2GAZA

Mycobacterial lipoglycan presentation by cd1d
Total Genus 79
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
79
sequence length
273
structure length
269
Chain Sequence
NYTFRCLQMSSFANRSWSRTDSVVWLGDLQTHRWSNDSATISFTKPWSQGKLSNQQWEKLQHMFQVYRVSFTRDIQELVKMMDYPIEIQLSAGCEMYPGNASESFLHVAFQGKYVVRFWGTSWQTVPGAPSWLDLPIKVLNADQGTSATVQMLLNDTCPLFVRGLLEAGKSDLEKQEKPVAWLSSVPSSAHGHRQLVCHVSGFYPKPVWVMWMRGDQEQQGTHRGDFLPNADETWYLQATLDVEAGEEAGLACRVKHSSLGGQDIILYW
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural characterization of mycobacterial phosphatidylinositol mannoside binding to mouse CD1d.
pubmed rcsb
source organism Mus musculus
molecule tags Immune system
molecule keywords T-cell surface glycoprotein CD1d1
total genus 79
structure length 269
sequence length 273
ec nomenclature
pdb deposition date 2006-03-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2gazA02
3.30.500.10 Alpha Beta 2-Layer Sandwich Murine Class I Major Histocompatibility Complex, H2-DB; Chain A, domain 1 MHC class I-like antigen recognition-like 2gazA01
1A3RH 1NLBH 5E8NA 5E8EB 1SBSL 4HS8H 3BPCB 3RX5A 5I30H 4GRMA 2Y6SC 4YHZL 4WENB 5HGBB 1A6AB 3GSOB 4N0RA 1VGEH 3UEZA 1QFOA 3C8KB 4FP8L 3U36B 5FFLA 4ZO8A 2AJ3A 4Z6AT 2VH5L 3QUMA 5IMKB 1O7VA 4L5FL 3MNVB 5DRNB 1XGTB 4KRPD 2NY0D 5L2KB 2DWDA 3QFJB 5DJCB 1YDPB 1EEYB 1JF1A 1S7SB 4F7PA 4FZEH 4ONGH 3U0WL 2VDNL 2DJ4A 1GGBL 5HDQL 1WQVT 5DHYB 5IBUB 2O61B 1JWMA 1V7MH 4G6AC 4IOIB 1YMME 1IAKB 4G8EA 5I73B 4WO4A 2GAZA 3OSKA 1LE9A 4MZ2A 1Q0XL 4J8RB 3V6ZA 5GS1B 1N8ZA 3U82B 3LKQB 4M6MH 2YRLA 3CXDL 1QPPA 2ARJB 3BRDA 1OCWH 5ITBH 2YBRB 1FPTL 3DX8A 3N1QC 3W2DL 4M7LT 4K3JL 4PDCE 3QDME 4PJ7A 1TQCB 1HIMH 2W60A 1DANT 4NN6C 2VQ1A 1T83A 3V0VA 1NANH 1JZ8A 1T2QL 2VZUA 4Y19B 1ZOXA 1CDIA 3IU3B 4V3DB 1KGCE 1UG9A 1Y18A 1WFNA 3TBYA 1MCSA 1JPTH 1CR9H 2WM0A 3REWA 4Y8DC 1YEDA 2Y4SA 4ONFL 3UTPD 1UACH 3NCCB 4MD5B 4X4YB 3DO7A 1LDPH 3F7YB 3NFPA 2J6EH 1KJ2L 3ARYA 5ICYB 2AJYL 1CFSA 1QLRA 1WIUA 8FABB 1NCDH 4RAUB 4MNGA 3VFSB 4CVUA 4OF8A 1MCDA 3T2QA 2V2TB 2JCCA 4WTWA 4QNPE 4Y2OA 4RGNB 1OB1B 5L2KE 5C1MB 1KNOB 5E2TH 4GRLD 1N3NA 5HGGS 1IKNA 3PGDB 3HRZA 3MR9A 3GSXA 4Y4HD 4ZDHB 3MV01 2BHUA 4LHUA 5GS1A 3DUUA 4MNQD 1CZ8L 3CAFA 2RB8A 4J6RH 4D3CH 3O6ML 1OGAD 4ODVH 5C2UB 3TJHC 5BVJA 5B8CA 3MLSL 1J5OL 4YDKL 4QOKB 5HI3D 4NKIL 2AEWA 2HT2C 2A6JA 3ULUL 3X12A 4YHLH 5J9PB 3GIZL 5EU3A 4XX1E 2I60L 4LBEA 2A9NL 3WL9A 1DLHB 3WIFA 3BE1L 2OS7A 4FHBD 1QYGH 1MHHB 4U4BA 2FHCA 1JF1B 4ZS7H 3QSKB 3NCFB 5FF6A 3SKNB 2X70B 4G9DA 3A6CL 1KYOK 4N9OB 4XNMB 3PDOA 3L3IA 5D8JH 2B2XH 2OL3H 4JFXA 2D0HA 4D8PA 3TYFB 1KEML 4S0TD 3D6GA 1UM4H 5EIIB 2GCYB 4NM4L 2E9WA 3EOTL 1WBYB 1ZA3B 4NNXA 43CAA 7CGTA 1UWGL 1C08A 4RX4A 2MCG1 4XGZA 4YC2C 3O81A 2VC2H 2HVJA 4Q9BA 5ABDE 4PGBA 1XH3A 4R26H 5HHQB 1LO0H 3B9AA 4Z7VA 3FZUD 2J5LC 4KUCF 4ONOA 1V7NL 2ICWI 1MFAH 4RRPG 4A6YA 5DA0B 3VE0A 3IXTA 2AXFB 5HHNB 4KDVA 1S7XB 1Z9MA 2EZ0C 3OX8A 2FBJL 1KIQA 1XCQB 1HH9B 4AH2A 5E2UL 1QNZL 4FQCH 5FO9A 2YD8A 1YA5A 3MRMB 4JRYD 3FQTB 4PPTA 3GRWH 4PJAF 3ZT7A 4AEFA 2CXGA 5K33A 3PE9A 1ZS8A 5E99L 3QA3B 4JZJA 2VE6A 1I8MB 5DD6A 1VFBB 2BNQA 5HPMB 4PTUB 1JNNH 4AIZA 3SDDC 4JO1H 1BZ7A 3MRNB 1QSFA 2OXHA 3I3BA 2J8OA 4WCYL 3MNVA 5DRNA 5J56B 2WW8A 4HLZH 3M1BB 3GDBA 2YEZA 4JKPH 3UZQA 5DA4A 4X80H 4HFUL 1IC7H 1X5YA 2K7QA 4QWWC 1H8NA 5ESQA 3U30B 2ZG3A 1OAKL 4U1MB 3QIUD 3M8OL 2ZPKL 2RJMA 4HKXB 1TDQA 2EDYA 1T7XA 4MD4A 3VGGA 4M9PA 4WU7B 2DL9A 4P48A 4U6TA 3RWGB 2HVJB 1XGPA 4MMXC 3VXSD 3MJ6A 2DLFH 3QDGE 2DIAA 1W8NA 3QWOA 3MNZB 1RZFL 1U91A 1IM9B 3B5HA 5HDLA 2GT9A 4JQXC 1FNSH 3F12B 4P2OD 4K71B 5GRUL 4Q97A 5CLTA 5DMKA 2VISB 3VD9A 4GXUM 4HT1L 4R4NC 4AEHH 3HZMA 3T3ME 5DVNA 3ROLB 1S7TA 4YHML 5J7CC 3UTQA 1FAIH 2VIRA 2R2BB 1KTRL 1W72A 2FX9H 5I1AA 4UQ3A 1I1CA 2Q7YA 3T1WA 1QSEE 4NKOA 4HIIA 3NAAL 4M7LL 3CXHK 3OWEA 1IAIH 1T80A 3SDXE 4BA8A 3GHBH 1ZWIA 4X6CA 4PG9B 1RJCA 5LJYH 3UTTB 1S7UB 3IDNA 3FN0H 1GC1C 2ZNXA 1NAKH 5BQ7B 5FGBC 1C5CL 1C5DA 3IFOB 4WI6A 1OSZB 5DEFB 5K9KA 3O3AB 2PKDA 3QXTA 4HUWA 4OFDA 3QXAA 3H7BA 1OAYL 3NPZB 1J87A 3QUYC 25C8L 4CN4A 4Z78A 3L6FA 4TSCL 2UZXB 4IRSD 2CO7B 5C71A 1TIUA 3IAQA 4H26A 4L4TA 4HV8A 3HC0B 4OGXH 3NCEB 1SEBA 5D2LF 1A9BA 3ECBA 4MSWB 5FGRA 3INUL 3QUXB 1MHCA 1MCCA 5IM7B 4MCZB 4KKLC 4S11A 3QUXA 2CQVA 3V6FA 1ZTXH 2IQ9H 5EOQH 1SBBA 3V7MA 4UOJA 3D85B 4BQ9A 4LGSB 1X6NA 3MLVL 2V7NA 2VDPH 1AI1H 3WNOA 4LEOB 1U9KA 4R4FL 4GAFB 5I17B 1CGSL 2XRAH 4JFEA 2P24B 5EU6A 4JFDB 3FFCB 4FQHB 3NFNB 3RAJH 2LU7A 3MLUL 2P7TA 4FFYH 4ZXBC 5D70L 1SBSH 4HS8L 3OMZA 2V5MA 4R7NA 4LSQH 4PJ5A 4AM0A 1N0LA 1J88A 4D9LL 4PLKC 3VRIA 4WEBH 3RL1B 5ANMA 4JFZH 3JSSA 4NIKB 1MHCB 4O58L 3X14A 4FXGB 4NJAH 1FRGH 2DWEB 2FEEL 2R1WB 4Q9CA 5AZEL 3JVGC 4FZ8L 3RGVD 5C0NC 4C4KT 4OKVA 2BFVH 3BHBB 4ODTL 1TPXB 5KANG 1PLGH 1BGXH 4LHUB 4Z5RA 1FG2A 2CKBA 4FMKA 1INQB 4LSVL 5FDWB 3MQIA 1QSEA 3SKMB 1ZLSL 1J9CT 3T3PE 5GGRB 5JXED 2C3GA 3DNKA 3U36A 1FZOA 3D39A 4CKVX 2FX9L 1CF8H 1DVFA 4NNYB 3WLWC 1XIWD 5K9JL 5T3XH 3ARDB 4Y1AB 4NCC2 4Y16C 4LEOA 4HULB 5I1CH 5E4EB 4LVHB 3SDYL 3D5OF 2JCCE 3SO3B 4OCYH 2FX7H 3O6LL 4JM2A 2VXUH 4Z7UF 4G80A 2HLFC 2X4OA 3WEXA 4Y1AE 5EU7C 1FYTA 2VXVH 1YPZF 4MXQC 1PFCA 2ZSVB 4OFKA 5D93B 1L7TL 1ETZA 2PO6B 3RWIB 4EVNB 1CGXA 5F7DB 1CZ8H 2I9LB 4EI5C 5C0GB 3QFDB 2XA8L 3B4NA 3QIBA 4XTRC 1O5DT 1ODAA 4NHUB 4YHKL 4HV8B 4MA8L 5C9KA 1HOCB 2PXYC 3WFBL 3KWWB 4BELD 1RULL 2XN9A 4QYOB 1T2JA 1E4XH 1F4AA 3BDYL 1G7QB 4KQ4H 4X6DB 2XT1B 5DD5L 5EOCL 3S35L 3MGTB 3TPKA 2MWCA 2I60H 2DLEA 1U3HB 2C4FU 1LEKB 2H26A 5EZIH 3D25B 2QQKH 1K8DB 2X89D 5IESH 3ILPA 1KULA 3MFFB 3R0NA 2FJFA 5SX4H 4HJGA 4X98B 5DRXB 3FQTA 4KI5D 4LPUA 2Q86B 1M05B 2GK2A 4X7SH 4OZ4A 1PKQB 1HINH 3UBXI 3QDJE 1F97A 1H5BA 1YQVL 5CJQL 1Y0LA 1F5WA 5TJWK 3IETA 1BOGA 1IC5H 2FIKB 4GXVL 2OTWA 4P23C 3TH2T 3ZDZE 4LHQB 1N7ML 2ZOLB 3CH8A 3JWDL 3WJLC 4RGOH 5JTWA 4KMLB 4JG0L 4Q2ZB 2F8XC 4Y19D 4ELMF 5DJDA 1FVDA 3OKEB 4KKLD 1FRGL 1LQVA 4KQ4L 3ARVA 3I9GL 5MHSD 3V6OA 2W65A 2J8UA 3TPUA 2BMKB 5TE6H 2C3VA 5F7HA 1MRFH 3QUXD 1T7YA 2P1YA 3MRGA 3C60B 4F2MA 2XN9B 4TSAL 4KUCD 5BJTB 4JB9L 5IROC 5EBMA 4PJXB 1MIEL 3ARSA 2Z8WC 3I9GH 5BZWA 1GVIA 5CSZB 3DXAB 4CU8A 1MHHA 4QRPD 4M48L 1UJ3C 4MS8C 4TQEL 4UTBL 1PVHA 3GB7A 3P4MA 4QF1A 4FQIH 3PWNB 4GSDL 4GKNA 1BM3H 4NFBA 2DQCL 3I75A 5FV2A 4OT1L 2XWTB 2BVPA 4QXUL 1VGEL 4UB0H 1CE6A 2V5TA 3RVTD 2NXYD 3BP6B 4QRUB 5E56A 4JRXB 2I25N 5D7JB 1TZHB 2GYSA 2NQCA 4JFDA 3H9YA 1U8LA 3EO9H 4D3CL 1QVOA 3VWJC 3L3DB 4X6FA 5CSGA 2CLZA 1T1ZA 3H42H 4LDLB 3VFGH 3TLRA 4OT1H 2FX8L 1FPTH 3CK0L 3O4LB 5HHOD 4OQTL 5I73C 3K4DA 5EO1B 1YEJH 4WV1C 5EO9B 2JJSA 4X99A 1U8JA 4XVUC 1MFNA 4K94C 1AXTH 1I8KB 4QEGA 5C0EA 4HKBB 2VZTA 3FL7A 4OJFL 3IF1B 4O5LL 2X1XR 5CEXA 1NUGA 4YWGL 1BQLH 2OI9B 4MJ5A 5CUSL 4DGYL 4ZUWB 3WFBH 2DYPA 1A6WL 3LQZB 3BP7B 3IJHB 4JCLA 5F9OL 5CAYB 3WO4B 4H20H 1OF2B 1H8OA 3TF7A 4JFQB 3ZTJH 1KJ2A 5E5MB 1K6QH 4AQOA 1G7MB 4FXGA 4DVBA 4FQQA 3EFFA 1ZT7A 3NA4A 5E6ZA 5IW3A 4ELKA 5A2KH 1N59B 2EE6A 3WXWL 4TPRH 3ZYIA 1T1XB 3ARWA 4DK3A 1SEQH 9CGTA 1XF2B 4R7DA 3MUZ1 3RA7L 3W81A 4X5XA 1KB5H 4G7VH 2GSGB 4P4RB 4GW4A 2X4UA 3BAEL 1ZSDA 5HYJA 3ZKXB 4UILH 1JRHH 2XZCL 4MHHI 4LVHC 4K3DL 4Z7NE 3BYTA 3MA9H 4RGNC 2YR3A 3WO3B 4TUJA 1OP5H 3SKOA 5TDOA 4PIRF 1N6QH 1FLTX 2AV7A 2BY3A 5CUSH 4DGYH 4PRHB 4NUGH 5GS0C 2ADGB 2P8MA 2GITA 2DDQH 5J11C 4PJIF 5E6YA 4UTAH 3ARFD 4XC1L 4KROC 12E8L 3I50L 2PO6C 3QFJE 4OZFH 4LLMA 4KK5D 5CZXC 5EO0A 4APQA 3ZHLA 4BFEA 4JFPB 1WC7A 5E6IB 3ZDYE 1BVLA 4PUBH 4OCXH 4W4OC 2P5WD 5JW4R 1JTTA 5JDSB 4ZNEE 3FB8A 3VWKB 3L9RB 4PJ9A 3CDYA 1EVTC 5D2NB 1S9VA 3CVHH 5LAXB 4DWHA 5KSBB 1A4JB 3EJZC 2XWTA 5ESQB 1OTUC 2EEBA 1FDLH 1J12A 4NKQB 1IBGH 1UQSA 1NC2D 3D69A 2DBLL 5K9KB 4RMVA 1LD9B 4C56B 2MTPA 4HBCL 2FYYB 3QUYB 2AJSH 4QXWA 5DVMA 1S9XB 5A2LH 4I8DA 2YK1L 1T0MB 1B88A 3KWWA 4NBXB 4DN3L 3U46B 3OHXB 3UTZB 5E0QA 3F62A 3LSOB 3RY5A 5L6YL 3TO4D 1OM3L 1T3FB 1NBVH 4DFIA 3F12A 2XA3A 2Q8AL 4ZOAA 1QBLH 4F15B 3ZZ1A 2XZZA 2KKQA 2VERN 2AJUH 2PF6A 1XF1A 4JQXA 4NQDD 1U6AL 4NC2B 1GCFA 3HFMH 2GT9B 2RAMA 4GG6E 3BZEB 3ISWA 4JFOB 2AV7B 2V6HA 2OM5A 4GG6B 1FDLL 2HFEB 2ADFL 3O11A 2EYTA 5EA0H 4Y0GA 5GGSB 4X6BB 3UPAA 4CAGA 2NY6D 4ZXBB 4KTEH 4KKAC 5IF0A 2AI0H 1BZQK 1XF2A 3AS2A 4BZYA 3FN9A 4XNQB 4TUKL 5HSFA 5FYKE 4KGLA 3NZ8B 2YPVH 4J1UA 5I1DA 3CD4A 3BZFB 3QUYA 3OKMA 3G6JF 2CUHA 2D31B 5MI0B 4UT9L 1I7RA 3KXFA 4YGVA 4HKJB 3C87A 1EDQA 2AGJH 3VXSE 2IPUK 4F7EA 4CMHC 4OKVB 1UZ8A 4QXTB 3VGAC 1CXKA 1FNSL 2XZCH 1KCLA 3P9LA 4N0CA 3O9WC 3O6LH 4F7CB 4Z76B 5KS9F 2HG5A 5IJKC 1I8KA 1YMHA 3EOAB 3Q48A 4S1DC 4GUPB 4HJ0D 3QDMB 4EIZC 4PGBB 5IB4A 5EO1A 4LPYA 5CP7B 2DLFL 2IADB 1T21B 2YC1A 5CIPB 5DWUL 1C5BH 4PJ5E 1FNAA 5FYJL 1KJMA 3VXME 3LH2H 4ZUUA 3KPQA 4M5YH 2JF1A 2PO6D 3MLTA 4U6VH 3EDKA 3QPXH 2W9DH 1RZIB 4JDZB 4Y4FC 2OI9C 4PJ5B 4AM0B 1B0RA 3IDMB 4JFEB 1KC5H 1RY7B 2BVQB 4FFWD 4M1CC 5SWSE 2D3VA 4ZFZA 4EDXB 4EI6B 5IB2B 4NFDA 1OARL 2J3SA 4M61B 5A2JH 1VENA 3NFNA 3W11D 4FXKA 4R3SA 3TYFA 2WUBH 5ISZD 4LARL 1FO0H 4BK4A 5DUPL 1C1EL 1OVZA 2PR4L 3VDBA 1LO2H 1C16A 4FP8H 4PGZA 1KEGL 3D2UA 5CZVH 3FN0L 3ZDYF 1E4JA 1S9KC 3T4YB 3T65B 1AR1D 4RFEA 4LSVH 3GJFA 1Z5LB 1AXIB 3ARTA 3JWOL 4GLRI 5KAQF 3C2AL 1GGUA 1ZHBB 1B0GA 4PRHA 2DQIH 3G5ZB 1OSPL 5LWYH 2C3VB 1KIUA 3FQRA 3N1MC 2HH0L 3QEQD 4H1LB 4HMCA 4QXTA 3WS6A 1U3HC 3HTLX 3MSPA 3TEUA 1KELH 3IKCA 3IJSA 3RY4A 1KSRA 2GTZB 2WP3T 2P5WA 1AE6L 1CCZA 3HC4H 1TITA 3PGFH 1I3VA 2VAJA 4GSDH 2Q8BL 1RU9H 4LCIH 3HE6D 4UIKL 4F7TB 3JV6B 3ZE0E 3FMGH 5D1XA 2HJLA 5ITBL 1VERA 3GHEH 4K3GA 2UY6A 1E28A 5IQ7H 4LCUA 1RZ8B 4L8DA 4HJJL 2WIIA 5KSBF 4M43H 4RGMB 5IV2A 1U8PA 5INDB 3OAYK 4TUKH 4A6YH 4MXQA 3AU1B 3HZVB 4MJIE 1JZ5A 4HLZG 3D9AL 1AY1L 3GI8L 1AO7B 1N6UA 4AMKH 3S34L 5CD3B 4M61A 4ZFGH 3D39E 4L8CA 5JNYA 2GTWB 4GBXD 5CGTA 4NQEE 5EH1A 3ELAT 4XZUB 1BPVA 1G9NH 4NHCL 1OCWL 4D2NA 5ITFB 3RU8L 4LSSL 2XWJB 4L29A 5ICZA 2SEBB 3I2CL 1U91B 4MAUH 1HHJB 4LKXA 1RZJC 3SE4A 5CJOH 3MROB 2RQ8A 4M6NL 4AMKL 4JHAL 5E1AA 3LRHA 5FYLL 1RK0A 1BQHA 5IHZB 5EC1A 5I1KH 1I9IL 2QJDA 4GS7B 3L5IA 5JW3H 1CBVH 1XGYH 4YK4B 4ORGA 4Y4KA 4WI7A 4I48A 1ZKAA 5E2WH 3BH9A 5KSBE 4HUMB 2FHFA 1C5DB 3ULVC 3BP5A 4IRSB 3UTPE 1R24B 1NQBA 3HMXA 3QULA 2EH7H 5IGXL 3I75B 2ATKB 3G6AA 5DSCB 1GIGL 4TPRL 1UJTA 1DEEA 4FQPA 3MNWA 1ZAGA 4O9HH 4NZUH 3V0AC 5DJ2B 1I8LC 3RI5K 4YDIL 4ETQA 4KH2A 3ABZA 3EO1B 3RDTC 3VWKA 3FB6A 3TFKC 1OAUL 2DLTA 3HI1B 1YNLL 2Z91A 4ODSL 4ONHA 5EZLA 3BRGC 3WUZA 2VZSA 2NY3B 5H35A 3PF2A 1J1OH 3O2DA 5F7NC 4AEIL 5FYLH 4LDEB 5EC1B 4GRLB 1IGYB 2FX7L 3GUTA 3OKOA 3SGJA 4HG4J 4LPTA 3SKUD 4NNXB 3TZVB 43CAB 2EDBA 3FHAA 3MROA 3N0PB 3MJ9H 4FOMA 4OBRA 3TBVB 4Y4HA 1BWWA 5DMGC 3N9GH 4OCXL 1UXWA 5D4QA 1JGEB 1U3JA 5IOPB 2WBJC 4AEIH 3T0VA 5ENWA 4KAQH 4KDWA 5D1ZD 2CLVB 1LE5B 1DUZB 5BS0D 2BVUA 1JYNA 4XCEB 1MFBL 1P7KB 1S7RB 4K8RL 3SDXB 2X4RB 5F9WC 3AAZA 1U93B 4TVPH 3ZYOA 4PY8I 3DV4B 3SQOL 5J1SC 4NRXB 2WIIB 3CZJA 4MXWL 4ELKB 2PW1B 1YY9C 1S78D 1YNLH 1ZHLA 4P3WA 3MBEC 1B90A 1VFBA 2BNQB 5HPMA 1YC7A 3U7YL 1QO3B 4PP2B 2IPTL 3SDAC 3LPWA 5KS9B 2G9HB 4KGJA 5EZOL 1RFDH 3QQ3A 5IR1A 4IS6A 5DTFB 4FQJL 4PJXF 4CGTA 1DL7L 3LPGA 1WZ1L 1CDYA 2YMXH 3DROA 3J7HA 1MNUL 4L9DA 3BVNB 1NBVL 3IGAB 2VKWA 4U1GC 3GI8H 3KPOB 2BP3A 5DJ8B 4ZDHA 2ILLA 2DBLH 5L88H 1EMTH 3WE6A 3ARPA 1U8KA 2QSCL 4KMTH 2EDQA 5D7SH 3RBSA 4HD9A 5IM7A 4PY8J 2DL2A 1XMWA 3K4ZA 4G43B 5T33L 1DN0B 4HFWB 5C3LD 1I4FA 1AJ7L 3TF7C 4RFOH 3VFWA 1MQKL 1QRNB 3IDGB 3BHBA 1PX4A 1Q0YL 2G5BA 2JCCF 5GJSH 5F88B 4LGRB 3OR7A 5AD0A 3HE7D 1QQDB 4OGZA 1TVBB 5D7KE 3H3PL 3JUZA 4MA7L 4OAWB 1BD2E 5L7XH 2D2OA 5SWSA 3EO9L 5F96L 1E28B 1HHGA 3RHWF 2D4DA 1MOEA 1Y18B 4AYFA 2YRZA 1X5IA 5D6CB 1N6QL 3BKML 4X6CB 2XY1A 3MBXL 3P0YH 2DDQL 4G8GB 2Z0BA 1NCBL 3VGDA 3O2WH 5TDNA 3I6LD 4DVRL 2DKMA 5ACZB 4EZMA 3JWNC 4PJ7F 5CEZD 3LEYL 2VUYA 2CDFA 1YNTA 4GUPA 4F2MB 2LVCA 4P2QD 1L6ZA 1S5HA 3CDGB 3P77A 3FRPA 4JRYB 2VISA 1NANI 3JTTA 5GGUB 4HT1H 3QEGL 1X5KA 3S37H 1ZEAL 5DHVA 3GJFB 1GC1H 4M8QB 1HWHB 1MVUB 4PJFF 3VFTB 3TBSA 3VMNA 4WRLA 1JYVA 3FAXA 1IGCL 5ECJE 4Z7UB 4N1CA 4C56D 5IVNA 4UT7L 5B3NA 3OR6B 2ZUSA 3QUZB 2FIKA 3BWUC 3HLAB 2W1NA 3E6FB 4FFEX 1CFBA 3ARBA 2F54E 3TO4B 4D9RE 4TULL 4U1JA 3ZL4L 3BQUC 4ZO6A 5IK3A 1A21A 4X8JB 3H7LA 3M1BA 5IMKA 3O2WL 3UTOA 25C8H 5LVEA 3OZ9L 4IRSC 3CFBA 1T6WA 1X6LA 4FTVD 2V7NB 1RZJL 2Q76A 4D94A 3S3PA 4NWTH 5BW7C 3C09B 4AJ0A 5JZ7C 3FO9B 4JN1L 3TO2A 3N06B 4GRWB 2DN7A 3EHBD 1D5MA 4HIEB 3KPLA 1WISA 3BDBA 4KJPC 5IBLD 1FGNH 1CLYH 3HNSL 1NGXA 3HZKB 1NGWA 4NO0A 4XAKD 5DC0A 1SJXA 2WY3A 4EN3A 3RWEA 3MBED 3EOAA 5KN5B 1CU4L 3GK8H 4A6YB 5DMKB 4KTEL 1RURH 3VI3E 4NO2A 1A22B 1T3FA 3JTSA 1J1XL 2NY4C 2R0ZL 2X4NB 3ZLQC 4AG4H 1CFVL 2Q87A 1KPVB 5JPMB 4QY8A 5ENWB 2CK0H 2DQJL 5E94B 3BJLA 2OL3L 1FVEA 2N4IA 4W6YB 4H5SB 1AR1C 5LWYL 3FO0H 1TQCC 4YEFA 5L2KA 2WBJB 3VXUD 1F8TH 3L3JA 1RV6X 3VXMB 4P2RE 1AGCA 4CN6A 3KLAA 5DMGD 4X8JA 5IFJA 1A0QH 5IEKB 3NZ8A 1TTGA 3WHXA 3L1OH 3QDJA 5IFJB 1IARB 1LO0L 5MEND 3E6FA 1Y0LB 3S3JA 4WHYG 1IL1B 3QUKB 4WWKD 3PNWA 5GGRA 2A38A 4BH8B 2VDLL 1DCLA 3UO1H 5DS8B 5F9JB 4CL7A 4POYA 4RDQF 3UBXA 2WK2A 3EO1A 5F1OB 4NQTA 4NQDE 4IMLA 3PL6D 4PJCB 1NGZB 1J18A 4MB3A 2R8SH 5KVEL 1EBPA 3KHOA 5DJ2A 4XP4H 3OB0K 5DEGB 3RFZC 3KPMA 1ZA6A 2RCSL 2GITB 3D9AH 4QT5A 2XN9E 4LMQI 1A14H 2XOTA 3EYSL 5IJVA 2NW2B 3FFCD 2ATPB 2UYLA 4PB0L 3ZE2E 4LQFH 4TUJB 4MGXA 3AVEA 2R15A 4H0HB 1IC4H 3O3DA 4FTVE 3RWEB 1XR8A 2MQ0A 4OZGF 3BWAA 2DQDH 1BD2A 2FJHA 1WJ3A 3QDHA 1RIUL 4JKPL 5FUOH 1CLCA 1ED3A 4XPTH 2BSRA 2NY5L 3MLRL 5K9QG 5AZ2H 3FRUB 2QR0A 5I19L 5B21A 4KV5F 3RX8A 1M71A 5FYLE 5K9OA 4PRAA 1E4WH 1U36A 1A3QA 2WV3A 4GH7B 1F00I 2DJSA 2X9YA 2WIMA 3WS3A 4U1KB 2FEDD 4WJ5B 2A74B 3RGVB 4DVBB 3BZ4B 1U8QB 3RNKA 4U05A 5AD0B 2IGFH 2M2DA 4X7FC 2Z31B 5JNYB 1FFRA 5DFWH 4LCWD 5IMMB 1TVHB 1BLNA 4OUUA 3FOMB 4QRQB 1WC7B 2HRPH 5KAQG 1J0HA 2YPVL 5E03A 3DECA 3AY4C 1JFQL 2NY0C 2W60B 4Z7VB 1DQQB 1U8JB 4JFPA 3PG2A 3UYRH 2BJML 3S36L 4QGYA 5F44A 5T1LA 2ESVA 3FT3A 1YEEH 1U92A 3LDBB 3QHZL 1DLFH 2BSED 2IFFL 1CFQB 4YBLB 2W0LA 4OV5B 3WD5L 1CU4H 1WZMA 2Y6SD 4G8GE 1DBBH 3JTTB 2J5LB 1JI2A 2ZCKL 2ZUWA 2AERT 1E6JL 1OARH 5F21B 1SM3L 1H8SA 5TDPB 2ZG2A 2PETA 4X7SL 3TJHD 3H9SA 1JZ2A 1AQKL 4QNPF 4F80A 1MFEH 2FGWH 5DVLA 3QUMH 5F1NB 3N9GL 3TIEB 2PR4H 3G08B 5T3ZE 4Y4FB 3WN5C 1J1PL 3F5WB 1MEXL 2HKHL 4Y8AA 3VJ6B 3F5WA 2XN9D 1S7QA 3LKNB 2H8PB 1G7HB 4RDQG 1TQBC 5CSZA 1R5VA 1FLRL 1TVHA 4RMTA 1I1AA 1E6OH 3T0EA 1TVBA 4RQQA 5IB1B 2F54B 3FZUC 2AJXL 5EU5B 2WBKA 3ALWA 4I3GA 1XT5A 1YPZB 2WSKA 2ZUQC 1GGBH 3CUPB 4ZSOE 2D0GA 5E2WL 3OF6D 3HCVB 2GSIB 4BZ2H 4UNVA 1X5AA 2YKLL 3ULVE 1B4JL 1DL7H 5B4MC 3AROA 4PJ7B 5GRJL 1UH2A 1GIGH 4DUWA 1RU9L 3MZGB 4X99B 2BDNH 3MA7B 2VRAA 1BREA 2R29L 2BRRL 5T5NG 5TE7H 1Q9OB 5IFHH 2GY7B 4HS3B 3DURB 2V17L 3MRCA 2J6EL 1EJ6A 5DZLA 2I24N 2DOCA 2F53A 3KPRD 3SGDI 1TJIH 2XTJB 3I3EA 2HT2D 2D7TH 1G7LA 1JCKA 1MCJA 2AQ2A 1CDGA 1LNUB 1S7WB 4LIQL 4U6YB 3V0WH 2M26A 3ULVL 3O6FC 4PJHB 4KHXH 2P5WE 1EEYA 2VITA 2V17H 4ZUTB 1UC6A 1AQDA 3MJ9L 1J8HA 4DZ8A 4H25B 2AXGB 2CXKA 5DS8A 5F9JA 4PG9A 1P5UA 1I7RB 3LY6A 1AKJA 1FCGA 1D9KB 5IG7B 5GGRY 3UTSD 4B5EA 2VH5H 1PW3A 5IFAH 1KCGC 1YECL 3OKLB 3QDJB 4Y4KD 4XB7A 1FNFA 2LQRA 2BSTA 3C5SA 2VR9A 3MCKA 1W72B 4Q9QL 3LKQA 4XCCL 4K8RH 3MCLL 2FSEA 3RWDB 4EI5A 5EBGA 1NEZB 4MJIA 1SMOA 2WBJA 2H32H 2D9CA 1T0PB 1LWRA 4H20L 4N0UA 4N8VG 3TPUB 5GGVY 3TN0D 3BUYB 1FYTE 1SJEA 5T3ZL 2E7BA 3G6JA 4G8GD 5IB5B 4XRCA 5DEGA 3I6KA 4G8IB 3D1MC 2NR6D 4KVNL 3T2NL 3QHTC 3WFHA 3GSRB 2X4NA 3NIFE 1AP2A 1H5BB 1AIFB 4PJCE 5INCB 5EWIH 1U8PB 4U1HA 4WU5B 3D2UD 4JDTH 3FTGA 2HJFB 5MEOB 2ZOKB 5IHBA 2OTWB 1WZKA 1P2CA 5C08E 4X98A 5BXFB 4NWUH 3I3DA 3V4UH 3MMEB 3DLQR 4LCUB 3QUML 2O5ZL 1AC6A 2D03H 2ENYA 3DHJA 1K8DA 1FZJB 3OKLA 2MKWA 4F7TA 1K4DA 4HUUB 3SDDD 1OT1A 5I15H 5D1XD 5AYUH 1JPTL 3O2DL 2ZUVA 4HJGB 1FNHA 3TO2B 2J6EA 4UNUA 3X13A 3EAKA 5IMLB 1X5ZA 4KJPD 4MDIA 3FO1A 4K55A 1A1MA 1RUAH 4LHJB 1DSFL 1WAAF 1U95A 1C12B 1FVCB 2XIDA 1L0QA 1N2RA 1OPGH 3T1FA 1VEPA 3WSQH 2DQGL 1RURL 3QCVL 3L95B 3MJGX 4JFFD 5HGHA 4CVZB 2R9HD 1DQDL 3ZKNC 1ITCA 5GHWL 1DSFH 2FJGB 3FTGB 4HPYH 1JFMA 1HHJA 4LKXB 5GRJH 3GMPA 3VXOA 4FMFA 3F8UB 3HN3A 3RVWC 2VDNH 1A1OA 4APQB 1HYSC 3GSQB 1F3DH 3HAEG 2BXZA 2CRYA 2OP4H 5I8EA 5FO7A 4DW2H 4FQJH 2A6IB 1FC1A 1JP5A 2CGRH 4MS8A 1TZIB 3FN3A 4KUZH 5CBEB 1HEZB 1T7WA 2R1YB 3MGOB 2CLRA 1REIA 1ZLUH 2PYEA 5HYJB 1JN6B 2QADD 1FIGH 5L2JA 2AK4D 4EUPB 5HHOE 1L7IH 2P8LB 4KMTL 3JV4B 3RDTA 2NXZC 2D7MA 1KXQE 4MAYB 4LRNL 1EHNA 4GBXB 5FA4B 1KIRA 4U0RC 5J06A 5TFSH 4HPYL 4Z76A 2ZUXA 3LV3A 1X5FA 3U9PL 4NZDA 2DRUA 3EFDL 4CDHA 3LIZL 1DQJA 2OJEB 4KDTA 1RZKH 2AEQL 3KLHD 4BZ1L 1YEJL 3VXPA 4ISVA 4E42B 4PJ8C 3QPQC 3FOLA 2NY5H 4YX2H 2DAVA 2GY5A 2W9EH 4RSVA 1I4FB 4M1DL 4CVXA 4Y5XA 4R90H 5FKPB 1AH1A 4R7NB 1NFDB 3IF1A 3NTCH 4HZAA 3QNYB 3GMQA 3FT3B 1PG7L 4MXQD 3E0GA 4PB0H 2PYEB 1Q94A 1JPSH 4U1IA 1MSPA 2O93L 4XNQA 3P11L 5CEZH 3WFCH 1QACA 5DFVD 2GJ6A 2YRPA 3LN9A 2XZQL 1UWEH 1GGIL 5DJ8A 5JIKA 2VQTA 3LH2L 4LRNH 3VFOB 1FO0A 1QR1A 2CJUH 5D7LA 2L7UA 3BW9A 1AGFA 1T7ZA 4GMTH 3T77B 4ZS6C 3L7EA 4AZ8A 1PZUB 1EZVY 2AJZA 2EIZA 4JPIB 5C0RL 1I1AD 3T0ED 3ULUC 5CBEA 3S37L 1AO7E 3D3VA 3LEXA 3O6FB 4RNRA 2FCBA 2GJZB 3OXSA 4AL8L 4CBPA 4XBEH 3THMH 4P23B 1FIEA 3BDXA 1IGCH 1ZLWH 4H26B 3VXUB 5I1EH 1SY6H 5BRZA 2BY2A 4Y5YC 2EIBA 3PWVA 2LTQB 4OCRH 3D39D 2V7HB 4FQLH 1ADQH 1F4WH 2OJZL 1KN4H 2XXMB 4TVPE 4LLQA 4PR5A 4P2QB 4PV9A 2OX5A 4LSRH 5JHDA 4PGCB 1FNGA 2M1KA 5LGHL 3GBNL 3GKWH 1EIBA 5A2FA 3MRGB 2APXA 3QB7C 4C56A 4E0RA 5I2IB 2Y5EA 3TBVA 5I1IL 4NM4H 3CX5K 4JHWH 2VL5B 2IANB 3MRRB 2HLAB 5JXEA 3FB7A 3BZFA 1EVUA 4L3AA 5C2BH 1FVDB 1TETL 3CDCA 1KTLB 3LN5B 4Z7WA 4EN3D 3BQUB 1UJ3B 2OTUA 5DD3L 2H2SD 4KTDH 4X6EA 1FGNL 4W81A 5I1LB 4W6XB 2ED7A 5I1LA 2DM4A 4KVCH 1UB5A 3ARGB 1I3RB 3GHBL 2LVEA 4M93B 3QCTH 1CDJA 4HDIA 1I3RA 1RZJH 1DBAL 1S7XA 4PG2A 1KLGA 1RVFL 2ZCHL 2G60H 5EUOB 1CDCA 3VWJB 4LRIC 1ND0B 1U3HA 3G6JE 4X7CC 5FYKU 5I74C 5IVXE 4S10A 1BEYL 1ZVHA 4KI5C 4MA1C 4QOKD 2OTPA 2X1WL 2NCMA 3PGCB 5T1KB 1JYWA 1IBGL 5EBLA 1CE1H 1RJZB 3E8UL 1XR9B 3S4SG 1ED3B 2DKUA 2H45A 2CPCA 1FNGB 2AK4A 3JXAA 4RIRB 3M8OH 2NXYC 3MV11 2H2PD 1I1FB 3EDDA 3O3DB 3TA3C 4U1MA 1OT2A 3TNMA 4N5EC 5C08A 3ARBC 1MJ7H 4Q9RL 2HVKB 3TESA 3ZKSD 2X7LB 5CILH 4OI7A 4KJQC 5BS0E 4POZC 4M00A 2AVGA 3ARDA 4Y1AA 2ZCHH 4WUKH 5CD3A 4OD2A 4U1NB 2DLHA 1ZGLP 4KZEH 4LSTH 3L3OB 4ZUWA 3BPNB 4U1LB 4YHYC 4DKFL 3EJZD 3PIQA 1HYRC 4HK0A 1CN4A 4HKBA 1CBVL 3P2TA 1A5FL 2HT4D 5GGVH 1ZLVK 1AQKH 2W92A 4P57B 1CGVA 2EH8H 1M6OB 1VEOA 3GMOB 3JBG7 1RJLA 4JG1L 1A2YB 3IFNH 4Y2DA 4XPTL 4EDWH 3SGEI 3HE7A 2PCPA 1A7RL 2E8ZA 1QFPA 1UWXK 3QZWG 3C5ZC 3BN9D 1INQA 3UROR 1Y6NR 3B83A 1Q9KB 3VFRA 2APBA 4LLQB 4KV5E 2CD0A 3MV8D 3U0PB 2X4UB 1YEHH 2VNCA 3ETBF 4F7MA 4QXGL 3E2HA 2Z93A 5FYKL 1I8LA 1R5VB 1S78C 2HRLA 3U83A 5CZKA 4WW1A 5IV2B 2DICA 3VWKC 4PJBA 5I15L 3TFKA 4CNIB 2Y1VA 2CO6B 5AAMA 1YNKL 2BCKA 2DLGA 3ZE2F 1PYWA 3V5DB 3LV3B 4E5XA 3FONB 1BIHA 4OTXH 4HWNA 3MV7A 5BS0B 1FZMA 3AREC 3WJJA 3BPLB 3NA9L 3QRGL 4IDJL 4O2CA 3IFNL 1F4XL 1NCWH 1IC5L 4EOWH 5CFHA 5AYQA 2DQHL 1NMBH 2GUOB 3IJSB 4NYLA 1FZKA 1ADQA 5A40E 1AI1L 4NC0B 2CLRB 2IH3B 2NY0B 5L2KD 3HRZB 3LHPH 3MR9B 3ZTNH 4YBQC 5ID1A 1DBML 4JGJA 4X6CE 4ZUUB 4M62H 1RIHL 4GAJL 5FO7B 4ZUSA 3DGGA 2WNGA 1I7TA 3GMMB 1L0XA 1BM3L 1VGKA 2C3XA 1R3KB 4YJZL 3OKDB 3SOBL 1NBZA 3TM6A 4NQEA 4P4KC 1IGIL 1F3DJ 3ZTNL 5HHXL 3ZSSA 5GJTL 1B2WL 4G9FD 2Z31A 1JPGA 3RVWD 3STLB 5TE4L 1GSMA 1PY4A 1JHTB 5D7JA 4L4TE 2WUCL 2AJ3B 4JGUA 5EU7E 1J0ZA 4FZ8H 1QBML 4GLRH 4YHOH 2YSSB 4F57H 3RWHB 5E9DE 2GI7A 4KRLB 1LDPL 5DXWA 1NLDH 3KYMB 5J89A 5ESVA 5T3ZH 2FECL 1FZMB 1XF5B 1ZHKB 1MI5A 1JNJA 5CLWA 2HWZH 3IDNB 4PYHA 5ICXB 1W0VB 1RK1A 1RZGA 5CMAB 2B1AH 5JR1L 3V4VL 4DQOL 1MCHA 3C6SB 5DQJB 1LK3L 4MQTB 1VPOL 5INCA 3CK0H 4LCYB 2W9EL 3UBXG 2HFEA 1F6AA 1LE5A 4HGMA 1MCRA 5E2VL 1G1CA 3U0PA 2D7TL 3HE6A 3DYOA 1KOAA 5DK2B 1AIFA 1AP2B 5H2BB 5DK2A 2W0KA 1KPUA 4MB5A 4XC3H 3HG1B 3UPRB 4XNUL 3QUMB 5IVOA 3SCMC 1KB5L 4G7VL 5IFHL 3EYQD 2XTJC 4UV7H 1V7ML 4KK6D 5E2VH 3BGFC 3LOWA 4D0BB 1JRHL 2NXYB 1PKQA 5HHMD 3LPFA 1K4CB 4NZTL 3WIIH 5CD5C 2Z91B 5I9QB 1UYWL 1YNKH 4LGPB 4LIQH 3WXWH 5DHXB 4QRSB 3L3HB 5GSVB 3TYGH 5C09B 2IANA 3MV9E 3A0OA 1D9KA 2XPGA 5IG7A 3UAJC 3IFLH 4KK9C 2NTFA 3QO1B 2XQYK 2R2CA 5CEYB 4C59B 3OXRA 4PRBB 3MRKB 1IEBB 5KVMC 1X5JA 1NMBL 4LCCC 5JHDB 4DAGH 2FO4A 1P84J 3OX8B 4TNVK 4NZRL 1HQ4A 1VCAA 1BIIB 5JO5A 4NZUL 5JDSA 1WTGT 2LAGB 1GL4B 1ZLWK 4UIMB 4ZTOH 4L4TD 4HUVB 3GSNH 2IALB 3ZKMC 3MYZA 3SDCA 5EBLB 3QH3B 1OY3B 1OD9A 3P4NA 2BOBA 2EZ0D 4PREB 3L3GA 4DZBB 1HSBA 4G42A 1CFNB 4HWBL 1KTKE 4UUJB 4YEEA 4CVWA 5BW7A 1F3JA 1MWAH 3W9DA 3KYNB 3GJEA 2NZ9C 3V8CA 1L8JA 3SQOH 1EEZA 5T5FL 3MLZL 4YXLH 2EC9U 4KXZH 5F89A 4UI2A 1CGUA 5JQHC 4GW4B 4WO4D 5GIRB 4I0KA 2HN7B 3QCVH 3IRZA 1KCUH 4JHWL 4XH2A 4D9QE 4GG8B 4OGXL 4YQXH 4AIXA 5C2BL 1H3TA 2MFNA 2BOCB 4RFNB 4OM0L 4HK3J 4BJLA 5BV7B 3CFDA 5LCVL 5BOPA 3QWRD 5L6YH 3TBSB 3MPCA 4PJ8A 5D1XB 4HAFA 1CLZL 2EC8A 4X9IA 2R69H 5B8CB 1MIMH 5JDJA 4P46A 5EIQA 5GZOD 5EZJB 5EFIB 1U3HD 4ZMAT 2AJUL 2YUVA 4JPWL 5SWZE 4OFVA 5I8KH 4OBSA 5DK0A 1KJVB 1NDGB 4JLRB 4XAWH 2Q3AA 3DPBA 2NY7H 3G5VA 2F53E 4HQQH 3CC5A 1NUFA 1T4KB 3RAJL 1MNUH 3FQRB 2NNAB 3DVIA 1ZK9A 4G59A 4Q6IA 1FAIL 3FT2A 4WFHD 1T03H 5ACZA 2JCCB 4XWOC 5D6CA 3PHQB 4OQTH 4JZNA 3WIHL 4XAWL 5FUOL 3IU4L 4P5MB 1QRND 1CFSB 4G6JL 4PP1D 4QRQA 3PWJA 2EDTA 1FFNB 4KZDH 1KB9J 1M1SA 1QVOB 4TSBH 3WFEH 5CGMA 2J88L 3DETC 3RVUD 3D3VB 1A7OH 1F2QA 5KSAD 2W0PA 4GG8A 3MBXH 3P0YL 2YPLE 1H15B 2LFGA 3FOMA 4PTTB 4ZPTA 5D7LB 4X9HA 3ZKQD 3TYGL 2DYPB 3BN9C 4Z18A 1S9WA 1QNZH 1P7HL 1KLUB 5F1SA 5A16B 3EKCA 2DQDL 2ZPKH 3BH8A 1RIUH 2ADJB 1HHIA 4H1LH 3H3PH 3CLEH 3QI9C 4QCIA 2HJKA 1JWUA 4R90L 1HNGA 3P9MA 4GAYB 4R96B 3KPRA 3HI5L 4WHTB 1KJMB 4FA8A 3VI4F 4Y88A 4B7IA 3MLYH 4BSWA 2FLRT 4F9LC 4LSUL 1AD9A 1WBZA 1PSKH 3EYVB 1QPXA 2YBRA 2DM2A 5MP6L 1QUNA 2C4XA 1YEEL 1T4KA 3IU4H 2IGFL 4L9LB 5EFIA 3HFML 4NSKA 5GS0L 3SDAD 3KPNA 1C5BL 3UTSA 1QSFB 2X05A 1E4XI 1KJVA 1NDGA 2ZWLT 4AEHL 4M1GH 4LASH 1GOFA 4D0CA 3LKPA 2OSLB 2HT3D 5D2LE 4G5ZH 4XBEL 1IAII 4G6FD 4XHQA 32C2B 1C7TA 2DI8A 4HKZA 4R2GC 4YHYB 1DE4B 5JUEH 1QKZH 2AI0L 3JV4A 5GSVA 1MI5D 4Y5VC 1MFDH 4XVJH 4Z8FH 2CJUL 3UP1A 1TTUA 4QHKI 1JV5B 1BOYA 5TGBA 1TCMA 3ZHKA 1HILB 4UT9H 3U6RA 4K8RD 1QHPA 1FH5L 1JGDA 3RI5F 1E6OL 3MNZA 3HB3C 2OMBA 5FGCB 2IBGA 2E7HA 4XRCB 3G6JB 3MUHL 5L0QB 4KDTC 1IGYA 5D1QD 4C57C 3AS0A 3GK8L 1BGXL 5C9JB 4P23D 1CVSC 1NC4A 1ZVSB 2HMID 4HUVA 4YLQT 4HPOL 4LCWB 4JR9H 1FVEB 4UOW1 3NACL 5K59E 1F4YL 4KKBC 1WIOA 5AG8A 2VXTH 1T89C 4HXAH 3ESVF 3VXNA 1BIIA 3FB6B 4MLSA 2IQ9L 5EOQL 5CJQH 3GMNA 1T66C 2Y06H 4PP8C 3VI3F 4ODUA 3SE9H 1FFOA 5ADOH 5J6HA 3P73A 4P49A 4PRBA 4DZ8B 5GXBB 2Q86A 4NDMA 2MCPH 1BFVL 3QJFB 2WINA 3QPXL 2OR7A 4WWID 3X3GH 3QEHB 3WIHH 3STBA 3FQNB 3CPLA 3AB0B 1YYML 4GAGL 4N0YL 3UBXB 4ZAKD 1ZHKA 3RTQC 2YD2A 4HWUA 4ALAH 1U8MB 1OL0A 1TJGL 5DEZA 4FFYL 1CFVH 4MD0B 4AENA 5C6PB 3ARGC 3UC0L 4L4VA 3UO1L 1GZQA 4AH2B 3QP3A 3T77A 3JTCA 1JNLH 3MRHB 2XTLA 1FL6A 3HE7C 1T5WB 1RMFL 4K3JH 5F7UA 4F58H 4K9EL 3VFVB 1NLDL 4IHOA 1H3VA 2IQAB 3DARA 4FQ1H 4EBQL 4RISH 2XA8H 1N3NB 1AXSB 4TNVF 4NN6B 1WBZB 3EYVA 3P9MB 4R96A 1BQHB 1VFMA 4RMWA 3HNTH 4OD3H 3K46A 1FHGA 2Y06L 4MCYB 1LP9F 1CXEA 4ONFH 1A6TB 1EFXA 3QUZA 1I9IH 3HG1A 3MLYL 2X9WA 4JFOA 4QXUH 2AV1A 1LP9E 4JKWA 4GQ9H 3QZWA 5HI4D 2VLLA 4YFEA 3LMJL 3DO7B 4LKCA 3RIFF 3U2SB 4WEMB 4X4YA 3ZKMD 5CJ5A 1NGPL 4MS8D 3W9EA 1MAML 2LU3A 5C0AB 5FF6B 4GKZA 3HA0A 4UV4L 3RBGA 3PXHA 2AS5M 3RX7A 3NIDF 3LKNA 3VRIB 3CDGA 3P77B 4BFIB 1W72H 5D1ZA 1D5MB 3RWCA 4MAYA 4O2CB 4Z7NF 1P4LA 3EIFA 3SJVD 4N8CL 3X11A 1CD9B 5BRZE 1YC8A 4MVBD 3RWJB 3GIVA 1FFPB 3O3EB 4UU9A 2XNAB 3VXMD 5H37G 5B39A 3QPQD 3HUJB 1JPST 3WHE0 3QCUH 5F6IC 2Y23A 1A6WH 2AK4E 1CGYA 1FNLA 2AAVA 3QAZC 2DD8H 4E42A 3CFEA 1GAFH 4OV5A 1L4IA 2NY1B 5C86A 1F2XK 1JHTA 3H8NA 1MRFL 2ESVB 1EFXB 2DMKA 1P6FA 4XXCA 4GKSB 4MA8H 5FDYA 1A9EA 5J8OA 3OGCA 5FHBL 1DQLL 3ZDXE 4ZNCD 1GYAA 4K2UL 1QLRB 8FABA 3VH8B 4LU5L 3BXNB 4YGAB 4TN9A 3VXQA 3PJSB 4DK6A 1I3GH 3QXDA 5C0CB 4BKLB 5F7FA 1XZ0A 4LOUD 4JRYA 1SYSB 3IGAA 4XXDA 5IB2A 3BE1H 1N6VA 1JHKH 1UZ6E 3BSZH 2EIZB 2XQYG 5SX4I 1J1PH 4NOBA 4UB0L 3WSQL 1W8OA 5EU5A 4FXKB 4R3SB 3N1FC 1R3HA 1U95B 2EE3A 3MODL 5ILTH 5F8RC 5BQ7A 3MOAL 3HNVL 1MWAB 1RULH 2GSGA 2VLRD 3VFUB 4J2XA 1HKFA 5F1IA 3I50H 3BD5A 1BFOB 2QHLA 3V4PL 3QDMA 3MLZH 3VWJD 4YXLL 3CU7A 1OAUH 3ARZA 1T0NB 4PJHF 3C5JA 3T8XA 3MRBB 4JFFB 4OI8A 3AAZB 2DQHH 3K7UA 1YUHB 3DRQB 3MODH 5ILTL 5E8PA 5CJ8A 3I02A 1N8ZB 1SHMA 5T1KD 2FNBA 2LE9A 4XPHH 2I9TA 4H88H 3A6BL 5HDOA 3WFHB 1IEAB 1I3GL 3BT2L 3QO0B 3O8XC 4URTB 1IRAY 1JTPA 4RGNE 3KYOA 2JJTC 2VXSH 2AEQH 1NGZA 3BEWA 4ENED 2EYRB 1U2CA 5I8KL 3CZFA 1S7UA 1UEMA 5F93C 2O26U 5DJAA 2MOVA 1EERB 3PL6C 5BVPH 3MOBL 2X4PB 4U33A 3BT2H 1J0JA 3B2VL 3NCBB 3IFPA 4UZGA 2BDNL 4U1NA 3VU2A 1T03L 1NCAH 2IWGA 3HC3H 1N4XH 3SE8H 3W2DH 1G7JA 1P1ZA 4AENB 4IS6B 2RHEA 1J8HB 3WJJC 2E7LE 2Y5TB 1RJYB 5B8CC 5DFVC 4HS6B 3RTQB 5CEZE 3GSRA 2EXWD 3ES6A 4XPHL 2X1OA 1A64A 3DX9A 1R24A 3SDCB 4OLXH 5IB5A 4BYHA 3PWNA 2ADFH 4NRZB 3MXVL 4Y4KB 4HUNB 4LNVA 3P11H 4FS0A 5HVHB 2EXYD 2NY4D 5HY9B 1IGTB 5KSAA 4QRRE 1AXTL 1I1FA 4P2QA 1YUHA 3DRQA 4PR5B 4PV9B 5DLMH 6FABH 4LCWA 5DR5H 1NGYB 2YEZB 4XHJD 4JPVL 4PV8A 4P5KA 3VFGL 1K5NB 4JDVA 2V2XB 1AHWC 1BZ7B 3MRNA 3VRLE 3RWHA 1I7ZB 5EIIA 4HHAA 3X13B 1D5BA 5DD6B 1U3ZA 3RL2B 1MREL 5GRXG 4LFHG 4OLYH 5FM5O 1BF2A 3RGHA 2R0KL 3PDOB 2AJSL 2EEAA 1OOAA 1G7JB 1P1ZB 1BVKB 4DJMA 2YSSA 3L5WB 3QISA 4WFED 1Z9LA 4Z0XB 3Q1SH 4PRHD 4Z7WF 4G5ZL 2CK0L 1MF2H 4TVPL 4O2FA 4GS7C 5EO0B 5T1LD 1D5ZA 3B6SB 3FB5B 2EDLA 2UWEA 4YK4C 5GGTA 1AGBB 4H8WC 4PRDB 4NWUL 5I18H 2FJFB 1FG9C 3BUTA 3U7YH 1MCFA 1HH6A 5TQ0H 2EYSB 3FB7B 1LO5B 3QEUA 1P9MC 4PGCA 5I0ZA 1VEMA 4M8QA 4JFYA 1BHGA 1LEKA 3GMMA 1CIDA 1MY5A 2X42A 5FEBA 1T83C 5JPMA 1BF8A 5JXEC 3PWLA 1EUUA 3HE6C 4YDLB 1R3IL 3PWPB 4P5TB 3SE9L 4B41A 1KCSL 3JUYA 2GKIA 5IHZA 5D7IA 4XPAH 1HKLH 4OLUL 5DUML 2VDKH 3OG4B 2MJWA 2CKNA 1IAOA 3O3EA 3B9KC 3SKNA 4P2OB 3O41A 4P3DA 2QKIA 4HPOH 4X5XB 3LVEA 2NY3C 1PY9A 5CGYC 1KBGH 5C0DA 2A73B 3FRPG 3IDXH 1FYTD 4ZPVB 4NC1E 5L8LB 12E8H 3EJJX 5TF1H 3HI6H 3EYFA 4PJHA 2UVEA 2UWEE 1Z0MA 5ETUA 2A6DB 2XZAL 3Q6FA 4ACPA 4NHUE 3WNKA 1CTOA 3IDIA 1D9KC 5CJBA 3DVGA 4EBQH 2FEEI 4ZG1A 4GXUN 5D7LE 1ZANH 1DUYB 4X7TA 4ZUVA 3EDFA 1RZIA 4QRRD 5F6HI 4FNLH 4HH9A 1BD2D 5C0FB 2X1PA 1NFDE 5GISL 5IHUL 1B3JA 2B1HH 1Q9KA 1WWAX 2CKBL 5D5MF 5B3JE 3FRUA 1OHQA 3SEPA 4M1CD 4JY6A 5IROA 4N5EA 4M3KB 5CP3H 3WNMA 3ARED 1H3PH 4F33B 1HSAB 5T3XL 1U8LB 4Y5XC 1CTNA 3KG5A 5IBTL 4PJGE 4RAUA 1KBGL 3RPIA 3VDCA 3ARDC 3BP6A 5FM5M 2AABH 5E4EC 3K74B 1PG7H 2VXVL 1D3CA 3PHOB 1VACB 3ALPA 1O0VA 4RQQB 2DBJA 2BHYA 3KXFB 3HUJA 1CE6B 2Z92B 1F3RB 3EYFB 3TVMC 5DUPH 1U8NB 5ANMB 2D9QB 4O51A 4NKMB 4M1DH 2OR9H 3DJ9A 3EJYC 1V05A 1G9ML 2CR6A 2VZ1A 4MA3A 2R39A 2I5YL 3QFJD 1AGEB 1I8IB 1XF4B 3MUGB 4NQED 4N0FB 1KXTB 1P69B 1JFQH 4QO1A 5GSRB 5EU6B 5C07B 4K7PL 4X9BA 4DTGL 4TRPH 4PJGA 3A6OA 1EO5A 2WQRA 3DX6A 3MLTB 3E2HC 5HBBA 2ICES 2HH0H 2ZZUT 1JGLL 4AEEA 3ARUA 1DQLH 2D7NA 1I9RL 4IBLT 5E94A 3GMLA 2AABL 3QWQB 2XQBH 3NFSL 1KLFA 4CN1A 5EU6E 4OZIF 1Q9WA 4F7PB 2YUZA 3PGFL 3QQ4B 5C0JB 2FL5A 4PLJD 2HTKD 1IGML 3UC0H 2F5BH 2ZNWA 4J7RA 1PKOA 2F58H 4XPBL 3SOBH 4M7JL 1R0AL 3LSOA 2IF7A 2NR6C 2R4RH 5KVDH 3MLRH 2JJWA 3IETB 4PJ8D 5EUOE 3D3VD 2X4SB 1BLNB 4U6HA 5IMMA 4J3XA 3ARGA 1T0MA 3FQWA 3J8F7 1EO7A 4UMGA 1DE4A 4LSPL 5EUOF 1NGQL 1VA9A 3LZFL 2CRZA 3UTZA 2DYPD 3NIGF 2NTFB 1ZTXL 1JZ6A 1IJ9A 5DJ0A 3NZHL 4TVSa 1RIHH 3CZFB 2CIIA 2ITDA 3U1SH 1KF9B 1UB6B 2UZIL 4PG2C 1P4BL 4W6WB 5DRWA 4ZYKA 4JFDD 4P2YA 2GFBA 5AUMB 2NY1C 5IWLA 3NACH 3R06B 4OB5L 5KW9H 2G60L 4MAUL 4ORGB 3H2WA 4IOFD 2HJFA 5HHXH 5MEOA 1CL7I 1BAFH 3S3SA 3QUZC 2V7HA 4UIMA 3QQ4A 2B0SL 5E5RB 2B1HL 4OF6A 1F02I 1M4KA 3O6FD 5GRVK 3I6GA 5BMFL 1DFBH 2M8XA 2WLZA 4S1SH 4Y16A 1MLCB 4NUJB 4ZUSB 1II4E 3KR3H 4HW6A 1S9YA 4KWUA 1Q9WB 1EXUA 5F7YC 5I76B 4JM2C 2ZCKH 4O58H 5TDOB 4PJGF 3U30C 3T0DA 3MRFA 4LVNC 4LSPH 3H3BC 2X4QA 1AO7A 3UZEA 4OLWH 1DVFB 4JPKH 2Y5TA 1NKRA 3FMGL 1R3HB 3CNKA 3QHFL 3SKOB 4ODHH 2OQJA 1NCAL 5D70H 3U6RB 4JPIA 2KL6A 4LEXL 1B4RA 5GQBA 4I0PD 3ZTJG 5JW4Q 3MCKB 1F90L 2X5PA 2E7MA 3G5XB 3MJ8A 1NMAH 1N59A 1UKTA 1I8IA 1U8NA 1XF4A 3MUGA 4JZNB 4NZTH 1NFDA 2NLJA 3HUJF 2PYFB 1F4HA 3TIDB 3RVVC 2PNDA 2F19H 5B38A 3EGSB 1Q94B 5A43C 4KU1A 5H2BA 1I3UA 3SPVA 1MCWM 2I9TB 1JNLL 1R5WA 3BP7A 3DURA 4DOHE 4MA7H 1R5WB 1JGUL 3SCMA 3SDXF 3VFRB 15C8H 1CQKA 3H9SB 4DKAA 1A7RH 3VFWB 5GZND 1KIQB 2C5DC 4XP5L 4JPVH 4XMKL 1NBYA 3T4AB 2JJUA 3X14B 4UDUA 3V5KA 1DEDA 4P23A 4QOKE 4K7PY 1C16B 4WY7H 1MWAA 3VFUA 4JREB 2B7DT 3V4PH 1ZHNB 5C8JB 3LEXB 1OTSD 2NY6C 3PQYD 1UM5H 1WCQA 1HHHB 2D03L 1H0DA 3KYKL 4O4YL 3L5JA 2F19L 3QEGH 3QXDB 1EGJH 1A3LH 3O45A 4UQ2A 2R0WL 3MRIA 3OKNB 3NA9H 4IDJH 2NX5D 3TVMB 1MHEB 3MUY1 4XCFH 4ZTPL 1JGVL 3O6KH 2H41A 1M7XA 2BNRE 5C7XL 4YE4H 4JFFE 4GKNB 4ZO7A 2X40A 1YEGH 2Z8SA 4HC1H 3BEVB 4WFEE 3QAZB 5JQ6L 1F6FB 2HG5B 2YN3A 5SV3A 5D2NC 4MSWA 2QKIB 1BJ8A 1CLZH 4GMSH 4HZLA 2H9GB 4L3ED 1MCNA 2A9ML 4GW5B 3KAAA 2R0LH 4LF3B 1Q0YH 3L7FA 3NPSC 2Z31C 1NFDF 4JO2H 4YQXL 1YNTB 1EUTA 5GPRA 5MEPA 1NDMA 1OSZA 5KVGL 3UJIH 3C5ZD 2UWEF 4KJYA 3L3HA 2O61A 1M7DA 3FO1B 2B4CL 5IMLA 4JO1L 1KB5B 3BKMH 4OUUB 3ARFA 4IMLB 4OF3A 3LB6C 2O5ZH 1A4KA 3PIQB 1NCBH 5L8KB 5C7XH 5EIVA 1VB9A 2J8UF 4MHHG 1IC1A 2FIRT 4LLUB 3D18A 4FQCL 1JJUA 2IC2A 3MX0A 4TSBL 2FB4L 5BOZG 3KGRA 4OZHF 2YA1A 3OAZH 4L5FH 3BZEA 1RZKC 1QRNA 2VL5A 2WUCH 1SJEB 5DJZA 1V8HA 2FZ3B 5C9JA 5E8NB 5J12B 3HE6B 1QLEH 5KVFL 1PJ9A 4N0UE 4G42B 2O5YL 3BGMB 1RZFH 1NPUA 4JHBA 4XBPB 4XP6L 5BVPL 4HUKB 3MGTA 4I2XA 2AP2A 5DMYA 2H1PL 3JWOC 5HHOB 3WUWA 1RQ5A 5ISZA 2Z35B 3GMRB 2WWKO 1TMCB 3MCLH 3BX7C 3AMKA 3DVFA 2O5YH 4XMLH 2XYCA 4WY7L 1LD9A 2R2EB 4JM2B 4NNPL 4N90D 3CH1B 4J3OC 4HF5L 3PUCA 2D0FA 4C55A 3CLEL 3FQWB 2W38A 4QTHA 5C6WH 4YHIA 3PDDA 2DS4A 4P9MH 4HWZA 3MREB 1CR9L 3BPLC 1PEWA 4NC1C 4QHLA 4M02A 3Q5YA 4WDIA 1KCSH 1QEWB 4I18A 3HR6A 3V6OC 1RZ8A 4F9LA 2C1PA 3MC0A 5DFTA 3HHRB 1G6RL 2JLLA 4I2XB 4U6VL 3RVXD 2AXFA 3ZE0F 5GGSA 4S2SB 2HTKC 4OCLC 3UX9B 2HT4C 2FEDC 4Y5XB 4Y4KC 3OR6A 1X5LA 5CZXD 5DJAB 4H8WL 4KPHL 2VN7A 1CT8B 4EIGB 3U4EA 3SDCD 3O4LE 1XCTB 3GSNL 1RSFA 4G6KL 3QG6A 4FN0A 4GW5A 2QHRH 3OJ2C 5IB3A 5DD0H 5KOVC 4NYLB 4UT7H 1HXMA 2PTVA 4U1SB 1IEAA 4D8PB 4D9QD 2AQ1A 4EUPG 1FV1A 1UB5B 4HWBH 5DF0A 4S1DD 3MRBA 2VSDA 4I4WB 4V1DA 2EO1A 4U2YA 1AQDB 4CJ0A 5IB1A 4OSUH 4WI8A 1GC1L 3I02B 2WANA 5D8JL 1U2HA 2B2XL 2EDXA 3ARGD 5I6XC 1G7HA 2NY6B 3K2UH 3SE3C 3LRSA 4JO3H 4P2CG 4P0DA 5HD8D 4ZQKA 5T3XD 1MCOL 3KYMA 4S1QH 1LO2L 1GRWA 4I5BB 5IMOB 1A6ZA 1IZJA 2YPLB 1DBAH 1UXSB 2BZDA 3E2HB 1CGSH 3BP5B 1R3JB 4BSWB 1INEL 1FZOB 4UDTA 1YN6A 5KTEL 1T66D 1WGOA 5DVKA 5LG1A 5K9QI 3IT8D 2CSPA 3AMLA 3STLA 4JY6B 2UZIH 3PWVB 1MCPH 3IDGA 1CXFA 3SGKA 5FK9A 3DIFA 3MOQA 4YDVB 1F11B 2JKXA 3NIFF 4PJBF 2YD3A 2FRGP 5JXAH 1BZ9B 4K3EL 3VGBA 4YDLC 5JW5A 1YYLH 4P5TC 2Q3ZA 1AE6H 4RA0C 4RGMC 4B50A 1A47A 4J3VA 5LGHH 4HX1A 4J3WA 4LEXH 3SCMB 3VFSA 4Z78B 4PJEA 3P9LB 4YZFE 2BY1A 3SDAA 3RU8H 1AGFB 3D48R 3RL2A 5DEFA 5DD1L 3KLSA 3O9WA 1OTSC 3L6FB 3NOIA 1UXSA 5C07E 2YK1H 3W0WB 4KQ3L 4FNLL 3QDJD 3H0TB 4WV1A 4OKDA 2JJSC 5KANI 2PYFA 2DI9A 5C8JA 4WGWB 1XIWA 5D2LA 3BD3A 4Z9KB 2O5XL 3RUGF 4RBPH 1XIWB 1X7QA 1JPSL 1XR8B 5KSVB 3H9HA 4QHUA 1P4LB 3TWCL 5ALCH 3ZT6A 3OGOE 1L0YA 3ROLA 4APQC 1UGNA 3I2CH 4RMUA 5JXAL 2Q7YB 4XCEA 1QG3A 4HCRL 4BUGA 4IRJA 5E00B 5IB3B 3GSQA 4WHYH 5BO1H 5I76A 1OP3H 5CEXB 2YWYA 4LVNB 1Q8MA 5HGAA 4KHXL 2A6KB 3N85H 2FD6L 4KJWD 2BNUB 1HN1A 4AY0A 5E70A 2QADB 1OGTB 3WLWD 2R8SL 5FYJD 5D1ZC 1EO8H 3RDTB 1IL1A 3VCLB 1F11A 5C09A 2NXZB 5I19H 2JK5B 3VFNB 5K59F 1HDMB 4GBXC 4XP5H 3RWGA 1YJDH 1M6OA 2X09A 5FCUL 5IEKA 1JZ7A 4I1NB 4LOUC 5I8OL 4M7ZC 3FO2B 2BFVL 2IPKB 1C5CH 4YUEL 1GZQB 2EKSA 4YDIH 3PQYE 4JO4H 4ZUTA 1N0XL 3K2UL 1WFOA 2YD5A 2EE2A 3GKZA 3H6JA 3P4LA 4PREA 3RVXC 1IAIL 4MQ7B 3NBNA 3KPSB 4ODSH 3BIAX 4CMMA 2EXYC 1I9RH 1X44A 3L3KA 4KTYA 3VXUE 4UUJA 3BPOC 4W4OA 1DBKH 4XXCC 4PRIE 3GMPB 1E4KC 4I9WD 3VXOB 5D1XC 2BOBB 1P7KA 3CMGA 4QY8B 1OW0A 2IBBA 2VKXA 1IGTA 4QHNA 5KSAB 2E9JA 2F5AH 2ED9A 4YZFF 5EBMB 2ESVD 1T6VN 2PYED 3VXNB 5JMRA 1UM6L 3NCYP 3DV4A 1BX2B 3T2PA 4RIRA 1J8HE 2IBZX 1D6EA 4P59H 3MLVH 3CJJA 2R23A 2HFFB 2NX5B 4DGIL 3KPLB 5TPWL 1IGIH 1SY6A 2Y36L 1UZ8B 5J1AB 4K3EH 3OKEA 4PJAA 1Q0XH 1IZKA 2GJZA 2FYYA 4JJ5A 3OXRB 2CIKB 4PD4J 1JZ4A 1XF5A 4OCWL 2FATH 4PS4H 1HNFA 3SE4C 1UA6H 3HI1A 4WHDA 2IG2L 4G9DB 4LP4A 5BZDB 5EC2B 5E9DB 5HHPB 3HPJA 4G8FA 15C8L 3S35X 4P9HH 1Z0NA 1AD0B 1F6LL 3QWRA 4EN3C 3K2MC 5AZEH 5FO8A 1MHPL 3IVKB 4RFOL 4UIKH 3OKKB 2CKBB 3O11B 1UM6H 2O5XH 1FL5B 5E08L 3U1SL 2YPKB 3GM0A 4G6FB 1ZS8B 3LQAH 3B43A 1NFKA 3C9NB 3NN8B 5FUCC 1VGKB 3QI9B 1F6AB 3PHOA 5FIEA 4NO2B 2A6KA 3LB6D 4OIIL 3VFTA 3QYCA 4PJGB 3AXLB 5B22A 2OI9A 1QFWM 1PZ5B 5E08H 1KJ3H 3R8QA 2Q8BH 1NGWB 1MH5B 4MX7B 3ARDD 4Y1AD 3QIUB 2EDHA 5LGJA 3PDGA 5KVFH 4LLVB 1JWSB 2EO9A 1BWMA 1AKJB 2QQLL 1TJHH 1ZHBA 3SGDH 4Q58C 4BFIA 4HXBL 1KJ2H 3ARXA 3R1GH 4J4PA 3RUGA 3T4YA 3T65A 5L2JB 3O9WB 5D72L 3F7YA 3NFPB 5I1KL 3OXSB 3B2UC 1HHIB 3KNBA 1N64L 5ITFA 2OCFD 4MA1B 3DVGB 4LVOB 5E8OB 1N26A 1J8HD 1VSCA 3C6LC 2AW2A 4NCDA 3HZYB 3BAEH 2ESVE 3VGHA 1MLBB 2A9NH 1GXEA 3MA9L 4GJTB 1KIPB 4Z7VE 4PJEF 3WDHA 3MRJB 1Q9OA 4G43A 5C07D 1FCCA 3TA3B 4Y4FA 2BSRB 4TULH 4OTXL 3HB3D 3OKDA 2NNAA 3MBEA 2EDJA 2PCPB 3V95A 1P7QB 2NY3D 5SX5H 1QBBA 3BP4B 5D5ME 3Q5OA 1TTFA 1WT5A 4OF0A 5D1QA 3RNQA 1AHWA 5BVJB 1CS6A 4O00A 1QFWL 4AQ1B 5D5MB 4GW1A 4K3DH 2R0KH 2FR4A 1KTDB 4DCQB 5FYKD 4XPFH 1TZHA 2Y36H 1NAMH 4OGYL 4XCCH 1ZGLM 4JREC 1V7NH 3RWJA 1HE7A 1MFAL 1YN7B 3CPLB 4G8GA 1QFUL 3CFCH 2Z9TA 5D1ZB 2QHRL 3RWCB 3S5LG 2UV3A 1X5GA 5KG9B 5EORL 3E3QE 4Y19E 4PLJC 4HBCH 4HKJA 3JWDH 5HI4C 5HGDB 1HI6B 2P5EA 3DBXA 4RX4D 3VRJA 3IJYB 4JPWH 5FYJE 5J3HD 1BFTA 5E9DA 4XNXL 5HHPA 4XNZB 4JFHE 1OTUD 5GRWA 3U4BL 3L5XL 3TT1L 3RHWK 1C7SA 3G5XA 2ZKHH 3X3FL 5B38G 4WU5A 2J7LA 3HPLB 4X4XA 5DC9B 4IRJD 4NO5B 1HINL 4FQXC 1LP9A 2XZAH 3C2SA 2R69L 2GJ6D 4LDOB 4J6RL 1BQSA 4PBXA 1EEZB 4MQXD 1MAJA 1NUNB 1RJLB 43C9A 5IB4B 1JIBA 1TNMA 4G7YL 4UINH 3V6FB 3SJVE 3SHSA 4MNGE 4OQTA 4ZSOA 3RA7H 2GIYA 1N5YH 4RZCA 1WF5A 1LO3L 4QRRB 3ROOA 2P8PA 3K4AA 5JLZA 4ELME 3OKOB 5JR1H 2A9MH 1MCQA 4PGEB 3RVUC 4POZD 3G5YB 1VKXB 1D6EB 2NY1D 2H6PB 2ICWA 3B8SA 1IAKA 4G8EB 5D7SL 3PP3K 3CU1A 1OWRM 4U1LA 5MERA 4MNQA 4DKEL 3RRQA 3R1GL 2J8UE 3EOBB 4OD2B 4JN2B 4YHMH 3MRMA 2QV2A 4Y2DD 4ZFFB 5ISZE 4Z77B 4JQIH 2X44D 1R6VA 2VAAA 3BGAA 1XFPA 1HH9A 3FO2A 4Y4HC 1J7VR 2XG4A 3BWAB 2VWEE 2I27N 4XI5D 4XT1C 4WWKC 2CGRL 1WZLA 3EOYG 3W11C 3F6IA 5DT1L 1OGTA 4K8RC 2XFXB 1KPUB 2BC4B 1RUML 4FFWC 1JL8A 1SJHA 1FIGL 1HDMA 1U58A 3NGBC 2EDRA 4HUXB 4FABL 1PSKL 5T1MB 3F7PC 3ZDXF 4MVBA 3B3IA 3LKSA 2BK8A 4HDIB 4LAQL 4BK5A 3RQ3A 4PTTA 3T0AA 5H35B 4U6XA 5DR5L 2OR9L 3O6FA 3HMXH 4OZHA 5E4IA 2YWZA 3PNWB 5FA3B 2MPAL 1I1AB 3T0EB 4BH8A 5ADPL 5GZNC 4FABH 4Z7VF 1KB5A 3LIZH 1CF8L 3IFPB 1NGXB 2FD6H 3UCRA 3LQMA 1GZPA 1MI5B 4CRPA 3BD4A 2APVA 4F8TA 1UT9A 3QJHA 3GSUB 1IVLA 3SY0B 1RK1B 1RZGB 5DI8B 2ED8A 3H9HB 5I71B 1HCFX 2J88H 1QA9A 4PRPB 1KT2A 1T1YA 1UB6A 1XF3B 2MPAH 5F7MC 4PY7A 1KENH 1ZT4A 2VDRH 4H1LA 4D0DA 4CVXB 1SEQL 4RCAA 3UYRL 2H2PC 1G0YR 3K1KC 2F58L 1UWXH 1HOCA 1BVLB 2E7CA 3BGFB 3EOTH 1VHPA 4IJ3B 1JUFB 3SDAB 1LQSR 4PRIA 3WN5B 4G9FB 4IIQA 4OZHE 2DQTL 1R3KA 1G9EA 2ITCB 1DBKL 4N0CD 4KQ3H 2B8OT 5GRYA 4O02L 1V3MA 5DK3A 4NQXA 2ZCLH 4OIAA 3QXVA 1TQBB 2AJXH 2EIDA 1MJJB 2AJZB 1N5AA 1MLBA 2HN7A 2P8MB 1ZSDB 5JMOC 4PUBL 4MYWB 3M17B 4RNRB 2NYYD 1VFAB 4LPVA 4JFXB 5BV7H 1MUJB 1D5IL 2VR4A 4NJAL 1E27A 4YBQD 3S34H 2GUOA 4LSRL 4ZFOB 1CLYL 3Q3GB 1CG9B 5C0CE 4PJHE 1SVCP 2PTUA 4I5BA 3K8LA 3QCTL 3TN0A 4XPAL 4Z95L 3WKMH 5CIPH 3N85L 3RZCC 1YMHB 1S7VA 4K71C 4QGTA 2ARJA 2DQTH 4MWFB 2XTJE 1NGPH 4G6JH 4OUOA 1S7RA 4FQ1L 2BCKB 4U1SA 4OZGE 4NBYB 5L9DH 2NX5E 5I16A 1VACA 2R56L 2VXUL 1G9NC 5TH2A 4Z0BH 4OLVH 3RWFA 1QP1A 3QQ9D 2BNRD 3U4EB 3LRGA 4U6XB 3EUUA 3EZ8A 2BRRH 2MNUA 4I13B 1URLA 4GBXA 1LK2B 5T1MA 4JB9H 4YGVB 4R4FH 4X6DE 3DTXB 5F6HJ 3VD7A 1C12A 1DQMH 1ZANL 5IGXH 4H0GA 1A6VL 4YHKH 1YMMD 1EHLH 4MJ4A 1KNOA 4L3EE 7FABH 1PG7W 5IHUH 2R1YA 5CKGA 1R3LB 3OAUH 3KS0J 4QHMA 2QTEA 3S88H 1FZJA 1XGYL 1DDHA 3NVQA 3WKML 1OGAB 1GZPB 1WK0A 3NCYS 4P3CH 4XP9L 3HRPA 5DRZA 5IIEB 2VLJD 3BIBX 1EGJA 3LN4B 1HIML 3L3DA 2EH7L 4FQXD 5DJ6B 4L3EA 3QDMD 3QDGB 2ENSA 3LRSB 5ALBL 2VLLB 3TT3H 2JELH 3H42L 3FQUA 4OLVL 4NGHL 4XC3L 3I6GB 2APWA 2R9HC 1UEYA 5ID0A 4X6DF 4V1DB 3MV8B 3UXFA 1CFTB 1EO8L 4OCWH 2BC4A 2X4RA 5GGTL 3AM8A 5C08B 3MACH 2AK1H 2F8OA 2HKFL 4YE4L 1A6VH 5EOCJ 3BKYL 5AYUL 4QHNB 3BMWA 5IW1B 3GMRA 2AXHA 4ZXBD 4NGHH 5ISZB 1MCKA 1I1YB 5DQ9B 5C0CD 3PWPA 4P5TA 1LEGB 3IDJA 2R0WH 2VXQH 3QIWC 5ESVB 4WO4B 1FO0L 3D87B 3RWIA 2R0LL 3T04D 3RZWA 5KSUB 2XTJD 4L8CB 1ONQB 2QSTA 4TSAH 1YEIH 3OPZL 4M7ZB 3CX5J 3D18B 3MLWH 1JGLH 3U4BH 1HWGB 2W0FB 1CWVA 2YZ8A 5J57B 1HILA 4XPFL 3QJHB 3VW3L 3ULSA 2EICA 4XPGH 1FBIH 3LD8C 2H6PA 4LHUD 1W72L 2FH8A 5EUKB 4MJ6B 4UQ3B 4NO3A 1SQ2N 5D2NA 4PGDA 2IPUG 1NBZB 4Y5YA 5ADOL 3NH7L 1BVKA 1YEIL 3OPZH 3PP4H 4OZ4B 1QYGL 1AGCB 2AEPL 2IAMD 4WTZG 1MEXH 1NL0L 1KELL 2R1XA 4N8VA 1TNNA 4E0RB 3QRFM 1J10A 4KUZL 3WNNA 4LLMB 2GTZA 4XC1H 2EYRA 1QSFE 4KJYB 1QTYT 4M62L 4QHKJ 4H1LG 2A83A 2Z35A 3IDYB 1KPVA 1MFEL 2UZYB 5JOFB 1KEMH 3C2AH 5BMFH 1FJ1B 3SQBA 4EQ2A 4K23H 5E2UH 3S98A 1ZGLA 3EYOA 4NJ9L 4OCSL 4R0LB 5HJ3B 1I1YA 4J4PC 5BRZB 3SO3C 2OK0H 4Y5VB 5LGKA 1X7QB 2GEEA 3ARQA 5BS0A 4RISL 1MHPH 4JM2F 3V5DA 4E5XB 1CL7H 1ZLUK 4DEPB 2B5IC 4NQDB 4X0KA 4XNZC 5DJZB 4H25A 3FKUS 3ULUF 1WWCA 2A1WH 1RZKL 4BH7A 4JQIL 1V3KA 4XMLL 1CICB 1S8DA 2FDBP 3S88L 3KDMB 4J3SA 3L7EB 1Q1JH 2WWMD 2VR5A 4FQXB 2COQA 3GO1H 1H15A 3W39A 4E41D 5I1GL 1Q9LB 3PP3H 2GQHA 3D3VE 3NIGE 5FUZH 4NT6A 3JV5A 5E99H 3SBWA 2H1PH 4O2EA 2CUIA 4Q6YA 4M3JA 3SKMA 4TNWF 3LQZA 4YWGH 1NUDA 4OV6F 1QBMH 1E4KA 3VH8G 3BP4A 5FK9B 5I1GH 1NBYB 5EZOH 4HFUH 3ULUH 2CLZB 3DUSA 1WZ1H 2YMXL 4PJDB 2B20A 1MH5A 5MENA 3A6BH 3AB0C 3G5VB 5DLML 2A77L 4WI3A 5CSBA 2GCYA 1PEZA 4M6ML 1MJ8H 5E6ID 2YA0A 1ES0A 3BVNA 4ZUVB 5JW3L 3DROB 5CGYD 2H2SC 4C4KO 2E7LC 2NY2D 2IBZY 5HHMA 3EGSA 3Q6FB 4DGVL 4LP5A 5FAAA 2JIXD 3LDBC 4OJFH 4NM8H 2D31A 4R97C 3D2UB 3HI5H 2ICCA 3RL1A 4EUPA 1MHEA 3ESUF 4XNYL 4LVOC 4G7YH 4UINL 4W70A 4HIXL 1IM9D 1MUJA 5B38B 4WWKB 3TBTA 3C6LB 4PJBE 4XMPL 1OAYH 4NQDA 4HK3N 4X0KB 4CU6A 2AK4B 5IBLC 3GBNH 3HC3L 3SE8L 3Q3GA 3QDGD 1G0DA 5EBWB 4LPCA 2CLVA 2ZSWA 3PWLB 4PJXA 1RJZA 2VDKL 1FYHB 5IQ9B 1HK6A 3C5ZA 3IS1X 1A6AA 2R2BA 3O6MH 4ODVL 2VIRB 1JGEA 5D7IF 4DAGL 1LO5A 3QEUB 5DVOA 4DOHB 1MJJA 2J8HA 3QXUA 4LLWA 4OCRL 5EB9A 2HFTA 1FJ1A 2QQQA 4EJ1C 4PJAB 3QZWB 1MRCH 4QLRA 5I1JH 2YC1B 3CVHL 4M03A 3UTTD 1F45A 2DQJH 5JUEL 3VA2C 1BZ9A 4W4NA 5F3HB 1RIVL 1I1AC 4NO0D 3T0EC 1S7SA 5CBAB 1RHHA 1JK8A 5B3JF 4KKNA 3CXHJ 4PJ9D 4X80L 3H7BB 4XH2B 3L3OA 1GGYA 3U46A 2WQ8A 4N5ED 2ICEB 4NZRH 5FYLD 3HMWH 4XMPH 5I71C 4HHAB 5T5FH 3ARFC 3P0VH 1IEBA 2FH6A 5I74B 1JMZA 4PRPA 3T1FB 3DV6A 3GSOA 1WEJH 3VXRB 2DLIA 2E6QA 1MI5E 4MD0A 4WI9A 5CCKL 1B0WA 1KEGH 3DRTB 3GSNA 2P47B 1T21A 5CIPA 3RJDA 5DJ0B 4AK1A 4FQ2L 1RUQL 1S5IL 5BV7L 1D5IH 1NAMA 3C60A 1KUMA 3HZMB 3CCHA 4M5ZL 4D0BA 1U93A 1MJ7L 4Q9RH 2IEPA 1BX2A 5I1AB 4KKBD 5ALCL 2MMXA 2FX8H 2NTSP 4NQVB 5EA0L 2E9BA 5KZCB 4EUPH 3W9EB 4XBGA 3QG6B 1WT5C 5D1QC 3DI3B 4JFZL 2NY7L 1Z9SA 1ZA6B 2PYEE 3GGWA 5JORA 1YPZE 2J1KA 3QO1A 1DP0A 4LCIL 4NPYB 4LCYA 4QRSA 5IQ7L 3V7AE 1FO0B 1QR1B 2DIBA 4GRLA 3GUTB 1DDHB 1L9MA 4Y4FD 5D7LD 5K9JH 2X4PA 1A4KB 4JY5H 2MSPA 3DUHA 2Z4QB 5EPMB 3GRWA 3SDYH 4NKMA 2AXGA 1RUQH 1L6XA 1S5IH 4NN7B 1KPRB 2EE9A 3QUYD 4KRMB 4DEPC 1T20A 1FL6B 1Z3GH 4AIZB 3B2UD 3CLFH 4PBWD 1FG2B 4XVSL 2ZJSL 4Z5RB 1RHFA 4ZD3H 4U7MA 2V2WA 2CRMA 3DGCR 3GFUA 4C56E 1P4IL 4JVUA 2A6JB 4QYOA 5E5UB 1IGJA 1BQUA 4OM1L 1XCQA 1S9VB 5KSBA 4YX2L 4M6NH 2H9GA 3CX2A 5FYJH 5F70A 3CLFL 4DCQA 1J05B 3VDAA 4D9RD 4RAVA 1OWWA 3P73B 3NGBB 2VXTL 4OIBA 1RHHB 4HXAL 2F53B 4Y16D 1EAPB 3VXSA 1KIRB 4R4BA 4UTAL 4WHCA 1MF2L 3N50A 2P4AB 2B4CC 3G04A 3R4DA 3O4LA 2WUBL 3NPSB 4NBZB 1BQHG 4LRIA 4OI9A 2C7UA 3RIAK 4V1DD 1UENA 5I1HH 1B6DA 4FQLL 2XWJA 4L29B 1NAKL 1Z3GL 4WEBL 5F1IB 2C26A 4UDTB 2KQMA 3F58H 4I0PA 4LNRB 3PHSA 3FQXB 4JRYE 4BSVA 4BUHA 3HMWL 4L4VD 4F15C 3HCVA 2DTMH 4WFHE 5LAXA 2YPLA 3THML 1DUYA 3ZO0A 4KI1A 1CQYA 4RGOL 3GHEL 4FRWA 2Y07L 4ETYA 1YEDB 4P59L 1NMCB 2GJJA 3ECBB 2P5EB 5KW9L 3PXJA 1LK2A 1DN0A 2VLME 2IH1B 4QOKA 4R4BB 4OLWL 3TZVD 5BJTA 3DIFB 2BX5A 3DYMA 3SGKC 4F57L 3JV0A 4P2RD 1J05A 3KJ6L 4JRXE 5CHNA 3G6DH 2CDFB 1IAOB 2ZP0T 5JHLL 1MPAL 4PJIB 5CZVL 4KAQL 1KTDA 1VADB 3RIFK 4B7LA 2XNAA 4JVPA 2X10A 1G84A 3UDWA 5DJDB 1TETH 2JE8A 3O3UN 2R0ZH 1CD1B 4FQIL 1H3UA 4YFLI 5KSVA 2L7JA 4DQOH 1AY1H 1WCBA 3WLBB 4UU9B 3G6DL 3KPRB 4OCSH 4WHTA 1OTTD 4KRPB 1JHLH 3FONA 4K9EC 3R8BB 4HEPG 5EUKA 3PV6A 2DQFB 5I17A 4MQSB 3MRJA 1SM3H 2UWEB 4XP4L 4YHPA 4RRPA 4OIIH 3WHE1 1FSKB 2OLDA 3Q0HA 4YXHH 3K8KA 3C8KA 3KPRE 4N68A 5F9AC 4RBPK 3S8WA 5F9WB 5L88L 3I6KB 5T5NF 2DQCH 3KPTA 4MCYA 4F58L 5K9OB 1GAFL 3SGEH 5J3HC 3REWB 2N1KA 3CH1A 1S3KL 1FFNA 1CT8A 2AJYH 2WWKT 2QQLH 2XFXA 4U1KA 3B9KB 4HFWA 2FJHB 2P43B 2HTLC 2ICWJ 1CICD 4A6YL 5T33H 4NQVA 1T1WB 3KYKH 4MJID 4O4YH 4Q6IC 4KVNH 1A8JH 1ZLSH 2ZG1A 4JY4A 3QBTB 3AREA 4M6OL 3CCHB 4YNYB 2EC9T 3EYUH 2VYRE 1EAPA 2BY0A 1DVFD 1WAAA 2VLRA 3BFOA 3MO1A 1QEWA 3LS4L 4I18B 4HUWB 4WVRA 4XBPA 4MD4B 2I9LA 2G75A 2V5YA 3MJ7B 1A7QL 3U7WH 4I3RL 3BO8A 3D0VB 3GSNB 4GRWE 3CVIH 4DTGH 1YY9D 4V2BA 3P30L