2GAZA

Mycobacterial lipoglycan presentation by cd1d
Total Genus 79
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
79
sequence length
273
structure length
269
Chain Sequence
NYTFRCLQMSSFANRSWSRTDSVVWLGDLQTHRWSNDSATISFTKPWSQGKLSNQQWEKLQHMFQVYRVSFTRDIQELVKMMDYPIEIQLSAGCEMYPGNASESFLHVAFQGKYVVRFWGTSWQTVPGAPSWLDLPIKVLNADQGTSATVQMLLNDTCPLFVRGLLEAGKSDLEKQEKPVAWLSSVPSSAHGHRQLVCHVSGFYPKPVWVMWMRGDQEQQGTHRGDFLPNADETWYLQATLDVEAGEEAGLACRVKHSSLGGQDIILYW
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords T-cell surface glycoprotein CD1d1
publication title Structural characterization of mycobacterial phosphatidylinositol mannoside binding to mouse CD1d.
pubmed rcsb
source organism Mus musculus
molecule tags Immune system
total genus 79
structure length 269
sequence length 273
ec nomenclature
pdb deposition date 2006-03-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2gazA02
3.30.500.10 Alpha Beta 2-Layer Sandwich Murine Class I Major Histocompatibility Complex, H2-DB; Chain A, domain 1 MHC class I-like antigen recognition-like 2gazA01
5J8OA 1KLUA 4R97C 3KPTA 3CU7A 1G7HB 1M4KA 4LSQH 1S5HB 1S9YB 2A74A 2VL4A 3D0LA 3PG2A 2NY5L 2DTMH 5FA3B 3IJHA 5D93B 5K9OA 1UFUA 5DZOA 1CGXA 1I8IB 1XH3B 4TRPH 3MGTB 3BSZH 5JXEA 1PYWA 2V9RA 1U3JA 4A2LA 1DBBL 1GH7A 1MF2L 2BVQA 3OMZA 3QFJB 1QQDA 3EGSB 4WHYG 4IMKA 3TO2A 4Z0BH 1HHKB 2DQHL 43C9A 4PG9A 1OB1A 3LH2L 4B50A 3SN6N 4GRLA 4UBDC 4RGNB 3CFBA 3LEYL 3JV6B 1ZANL 3CC5B 4JFDD 1RHFA 3CLFL 5C09D 3U7WL 3S88H 3ZHKA 1TENA 2DQTH 3U0WL 1NLBH 1KJVB 2I24N 3O2DA 5D7IA 5DFTA 3QAZB 4I48A 1U3HB 3EOAA 3OJDA 1UACH 1GGYA 4LPWA 4Z7VE 2Z92A 5J11C 4EXKA 3BOVA 5ICXB 3MLRL 1SHMA 3LPGA 5EFIA 4JPVH 4MCZA 1I3UA 5T3XH 3P4OA 3M1BB 3ZDXF 4X6EB 1AC6A 1HQRB 5D1XB 3V7AE 5MEOB 1QO3B 5ANMA 3IXAA 1MCKA 2EC9U 1X44A 2FHFA 4PJ9C 2C1OA 5F96H 4J3UA 3L3JA 5LAXB 4EUPB 4X6BA 4D0DA 2DQUL 4JQIH 5HYSG 4FFVC 3G9VA 4I5BA 4K7PL 4NC1E 1GOGA 4IRZL 3U1SL 4X83A 4G6FB 4N0FA 1B3JA 3T65A 3CCHB 4K7PX 3VFUB 2EDXA 5JA8B 3RAJL 1OL0A 4FRWA 4Q6IB 3CVHL 5DC0A 3FJTA 5T3ZD 4YO0A 1I3GL 4HWBH 4FQQB 4XNUL 4WTXA 4MNGE 1LP9B 4L3ED 1KIQA 2L0DA 4YC2C 1FSKB 2CSPA 4MJ6B 2P5EE 1ZLUH 3QDGE 1T66C 4N8VA 4YNYB 3SKOA 1VACA 4LARH 3L3IB 2FX9L 1KTKE 1G7MB 3BIAX 3K46A 5EU3B 2I9TB 3G6JF 5L2KE 1FV1B 3VG0H 1YDPA 4Y19B 4PR5B 3WIHH 4KWUA 4YUEL 3OAUH 3UO1H 3MQIA 4LCUB 4ALAH 1QTYT 4R7DA 1B0GA 2FGWH 1IJ9A 3WFCL 2AJZA 4PV8A 1T7VA 1ZGLA 5C09A 4LP4A 3DO7A 1HHIA 1KIPA 2BOCA 4QRSB 4YXHH 1ZHLB 3QUKB 4MZ2A 1DCLA 1FVCA 5T1LB 5GGTH 3LKSA 1GGCL 4F37K 4UTAH 2D7QA 2QJDA 2IALB 2UWEF 2IQ9H 3NFSH 3FO1A 1TJGL 1BF8A 3T1FB 3OGCB 1TVBA 3LV3A 3S96B 3VDAA 3P73B 3U4AA 5INDB 2ZUWA 4G42B 3KAAA 3TN0C 1NC4B 4MS8D 4XZUB 5EUOF 2AERT 5EU5B 4HBQA 4JPWL 4K55A 4YHLH 5LCVL 5C3TA 5BMFH 3PP3H 3PDOB 4PJBB 2XI9A 3RUGE 4HIIB 3KPLA 5E00B 4HCRL 2O61B 4LSVH 2EDLA 1MWAH 2ZG1A 4WO4B 1EEZB 1V3LA 4FZEL 4HPYH 3WJLC 1EO8H 1TZIB 5IFHL 4QHLB 4OF7A 5GGUB 4Z18A 1PKQA 4U0QB 1JHTB 4JFYB 1MJJA 5LG1A 4YK4B 4X5LA 3WXVH 3IDJA 1I9JH 3MUY1 5IW6B 1S8DB 3MREA 4NHCH 2OXHA 1G9NC 1PLGL 1UKTA 2BSRB 5CHNA 4J6RL 3MFGB 1FLRL 1X5FA 4MHHG 3RGHA 5ESQA 1G1CA 5GIRA 1GXEA 5E4IA 5IHUL 1QBLL 1VB9A 2D9QB 4HX1A 3BXNB 3RKDC 3C8KA 1UEYA 5AWNH 4J3TA 4KKLC 5GGSA 1H3UA 3AM8A 4QRRE 5F93C 2OJZL 3FONA 4GRWE 3RHWK 2RR3A 3HLAB 1CI5A 4QXUL 5FOBB 5F21B 1AP2B 3GSOA 5FECB 3ULVE 4YE4L 3QFDB 5IHZB 2W9LA 4K3JL 1NCCL 4YX2L 2NX5B 4NDMA 4QTHB 4F2MB 4UT9H 3I3DA 5GSRA 2NNAB 3MMEA 5CEZL 4F7TB 4WHDA 4WFGE 4NUJA 1AGEB 1AHWB 3Q5YA 4R2GC 4I1NB 1JK8B 4KZDL 2OK0H 3CFJB 2IFFL 2WIIB 1S3KL 3NAAH 4JM4H 3QQ9C 1NGYB 3CPLA 2A73B 3E2HB 3G6DL 2B2XL 1ED3A 3QZWG 5L9DH 4MS8A 3FO9A 4YXLL 3QHFL 3B43A 4JGMA 3X3FL 3F58L 2Y6SC 1FZJB 5BVJA 1I1YA 1MHEA 4BELD 4KK8C 5KSVB 3GMNA 3GMLA 3O6KL 3C6SA 2CLRA 5ICZB 4MA1C 4HWZB 1N4XH 1IAII 1CICD 5JHDE 2YRZA 4W4OC 1MUJA 2WBJC 1MVUB 2X70A 4N0CC 4Z76B 1I7TA 4LF3A 1N3NA 3VWJB 3U7YL 5BZDB 5E5RB 1ROWA 1IT9H 5BCAA 3OV6A 3BW9A 1MHCA 3B9KC 3IS0X 5KOMC 2VE6B 3OTTA 3GEWB 1CFTB 5BQ7A 4PJDB 2F54E 5F71A 3W0WB 3HKFA 4RAUA 2UYLB 5FKAB 2BNQB 3S34H 5F3HA 3RVUD 1UA6L 5KJRH 1IGIL 4OF8A 2ICEA 4P23B 3QP3A 3SDAB 4QF1B 2EYSA 5CUSH 4Q97A 1MAML 4NWUH 5JXAH 4NRXB 3QISA 4IRJB 5DMKA 3MRKB 1LE9A 4L8SA 4XC3H 3CJJA 4GH7B 1RMFH 1CDUA 1MCHA 5GGRY 3ZT5A 1RI8A 1BFVH 1RZFL 3HMXH 2EE3A 4EEEA 4UDTB 1F58H 1SVZA 4NZTL 2V5RA 3GMMA 2QQNL 2VR4A 5F8QC 1I3RB 4JY5L 5HD8D 1U8JB 4KTDL 2X7LB 3VU2A 2VISB 3AS1A 4OSUH 1NFDA 1QACA 5H8DA 3Q5TA 1YECL 4NO3A 4AYFA 1YEJL 2WBWB 3U0TA 4QOKB 4G6JL 4KJYB 4M00A 5TGBB 2H3NA 1WQVT 1CCZA 1FZKB 4YDIL 1S7WB 1A9EB 1IGMH 3DHJA 3FRUB 1OT1A 1JYWA 3S3JA 1EUUA 5ITBH 3GJFH 2I60H 3PHQB 5J12C 4ZXBD 1C5DB 2IBZY 3QJHB 3L5WA 4KXZH 3EO1A 1MFCH 4X6CF 5JHLL 1AIFB 1RZIB 4G7VH 4F9LA 3UJJL 3JBG7 4BUHA 4HHAA 5DS8A 5JW5B 1CICA 3CXDL 3UTZA 4NZJA 2ARJA 3F8UB 1VKXB 1ND0B 4X9IA 1TITA 3MRBA 3RX5A 4Y4FC 1CG9A 5I17A 3WHE1 4KTEH 3CDGB 3KHQA 4CNIB 4ONFL 1IM9D 3MLWH 4OQTA 1LQVA 3MLTB 3ULUF 4QHKJ 2V6HA 5EBGA 1CLOH 3K8KA 1LD9A 2EXWC 1IGYB 4F58H 4L3CA 1JNHA 2YHGA 2R2BA 1PEZA 2X05A 4C56D 4NM8L 3GMOB 4FG6D 4PRHB 1MIEH 3MZGB 4X80H 4ZYKA 5BS0E 4IOSD 1FC1A 3QEQE 4HIEB 4JN1L 2YEZB 1RUPL 5FUZL 3NH7L 3UPAA 4OIIL 3GO1L 4BZYA 5T1KD 1KJ2H 4UUJB 3VI3F 3B8SA 3DIFA 4PJ7F 3VFNA 1UZ6F 3L95A 3SOBL 3QCVL 1J18A 3BIKB 1A7PH 4D3CH 4GMTL 3HI6H 1ZT7B 4NZRL 4OV5A 5JW4R 4Z7UA 3DI2B 3L3DA 3QNXB 3FKUS 4OZIF 3KPRE 3I9GH 3MOAH 2X4TA 4HJ0C 5I19L 3LEXB 3BQUD 4EOWH 2EZ0D 1HZHL 2B1HL 5TPWL 4FNLH 5F88B 4NN7B 3SPVA 1OM3H 2A6DB 3L5XH 5JPMB 3TPUE 5C7XL 4GQPH 4NKMA 5ALBH 3KWWB 1PG7W 4OF5A 5A40E 5CEYB 1NEUA 3O6LH 4ONGL 4LDOB 4LU5L 2BSTB 3PWUA 2DYPD 2AXFB 4NO2A 4ZXBA 4N8CH 5DVMA 4LAQH 4FS0A 4MQTB 4CGTA 1A9BA 2OTWA 3E6FA 1X5GA 3NCJL 3CNKA 5CAYB 4IMLA 3RIFK 4YQXL 4RMVA 2ARJQ 1WZLA 1WAAF 4M48H 4ELMB 3DV4A 5E0QA 5DD0L 2E7BA 3ZL4H 5E2VL 5KAQF 1K2DA 1IM9A 3QNZB 4ZS6D 3HE6D 3QO1A 1L0XA 3LQZB 3TLRA 2XTJB 3VD4A 4PJEF 3IF1B 5IMOB 2R8SL 4D9LL 5IR1B 2ICES 1U95A 1RQ5A 1HK6A 4C56A 5I1KL 2V2XA 2BOBA 1F3DJ 1SY6H 2XXMB 4GW4B 3FTGB 3IDXL 4I77H 5EOCL 5IHLB 1YYML 2ORBL 2AJUH 5F3BA 4ZOCA 4P2QE 5T1KA 5DJ8A 5I18L 1RFDL 1BZQK 2ICWB 1QFWL 3RY6A 5DRZB 3VXPA 5I1IH 1CXKA 3KPQA 4EDWL 1JHLH 2WP3T 4N5EC 1H5BB 1T21B 2CIKB 5DD5H 3QCUH 1KTLB 1W72H 4XCEA 5KBNC 3MYZA 1LO4H 3VW3H 5D1ZB 4WDIB 3LKQA 4Z7UF 3VFOA 1FVDA 1TCRA 4RWYH 4ODHL 3SEPA 5F9OL 1WT5A 3BQUA 3D0VB 3I3EA 1BBJA 5ENWA 4AEHL 4LCCA 2F53E 1Q0XL 2A6KB 1Q9KA 3X14B 1FFOB 1LE5A 5CIPB 5K93A 1HINL 5EU6B 1EIBA 1KG0A 4EDXB 2PCPB 2C3GA 3HNVL 5L8JB 2F58H 2R1YB 5A3IC 4MNHA 3MBXH 1P6FA 2DYPA 4JN2B 1YPZB 2R0KH 2R4RH 3B83A 5H35A 2AABL 3CFCL 4O4YL 4PJHF 1ZMYA 5D7SL 1R24A 3E8UH 3LS4H 4KUZL 4FQ2L 4WO4C 1NDMB 5F6IC 2VZ1A 1EH9A 5EOCJ 4PG2C 3LIZL 3GM8A 1E4XL 2YZ1A 1JTPA 1M05B 2YD3A 1CD1A 4NNYB 4CU8A 2H26B 2RBLA 1C7SA 4LMQI 5KVFL 2OL3B 3HE6A 1JMZA 4RDQG 5DJZB 4DQOH 2GEEA 2RQ8A 5D96B 4PRDA 2MKWA 1Q94A 2NR6D 1FG2A 4DZBA 2YWZA 4PGEA 4JG0H 3QXAA 1RIUH 3HZYA 4HUMB 1MRFL 5E2WL 1CD0A 1CL7I 4LVNC 2VB5A 4X7SH 5I1JH 1KNOB 3UDWC 4D8PA 1CXLA 3QUXB 2ADFL 3RI5K 4XPTH 3I6LD 1H0DA 4GAJL 4LMQE 3PIQB 2BRRH 4JVPA 2Q8AL 3MLUL 2P8MA 3IU3A 4LSTH 2PNDA 1GL4B 1KENL 4Q74A 1A47A 1MCPL 1QD0A 3TIEB 2JB6B 2Y7QB 1B90A 2J88H 2APXA 1DTUA 5J7CC 3BZDA 2MKLC 3O6MH 4MLIA 3P11L 5FYLL 5JQ6H 4MNGB 3U4BL 3EIFA 5IB2B 3DX9A 4U0RB 1RZ8A 5DK3A 4UIMB 3HZKB 1AHWC 3N85L 1RUML 3HA0A 4P5TD 1V7MH 4Z78A 1QBML 2YN3A 1FVEB 2YC1B 3AY4A 5D5MA 1T6VN 3DROB 3KPSB 4O2EA 1A6VH 5C0CB 3RNKB 2FBOJ 1T1YA 2F74A 4WW2F 3T4YB 4F33A 5J9PB 3PDGA 2EH8L 2BFVH 2EYRB 3HS0A 3JWDC 4QRUB 4BSWA 1BZ7A 4XNMA 4J7RA 3CLEL 5BV7C 3ZSTA 5EN2A 4HUVA 5D7KE 2J12B 2CKBH 1ZLSL 4U1JA 3TYFA 3VWKB 2GT9A 5B3JE 4V3EB 4NQCE 4G6KH 5AG8A 5DHYA 5B39G 4X9FA 1TVHB 2YPKB 3MNZA 3RWFA 4JEGB 3MUJA 2LTQB 5ACMA 4YHZL 5I16B 4JRXE 3Q3GB 3ULUL 1I1FA 1DFBL 3IDYB 3RUGB 3BPNC 3A6OA 4QXGH 4PJFF 1NCWH 3OQ3B 4IIQB 4S10A 3QULA 2EDJA 3NMEA 3FOMA 4KK6C 4P23C 3OKLA 5DJCA 3LRHA 3RZCD 3V6ZA 4JR9H 4KJQD 2OZ4A 1QOKA 1QSEE 4KJPD 4JGJA 4G8FA 1J5OH 3WFBH 4HGWB 4YBQC 3NIFE 1HI6B 1TTFA 1T20A 3WLBB 3VE0A 4M5ZL 5ADOH 1N26A 3SKUD 1FNEA 4PGZA 3GNML 4HIHA 5GJSH 1O7SA 2QBWA 4PRIB 3GSRB 4CMMB 4JJ5B 4ODXA 1QEWA 4Y5VB 2VDLL 1E6OH 1HH6B 2X9YA 2FRGP 3ZDYE 4U1NB 3Q5OA 2X10A 2VL5B 3JWOH 3UZEA 4OLWH 2GTWA 1I9RH 1WICA 4FXGA 4HZAA 3IJSA 2J1KA 5C0IA 4PB0L 4WU7A 1HDMA 4WV1A 3RJDA 3V0WL 5HYJB 1G7PA 1R3IL 1NMAL 1IL1A 4MHHI 3M17B 4UNVA 3O11B 1OGTB 3HR6A 4P5TA 3ARSA 4QNPF 3I02B 3OKOB 2QADC 4OM0H 1I1AD 3H42H 2GCYB 4JDVA 4O5LL 1NH6A 2DQDH 4GXVH 4WEUD 3V6FA 4GAYB 1E0OB 1ZVSB 2EDTA 1WLHA 5GRWA 4HF5H 3O8XD 3HRZA 3ZDZE 5DD3L 4A6YA 2VAAA 3SDDD 4PRNA 3V4PL 4PV9B 1FDLL 2VZSA 3IDNA 1TZGH 4FQHB 3BD5A 1FAIL 1D5ZB 4ZQKA 3QQ4B 4XP4H 2J3SA 2YD4A 3QRGL 4FP8L 1OAZH 4ETYA 4GBXB 4LP5A 1ADQA 4O2CB 3TT3H 5ITFA 1FE8L 2VLRE 4JRWA 4MAUL 3ARFD 3HCVB 1EAPA 5C2BL 1H3GA 2HFTA 1NBVH 3WL9B 1WTGT 1JRHI 1VEPA 4UT6H 1IAIM 4I3RL 4YWGH 1GGBL 4JFQA 5F7FA 1UB5A 4U1SA 4KK5D 4I4WA 3MJ7A 4UV4H 1RIHH 3RZCA 12E8H 3O3BB 1H9VA 1GC1L 3BHBA 2HMIC 3NABH 2ESVD 4H1LG 2BVYA 5KS9E 1SBBA 3RKPA 1AGFB 3H8NA 4I2XB 3SE3A 5I1CL 4NQDD 3D69A 4JZOA 4BZ1L 3TO4A 2EIZB 3DVGA 3G5VA 4TOYH 1UM5L 3MRLA 4P9HH 1ORQB 2H1PL 3EOYG 1HKLH 4M7ZB 3C9NA 1W0VA 1T0MA 4HZLA 1NCAL 1MRDL 4LASL 3VFWB 4ENED 4OLZH 2NY4B 1AXTH 4HS3B 5L6YH 1UM4H 1U36A 4Z7OF 3WKML 2X4RB 4AM0B 4X6DB 1Y6KR 4JHZA 4PY7A 5JQHC 4NN7C 1N5AB 1VADA 1JFQL 4GQ9H 5I2IB 4ZD3L 2AV7B 1A0QH 1I1AA 1J12A 1YQVL 4G6MH 4MMXC 4NRYB 5DRWA 1U58B 4GT7A 5HGGS 5IVNA 3S37L 3LN9A 2EE6A 4P46D 4MX7B 4OCXH 2Z93B 2NLJB 3PDDA 1HHJA 1T22A 4YGAB 3G9AB 3S6CA 4PJCF 3K2UL 3O8XA 2NY0D 5MI0B 4F3FA 3S37X 1MWAB 5F70A 4OUOA 5GPRA 5ISZE 1OD7A 4NRZA 3GIZL 4XCYA 3SDDA 2AGJL 2R1XA 4LRNH 3VGBA 1OGAA 7CGTA 3DXAD 3O2DH 4NJAH 3LPFA 3QIUB 4S0UC 5CCKL 1RZKC 2MWCA 4JFHE 2PW2B 1HN1A 4J1UA 4X0KB 4HAGA 1ZE3C 2P7TA 4HJGA 5FGRA 1CF8H 1YMMB 4XHQA 5DC9B 4HG4K 15C8H 5D7LB 4P49A 1N7ML 1MRCL 3S3PA 2MJWA 4W6XB 5CZXD 4KRPC 1YNLL 3LN5B 3SDCD 3TH4T 3V5DA 4PS4H 3MBEB 4X4XA 4ZAKD 3ARFA 5C0FA 2IPKA 5D6CB 4ZFOB 3LZFH 5FK9B 3IFNH 2XZZA 4OCWH 1F3JA 1TMCA 5E5MB 3DX6A 1FLTX 4GKNA 3SQOL 4FQXB 2CIIA 3RRQA 1BF2A 3MOBL 4NHUB 1YMHA 1JGVH 1D6VL 1JWSA 5C0EB 2HN7B 2ESVA 2KQMA 1PDKA 1R3JB 5DD1H 4AK1A 5FYKH 4NQDA 5F1NB 3ROLA 2HFGL 3V7MA 5LBSH 1OTSC 2FX8L 4P3CH 3QXDA 3OKDA 1NGXA 1F90H 2JCCA 4BM7A 1RU9H 3IAQA 3BRFA 1ZWIB 4F80A 1U41A 3BP5B 1BVLA 3U6RA 2OJEB 3AS0A 4NFBA 5HHOB 2D4DA 5ACLA 3S7GA 1J8KA 1D5MA 1DN0B 5FA4A 3ARBD 2ZUQC 5F7KC 2C1PA 4ZFZA 5IT2L 4P46A 2HKFH 1INDH 5EUKB 3ALPA 1T3FA 5J0BA 2FB4L 4U6HB 5BJTA 1F11B 3D3VE 1RUKH 4GW1B 5CGYD 5JR1L 3SDXE 4ODTH 2X1PA 3CSGA 4ODVL 1XFPA 3H9SB 5D2NA 4M9OA 3VXSD 5DQJB 3DXAA 1QFHA 5C08E 4LSSH 3LKNB 4ZDHB 5C9JA 5JIIA 3MLSH 1NBYA 3VI4F 2D31A 3LD8B 4ERSL 3DETD 4HFUL 3RVWD 2BSSB 2FJGB 3AXLB 5T33H 3HB3D 4IM8A 5GZOD 5F7DA 2AJ3A 4W4NA 1HNFA 2C3VB 3DSNA 2W9DH 3TV3L 1QRND 1RK0B 1CE1H 5AAWA 5J13B 3FAWA 2GJZA 4ZAKA 1INEH 2EDDA 5FYJE 3O4LE 1AO7E 3VA2C 4YDVB 1DBMH 4HW6A 5FDWA 3U2SA 5ERWB 3TBSB 2JELH 4OKVB 2BNRE 3TBVB 5MENB 4XT1C 5F7UA 3DVIA 4QT5A 1IGJB 1PX4A 3ZT7A 3WCYA 2ATPB 1WFUA 4M1CD 3SJVD 5JO5B 3FQRA 4G9FE 3TZVD 3QUXC 3QPXL 5DSCB 2Y06L 3CGTA 4XNZB 4MD5B 3S4SG 5HY9A 4R0LA 3CH1A 3BYTA 2PUQT 3C87A 5E56A 4LCWD 3RVVD 5EZOL 2B1AH 3MV8B 5T3ZH 2UUDK 3MFFA 1MNUL 4XB7A 5LWYH 3ZTNH 5IFJA 1U91A 4NQSB 4R90L 5F89B 1E27B 1G9MH 2WWMC 5GS1A 4H5SA 3GJFB 1XZ0A 3DECA 1DQDH 2BCKA 4L1DA 4M8QA 4XVSL 1DUYB 1HHGB 1S7XB 3EOBB 3MV7A 2VJXA 2W9EL 3QXVA 5CBEB 3LSOA 4JJHA 4PTUA 1L6ZA 3ZTJH 1IFHL 5C0JA 1MIMH 1MHPL 4LGRB 4L8DB 3UC0L 3CZFB 3QFJD 1BM3L 2YD6A 3SE4A 1HIMH 1U9KA 2ZOLA 4R96A 3AGVA 3VXSA 2HVJA 1HEZA 1U8NB 2IFGA 1QSZA 3MLYH 5DJAB 4P3DA 5DUML 2FATL 1HSAB 4DZ8A 3PJSA 3OKKA 2I5YL 3FN9A 4RGND 4H0GA 3PQYB 3ZKXB 3AROA 4ONOA 5BXFB 3EJZC 5IQ7L 1Z2KA 4GRMA 5IOPA 1QRNA 1MJ8L 3FRPG 5JDJA 3ARDD 1VPOL 1U3HD 4LFHD 2FHBA 3IDYC 1LEIB 4XVUC 2VXQL 5DHXB 3GBMH 3SO5A 2LU7A 4N9GB 1KJ2B 4IIQC 3T77A 3LKOB 1JTTA 5KSUA 2DWEA 1A22B 4N5UA 1EMTH 3CVIL 5TQ2L 4G43A 1KPUA 1BQHA 1N2RB 4F7EA 4YDLB 5L7XL 1R5VA 3SJVA 5D1XD 3QA3A 1MREL 1SBSL 5EBMA 1NGWB 3SKMA 3TZVA 4KMLB 4JE4B 3RWIA 3RBSA 2XWJA 4X8JB 1UQSB 4ZPTB 4GG6B 5IMLB 1U8PA 4RWHA 1AGCB 4WNQB 2HLAB 1T1XA 2LFGA 3TBYB 1NLDL 4QGTA 4LCWA 4OF0A 4GS7B 1X5IA 1V3JA 2YKLL 4DW2L 3BDYH 4U31A 5FGBC 1M1SA 2P42B 1HWHB 3D18B 2HJFB 4P2RD 4UOW0 3W11C 5TDOA 1YY8A 5D71H 1G7HA 2JK5B 1Q1JL 2GQHA 3WYRA 1XR9B 3NPSC 4AL8L 4L4VE 1Z6JT 1I8IA 2FL5B 3MGTA 2HTKC 3E1F1 5DFVD 4M7LL 1TZHA 3T2OA 2XQYG 3QFJA 5CINH 5C0NC 5I8EA 1AKJB 4KMTL 5DF0A 4HC1L 4ODSH 1F4XH 4OI7A 3FO0H 1SEBB 4YHKH 1DJSA 3S5LA 3DYPA 3KGRA 4KUCF 1T89A 4Y19D 3L7FB 1QKZL 5DMGD 2VDML 4HIXL 4N0YH 2XN9B 4JM2C 3L1OL 3T2NL 2OYPA 4DGVL 2HJKA 4OZFG 3JV6A 3WE6B 3P0GB 1LNUA 2ADGB 3QWOB 3A6BH 3ARDA 1U3HA 4IDLA 5E2TH 2BMKA 1A3RH 2ERJC 1BEYH 2ENYA 1K4DA 4JFOA 1GCFA 3CH8A 5CLWA 5SV4A 3C08L 3P77A 3I6KB 1DQLL 1LO5B 4JG1H 5KSAC 6FABH 4LSRL 4M7LT 1KXVC 1HQRA 5D1XA 5MEOA 1QO3A 4JVUA 5I8OL 3ZSSA 2DQCH 4JKPL 1W72B 4OQTH 2XWBA 4UB0L 3LKRA 8FABB 1N6QH 3MRDB 4KAQL 3MRQB 1KB9J 4WFFD 4AIZB 4M7ZC 4L9LC 2F5BH 4QYOA 5GISH 4ZODA 4BFBD 4FQ1H 4EUPA 2NY4C 5HHQA 3OHXB 3OZ9L 2EKSB 3QIBC 1BFSA 1CK0L 2FR4B 1EBAA 1MQ8A 4XMPH 1M71B 4JQXA 2CD0A 1FBIH 3H7BA 4P2RA 2N7BA 4RGOL 1IKFH 4KJWD 5J56B 4QTIL 4R4BA 3CCHA 1QNZH 5FUOH 4MDIB 5DJXB 4UU9A 4Y16C 4IEFB 1FRGL 4Q6IA 4LVHC 2R56H 3ZT6A 3S9DB 4NBXB 3VXRE 3KPNA 1LP9A 2NYYC 2J7LA 2FX7L 2G5BB 4MCYB 3EJYD 1P7QD 5FOJA 4YNYA 2DLGA 2VLJA 4LIQE 3QIUC 3H9ZA 4ETQB 5EU3A 2I9TA 2V2WB 4HGMA 3EDDA 1S7RB 4HH8A 5SWZE 4EN3D 2MNUA 4JCLA 1PZ5A 2DF3A 3DSFH 3ES6A 2CKNA 1TFHA 3MBEC 4QRSA 5IIEA 3QUKA 1T1ZB 2Z35A 3MROB 3FHAA 2H45A 4NP4H 1CLYH 1P1ZB 3WDJA 3AREB 4W6YB 2IALA 1RV6X 3T1FA 5KSBF 2A9NH 2GSGB 3S96A 4C55A 3P73A 1QHOA 3F6LA 4XZUA 4Z77B 2BY2A 2XWTB 1WVZA 5EU5A 1EX0A 1YJDL 4LHUG 1F6FB 3T0ED 1NAML 1XGQB 2O5XH 2L7UA 2VLRB 5L88H 3PDOA 4TQEL 4U6TA 2W0FB 3MODL 2Y25A 2R4SH 4OCRH 5HI3D 1EEZA 4GSDL 1J87A 4Y7MA 2BVUA 2ICCA 3QCTH 4PJIE 4XAKE 4CJ1A 1ZHNB 4CAGA 4DN3H 5GGUA 2PW1A 3EFDL 4U1KB 3VWJD 2VWEE 4PUBH 3B2VL 3WJJA 5E6IC 1BBDH 4OI9A 3GJEA 1R6VA 3EFFB 4XNYL 2AW2A 1UH4A 3ARUA 4L4TD 4XGZA 5KS9B 5MP6H 3UAJD 5TJWK 1QSVA 5IW6A 4ZUWA 1JI1A 1BQLH 2G9HB 5EA0L 5C0AE 1KB5A 3QXUA 5E24E 2G75B 1WEJL 4JFZH 3RTQD 3D39E 1SYSB 2BNQD 1LO3H 3Q6GH 4AH2A 1GPOH 2DI8A 2C4XA 3SDAD 1UH2A 1U8HA 4K7PY 4YHMH 2ZKHH 2CKBB 1P7QA 1CT8A 4G9DA 1LP9F 3GSNA 2XOTA 4KQ4H 1BGXH 2G2RB 3ALXA 4LOUD 1JP5A 1KYOK 3WNPA 3HLAA 4EN3A 2WY3A 3QFDA 1FL6A 1YEHH 5GS0D 5IHZA 1I7RA 4N0UB 4BH8B 1UWGH 1NSNH 4EVNA 2FJHB 4F2MA 3MO1B 2WWKT 1DLHB 1RZ7H 5J13C 2NNAA 4PGDB 1Y0LB 4I9WD 4OLVL 2WMPA 2ZOKA 3HUJB 1ZLWK 4UNUA 4I3SH 4FXKA 5E7FA 3RPKA 1V3KA 2H9GB 2LABA 2K7QA 3B3IB 3DBXA 2JF1A 3OAZK 3TM6A 2WIIA 4ZPVA 2YXFA 4U7KA 3VFGH 4YLQT 4ONHB 3L3GA 4R26H 4YPGB 3VH8G 1MI5D 3TFKD 1QSFD 3BUYB 3FQNA 4S1DC 5HHME 1WFNA 5CEXB 5KANI 4MAYC 2Y5TA 3T0EA 1FZJA 2B0SL 2HG5A 1QLEL 2XIDA 2V7NA 1S78D 1IC5L 2W59A 4UQ2B 5GGVL 4V1DD 3WHXA 1GYAA 4NNXA 5ICZA 4XNZC 5CJ8A 4XXDB 1D5IL 4PJBF 3DYOA 4NO0B 1EK3A 1MVUA 1MY5A 3BGMB 4Z76A 4O02L 3FT3A 1ZV5A 2R23A 3VWJA 2ZUSA 1G6RL 5HDOA 4L4TA 3V4VH 4Y4HD 1OAKH 3K4DA 1CGSH 3BT2H 3PGFL 4M6MH 3OKMB 4HK0A 4X6FB 2ZJSL 4R8WL 4QLRA 3BZEA 2UYLA 4TVPL 1ZT1A 5FKAA 2YSSA 3RTQA 2BNQA 1CU4H 1AR2A 4RCAA 2RCSH 4YHPB 3DGGB 5FM4A 3SDAA 4QF1A 4ZO7A 4XBPA 5EWIL 4GXUN 3ETBF 4RZCB 2Z9TA 2UUDH 3DARA 1VHPA 1YEKL 2X42A 4NRXA 5SWQB 5CJQH 4DVRL 2OI9A 4XPHL 3MRCA 4PRAB 4HS6B 3OF6D 4RNRB 3E6HA 4KDTA 4NPYA 5I1GH 1DBBH 1H3VA 1G9EA 4UDTA 1TVDA 3P4LA 2XXCB 3ET9F 4I0KA 1UXWB 4OZ4A 4NGHH 4M8VA 5DI8B 1I3RA 4E5XA 2YPLD 5HI4C 1DVFC 3D3VB 4K2UH 4KVNH 5F1IB 3LAFA 1YEGL 4G8GD 2VZOA 3ZDZF 3LH2H 1A6UL 3HNTL 1EJOL 1XGYL 2VDRL 1XIWB 5C08B 2FEDC 3BPLB 3D25B 3IAPA 4G6AD 3MRMB 3DRQB 3LEYH 5GJTL 1ZANH 1WWBX 2NY5C 1KFAH 5LQBH 1PD6A 2NY1C 2Z91A 5B8CC 1MI5A 3TFKA 3IGAB 5AYUL 1QSFA 4KV5E 3O9WB 3BPCB 4P3WA 1KLUB 4MXVE 4PJAF 4OCLC 1OTTD 4H8WL 4XBGB 2X2YA 1XCTA 3F65A 3O0RL 3D0LB 2WUCL 3MLRH 2F8XC 1XGUA 5K9OB 4DN4H 4MQXC 3FFDA 1RZIA 5ICYA 5JUEH 4V1DA 3O4LB 1AO7B 1MCFA 4PJ8D 1PYWB 4MVBC 5JW5A 1Y18A 2XZCH 1MCCA 1VKXA 1NMBH 1UCBL 5IGXH 5EULV 3SE8H 1GIGL 3TO2B 3MNVB 3ZHDA 2QHLA 4Z7QF 2OZ4H 3TNMB 4XNXL 1P4IL 4Y4HA 5F9AC 2XTJD 2ZCKL 4H26B 4PG9B 1OB1B 3W9DB 3CFBB 3HMWL 4X5XA 2V17L 4PJDF 1IGTB 2FBJL 5D7IB 1EZVX 3G6AA 4I48B 3EOAB 5I9QC 2VXUL 1XGRB 5K9QG 2Z92B 4MJIB 1MPAH 1JHKL 3UYPA 4NNPL 1UM6H 1XGPB 5F44A 3RAJH 4OJFL 5EFIB 3VXME 3WUWB 3BIKA 3T0BA 1JWMA 3P4OB 3GSUB 2ZSWA 3OF6A 3QNXA 1OAQL 4J3XA 1CD9B 4LNRA 4N8PA 5DLMH 5D1ZD 5L0QB 5ANMB 4PLKC 3SKJH 4N8VG 2CUMA 3IXAB 2YPLA 2FEEL 3E3QA 5CJXA 2ZCLL 4A6YH 4XHJC 2C1OB 4YDKL 4G8GA 3W5NA 3L3JB 1DZBA 1GGUA 5F88A 4U05A 4L5FH 1U42A 4D0DB 1ZGLP 3D9AL 2V2TB 5EU6D 1EA9C 3N1GC 5FUCC 2KZ1B 5GGQL 3KWWA 5I8KL 4I5BB 3MJGX 2NXZC 3GBLA 3JTSA 4OFDA 2FWOA 3BKMH 5ELIA 5IVZA 1MCNA 1GGIL 4XP6H 2AXFA 1KXTB 4K71C 1ADQH 3FHQA 2W07A 5T5NF 4EKXA 3FFCB 4PJGE 3SBWA 4FZ8H 1MLBA 2X1QA 2Y1VA 3GRWA 4YO0B 4PJXF 4PJ8A 1UWEL 3C5ZD 1KIQB 5JTWA 2IH1A 1C1EH 1EGJL 1MCOL 4ELMA 3SKOB 1EAJA 4OZGE 3IFLL 5ALCL 5EBLA 3QUZC 4IDJL 3U0PA 2HVKA 1YDPB 5DO2D 4YBLB 4OCYL 5HHVH 3IF1A 5IR1A 4FZEH 4JFPA 1FNGA 2F15A 1IQWH 1KTDA 1B0GB 2E8ZA 5IFHH 2AJZB 4HPOH 5C09B 1AE6H 1HHIB 5F9WB 1KIPB 4BFIA 3FTGA 1XEDA 1LDPL 1FVCB 4FQCH 1KIUA 2YUWA 3LKSB 3UBXI 1B4JH 2VUYA 3RX7A 1QUNA 1EHAA 2RHEA 5C0RH 1J8HE 2VH5H 2ICWA 5DRZA 4XMKH 1H5BA 1MJ7L 4J6RH 2F5AL 2P8LB 1T21A 2XA8L 1CLZL 3A6CH 1A14L 1KTLA 1IAKA 1YEIL 3SGJA 5F6HJ 4L4VB 5D1ZA 4WDIA 1KCRH 3REVB 3HC3H 3KPLB 5AZ2L 1I85A 5HDBF 1F4YL 4UOW1 4XI5D 1I9IH 2P5ED 3CMOL 3QDGD 5TE6H 1JE6A 3ZE2F 2MQCA 3IDMA 1AR1C 3X14A 4F57L 2FCBA 4F9PC 2YK1L 2PTUA 3ZTJG 5CIPA 5EU6A 5L2KD 1I8MB 1FFRA 1UCTA 4AEIL 4FQIL 3DYMA 2JJUA 2AEQL 4YHNB 5C0CD 1P84K 1FHGA 1MJJB 2IEPA 2J8UE 2R1YA 4L9DA 3CK0H 4JN2A 4U3XA 7FABH 1YPZA 5FCSH 2BY0A 2A0LD 4WJ5B 1PEWA 1G0DA 1CDGA 3MRIA 3V5HA 3SCMD 1S3KH 4GMSH 4Z7VA 4HUUB 3MLZH 5GIRB 3C5ZA 1NDMA 3KYAA 2NZIA 4HX1B 2NTFA 3VWKD 5A2JH 1AJ7L 4WUKL 4OD3H 1M05A 3DOSA 3CU1A 1FNSL 3ZE1F 5H37H 1EERB 1JZ2A 5I74B 2OL3A 5BOZG 2B5IC 3PP4L 4CN1A 3GSOB 4CVWA 1CXFA 4NDMB 3VGEA 3CDFA 1X4ZA 2VDQL 1A3LL 3MMEB 1BPVA 3F12A 4UAOC 1KT2A 3MJ9L 2X1WL 4I0CC 4NUJB 3LMJH 3MX0A 3V6OE 1FGNH 3C6LC 2DQIH 4PP1C 2AXJA 1CQYA 2CUHA 5D2LB 4HAFA 3CPLB 2IBZX 4C54A 2OR8A 1IGIH 4UILL 3FO9B 2LU3A 4EBQH 4MA7L 4NQEE 5HPMB 4U6VL 5EC2A 3OAYK 4X8XA 2Y7QA 1I1YB 4Y5XC 1LEGB 3QRFM 2BDNH 1QYGL 3QG7L 3GMNB 3GMLB 3C6SB 4M9PA 4MNGA 1GRWA 4DFHA 2P5EA 2V5SA 3HZVA 3QDGA 4UIMA 3SKNA 3HZKA 5DRXA 1FVEA 4NZTH 4W81A 1I7TB 5L2KA 1S7TB 1N3NB 2F19H 4QRRD 4FFWD 3SGEH 4JY5H 5C0CA 5HDQL 2LVCA 3K1KC 3RNKA 3ULVD 1OAYL 2OR9L 4M02A 3DRTB 3CIQA 4LPYA 2X4PA 4ZFGL 5F3HB 1Z3GL 1ZLWH 2EYRA 1H8SA 3SCMA 3I6GA 4WFGD 4OUUA 3IRPX 1UVQA 2ICEB 1HOCB 2GITB 2CK0L 2EYSB 1QG3A 2W0PA 3OAZH 3VMNA 1F8TH 2GSIA 3VWKA 3ARPA 4GBXD 1J1PL 3JWDL 5DMKB 4UIKH 3D5OF 1IC7H 1PX3A 4Z0XA 4L8SB 4KROB 1TVHA 2YPKA 4G7YH 4XP1L 3BYYA 3UJJH 1T03H 5I16A 4HJJH 3Q3GA 1VFBB 3RUGA 3BP7A 4Z7WE 3GHEH 1FQ9C 3GMMB 4JFEB 4FFEX 5KAQG 3INUH 1Q9LB 4I18B 3NN8A 3ARQA 1PG7L 5JHDD 1JNLH 5LXGL 1NFDB 4NO3B 3LRGA 5MHSD 4ORGB 3U0TB 4XVTH 2WAHA 1PG7X 1KCKA 1HI6A 4ZNEE 5C07E 5CEZE 3B4NA 1ZKAA 3ESVF 3RJQB 2F54D 5D8JH 2NW2B 3IFPB 4RFOH 5C0AB 4CMMA 4JJ5A 4Y5VA 2HWZL 2RGSA 2HRLA 1RUPH 5EG6C 4U1NA 4DOHE 2VL5A 3L5WB 1DP0A 3QI9D 1IQDA 1MFAH 5IROA 4HHAB 3GI8L 4KVCL 5DS8B 4WY7L 1CICB 5IW1A 3M17A 4RDQF 4CL7A 3O11A 5GS0L 4O58L 1XIWC 3BPLC 4OD1H 5I17B 4PJ5E 2DWDA 2GCYA 4OZHE 1GVIA 3I75B 4QRRA 5GGSY 4DAGH 4K23H 4KHTL 4GAYA 1S7VA 4Y4KC 1TQCB 4HT1H 1I8LA 5IB4A 3O9WC 4M7KL 1A8JH 3H7LA 1LD9B 3FN0H 5TH2A 1JNHB 5TPWH 4QHKI 4NC2B 3FL7A 2R2BB 1JZ8A 1PW3A 1FH5H 4M43L 4G80A 2NY2C 3UTSE 4KPHH 2R0WH 1WFOA 2B7DT 4MZ3A 3B9DA 4ZYKB 5JXEC 1PSKH 1D5ZA 3W39A 1DL7L 1SYVB 1S9VA 2VDPL 3RVXC 1IBGL 3QUMA 3T3MF 4GBXA 3VRJB 3P0YL 4IMKC 2Y5EA 3L95B 4O2CA 3UTTE 5IBTL 5E99H 4YHOL 5GXBB 3MCLL 4BK5A 1YN7B 3LHPL 3NCJH 1VFMA 3WS6A 4GRLC 3WL9A 3MXVL 4DUXA 3BRDA 2VDNH 2X4TB 1BMGA 4FQXD 5DD0H 5JHDA 5D1QD 1TIUA 3KR3L 5J1TC 5IVOA 4X99A 3CZJA 2EKJA 5D7JD 4MA8H 1ZA6B 3SPVB 1ZEAL 3WN5A 5AZEH 2AV1A 1CBVL 3TJHD 2F54A 4L4JA 4LNVA 5MEQB 3RA7L 1YYMH 3OXRB 3S35L 3PWUB 2MPAL 5B4MC 1TETL 3FT4A 1U3ZA 5GGTA 5E08L 5L0QC 3R1GL 4N1CA 1OARH 4YFDB 3QI9A 3QEQD 2OTWB 4JY6A 1F42A 3S35X 2BY3A 1K9TA 4EDWH 4R3SA 3C5JA 3E6FB 3ZDXE 4NO5A 2HKHL 1Z9MA 1PBYA 3PWNA 2BXYA 2ARWA 2Z4QA 4BZ2H 1IC1A 4LLYA 4XC1H 1CXIA 5TF1L 4MJ5B 3QG6B 2AV7A 4P2YA 5T5FL 5DD6A 4NRYA 5I76A 3O2WL 4M6OL 4XCFL 1KN2L 1H3PL 4U7MA 3LQAC 1K2DB 4ODHH 4MX7A 2FO1A 2NLJA 4WW1A 1U6AH 4L3AA 4XPGH 1RUQL 2R0LL 3KPRD 1MWAA 2BZDA 5JZ7D 5LGKA 2GJ6E 5SWSE 1U95B 1XF4A 1BAFH 2UY6A 2VKXA 2PO6B 3H9SD 3TC9A 4Q58C 2GYSA 3HZMB 3KYMB 2V2XB 5CJOH 2BOBB 3RWGA 1VCAA 4NM4H 4ZTPH 4JFFB 4POZD 1MH5A 4NOBA 3U9UA 2ITDB 4ZTOL 4X0KA 1WZ1L 5T1KB 1KELH 3QBTB 5GRZA 3VD5A 2AABH 3WFEL 1KN4L 4XBEL 3VXPB 3I85A 2IANE 1TXKA 3LN5A 3KPQB 5DR5H 1A2YA 1RZKL 4JM2F 4YBLC 2YUXA 5D6CA 1ZVYA 4XCEB 5JW3H 2IPUG 3NPZB 3P9MA 1C8PA 3LKQB 4Q9QL 5ILTL 4AQ1B 1TCRB 4FQXA 5F9WC 3G6JE 2AAVA 4RISH 1KC5L 4XPAL 4EI5D 3K4ZA 5D1QA 5ENWB 5KVFH 4DKFL 5C0EA 4LCCB 5D7JA 3K4AA 2CXGA 1Q9KB 2Y23A 1AC0A 3ILPB 1ZLVK 1MELA 1P2CA 2ZUTA 1CR9L 3V95A 3WSQL 3HNSL 1KG0B 1YEFL 3GK8L 3TJHA 5F8RC 1WBXA 1BFOB 4GXUM 2M1KA 4DKEL 3TESA 1AQKL 1S5IH 1VEMA 1VGEH 2AXGA 4MNHB 5TDNA 1NANI 1QPPA 2Y36L 1RIVL 2HTLD 2UWEE 2NY3D 3L5IA 1ZWIA 4DTGH 3MV8D 2VITA 3BP5A 1QLFA 3QEQA 2E27H 3JSSA 4AG4L 1R24B 2VQ1A 3H9YA 2OJEA 3DO3A 4P2QD 5EUOE 3TWCL 1CFNA 3G04A 2E7LE 4G5ZL 1F4WH 5K9QI 1OAXL 1MEXL 4X6DF 2DQGL 4M7JH 5GS2D 3G5YA 5LGHL 4K3EL 1NGPL 5FYLH 1I1RA 2CGRH 3HE6B 3LB6D 1U3YA 5B38A 4U6HA 4PRDB 3KPRA 2N7AA 4GW1A 1QFWI 3VFRA 1A7QL 3WMSA 3GUTB 5I1DB 1FG2B 5IVXB 4CMHB 5DQJA 4NBYB 1BWWA 1F45A 3QXAB 1NUDA 2PKDA 3BKCH 4NN6B 4P9ML 3HZYB 1I7ZB 5ADPL 2QQKH 5EORH 2D0HA 2GUOB 3TPUA 3CX2A 2A6IA 1G9MC 5EDXA 3U9PL 2FJGA 2YXMA 2R15A 4WHTA 2H32H 4D8PB 5I74C 5ID1B 3AM8C 4ZOEA 3IU3B 5IMKA 3MXWL 2VR5A 3WNMA 3VXTA 3QDAA 3SE9L 3MACH 5ERWA 1Q8MA 2BJMH 4OKVA 5F7WC 1CGWA 2OL3L 4NT6A 3TYGL 4DGIH 4EI5A 4MB5A 1T7YA 1RZ8B 1U92A 4OFVA 4P59H 2A38A 2ATPA 2X4UB 1X7QA 5JO5A 5LGJB 1X4XA 4MYWB 5D5MB 5E8DL 3V0VA 3V4UL 3MLVH 4JHAH 3RGVD 1I8KB 4O2EB 4PPTA 5ABDE 4JFDE 2E9JA 2AP2A 4FFYH 4MS8C 4P4KD 4PRBA 1T1YB 3VDCA 1KB5H 2F74B 1E4XI 1RAMA 4MJ4A 4F33B 3H9HA 4M5ZH 3MGAA 2G5RA 3GBNH 3HS0B 4NKDB 5FV1L 3T04D 4BSWB 1A6WH 4P2QA 1J0YA 1WF5A 1IEAA 5EN2B 1J8HB 4HUVB 2YZ8A 2VDLH 3O4OB 2GT9B 3GSNH 4D9QE 5DHYB 4E42A 2C7UA 1EHLH 3RWFB 2R2EA 3OAYH 4L8DA 1NCUA 3CZFA 3PWLB 2K9UA 3THMH 5J1SC 4U6YA 1E4WH 4KZEH 3QULB 3R0NA 3WV0A 4OFYD 5DJCB 3OKLB 1ORSB 5E2UL 5DQDH 3V6ZB 4XXCA 1X5XA 1BQSA 1NJ9B 4G8FB 3MUZ1 5TQ0L 1OPGL 2XN9D 1KCVL 1T20B 3VE0B 4F7MA 5BXFA 1FNEB 2N56A 4L8SC 2ADJB 2W0KA 4FABH 2LVEA 4ODXB 2DL9A 3RU8L 2NW3A 5ACZA 1N5YH 4GUPB 1DBKH 4N9GA 5I71B 1P7KA 1UXSA 1KJ2A 1TPXC 1NCDH 5D6DA 4L3EE 2XACC 4AZ8A 4FXGB 3IJSB 3PWVA 5A16B 5D7KD 4TRPL 3IJYB 1WWAX 3BSZL 1HDMB 4WU7B 4P48A 1G7PB 3BE1L 5IB1A 4NQCD 3HFMH 4DVBA 4P5TB 5FYLE 1YUHB 5FB8A 1U8LA 1EO5A 3N9GH 2PTVA 3NTCL 1E4JA 4JDVB 1EHNA 3DX8B 1MCQA 3RGVA 4Z0BL 5E70A 1GGBH 4X8JA 5IMLA 3DGCR 4P4KA 3FB7B 4PREA 1AGCA 4U1MA 1GSMA 3HRZB 4BH7A 4WNQA 2HLAA 1CDIA 1GC1H 2X4SA 4A6YB 3TBYA 2VAAB 2VXTH 3S88L 5I1CH 2ADIA 3IDNB 4KGJA 2CDEB 1NLBL 5F7EH 4F9LC 1BECA 1QSED 4ZQKB 1UACL 3HC0A 1ULVA 1UM5H 3D18A 1CICC 2HJFA 5GRUH 2H1PH 5AUMB 3KXFE 3T0WA 1G0XA 4NCDA 4P0DA 2CO6B 4X6CE 1NCAH 5C0BE 3KLHD 3C60D 3HRPA 1XR9A 4JPVL 5CJBA 5ITFB 5T3XL 1R0AH 1TQCC 3D48R 2DS4A 4P99A 3WKMH 1NEZA 1AXSA 1FGVH 1BJ8A 1H8NA 3WKNA 1WITA 1C12A 4B41A 4TTGA 1ZXQA 1JFQH 4ZD3H 1OWWA 3TP4A 3RVUC 1YQVH 4ZOAA 3ULUE 1UB5B 4U1SB 1SEBA 4OFYA 4I4WB 3RZCB 5F96L 3L7FA 3BHBB 4WU5A 3K2UH 4XRCA 1CDHA 4JQIL 2XN9A 5L2JB 4GFTB 2W60A 3WE6A 1N6UA 4JZOB 2AGJH 4PLJD 3TO4B 5HHPA 2BHUA 3DVGB 2IWGA 1SY6A 3KJ6H 1VEOA 3ARED 3C9NB 2GK0B 3V9FA 1MVFA 3VI3E 2VXSH 1T0MB 3GIVB 4HZLB 4PJ7E 5EU7E 1UZ6E 3CFDB 5HD8C 1FJ1A 3I6KA 5FM5O 3M45A 4HWBL 4WHCA 1T83A 4PY7B 4J12A 4NQCA 5I1LA 4EZMA 1CFBA 4X9BA 1VADB 1FNAA 4OZIE 5E1HB 5DRWB 1I1AB 1W72A 4LARL 2VLRD 4JY4A 3GSVA 3SQOH 1KCUH 3TGXA 3VG0L 3MRDA 1HHJB 3WIHL 3O8XB 4AIZA 1D6VH 3OAUL 3UO1L 1K85A 2YWYA 4ZXBC 4JKMA 1ONQA 5H37G 4CU7A 5D72H 4GG6F 3ZYIA 1QVOB 4XCYB 2FGWL 3FN3A 1LQSR 4I3GA 2R1XB 3QWRD 5FM5M 1OGAB 3EJJX 2EKSA 4YXHL 4G59A 1QBBA 1QSEA 4YGVB 1M71A 4J1UB 5GGTL 2P5WE 1RULH 5B3NA 2IQ9L 3NFSL 1DQMH 4K9EH 4TNVF 2AK4E 2QSCH 3H0TB 3C60A 1VFOA 3DMMB 3WNOA 4X4XB 3ARFB 1DDHA 2HRPL 1HILA 2G5BA 4MCYA 1WAAE 4YHLL 1TMCB 1F3JB 4HBCH 3DX6B 1CQKA 1RZGB 4N9OB 5BMFL 4FG6C 2JIXD 2HJLB 1HKFA 2CIIB 2V2WA 4LSVL 5DQ9A 3EZJB 1YMHB 4PJEE 4UINH 4XCNB 1WFTA 4P57B 3X3GL 4HPYL 2FB4H 4OZHB 1EO8L 3U7AA 5JR1H 2F9BT 1IZKA 3RY6C 4ODVH 4NQDB 4U1IB 5I75C 3ROLB 3F5WA 5DZNA 1HSBA 1TQBB 4JQVC 5SX4H 2RAMA 5ISZD 3WXVL 4Q9BA 3OKDB 1I9JL 1F4AA 2JCCB 1P1ZA 5EOQH 3AREA 4ERSH 4NHCL 5IK3A 1WT5C 4OGAD 3BQUC 4XH2B 4FXLA 5DJ0B 2KKQA 2EZ0C 4ZFOL 5CMAA 4Z77A 4LCCC 2XWTA 4GW5B 3ABZA 3GSQA 5FA4B 3QB7C 3UTTB 1SEQH 1JZ4A 1TJIH 3QYCA 2CMRL 4Z7UE 2PXYD 2VLRA 5HBBA 1IC4H 2NPLX 3H6JA 4WW2C 4P46B 2W0FA 1FYTE 4NQXB 5DJ6B 1T3FB 2C26A 1N64H 4QWWD 3DJ9A 2NY0B 3DNKA 3JTTA 1FN4A 2IQAB 4NJ9H 4U1KA 3QWRA 4UT9L 43CAA 2VLKE 4WUUE 5MERA 5KS9A 1ZLVH 5C9JB 2AJXH 1MLCA 1NBYB 1MQKH 3BKJH 4FTVE 3MV9E 2D31B 4S1RH 5FGSA 4MMZC 3EOTH 4GAGH 3H2WA 5EZOH 2G75A 4I0PD 1J1XH 1OWRM 3QZWA 4JM4L 3NAAL 3UZVB 3HPJB 1A6AA 4NKQB 4PP2A 3VGDA 3R4DA 3PE9A 4ZS6C 2QLVB 3HE6C 3N1QC 3R8BB 5L9DL 2GJZB 4D9RE 1A1NA 3I2CH 4ZAKB 3HAEG 3P9WB 2GK2A 3ZYZA 2XY2A 3AC0A 5FDWB 3U2SB 4F37F 1Z0NA 2JIXA 4HIJA 4FA8A 3B5TA 3T09A 5I73C 4QT5B 1N4XL 3O3DA 25C8L 2G2RA 1DANU 5DT1L 2R2HB 2YRPA 4OB5H 3BPOB 4LLWA 3CXHK 1WIUA 2QSVA 3ORJA 1OW0A 4BH8A 1IT9L 3MO1A 1DLHA 3D3VD 2Z8SA 4P5MB 4C56E 5ISZA 5SWSB 1Y0LA 4YH6A 5HY9B 2R29H 3UTQB 4JHWH 4N1EA 5C08D 2H9GA 2DLFH 2R69H 5A2KH 3S34L 5IP4A 3RNQB 4LLVB 5KJRL 5IQ7H 3MFFB 5C2UB 4ONHA 4LPVA 4MQSB 2A1WH 1NGQH 1T2XA 2WP3O 5CUSL 3MUGA 4H5SB 4M8QB 3AY4C 5SX4I 5JXAL 3MV7B 5EZIH 2PXYA 4XC3L 2APWA 4K8RH 3LSOB 1RMFL 4UQ2A 5HVGB 5FYJD 3O4LD 4PTUB 3U82B 1AO7D 1YY9D 5C0JB 1BFVL 3V8OA 3HMXL 5IW3A 3AS2A 2IAMD 1F58L 5DEGA 4NSKA 1BQHG 2BNRD 4Z8FH 3CFEB 1SBSH 2ZOLB 3VFSB 4LK4A 5GS3A 4H25A 3VXSB 1ZHBB 2HVJB 2V7HA 2APBA 2AI0H 4OSUL 4K7FA 5C0GA 4P3DB 2EDHA 4DZ8B 3OKMA 4X6FA 1L4IA 3O4OC 3OKKB 4XPFH 3OKNA 3RHWF 4NN5B 4I0PA 5HGAA 1YEDA 1IGML 5IOPB 2UWEB 5ITBL 2NR6C 4MJID 5E4EB 1MFCL 5CGTA 3T77B 2APFA 5EUOB 4G7VL 4Y0GA 2DWEB 2X5PA 4G43B 1KPUB 5IESH 4RNRA 5JOPE 4F7EB 1R5VB 4LSUH 3SJVB 4BA8A 4EQ2A 3QA3B 2VDKH 5EBMB 3SKMB 4PJFE 1P5UA 1UXWA 4KTEL 1X5HA 3RWIB 5DJDB 3VRIA 5ETUA 5DI8A 1MFDL 2HFFA 1U2HA 4GLRI 4HC1H 2OMNA 3MLWL 3NACH 1FIGH 3W82A 3D3VA 3G5XA 3SDXA 3KHOA 4JRYE 3L3OB 1CLOL 4RGMC 2VSDA 4HWUA 4AENA 4F58L 1QKZH 4NUGL 2DBLH 4HIXH 5I71C 4OAWA 5C08A 1B2WH 3HUJF 1MCRA 3MRMA 4PD4J 1LO2H 4QEGA 4X80L 4WV1C 2CLVB 1UC6A 3BPCA 5KVDL 5TDOB 1YY8B 4RMWA 1KJ2L 4P5TC 4HXBL 5GRVL 4LFHG 4XBGA 3LS5H 1OTUD 2VLME 3C08H 1X9QA 1D3CA 3FFCD 3C2SA 4NZUH 1CZ8L 1DQLH 1A7PL 3O4LA 4ZS7L 1AO7A 2YS4A 4D3CL 4XMLL 1TZHB 3W5MA 1UH3A 3REWB 4RQQA 2IAMA 4QNPE 2BNRA 1CDYA 3GB7B 4UZGA 5I8EB 3VGGA 3MOAL 4PY8J 5DMIL 3MNVA 5GGVY 1ACYH 3S5LB 4EOWL 1SQ2N 3TNMA 3UYRH 1D6EB 4G9FA 4HV8B 4H26A 4JZNA 3BO8B 4DGYH 1D7FA 4MXWH 1OM3L 5HYQA 1RVFL 1G7IA 3W9DA 2LV4A 4OCMC 3L5XL 4TTDD 2HJKB 4X4YA 2H2SD 5HVHC 4HKZA 4EUPG 5ALBL 1LNUB 3IS1X 3OZ9H 1IGTA 5F9DC 5BRZB 1BD2E 3JZ7A 1IAOB 3O6LL 5F7MC 3ARDB 5JOFA 4AEFA 4KI5D 1XGRA 1JCKA 2BMKB 3BP4B 4N8CL 4MJIA 1K4DB 1DQJA 4JFOB 4LAQL 3QIWD 2VLLA 3ZHLA 3P77B 3BD4A 1PVHA 3WO4C 1XGPA 1FRGH 3WUWA 4DEPB 3ILQD 4JO1H 3GSUA 4KJQC 4KJPC 2ILLA 4U4BA 5K9JH 2C4FT 4M48L 3SE3C 2X4OB 4L4VD 2JJVA 4GRWH 4QY8B 1DSFH 1UJ3C 3ZL4L 2XWBB 1T5XA 3LKRB 2ID5A 3ULVH 3FQTA 3Q1SH 2R39A 4QYOB 3QEUA 3OB0K 2PR4H 4HXAL 2Q8BL 1KBGH 4FFZL 4L8BB 5SV3A 2V2TA 5HHQB 4JZJB 5CS7A 3N0PB 1VDGA 3AB0C 4ZFFA 3FB6B 3B2UD 2AQ3A 2RB8A 3O45B 4I77L 1L7IH 1GHFL 2FDBP 2AJUL 3H7BB 3MRRB 4P2RB 4CDGC 3QUMH 4XX1E 1FL3B 3KJ4B 5E8PB 5KW9H 3QNYB 1I1AC 4R4BB 3TVMD 1KF9B 4UU9B 5I1IL 4Z7OE 4TPRH 2BVTA 1JHLL 3FFCA 3PXJA 4F7CB 3O8XC 1I7UA 4KHXL 3KPNB 5DD5L 2AEPH 3QCUL 1W72L 3SGKA 2YRLA 1LO4L 3SDDC 1FL5B 1PAMA 4ODBD 4M03A 1JV5A 1G7QB 2VLJB 4RWYL 2ZSVB 5CP7A 4GJTB 4PJCE 3TJEH 4HWEL 5EO9B 4WGWB 5EZLA 4TSCH 1FNLA 1NL0L 4Z5RA 1W8NA 4QHUB 3N06B 3HG1B 1PZ5B 3ES6B 4M3KB 1AY1H 3TT1H 4Y1AE 1TJHH 2F58L 3QEHA 5IIEB 3ARFC 3GI9H 2Z35B 3MBXL 2R0KL 2R4RL 1E28B 4XWGL 5EBWB 4NQVA 1CFVH 5D7IF 1IAIH 3ZKND 1YJDC 2EYTB 3QIWA 1EZVY 1IGFH 2H32B 2N1KA 4OLEA 4XCCH 5A2FA 3E8UL 4KK5C 3KXFB 3EO9H 2P8LA 3DUSA 2W65B 1R3LA 5EO1A 2HT3D 4L4VA 1C7TA 1G9NH 1P69B 3REVA 1TQBC 2FO4A 3HR5B 3MRHA 4E0RA 4OLUL 4J3VA 1IMHC 3MC0A 4DQOL 4JKKA 3CUPB 1SMAA 4Y89A 2J4WL 4J8RB 4LSPH 3LDBC 5I1HH 2YA1A 4ENEC 2P8PA 2FD6H 1I8MA 2PW1B 4DK6A 4JG0L 1RIUL 3CDCA 4YHNA 3GJEB 2WNGA 1K4CB 3NFPA 5SWZD 4XGZB 3T4AA 1JZ3A 1FORL 4NOFA 4RBPK 4PLNC 4QCIB 4OLVH 4ZUWB 2XRAH 1NCNA 5IFAH 4X7SL 5I1JL 4OLYH 2YD8A 1KB5B 3TVMA 4E9LA 4WJ5A 4XPTL 4P46C 4AH2B 3BP6B 3RWDA 1BP3B 4HUUA 4LSTL 2YPVH 2NY0C 1U8HB 1FO0A 1JF5A 5D2NC 1P7QB 1CT8B 4G9DB 1GOHA 3O6ML 4GG8A 3GSNB 1X6LA 4KROD 2IG2H 3DUHA 2DKMA 1CGYA 1HXMB 2MMXA 1HH9B 4BKLB 1EBPA 4OZIB 3P2TA 2ZNWA 4JREB 1D5IH 1V7ML 2D03H 4X5WA 5D9SA 4L8CA 4EN3B 5CZXC 4JFED 2GIYA 1FL6B 5HVFB 2Q3ZA 3SDCC 1I7RB 2DQJH 1A6VL 4Q2ZA 4KI1A 4EVNB 2JJSA 4OFIA 3CMGA 4ZAKC 2ZOKB 3EYQD 4KMQA 4XAKD 3VI4E 4Q9RL 4FXKB 2YUZA 1U8OA 3NZ8A 3J7HA 3DBXB 2BFVL 3PL6D 2A6JB 5D2LA 4ZPVB 4MJ2A 4RIRA 2P5WB 4ISVA 4NWTH 5C8JA 1X6NA 1Z9SA 2E6QA 3L3GB 4PRPE 5C0AD 3FQNB 3MA7A 4IOFD 2CKBL 3O3EA 4OLXH 3D39D 3VD3A 5HPMA 3ARRA 2Y5TB 3T0EB 3BPOC 5EWIH 2C3HA 2HG5B 1LEGA 4G6KL 3KLSA 2V7NB 1KOAA 3HE7B 3WHXB 3VXRA 4NNXB 1HYSD 2ZG3A 2D7MA 4R0LC 5DFWH 3O41B 4N68A 1XF3B 3OR7A 3WXWH 3EZ8A 2UVEA 3FT3B 1GAFL 4QXGL 1NCWL 2HFEB 3MRJB 1S7TA 2R23B 2ESVE 4QHNA 1I4FA 3B9VA 5EIQA 3C8HA 4JB9H 4KGLA 4MNQB 4IRSB 4L4TB 5SWZA 1X5ZA 4LLUA 4OT1H 4JR9L 3U30C 1KLFA 5GS1C 4HK0B 2DD8H 2CLZA 3WFBL 3U4EA 1EEUA 3DRTA 1J5OL 3ARBC 3BZEB 2AJSH 4PTTB 1ZT1B 2YSSB 3RTQB 5GJSL 5I66A 4KKBD 4M93B 3RL1A 4G3YH 3JTCA 1CYGA 4ELKB 1HOCA 2GITA 1BVZA 5CGYC 4U1GB 4XBPB 3SE4C 5IBLD 4POYA 3JWOL 5T5NG 3ERYA 4OLWL 1I9RL 5GRJH 2OI9B 4XP5H 1UKSA 3LQMA 2BNUA 5HHMD 4CADB 1A6ZA 1ZAGA 3N50A 3MRCB 3RI5F 1PY4A 3E6HB 4NPYB 4WI4A 4DKAA 3DETC 3L7EB 3RVWC 1VFBA 2FSEA 2WK2A 3MYJB 5GZOC 5T1MA 3H42L 4JFEA 4OZ4B 2DQDL 4GXVL 4UDUA 1Q9LA 4I18A 4E5XB 1KEMH 5D2NE 5KSAA 4HF5L 4XNXH 4PJIA 4ORGA 5E4EC 3PGDA 2YA2A 3NIGF 3OG4B 4H8WC 1TZGL 2IJ0C 3WFDH 3PL6A 1FFPB 4OFKA 5K9KA 4K94C 2Z91B 1X5JA 2JJWA 2NW2A 1MI5B 1CN4A 3R0MA 1QSFB 3IFPA 5C0AA 5E5UB 3MJ8A 4PJHB 1FZOA 4M1CC 5D2LF 4XP4L 5LKNA 3D39A 1K3IA 1OAZL 4L9LA 1KACB 3TZVC 2C3WA 5GS2H 1XCTB 3A0OA 3BVNA 1XGUB 3TT3L 3FFDB 5ICYB 1A02N 4V1DB 4OM1H 3OB8A 3C5SA 4B5EA 35C8H 5HJ3A 1NBVL 3RVVC 3QO0B 5J3HD 1Y18B 1VFAA 4U6XB 4UT6L 1OAQH 3F7YA 1W8OA 1XF5B 3IRZA 3V2AR 1FG9C 5JNYB 3I50H 2A77H 4YWGL 4LDEB 1SJHB 3I75A 2C5DC 4UV4L 1RIHL 12E8L 4Y4HB 4H1LA 3NABL 2DLEA 1T7ZA 4P2OB 3KPOB 1BZ9B 4H0IA 4NFDA 2X89D 2PO6D 4X5XB 3NCYS 5D93C 4WFHD 2DQFA 4TOYL 5E9DE 4JFFD 4P9HL 3G6AB 1DLFH 1HKLL 1SYVA 4TVPE 1GGIH 3NOIA 3PWPB 1C5BH 2AXHA 1EDQA 3VRJA 1AXTL 5L6YL 1UM4L 3QT2A 5HHMA 1NC2B 4LPTA 1G84A 5HTSA 1JWMB 1YN7A 1T89C 1FFNA 2ZSWB 4GKSB 4POUB 4WHYH 5FHBH 3TPKA 1UKQA 5M7QA 4RGNC 3Q6FA 4PB9H 4LNRB 5AG9A 1A0QL 2VXVH 4G6ML 4EQ3A 3W9EA 2R0ZH 4H20H 3CSYB 2GTZA 5E8EB 5HHXH 2YPLB 2WUBH 3QAZC 1A1OB 2APTA 1T2QH 3ARDC 3WD5H 1U3HC 2VIRA 4TVSa 4G8GB 3CFIC 3FMGH 2COQA 2GKIA 1ZA6A 1NFDF 5DUPH 5AEAA 1NCBH 4LRNL 1AFVH 1ZSDB 3O2DL 3C09B 5CD3B 2CRMA 1NBQA 1W0WA 1MCLA 4DEPC 4YFEA 1AXIB 2VNCA 3JTSB 2FWOB 5MEQA 1LWRA 5IVZB 1OQXA 3OXRA 5D1XC 1QRNE 1JVKA 2GFBB 3AU1A 3B5HA 1XMWA 3TBTB 4PS4L 2FYYB 5IEKA 1MLBB 4RMRA 5E6IA 5HGDA 3SGDI 4YXKH 2VDOL 4PJ8B 4DUWA 4RFNB 2HA1A 3LZFL 5IWLC 4X7TA 3IFNL 1JYNA 4OCWL 2IH1B 4FN0A 1YEIH 5KTEL 3BWAA 1BOGA 3QG6A 4MJ5A 1CL7H 1F6LL 4HKXA 3ULSA 5EBLB 4BYHA 3Q2CA 3VXUE 4JQXC 1JGVL 1F4YH 1KEGH 3U0PB 4X7FC 2HVKB 4PJFB 3KJ4C 1KUMA 4JFPB 1FNGB 5C71A 1KTDB 3BDXA 4F57H 2X89A 5J6HB 3QSKB 2PO6A 5FYKL 2XKNA 3SY0B 3LQAL 4LCWE 1FYHB 3HZMA 3KYMA 4Q6IC 4N90E 4B7IA 5LBSL 4P3CL 2OLDA 5DFVC 4JFFA 4WTZA 4BFIB 3OB0H 2K7PA 1F90L 4Q0XH 2ITDA 3MOQA 1FSKC 2FEEI 2KZWA 1QR1A 3P0VH 4GKZA 1SJVA 2GHWB 3GFUA 3LOWA 5C92A 4YHYB 3FOLA 2DRUA 1IILE 4YFLF 5DMGC 3TNNB 1LK2A 4HLZG 3L3HA 5L8KB 1N59B 1IAKB 4HS8H 1AJ7H 3MRFA 4WUKH 4AT6B 2HKFL 1INDL 5F6HI 1J0JA 4ZUVB 1T1WB 1BVKA 4AMKH 4HUXA 4JKWA 2EDEA 5EU4A 4HLJA 3PP4H 3IDMB 4ODTL 3ILPA 2DJ4A 2X6MA 4OGZA 5BVPL 4WIQA 4RGNE 4LSSL 2M26A 4KRLB 1BFOA 1V7NH 4F8QA 3MLSL 4RAVB 1T5WA 4TULH 3MJ9H 4TUKH 5T33L 4UV7H 1AGDA 1MFBL 5KSBE 4OGXH 3NFNA 3MRIB 3V5HB 5C6WH 2W9DL 3EHBD 2LQRA 4XB8A 4Z7VB 2DKUA 4GKOA 3EYOA 2P1YA 1INEL 4YR6A 1J8HD 3C5ZB 4S1SL 3VXNB 2MHAA 3BAEL 1DBML 2NTFB 4U6VH 2JELL 4J4PD 1FCCA 1WSST 3WJJC 2NQCA 5A2IH 3NIDE 4YK4C 4KJWC 2IH3A 5HYEA 2CJUH 3LKPA 2EDYA 3GUTA 5E8OA 5I1DA 3UEZA 5IVXA 1Q9WA 3S4SA 2DB8A 2ITCA 1I7ZA 2OQJA 3F12B 1KT2B 2GUOA 3EJYC 4OTXH 3ZZ1A 1JYXA 5T3ZL 4RBPH 1Z3GH 5LWYL 5ID1A 3ZTNL 3UROR 1G9ML 1URLA 4QO1A 1OSZB 5GRXG 5EC2B 4EN3C 3IB4A 4PJGA 3EYSH 4JHBA 4LKCA 4R4FH 3B6SB 1LP9E 4JDZA 4XWOD 3PHSA 2Q6WA 5BV7H 1MIML 2YA0A 2QQQA 3UJTH 2P5EB 3HZVB 5E2JA 3QDGB 3SKNB 3P9LA 2X4UA 1XCQB 5FV2A 4Y2DD 5LGJA 4Y19E 5DRXB 5CP3H 4M6NH 5L2KB 2DDQL 5IJKA 3E2HC 4M3JA 1I8KA 2KH2B 4TUOB 3I84A 3UJIH 1NPUA 5EO0A 1V5JA 3EO0A 1HWGB 4S0SD 2AJVL 1JBJA 2X4PB 1DEDA 3MRPB 1JRHH 4NKDA 3SCMB 3I6GB 3T3PF 1S7QA 4OUUB 1DBJH 1UVQB 4LGSB 5HI3C 2YD5A 1S7SB 1LILA 1J8HA 1YC7A 4LLAA 2GSIB 3VWJC 4J4PA 4M62H 4ZNCD 4Z0XB 2HLFD 1A7RH 1EMTL 2D7OA 3UPRB 3LN4B 4NQED 1RUAH 4PJBE 5JPNA 3UAJC 3GI8H 1AD0B 4AQOA 3PWLA 3BP7B 3RTQC 2GJJA 3ESUF 2OS7A 3NN8B 2AS5M 5DJYA 3T8XA 2QHRL 4KHTH 3UBXA 3SDAC 5IVXF 1ORSA 4GO6B 1NJ9A 4U1GC 3MGOA 4IRJC 2J8UA 2ADJA 3VG9B 3BDYL 3TO4D 5INCA 3VXOA 3WFHB 2IPTH 1YNKH 3FB8A 4LOUC 4KDTC 5KZCD 1PJ9A 3IDIA 4S2SB 4AIOA 1NUNB 4GUPA 5TFSL 5C3LD 1IBGH 1T4KB 3RZWA 4WVRA 3WEXB 5GS0C 1UENA 5ECJE 1IQDB 1ZLUK 3RWJA 3UTOA 5A16A 5KG9A 1PGRB 3IJYA 4V2BA 3MCLH 1AGBB 2EC9T 3LHPH 3CVHA 1KCSH 4WCYH 5IW1B 1RHHA 4QXTB 4Z7NF 5CINL 4BQ9A 3PV6A 1YUHA 4Y2DA 1MCBA 3MXVH 5CSBA 5KN5B 2DWDB 2MFNA 1IEBB 4ODSL 3MTRA 3DX8A 4OIBA 1F4XL 4JO4H 4QRRB 4GRWB 2OSLA 3FO0L 2RIKA 4YHKL 5JMRA 1S7VB 3TFKC 2EDWA 4FOMA 4FQJH 3D2UD 4QRQA 3JV4A 5IB4B 3FB7A 5D5MF 2NX5E 5CBAB 2WWKO 2CDFB 2W1NA 4OZFA 5TH2B 4N0YL 4YC2B 2ZUYA 4CN6A 3X13B 1ZEAH 1OF2A 4G80B 5H2BA 1FPTH 1S78C 1OGAD 2CDEA 4M1DL 1NDGB 1C5CH 3A6BL 3V6OA 3W39B 5E2TL 4PJAE 1S9VB 4WI9A 5AUMA 1A3RL 5CEZD 2MPAH 1BEYL 1JGEA 1L7TH 1JIBA 3QUMB 1TETH 5H94A 3ZLQC 1CVRA 3R1GH 2IGFL 2NZ9D 1HXYA 4YZFF 2YBRB 4JG1L 2IC2A 3DMMD 6FABL 4NQEA 4Y4HC 4MXQD 2AK1L 3VFMB 3WFZA 1UWXK 3CSPA 4YAQB 2Y4SA 4M1GH 3KPPB 2DQCL 1J10A 2P24A 3WLWD 1JFMA 4OQTL 3O2WH 1OP3K 2YUVA 4Z7QE 2IMMA 4KKAD 1H3PH 5JHDB 1Q0YL 1YA5A 3SDYH 4X99B 2F5BL 1RUQH 2R0LH 4JAMA 3S36H 4FQ1L 3WN5B 3TIDB 4ODUB 5L2JA 4PJDE 2AV1B 5TE4L 4K9EC 3W0WE 4PBXA 2F54B 4LEXH 2BNQE 4O2FA 1IKFL 3O2VH 3RL2B 2CH8A 5FHAH 3FT4B 3UTSD 2GK0A 3BZ4B 4BQCA 4F9PA 1QNZL 3GIVA 5FUOL 1ODAA 4U1LA 1J1OH 3CFDA 3QI9B 5FYJH 1MFEH 4JY6B 3E3QC 3N1FC 5CJXC 4R3SB 3C5JB 1RZKH 4JO2H 1BOYA 4NO5B 1JN6A 3PWNB 4XAWH 3PHOA 3STLA 2Z4QB 2DI9A 3UTTD 4LLYB 4G6AC 3RIAK 3EW3B 5DD6B 3VFVA 3NA4A 5I76B 2VKWA 4TUJB 2G60H 4OD2B 1KC5H 4XPAH 3D2UA 4WW1B 3LPWA 2YMXH 2X9XA 4Z7WA 2O5ZH 2C9AA 1OTTC 4QRPE 1XF4B 1QVOA 3GHBH 3DSFL 4QOKE 3L9RA 3RWGB 3GGWA 4PJ8C 4RFNC 5DDHB 2AVGA 4YGVA 1MH5B 3U9UB 4NP4L 4ZNEA 1CLYL 4J2XA 2W38A 5KVEH 2Y36H 3OPZH 4XP9H 3ALWA 1KJ3H 1I1CA 2Q7YB 4A2MA 3G08B 3QDME 3L3KB 2A9NL 3VCLA 2ZCHH 3ARWA 3H0TA 1A2YB 1E6JH 2LE9A 3DMMA 4PJXE 4CN4A 1WJ3A 4MXQA 2XTJC 1RJZB 3RDTD 4WEBH 2DLTA 2O5XL 4R2GB 3C6LA 3P9MB 5L88L 1RZGA 2VUOA 4G8IA 4KQ3H 1NFKA 2AEIT 2QQLH 2HJLA 2R4SL 5D1QB 4OCRL 3BN3B 5KVMC 4TN9A 4XCNA 1EEYA 4P57A 5I30H 3GMQA 5D7JB 4OZHA 1XF2A 1P2CB 32C2A 1EO7A 4PUBL 2BERA 4U1IA 4F8TA 1BBDL 4XPBH 2BVOA 1H5BC 1WBXB 2BVPA 5MP6L 2GJ6D 3V8CA 5SWSD 4MA1B 2AXGB 2FECL 4PRHE 5TDNB 1BQLL 4ACPA 3PNWA 3SGJC 3UTSA 1EVTC 2WBJB 5D1ZC 4JFZL 2VITB 5FYKU 5BS0B 1LO3L 3Q6GL 3QHZH 4CW1A 1QLFB 3QEQB 4HQQH 1I85C 1GPOL 2VQ1B 1A5FL 3P30H 4XH2A 2OR7A 5DJ0A 4Y4KD 1CFNB 3G04B 1KGCD 4YHML 2D0FA 3B9KB 1I9EA 2ZKHL 3MXWH 4GW5A 1S7UB 3KS0J 3HC4H 1HQ4A 2IAND 3MV7D 3UTTA 3D1MC 5TE7L 3G5YB 5HDBE 4MWFA 1CD8A 2E9BA 4NQXA 2J6EH 3ZE2E 2KPNA 4HFWA 5DJ6A 4NYLA 3ZYOA 5JW4N 3BGFB 5CSZA 5B38B 3E3QE 4TNWK 4TSBL 2PN5A 3KPRB 3VFRB 1YEHL 3ZO0A 2IQAA 4NQUA 1UWGL 2E6PA 1KSRA 3HI1B 1NSNL 3OXSA 1T0PB 1RZ7L 2VC2H 3C5ZC 1BWMA 4I3SL 2FH6A 3UTPE 2MCPH 3TPUB 1A7OH 2EH7L 2Z31D 2A6IB 1BX2A 4WHTB 2Z8WC 3VFGL 4R26L 3HPJA 1LK3H 2PETA 5IMKB 5DO2C 4RMTA 5D96C 2A83A 3RDTA 3VXTB 3EAKA 4JPIB 2KBGA 3ARVA 3ZE1E 4NT6B 4JFXA 1T0NA 4EI5B 4NKIH 1Z9OA 1U92B 1UYWH 2R2HA 3MLPA 1YEEH 1X7QB 5J12B 2XTJE 1WK0A 1KCGC 2DM4A 3VDBA 3H3KA 5FXCH 3U79A 3V0VB 1J11A 1PY9A 3V4VL 4QKXB 2GJ6A 4P5MA 1CGSL 4PRBB 5SWSA 4M6ML 3FT2B 4KDVA 5JOEA 2NY3B 3UTQA 3FQUB 5IUSA 1KCVH 3H9HB 2XZAL 3RNQA 5IG7B 1OHQA 2RCSL 5GRVK 2JCCF 4LLVA 3WS3B 4XI5C 5GHWH 4U0RC 4HUWA 2OP4L 1QP1A 3G5ZA 4P2QB 4Y4KA 5A43C 1FO0H 1IEAB 2AJYH 2IANA 5I1EH 4F15B 2P48B 4LCIH 4UI2A 1X5LA 1DBAH 5CJQL 4DWHA 1LHZA 2C7UB 4E42B 2EDOA 5IBUB 2QTEA 1ZK9A 2R2EB 3NA9H 5I1GL 3BE1H 1A6PA 3KLDA 1F4HA 1E4KA 4G8EB 4RMQA 1BJ1J 3CFEA 4BSVB 3G6JA 4NGHL 3VFSA 2A0LC 4U6YB 1UZ8B 3RWEB 2P44B 3NTCH 1ZHBA 3SCMC 1TTGA 3S97C 1VESA 4KVNL 4K2UL 2F53B 5EU6E 2WQRA 1LO0H 2Z31A 4TNVK 4RRPA 3QQ3A 3VWKC 4LEOA 4F7MB 1W0YT 1YPZE 2P47B 1KFAL 5LQBL 2VZUA 1KCLA 2R9HD 4PGCB 5BRZD 2LTQC 3QPQD 2UWEA 4Y88A 2NW3B 5ACZB 5KSBB 4HKBA 1P9MA 1P7KB 1UXSB 1MAKA 5EUOA 4DN4L 5JUEL 3PWVB 3KYKH 2E7LA 4Z6AT 4H88L 1UJTA 3NCCB 2PTTA 4OIAA 5TDPB 2QKIB 3TCLB 1M7IB 4FQLH 1PQZB 5T1DH 5IB1B 1R5WA 4LIQH 4XTRD 2XZCL 4D9QD 4DVBB 4V3DB 1NEZG 1WC7A 4MQ7A 1NMBL 5FB8B 1OCWH 1U8LB 4CVUA 3W2DH 3TBWB 4JDTL 4NFCA 5IGXL 4OKDA 1A21A 5DJDA 3VG9C 3SE8L 2JB5H 5FCUH 3RGVB 2OZ4L 2RFXB 4P4KB 1RZJH 2LAGB 4KDWA 4MSWA 3L3OA 4PREB 4U1MB 4Y5VC 4BH7B 2X4SB 4X98A 4RA3A 5EZJA 1X5AA 3O3AA 2D7TH 3HI5H 2ADIB 5C0DA 1A4KB 1JF1B 5IROC 3HPLA 1YNTA 2CLVA 1MJUH 3HC0B 2XQYK 1ITBB 1JNNH 3EKCA 1N0XH 1YYLH 5EB9A 1MPAL 2UZIH 5AYQA 1UM6L 2I07A 5E94B 2Y9RT 1R5IA 5C6PB 2BC4A 4FFWC 1HYRC 1T04A 1QPXA 2H8PA 3V52H 4LPCA 1I8LC 3LVEA 3ULVC 2WQ8A 1NEZB 1AXSB 3REWA 1RURL 1AH1A 1C12B 3FQWB 3GB7A 5DLML 3QH3A 3T08A 3SKJL 2VLJD 3D85B 3TF7C 4A6YL 3EYFA 5FYLD 5DRNA 1D6EA 1UEMA 3KPSE 4NKOA 4WU5B 4HV8A 5C0CE 2YD2A 4XRCB 1ES0A 4D2NA 3BO8A 4UMGA 4L5FL 1IZJA 1KLGB 4GBXC 5HYSB 3ROOA 3HG1D 3NZHL 2W60B 4JFDA 4JPKL 4P5KB 1UB6B 5HHPB 5BRZA 4Y8AA 3TCXA 3BKML 2I9LA 1IAOA 3WS6C 3A67H 4XP6L 3VFTA 3P4NA 3RWHB 3VXQA 1LDSA 3BP4A 3T3ME 3WDHA 4UTBH 1ADQL 2A9ML 1CLCA 1SJEA 2X09A 1FJ1B 3B9EA 4R4ND 4FZ8L 5HI5D 3KXFD 1A7BA 1FNHA 5GGRB 1J9CT 4NQCB 5I1LB 2HRPH 5C0BD 1C1EL 3WN5C 4M5YH 2X4OA 2DMBA 3LEVH 4QY8A 2P45B 4JY4B 4UT7H 3GSVB 1JL8A 4H1LH 4JRXB 1UWXH 3UZQA 2Q20A 4LBEB 5CZVH 4OF3A 5HHVL 3BN9D 3S8WA 3X3GH 5F6IB 1WWWX 1ONQB 1IQWL 5EH1A 3ZE0F 5JLZB 4L8BA 1OP3H 3ULUD 2PYFA 3GSWB 3QI9C 4HPOL 4MB4A 1AE6L 2HT2D 4JZJA 3FB6A 1QSEB 1JI2A 1Z9LA 3O45A 3RPIA 4FQCL 1IGCH 3MRRA 4PRIE 5EIIB 2DQEH 1FL3A 1B4JL 5DK0B 5E8PA 5C0RL 2HT4D 3QNYA 3MR9B 2VH5L 3OR6B 3U48A 4XMKL 3IETB 2P43B 3C60B 4F7CA 4M4RA 1SMOA 3A6CL 5MI0C 1DDHB 4L3EA 1HILB 1J0ZA 4OGYH 5HYJE 4LVNB 2K1MA 3IAGC 1FL5A 5T3XE 4PGBA 2NY7H 1RJLB 1KCRL 3HC3L 3DWTA 2CMRH 1G7QA 2XNAA 1KV3A 5KVGL 2ZSVA 4X9HA 1I9IL 5DQ9B 2CDGA 2VZ3A 1JPSH 5EO9A 5TE6L 1XT5A 3BH9B 2EO1A 1IRAY 5HHNA 4QHUA 1A4JA 2PYEE 2C3XA 3HG1A 4B53A 3F5WB 5C6TH 1HSBB 2AEWA 4HK3N 1K8DA 4XNQA 3NCFB 5BW7A 3CK0L 1MCSA 2EDKA 4LVEA 7FABL 3KDMB 3KYNB 1XGTB 1E28A 2E6JA 5EBWA 2ZPKH 2FJFA 4OCSH 5IK3B 4MGXA 5F7HA 5MEPB 1WIPA 2EYTA 4LLQA 1X3DA 4FQXC 2H32A 4GMSL 2HH0H 4PJAB 2P5WD 4WWKD 3KXFA 5D1QC 3MLZL 4UQ3A 5CMAB 4H0HB 2HAZA 2B4CH 5D7JC 4R6UA 4X6CA 5DWUL 1TNNA 2W65A 1JPTL 3F7VB 3GSQB 5JDSB 5C0BA 5EPMB 2AK4D 1J7VR 1EFXB 4OD3L 1DEEB 3RY5A 4PBVC 3TJHC 3HE7D 3HR5A 4HMCA 3BX7C 3GMPB 3NIDF 1L0YA 1BLNA 25C8H 3CUPA 5BV7B 5FAAA 4J8RA 5DT1H 3NCBB 1WCBB 3JTTB 1FN4B 3KPMB 5MHSE 1RK1A 2AKRB 2WLZA 4CVZA 3K1DA 1S9XB 43CAB 1IM3A 1K4CA 4I2XE 2E9IA 2Q76A 4IRSD 4MNQD 5E6YA 5MERB 4QCIA 2XZQH 1MLCB 3LMJL 5L8LB 3QWQB 1FGNL 2DQIL 2MSPA 4F7PA 3BPNB 3QZWB 4LQFH 3BP6A 1A6AB 4ZG1A 4PP2B 4K3DL 2FGZA 4I8DA 1G6VK 4Y5YA 1A1NB 3BGFC 4LLMA 4EBQL 1FP5A 4PJ7A 5JZ7C 3ZYJA 2XY1A 4X6DE 5HYFA 1P4BH 4KKCD 2BDNL 2EE2A 2FZ3B 5IF0A 2JIXB 4HIJB 4ZUTB 2ZZUT 4HWNA 4POZC 1HXMA 4Z95H 3O3DB 1HH9A 3EDJA 4O9HH 4S1QL 4O51B 4BKLA 4OZIA 3LD8C 1JUFA 4QHMA 3CDYA 2OTUA 4LLWB 2EDQA 2F19L 1IVLA 1FYTD 2IADA 1B88A 1OAUH 3L6FA 3IU4H 2ZG2A 5ISZB 5DHVH 4QRPB 3X17A 1WBYA 5K59E 1JGLL 2JJTA 2VO5A 2VLKD 3PABA 4WUUD 2QADB 1YMME 1ZTXH 2A6JA 4JKLA 3H3PL 5D7LE 2K3TA 4FTVD 4EI5C 3MV9D 2P5WA 2XQBH 4WWKA 4WI7A 1SM3H 1F2XK 1F3RB 1NBZB 1WWCA 3QDMB 3MUGB 4XVJH 1F8TL 2AK4A 4TSAH 4PJXB 4UIKL 1IC7L 2PXYB 4D9RD 4P4RB 3HE7A 5I15H 4G7YL 2W91A 5ESAA 3M8OL 1T03L 1WAAA 4HJJL 3O41A 2HTLC 2SEBB 2NY3C 5HDLA 5DEGB 1XF3A 4NSKB 4NHUE 3P4MA 1BREA 1CDJA 3MRGA 3GHEL 4IS6B 4JCMA 3INUL 2HFEA 3MRJA 3ZKMD 4H25B 4PJEA 4WI3A 2V7HB 3QEGH 1MFDH 1JNLL 4LLDB 2A2QT<