2GAZA

Mycobacterial lipoglycan presentation by cd1d
Total Genus 79
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
79
sequence length
273
structure length
269
Chain Sequence
b'NYTFRCLQMSSFANRSWSRTDSVVWLGDLQTHRWSNDSATISFTKPWSQGKLSNQQWEKLQHMFQVYRVSFTRDIQELVKMMDYPIEIQLSAGCEMYPGNASESFLHVAFQGKYVVRFWGTSWQTVPGAPSWLDLPIKVLNADQGTSATVQMLLNDTCPLFVRGLLEAGKSDLEKQEKPVAWLSSVPSSAHGHRQLVCHVSGFYPKPVWVMWMRGDQEQQGTHRGDFLPNADETWYLQATLDVEAGEEAGLACRVKHSSLGGQDIILYW'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords T-cell surface glycoprotein CD1d1
publication title Structural characterization of mycobacterial phosphatidylinositol mannoside binding to mouse CD1d.
pubmed rcsb
source organism Mus musculus
molecule tags Immune system
total genus 79
structure length 269
sequence length 273
ec nomenclature
pdb deposition date 2006-03-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2gazA02
3.30.500.10 Alpha Beta 2-Layer Sandwich Murine Class I Major Histocompatibility Complex, H2-DB; Chain A, domain 1 MHC class I-like antigen recognition-like 2gazA01
4NQSA 5FB8A 2GITB 5MHSD 5CEXB 2E9IA 2E9WA 2BNRB 4KI5D 3KDMB 3DV6B 5ERWA 4RGMC 1P6AB 1FYTE 4Y19B 1JJUA 1DBKL 3S4SB 3S37H 1IARB 4HWZB 4FABH 4HUWB 1TFHA 2YK1H 4RCAA 2ITDB 4D9RD 5FF6B 4AT6B 2EIEA 2GYSA 4Y2DD 3RIAF 5E9DE 1XGTB 3VE0B 1R0AL 1AD9A 4YFLF 4PRBB 3EDEA 4HBCL 5M94B 1KTKE 1XIWA 1B6UA 4FQLL 4LVNB 4MAYA 4XWGH 3BWAA 1CS6A 3REVA 2K3TA 3T0ED 1PZ5A 1RZKH 1MFAH 4TNVK 1Q0YL 3QCVL 1VEPA 4U3XA 2FX9H 1ZS8B 2Z0BA 3L9RB 2DQEH 4P4RA 3N50A 1EHXA 5I6XC 3LKPA 5EZJA 2IH3A 3TZVD 3SDCA 4WU7B 2HT4C 2YUVA 2MSPA 1KSRA 3MRFA 5D70H 5TE7H 3RPIA 5ACZB 3FN3A 2J8UA 4BYHA 4PTUA 4GG8A 4QXGH 2DQCL 4JREB 5FYKE 3LDBB 5I8EB 2BY3A 1T04B 5HJ3A 2FECI 3GSWB 2OXHA 2CR3A 1L8JA 3FQUB 2EDEA 4NZTL 4QRTB 3BP4B 3MA7B 3BP7A 1UC6A 1FAKT 4U6YB 2Z8VC 2MTPA 4XPHL 1JV5A 1ZVHA 3C5ZA 4MX7A 4ZXBC 3RY6A 1FORH 2BDNH 5IP4A 1YECH 5DJZA 1I7RB 3SPVB 4DOHB 1C8PA 5SX4H 4JFOA 4Z95L 3HHRB 1RJZA 1FCCA 4EDXA 1I8IA 2OR7A 2P47B 2FR4A 4TRPL 2ZOKA 4PS4L 4OAWA 4JZJC 3GBLA 5DXWA 5HYSB 5F1SA 4L1HA 4P23C 5D1ZB 5KSAB 5BS0A 1XEDA 3IDNB 1A4JA 5IT2L 2CKNA 5EN2A 5DMYA 5IBUB 2YEZA 4IRJA 4HW6A 5T3ZL 1S9VB 3VRJA 1MCRA 4ERSL 3V6OA 4XWOD 4NN7C 1N2RA 3BW9B 1LK3L 4KKLC 4ZFZA 4D9QD 2W59A 4X6DE 2G9HB 4NWTH 1MCWW 3ARDC 2XWJB 4S2SA 3VWJC 5IMOB 2NY0B 1OTTC 2OL3L 3LQMA 4GBXC 1S3KL 4PUBH 4MS8C 3HB3C 3GSNB 4OZ4A 3E6HA 3K8LA 4PP8C 4ACPA 3MRGB 1T2XA 1HQ4B 3FT4B 5JMOC 3QJHB 5A3ID 5GS0C 1A1NA 15C8L 1MCDA 2JCCE 4NKDA 4M1GH 1MWAL 3RI5F 4NKIH 4JPKH 4XH2A 3DRQB 3SDAC 1VFBB 1SJXA 2D0GA 4G6AD 5F97E 5C0BB 3O0RL 1HE7A 2VLJD 5IVZA 4MZ2A 1MCQA 2VL4A 2PYED 3DX6A 5GGQL 5CZVL 4F9PC 1BVZA 3DGGA 1MCPH 4NO0D 3VMNA 1ITBB 2IPTL 3N0PB 5IQ9A 4MD4B 1TMCA 2KQMA 4UTBH 4N5EC 3MCKA 2Z92A 1NC2A 2CRYA 3D3VB 3JV4A 3LHPH 2JIXB 4HPOL 1F45A 2IGFH 5D1QB 5FUZH 1ADQA 2NY3C 3MRBA 4QWWD 1UKTA 3PXHA 5CKAA 3MRPB 3VGAB 5H35A 1J12A 1MHPL 4JFEB 2ADFL 4BZ1L 1V7NL 3VXOA 1K3ZA 1Q72H 2DI8A 4KI1A 4X4YB 1U8HB 2Q3ZA 4QHLB 5I1DA 2Z35B 3E8UL 4L4TD 5DK0A 1AGEB 4J3SA 2RCSL 3OKNA 5HHMA 4KXZI 4TPRH 1DE4B 2GSGB 3T4AA 2FNBA 4YHYC 2DDQL 2ZCLL 4G42A 4XPFL 5E2TH 1DUYB 5T1KA 3VXSD 1FNSL 1OY3B 1OSZA 3MRJB 4Y5YB 3RIFK 1F6LL 3QBTB 3GSNL 6FABH 4MNHA 2X4NA 4JDVA 2CO7B 1X4ZA 4OUOA 4XNXH 3P73B 2DJSA 5EBLB 1CE1H 3UZQA 3FT3A 4BK4A 4ZDHB 3TEUA 3MSPA 3FB8B 4R90L 2HJFA 3ZKND 4UV4L 3IGAB 5IVXA 3R1GH 2IPKA 3TA3A 5DZNA 3MODL 3MROA 1C12B 1RHHA 5I1AB 1QBLH 3L3GB 4YAQA 5LCVL 1HXYB 4P2OB 4JQXA 4KJPC 1AKJD 3W2DL 3Q3GB 1OB1B 1BVKA 1DSFH 3SJVB 3ULVF 1GAFL 1V8HA 5EOQL 1CFVH 4TSBL 3V4VL 1AO7B 2HFEB 3P11H 5DQDL 4F2MA 1VGEH 4GSDH 2CIIA 5MP6H 2NLJA 1JNNL 4X4ME 4ENEC 4F15B 3BGMA 4OM0L 2P5ED 4WI6A 3BQUD 4LPXA 2FWOB 3DROB 4XMKH 5JZ7C 3LIZL 1J88A 1WAAF 3MJ8A 5CMAA 2APBA 3BWUC 4NQCD 1RFDL 4Q6IA 2MKWA 4HKBB 3MGTA 4OZFB 4JGUA 1RJLB 2XKNA 3GMLB 1AJ7L 5EU6E 1T66D 3F8UB 2ESVB 4JRXE 5BO1H 1NFDA 4KQ3H 4OF6A 1CFBA 3CFCL 3O8XA 3QDJA 4OD2A 4QCIB 4KI5E 4AG4L 1AC6A 3PHOA 1TNNA 2D31B 4K7FA 4Z18A 1MNUL 4BUHA 3PNWA 2VITB 5I75B 3OKLA 1FV1B 4KY1H 4HK3J 1FFPB 1HQRA 3STZB 4ODUB 1OSPL 2FCBA 3EOAA 5DR5H 2YD6A 4D9RE 3EOBA 3OGOE 3HC0B 1CDIA 1JN6A 3BJ91 4XC1H 3DRTB 4LVEA 1XCTB 2R8SH 4NBXB 1E4KA 1JVKA 4JZNB 3OKMA 2PO6A 3TN0B 5KZCB 1FL3B 4U1JA 3TVMC 4XZUA 1LO5B 2BK8A 3VXUB 1WF5A 2OBGA 2OM5A 1YPZB 1MFDL 4JFZL 2WZPD 2DYPB 1QNZH 5AZ2L 4IEFB 4G80B 3VFOB 3LV3A 2W60A 3CCHA 3GIVA 4FHBD 1T03H 5BRZA 3QG7H 3W0WB 4JQVA 4XP1L 3LRGA 1GGUA 1C16B 4NT6A 3WL9B 3X17A 1OP3H 3LKOA 4S1QL 5JHLH 3O6LH 2WINB 4G6KH 1BWWA 4KRPC 4YHML 1A9BB 3L5XL 2ZPKL 3MYJB 2EECA 4I3RH 2DQTH 4OIIH 2DS4A 3KPSA 4NRZB 3BPNC 2VZSA 5FA4A 4PRDA 3AAZB 3VRIA 4QRQA 5E9DA 3F5WA 5A43C 1KB5B 3S36X 2BZDA 3TWCH 1C5CL 3V5KB 1B2WL 5JW4M 2FIKB 3PL6A 1HI6A 3ZSTA 3QG6A 3TBWB 1X7QA 3FO0H 3V0VA 5DTFA 5GIRB 4UINL 3WFHB 1CYGA 1X5FA 4YHPA 5D5MA 3BD5A 1MREL 1CLYH 1IKFL 3FO2B 4Z77B 3LEVL 5I16B 5E00B 5ESAA 1MVUA 1YZZA 5IB3B 12E8H 2DMBA 4OIBA 4NQSB 3BHBA 5LG1A 3UTOA 5C08E 5ERWB 4U0QB 4OGAC 2GQHA 4MA3A 5MI0C 4R8WL 3JWDL 2FB4H 4S10A 2BVPA 3WXVH 3ULVE 4N0YL 1KN4H 1U41A 4TVPD 4D9QE 3O6KH 5CJ8A 2A73A 2BVYA 2FL5A 4CU8A 3VDCA 2H2SC 1N0XL 1UWEL 1AD9B 1WGOA 2EDLA 1KB9J 4J4PC 1YC8A 5GXBB 5JR1L 2RB8A 5C2BH 3W9EA 3A6BL 1XIWB 2DM4A 3HNSH 5HHPB 5D8JL 5C6TH 4OCNC 5MENE 4MAYB 5EOCJ 3BWAB 1U8OA 2NXYB 3REVB 5DFVC 1PZ5B 4LVOB 3UO1L 4LPVA 1R3JA 1RK1A 4C56A 4DKEH 5CEYA 1INEL 1MCBA 4P4RB 5BV7H 1RQ5A 2EIDA 4HXBL 3ULUE 3LKPB 5EZJB 2IH3B 4M3KB 1G7HA 3RGVC 2VLJE 3MRFB 4RMSA 3RPIB 2J8UB 3ZKXB 4Z78A 3HZMA 4GG6A 4PTUB 4GG8B 4XNZC 1HHKA 3U7WL 5HJ3B 5DT1L 3CSGA 4XNUL 1KB5L 4H0IA 1L0YA 1FP5A 2VTFA 4RAUA 5IROC 3BP7B 5C07E 4EQ2A 4PYHA 1VPOH 2NCMA 4NWUL 1JV5B 3C5ZB 4MX7B 3VRLF 2GEEA 1BGXH 5DJZB 5I2IA 1DBJH 4JM2A 4PP1D 5D2NA 5AEAA 3K3QA 3QUYA 4PY8J 4OGXH 4JFOB 1RJZB 5DSCA 5CEZE 4TTDC 5K59F 4EDXB 1I8IB 2R4RL 5D1XC 2JCCA 5DD3L 1XGRA 2FX7L 5L0QB 2FR4B 2ZOKB 4I18A 4NCC1 4OAWB 4P3CL 3DGCR 4B7LA 2VLRD 4Y16A 4S0TD 2B5IB 2F58L 5BS0B 5ALCH 1F4YH 2ICCA 1A4JB 2AXFA 5TF1L 5EN2B 2XZZA 3G5VA 2YEZB 4IRJB 5EIIA 1G9NH 5DD1L 4ORZC 1YNTA 4OF7A 3VRJB 1BWMA 3VXSE 1N2RB 1N5AA 3MOQA 4ZFZB 3SDDC 4OFPA 2CGRL 1GOHA 2GUOA 4EN3C 4S2SB 5FM4A 1QBBA 2HT4D 1C08A 1LP9F 4I3SH 4KHXH 4G6MH 4OZ4B 3E6HB 1ZOXA 4CDHA 1MQKH 4ZMAT 2VAJA 4HUUA 1HINL 1JFMA 2I9TA 4HUNB 1A1NB 1IC5L 4JFDA 3E3QA 3MGOA 4AQ1B 4NKDB 1WLHA 2W1NA 5F71A 4QXUL 1UJ3C 4ODHH 1P7QD 4XH2B 5CWSA 1I4FA 2AEPH 2A77H 1R24A 4PJGF 1SY6A 2IG2L 2EH8L 1PEZA 5IVZB 1KYOJ 5FK9A 1F90H 3F58L 4EI5C 3DX6B 2H8PA 3CC5A 4YQXH 3EJZC 1KEGL 4HT1L 3RWIA 3DGGB 5GGTL 4Y7MA 3QEUA 1QO3A 5IQ9B 3DXAA 2C1PA 5D7KD 1TMCB 4DTGL 1FL5A 1SBBA 4F33A 1T7WA 3MCKB 5J11C 1NGXA 1NC2B 2Z92B 1R5IA 1AY1L 5FKAA 3JV4B 4NNPH 2P5EE 3GNML 3GRWL 4LNVA 2JK5A 1JWSA 2QHLA 3LN9A 1R3IL 3RUGF 4IRSA 4R97C 4KKLD 1T0NA 3MRBB 1WITA 5K9QI 1JZ3A 2AK1L 1IC4L 5H35B 3HR5B 1G7QA 3ARDD 2AEQH 3OAZH 4WW2C 4WY7H 3CSYA 5BW7C 3L3IA 3H3KA 4LIQH 4GBXD 3VXOB 2HKHH 3UZEA 4GRWH 4MS8D 5I1DB 2NTFA 5DK0B 4YDLB 4ELMF 1ZT1A 1CCZA 4I1NB 5CS7A 3OKNB 2HH0H 4U7KA 5HHMB 2QL1A 3ZDXE 3EYQD 1B4JH 1B4RA 3A67L 1NCAL 2YXMA 3T4AB 5GS0D 3MJ9H 4TTGA 2ENSA 4G42B 5T1KB 4MNQD 5EB9A 1OSZB 4FZEH 1NJ9A 3MRLA 5EZIL 4HC1H 1H9VA 4J6RL 1FIGL 4WWKA 3EFDH 3GGWA 2X4NB 1TJHL 4JDVB 1WFUA 3DVGA 2X7LA 5CP3H 2VH5L 1CDJA 1DVFC 3FT3B 2KUTA 4XPGH 1IE5A 3VRLE 2R1XA 2HJFB 2L7UA 3HMXH 5IVXB 5I1IL 1DEDA 2EKSA 2ED8A 2IPKB 4FA8A 3TA3B 5F7HA 2X1OA 2XYCA 1XZ0A 1PJ9A 2Q86A 2OMBA 3MROB 5EU6A 4O2EA 4U1MA 1RHHB 4JRXA 4OZHA 4YAQB 4ELKA 4MJ4A 2QQKL 1VSCA 3PP4H 3L5IA 1D6EA 2VUOA 1BVKB 3OTTA 4XXCC 1K9TA 4HBQA 4D3CH 3MV8B 3NCYP 4F2MB 1WZKA 1K3IA 2R2EA 2CIIB 2NLJB 4PBWD 4GRWF 2Q8AH 4PFEA 2VZUA 3BGMB 4JPIA 4H8WC 4F7CA 43C9A 2AKRA 3EBAA 4BSVA 2X4QA 4JKLA 4BJLA 2OCFD 4UV7L 3MJ8B 2QSTA 2VSCA 2ZUXA 5CMAB 1CL7L 4KJYA 1NBYA 5FIEA 4L3EE 2C3GA 5DK2A 2R0LL 2V5TA 4Q6IB 5LBSL 3MGTB 4RFNB 4K7PX 4XBPA 3IAQA 2X9XA 2XKNB 5C0JA 2FEDC 2R29H 3SO3C 4OLZH 1NFDB 1UWXH 1PKOA 2R0WL 2EH7H 4FOMA 3O8XB 3QDJB 2AXJA 1I8MA 1FC1A 3HG1A 4OD2B 4PJGE 2P8LA 1KV3A 1KCRH 1SMOA 3RPKA 4LAQL 3PHOB 4JN2A 4K7FB 3PNWB 3OKLB 3ARBC 4MLIA 4F57H 1HQRB 1Z3GL 3EOAB 2A6KA 2KPNA 4LAJH 1OAKH 4NM8H 2AV7A 4KJPD 1F58L 2I60H 4GXUM 1CICA 2B4CC 4M5ZL 4JVPA 2CPCA 1JN6B 3MLUL 4LLWA 3CH1A 5F6HI 3R0NA 2ZG1A 4NZDA 3OKMB 2PO6B 2KKQA 3FO9A 2DQDL 3TNMA 1L7TL 4U1JB 2BC4A 4XZUB 5DGQA 1LILA 4ENED 1N7MH 1CIUA 3K46A 3O6ML 5EZLA 2UV3A 3KYMA 3MRKA 2VDLL 3LV3B 1MI5D 2W60B 3CCHB 3GIVB 5BRZB 5ID1A 4MB3A 2VNCA 2R56L 3CJJA 3SOBL 4NT6B 5EZOL 2WNGA 4O51A 3LKOB 1CVSC 3RZCC 4OT1L 2Q87A 1A5FH 4ELME 1PEWA 3JSSA 2L0DA 3QHZH 1XF2A 4OCWH 5JQ6H 1ACYL 3GEWB 4P48A 3KPSB 3NAAH 1HHJA 5EOCH 1I1YA 1KN2L 5FA4B 2W92A 4PRDB 2OQJA 3VRIB 1XCQA 4QRQB 5E9DB 1MCSA 1A6VL 1T7XA 3F5WB 3HE6D 2FO4A 2HAZA 3VXME 1NLBL 2WP3T 1D9KA 5JHDD 4NQVA 4HF5L 4OLWH 4H0HB 3PL6B 4FFEX 1HI6B 1W2KT 3QG6B 5MENA 1X7QB 2G60L 2PN5A 3V0VB 2GCYA 5DTFB 1A6TA 1WAAA 4NUGL 5D5MB 3K80A 1QFUL 5JPNB 2Q8BL 3AB0C 1MVUB 5ESAB 3S3SA 1OGAD 1QFWL 5TFSL 5SWZE 5E8DH 3BHBB 5B39G 3FN0L 3GB7A 1WWWX 3VFTA 4MA3B 1S78C 2BVPB 3NVQA 3HMWH 2A73B 2PW2A 4HH9A 4O4YL 3I6LE 2FL5B 4GRLA 3MXWL 1A3QA 4GRWE 5C07A 5C0RL 4D94A 5HBBA 1PX4A 3W9EB 4M6OH 4CW1A 4OB5L 4PJFF 1QBMH 5DRNA 4UUJA 4EVNA 5F88A 3T2OA 3UJTH 1U8OB 3VGHA 2VR9A 4V2CB 5IEKA 2XA3A 1R3JB 4C56B 2DQIL 5CEYB 5BZDA 1M7XA 3B43A 2JJTA 1JF1A 1BX2A 3FMGH 2HRPH 2Z8RA 1G7HB 5F7DA 3DX9A 3S97C 4Z78B 3HZMB 4GG6B 1RIHH 1HHKB 5ANME 4LGSB 3WV0A 1JCKA 5GSRA 3I3BA 2MQ3A 2F54E 4KK9C 4RIRA 5C0ND 1ODAA 4RAUB 1CDBA 1BFOA 2PETA 5LGKA 5E6ZA 4QGYA 5FDYA 5C0EA 3S35L 2IC2A 1S8DA 5I2IB 1U3JA 5SV3A 4XVJH 2UZYB 2YA1A 4JM2B 5D2NB 3QUYB 1WCBA 2E7CA 2UWEF 1X5IA 2H1PH 2CR6A 1Z0MA 1N4XL 5DSCB 4ZTOL 4RFOL 4DKAA 1GHFL 2JCCB 3O3EA 1XGRB 1U91A 4I18B 1JHLH 1RJYA 5CJXA 2H2SD 2HRLA 4TOYL 4Y16B 1N59A 4RWHA 3T2NL 3KPRD 1MUJA 1RULH 3BIKA 5KSVA 1MJUH 1GXEA 1ZEAL 1JNHA 3FZUC 2AXFB 2YPLA 2NY7L 2FYYA 3LEXA 3VDAA 3G5VB 1YYLH 5IG7A 7FABH 5EIIB 5B4MC 1YNTB 5EC1A 1EGJL 1N5AB 2R1YA 1IGMH 1FBIH 1CFSA 3QIUA 4L8SA 3WHXA 2GUOB 2QADB 3T04D 1A8JH 1C08B 1IZJA 1XF4A 2BNQD 4U3CA 1BQHG 2D03L 4HUUB 2I9TB 5FGBA 2Q6WA 2RHEA 2YKLL 3FL7A 1FNFA 2QQNH 4JFDB 3WFDL 4ZAKA 3MGOB 1SYSA 4EUPA 4LCIH 4XCFH 2EYSA 4NZJA 5KJRH 4LBEA 5CWSB 1I4FB 1OAUL 2FZ3A 4WFED 1R24B 2X89D 1SVCP 3ZE2F 5L88H 5FK9B 1GYAA 5E0QA 4DEPB 3CC5B 4RSVA 4TTDD 3CK0H 2NY5L 3RWIB 2YD3A 4PGZA 1ZGLM 3G9VA 4ZODA 1OAYL 1GGIL 3QEUB 1G7JA 1QO3B 4UT6L 1LO4H 3DXAB 1FHGA 2C1PB 4UT9H 1FL5B 4F33B 5I8OH 4JFFD 1FGNH 4Y89A 1NGXB 3QAZC 1R5IB 3B2VL 5FKAB 1MRFL 4FQXD 2D9CA 1NMAH 4H88H 2JK5B 4PREA 1JWSB 2GK2A 1FQ9C 2Y7QA 4PD4J 4YBQD 4IRSB 5I74C 5CINL 3NCJL 1T0NB 4KKNA 4QEGA 4LSVL 3OXRA 1G7QB 1Z9OA 3CSYB 4EN3D 3DSNA 3ECBA 3QUZA 2F53A 3L3IB 3FFCA 3DOSA 5GSVA 2NTFB 3BAEH 4JN1H 1ZT1B 1CLOH 1DEEA 1HDMA 3VD4A 2ED9A 5GISL 3PWPD 1JGEA 2OR8A 4MJID 4MQ7A 3QUMH 5DA4A 3DBXA 2YD5A 3O4LA 5B3NA 4QRSA 1NJ9B 3MRLB 1G7MA 2IFFL 4WWKB 1KBGH 3GGWB 3MJ7A 4K3JL 2Y06L 1AE6H 1J1PL 1FPTL 5IBLC 1J1OL 3DVGB 1X5YA 2X7LB 3EJZD 2HKFL 3IDMA 4JR9H 1LP9A 2P8PA 4S1SH 4CVZA 2MPAL 1XAUA 5D7IF 3NCBB 2R1XB 1FH5L 1SY6L 2GJZA 2EE6A 3RX5A 1VCAA 2EKSB 2LTQB 4N8PA 1KTDB 4D2NA 1XZ0B 4FRWA 4PLJD 2Q86B 5EU6B 4IDJL 4O2EB 4U1MB 2ZKHL 4I77L 3O9WA 3QCUH 4JRXB 4OZHB 4ELKB 1T2QL 3E2HA 1I9JL 1QLEH 1QRND 1EH9A 1NH6A 4KKAC 1UZ8A 1D6EB 4A2MA 2E27L 3OKOA 4NQDE 1I3GH 4KGJA 4AL8H 5C71A 2R2EB 4JGJA 4FQ2L 1IM9D 2CXGA 2EE2A 4JPIB 4LKXA 1RHFA 4XCYB 3AUVA 4P3WA 4F7CB 43C9B 1WUNT 3BPLB 2AKRB 4KTYA 3S37L 4BSVB 1LE9A 2X4QB 2LU3A 5FYJU 4F9LC 1CU4H 4FABL 5HHXH 2YK1L 5IWLA 3LAFA 4KJYB 1NBYB 4JFPA 5DK2B 1BZ9A 3RRQA 2B0SL 3DHMA 1A6PA 3RUGA 5I19H 1WT5A 4L29A 3OR6A 4X7DC 3FRUA 4XBPB 4QNPF 5C0JB 2ENYA 4PJIE 2PXYC 3KHOA 4LF3A 4HJ0C 3QUKA 2P7TA 5FYLD 2P44B 1DVFD 2VDNH 1I8MB 3HG1B 3PABA 3SGKC 4XWGL 2P8LB 4ELMA 5FM5M 4NO5A 4JN2B 1VEOA 1MFAL 2FX9L 1C1EH 2DQEL 2AAVA 1H3GA 2A6KB 4WUUD 2CJUH 4G8FA 1G7PA 3H9SE 2AV7B 4F3FA 3BKMH 5D70L 1CICB 4AY0A 4G3YH 4QXGL 4LLWB 3TJHA 1WBXA 3CH1B 3RWGA 3VXMA 3IU3A 4RBPK 4BZ2H 3IB4A 3FO9B 4OD1H 3TNMB 1MFBH 2BC4B 4MXWH 1H3WM 3V0WH 2IAMD 3DJ9A 4EXPX 3OWEA 1CZ8H 2FO1A 4JHBA 1NBQA 4NHUE 5EU7C 1OHQA 5EZLB 3KYMB 1JYVA 3MRKB 4YDVA 1RVFH 3AMKA 3PG2A 1FORL 5ID1B 2OZ4H 1YECL 3CU1A 3LSOA 1AD0A 4O51B 4OGYL 1EAJA 3PWVA 3TO4C 5E2VH 1XF2B 5JDSA 4WU5A 5AUMA 1ORQA 4UTAH 4PRHD 1QFOA 1HHJB 3CXDH 1I1YB 1PX3A 1QP1A 2DLEA 2VR5A 5AWNH 4N0UA 2OQJB 1F4WH 4K8RL 4L9LC 3IAGC 2X4OA 4OFVA 5ENWA 2FO4B 5T5NF 1ZHKA 5DZLA 4NQVB 1UFUA 3ZE1E 5EBGA 1FC2D 1S7SB 1IC1A 4NWTL 3P9WB 3MJ9A 4P5TA 5MENB 3VH8A 2GCYB 5D7IE 1A6TB 4AEFA 3L1OH 3DUSA 3PQYE 4KVCL 4HIJA 1E4WL 4PUBL 4HC1A 4K3HA 3PGCA 1FNAA 3B9AA 5I6XB 1R3KA 4KKCD 1YNKH 4ZD3H 3I02A 4X7TA 4M1GL 3QJFA 3GB7B 1PVHA 2DBJA 1NUGA 1Q94A 3VFTB 1KIUA 3QI9A 4JPKL 4LVNC 2F54A 3BH9A 3G08A 2GSIA 3HMXA 1WJ3A 2PW2B 4HH9B 1T6WA 4XGZA 4GRLB 1J5OH 1QSED 5C07B 3RZCD 4JHWH 3SE3C 4OCLC 5JMRA 2A1WH 2I9LA 2MFNA 4KXZH 4CW1B 1CFQA 2CQVA 5DRNB 1IKNA 5JIKA 4UUJB 4EVNB 5F88B 4UTBL 1BJ1H 2P48B 3Q6FA 4JREC 3X13A 4WO4D 5IEKB 3LHPL 1I1FA 1OPGH 4ZQKB 5C7XH 3MBEA 5BZDB 5ISZA 2BSED 2WV3A 2A38A 3NTCH 4QNPE 3SCMC 4XAKD 5FUZL 5FXCH 1JF1B 1BX2B 5JOEA 4TSAH 4YH6A 3EDKA 1J8HD 1F4HA 2DLIA 2RBLA 3DX9B 1G6RH 5F7DB 1ZSDA 1KC5H 4Q7DA 1Q72L 5GSRB 5F1IB 5INCA 5D71H 1PKQA 4RIRB 2XQYG 1I1AA 4WCYH 5L7XH 1F4XH 4TPRL 1DBMH 1BFOB 3SGDI 1A6UH 3UMTA 5C0EB 3BGFB 5HYFA 5D1ZC 5E2TL 3RVWC 5KSAC 4P2RD 5F7MC 1S8DB 3CXHJ 5FCUH 3F7RA 4LSPH 1WCBB 6FABL 1EBPA 1FFOA 2VDRH 4XNMA 5IJKA 3FFDA 3O3EB 1HIMH 1U91B 4UILH 4N5EA 4XNXL 1RJYB 2Y36H 4I8DA 5D6DA 3FHAA 1N59B 4EDWH 2VL5A 1CE1L 4JPWH 1MUJB 3BIKB 5KSVB 2CRZA 4Z7WF 3EJJX 1OOAA 1JNHB 2NY0C 5DJ2A 5LAXA 4XXDB 1A7QL 2YPLB 2FYYB 3LEXB 4LHJB 5IG7B 3EYSH 2AQ3A 3R1GL 1IBGH 2PTVA 5EC1B 2VXSH 1KIQA 2OJEA 2R1YB 1QBLL 5SWQA 1CFSB 4L8SB 3WHXB 3P30H 2F8OA 2AJ3A 1GGTA 5F44A 4RRPA 3T65A 1DSFL 1XF4B 3QEGH 1AGFA 1CFVL 4ZS7H 3NIDF 3P11L 4P99A 4Y1AE 1VGEL 2Q6WB 3JBG7 4GSDL 5FOBA 5MP6L 4PJAF 2GW5A 1CFTA 4NQUA 4Q97A 4B5EA 5KS9F 1L9MA 4ZAKB 1SYSB 4EUPB 3FAXA 4PJFA 2EYSB 4XPBH 4LBEB 1C5DA 2UVEA 1JNLH 2EEAA 2FZ3B 2NPLX 4XMKL 1AP2A 4C58B 1TVBA 4FG6C 4C4KO 3P9MA 4WRLA 3GK8H 5C0AD 1ZAGA 4KDTC 4XX1G 4JG1H 1MLCA 5D1QC 4R4NC 5DD5L 3T8XA 2XA8H 4Y4HB 1NUDA 1G7JB 5BO1L 4KQ3L 3VGAC 4S1DD 2BXYA 1DFBH 1VA9A 3F7VA 1M05A 4DGYH 4E9LA 1J11A 2D4DA 4ZSOE 5L2KA 1A7NL 5KVMC 4AEEA 3QPXH 4PREB 5B4MD 3OKYA 5IJVA 4NQEE 2V5SA 4JJ5B 2Y7QB 1DANU 4PGEA 4KY1L 1DANT 4LCCA 3WNPA 4OTXH 3QEQD 2Y5EA 5DR5L 1BD2D 3OXRB 2UWEA 4GLRI 3QUZB 2GKIA 3ECBB 2JB5H 5CILL 2F53B 4Y5YC 3FFCB 3MQIA 4XC1L 3DUUA 2R8SL 1BQLH 5GSVB 3ZSSA 5FYLE 1DEEB 5GJTH 1HDMB 4PRID 4DFIA 1IC7H 3QPQD 1J9CT 2UUDK 3MRQA 4M8VA 1JGEB 4FTVE 1QNZL 3DBXB 3O4LB 4QRSB 5BZWA 3QP3A 3WYRA 5DJ6A 2MQCA 3QG7L 1G7MB 5E99H 3MJ7B 2DM7A 3MOBL 4PJ7F 3UAJD 4OF5A 5CLTA 5JHLL 3O6LL 4G6KL 1GC1H 4Y8DC 5F6HJ 4TNWF 5BV7B 4O2CA 3HFMH 3IDMB 1NQBA 1LP9B 1U8KA 2P8PB 1XMWA 4CVZB 1KTLA 4I3RL 2DQTL 4OIIL 4MB5A 4JRYA 4JFYA 3L7EA 1A7PH 1EJOH 2GJZB 2XFXA 5BVPH 3FKUS 4MJ6A 3AMLA 1N3NA 3TWCL 5I17A 2FGWH 3O9WB 4C55A 2E7LA 4F15C 5JW4N 5D7SH 4AH2A 1U3ZA 2PF6A 3D18A 1UZ8B 2XI9A 3QDAA 3FO0L 3MV9A 4Z7WE 3CDCA 4E42A 5B8CA 3OKOB 3IU4H 4YUEL 1CLYL 4HLZH 2P24A 1S9XA 12E8L 3FTGA 4LOUC 5GZNC 3VWKD 3ZTNH 3O41A 4LKXB 3H9SA 2GI7A 4XMLH 2J7LA 4WFGE 1QSFE 3BEWA 3VI4F 2ATKA 1LE9B 2FB4L 2QV2A 4XMPH 3WXVL 3TT3H 3CSBA 1KN4L 4N8VA 3O6KL 5DLMH 4JFPB 4KQ4H 1BZ9B 4K94H 3RUGB 3RKDC 4L29B 2PUQT 3OR6B 4PJ9A 3FRUB 5I75C 1JZ2A 3EIFA 3OXSA 1YYMH 5IBLD 2FD6H 1TIUA 2KZ1B 4LF3B 5C2BL 2DKUA 3QUKB 4S1RH 4PYGA 2P7TB 3HNSL 4P4KA 5C6TL 5BOZG 3PABB 3JWDC 5FO7A 4K7PH 4YK4B 4J7RA 4ELMB 2Q7NA 4NO5B 5DEGA 5IR1A 1I9RH 1LNUA 4DK3A 4MXQA 4DKEL 4YO0A 3QNZA 5BV7L 3HE7A 1P4IH 4G8FB 1G7PB 3SBWC 4F3FB 4GAFB 3CZFA 1QSEE 1QZ1A 1WBXB 3VXMB 1T1WA 3QDME 3RWGB 5F7LB 3DIFA 3IU3B 4IMKA 1IM3A 1EBAA 5SX5H 4JFXA 1TZHA 1KPVA 4LK4A 3WJLA 3BPOB 3ESUF 1RZJH 5D7IA 3PWLA 1TZIA 3PQYA 1VPOL 5DK3A 4YDVB 2V7HA 3FRPG 3WN5A 5T3XE 3VG0H 3M17A 1BGXL 2P45B 1DBJL 4NKQB 2IFGA 5HD8D 3WEXA 1NKOA 4XAKE 4TVPH 5DS8A 3LSOB 3INUH 1AD0B 5ADOH 5KG9A 1RZGA 4P9HH 3AREA 4G6FB 1K4DA 2DIBA 3PWVB 2X1WL 4LHUG 4OZIF 2NY2B 5JDSB 2DF3A 4WU5B 5AUMB 2HLFC 2BMKA 1H3UA 4UQ2A 1ORQB 1D7FA 2PXYD 4K2UH 4R4BA 5ALCL 4HJ0D 1F4YL 4FFYH 1EUTA 5F21B 3QIWD 4L4VE 2C1OA 4N0UB 1QFPA 3V52H 3TM6A 2QSCH 4GRWB 2X4OB 1G9NL 2X6MA 5CHNA 4PJ7E 1JZ5A 3ISWA 4LSRH 1ZHKB 4M7KH 2J88L 2E9JA 5E08L 1GOGA 4JGMA 5BMFH 3HAEH 4HK0A 3MRRA 5B3JF 2Z9TA 2ICWI 3ARGD 4P5TB 3QUMA 4IOFD 3VH8B 5TE6H 3I2CH 2VSDA 3DUSB 4I3SL 3ARTA 1KCKA 4Y8AA 1XFPA 4KHXL 5IROA 4G6ML 5FM8A 1MQKL 4HUXA 4PRPD 1JI2A 3PGCB 1A1OA 5SWSD 1R3KB 1T83A 3CFIC 3I02B 3V7MA 4X7TB 3QJFB 3RHWK 4L8CA 2COQA 1EMTH 3FB6A 1Q94B 1XIWC 4NOBA 3QI9B 4LASH 3QWRD 3GSOA 4ODHL 3H0TA 4KTEH 5D1XA 3Q2CA 2C3XA 3BH9B 2F54B 2A77L 3G08B 2AEPL 1BVLA 2GSIB 2NXYC 4NRYA 5H37H 3B9KD 4BH8A 4LVOC 4XGZB 1F90L 1A64A 2ZP0T 1UEYA 4YQXL 1BZ7A 4ZS6C 2IPUK 5HDQH 1Q9WA 2F19H 2I9LB 2F5BH 1RI8A 3VI4E 1CFQB 3ZKXC 3NH7H 3X13B 3SDDA 1MELA 2XN9A 2ZSVA 2YC1A 1I1FB 1Z5LA 3MBEB 3LB6D 2WY3A 1PG7W 3D2UD 2I25N 5TDNA 5ISZB 1JYNA 1VKXA 4YHKL 5E70A 4RNRA 3BZEA 3X12A 3CMGA 3EDJA 5FYKU 2AEQL 4NC1C 4WY7L 4Y19D 4ETQA 4WHDA 3DNKA 3EZ8A 3OHXA 1ZSDB 3A0OA 1E6JL 4LIQL 4HBCH 5EBMA 2HKHL 1FRGL 4R2GB 3UDWA 5INCB 3V8CA 2BP3A 1PKQB 1S7RA 1I1AB 3GMNA 4YGAB 3VFUA 4OQTH 2DLFH 5L0QC 1B4JL 3S5LG 3H3BC 1I8LC 3MJ9L 3ZYJA 2B5IC 2MKLC 2J2ZA 1F13A 3L3JA 4EI5A 3H42H 4FZEL 1N6QH 1BIIA 1FFOB 3ERYA 2B2XH 4QRUA 3UTTA 3EFDL 4IRJC 4XNMB 4DKDC 4ZOBA 3VA2C 3FFDB 4X7SH 5DI8A 3V6OC 1IL1A 2DQCH 2VDOH 5CSGA 1I3UA 4XVUC 3HUJE 4W4NA 4XPGL 2OTPA 3WUWA 5J3HD 5DJ2B 3E1F1 5LAXB 2WBJD 1B3JA 1EEZA 2NY3B 1EVUA 2ICES 3PP3K 3QDGA 4I0KA 2OJEB 4KK6D 3QWOA 3AU1A 5SWQB 4OZIE 3RY5A 4LGRB 1TJIH 3BKYH 4JZOA 3O2WH 3PP4L 2AJ3B 4W68A 1RZ7H 1PGRB 4ZO8A 4XP6H 4CRPA 3T65B 4Q9BA 1HCFX 1AGFB 4D3CL 3IDIA 2OZ4A 3L5WA 1BJ8A 4NQEA 3MBXH 1FNGA 3ABZA 4RX4D 3L3KA 4JRWA 4PD4K 3NA9H 5FOBB 1CFTB 4K7PY 3EYFA 2Q8AL 5ESQA 2X41A 1LWRA 3FQRA 4PJFB 5B3JE 4YXLH 1U3HA 1C5DB 4M1CD 5E8EA 3TIDA 5D1ZD 3EZJB 4KVNH 5KSAD 3RVWD 1TNMA 1AP2B 2V9QA 1TVBB 4EEEA 4WDIB 3P9MB 2J4WH 3TNNA 1A1MA 1RIUH 2OTUA 4NNXA 1MPAH 1MLCB 2M8XA 1S5IH 5EG6C 3T0EA 5HI4C 1S3KH 3T8XB 4XC3H 5DVNA 4OLZL 1F3DJ 2EH7L 3F7VB 1M05B 2FGZA 5L2KB 1Q38A 1KCRL 3AXLA 5ACLA 1T22B 4XP5H 3LRSA 4KPHH 4XXCA 5IJVB 2K1MA 4PGEB 4F57L 2X1QA 1J87A 2VZ1A 4LCCB 1N6UA 2FBJH 3P3YA 3EYUH 1OAKL 3JV6A 4NM8L 2CDFA 4GXUN 3K7UA 3RDTA 2UWEB 2B1AL 4OI7A 3DUUB 2FJHA 1A3LH 4UB0H 5C0BD 5ADPL 3I3EA 1XGYH 3PUCA 3MRQB 1N7ML 4HZLA 4Z7WA 4HWNA 5BZWB 4C83A 5DJ6B 3QH3A 1TTFA 3R8BB 2P8MA 4W6YB 1UCBH 3QZWG 4FG6D 3TA3C 4URTB 2JIXD 1QHOA 1A5FL 2DLGA 2F5AH 3P0VH 1MHPH 5ESVA 3QHZL 4O2CB 4OCWL 4JKKA 5JQ6L 1UG9A 1EVTC 4JQXC 4X6CE 1KTLB 2D9QB 4FZ8H 2RCSH 2YA2A 4FFZH 4KMTH 5KVEH 1NCNA 3NAAL 4JRYB 4K3GA 4JFYB 1F97A 5EOCL 1G6RA 3L7EB 5CGYD 5DJCA 4ALAH 4UNTA 4JFED 2EE9A 4MJ6B 4PJAA 1WSST 1NL0H 1N3NB 5KS9A 5HY9A 1AGBA 5I17B 1Q1JH 4D9LH 4OLWL 3BFOA 4AH2B 5DMKA 1ZLUK 4HIXH 3D18B 3MV9B 4IOSD 4E42B 5B8CB 3BN3B 1QVOA 3PV7A 4YHOH 2P24B 3ILPA 5JW5A 3I50H 1S9XB 4JVWA 4Q6IC 3U30B 3FTGB 4M7ZB 5E8DL 5HVFB 4RFNC 3O41B 3AVEA 3H9SB 3MPCA 4UV4H 1LQVA 5AD0A 3BEWB 4XI5C 3RWFA 1OP5H 2J5LB 1KJ3H 4NO0A 2ATKB 3MLXH 3QDMA 1CVRA 2EDXA 8CGTA 3O8XC 2Y72A 5C0FA 5FYJD 4CJ0A 3HMWL 3JTTA 3GMPA 3W2DH 4A6YH 5EO1A 4PJ9B 3OXSB 2EZ0C 1QR1A 3UBXA 4BSWA 4PIRF 4P2OD 4P4KB 4M6OL 1G7LA 1QBML 1EEYA 1L6XA 5FO7B 1PQZA 3ILQD 4X6FA 3SJVD 3ZT6A 4CADA 3GJFK 1CDGA 1RSFA 1E4KC 5DEGB 1AO7D 3D5OF 1HSAA 5IR1B 2PO6C 1LNUB 5EU5A 4GAJH 4YO0B 1P84J 1CR9H 3QNZB 3HE7B 4PBXA 3FMGL 2HRPL 1X5KA 1RFDH 5C09D 4WW1A 3CZFB 3P40A 1RIHL 5D4QA 1T1WB 4JQVC 4PJ7A 4X83A 5I9QB 3DIFB 1IM3B 2BVOA 2DQJH 1HH6A 4O58H 4G9FE 4JFXB 1TZHB 1KPVB 1F11A 5HHOE 3VGDA 1JZ4A 3GHBH 5GZND 5J9PA 5D7IB 3PWLB 1TZIB 3PQYB 1MNUH 2ESVD 2V7HB 3WN5B 3M17B 3M8OH 3QQ4B 1F6FB 3DYPA 4Q0XH 4XVJL 1ED3A 3THMH 5LWYH 3WEXB 4H26A 4LU5H 2H1PL 4HKJA 5DS8B 2BVEA 3BGAA 2BNRE 3NCMA 1C7TA 5KG9B 1RZGB 3AREB 1K4DB 3RKDD 1JHLL 1GGYA 3PL6C 1D6VL 2BMKB 4LCWE 4UQ2B 3ZKMC 1RULL 4R4BB 2A9MH 5T3ZE 4NC0B 3LN5B 4OLXH 4MJ2A 2C1OB 2W0PA 4GXVH 1YYLL 3SQBA 7FABL 5IHZA 5CHNB 2EDJA 4DUXA 4F58H 4R7DA 3O4OB 4N0CD 5D7JD 4FQHA 3TN0D 4Z7UF 5KZCD 3IVKA 1IGML 1FBIL 3EYOA 4XP1H 3VXUD 1GRWA 3MRRB 4HK0B 3QUMB 2CLRA 5A2IH 3BQUA 4YX2H 5EORH 3OBAA 3I9GH 5E94A 5C9KA 4HUXB 1Y6MR 1MIEH 2V17H 2CD0A 4TUJA 5CJBA 1N26A 1A1OB 4U2YA 2VO5A 2ZG3A 3MZTA 4NQCA 4F7EA 1GH7A 1X5JA 2QQNL 3ZE0F 5F7EH 4LCIL 4XCFL 1J8KA 4L8CB 3FB6B 5D1XB 3GSOB 3H0TB 4G5ZL 1A22B 5IKCA 1BVLB 1W72H 4I0PA 4NRYB 4BH8B 1IEBA 5K9JH 1IEHA 3C5JA 3S88H 5T1LA 5DFWH 3CK0L 4MMZC 1BZ7B 2VABA 1T0MA 1Q9WB 4OV5A 3MFGB 4CKVX 2X70A 3MRHA 2IAND 3V6FA 3GBNH 5F1KC 3MCLH 4UT9L 4CVXA 2D4FA 5I8OL 1FGNL 2HT2D 3MLWH 3SDDB 5CD5C 2XN9B 2ZSVB 2YC1B 3RY4A 1NMAL 4GKZA 1Z5LB 1NAMH 3B2UD 3EW3B 4H88L 4LLYA 2HFTA 5TDNB 4LLQA 1VKXB 2NY5C 4HDIA 1CD0A 1DCLA 4RNRB 3SY0A 3BZEB 3X12B 3ARVA 4HFUH 4WI4A 3CDYA 3O3UN 2VZOA 4ETQB 4RGOH 3OHXB 5D2NC 4JM2C 2VZTA 5EBMB 4G6JH 4DZBA 1S7RB 4JN1L 3BAEL 4Q2ZA 4F8QA 3GMNB 3VFUB 1CLOL 4KJWC 5IFAH 2NR6D 2EIBA 4I18C 2WLZA 3K4AA 4Q74A 4Y16C 3QUML 1J0HA 2JKXA 4J3XA 3L3JB 4EI5B 1B9ZA 3MMEA 1X5AA 4HXBH 1BIIB 2D7NA 1KBGL 4MAYD 4QRUB 3UTTB 1UM6H 2NXYD 1BEYL 4YBHA 1MAMH 1BQSA 2YN3A 5DI8B 1WTGT 1AE6L 1RUPH 3WFZA 1IL1B 3KLDA 4RISL 3C8DA 4EZMA 5ILTH 1U92A 2FHCA 3TBVA 1F3DH 2CIKA 2K7QA 3C60D 2QADC 4WHTA 4S1SL 3RWHA 4CN1A 3SDCD 1K5NA 5C0BE 3WUWB 1PDKA 1EEZB 3T1FA 3AC0A 4JHAH 5I18H 2VQ1A 2AQ2A 3IFNL 3QDGB 3C08H 1FJ1A 1NEUA 5SV4A 3QWOB 3AU1B 3QCUL 3WKNA 3MREA 3E3QC 4JZOB 1QLEL 5DHVH 3HRPA 3IAPA 1FGVH 4HLJA 3RAJH 4HSQA 3D3VE 3N1PC 3C5ZD 4LLUA 3IDIB 3C5SA 3K2UH 3L5WB 1CT8A 3NABH 3FOLA 1I3GL 4NQEB 3WNOA 4AL8L 1CD9B 3TPUA 1FNGB 2F58H 4OLUH 3L3KB 4QHKI 1ZE3C 3EYFB 2GIYA 5ESQB 3MRIA 4Z7UE 2DLHA 1I9EA 1X5LA 1ZXQA 4BKLA 1MFEH 3FQRB 1U3HB 4U4BA 5E8EB 3TIDB 1AQKH 1CU4L 2HP4A 1R5WA 5HHXL 3TNNB 5AZEH 1A1MB 3MNZA 4IRJD 4BH7A 2OTUB 5I19L 4NNXB 3T0EB 3MTRA 2FECL 2ITCA 4IRSC 2DKSA 3ZE0E 4PLKD 1FVDA 3HAEA 2EC9U 2EC9T 1YA5A 3GM0A 2GHWB 2VDNL 5LKNA 1IC5H 4XNYH 4GUPA 3AXLB 1UM4H 5F7YC 5L8JB 3LRSB 3UJIH 3AS1A 3U7YH 3GKWH 1MLBA 1NBVH 4BZYA 4Q58C 1C1EL 2IG2H 2HVJA 3KPNA 3ZL4L 2CJUL 2YMXH 4AZ8A 1HWGB 3JV6B 2CDFB 3BKML 4XCCH 3RDTB 3KR3H 5EO0A 3U2SA 5E56A 5GGTH 1MCKA 1EXUA 4WWKC 1CGTA 2FJHB 1MCCA 4BZ2L 1L9NA 4OD1L 2H26A 1E4XI 1MFBL 1RZKC 4MXWL 5B38G 4XB8A 3D9AH 1CZ8L 4HZLB 3SJVE 3D39E 4Z7WB 5FKPA 5C70A 1RVFL 1AO7E 2VLRA 4C83B 3K0WA 1R3IH 3QH3B 2OZ4L 1F2QA 2LTQC 2P8MB 1NC2D 4P49A 4XP4H 2VOTA 5EUOF 2WWKT 4MQXD 5ESVB 5E2VL 1VESA 4JY4A 1YDPA 1F3RB 3BRDA 3BKJH 2UZXB 4QY8A 3T3PF 4UTAL 4EUPG 3G6DH 2G75A 3H3PH 1Z9MA 1AH1A 1A6AA 3CMOH 1HCVA 1G6RB 3WS6C 3CXDL 5T33H 4O9HH 1ZLVK 5ECJE 5AWNL 5DJCB 1F4WL 4PJAB 1MFNA 4XP9H 2BOCA 5KS9B 5HY9B 1AGBB 5I73B 4OQTA 2CDEA 5HHMD 5IW6A 4PJXF 3WHE1 5DMKB 4N8CH 3R4DA 4P2QD 3BPLC 4OJFH 4FS0A 4OKVA 3L1OL 2MOVA 5T1KD 4KHTH 1Z6JT 1QVOB 3S36L 1FZMA 3GSQA 1IQDA 2VH5H 3ILPB 1Y0LA 5JW5B 4RAHA 1YNKL 4QXTA 4ZD3L 3KPMA 5AD0B 3RWFB 1YEHH 4NO0B 2C7UA 3V5DA 5DMJB 3PIQA 5C0FB 4MCZA 3JTTB 1QUNA 3GMPB 2AJXH 5HHOA 1YPZE 4KUCF 5EO1B 2V2WB 3TA3D 1J5OL 5CBAA 4HPYL 1S9WA 1QR1B 4JHWL 3UBXB 4BSWB 3G6JF 4HWUA 2A1WL 3UTSE 5HPMA 1FO0H 3W0WE 3NIGE 1G7LB 1CICC 5DVLA 1D5MA 3SGDH 3U4BH 1LO0H 1EEYB 1WISA 1PQZB 4X6FB 4CADB 4TQEH 3KDMA 2CLVB 2APTA 2EDKA 1OPGL 1HSAB 1KCSH 5C7XL 2Y25A 1D5IL 5EU5B 4LCWA 4HUWA 3FHQA 2UZIH 4UAOB 3NTCL 3AB0B 2IMNA 4TSAL 4L3CA 1M1SA 4PRNA 4Q6YA 2GJ6E 1L0XA 3MNVA 1X5ZA 4WW1B 1G6RL 1YMHA 4PJ7B 1KC5L 2AVGA 4MNQA 4MLSA 5DJDA 2BVOB 5D7LA 1HH6B 5D71L 3P2TA 1F11B 1V3MA 4WCYL 2X4TA 5L7XL 1MAKA 2OL3A 3UX9B 1MRDH 1F4XL 1DBML 5J9PB 4GOSA 3MR9A 1RAMA 4KJQD 1A6UL 3TPKA 4MHHG 5J13B 2XNAA 3MRNA 3ULVC 1EEUA 4F80A 3QISA 3P9LA 2D7PA 5FCUL 1ED3B 1UGNA 4LSPL 4H26B 4HKJB 2VDRL 1F02I 1EPFA 1MWAA 3ELAT 1HIML 4ESKA 4Y5VA 2Y36L 4YHIA 2LV4A 4W4OA 1UT9A 2OJZH 4EDWL 4JPWL 4LP4A 2DQDH 4PJ5E 1NMBH 3SCMA 4M4RA 5GRJH 3EYSL 5IHZB 2QJDA 1IBGL 1YQ2A 3G5ZA 4R7DB 5EUOE 3MLZH 3IDXH 1MAJA 5KOVC 3RJDA 2VXSL 4FQHB 3IVKB 4CMMA 3EYOB 4QOKD 3P30L 4TUOA 2CLRB 2DI7A 2I5YH 3BQUB 1FNEA 4ZFFA 1ACZA 3QEGL 5E94B 2BNUA 2VXQH 2BVQA 4ZS7L 1QFHA 4Z7NF 4TUJB 3PWJA 4GRLC 4NQCB 2H32H 3D0VA 4F7EB 4J23A 5EA0H 3VXNA 4PJXE 4JHZA 3N1GC 4XPBL 1V7MH 1VFAA 1JNLL 3QDHA 3KPSD 3VXTA 5IKCB 3ETBF 4I0PB 4NN6B 1IEBB 3GK8L 4GLRH 5F9WB 3C5JB 4YZFF 1Q0XH 5E9DD 5T1LB 2B8OT 4H20H 2WSKA 2VABB 2JJTC 2XA8L 1T0MB 1QPXA 4OV5B 3PL6D 3ARPA 2X70B 3MRHB 3V6FB 3RVUC 4CVXB 1G9MH 4KV5E 1DFBL 4DGYL 3WNNA 5F7UA 5DRWA 1LEGA 5IM7A 4GKZB 3VGBA 3QPXL 4X98A 4LLYB 4HCRH 1YEJH 2CUHA 3JV5A 4LLQB 2DBLH 2E6PA 5BS0E 2KBGA 2NY1D 5IK3A 4HDIB 2MNUA 1KJ2L 4NFBA 4OTXL 3SY0B 3C09B 1F5WA 2NY4D 3BGFC 4O4YH 2XPGA 4KAQH 3RL2A 3MXWH 1CF8H 3DHJA 4ZUVA 5FYKD 3MFFA 2JB5L 1MI5A 3ZZ1A 1U3YA 5E4IA 4M93B 3V6OE 1BQLL 1FSKB 4HQQH 2H41A 4DZBB 5I0ZA 4Q2ZB 5HI5D 2ZUSA 5GJTL 1KULA 3CVIH 2CXKA 5CJXC 4HHAA 1W8OA 4G7VH 5FECA 1NANI 5EU3A 1BM3H 3LKSA 2ZUVA 2AJUH 3B9EA 3MMEB 1DL7H 1U8LA 4NYLA 3GIZH 5E8OA 1LK2A 4K3DH 2G2RA 4Z7UA 2Y6SC 1GC1L 4R26L 4UU9A 4C56D 3BDYH 1U92B 2D7OA 3TBVB 2CIKB 4L8SC 3HFML 2WWMC 4WHTB 3RWHB 1K5NB 5GGRY 1IGIH 1A7PL 1EJOL 3T1FB 3L3DA 4LLVA 1RZFH 3O45A 5BVPL 3FT2A 4J12A 2VQ1B 5CD5D 5FGBC 4MYWB 1FJ1B 1KPUA 1OGAA 2FGWL 3MREB 5D7SL 4ZAKC 4N1HB 3RX7A 4ZFGH 1IEAA 1KIPA 5JW4Q 1PLGH 2EXYD 4LLUB 2IJ0C 3OSKA 4PLOB 3C5SB 1JGVH 3IU4L 4JCMA 3VFPA 1CT8B 3FOLB 4FXLA 4NDMB 3BIAX 4JM2D 2A6IA 3N85H 4QRRA 3QUYD 3TPUB 3R06A 1BZQK 4WHCA 3STBA 5CLWA 5JXEC 3TF7A 1J0IA 3ZTNL 3MRIB 2RGSA 2O5YH 4Y4HC 5HGDA 4BKLB 4XMLL 4Y16D 1JHTA 3I6KA 1U42A 4YWGH 4OCRH 5F8RC 1FIEA 1KT2A 2AI0H 4H5SA 3L3GA 1G0YR 4XMPL 5E6ID 3RTQD 1R5WB 1IAOA 2C4FT 1NGQH 5DLML 5CD3A 4Z7NE 1EZVX 4K94L 3MNZB 4BH7B 1Z9LA 2XTJB 3D39A 4H1LG 5FGCB 2ITCB 1YYML 5DUBA 3IT8D 4ZO6A 2FD6L 3VGEA 1FVDB 3HAEB 5DC4B 2YPVL 4S1RL 2EYTA 2BVTA 3RVXD 2DQUH 3DX7A 4PJBF 2NQCA 3DETC 1KXTB 2CK2A 4K7PL 1SYVA 3TH3T 4POUB 4GUPB 4YDKL 1EUUA 1T1ZA 5C3TA 2IBBA 1I9RL 2XZAH 5CIPH 1MLBB 1OAUH 5JORA 4RDQF 1H3PH 1EO7A 2HVJB 3KPNB 1P4IL 4JFDD 2XZQL 2GAZA 4ZFOA 1VB9A 2AJVH 5EO0B 1Z9SA 3U2SB 1E28A 1CXEA 2WWKO 3ZTJG 3NCFB 4R96A 1OAYH 1A0QH 1EXUB 3OR7A 1W72A 3WD5H 3A6CH 5AYUH 2H26B 1I1RA 3L5HA 3B2VH 1RZJL 5BV7C 3MV8E 2R2CA 5FKPB 1HN1A 2P5WE 1EFQA 1FZKA 2VLRB 2X4PA 1QKZH 3VG0L 3KPRA 5HVGB 5IEHA 2X1PA 5I71B 1TQBB 4TVPL 3OF6A 5ADOL 1KEML 4KUZH 1NAMA 3GM8A 3KJ6H 3O9WC 4KRNA 1A3RH 1FE8L 4JY4B 1D5XA 1YDPB 5LGJA 5DVKA 3QRFM 1ERNA 4QY8B 3SEPA 4JO2H 2G75B 3T09A 1A6AB 4FFYL 4K9EH 4PGDA 3V52L 5M95B 4YBLB 2BNQA 2QSCL 3NCYS 2DJUA 2HFGH 2BOCB 4NBYB 4LSRL 4JDZA 1NFDE 2X05A 4NCC2 3UTSA 2CDEB 3C6LC 2CO6B 3KG5A 5IW6B 5BMFL 3MOAL 3QDJE 5KAQF 2OI9C 4OI9A 2QBWA 5TE6L 4OKVB 3I2CL 1J1PH 4NRXA 4FQPA 1FZMB 3CX5J 3GSQB 4AK1A 2YZ1A 4WFHE 5IWLC 1IQDB 1Y0LB 2OP4L 3ALPA 1CK0L 2X89A 1G9NC 5GPRA 2VERN 1WT5C 4X9GA 2I07A 3QFDA 4QXTB 2GJ6A 3KPMB 3T77A 5H2BA 4U6HA 1EMTL 3TC9A 2C7UB 3V5DB 2H2PC 5I1GH 4DQOH 4LASL 5E5UB 4KTEL 3PIQB 3V5KA 5FUOH 4MCZB 4YK4C 1I9JH 4JFFA 5HHOB 4HKZA 1LDPH 2N7AA 5HHQA 5A2LH 1CFNA 3LRHA 4X9HA 5CBAB 5K93A 1S9WB 3EJYD 5EU6D 4DWHA 4XB7A 4BQCA 5HDQL 5BRZE 4JRXD 5HPMB 2F19L 4LVHB 2F5BL 4FQ2H 1I85C 1D5MB 1YY9C 3PDDA 4I3GA 3TJHC 3NH7L 3T0DA 5E7BA 5IB1A 4I9WE 3WCYA 1UM5H 4LCWB 3OAYK 3BPOC 3KPSE 2WBWB 4HGWA 4L3CB 4PJ5A 2EXWD 3LQAH 4PRNB 2B0SH 4LQFH 3MNVB 1YMHB 1NGYA 4Y2OA 4MNQB 2ERJB 3F6LA 5EUOA 5DJDB 5D7LB 1NDGA 5HHPA 1DDHA 3MRCA 2X4TB 2XG4A 4OQTL 2DLFL 2OL3B 5HI3C 4U1GB 4WNQA 2NY2C 3DTXA 3MR9B 4LQ1A 4YXHH 5D5ME 2XNAB 3MRNB 4MA8H 2QSVA 1SBSH 2W9DH 3H42L 3P9LB 1BOYA 1A2YA 1HK6A 1N6QL 3WMSA 4KFZC 2B2XL 4ONFH 2C3WA 3SKOA 5I76A 1J0YA 1H8SA 1MWAB 3MV7A 1IQWH 4X7SL 4PJXA 5M7QA 3S35X 4Y5VB 2VDOL 4YHIB 2PKDA 3FQWB 1RUQH 3EUUA 4P5TC 1YEKH 4LMQE 3RL1A 2H6PA 4YDIH 3CLEH 3SCMB 2VUYA 5KSBF 1OCWH 4OQ1A 5GGTA 3BD3A 1X5HA 4N8VG 1JF6A 3G5ZB 4CMMB 4NKMA 5JXAH 1IM9A 1TJIL 3BKYL 1JIBA 3CH8A 3O2WL 4TUOB 3C9NA 4OGYH 1RZ7L 2YRLA 3GRWA 4XP6L 3QI9C 1P6FA 1FNEB 4ZFFB 1WFNA 3V8OA 3VG9B 2BNUB 4C56E 2BVQB 1I8LA 4JG0L 5IHLB 3MBXL 3VMOA 1TQCB 3PWJB 3T4YA 3NA9L 3D0VB 1IGJA 3G6JA 3UYRH 5JTWA 5C08D 3VXNB 1S5HA 4K8RH 4GG6E 4YXLL 1VFAB 2AK4E 4FFWD 4HUVA 4KVNL 3ULVD 1IKNC 3MLVH 3VXTB 2BSSA 3MRMA 3RZWA 3MXVH 1BJMA 2J4WL 1JE6A 4N5UA 3EFFA 2GT9A 3MBEC 1RIUL 1YEDA 4KVCH 1MPAL 4ZNEE 1S5IL 1AHWA 1E4WH 1OTUD 1EA9C 1D9KD 1GZQA 1JF5A 2ZUUA 3OB0K 4XC3L 5HYEA 5D2NE 5IGXH 5JOPE 3GMMA 5DEFA 2P42B 1ZA6A 5MEND 2VLKE 4U1LA 4HG4K 5F3BA 5IMLA 5DRWB 1LEGB 4OZHF 4R2GC 5IM7B 4XP5L 3BDXA 3LZFH 4X98B 4KPHL 2EDQA 1I1AC 2AGJL 3ULUD 5GGRA 5IK3B 3RGHA 2BHYA 5FOJA 1AFVH 2FBJL 4M61A 1KUMA 3EYUL 25C8L 4UNUA 1UYWH 2XPGB 5FHAH 3RL2B 1G84A 3S96A 3K8KA 4ZUVB 3U0TA 3MFFB 2Q3AA 5HGGS 1MI5B 2VQUA 1HNGA 5E7FA 5FGSA 4QXWA 1IGTA 5J8OA 1A3LL 5IJKC 5GRXG 4UB0L 2F9BT 5A16B 3O6FD 2AXHA 4FP8H 1XGYL 5E1AA 5I1CH 4HHAB 5C07D 5D6DC 5FECB 3DVNA 3LKSB 5EU3B 1FO0A 1SJHA 1U8LB 4LDEB 3U4EA 4NYLB 4M7LH 4GMTH 5E8OB 1U8QA 4L5FH 5ETUA 2Y5TA 1LK2B 3OG4B 3D6GA 2QQQA 2XICA 5CEZD 3HI5L 1UCBL 4UT7H 2G2RB 2JTDA 3E3QE 3HR5A 4JFDE 4LSTH 4Z7UB 2F5AL 3P0VL 4UU9B 5C6PB 4YPJA 1FZJA 5CZXD 2NZ9D 5F70A 4FZ8L 5KVEL 4KMTL 4FFZL 2FLBT 2LAGB 5DWUH 3MCG1 3JZ7A 5HTSA 3L3DB 4LLVB 3O45B 4K07A 3FT2B 4ALAL 2CKBH 1MQ8A 4MGXA 1ZVSA 1NL0L 2AXGA 1KPUB 1TPXB 1DQTA 1OGAB 1Q1JL 3DXAE 2G5BA 4D9LL 3CAFA 1IEAB 1KIPB 2CH8A 2Z8SA 4HIXL 2B39A 1RV6X 3B9DA 2AEWA 1YUHA 2VDKH 3GO1L 5FAAA 3VFPB 4XVSH 4C54A 2ID5A 4IDLA 4YHOL 1GSMA 1NCCH 2RFXA 2A6IB 4QRRB 3I50L 1U0QA 3R06B 4KROB 1LO3H 1JGDA 1A7QH 2KH2B 4KZDH 5HGDB 5LGHH 1MCHA 2FHBA 4QHUA 1R3LA 4L1DA 3R8QA 1KJ3L 1JHTB 3I6KB 3MLXL 1T7YA 2ZSWA 1KT2B 4H5SB 3B5TA 1IAOB 2Q7YA 1V5JA 5CD3B 2NYYC 3BEVB 4WO4A 4A6YL 4Y88A 4XCEA 2Y6SD 3D39B 3MV8A 4J3WA 3UJJH 3TO2A 5DUBB 3ZYOA 4LCCC 2P5WA 1NLDH 1ZT4A 4LGPB 3WSQH 5F6IB 2EYTB 3QIUD 3W11C 3DX7B 3HZKA 3QNYA 4QF1A 3UTPE 1RUKH 3WE6A 2NW2A 1SYVB 1HWHB 1QLFA 3GSXA 1T1ZB 3NPSB 4GAJL 1WVZA 2H32A 4C57C 5JORB 1CR9L 2P46B 1GVIA 3PDGA 3SE4C 2GAZB 4ZFOB 1CWVA 5DD5H 1E28B 1KENH 4R96B 2D7QA 3KJ4C 5J56B 1W72B 3OR7B 4OZHE 5CGMA 2DQJL 4O58L 2CK0H 4X7CC 3U1SH 3C2AH 3UYOD 3GHBL 5I1EH 3PXJA 2AEIT 1A7NH 3NFSH 2FSEA 2XTLA 1FZKB 4WEBH 5KANG 2X4PB 4Y4FD 3M8OL 2ZG2A 3KPRB 5E6YA 4DW2H 4Q0XL 3N1QC 3THML 5IEHB 5LWYL 3JUZA 4LU5L 5FYJH 3ZDZF 1NAMB 1CTOA 1W0YT 3VFNA 4HCRA 3PHSA 5CILH 3CNKA 2E7LC 4QRPA 4DFHA 3CFBA 5LGJB 1D5XB 1PSKH 2R23A 3B4NA 5DF0A 1EHLH 5EIQA 4FQ1H 3TFKC 1UJTA 4BK5A 1D5ZA 2A9ML 5B8CC 4OLXL 3EDDA 3DETD 4PGDB 3QUZD 4GXVL 3ARFD 2F53D 5T1MA 2BNQB 1LE5A 4F58L 4R9HA 4WTXA 3U30C 4JDZB 4M7ZC 1X5GA 3UTSB 5C8JA 1OAZH 1P4LB 3QHFH 5DO2D 3HG1E 5HGHA 3MOBH 2EDRA 3QXDA 3RU8L 2J5LC 3AROA 4NRXB 4YX2L 2YD4A 5EORL 5BVJA 5T1DH 3I9GL 1JRHI 1OD7A 2Q1EA 4GS7B 1MIEL 2V17L 1NCWH 2YA0A 5C0AA 2I07B 4PJ9C 3B8YA 3QFDB 1P69B 3RIAK 2GJ6B 3IKCA 2OTWA 5F7EL 3T77B 4PJBA 4OZFH 5H2BB 4U6HB 1MCWM 3LPWA 4ZFOL 4JO1H 4QTIH 4P4KC 5JW4R 2IPUG 3P4LA 1W72L 2ICEA 4JFFB 4L3ED 5K9JL 4HKZB 5HHQB 3S88L 3V6ZA 3LH2H 4MXQC 1CFNB 4YUEH 4UOW1 3OX8A 3HE7C 3O9WD 5JPNA 4CGTA 1AGDA 3ARUA 4PJHF 4AJ0A 4UBDC 3QEQA 1WQVT 3GBNL 3MCLL 4LEXH 4APQD 1R3HA 3MLWL 4YXKH 5IB1B 5I9QC 4IMKC 5DJXA 1DQMH 2FX8L 1NAML 4PJCF 5TQ2H 5BOPA 3KGRA 5DJAA 3M45A 2Y4SA 1C5BH 2EDNA 3WJLC 2HTLC 4PRIA 4HGWB 3F7YA 4PJ5B 5HYIA 5EFIA 2B20A 4HFUL 3WN5C 2J8HA 4RGOL 1EGJA 1R6VA 2F8VA 4ZYKA 4RGNB 1NGYB 5E8PA 5EUOB 1AI1H 4G6JL 1NDGB 2NX5A 1DDHB 5GS1A 1HXMA 3MRCB 3AREC 5IFAL 4JPVH 4HJJH 2XXCB 4WNQB 3DTXB 1WAAE 2AQ1A 5TH2A 3MGAA 4KK5D 4U1SA 3LS5H 3FO1A 3QB7C 4POZD 1A2YB 3V0AC 5D93B 3SKOB 5JPMA 5I76B 1UM6L 1WZ1H 1NDMA 1MAML 3MV7B 1F4AA 5TGBA 4PJXB 3O4OC 1RUPL 3BN9D 2A74A 4PJ8A 5ILTL 2AK4A 1EDQA 3N1FC 3RL1B 2H6PB 2ZUQB 1PFCA 2NW3A 4JHAL 5I18L 3TJHD 1NCDH 4B41A 4ZNEA 3VXMD 1FYHB 3C08L 1TZGH 3WNLA 4NKMB 1T83C 1IM9B 4P46A 3VWKA 1LD9A 3C9NB 1FGVL 1RMFH 1QD0A 2VLKA 3RAJL 5CCKH 1L7IH 4OCSH 3O2VH 1ZK9A 3RI5K 4F37F 3K2UL 1BF2A 3NABL 4GKOA 3GSUA 3VD7A 5CSBA 1D3CA 1PAMA 1VDGA 4OLUL 3T4YB 5SWZD 1A7OH 4M62H 4BM7A 4N9OB 4E0RA 1IGJB 3ET9F 3G6JB 5GZOC 1DN0A 4MHHI 3OJMB 4G6FD 5DDHA 5HI3D 1S5HB 1MFEL 4U1KA 4HUVB 2J88H 3NCEB 4P57A 1AQKL 1IT9H 5E08H 1IGCL 4K3EH 2BSSB 3MRMB 2X44D 3I6LD 3EFFB 2GT9B 5AZEL 5C0GA 1YEDB 1KJVB 1AHWB 2XRAL 5DUPH 1SVZA 1GZQB 2BCKA 4LDLB 1E4XH 3CD4A 1WV7T 3GMMB 5DEFB 4WI2A 1GGCH 1ZA6B 4P5TD 1NMCB 4XNYL 5J89A 4U1LB 5F3BB 5IMLB 1CDCA 3KPOA 3UDWC 1UM4L 3CUPA 3D85A 4LRIC 3UJIL 1QG3A 3U7YL 3GKWL 4ZXBD 1NBVL 2IEPA 3UTZA 2ZNWA 4MMXC 5GGRB 1QHPA 4M61B 1I1CA 4P9MH 2YPLE 2YMXL 2VLMD 4XCCL 3S96B 3U0TB 3KR3L 4JFHE 3WIFA 3W5MA 5DRXA 3V95A 2F54D 3LKQA 1K8IA 1OT1A 1IGTB 1UA6H 2OMNA 4LP5A 4P23D 4DKFH 4JJHA 3WO4B 2YBRA 5E1AB 1MVFA 3OJDA 2OS7A 3QXVA 3D9AL 2BRRH 1L0QA 1WWCA 5B39A 4GJTB 3DVNB 1FO0B 4UIKH 4Z5RA 5EWIH 5A2JH 1SJHB 3GBML 3U4EB 4GMSH 2W0LA 5KSBA 5E4EB 4YHKH 1U8QB 5ETUB 2Y5TB 2XXMB 4PJDF 3QIWA 4XP4L 4BELD 5JW3H 3T3MF 5JUEH 3MBED 3VWJD 4DUVA 1OTTD 1E6JH 5IQ7H 5ISZD 1FZJB 1FRGH 4QHMA 3HB3D 3BKJL 1SEQH 1N0LA 3TYFA 5I1LB 3G6DL 5C1MB 5IW1A 2XG5A 3H3PL 3NN8A 4W6XB 3ARGA 3CMOL 3PJSA 5T33L 4O9HL 1I7ZA 1ZVSB 5IHBA 2AXGB 4TUKH 4XP9L 1TTUA 4LSQH 2APXA 2G5BB 2WBKA 5SWSA 5C0CE 3SDAD 4PDCE 4N8CL 4LDOB 4GRMA 2Z91A 1U3HC 4OJFL 1YUHB 3BH8A 5IBTH 4KHTL 5C86A 2O93L 1UH2A 5GGSY 5FO8A 3IRPX 3QWRA 3CPLA 1VHPA 3MNWA 1NSNH 2RFXB 5FA3A 3DECA 3B9KA 1JGDB 3T0EC 1LEIA 4IJ3B 3RWDA 4N5ED 1LHZA 4QHUB 3UC0H 1R3LB 5CJQH 2F53E 4L3AA 1KTDA 3FFCE 1YEHL 3WIIH 1UQSA 2Z31A 5CKGA 1MY7A 2ZSWB 5K59E 4H8WL 2Y9RT 2M2DA 3OG6B 4NP4H 2Q7YB 1DQJA 2NY3D 2AJXL 4WO4B 1DN2A 4XCEB 1BOGA 4BFGA 3WS6A 4CL7A 3TO2B 4ONOA 3D2UA 3FAWA 3O4LE 1U58A 2P5WB 3WXWH 4CMHB 1ZGLP 1ZT4B 1P1ZA 1BIHA 1FO0L 3NBNA 4FXGA 4QF1B 3HZKB 3QNYB 1ADQH 1IZKA 3O3BA 3RDTC 3KXFE 3U4BL 3WE6B 1LO0L 1T5WA 2NW2B 3F65A 3QFJE 1DLHA 1QLFB 4TQEL 3GSXB 4XCYA 1M71A 4RA0C 1KCSL 5D96B 1Z0NA 3JTSA 1LP9E 1FL6A 2H32B 2UZIL 4PB9H 1JTPA 2Z93A 2ADJA 1RY7B 5E5RB 4M3JA 1T0PB 3ROLA 4RMTA 4YR6A 4OZGF 2B1HH 2D3VA 2DAVA 3N9GH 1AIFA 2BOBA 1OGTA 5DGRA 3HC3H 1KLGA 1BQHA 4F7TA 5KSUA 1XGUA 3JVGA 2A2QT 1MRDL 1G6VK 2FSEB 3NACH 4X6BA 3VFSA 2V9TA 2WBJA 4PG9A 5J12B 4J2XA 1FN4A 3VFNB 2IQAA 2B1AH 5I73C 4QRPB 3CFBB 5CZKA 2R23B 1NC4A 2OJZL 2C4XA 4H25A 4E41E 5ADPH 4NN5C 1D5ZB 1NMBL 2QQLH 2ZUWA 3RUGE 5GRJL 5T1MB 1EAPA 4PJDE 1LE5B 1JHKH 1HEZA 2OR9H 3RVTC 1NEZG 3MLZL 1DQLH 3IDXL 3T3ME 5J1TC 1JPSH 5C8JB 1U8IA 4OFKA 5JZ7D 1M6OA 3BPCA 2R4SH 2DTMH 4RMUA 5HGHB 3QXDB 2VR4A 2I5YL 4NQDD 5BVJB 5CJOH 2E6JA 1U8NA 5HVWA 2VXQL 1UKSA 4XAWH 2WLYA 5C0AB 1CGWA 3ARSA 2JLLA 1B0GA 4YDJA 3IKCB 5EA0L 4PPTA 4B53A 2OTWB 4PJBB 1OP3K 2GY7B 3G04A 1V7ML 2X09A 3SKUD 2RAMA 1JYXA 4JRYD 1ZLSL 2ICEB 1S7SA 3G6AA 4BFIA 1MHEA 2CKBA 1Q0XL 3V6ZB 1MOEA 4NOFA 2MJWA 4H20L 2W0KA 3IFLH 4UAOC 3OX8B 4G7YH 2EO1A 2VMFA 1AGDB 3GHEH 2F74A 3QEQB 4PBVC 1BD2B 1G9ML 2IF7A 4GKNA 3MV9D 5E1HB 2I26N 3TVMD 1R3HB 4ETYA 2FH8A 5DQJA 1OL0A 4TYUA 3WDIA 5DJXB 2R9HC 4MXVF 1OM3H 1CXKA 5HXMA 4HCRL 1YEJL 1T21A 1NAKH 2DBLL 4M6AA 5DJAB 4NQTA 4PRIB 1UCTA 3F7YB 2E6QA 4LARH 3H9SD 1Q9OA 2M1KA 5J13C 5EFIB 4KAQL 4N0UE 4LIQE 4ZOCA 1CF8L 1WEJH 3RNQA 1H8OA 4ZYKB 2XWBA 2CSPA 5E8PB 5IUSA 4MQSB 3HI6H 4KRPD 4HQQL 1N5YH 2NX5B 3ZKNC 1DQDH 5GS1B 4WV1A 1HXMB 3RWJA 1CQYA 1MIMH 3CVIL 4PJ9D 4G7VL 3O3AA 5TH2B 4F37K 4ZQKA 1BM3L 3BUTA 4HUKB 4U1SB 2AJUL 3FO1B 1DL7L 2N56A 1G1CA 3GIZL 4P4KD 4OZGE 3F62A 2FJGA 4PY8I 4X0KA 5IVNA 4M02A 4K3DL 4X99A 5JPMB 3L3OA 1NDMB 3ZKSD 2VLME 5TGBB 1T1YA 1QOKA 3HNVH 2A74B 4PJ8B 1QLRA 1KELH 3BDYL 2AK4B 3HE7D 5F1IA 2X42A 4JDTH 3QIBA 3STLA 1O7VA 1N8ZA 4UBDD 3BQUC 1IGIL 1NGPH 1PG7X 3EOTH 2NW3B 3U0WL 1RZFL 3CZJA 1MFCL 3DI2B 4X80H 1BLNA 3EOYG 2ZWLT 4N1EA 1HHHB 2XQYK 1GJIA 4DN4H 1MCLA 1CDUA 4OGAD 3GFUA 1OTSC 4JKMA 1GC1C 4NC2B 4P46B 3AM8C 3VWKB 5D2LF 4DN3H 1LD9B 4ZFGL 3ULSA 2HTLD 3G5YA 1LO2H 1FNLA 1H3TA 1PLGL 1VEMA 1HKFA 1OAXH 2VLKB 3PQYD 4U6XA 2ZCHL 1CGSH 1JGVL 5FYKH 1D6VH 1XF3A 4I0PC 4J4PD 4NN6C 3GSUB 3T1WA 5ISZE 3N85L 3TP4A 4Z7OF 5F9WC 3VFGH 3BZDA 1H3VA 5DD0H 4E0RB 3GJEA 2IQ9H 4XXDA 1DN0B 3ARED 2O5YL 2ORBL 5DDHB 3S4SG 4PJHA 1BJ1J 1FLRH 1FAIH 4ONHA 5DFVD 2BVUA 4U1KB 4YWGL 4P57B 4OCRL 2AI0L 3NZHH 1PKQE 4YGVA 2Q76A 1E27A 4PJCA 4WTZG 4M43H 3REWA 1NGQL 3MLRH 3KPPA 1RUMH 5C0GB 1KLUA 3RGVD 3BDBA 5JIIA 5KTEH 4QTHA 3H6JA 2BCKB 1U2CA 3RIFF 4HWBH 3C09C 2DQUL 4PV8A 5EBWA 3KLHC 1U93A 4Q9RH 1G0XA 1RURH 5C09A 3KPOB 4M93C 2JJSA 3U9UA 1FSKC 3CUPB 3D85B 2XZAL 4G5ZH 3O2DH 4K94C 3UTZB 1H3PL 4BQBA 3C87A 5JXEA 1J0KA 4POYA 2Z8WC 2AJVL 3B3IA 5D1XD 3WIFB 4Y4HA 5DRXB 4QYOA 4CU7A 1EX0A 1A0QL 3LKQB 3WD5L 1K8IB 3A6CL 5K9OA 4LPTA 4MXVE 5B22A 5AYUL 2MWCA 3VXRE 4IBLT 5C0CA 2YWZA 1WBZA 4HD9A 2YBRB 4WFFE 4MD0A 4Z7VF 3OJDB 2IH1A 4P2YA 1H5BA 5E2UH 5GGSA 5B39B 3FJTA 4Z5RB 2I24N 4JJ5A 1QKZL 5KSBB 3LN4A 4C4KT 3TV3H 4CU6A 3JUYA 4J3TA 2PCPA 4N9GA 5J57B 3SDDD 1P4BH 2XN9D 3QIWB 3GSVB 4KUZL 3IS1X 5HYSG 1VERA 4Y5XA 4PJFE 1M7DA 3KJ6L 1QRKA 1A3RL 5HGBA 4OCMC 5D7JA 4QHMB 3LKNA 1NCUA 1RZJC 1MCOL 5IBUG 4RWYH 3TYFB 2VDMH 4JO2L 5IW1B 1YY8A 3NN8B 4RQQA 3ARGB 4LSSL 2O5XH 3PJSB 4K9EL 4WI9A 1I7ZB 5IB2A 3OAZK 5IHUL 2HFGL 4P9HC 1QFWM 5SWSB 1NCBH 2LABA 5ITBH 4GRMB 3KXFA 1BEYH 2Z91B 4D0DA 4X6DF 5L2KE 3QFJA 3BH8B 4RISH 3U6RA 4EI5D 5FO8B 3CPLB 4MAUH 4Y1AD 3MNWB 4KU1A 1CXHA 3GMQA 1UACH 5FA3B 2XTJC 3B9KB 4OFYA 1LEIB 2ARWA 3RWDB 2UWEE 5D2LE 5DURD 3IFNH 3PWNA 1UQSB 2Z31B 4DQOL 4W81A 4F8TA 5I1GL 5ICZA 4G8EA 1AR1C 4ISVA 2IANA 5DMIH 5FUOL 5FGRA 5IMKA 1DQJB 4Z7OE 3GI9H 1LDPL 4WJ5A 3QDGD 1BOGB 3D87B 4LNRA 1YN6A 3D2UB 3ZHLA 1MJ7H 1U58B 4NUJA 1P1ZB 4FXGB 3T2PA 2WK2A 3O3BB 1Q9LA 1EK3A 1T5WB 4G8GA 3C6LA 2QSQA 5KOMC 5LQBH 1DLHB 2OI9A 4PP1C 4OLYH 1M71B 2QTEA 4NQED 3JTSB 4FQQA 1UM5L 1FL6B 3F7QA 4E41A 2Z93B 2ADJB 4JRYE 3EHBC 1A6WH 2AP2A 3LQAL 3DO7A 4LQFL 3ROLB 2QR0A 1U3HD 4YR6B 4PJDA 2A9NL 1AIFB 5JA8B 4JO4L 1UH3A 2BOBB 1OGTB 5I71C 3BIBX 2E7LE 1TQBC 2OK0H 1KLGB 1BQHB 1CN4A 1OF2A 4WI3A 4U7SA 3SKNA 1MEXH 2VISA 4F7TB 5KSUB 3Q5YA 1XGUB 3MV9E 4FTVD 3NFPA 1YEGH 1IAII 4YXHL 3ZE2E 4R0LA 4MA8L 5GQBA 4X7FC 1XR8A 4X6BB 1SBSL 2W9DL 1XF5A 3C60A 3DLQR 5I1KH 1NFIA 3VFSB 3PWUA 2E9BA 4RMVA 2H3NA 4OI8A 2YUWA 1ORSA 1UWXK 1YMMA 2WBJB 4ONFL 4PG9B 4YBLC 3ZL4H 3V6BR 1F8TH 3L3HA 4Y4KA 3O11A 1I85A 1FN4B 3H7BA 4NKOA 1IQWL 2IQAB 4Z7VE 3TBSA 5DJ8A 1NC4B 4JO3H 1RPQA 1RUQL 4H25B 1YEKL 1UZ6F 4YDIL 3CLEL 3RDTD 5F7NC 1OCWL 1EAPB 3DV4A 1HEZB 3SDYH 4OLVH 3MUJA 4GFTB 43CAA 1KFAH 1U8IB 5JXAL 1M6OB 3BPCB 3UROR 4GQ9H 2R0KH 3RWEA 5LXGH 1MH5A 1V3KA 4BSJA 1U8NB 3AGVA 1UENA 1Y6KR 2FEDD 2BFVH 3UYRL 1B0GB 4YDJB 3ZT5A 1JTTA 1CXLA 5KANI 4WFGD 8FABA 1QSFD 5CJ5A 4EIGB 1O0VA 3K74B 3P77A 3G04B 4LVHC 1KB9K 4OLEA 2G5RA 3MLVL 3ARBD 2YS4A 3G6AB 4BFIB 4OZFG 1MHEB 1WBYA 3MXVL 2CKBB 4M48H 3QUXA 5EDXA 3S36H 1HILA 1G1YA 4XPAH 2ZJSH 4R4FH 3J8F7 3EYQC 3WFBL 2YOCA 5IGXL 2F74B 4BQ9A 4OZGA 2FEEI 4GKNB 1V3JA 1JPFA 5CFHA 5DQJB 3V7AG 2ERJC 1S7VA 5CP3A 3DVIA 1JPTH 3LZFL 3BESR 3UPCA 1T21B 4KI5F 4DK6A 6CGTA 3RVTD 3QO0A 4U1GC 1AFVL 1Q9OB 5KVDH 1UYWL 5FHAL 5E03A 3RNQB 4WENB 4HPYH 2XWBB 3SHSA 3QDMD 4YPGA 1ZT7A 4FMFA 3X3FH 4N90E 4WV1B 3RWJB 1RK0A 1S7WA 4FP8L 5I1CL 4Y5VC 1KXVC 3WKMH 3O3AB 4W4OC 5T3XD 5I1HL 1D5IH 4YC2B 4M7LL 4NGHH 1FLTX 2FJGB 1JP5A 3DURA 4GMTL 4L5FL 4CN6A 3ULVH 3E6FB 4X0KB 3CIQA 5HYJE 3QA3A 3MC0A 4X99B 3L3OB 4UT7L 4LSTL 3SE9H 1T1YB 2GTWA 1VADA 1QLRB 4RAVB 1T4KA 1DLFH 3KPTA 2OYPA 5JO5A 3QIBB 3STLB 4ZPVA 1N8ZB 1PBYA 4QT5A 4P2QA 3P4OA 5DWUL 4L4VD 3VG9C 1XR9A 2VIRA 1BLNB 2CKBL 4Z9KB 1TQCC 2R9HD 1S78D 1ES0A 2DWDA 1WCQA 1JGLH 3ULUH 1TXKA 3ULSB 2FLRT 3G5YB 4S0SD 4U6XB 2XN9E 2VDKL 2X4RA 1UZ6E 1NGZA 2VAAA 5F1NA 4Y0GA 4XVSL 1XF3B 1NCCL 3LVEA 3M07A 1U8MA 4U3HA 2E8ZA 4JY6A 3GJEB 1LO3L 4KZDL 1KYOK 4PJHB 5L9DH 2EIZA 5LGHL 3JWOH 5EPMA 4ONHB 1RJCA 5F96H 4HH8A 2EICA 3FRPA 4YGVB 2Q76B 3ZO0A 1E27B 4AMKH 2JELH 4LRNH 4PJCB 3VXRA 4HXAH 3REWB 3U4AA 1ZVYA 3KPPB 2YN5A 1ZGLA 2ADIA 1BFTA 1TDQA 1KLUB 5CEZH 3LS4L 4QTHB 3UJJL 4S0UC 4LHUA 5F9AC 1NLDL 3WSQL 3JV0A 4PV8B 1X9QA 4KK9D 5EBWB 5DVMA 1RUKL 3UTTE 1U93B 4RMWA 3CGTA 3QXAA 3HLAA 1CLZH 2LU4A 5C09B 1CI5A 3QYCA 3D0LA 3U9UB 1BMGA 1HOCA 2OSLA 3WO3B 3HPLA 4GW5A 3QCTH 3UBXI 1OTSD 4WDIA 4GAYA 3W81A 3ULUF 5I30L 3B3IB 3QDGE 2YUZA 4V1DA 1KENL 4QYOB 4HS3A 3GDBA 4I0PD 5K9OB 5MHSE 2CK0L 5C0CB 1CTNA 1WBZB 3U1SL 3C2AL 4MD0B 4Z8FH 1EFXA 3HE6C 2IH1B 3BD4A 5I1EL 4MA1B 4Q9QH 5T1LD 1H5BB 3FZUD 3OKKA 3NFSL 3ALXA 3QNXA 5GGSB 1T22A 4L8DA 1I3VA 2WAHA 4WEBL 3LN4B 2JJUA 4DW2L 3OJVC 1KJ2H 5DMGC 2PCPB 4N9GB 3C8HA 5FYJL 5DC9B 5GRVL 3RX8A 1IRAY 4KKBC 4JE4B 1FVEA 1K6QH 4Y5XB 1JRHH 4P2CG 3H7LA 1M7DB 1TPXC 3BYTA 4U6TA 2A6JA 5D2LA 4EBQH 4G43A 5HGBB 1FFRA 5D7JB 3KPQA 4BA8A 3LKNB 1PSKL 1KLFA 1OLZA 1J0ZA 4I2XA 4ZO9A 1EHLL 4V3DB 5TPWH 1QPPA 4FQ1L 4ORGA 4QOKA 4AQOA 1TCMA 1YY8B 4P5MA 4RQQB 2LQRA 1S7UA 4Z0BH 3KLHD 2VXUH 5IB2B 1OWWA 2QHRH 3T0EE 3BO8A 3H2WA 3SE4A 4KROC 2PR4H 3BMWA 3TF7C 5F7KC 3ARXA 3CFJA 1OAZL 3QHFL 1DBAH 3KXFB 2PNDA 5ITFA 4D0DB 2C26A 1FYTA 3QFJB 4EUPH 2XV6B 4R26H 1CE6A 3QULA 3U6RB 4PR5A 5T1DL 4JANA 5DHXB 4PRAA 1A7BA 3VW3H 4KH2A 3GMQB 1NCWL 1NFKA 1KCLA 2YPKA 2E3VA 5JNYA 2BSRA 3CSPA 3DSFH 5ABDE 3BP5A 1X4YA 4UOJA 4U49A 2VN4A 3S5LA 5E2JA 5F6IC 4MVBA 3PWNB 4JO1L 4QTIL 5GRUH 5ICZB 4IMLA 5HDOA 4CNIA 4N0RA 4G8EB 4ISVB 2IANB 5IMKB 2X4UA 3WFCH 5IV2A 2XT1B 3D69A 4O02H 3TFKA 4WJ5B 3VJ6A 3IDYB 3LH2L 3NPSC 4LNRB 1YN6B 1ITCA 4NUJB 5C0NC 4HULB 4TSCH 5FB8B 3NPZB 3W9DA 4KTDH 1EEQA 1CDHA 1Q9LB 4J3VA 2EYRA 1A