZ8H 1JHKH 1DQQA 1T0MA 2F5BL 4IBLT 4P59L 1FNLA 3L9RA 1CIUA 1BD2D 3VXPA 4Z77B 4G8FB 4AT6B 4F9LC 3U1SH 4OSUL 2YWYA 3S4SA 4OLUL 2R56H 1P9MA 3G9VA 4R0LC 5EWIH 4LCUA 5DJ2A 1QLEL 1YEJL 3U30B 4KKAD 4XGZA 4P5TC 5FCUL 2GY7B 1KGCD 2EDQA 5T1DL 4KRMB 4HLZH 4Q0XL 1HQ4B 2L0DA 3MRMB 1RUKL 1YNKH 3QNZB 4QOKB 2AJYL 1OT2A 5FOBA 2FO4B 1HDMA 4IDLA 4KMQA 4RFOH 4UT7H 4YHMH 1R5WA 5H35B 3QUMA 1JNJA 4PUBH 3UTTB 4OFVA 5IFAH 3BP4A 1SEBB 1JHLL 4QXGH 1IGIL 1GGYA 3UYRL 2R2EB 1TJIH 2EIZB 4PRAB 4FQJL 3EJZD 1FORL 4JJ5A 4X4ME 5LCVL 1KIPA 1CYGA 1RIUL 4KDTC 3WHE1 3HMWL 4GS7C 3HS0B 3BZDA 4Z95L 4W4NA 1PYWB 3GK8L 4RISH 4YHZL 1QSEE 5F9JB 1B6DA 4LCIH 4EJ1C 1U8LA 4NQVA 4RIRB 4R90H 5HHOA 1CDIA 3I75B 3PQYA 4R4ND 3JTTB 1ND0A 5KW9H 4NKMA 4KJPD 4UV7H 3LQZA 1IGJB 3LKRB 1EBPA 1BBJB 2P24A 3CAFA 3EAKA 5JORA 4XVUC 4LDEB 2B4CC 1J0JA 1I7UA 3BZ4A 4NRXA 1FNHA 1PAMA 1CGTA 2LAAA 1N6VA 3QR2A 1J9CT 2VDKL 4BQBA 2A6JA 5CD3B 4OJFH 2FIKA 1MIEL 1KJ2B 2VQ1A 4WDIB 1WZ1H 3UCRA 1I8IB 3IGAB 4R7NB 1YDPA 4ISVB 3QUXA 4NSKB 5C0GB 4OZHE 4X99A 1L7IL 3LEVL 3Q6FB 4JG0H 1P7QD 3FHQA 4M7LH 2X9XA 3PQYE 5JDSA 1BVKA 1C1EH 4HIHB 2APVA 1BLNA 3OJMB 3VXRA 1B2WL 3CDFA 2FYYA 4NC2B 1R5VB 1UJ3A 5DURD 2BK8A 4HULB 1EDQA 2RQ8A 4FQ1H 4DUWA 1J11A 5D1ZA 1A9BB 4HCRA 3ZYOA 4U1KB 1AXTL 4NKOA 4U1IB 4DFIA 1X5AA 2IBZX 1JNLH 3HUJE 2AJ3B 4CBPA 3OKMB 3OKDB 5SWSA 4PREA 4NNPL 1OAKH 4IMLB 5KSBB 4FFEX 2J6EA 4M61A 3NZHL 4KRPD 4XMKH 5T5NF 5EFIB 1JL8A 4QRRE 1J5OL 3PL6C 5IJKC 3FKUS 1KXTB 1S7WA 1QNZL 1K5NB 3F7YA 4NN5B 3HMXA 3FMGL 3B9KC 5EOTB 5LXGH 2D0GA 2XXMB 4EVNB 3JWOL 2Q87A 3SDYH 3REWA 1A1OB 3LN9A 4JVPA 6CGTA 2BVPA 5BRZB 3U7YL 2HJKB 1IKFH 4NRYB 2R0KH 2VZSA 3WFHB 3L3KB 4Y4KD 2P5EA 2HJLA 4N8CL 3O4LD 4EVNA 3C08H 3NBNA 3UPRB 2QSVA 4HXAH 2ARJQ 3PV6A 4GQ9L 1BX2A 2YN3A 1S5IL 1N5YH 4HKBA 2H3NA 2ICCA 3SJVD 4JLRB 5CJBA 4PJ7A 4M3KB 3RVXD 2KQMA 4RA3A 4IRSB 1DFBL 4UI2A 4YDLB 1YEKH 2FZ3A 4PJCE 3RA7L 2G60H 2HKFH 3SO3C 1AO7A 2YKLL 3HNTL 5DR5L 3PGCA 4DW2H 1OAXL 4ERSL 3N1FC 1Q72L 4X6BB 4HUWA 3QDME 1K8IB 3AUVA 4GG6B 2CKBL 1LO3H 3VFTB 1LMKA 3CLFH 1JTTA 1B0GA 2VITB 5HHMD 4HKZA 1JZ8A 2ILLA 3VG0L 4HC1A 1WVZA 1E0OB 4OM0H 1RUKH 3RGVD 2XWJB 4NKMB 5HD8C 4LHUD 1WCBA 3UDWA 5I30H 2CJUL 3P0YL 1YA5A 4NZRL 4P9ML 3EYUL 4J4PA 4HKZB 4PJGE 1DCLA 3SY0B 3MOBL 5GZOC 1NANH 4LL9A 4RGMC 3VRJA 1KELH 2EYRB 4JZOA 2ED7A 1BQSA 1C08A 1UJTA 1RK0B 2R2BB 4OZFB 4EXKA 2QSTA 3QCTH 1V7NL 2D7QA 4WUUD 1AGDB 5F1OB 4FZ8L 5JHDB 3HE7C 4CU6A 4QT5A 3QWRA 5EZIL 4KDWA 2DQFB 2PW1A 2GFBA 4QHMB 5J11C 1U93A 4YHZH 1GGCH 2D7PA 4NQCE 5IW6A 3CCHB 1I7ZB 3GO1L 4ZXBD 3L5XH 5K9JL 3RZCD 7FABH 4KV5F 4K7FA 1SBBA 4WCYL 3E6HB 2VITA 4ZAKA 3FB7A 1OSPH 3S37L 3V5DA 4L8DA 3BPOB 2XXCB 3RPIA 4NRZB 1YMHA 4O4YH 3QHTC 5DVOA 5AWNH 5JHDD 4P2RA 3UTSE 1W0VA 1X7QA 2AK4E 3GSUA 3RGVC 4YXHH 3IDIA 4P3CH 1F02I 1KNOA 1J0ZA 3MPCA 3HMXH 1KJ2L 4GW1B 5HPOA 4XAKD 4LCWB 5IVXE 1BHGA 4RGNB 3HB3C 3D2UA 3K4ZA 1N8ZA 2NY0D 4JFEB 2O61A 1HH9A 2XFXA 4MAYB 4I9WE 2Q8AL 3CFCH 1XR8A 3V5HA 1MH5A 3OKDA 3LRSA 4RWHA 1KTDB 3W5MA 1U3HB 3MRGA 1CTOA 4P99A 4HSQA 1H3TA 5D2LF 5HYSB 3TNNB 4XCFL 1TMCB 1QD0A 3FFDB 4J8RA 5F7UA 1FN4B 2YRZA 3BPCA 4OB5H 1I7TB 3NIFF 2Q86B 4IOIB 2JCCF 1K5NA 3F7YB 1MI5D 4FQXC 5EUOB 2AQ1A 2VDMH 4AK1A 5CGMA 3DVGB 2ZG3A 4JFYA 3VFVB 4S1QH 4YR6B 3HI6L 3HNVH 3HC4L 2C3XA 5D2NC 3SKOA 2R29L 1DQQB 3CSYA 4LIQH 5HI3D 2AEPL 2WIIB 4NZTL 3B9KA 4AG4H 3MTRA 5EULV 2ORBH 5SWZA 1FDLL 1S9VA 4CGTA 1ZA6A 4LVOB 1WBZA 3LRGA 2VR9A 5MERA 2APWA 3B4NA 4AL8H 1OGTA 3NPSC 5IOPA 4DN3L 2IQ9H 2K3TA 3P73B 3AXLA 3FO9B 1TVBB 15C8L 3DYPA 4YDJA 4FMKA 1DVFC 5IVZA 5JORB 2Q76B 2R0KL 3CZFB 1IAII 1QFWM 4N0CC 2DQJH 2MHAA 1F2XK 3MGOB 5IOPB 3X11B 4S11A 4JRXA 4P5MA 1A3RL 2DB8A 3PL6B 1II4E 4PB0H 5ID0A 4R4NC 5I8OH 1L9MA 1CU4L 1A7BA 4CUCA 3ROOB 4EI6A 1XCQB 1SYSB 1BFVL 3VMNA 4LSPL 3EO1B 1X5JA 4PRPB 5EB9A 3VXNB 1FYTE 5KS9F 4RFEB 1Y0LB 4C4KT 5JOPE 3HS0A 2FEEL 5FK9B 2EH8H 3RVTD 3MCG1 5IG7B 1I7RB 2V6HA 1JRHH 4XNQB 4K94C 2H26A 3FOMB 4KJWC 4CADA 4I2XE 1J0YA 1I1AD 3AY4C 4QRTB 1KXVC 4D9LH 5I8CB 3B5GA 1ND0B 3RHWK 5LGHH 5E2UH 5F9OH 4MS8A 3WNPA 4JFPA 1AP2A 1MY7A 2Y06H 4WWKB 1GPOH 3VFUB 2GI7A 4IRSC 3SE3C 5DD5L 1T7VA 4EI5B 2ATPA 1XF2A 1BPVA 1TJGL 2P8LA 4PJ5E 2JJSC 1CFQB 5HY9A 5A2JH 3HR5A 1ZA3A 4BQ8A 5D72H 3BFOA 4X7TA 3QEQA 5IGXH 1GSMA 5F6HJ 5DLML 1S7UA 1YQVH 4GS7B 5AZEH 3QQ4A 3B2UC 3WIIH 1K3IA 5I74C 1VEOA 3PHQA 1NEUA 4HZLA 4CL7A 4M7ZC 3BDYL 4RNRA 4F7CA 2DD8H 3QUMB 2QR0B 3BRDA 4YHOL 5SWZE 4O2EB 3GSRA 2EDYA 4X7FC 5DD6A 1OAYH 4JKPH 4K8RD 1URLA 1UVQB 2VZUA 1XF2B 1X5HA 4OCXL 2BNQB 3OR6B 3G08A 4ETQB 4GAYA 1KB5L 2CKBH 3L5XL 1C12A 2DLFL 3E6FA 2A73B 3KYKH 1I8LC 3MBEA 1QFUH 3CDGB 2VXSH 4PJAE 3STZB 4S0SD 1NDMB 5IF0B 4HKXB 3THMH 3H3KA 1FNFA 4Q58C 4HLZG 3BIKA 2M1KA 4WI6A 1WFTA 5EN2B 4YX2H 4X9GA 1VGEH 2JELH 2JK5B 3TJHD 1MPAH 3SO3B 5JO5B 2E3VA 2ZNXA 4K3JH 2L7UA 3RWIA 3CUPA 2H9GA 1R3KA 2R2CA 4HGWA 3TCXA 5DJAA 3L3JA 1PD6A 3OAZH 1F58L 3K7UA 4Y16D 2G5BA 1EIBA 4ZUUB 2VAAB 1T0NB 2YMXH 4N8VA 4HWBL 5EIIB 3D85A 4PTTA 4HF5L 4NM4L 1JGEA 4JM2C 3NCYP 4KZDH 5HVHC 5CBAB 2HLFC 3QUZC 5C0AA 3MLZH 1VACB 1JK8A 5FDWA 4PBXA 3MXVH 4OT1L 4NWTH 4WW2B 2WBKA 4FA8A 3GSVB 3G5XB 2W0PA 1WFOA 2UWEB 5DS8B 4KVCL 5JUEH 1T04A 3O4LB 2RBLA 3KVQA 1FP5A 3VFVA 2HFFB 4IM8A 4FQLL 2YEZB 5GS0D 4YXHL 4YHLH 1MCWM 2DTML 2WWMD 3JV0A 3ISWA 2AABL 4LRIA 3D0LA 2CLVA 4OI9A 1WIOA 4E41E 1UCTA 4GRLC 1UG9A 2NR6D 4I4WA 3CMOL 2CO7B 3LQAL 2V2XB 4UOW0 2GQHA 4UINH 5DJXB 1EZVY 3OBAA 3O81A 1KTDA 2HH0L 1QZ1A 4U1IA 1J88A 4M43H 5EOCL 4UB0L 3RNKA 3FQUA 5M7QA 3QDMA 4JCMA 5GGQL 2V5MA 1IBGL 4MA1C 4M3JA 1NQBA 5DGQA 1I1FA 3QIWC 4Y5YA 3WFEH 1WFNA 2HFFA 1CU4H 2VRAA 3KJ4B 1S7TB 3L7EA 1RIHH 2CUIA 4RGOL 5C09E 2FEDC 4J3SA 3G6AA 3VGGA 1HXYA 2BP3A 2C26A 2R1WA 4KV5E 5BZDB 2QQKL 4F7TB 1WQVT 4Y4FC 2J2ZA 1D5XA 4D0CB 3DVFA 4R4FL 1HN1A 4APQD 1CICC 1RJCA 4PGEB 3VFSB 3ULUE 3UXFA 3FJTA 5D70H 1JF1A 4NHUB 2OL3B 3C87A 3JSSA 5DTFA 3MCLL 1MLCA 3QEGL 3KHQA 2A2QT 4JM2F 1B4RA 4PP2A 3NFSH 2Y06L 3RY5A 2APXA 2DOCA 1IAOA 1UCBH 4NPYA 2AGJH 2X4QB 1XF5A 2P5WE 4Q9RH 4NJAH 3FQRB 2VAAA 4KK9C 4LPWA 3NCBB 2ZJSH 5D2NB 4ELME 4JO1H 5IEKB 3CDCA 3TPUE 1ACYL 4QRRA 1MEXH 1YQ2A 3ZKND 2E7BA 1EAPA 1ZXQA 3ZKSD 3UAJD 3INUH 4FFYH 1P6AB 3T4YB 2MPAL 3CU1A 1UXWA 4IRJB 4NQCD 4PPTA 2P42B 1BQLL 4N0UE 1N3NB 2DKSA 4WHTA 4OCYL 3QIBC 3P40A 3MLPA 4EDXA 3CFIC 4RMRA 4OFDA 1G6VK 3G6AB 3LY6A 1WTLA 1OSZA 1CIDA 1CLCA 2JJWA 4X80L 1MWAA 4S0UC 3V8CA 2FX9H 3FT2A 3VWKA 4PG9A 4HBCL 1J8HB 3O6MH 2OL3L 2AK1L 1QHPA 2IJ0C 4P4KD 3IJYA 3SCMA 5H35A 1RIVH 3VXRE 3EHBD 4Y4FD 2OI9A 1A7PL 5J7CC 1Q0YL 2EDRA 3HUJA 4G6KL 4NNYA 2DF3A 2FWOB 5AD0A 5DTFB 4UIMA 3ARXA 2YUZA 1S8DA 1EEYA 5T3XE 1P7QB 3U9UA 4PJDB 2FNBA 1MVUB 3EYQC 1QR1B 4WEUD 2Y5TA 1HHHA 1TQBC 1YNKL 4L3EE 4PS4H 4TSCH 1T1ZB 1KBGL 3UJIL 5ISZE 1K8DA 4PLNC 1RZFH 3RRQA 5HVHB 1RJZB 3HZVB 1TTFA 4WU5B 1INQB 5EZLB 1X5XA 1OLZA 5IJVB 1JNHA 3DOSA 4O02H 3IVKA 3WHXA 1OTTD 3HUJF 3FN3A 3N1GC 3U46B 1IGIH 1NCDL 5TF0A 5HHXL 4EOWH 4B50A 3C2AH 3BDBA 4PRPA 1CLYL 1P84K 3BD4A 4TSBH 1OP9A 2HTLD 5ADPH 1U8JA 4P46B 1M05A 1CFQA 2YMXL 3CVHB 4PJIA 2L7JA 4QWWC 3FRUA 5HHOE 5IVXF 1JHKL 3OKMA 1AH1A 4L3EA 5D8JL 2I60L 3OTTA 4JQVC 4FQXB 1NCCL 5ILTH 4WO4B 3V0WH 1AHWA 1YC7A 1INDH 4GG8A 2E8ZA 3BGFC 3B9DA 1LD9A 1IGML 5JIKA 4QGTA 5C92A 3I02A 4Z9KB 3LV3B 4H26B 1G6RB 5BOPA 2EDTA 4R90L 2BSSB 2DQUH 4G9FE 4JZJB 2RCSL 4PJ8B 3FTGB 4MAYD 1FL3A 3TO4A 3O6FC 4LU5H 4LSUL 4L3CB 1CF8H 4KVNH 1S9YA 1MRCL 4XPGH 4NN7C 1EK3A 3MV9B 4QXTA 3SBWC 1MPAL 1MQ8A 3NFNA 1KLUA 4WWID 1QEWA 4YHML 1VEPA 3V8OA 1U3ZA 6FABH 2DI7A 4GW5A 3BQUD 2DBLL 2CK2A 3T0EB 4ZXBA 4YR6A 1YEDB 3EGSB 3SPVB 5KN5A 4YC2B 1U8IB 1PEWA 3GMMB 1OTTC 1MFBH 5ACZB 2WWKT 5I16A 4J8RB 2PR4L 4WHYH 3QIWA 3V79C 2Y7QA 3LN4A 3TF7C 2XV6B 4ZXBB 4P2RD 3T0EA 3S35H 4J3WA 3FAXA 1U92B 2APTA 1RPQA 2IG2H 1J8KA 3MV9A 4QXTB 2PKDA 3RJQB 3L3DA 3MODL 1EO7A 2QR0A 4WU7B 1SY6A 4NNXA 1BQUA 4U0RB 2I5YL 1QKZL 5J6HA 2E7LA 1CI5A 5FO9B 4MD4A 1F11B 1GC1H 3OAUH 5CUSL 2IH3B 3EDDA 1DN0B 4WEBH 1NKOA 5E5RB 5GZND 5EA0H 5DMKA 12E8L 4ZYKA 4K9EL 3CX5K 4FZEL 3MZTA 3TFKC 2HG5A 5HYJA 1OW0C 4G8EB 1K8DB 4UDTB 3LHPH 1TZGH 1J18A 5IW1B 3JVGC 2ADFL 2BC4B 1JZ4A 3S97C 2DQIH 4NQVB 4F15B 1U3HA 2KDGA 3KPLB 2AKRB 3QWQB 2C7UB 4ODUA 4LSVH 3ARZA 2W9EH 4UIMB 3U4EA 4PJIB 4QOKA 3KR3H 4JRWA 4GRMB 3OKKB 2QHRH 4X9FA 1ZT1B 4S1DC 3MUZ1 5C0CB 4MS8C 2FHCA 2R0WL 4FABL 2ZJSL 2HMIC 3H9SE 1CD1A 3RUGF 1UKSA 2HLFD 1CFVH 2X9WA 4XWGL 3O8XA 5ENWB 5INDA 5LWYL 2XYCA 5L0QB 4POZC 1EEUA 2D31A 4GKZA 2PXYD 4R8WL 5BJTA 4EDWH 3MSPA 1QSED 4ODWA 3RWGB 2VDNH 4GRLB 1CD1B 3GMNA 1UXWB 2B1AL 4M6AA 5GGSY 4C55A 3NAAH 1BBDL 1UC6A 1OTSC 4LLDB 4I77L 3TH2T 3SE9L 2CDGA 1EHXA 3C5SA 2DKUA 4WHCA 1TZIA 1A7PH 5K9KA 3ZMRA 4LSTL 1LDPL 4U6XA 3SDDA 5KVEH 4FFVC 1EVUA 3ULUF 3BKJL 3TJEH 4BZ2H 1MF2H 1IAOB 3R0MA 4FP8L 2AEQH 1MIML 5D1XC 5A2FA 3ULUH 4FNLH 1QRNE 1I7RA 1ZLSL 1I8LA 2AGJL 4AMKH 5GRWA 1PGRB 1SM3L 4RMWA 1W0YT 3OXSA 3WUWG 3UO1H 4GJTB 4I13B 2MSPA 1T89A 5L8LB 4NQDA 5IMOB 2C4XA 2VJXA 4BK5A 3BEWB 3OR7A 1IZJA 4KUZL 4MSWB 5BRZE 1AXIB 3FONA 1AXSB 1J1PL 1NAKH 3VCLA 5IB5B 1I9RH 1LO2H 2NY7L 4P23D 2DDQH 1KG0B 4MX7A 1ED3B 4GXUM 3OAYK 3ARDB 3D18A 3DVGA 1H8OA 3ARTA 4DZBA 5EUOA 1MUJA 3P0VH 1TZHB 5IROA 1WEJL 4UBDC 1YC8A 3VXTB 3OHXA 3VW3H 4LLYA 5MENB 4DW2L 4LGPB 3MUHL 1KPUB 2BHZA 4O58L 4P2CG 1MVFA 2YK1H 3WBDA 2J7LA 4PJAA 4FFZH 4BUGA 3RTQA 1T1YB 3RY6C 4HGKC 4NBZB 1Q1JH 1PKQE 3WIHA 1F4WL 4JN1H 5F7EH 3MROA 2WMPA 4H0IA 4P2OC 3SDCB 4P23B 5KG9B 3EZ8A 1H3VA 2V7NA 3PP3K 2A6DA 4Z5RB 2ZCKL 4K23H 1HXYB 1JRHL 3O2VH 4WENB 5I66A 5KVMC 3DURA 1NCAL 2XWTA 1R0AL 5KANG 1FL3B 3LEYL 4P9HC 3DRTB 3L5WA 3H9SA 4N9GA 2HKHL 1LP9B 1F8TH 1NH6A 1NMBH 3PV6B 4KTDH 5D7LD 5IESL 1FCGA 1RZKL 4KJYB 1Z0NA 3O6LL 4QOKE 5I0DA 2V7NB 1ADQL 5SX5H 3L3IB 1MRFL 5JHLH 1EJOH 2EDEA 3MBED 2EDLA 2VDLH 4OZIF 1CFBA 4M7KL 4JZJC 1LE5A 2O5YL 4KDTA 4XPAL 5EBWB 1XGRB 3RVUD 4YXKL 5J3HD 3G6JB 2BVUA 2LV4A 4JFXA 4HX1A 5BZWA 2IPTL 2NX5B 4PB9L 3VJ6B 5BW7C 4KU1A 3OJDA 1IE5A 1HH9B 2G60L 2CLVB 4N5ED 1D5ZA 2B2XH 4K3GA 1TXKA 3QUYA 2IAND 1LE9A 2FBJH 1D5IH 2AK4D 5E99L 4HKJA 1LO5A 3WHXB 3ARDA 3D18B 3ECBB 4F15C 4G6ML 4DTGL 2DBJA 3ZSSA 4EUPG 7FABL 2NTSP 3MV9E 2EDDA 5TQ2L 3MROB 5AUMB 1CXFA 3BX7C 2FGWL 4LBEB 3GHBH 2ARJA 4URTB 4GAFB 3CK0L 4Y5XB 2O5XH 4U1KA 3VD5A 1BECA 2YHGA 1KN2L 2OJZL 2FWOA 3WJJC 4Y16B 3WFCH 2XQBL 5HJ3B 2IALA 5D2NA 2DBLH 3IAPA 4HK0B 3FQTB 1BBJA 2DLGA 3UJJL 1A6AB 2VN4A 4B7IA 5E4EC 2N1KA 2AV7B 2AV1B 1VPOL 1D6EB 4WUKL 1KELL 4U0RC 1CXEA 2X2YA 3FT4A 2P45B 1AGCB 3MRKA 1VERA 1R3LA 4ODVH 3HZKA 2VXQH 1OM3H 2A0LC 4J4PC 5C07A 1IFHH 1A1MB 3RGVB 2RB8A 1VCAA 5IKCB 1IAIL 5GRUL 3SGJC 1EXUB 5IHUH 5DWUL 4X7SL 1UWGL 4G9FA 1JPGB 1I7UB 2G5RA 1JE6A 4XH2A 4CVZA 5IEKA 4U1MA 1U3JA 4YPGB 3CFBA 4OM1L 3Q2CA 5L6YH 1G7IB 1V05A 5IF0A 1N26A 1ZVSB 2NX5E 3TT3L 2AV1A 2PO6B 5FB8A 1I1FB 2XA3A 3QEQB 3BWUC 4YAQA 4NWTL 3V9FA 5K33A 2NY6D 1RUPL 4XP1H 5J1SC 2IFFL 4KJWD 2JE8A 3ILPA 2QQLH 3TBVB 5KSVB 4JO2H 1F90H 4W4OC 4XXCA 1U2CA 1T89C 3FQWA 2VIRA 4JANA 5FM8A 4UOW1 3CC5B 3PHQB 1FVCB 5GS1B 3WJLA 4CNIA 4TSAL 4MA3B 2WUBL 5DMKB 3BD5A 1FNAA 1B0WA 3FFCE 2LAGB 4OLEA 5ID1B 2GCYB 1LEIB 4HKJB 1FFPB 5ICZA 3B6SA 5C86A 3TIEA 5I18H 4R97B 4ZS6D 3RWJA 3T1WA 1UZ6F 5F3HB 2H45A 1NFKA 3BWAA 4JGJA 4M7LL 5FYJE 2X5PA 4DCQB 4ZD3H 2F54D 1T22B 4JPVL 4UT9L 4FHBD 2DWDB 4MQXD 2E7LC 2R29H 4LIQL 2XZQH 4GOSA 2YZ1A 2YRLA 3FCTA 2HA1A 5I9QC 2VR5A 3K0WA 2G9HA 5E5MB 4P9HL 2VKWA 4PJAF 1EFQA 1LP9A 1TZGL 2OZ4L 3LN5A 5EPMB 3S4SB 4EBQL 1XFPA 3NMEA 1FZOA 4CAGA 3OKOB 1FGVL 3IDYC 3K46A 4HQQH 4XTRC 4X9BA 4RGND 1HHKA 1UYWH 4H8WH 2BFVH 5DJ0B 2XPGB 4M6OL 4ISVA 4O5LL 5C0IB 5FEBA 2IQ9L 3RUGB 5EC2B 3D3VD 4ELMA 4OLWH 8FABA 1JHTB 1CGXA 3VU2A 2VUYA 1MHHB 3SCMD 4QHNB 4HT1L 2BCKA 2UYLB 3SE8L 4E9LA 2V5RA 1VACA 1A9BA 1IAKA 1PG7W 5C0AB 3K3QA 3VXSE 2Z8RA 4XPHL 5IWLC 4F57L 4GH7B 2HT2D 1KT2A 1N6QH 1T2QL 2DRUA 2VDNL 3IB4A 3BH9A 3GM0A 5DJCB 5IMLA 3KYNA 2Y4SA 5C08E 1S3KL 4HUUB 1KACB 4ETQA 5EH1A 2IFGA 5F70A 4DN4L 1HYSC 3NFPB 4LEOA 3OR7B 4XAWL 4OCYH 3LS4L 4ZPVB 4J6RH 5I1KH 4XBEH 4D9LL 4GXVL 4WGWB 5C09A 4AM0B 3RPKA 2HT3D 4XI5C 1JYWA 3SDDC 5HI4D 1FC1A 1U8QA 5D2LB 3W2DL 5I1EH 4J3VA 4HZLB 3IVKB 1ZK9A 3CXDH 4M7ZB 1Q9LB 4FQIL 5C08A 4AIXA 4X6EB 2R1YA 1IEBA 1EO5A 3FFDA 1TMCA 4QGYA 3Q1SH 4JFDA 2EH7L 5DUBA 3ULVD 2A73A 5KVGH 4M93C 4PJFE 1TZIB 1QBAA 1NEZG 1NGZB 1YYML 2J8OA 5J8OA 1ZANH 2X4OB 4JRYA 5DYOA 1YUHA 2WY3A 4K3DH 3TO4D 1HQ4A 2QLVB 1KB5A 4WTZG 2VLJD 5D1QD 1MWAB 3PWUA 5INCA 1MFAL 3T1FB 4XNZC 3VWJC 5JXEC 1LP9E 2X4PA 2DLFH 2PYEE 4RFNB 1QLEH 1YEJH 4KJPC 1VA9A 2AJXH 4PP1D 1CGSH 1MNUH 4HJGB 1HE7A 1MAML 1EEYB 2AJVH 3PWNA 3GUTB 3PWLB 3VXUD 5C2BL 4NQEA 5ID0B 4Q0XH 2PCPB 1Z9OA 4KK6D 4U1GC 4MZ2A 3TZVA 4GBXA 3UBXI 4YHIB 4JFHE 2BJML 2HN7A 2PO6A 4R97C 1VGEL 2JELL 1RQ5A 3NABH 4P4RA 1CF8L 4KVNL 4Q2ZB 5CLTA 3L1OL 4F7PA 3BYYA 4XPTH 4YBHA 1KYOK 5KN5B 1NCBL 1LEGB 1P1ZB 4LDOB 1GZPA 4TNVF 3TO2B 4ZUVA 1UA6H 4L9LA 2NXZD 2VTFA 4TSAH 2R69H 4Z7QF 3LKNA 4XC3L 4N1HB 1SYSA 1RIUH 2V2TB 5HYJD 2GIYA 4WI3A 4HAGA 1XMWA 3WLWC 5CKAA 1KCVH 4OTXL 4FQCH 1D6VL 3SGKC 5MEOB 2P7TB 1ZS8B 1FL6B 3SDCD 3L6FB 4MJID 4U6VL 5HDLA 5LGJB 3O2WL 5D7IB 5DDHA 3D9AL 1KJMA 4H25B 2Y7QB 2H32A 2X7LB 2DMCA 4U1NB 2DAVA 4QOKD 4P2QB 1A7RH 3MJ9A 4YDVB 5GGTH 4BZ1L 5C0BE 3TV3L 5JLZA 4CN1A 3QDMB 1I1AC 2NX5A 5DD3H 4AEHL 1AD9A 1MCSA 4MNGE 5E2TL 1FZJA 1EBAA 1OGAD 3IRPX 4GO6B 1JUFA 5EZJB 2V5TA 3M45A 4LP5A 3SGEH 2IANB 1FGVH 5DJ6B 5IJKA 2QV2A 3RNQB 1QSEA 4P46A 4QHKI 4RMUA 5CEYA 3SE3A 4D94A 4OZ4A 4O9HL 3EYQD 2A74A 2W60B 2FDBP 5AYQA 2FD6L 5D4QA 2BVEA 2XY1A 5C0RL 4XP9L 4PJ5A 1TETH 4XP5H 1P4IL 2VZ3A 1L0QA 1QYGL 4X4MA 3VJ6A 1W0VB 3TT1H 1M7XA 2GSGA 1NCDH 1AHWB 1YN7A 4ZNEE 4YDKL 3FQWB 5CJ8A 3N50A 4JM2B 5F7WC 2DYPA 2EDWA 3LQAC 4PJAB 1MCBA 2YXMA 3WNKA 1TNMA 4WHDA 2NY5L 1GGBL 4JB9H 3UBXB 2I26N 1CE6B 2QQKH 1JFMA 1T5XA 4LPCA 4EQ3A 2NY6C 3DX6A 3TIEB 4HIHA 1KTRL 5D7JA 4PDCE 2OP4H 4WY7L 2ESVD 4M9PA 1T0NA 4XMLH 1A3LL 4EI5D 4GXVH 2FATL 4U1MB 4F9PA 3KYMA 4KDVA 1YNLL 4JO2L 1IM3B 4RRPA 3CC5A 5F7DB 4PREB 3BEWA 2R0ZH 1E6JH 4OD3L 5I8EA 2ZUXA 1KJ2A 3ZDZF 5E1AA 3QT2A 4UNUA 4Q7DA 3D6GA 3MFFB 4J3OC 5E00B 3D0VA 4RDQG 3V4PL 4U6HB 3LPGA 4IS6A 4ZUTA 4MQ7B 4K3EH 1BD2B 2EZ0D 3KG5A 1YY8B 2EC8A 5GS3A 2C9AA 2QBWA 2B5IB 4TRPH 4WWKD 1FAIH 5GISH 4D2NA 3VI4E 2KBGA 1A5FL 1SYVB 4ZAKC 3HPLA 2D7NA 3R8QA 1S7RA 4TUKL 5JXEA 2HFEA 4JAMB 4NFBA 1MCKA 5EORH 3KXFE 4OIBA 1KCSH 5CSGA 4ERSH 3T0VA 4ZDHB 5DFVC 1OWWA 3Q3GB 1CDCA 3IFOA 4GAGH 4N0FA 5LBSL 3TBTA 2NYYC 3GJEA 3RBSA 4XTRD 4PRHA 2D03H 3WJJA 2DQGL 1SJEA 1S9WA 3HNSL 4JE4B 3MX0A 1YMMA 1WCBB 2BXYA 1BQHA 4OSUH 4L4TB 4PV9A 1E6OL 1MRCH 2W38A 2XQYG 2E7MA 1N0XL 1CTNA 2VDPL 1QFUL 1WITA 5LG1A 2EDXA 3G6JA 2F5AL 3RWHB 2HRLA 3WFHA 2F8OA 3ARDD 3FL7A 4NQXB 1BZ9B 4LOUC 1DL7H 1UWEH 3T0WA 3L1OH 1A14L 2V9QA 5DRXA 5E56A 5DRWB 2NXYC 4QRSB 4KRLB 2P8PB 1SJHB 3QXDB 4BFEA 1BOYA 3RY4A 5I2IB 1NMBL 3TWCH 5I1JL 4ONGL 3I6LD 3O3EB 4P2RE 2DQTL 2PUQT 5I75C 5F21B 3QO0B 1I1YA 4QY8A 4AENB 4YDLC 2OR7A 4WI2A 3VDCA 2O5YH 4JRYB 2P48B 2P44B 4YHYC 2BHYA 2X4OA 5IHBA 1DANU 5DQJA 3CFEA 3ZTNH 2F15A 1DVFB 2B2XL 5CEZE 4K7PY 1TVDA 5TE7L 4RX4A 3SDXF 2BNRD 3CXHK 4PD4K 1UEYA 5DUBB 4C56D 3P4NB 3ULVC 5CJXA 3QXUA 4IIQC 3MYJA 2BXZA 4ZPTA 3U83A 1RZ7L 2ZCLH 1YNTB 2CKNA 2EKJA 1ITCA 1NKRA 1ZHLA 4PJEF 1A21A 1DQMH 4V1DD 3LKPB 5IMKA 1EAJA 3BIAX 4BZYA 1U8QB 2VABA 4PLKD 5CKGA 4PJFF 1IGYB 3TM6A 4ZSOB 3ORJA 4QHNA 2BZDA 4XP6H 4YNYA 2NY3B 3VH8A 4ODXA 1M7DB 3P9MB 4AY0A 4K3DL 3HMXL 5DJ6A 4RMVA 3HG1E 3MOAL 3S3SA 1MJ8H 3DMMD 3UBXG 1KN2H 3BHBB 4PGCA 4Y4HB 1S9VB 4KY1H 1JPFB 3QEHA 5D1QC 3W0WA 1T3FB 5J56B 4Q9QL 3VGBA 2WINB 4Z7WE 1K4CA 1OCWH 4AQOA 5ALBH 1Q94B 5IFJB 1IGYA 4MNQA 4L3AA 1VPOH 1CFNA 3OAZK 1NFDB 3DYMA 4P5TA 5L2JB 1CBVL 4LKXB 1RK1A 3N06B 2FX8L 4PRIE 5L2KA 3AY4A 3BVNA 2DDQL 1EH9A 2A9NH 1LWRA 3IU4L 5C9JB 5F9DC 5L88H 4Z7VA 1X3DA 3QWOA 1WLHA 1T7YA 1KG0A 2G5BB 2UWEF 4OZGA 3SKNB 3S5LG 3QFDB 4TN9A 3T4AB 3FO0H 4FG6C 3QO1A 4LCCA 4BSWA 5KS9B 4KGJA 1B6UA 1RU9H 4LVEA 2OI9C 5FGSA 3W39B 3MV8A 4K71B 4GUPA 3E3QE 4MVBD 1FO0H 1KN4L 1GGIL 2CIKA 1EERB 4UTBL 3IFPB 5C6TH 3T04D 4POYA 1CE1L 3WS6A 4FTVD 5BJTB 3WFBH 4G7VL 4IRJD 5ID1A 3MCKA 4GLRI 4JFHD 1HOCA 2A1WL 3D48R