2GAZA

Mycobacterial lipoglycan presentation by cd1d
Total Genus 79
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
79
sequence length
273
structure length
269
Chain Sequence
NYTFRCLQMSSFANRSWSRTDSVVWLGDLQTHRWSNDSATISFTKPWSQGKLSNQQWEKLQHMFQVYRVSFTRDIQELVKMMDYPIEIQLSAGCEMYPGNASESFLHVAFQGKYVVRFWGTSWQTVPGAPSWLDLPIKVLNADQGTSATVQMLLNDTCPLFVRGLLEAGKSDLEKQEKPVAWLSSVPSSAHGHRQLVCHVSGFYPKPVWVMWMRGDQEQQGTHRGDFLPNADETWYLQATLDVEAGEEAGLACRVKHSSLGGQDIILYW
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system
molecule keywords T-cell surface glycoprotein CD1d1
publication title Structural characterization of mycobacterial phosphatidylinositol mannoside binding to mouse CD1d.
pubmed rcsb
source organism Mus musculus
total genus 79
structure length 269
sequence length 273
ec nomenclature
pdb deposition date 2006-03-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2gazA02
3.30.500.10 Alpha Beta 2-Layer Sandwich Murine Class I Major Histocompatibility Complex, H2-DB; Chain A, domain 1 MHC class I-like antigen recognition-like 2gazA01
4HIEB 2GJ6E 4X9HA 4QOKD 4KQ4H 4ZTOL 3UTTB 2DBLH 3BZDA 1H3PL 5BV7L 4KJQD 1B6DA 2J5LB 3A6CL 3ULUE 1BJ1H 3KPNB 4AEIL 4NWUH 3V79C 2K3TA 4LLMB 2P5WB 4C83A 1A1OA 1GOGA 4G6KH 2WUCH 3RIFF 4K9EH 3WDJA 5E7BA 1IL1B 4NUGL 3A67L 2VAAA 3ZZ1A 1K6QH 2Z8RA 2NY6D 3S8WA 4QF1A 3L5WB 2W0LA 2H32B 1KXTB 5DMKA 4JHBA 4FNLH 4LSVL 4XP5H 4L3EA 1E4KA 3BGMA 5SWQB 1NMBL 3PL6B 5D93C 2EDRA 1OGAB 3QEQB 4HFWB 1KEML 1K9TA 1D6VL 3UZQA 4BH8B 4AENA 3F7QA 2DYPA 2BNRD 1N5YH 3T08A 1DVFB 2W07A 3GBML 3QXVA 4P46A 5LVEA 5LGJA 1F8TL 1MJJB 1A7QL 4U1KA 3GHEL 3UXFA 4JG0L 1K3IA 5DT1H 5JDSA 2Q86B 2QEJA 5IIEA 2Q8BL 3ULUF 4F58H 3PWUA 4L3EE 1S7XA 3MUJA 1GPOH 4RIRA 4APQC 4LPCA 3X3FL 1GGBH 3ZT6A 1IGYA 5CIPB 2ARJA 4S2SA 5LKNA 4XAWH 3IKKA 5FA3B 3CIQA 1U8MA 5KJRH 3QCTL 4YHNB 3PJSB 3U1SH 3W82A 3DYMA 5D7IA 1T22B 1YQVH 2AJYL 3T09A 1E6OL 3HAEG 1MCLA 2ESVB 3BIBX 4OD1L 2WP3T 4P2QB 1IFHH 4GKOA 5DSCB 1X6LA 2WUBH 3MRGB 3BKYL 2OI9C 4PGJA 4FOMA 3T0BA 3RWEB 3VWKD 3VGAB 5FV1L 4Z18A 1EV2E 4LCWB 3GJFH 4FFZH 4HLZH 4BQ9A 5KW9L 3FFDA 5CEYB 1ZA3B 3OL2A 4OF0A 3V0VA 1I8KB 4LLAA 2R2HA 3RDTD 5E0QA 5I2IB 2GCYA 2QJDA 2MHAA 5D7IE 4PD4K 4TTGA 2IAMB 4OM1H 4R3SB 2UVEA 2V5YA 1RIUH 3BGFC 2Z91A 3G5VA 3KYMB 1P2CB 2V5RA 5IG7A 3ARGC 4OFYD 3HTLX 3R1GH 5A1AA 3UBXA 1FO0H 4N0YH 4JFQB 1GVIA 3GJFA 2Q6WB 4BZ1L 5JOPD 1XF4A 5AAWA 3A6BL 4EDWH 5CD3A 5IBLD 3G6DL 3NACH 1UB6B 1CLYL 3FFCE 1SJXA 5F7EL 2F19H 3LKSB 3VXRE 5CBAB 1IBGH 4OKVA 3BXNA 1BZ9B 2CKBH 2DM4A 2E8YA 1X6NA 4QRPB 4P0DA 5HYSB 4PJIE 1G9ML 4Q97A 3QR2A 1CDCA 2GK0B 3S96B 3NGBC 3STBA 3CFEA 2V2WB 1FO0A 4XZUA 2JB6B 4O2FA 1RJYA 5BZDB 2JB5L 4YDJB 1JNHA 3I75A 5J9PB 3UBXG 3VXPB 2R1XA 3TNMA 4R97B 3TBYA 3D85A 1U8JA 4HLZG 2XZCH 3K2MC 5D7IF 4Y5VB 4M1CC 5DHVB 5JZ7D 5TDPA 5C09A 4P2RB 4UU9B 3WS6A 4QHUB 2CKBA 3MLZH 5KG9A 4I3SH 1VFBB 2D03L 4M1GL 1PEWA 5T33L 5EZLA 2HLFC 3EYOA 5DUPH 3TJHD 2YOCA 1U0QA 1AQDB 2Q20A 3OKYA 3LRSA 1ACYH 1S7QB 3UJTL 4E9LA 5GRWA 1IRAY 2NY1C 1CF8H 2R69H 5GGTL 3T3PE 2CGRH 3RAJH 4X7TB 3CFJB 4LQ1A 4PTUA 5D7JB 5DJAA 2HG5A 4TN9A 3HB3D 2EIEA 4JDZA 5I8CA 1F58H 4MD5A 2X7LA 2XACC 4HIEA 5C09E 1VENA 3UTTA 2H32H 1FLRH 3P73B 5E70A 5HGHB 4MXVE 1EHLH 4U2YA 1EPFA 3O6LH 3VFMB 1Z9OA 1I1FA 3KPNA 1ZLWK 1KENH 3T0XA 4LLMA 2P5WA 1JWMB 3CNKA 3KS0H 2J2ZA 4GAYB 1U8IB 1HH6B 2WIMA 3AS1A 4JJ5B 4JR9H 1EHXA 1DBJH 1IL1A 3V95A 2J8UF 5MP6L 5CGMA 4N0UB 1MQ8A 4BFEA 5EFIB 3L5WA 3UTTE 2DM3A 2H32A 2NY4D 4DQOH 3TN0B 4I0PD 3O6KL 4B0MM 1EHAA 3TO2B 3BAEL 4JFDE 4LSQL 1XR8A 5SWQA 5A16B 3PL6A 1VFUA 3BUTA 5AEAA 3QEQA 3GMPB 1M6OB 4HFWA 5I8KL 3HC0B 3RWCB 4HXBH 6FABL 2P5WE 4YBLB 5AD0B 1AH1A 3MTRA 2W65B 4BH8A 3NIDE 5CIPH 5AWNL 3MNWB 3C2AH 1JN6B 4DK3A 3R06B 1DVFA 1EGJL 1NGPL 2BVYA 5EUOE 4WJ5B 4KKAC 3LZFL 4JRWA 3H9SD 1MJJA 4KU1A 4O4YL 4J23A 3O2DH 3UTZB 1FE8L 2NY7H 4HDIB 3BN9C 1OL0A 3M8OL 4MJ2A 5DR5H 2DQCH 4HZLB 3QEQE 2FEEI 2VDPL 1H9VA 1E4WL 3TPUB 4ONFL 1I1AB 3IFNH 4HCRL 1OP3K 4LSPH 3S3SA 5K9JL 2CK0H 1CR9H 3DIFB 5CIPA 2FH8A 2VL5B 5EU4B 3B9VA 5FA3A 5DJCB 3OJMB 4JREB 3PJSA 2H1PL 4AEFA 5EORH 2ENYA 1T22A 3GK8H 3MLVH 1NGYB 4K3GA 4XNYH 5IB4B 2ESVA 3IGAB 5IROC 2CRYA 5DSCA 4M1CD 1IGIH 2EC9T 3O2DA 3MRGA 4F7TB 3MCLH 1LMKA 1FVCB 3VH8A 5EWIL 4I5BB 2MNUA 1D5XB 3PG2A 3RWEA 4BZ2L 3AREB 3T65B 1CXFA 1F97A 3RX5A 4LCWA 2HH0L 1D9KC 4G8GE 1KFAL 5CEYA 1ZT1A 3MRFB 4J12A 1ZA3A 1R24B 2NY1D 5IFAL 2WMPA 1A7PL 1FC2D 1I8KA 3QIUD 4WEUD 1IVLA 2VZSA 1T5WB 1HEZB 5E24E 5I1HL 4JO3L 4K07A 2KQMA 5I8OL 3MOBH 5I2IA 2ICWJ 3BKJH 1AXTL 4UILL 4R3SA 4G7VH 4IRZH 3LQAL 1DLFH 1I8MB 1PQZA 4PR5B 4V3DB 4P59H 1P2CA 1YJDC 3CDYA 4WFHD 4GRWE 1N4XL 3TA3C 1JGEB 4H0GA 1DUYB 2OYPA 4JFQA 5EU5B 2FX7H 2V5SA 1EEQA 2Q6WA 4GSDL 3EZJB 2VLKB 3DRTB 3JBG7 4LU5L 2GW5A 4U6YB 2PW2A 3I9GL 5H37H 1UB6A 1UH4A 1X5IA 1YPZB 5ILTL 2ATPB 5CBAA 5DHVH 3H7BB 5T3ZD 2F8VA 3J7HA 1BZ9A 3MV11 4I0KA 2VDKL 4LCCB 4QRPA 2E7HA 1DBML 5HYSA 1KLGB 1VGKB 4HSQA 4AQOA 4R8WL 2GK0A 3S96A 4AT6A 1DP0A 4YHZL 1FFQA 2C1PB 4FQIH 2V2WA 3JSSA 3OMZA 1C5DB 4H20H 1LO4L 5D1QB 5FYLH 2JB6A 3W0WE 3LN9A 5BZDA 4YDJA 4NKMB 1WTGT 5J9PA 3VXPA 3F7PC 1SM3L 2I60L 3NIFF 3RZCB 2G2RB 4WEMB 4IRSD 2YR3A 4KI5C 1RUAH 4Y5VA 5DHVA 4P2RA 4UU9A 3BKMH 4QHUA 4NZRL 4KKAD 2VUYA 1VFBA 2YMXL 1EJOH 4KDTC 5E8DH 4Q0XL 1QLEH 3PGCB 1AQDA 4AIXA 1EA9C 1S7QA 5HYSG 2E7MA 1GSMA 3K4AA 5LWYH 1KBGL 1KCSL 4CVXB 1NFDE 1QKZH 4CU7A 3KPSE 4X7TA 2VZ3A 3CFJA 3NBNA 4XI5C 5BRZE 3DUUB 4QKXB 2DTSA 3DXAD 1I9EA 3OF6D 4GMSL 4Y2OA 5TQ2H 2XY1A 4FQQB 2NQCA 2ZNWA 2ZUQC 5H37G 3P73A 5HGHA 5B4MD 1YEDB 3DURB 4Q74A 2UYLB 4IMLB 4GBXC 3VFMA 5EBMB 4RRPG 4RCAA 4UIKL 1ZA6A 5D1ZB 1JWMA 4ODTH 5FYLE 4EKXA 2A1WH 4WFFD 1U8IA 1HH6A 2MSPA 4JQXA 5F7LB 4JJ5A 5FV2A 3QRGL 1C5CH 5ANMB 4MNGB 3S4SB 5IEKA 4XCCH 4N0UA 4GW1B 5E2UL 2F53D 4FQCL 1DCLA 4LIQE 4PPTA 5IW6B 4ODXB 3TN0A 3FB8A 4NO0D 1AKJB 2FDBP 2XRAH 4LOUC 3TO2A 3UZVB 1I85A 5MENB 3KPSD 1QRND 5A16A 1G6RB 2OBGA 1BBDH 4TQEH 3HC0A 3RWCA 5AD0A 4BELD 2K7QA 2W65A 2NTSP 1VGEH 3MNWA 4CNIB 3B9EA 3V0AC 1JN6A 4JFZL 4XP1H 4I48B 1QQDB 4ZTPH 3R06A 2NTFB 4QHNB 5BW7C 2Z35B 2JE8A 3E3QC 4WJ5A 1TQBB 1NC4D 5I6XB 2BSSB 4G6JH 3KJ4C 3S88H 1UCBH 3LKOA 4JY6B 3GI8H 3UTZA 3D5OF 2AERT 4HDIA 3QH3B 3AGVA 2D0GA 1IGTB 4HZLA 1RIHL 5D7KE 3MJ9L 3TPUA 1I1AA 4OLVL 1OM3H 2XTLA 3DIFA 3EBAA 2VL5A 4MLSA 4WI8A 5EU4A 5F72S 5HVFB 5A2KH 3BE1L 4UI2A 5DJCA 2G5BB 3QIBA 5ADPL 4W4OA 4I0CC 5ICZB 5I1AB 1NGXB 2O61B 5IB4A 1NGYA 4FABL 3DETD 1MREL 1VFOA 4F7TA 2DQFB 4Y2DA 4NZUH 2X89D 1FVCA 5I1LB 5EO9B 4I5BA 5TE6H 5IUSA 1NCWH 1D5XA 3L1OL 5J0BA 4RMTA 2W9EL 1VFAB 3AREA 4M93B 4P4KC 3T65A 1H0DB 4DGYH 1R5VB 3U7YH 3TPUE 4D8PB 3MRFA 3CSBA 1R24A 1TNNA 5LGKA 1GXEA 1RHFA 5GGQL 4XH2B 3O6MH 1T5WA 3ZE1F 2Z31B 1HEZA 4QY8B 5K93A 2ZG1A 4RSVA 4EOWL 4P23B 3V4PH 1ZS8B 3V6ZB 4ORGB 5DLMH 5D4QA 5IVOA 3QA3B 3QIWC 3WFCH 3ULVH 1I8MA 2AEQL 4FQLL 4PR5A 3UPRB 3TP4A 2ZSVB 4KZEH 7CGTA 1LNUB 1RY7B 5F9OH 1U95B 1UA6L 1JGEA 1OAKL 4OBRA 4XMLL 4MB5A 4WVRA 2O93L 1J9CT 1DUYA 1FNEB 2C7UB 5EU5A 4XCFL 3MBXL 1D5ZB 5F6IC 1TETL 2VLKA 3DRTA 1X5AA 3MPCA 3WFEL 4U6YA 4D9LH 5DD1H 4DKFH 5JUEL 3TF7C 1ZGLB 1YPZA 2ATPA 2CK2A 3H7BA 4HIIB 4YHKL 4JZOB 4X6EB 3DRQB 4LCCA 2ZUVA 1JHLL 3SGJC 5E56A 4BZYA 1KLGA 1VGKA 5DD5L 1CGYA 2L4OA 4ZUSA 1F3DH 4LOUD 2C1PA 3B83A 4RNRB 1C5DA 2KDGA 3HPLB 5D1QA 1LGVA 3P0YL 3B3IB 2VLKE 1R3IL 3NCBB 3GIZH 2YN3A 1D7FA 4NKMA 4X6BB 5F8RC 3TV3H 4RFOL 3U83A 3ARBD 3I3DA 3OG4B 4E41B 3FO9B 3FO2B 3RZCA 2VZ1A 4TTDD 1CCZA 3MLRH 2G2RA 1UXSB 4LVNB 3QZWA 3WXVL 4X9FA 4JO1H 3SKUD 3BMVA 3WUWB 5M94B 1BQLL 3GRWH 5C2UB 3TT3L 3ULVE 4KJWC 3C9NB 1N6QL 5KANG 1OGTB 3QULB 2CLZB 3PGCA 1NSNL 1JNNL 2P43B 3D0VB 3VE0B 1QACA 1CK0H 2EYSB 3OV6A 5F44A 2R0ZL 2VDRH 1X4YA 3LDBC 4HKJA 3GSXB 1YEHL 1FL5B 3DUUA 1MJ7H 2BRQA 4TVPD 4X9IA 4AIZB 3T0EC 5CEZH 1ZLUH 3OAYK 4FQQA 2IPUK 2VDNL 1ZANH 1FCGA 1LP9B 2XTJC 1J0ZA 3HZYB 4KMQA 4P48A 5I71B 4Z7VE 2WBWB 4ZPVB 3GRWA 3VI3F 1YEDA 2OMBA 3DURA 3LIZL 1TVDA 2UYLA 4IMLA 5T3XD 2EXWC 4YBQC 5EBMA 1G6RH 5C1MB 3K74B 5DMJB 4PP8C 1B4RA 3HNVL 4JPIB 5D1ZA 3GDBA 4XVUC 5BXFB 1DSFL 4YDKL 5CD5C 4PTTB 5GS1B 1NEUA 4V1DB 1WWWX 1ZVHA 1YPZF 4X7FC 1CU4L 3KJ6L 3EHBD 4J4PA 4NM8L 3HR6A 1G7QB 5ANMA 4MNGA 3S4SA 3GMOB 1MJ8L 4GW1A 1IGCH 4H26B 5IBUB 5E8PB 5IW6A 4ODXA 1AKJA 3MLUH 4O5LH 1ULVA 2HFEB 5KN5B 5MENA 4YXLH 1S7UB 1NMAL 3H6JA 1G6RA 1NCCH 3QXUA 35C8L 3LKNB 4LARL 3SDXB 32C2A 4HC1H 4CNIA 3FQXB 2FWOB 4Y4FC 4XBPB 4I48A 1QQDA 5EIVA 5I1JL 2X70B 2NTFA 4QHNA 4MNGE 1R3JB 2Z35A 4NRZB 1QNZH 3CVIL 4FXKB 5KS9F 1CXHA 5CEZE 1SJVA 2BSSA 5EOQH 4F33B 3QEGH 4JY6A 1AIFB 3S4SG 2Y9RT 4NYLB 1ORQB 2YRPA 3WJJA 2AJXL 4U1LB 1IGTA 1UYWH 4N8CL 4L9DA 5FUZL 5HYIA 3UAJD 4F7CB 1QRKA 4J3WA 3QJFB 2APXA 3O6FD 1ZXQA 4HC1A 3F6LA 1KC5H 2G5BA 3B9KC 5ICZA 3CVHL 5I1AA 1NGXA 5GRVK 2HRLA 2XZAH 1T21B 1I4FA 5KVDL 2QKIA 5GS3A 2Y6SC 4N5UA 3SDAC 2C9AA 3U48A 3BP6A 5I1LA 5EO9A 5HHMB 2OSLB 4GG8A 1X7QB 4X6CB 1G6VK 4KJWD 2E7LC 1INEH 1VFAA 1H0DA 5I16B 1LO5B 1R5VA 3V0WH 3JV5A 4XRCB 4K55A 4D8PA 4ZAKD 4Z95L 3MYJB 1P5UA 2M8XA 4OZGB 3VW3H 4U7MA 2Z31A 4QY8A 5ISZB 3ARFA 4P23A 4OAWB 3BH8A 1ZS8A 3V6ZA 1T66C 2XFXB 4ORGA 5HXMA 3DMMC 3T0ED 3IFLL 2XXCB 3QA3A 4NO3A 3UJIH 2XG4A 1NEZB 3UPRA 2YUWA 3UP1A 1DEEB 1Z5LB 4X6DE 1LNUA 3DGCR 3QXAB 2C7UA 1FNEA 3LN4B 3MSPA 5LXGL 3RHWK 5HYQB 2ZKHL 1D5ZA 4PD4J 2CMRL 3JVGA 1NBVH 2R0WL 4YHOL 2NY3D 1DBAL 1ZGLA 3SOBL 3U9UA 4OCXL 5FHAL 4HIIA 4JZOA 4X6EA 4GH7B 3DRQA 3DVGB 3BOVA 2WBJA 3RL2B 3VD3A 4D0CB 1UM6L 1FRGL 2Z9TA 4UV7L 1F6FB 3BN3B 3WIHL 5K9QG 1MNUH 1MCWW 4S1DD 3VDCA 3NCEB 1KG0B 3B9AA 4RNRA 3HPLA 3HRPA 4JY4B 3B3IA 1PJ9A 1CDJA 4FZEH 4X6BA 4QRRD 2ZCLH 3RA7H 1KCKA 2WZPD 4E41A 3FO9A 3FO2A 3JTSB 1HHIB 2VDQL 1UXSA 4Y4FD 2EH7H 2F58L 5D8JL 1P7QD 4C56E 3WUWA 3GSWB 5E5UB 3OJVC 5ACZB 1KIPB 5D2NE 3LKPB 3P9MB 3C9NA 1NFKA 2EH8L 5EC1B 3JV6B 1OGTA 4F9LA 3QULA 2CLZA 3TVMB 5CJ8A 3D0VA 4PJ9C 3VE0A 3CD4A 3BPNB 3CMGA 5IK3B 2EYSA 3ZL4L 4ZOBA 2EIBA 2R2EB 3UBXI 1UT9A 3GSXA 4OI8A 5ALCL 2BOCB 1FL5A 4J8RB 4E41E 4O2CA 3QDAA 2DQDH 4AIZA 4RMWA 1VHPA 5K9KB 2CR3A 1U3HB 2F9BT 3N9GH 5IB5B 1QLRB 5C2BH 1LP9A 4UTAH 1LILA 3HZYA 3MV9E 4IDJL 3BP7B 5FAAA 3DOSA 4ZPVA 5DFVD 3ZHLA 1BIHA 3OAUH 4U1HB 3SDAD 3SE3C 3WUWG 5IWLA 1VEMA 3SGEH 1P7HL 2D7MA 4NHCL 1J1XH 2KKQA 2FBJL 4JPIA 3OJDB 2ICWB 2R8SH 1DQLH 2K1MA 5BXFA 1HHHB 1J88A 1IGMH 1M05B 4C56D 3ULUC 1OSPL 4PTTA 4L1DA 5GS1A 1FNSL 1TPXC 2DKUA 4V1DA 1MF2H 5K59E 2YHGA 1CGUA 3PWVB 4FQXC 2G75B 1G7QA 5AZ2L 4Y4KB 3GMOA 1IEAB 4Y0GA 1TZIB 2LTQC 4H26A 5IFHH 1E4XI 1KEGL 1UM5H 5E8PA 5A3IC 5DVNA 1T66D 2J88L 5KN5A 2HFEA 4MAYC 1S7UA 3EFDH 2RFXB 3LRHA 3WBDA 5C0RL 1F90H 2IAND 4JPVH 4MXWH 1JGLH 1CTNA 3LKNA 1K8DB 3K8LA 3MFGB 1DL7L 3GMNB 3C60B 3BSZL 3MGOB 1G9NL 5IHZB 3FQXA 1J5OL 3KXFB 2FWOA 3MV9D 4XBPA 4V1DE 2X70A 4NN5B 3QDGB 3QFJB 4FXKA 5J6GB 3CU1A 3O4LD 4HV8B 1EBAA 1V7MH 2DN7A 4F33A 5J3HC 3D9AH 1AIFA 1SY6L 5I1GH 3K7UA 3DVIA 4DZ8B 4NYLA 4EBQH 1ORQA 3MUY1 5HHQB 2OZ4H 1RU9H 4U1LA 5IBUG 3U30B 2HT4C 4FN0A 2JF1A 3R4DA 1DN2A 1AD9B 5GS2D 4UB0L 4AYFA 2HMIC 2AGJL 4F7CA 3QJFA 3K81A 4XP4L 5K59F 2MMXA 4OLXL 2R4RL 2WWKO 4E5XB 3WYRA 5HYJD 4KUZH 5HDBE 1A3LH 1EDQA 3C8KB 3E8UL 3CXDL 3ARRA 3MV7D 5EULV 4Q9RH 1T21A 1LP9F 4KK5C 3UC0L 4K9EC 3PHOB 3GI9H 4Y5YB 1BAFH 5FO8B 4P46C 2OSLA 5B21A 5L9DL 5HHMA 1X7QA 2OZ4A 3L95B 2D3VA 5T1DL 4YPJA 2CDGB 3RWJB 5I16A 1LO5A 4HBCL 3CFBB 3I6LD 4X9BA 4XRCA 1EK3A 2EEAA 4B53A 4PJ9D 3GSRB 4IIQB 3MYJA 2QQKH 4AL8H 4R4FH 2IH3B 4J3SA 4YXHH 1CD1B 4MJ5B 5ISZA 5F1KC 1TLKA 3F6IA 1PSKL 4HPYH 3P4LA 3ZKXB 1QYGL 2X4RB 3MLXL 4OAWA 2XFXA 7FABL 1J0HA 5IMOB 5DQDL 3TO4D 4CVUA 4EZMA 1NEZA 3CFCL 2XI9A 1DEEA 1Z5LA 3O45B 4I3RH 2BY1A 5DJXB 5HHME 4ODVH 3MX0A 2AK4A 1CWVA 3QXAA 4OCYL 4U3XA 3LN4A 2AK1L 2OQJB 2UV3A 3P0GB 1LO3L 3TJEL 5HJ3B 4RAVB 5HYQA 4QGTA 1PGRB 3SDXF 3C6LC 1JZ6A 4CDGC 1YY9C 2NY2D 4HHAB 3LRGA 3VFNB 4PB9L 4PJXB 5HD8D 4AEIH 5ISZE 5EC2B 3VFTB 3VRLF 4FQXD 4WRLA 4OZIF 4UZGA 1DDHB 4QTIL 4UDTB 3DVGA 4Z7UA 3SGDH 3RL2A 3L7FB 5CSBA 2DLGA 4G80B 2X40A 3K8MA 5C9JB 4NUGH 2AK4E 4ONOA 1ZWIA 3A67H 5DHYB 5T1LB 2YS4A 3LVEA 1B4JL 1KG0A 1NEZG 2FZ3B 3O9WC 3BYYA 5IJKC 2NY0D 4JY4A 1WAAA 2Q76B 4NQDB 3SJVB 4LSVH 5DVOA 4HFUH 2J12B 4NZJA 1A6VL 1OLLA 3JTSA 1NMBH 3MR9B 3P4OB 2M26A 4OSUH 1HHIA 2H8PB 1R3KB 1D6VH 1JGVL 2EYTB 1YYLH 4WI2A 1KCLA 3GSWA 1W0VB 4Z7UE 5C0FB 5ACZA 2PKDA 1KIPA 1PG7X 2P24B 3LKPA 3P9MA 4MA8L 4URTB 4AH2B 2FATH 5EC1A 3HI6L 4X6CF 3VD4A 3TVMA 4KKBD 3LD8B 1A7QH 5IK3A 2HT4D 5ITFB 2NXZB 3DJ9A 2R2EA 3GSOB 1WAAE 2Q8BH 2Z8SA 3KLDA 1FNLA 1MFAL 4OZGF 2AJSH 2BOCA 3DO7B 4J8RA 4XP6H 3FRPA 2PYEE 5J7CC 3QDMB 5K9KA 3U4BH 5DEFB 1U3HA 4FQ2L 5IB5A 1Y18A 4GKNB 3X3FH 1QLRA 4HAFA 2BVPB 3BP7A 3VU2A 1OW0A 4DUVA 4KK5D 2DQUH 2B4CH 3QCTH 3OZ9L 3DI2B 1DR9A 4P46D 1SEQH 4K3HA 4OD1H 1D5BB 4ACPA 2ICWA 3OJDA 4F7PB 1HHHA 3BKYH 1M05A 5C0CE 5DMGD 1UKQA 4UT9L 3PWVA 2G75A 4X5LA 4H8WL 3IYLW 4Y4KA 3VWJA 3E6FB 1TZIA 1BJ8A 3GSVB 2X1WL 1PG7L 1DQML 5EN2B 1KCRL 3FRPG 4NCDA 4OIIL 2GKIA 3VFVB 5T5FL 3RU8L 2VLRB 4M5YL 2HAZA 2RFXA 4PS4H 2D7PA 1K8DA 4ZUVA 5GRVL 3GMNA 3C60A 2J5LC 3MGOA 2E6QA 5IHZA 1F02I 4XPFL 5CKGA 4OLWL 3JV4B 2OTPA 3C6LD 1YY9D 3QDGA 3QFJA 3U7AA 3PNWB 1D3CA 4BZ1H 5HHXH 1AQKH 4OLZL 2JJSC 4JFED 3PWPB 3IFPB 1P4BL 4DZ8A 1CLYH 1OQOA 4HWNA 2FR4B 5F7EH 1RPQA 5C0CD 2L7JA 4NKQB 5HHQA 4ZNCD 5IJVB 4MXQA 1JV5B 1IAIH 1CN4A 1QR4A 4AMKL 1S9VA 1J8KA 5FYKU 1AD9A 3E6HB 3NA9H 5BO1H 5SWZD 3ZKNC 2Y36H 4Y16D 5GRJL 4JFOB 4OF5A 1H15B 5CJQH 3K80A 3O9WD 4CADB 5C8JB 3E2HB 3PL6C 4E5XA 3WNPA 3ABZA 3QDGE 4YHML 2W0KA 4EXPX 3WHE1 4XVTL 3CUPB 5EO1A 1PAMA 3JUZA 3PHOA 1DVFC 1JE6A 3IDNB 4BQBA 8CGTA 5FO8A 1JF1B 3C5SB 3L95A 3G5ZB 3BRDA 2CDGA 5L2KE 4P3CH 1GRWA 3RWJA 3CFBA 3I3EA 4LFHG 3GSRA 4IIQA 2D03H 4M1GH 5T33H 3AFLA 2IH3A 4JY5H 1T1XB 4JANB 1PBYA 2A6JB 1CD1A 4MJ5A 5DD0L 3LB6C 5BS0E 3BEWB 4OF7A 2X4RA 3VXQB 5L88H 2VKXA 5IMOA 3SO5A 2XG5A 1FG2B 3HE6D 1QO3B 1ZTXL 3O45A 3IDMB 2DTMH 4WENB 5DJXA 4NBYB 3WIIL 1VACB 4EI5B 2YPLB 2OQJA 5HJ3A 2ZG3A 4RAVA 2X4UB 3HMXL 4OFDA 1JMZA 1ZGLP 5E08L 3WNKA 3TWCL 2GHWB 5JW4Q 1J0JA 4HHAA 3VFGL 3VFNA 4C55A 2XT1B 2MQ3A 4PJXA 3TYGL 3VJ6B 3EJZC 5EC2A 4KAQL 3QUXD 4DKEL 1DDHA 2QTEA 3PGFL 5EPMB 4GRLB 4UDTA 5L2KD 1EVUA 4O2EB 4QXUL 4G80A 4A6YB 4P3WA 2EDHA 5C9JA 3EO0B 3HNTH 1MI5D 2IAMC 3VD5A 5DHYA 1B0GB 5T1LA 2FZ3A 3QUMB 3V52L 1HKLH 4NQDA 3SJVA 2Q76A 1DUZB 4CL7A 1NL0L 1MCFA 4LKXB 1NCAL 4LSQH 2AEWA 4X4ZA 3MR9A 3P4OA 1D5IL 4PJXE 2H8PA 5I8KH 1R3KA 1NUFA 2NMSA 4PG9B 2ILLA 4OM0H 1FBIL 3G08B 1F4WL 3WN5B 1DQQB 1W0VA 5C0FA 3NAAH 4LCYB 3EYSH 4K71B 2P24A 4AH2A 4LSRL 4MCYB 5GGVY 2BVOB 1EGJH 4PLKC 1NGPH 4NJAL 1EUTA 2VTFA 4U1MB 3W39B 4O4YH 1KCVL 5ITFA 3I6KB 3GSOA 4NQDE 3SJVE 2Z93B 3M8OH 5T1MB 3V4VL 3DO7A 1BBJB 2B2XL 2UWEB 3QDMA 3QWOB 3PL6D 4NFBA 2EEBA 4ERSL 5DEFA 1OGAD 1E4WH 3HRZB 5DD3L 4ONFH 5K9JH 4HCRH 4W81A 1OT2A 4Z0BH 2BVPA 2Z0BA 4ZFGL 3BZ4B 5KANI 4L8BB 3QXDB 4R97C 3RVTC 4Z6AT 1VCAA 4L8DB 4Y5VC 2H1PH 5JQ6L 1EGJA 2Y4SA 2BERA 2OCFD 5F9WB 1AR1D 2ARJQ 1D5BA 2PXYB 3X17A 5HSFA 4F7PA 4I3GA 5ETUB 2EDFA 3QG7L 4G9FE 1PY4A 4X98B 1HZHL 2VR9A 3ZE0F 3PABB 3SKJL 1G0YR 1RJCA 1DBBL 3QDME 2QADB 3E6FA 2VXQH 3MACL 4Q58C 1KFAH 2QSCL 1RURH 1XIWB 3GSVA 4HCRA 3PP4L 4KTEL 2O5ZL 5D7JC 5EN2A 4JCMA 3V5HB 3GSQA 2R0KL 3FN0L 3VFVA 4JO3H 2VLRA 1U9KA 1WZKA 4HUVB 1JBJA 3MXWL 4XP9H 5I8OH 1BQSA 2X05A 1CXEA 3DVFA 4UILH 5IMKB 4LHUA 2PNDA 4M43L 3LQAH 2ESVD 4WWID 5HVHB 4P2QD 3QJHB 1C7TA 1N4XH 3JV4A 1B2WL 5I73B 3PNWA 5C0BE 4X7DC 3HG1D 1J87A 4JQXC 3EJZD 4LU5H 5JW3L 3TC9A 4BQCA 3I9GH 2PETA 3PWPA 3IFPA 4DEPB 2FR4A 3K2UH 5ILTH 4PJFB 2VLRE 3U0TA 1CICB 1J8HD 5IJVA 1AGCB 1JV5A 5I18L 1MAML 1NCDL 4M7ZB 5E5MB 3SE4A 3E6HA 2A38A 1DBMH 2IAMD 3TN0C 1MFEH 1IM3B 4JFOA 1I85C 5D7LD 1H15A 4R8WH 4NQXA 4CADA 5C8JA 3TBSB 5I66B 1J7VR 1UM4L 3VGFA 1FC1A 5DGRA 2IALA 4YBLC 1LO4H 2OM5A 2P8LB 5C0AB 1S7SB 3CUPA 3IDNA 3PDDA 5AUMB 2F5AH 2I60H 3RTQB 4HS8L 3ESUF 1JF1A 4IRJB 5J6HB 1JTTA 3C5SA 3RUGF 2ITDB 3G5ZA 5CILL 1N0XL 2R0LH 1V05A 1I3GH 1CGTA 1A9EB 4NZRH 4ZD3L 4MA7L 5C0BD 1UKTA 2NCMA 1WFUA 5LGHL 1VA9A 1T1XA 4K7PY 4JANA 2A6JA 2VXTH 3ZLQC 5J11B 3QWRD 5FM4A 3UJJL 3V2AR 2KUTA 4TNVF 1I1AC 2A9NL 3BEWA 1KBGH 1BQHB 3B6SB 1KCSH 2NY5H 5CGYD 5A2LH 1UFUA 3TLRA 1FG2A 4MVBD 1C1EH 4A6YH 1QO3A 2EKJA 4JREC 4JFXB 4RGMB 2EO1A 3OB8A 1BP3B 1VACA 3QDJD 4EI5A 4GMSH 2YPLA 2B0SL 4N5ED 3QUMH 2EECA 4WW1B 1IC7H 1II4E 2X4UA 5IGXL 4WIQA 4U1JB 3D3VB 1CDGA 4XC1H 3V6FA 3MO1B 3AREC 5C71A 3VJ6A 4FFYH 1ZK9A 5TH2B 3LY6A 5CAYB 1XGTB 2WSKA 5EPMA 4GRLA 1WT5A 4KC3B 5JLZB 4O2EA 4A6YA 1XMWA 3ZTNL 3QRGH 1UGNA 5D7JD 3EYVA 3EO0A 3GNML 4DFIA 1H3WM 4QRUB 4XMKL 1B0GA 4HH9B 3MJ6A 5E2UH 3N50A 1JZ5A 3QUMA 2D7NA 1OF2B 4YFEA 3BP5B 4BH7B 2ZPKL 1DTUA 1T7XA 1DUZA 4LKXA 1W2KT 1X5ZA 1MLCA 2LAAA 1IC5L 2VMFA 3RX7A 3UTPE 4UTBL 4MA3B 4PG9A 3RRQA 3G08A 3WN5A 3GSUA 4LCYA 4JFZH 1I8LA 4U6VL 4MCYA 4KZDL 5ESVB 1QSED 2BVOA 5JHLH 4WV1B 4D0BB 1EMTL 3CX2A 4LCCC 2V7NB 2E9WA 4XNUH 3PQYB 3WEXA 3W2DL 3ULVC 1G7HB 1X5YA 3I6KA 3ESVF 4Z7WF 3BGAA 4I9WD 2Z93A 3UYPA 2VQ1B 2XN9D 4O9HL 5HI3C 4EI6A 1T7YA 3P77B 5T1MA 1IGFH 1BBJA 4N68A 3VGBA 4S1RH 2UWEA 2OR8A 3QWOA 5D1QC 1T1WB 3MJ9H 3KLAB 4OLVH 4TUOB 2RR3A 3UROR 4C4KT 2G60L 3BZ4A 5SWSA 4L8BA 3RZCC 3QXDA 5GRZA 5ADPH 3DARA 4L8DA 4NQSB 2BRRL 4N9GB 4NRXB 2H3NB 2C26A 5T1KD 4RGND 4JHAL 3CLEL 3IF1B 2BHZA 2PXYA 1ZHNB 4PJCB 4FABH 1FDLL 2DQJL 5ETUA 5DMIH 1VFMA 1FNGA 4M6NL 4YQXL 2YD9A 3O0RL 2JCCE 2YD7A 3PABA 3L1OH 3F5WA 2RAMA 3VFOB 3T77B 4Z8FL 2UWEE 5I9QB 3EYFB 1ZLVK 2YPKB 2FLRT 3C09B 4XCYB 3RWIB 3MJ9A 4X7SL 1XIWA 5F7YC 3V5HA 4HUNB 4L8SB 5GGQH 1DE4B 2DDQL 5SWSE 4MLIA 1N0LA 4HUVA 3IDUA 4MYWB 4EOWH 1D6EB 3QI9D 5IMKA 3BIKB 1WIPA 3Q0HA 4FQLH 3AROA 1IQWL 4ODSL 5E6ID 3GEWB 3QJHA 1Z0NA 4ZQKB 4L4VE 1S5IL 1OAKH 4PJ7B 4XMLH 4S11A 5IW1B 5D1ZC 4XCFH 4M8QB 3MBXH 1DBKH 2X42A 1IMHC 1TETH 1XGYL 4ODWB 3LS4H 1FH5L 4RMUA 3MGAA 1UH3A 4J4PC 3THML 3ARSA 5ID0B 5CZVL 2FGWH 4M7JH 4PJFA 1CICA 1AGCA 4PG2A 3V7MA 4G5ZL 2AAVA 3DX9B 3LEVL 1JHLH 5E5MA 4XBEL 4YFLI 1IM3A 4ZMAT 4BFBD 2YK1L 3TBSA 2MPAH 4MS8C 5I66A 5HPOA 3CXHK 1KJ2L 5D71L 4DJMA 2DF3A 4Z0XB 4BSJA 4BSWB 2AJ3A 4ESKA 4ZO9A 2P8LA 3P40A 5C0AA 1S7SA 5GJSH 5BQ7B 5GHWL 1I8IB 4G6FB 4FQ1L 2GTWB 5AUMA 3RTQA 1T03L 3CMOH 5JXEA 4IRJA 1AHWC 1TQBC 4DOHE 1CDIA 3WXVH 5I6XC 5J6HA 3ROOB 2ZCKH 4L4VD 3MBED 5ELIA 1WWAX 1X5JA 1A9EA 1ZLWH 4HULB 3KYAA 3JWOC 1IKNC 2H2SD 3TT3H 2YD6A 2N4IA 3IDJB 4YLQT 4FFVC 3WJJC 1ITCA 3BDYH 1N6QH 1NSNH 3SN6N 1JNNH 5D72H 4HUXB 3HMWH 1HKFA 2AABL 3K46A 4YC2B 1BQHA 3B6SA 4HJGB 5E8OB 1YN7B 3SQOH 2PF6A 5CP3H 4JLRB 2BY2A 2R0ZH 2LFGA 4JFXA 4DUWA 5EOCJ 4GAGL 3AC0A 2M1KA 1TJGL 4JGUA 4GRMB 3V8OA 3HCVB 4WW1A 2VDNH 2YRZA 3VXOB 5KAQG 1OAYH 1ZHBB 1IE5A 4U1JA 4JE4B 3D3VA 3MROB 2VN7A 3FT3B 3G5XB 3ZKSD 1X5KA 3MO1A 4R26H 4YEFA 1WLHA 1FGVL 4M93C 1SQ2N 4KMTL 1QFPA 5E2VL 2L0DA 5TH2A 1AC0A 3D39E 1XGTA 4QXTA 1KN2L 4O58L 3EYUH 5DRZB 5E9DB 4PRHD 5CP3A 4OD2B 2Z31C 2QQQA 1CU4H 3KJ6H 4KKLC 4W4NA 4NM8H 5I1EL 4AG4L 1MOEA 4PJFF 1BQHG 4JVPA 5T3ZL 2GYSA 4JRYE 4P23C 4QRUA 3KYOB 1MJ8H 4HH9A 5FGSA 2VXUH 4LDEB 1BFTA 3J8F7 4WUUD 3G04B 3BP5A 4BH7A 3BRFA 3VXSD 1F4YL 4ZFOB 3INUH 1OP3H 2VNCA 3IDGB 1JUFB 4XNMB 1NMAH 3GHBH 3AMLA 2YPVL 1KPUB 5F3BB 4MA3A 4LARH 1JPGB 3S7GA 1N3NB 4R9HA 2ZNXA 5D1ZD 2BSTB 5FK9B 5ESVA 4KVCL 4WV1A 3CVIH 4D0BA 3TESA 4KUCD 2V7NA 1Q9WB 3PQYA 1RUPL 1G7HA 1A1NB 2C3XA 4HX1B 2G9HB 3QAZB 5ID1B 2VQ1A 4PRAB 2F54B 2AJXH 3P77A 4G6MH 1YNLL 4L5FH 1F4AA 4MS8D 1T1WA 3ZYIA 1JYXA 1RIVL 3FO0L 3KLAA 4JFHD 5LJYH 1HDMA 4TUOA 2MQ0A 1JHTB 2SEBB 3P11L 4Y4HB 3O2WL 3D2UA 4LVNC 4NQSA 4N9GA 2X9XA 4NRXA 2H3NA 1XH3B 4GW5B 1U2HA 5DC9B 3PQYE 5KVDH 1VEPA 4F9LC 4LSSL 2HKHL 4KWUA 4ZUWB 3VFOA 4FFVD 3T77A 5C9KA 1FQ9C 3EYFA 2ADJB 5C07B 1X5HA 2YPKA 3BFOA 3VXMB 5DDHB 1HQRB 4XCYA 5IESH 3H3BC 1HWHB 1AGDB 3KPRB 4L8SA 1DE4A 1T04B 4WTZA 4NKDA 5JO5B 1D6EA 3BIKA 4F7EB 5I71C 4PJ8D 3KGRA 3S35H 1QBLL 3IKCB 1GIGH 4ZQKA 4XTRC 5B39B 5IWLC 3GIVB 1YJDL 3RKDD 1K5NB 2OR9L 4PJ7A 3PWNB 2F5BH 5C0NC 3K0WA 5IW1A 1WFOA 2ICEB 4LEXH 1NLDL 4M8QA 4WI4A 5ECJE 1VPOH 2CMRH 4ODWA 1UWGH 4PGDB 5IQ7L 3T0WA 2R0WH 4YHOH 5GS1C 1YNKH 4U0RB 5CHNB 1DBAH 4Y19E 1HXMB 5HTSA 3SOBH 5ID0A 3MOAL 4ONGL 1ETZB 3Q1SL 1P6FA 5FHAH 3M1BB 3LKRB 3HKFA 3DX9A 4OZFB 1OPGL 2HTKC 2B20A 1IT9H 2V9QA 2ZUUA 3UX9B 5IMMB 1BFSA 1LDPL 4KPHH 4M6OH 4YHYB 4UINL 1YEIL 5CBEA 1UXWA 1JMXA 4BSWA 4LVHB 1SHMA 3VMPA 2FB4H 5BQ7A 5GGVL 1I8IA 2ZOLB 1MCCA 2GTWA 3HC4H 5FYJD 2F58H 12E8L 5D8JH 5J89A 1U91B 3ROOA 1R0AL 4MB4A 4PJCF 2NLJB 4HEPG 1BREA 2DKSA 3IDJA 2DQGL 2EH8H 4F15B 2DKMA 3TBVB 3WIHA 1TVBB 3HZMB 5IFJB 4NM4L 3G5YB 1EO8L 3NTCL 3IDIB 4HJGA 5E8OA 3LMJL 1YN7A 3WSQL 4H88L 4UUJB 1GOFA 3ECBB 1A7BA 2E9JA 2OL3L 4L3CB 2PR4H 1GAFH 3C5ZB 4HWUA 4G8IB 4GRMA 2F74B 2XKSA 5IMLB 3HCVA 4HPOH 4IDJH 3VXOA 5HVGB 1ZHBA 3VXNB 4P5TB 3O81A 4CDHA 3MROA 3G5XA 3FT3A 3X3GL 5FCUL 1XF3A 4OJFL 5A2IH 4PJ7F 5DFWH 4M8VA 4NHCH 1G7JB 1Q0XH 2C5DC 2FBJH 3MFFB 1GZQB 5DRZA 4K7FA 5E9DA 2ADFH 4OD2A 2BMKB 4MHHG 1EAPB 1FNSH 2VXVL 3V9FA 5F9JB 1IEHA 1U92B 5AZ2H 2Y23A 4R4NC 4FG6C 3KYOA 5F1SA 2X5PA 3RGHA 3B2VL 3LPWA 3N06B 3MCG1 3JWDH 3G04A 1KEGH 2CPCA 4MNQD 4HK3J 4ZFOA 1X3DA 4OUUB 5EO0B 2J88H 3IDGA 4XNMA 5I1IL 1IAII 4FTVD 4LK4A 3RQ3A 4UNUA 4XTRD 3C08H 3ZTJH 5F3BA 1L7TH 4Z7OF 4NZTL 3FAWA 4HUUB 4QCIB 1JPGA 3BESR 1N3NA 1T1ZB 4KTDL 5C0ND 3BSZH 3FHAA 3QUZD 4B41A 1G9NH 2BSTA 5FK9A 2FEEL 4NSKB 1QD0A 4KK9C 3OTTA 1WK0A 5FHBL 3HS0A 4JDTH 4D94A 1Q9WA 3SE8L 5L2JB 2BVUA 3B2UD 4NQCB 1A1NA 2I5YH 3I3BA 1SY6H 3QEHB 4HX1A 2G9HA 2AW2A 5ID1A 4PRAA 4CVWA 2F54A 1K3ZA 3VXUB 3T2QA 3M17B 1M71B 3QUYD 2VOTA 2VZUA 5FDWB 3EOBB 1S7TB 3WV0A 1JWSB 4UB0H 4OLXH 4QNPF 1JHTA 1Q72H 2SEBA 4TVPL 4Y4HA 4XWGH 2IBBA 4JPWL 43C9B 3ZHKA 2GUOB 4NCC2 3E8UH 1XH3A 4GW5A 4MGXA 3WIFB 3K3QA 3UC0H 4KGLA 2D31B 1F4XL 5T3XL 4NWTH 1SY6A 3TVMC 5L9DH 1ZOXA 3I50H 1KTLB 2F54E 4Z7NE 4ZUWA 3BP4A 2F8OA 3BPNC 4CJ0A 5E99L 2ADJA 5C07A 4JKMA 3VXMA 5DDHA 4PJGB 4DN4L 43CAB 2KZWA 3V4UL 1AGDA 3KPRA 1T04A 3ZTJG 5CJXC 1FHGA 1U3HC 5JO5A 1PSKH 3T8XB 4OB5H 1QYGH 4CMHB 3MLXH 4OZFH 4WY7L 1NLBL 3MZGB 4HUWB 4F7EA 7FABH 3SBWA 4L4TD 3MV8D 4PP1C 4N0CA 3IKCA 2BY0A 1RZKL 4F7MB 1TJIH 3QBTB 1CXIA 3GIVA 4XPBL 1K5NA 2XPGB 3TH3T 4NQEA 4PRDB 4PRPA 1LO3H 4GQ9L 3R0NA 1OP5H 5JTWA 3T4AB 4OZHB 4OCNC 3ZDYE 5CHNA 3NFNB 4LP4A 4YDVB 1HXMA 1BD2E 2YD2A 2CXGA 3T2PA 4Y4KC 1ETZA 4QGYA 4WHDA 1OWWA 3OHXB 1GYAA 3M1BA 2D4FA 4WHYH 1PX4A 4OZFA 4QTIH 1NC2B 2EIDA 4UIMB 5IMMA 2A77L 5CUSH 5GJTL 2B4CC 2WWMC 4YDLB 1QSZA 4Z7NF 4LMQE 1RUQH 3QNZB 3MA9L 4NQEE 4NCC1 4PJHE 4PRPE 5I0ZA 1B4JH 3BD5A 4DVRH 4RWYL 4CN1A 4X0KB 5HHOE 1BZ7A 4PV8B 5DMYA 1G84A 1OSZB 3MRHB 5B39G 1CZ8L 3STLB 2ZOLA 1FGNL 4ALAL 4ZS7H 4NN5C 3TBWB 2XKNB 1A6VH 5JHDB 3HNSH 1C5BH 3WFBH 5TE7L 5IEHB 5IHLB 5FUOH 5EBWB 1U91A 1RVFL 3RVXC 3O41B 2NLJA 2BCKB 2ADIB 4RGOL 1XF2B 2UUDK 5E4EB 4S0UC 2BXYA 1JFQH 3VFRB 3HI6H 4WUKL 4MXQC 4OZFG 3TBVA 1J1PL 1BD2D 1VERA 5IBTL 3HZMA 5IFJA 4LAQL 3G5YA 4PRIB 1UZ6F 2HT3D 5H2BB 2ZSWB 3WXWH 4UUJA 2DMCA 2Q87A 1ADQL 1CIUA 1QP1A 4F9PA 1CFVL 3V6OA 2DLEA 1QFUL 3ECBA 4L3CA 5DA0B 3C5ZA 4G8IA 1H3GA 2R15A 4JRXB 1VB9A 4FQ2H 4XNXL 2F74A 5IMLA 3MLPA 4LLQB 2VYRE 4YWGL 4Y5YC 4P5TA 4S1SL 4YBHA 2A73B 3ARYA 4K3DL 4KVNL 3MLYH 1MHPL 3OZ9H 4WHYG 1EZVY 2LABA 4X80H 1G7JA 3MFFA 1OCWL 4HIXH 4N0RA 2A6IB 4IIQC 4M7KH 1GZQA 2BMKA 1EAPA 4EIZC 1MHEB 1NDMB 4UT9H 5F9JA 1U92A 3BHBB 4H8WH 3ZKXC 2IPUG 4HMCA 1DQMH 1DZBA 1KCRH 3MREB 4JG1H 4OUUA 5EO0A 3BQUD 2E9IA 3WKNA 4ELKB 3UEZA 3RP1A 4QOKB 4Z7QF 4PJEB 1I1CA 3A0OA 4QCIA 4HUUA 1T1ZA 4LCIH 2HVKB 4XPFH 5F1NA 4NSKA 4JKLA 4OLWH 4A2LA 1MEXL 2JK5A 2V9RA 4Y1AE 4OBSA 4PY8J 1TFHA 5M95B 1ROWA 4LGSB 3D25B 3FTGB 5FUCE 4Y4KD 3DX8B 2C3VB 5L2JA 3H3PL 5FYKH 4NQCA 3N1MC 4NN7B 3S97C 4HK3N 2GT9A 3VXUA 1M71A 2WWMD 3W9EB 3DX6B 4GT7A 5FDWA 3EOBA 1S78C 1S7TA 1FG9C 1JWSA 5F70A 3TZVD 2J4WH 3QG6B 5GRJH 5KSAB 1ND0B 1QZ1A 1KJ3H 1MJUL 3MRRB 3KXFD 1OQXA 43C9A 4O00A 2GUOA 1MCWM 4G43B 1KN4H 5J1AA 3QFJD 2GJ6B 3ES6B 3G6AB 3UTQB 3WIFA 5DO2C 4POYA 4OTXL 2D31A 3UZEA 3RVXD 5CSZB 2GFBB 1CLZL 1KTLA 3ZSTA 4N1CA 3LD8C 3QNXB 5EU7C 4CW1B 4Y1AD 1I9IH 4EXKA 2GSGA 1V7NL 5GS0C 1MFBL 2NXZC 4PJGA 5LBSL 3VGGA 3LHPL 4XCNB 43CAA 2LVCA 2HKFL 4KV5F 2A6DB 3BZEB 5EZIL 2FJGA 5DD0H 5KVEL 3NCYS 3T8XA 1NFIB 5D6DA 1U36A 5MHSD 5INCB 1T6WA 5HHNB 1AI1L 1ZTXH 1WISA 4K94H 1F13A 4F7MA 4DAGH 3VD7A 2XPGA 2H2PC 4PRDA 3FJTA 2VLMD 4MD4B 5D70L 2O5XL 4Z5RB 1NPUA 2CRMA 4OZHA 3NFNA 3TWCH 4YDVA 2E27L 3BRGC 4HJ0D 4RISL 4AEHH 2Y25A 3VFUA 3OHXA 3I2CL 3KLSA 4KAQH 4DKEH 4E0RB 4KK8D 3HZKB 1AE6H 5TF1L 1OAXL 5ESAB 4UIMA 4XB7A 2KZ1B 3VI4E 4QXUH 3RDTB 5DMKB 4U05A 3ERYA 2YBRB 2KL6A 2Y07L 2CLVB 4GLRH 4FFWD 4N0FB 4DTGL 5HI5D 4X0KA 4PV8A 5I19L 1OSZA 3MRHA 2DLFL 4V2BA 1NL0H 2IFFL 5CINL 3STLA 2XKNA 5JHDA 4YPGB 5GRXG 3H42H 1D5IH 3CXHJ 1LWRA 4GMTH 5JA8B 3ETBF 5IEHA 5EBWA 1H3UA 1TENA 2IMMA 2LQRA 4I8DA 3O41A 1IKFL 4D9RD 5IHUH 2BCKA 2ADIA 3RVVC 1XF2A 5DVKA 2ARWA 2EDLA 3VFRA 3PWUB 1R6VA 1U3JA 2OJZH 3Q2CA 1HSAB 3RI5F 1XCQB 5FO9B 3SE4C 3RVWD 1ZLSL 1S5HB 1OD7A 4S10A 4PRIA 3LQAC 4PJGF 1KCVH 3N1QC 5H2BA 4WCYL 2ZSWA 3FMGL 1S78D 2ATKB 3D6GA 3E2HC 1GGIL 1U8MB 2W9DL 2B2XH 3RGVB 1Q0YH 4ZPTB 1ZV5A 4ERSH 2DQIH 2BNQD 3PHQB 4JRXA 3UO1L 1KCUL 4XBGB 1B9ZA 4LLQA 5JOEA 4WEBH 5DWUL 3EO9L 4ZFGH 3RHWF 2A73A 5DO2D 3MXVL 3QO1B 2WANA 2P1YA 3I84A 5JQ6H 3NABL 1G0DA 3P9LB 5CMAB 4XMPL 1FYTD 2XQBH 3TBTB 2DI8A 2EKSB 2A6IA 4PRIE 3KHOA 3DUSB 4OZHF 3QG7H 3W81A 1G7LB 5GS0D 1CL7L 2NXZD 1YEJH 4L3AA 4GXVL 3UTSE 3GMMB 2DQTL 1NDMA 3T04D 3FFCB 1Q1JL 3SKJH 3BHBA 3EUUA 5FOBB 3VXRB 4UQ3B 3VG9C 2NPLX 2JIXB 2QSCH 2XZQL 3FQNB 4KTEH 1P69B 2O5ZH 3MREA 2QQLL 2CO7B 2Z91B 2R0KH 3FN0H 4PJIB 4EN3D 1I9RL 1FFNB 4KKCC 5DF0A 4HS3B 4ELKA 4EI5C 4UT7H 2A9ML 4QOKA 3SKOB 4PJEA 5HHVL 2H2PD 4M43H 4PLOB 5B38B 2VC2L 3IU3B 5B3JE 4OLYL 2HVKA 3JV0A 2OI9B 2RB8A 4QYOB 1LEKB 5TPWL 3D25A 4M7LL 4OKVB 2JLLA 4GRLC 3FTGA 4PJDE 4ODHL 1N59A 2NY5C 3DX8A 2C3VA 1P4IH 1WT5C 5JIHA 4J2XA 4KK6C 2QL1A 2XV6B 4JGJA 3EW3B 3WHXB 1OD9A 3QPQD 4JQIL 5EOCH 4KRLB 3W9EA 3DX6A 1IEBB 5I18H 4QOKE 1NCDH 4PJEE 4KQ4L 1LEGA 2NY4B 5D7SL 4AK1A 4I0PB 5FXCH 1EO5A 3QG6A 2DBLL 1ND0A 4XC3L 1BLNA 2W0FB 5TQ0L 2CUMA 1RK0B 2R9HD 2P46B 4G43A 4I18B 4JZJB 4ZO8A 1TJHL 2VDMH 3WN5C 4R96B 1KELL 5C09B 2GJ6A 4JFPB 3NIGF 3ES6A 3G6AA 3UTQA 1QSFE 2BNRA 5DK0B 4K71C 4PJAF 4TVSa 3PUCA 1WEJL 2GFBA 5CSZA 3PWPD 2V5TA 3HPJB 1A7RH 4DGIH 4DGVL 5I1CH 2YA0A 3H9SB 3QNXA 5CILH 4CW1A 5IQ9B 4NNXB 1S9YB 2P47B 4MA7H 5B3JF 2XZZA 1YDPB 5F7DB 4XCNA 1P6AB 4Q6IA 5LGHH 5JW4R 2VDOL 2A6DA 4HJJL 5IB3B 4LLWB 4FNLL 3BZEA 1X5FA 2WAHA 5TGBB 1KJ2B 1K4DB 3UJJH 4Y8AA 3REWB 1RHHA 1NFIA 1XAUA 1OT1A 4TSBH 2ID5A 2CUHA 2BNRE 1UJ3B 3QT2A 3RIAF 5INCA 5HHNA 2OXGA 1N5YL 4HEME 4JFDB 4R2GD 2B0SH 4ENEC 5F9WC 1I1FB 2PXYC 1HE7A 4MD4A 4PJEF 5F6HJ 2GJJA 4OF8A 4BFIB 1FORL 3GM0A 4Z5RA 1DFBL 3ET9F 3Q5OA 1QSFD 3AM8C 1XCTA 1HYSD 3VWKA 1GPOL 2ERJB 2QADC 5EUOB 4U2ZA 1OTSC 3KVQA 1DANU 1XIWC 4E0RA 2DB8A 3OBAA 4P2CG 5CJOL 3HZKA 5I15H 3VDBA 3HLAB 1YEFH 3QIUB 1GGBL 1F11B 5ESAA 4TSCL 4XNZB 1NCTA 4XAWL 3RDTA 3ZTNH 2IQAB 4M1DL 5KJRL 3LV3B 1PG7W 4XXCA 1XR8B 1MVUB 2YBRA 4XMKH 1S9KC 4NRYB 2CLVA 2FJHB 4KKCD 4KXZI 4N0FA 1AXIB 4PREA 1YQVL 2LU4A 2YPLD 1KPVB 4BUGA 1W72L 5HVHC 4LHJB 4ELME 1IFHL 2XY2A 4OFYA 2WUBL 1CFBA 1MCRA 4YPGA 3ARZA 2OXHA 4XWOC 1U3YA 5I73C 3H2WA 4UTBH 3OPZH 1H3XA 4PJ5D 2E8ZA 3DX7B 4FFZL 4POUB 1WUNT 4LLYB 4DEPC 1BMGA 4ZDHA 5CWSB 4KZDH 2DRUA 1CICC 4KK6D 4PG2C 3JUYA 1EMTH 4M7ZC 3RJDA 1HSAA 1XCQA 5FO9A 1S5HA 4TRPH 4OM1L 4ZYKB 4G8GB 1BX2B 3L5XL 4F37K 5J1TC 2ATKA 5JORB 5SX4I 5DFTA 3GBLA 2XICA 1Y6KR 1MFCL 3RGVA 3R1GL 4ZPTA 1IJ9A 3PHQA 4TUJB 3EDKA 4PRBB 5JOPE 5DK2B 4XBGA 5F9DC 2P4AB 1YMMD 2GTZB 5T5NG 3RL1B 3RTQC 1XGQB 3QO1A 3SDDB 3P4MB 3NACL 3VH8B 5JXEC 5FKAB 4GRWB 4IRSB 1E4XL 2F19L 3NPSB 3P9LA 5CMAA 3DNKA 3GB7B 3G6JB 2RCSH 3TBTA 3NZHL 5AG9A 1FDLH 2EKSA 4ZSOB 2R39A 2OMNA 5CCKL 3DGGB 3DUSA 4POZC 1MIMH 1ZT1B 1G7LA 5ERWB 4QRSB 3RWGB 3TJHA 4JDVB 4RFNB 3GMMA 2R29L 1U58B 5J11C 3FFCA 4XCEB 5FOBA 3VXRA 4FP8L 4UQ3A 4YJZL 5SV4A 2JIXA 3FQNA 4PFEA 1PQZB 2DDQH 4HIJB 4RGMC 4PJIA 1CGWA 1FFNA 3QWQB 3JXAA 4HS3A 1N6UA 2EXYC 3PXJA 4DW2H 2XZCL 4K8RH 3SKOA 2P45B 2ED7A 3MRJB 5B38A 3IU3A 4MDJB 1KYOK 3W0WB 5ENWB 5HI4C 2PW2B 4QYOA 2OI9A 5T5NF 4JPKH 2Z8WC 2DAVA 5JIKA 1ACYL 1LEKA 4C54A 1AD0B 3CLFH 3I6GB 1CF8L 3QISA 1P84J 3RAJL 5MERB 1FH5H 4GXUM 3B8SA 1XIWD 1HHKB 3THMH 1AGEB 2C3WA 2D0FA 5CZVH 3WHXA 1CLCA 1MAJA 4AT6B 4YUEH 1G1CA 1F58L 1IEBA 2F53B 3Q48A 2R1YA 3LEVH 2JJUA 4XBEH 3CCHB 5CZXC 4O51B 1RZJH 1UENA 2H45A 4I0PA 4NO0B 1FLRL 3ARVA 1NFDB 3KPSB 2W0FA 3AAZB 3HA0A 1QRNB 4GQPH 3RZWA 3LEXB 1EHLL 3SDYH 1RK0A 5AZEH 5BRZB 1KJ2H 1MPAL 5D71H 5B38G 1FLTX 1H8NA 1RZFL 3DV6B 4I18A 4JZJA 4MZ2A 4XWOD 4R96A 2QBWA 4JFPA 2WINA 1A6WH 4YHIB 5GHWH 3W11C 5DK0A 1TQCB 4DKAA 3BUYB 4JR9L 2XXMB 3HPJA 4HXAH 1AGFB 1R5IB 2RBLA 3ZDXE 3H9SA 1GC1L 5JW4M 1CICD 5IQ9A 1KB5B 1CDHA 4IHOB 4NNXA 1S9YA 4KRPB 4APQD 1YDPA 5F7DA 2D7QA 4G6AC 5CEXB 5IB3A 4LLWA 1PEZA 1MCOL 2FLBT 4R90L 3LPFA 5DXWA 5TGBA 1KJ2A 2PTUA 1K4DA 5FFLA 5JQHC 1FAIH 2AABH 2NW3B 3REWA 1KXVC 2RJMA 1OP9A 1UJ3A 3C2AL 4PJIF 4OCSL 4ZO7A 2BX5A 5EG6C 4JFDA 1U3ZA 1TJGH 2V2XB 2QR0B 3H9SE 5JXED 5EUKB 5CLWA 4BFIA 5FF6A 4QT5A 3VMOA 1ZA6B 3FQRA 3OAZK 1OARH 4KFZC 4JVUA 4XPGH 1LQVA 3CH1B 5I9QC 5DR5L 2I25N 2DQCL 5EIQA 5EUOA 5IEKB 5J8OA 2ICCA 3C09C 3FB5B 5DQJB 4O58H 3HLAA 4LSPL 3QIUA 2R2BB 4L8SC 1F11A 1CR9L 2FX9H 1N5AB 5ACMA 5I1EH 3FB8B 2IQAA 4AG4H 4ZFZB 1B6UA 2OL3B 5D6CB 3X12B 3LV3A 1TZGH 5T3ZH 3ZDXF 3O4OB 2L7UA 1MVUA 4NRYA 2FJHA 1J05B 5EORL 3ARGD 2EXYD 3GK8L 3MLVL 1KPVA 3T3PF 4JEGB 3MRQB 1F4YH 1IGIL 4L1HA 1YEGL 1YY8B 1FFOA 2YPVH 1NANH 4JHWH 5HI4D 3IJHB 1A0QH 4WW2B 3OKKB 4JFFD 3DX7A 5H8DA 2PCPB 4LLYA 4QXGL 5D5MB 3AMKA 4MXVF 3LKOB 3SE9H 4CN4A 5C08D 1TZHB 5CWSA 4GRWH 1S8DB 4KVCH 3K1DA 3MOBL 3BKJL 5SX5H 4PJBE 5A2FA 4ZYKA 4G8GA 1BX2A 2FIKB 4IRZL 2B1HL 2HP4A 3CK0L 5JOFB 4WFHE 5JORA 4P59L 2D2OA 5CZXD 1G9EA 1CFQA 4PV9B 5E6YA 5LCVL 3QIBB 4MJ6B 1LK3H 1RIVH 1V3MA 3QCUL 4TUJA 4PRBA 5DK2A 3FO0H 5F1IA 4YK4B 2E5EA 2GTZA 3RL1A 3ARBB 5CSGA 4UOW1 3P11H 4Y2DB 4M48L 1XGQA 3SDDA 3P4MA 3W11D 5FKAA 4IRSA 1J1OH 1F45A 5T3ZE 1BZQK 3GB7A 2HLFD 4C59B 3KWWB 3G6JA 1WITA 5IF0B 1AJ7L 4ZSOA 3KDMB 2AKRB 2N7BA 2VSCA 3NIDF 1CDBA 3WD5L 2ZUXA 3DGGA 5ERWA 4QRSA 3RWGA 1YUHB 2VWEE 4JDVA 1U58A 2HKHH 3VA2C 4P49A 4XCEA 4YC2C 3RVUC 4PUBL 5EUOF 4H20L 3MRLB 1OAQL 2VN4A 4MJIE 1B90A 4G3YL 4HIJA 3U9PL 3OF6A 2DD8L 2XWBB 1RUAL 3G6JE 3NMEA 3BKML 5GGSB 3MRJA 4ZSOE 2DM7A 4MDJA 3W0WA 3VH8G 5IROA 5ENWA 1EJOL 1YJDH 3KYKL 4I2XB 3ZSSA 4KRNA 4NKIL 5FECB 3CPLB 4LPTA 1NLDH 1AD0A 3I6GA 4MSWB 5IQ7H 1QOKA 1CLOH 1E28B 3BI9X 4OGYL 5MERA 1QKZL 1HHKA 2Y1VA 1AGEA 4TUKL 3DXAE 3L7EA 3Q1SH 4ZUSB 1MIEH 2F53A 4BYHA 1KB5H 4OCRL 5TQ2L 3VMNA 1OPGH 3DSFH 3CCHA 4HWBH 4O51A 1GHFL 4WWKB 2OTWB 4NC2B 4NO0A 2VITB 1NFDA 2DICA 3KPSA 4UT6L 3AAZA 1QRNA 2ED9A 3LEXA 4OV5B 2UZYB 1MCIA 4MJID 5BRZA 4TSAH 4UINH 5D1XB 2QHRH 3DV6A 3UTOA 5E2WL 3QZWB 3T0AA 4WFFE 4GXUN 1MCSA 4ODTL 3LH2H 4YHIA 2P5ED 2IF7A 2Q3AA 3PDGA 4LIQH 3MRIA 4Z7VB 1FIGH 5MEPB 3BUYA 3TH4T 4GRWF 1AGFA 1R5IA 5IP4A 4O02H 4XCCL 2F53E 4WU5B 5EU6D 1QBBA 5CP7B 2YD1A 1KB5A 3BN9D 3JWDC 4IHOA 4HWBA 2WLZA 2OR7A 3KR3H 3QAZC 5CEXA 4NBXB 1QRNE 4HKJB 3U46B 1VEOA 3QEUB 4BFGA 4TQEL 1BBDL 4NM4H 3QFDB 2Y7QA 2NW3A 1WJ3A 1CG9B 3NTCH 5D2LE 1IZKA 1JIBA 3WSQH 3O6FB 1G9NC 1L9NA 4QWWC 3FQTB 4GAFB 3Q3GB 4Y4HC 5BVPL 2OL3H 4D3CL 5J13B 5IM7B 5F93C 2V2XA 2QR0A 5EUKA 1FZKB 1FJ1B 2X89A 5JIIA 3S88L 1K2DB 3X3GH 1D9KD 4OJFH 2YXFA 4YGAB 2R56L 3CH1A 4ZS6C 4LPWA 5ITBH 1FN4B 2LAGB 3PF2A 4ZAKB 3FB5A 5F1OB 3RVUD 5DQJA 4KY1H 1BECA 3VRIB 2R2BA 3V5DA 1N5AA 1JYNA 3FKUS 1QEWB 4ZFZA 2OL3A 1SBBA 5D6CA 4JN1H 3X12A 2V17H 1QR1B 1ES0B 1HNFA 1J05A 3WNLA 3B2VH 3TA3D 2E7CA 3SBWC 4OFIA 4N0CC 3MRQA 1KB9K 1NFDF 15C8H 1OB1B 1QSVA 32C2B 2EICA 1YEKL 5I1IH 1YY8A 2CIKB 4LRNL 1NCUA 3R0MA 2YKLL 3CC5B 2P8MB 1A7NL 1CD9B 4U33A 1AY1L 3IJHA 4PP2B 1QFWI 4WW2A 3OKKA 1BPVA 4DGYL 5E2TH 4KTDH 4J3TA 1K8IA 2NY3B 4U0RC 2PCPA 3MLSL 1A6ZB 2VL4A 5D5MA 1P4LB 4JO2H 1TZHA 3O6ML 1S8DA 5FHBH 2VE6B 2JELH 3LSOB 1BGXL 4RZCA 4PGEB 3V4PL 1MRDL 4JCLA 1ZLVH 1QLFB 2FIKA 5DC0A 4K23H 5JOFA 3QHZH 4YHYC 3NH7H 4KZEL 3OB0K 4PV9A 5E03A 5F9OL 2VLJD 5EA0L 1S9XB 1WBYB 4LVHC 4MJ6A 3SCMB 4XAKD 2MKLC 3H0TB 2EZ0C 3GO1H 4ZODA 1I4FB 2QKIB 3CSGA 4KI5D 3ARBA 5D5ME 4TVPH 5DD1L 4S0TD 4JPWH 3BP6B 4X6DB 5HGBB 5AYQA 4GG8B 1YN6B 1P7QB 1F42A 3K8KA 3KWWA 4M5ZH 5FGRA 5IF0A 3EZ8A 3TIEB 3KDMA 1MRFH 2AKRA 4OFVA 5T3XH 4F15C 3CFKB 3OX8B 1HN1A 2YRLA 1YUHA 5EZOH 5TE4H 3OXRB 1U8NB 1M7IB 1JHKH 4XI5D 5E99H 3ARFB 3RKPA 4DN4H 1LEIB 3MRLA 2IMNA 3BH8B 4F9PC 1JYVA 3V6OC 1RMFL 5TDOB 2DQEL 4CU6A 4NO3B 1IILE 3DSNA 1RUMH 1MCEA 4DK6A 3C5ZC 4F57L 1UJTA 1JTPA 1A47A 2XWBA 4Y4HD 3CX5J 4GW4B 3IAPA 1JRHI 3HHRB 1NLBH 4JO1L 2UY6A 4GBXD 3E3QE 5GGSA 1AO7D 5BMFH 3P9WB 1I3UA 1RZKH 4XPBH 3WS3B 4I2XA 2FH6A 5GPRA 5FECA 3U9UB 3CPLA 5HDQL 2NYYC 4WW2F 5FM5O 4MSWA 4C56B 5KVGL 3VXMD 1E28A 1FNHA 1P7KB 1QA9B 4LNVA 2WBJB 5D2NB 4TVPE 1T89A 5GGRB 1MJ7L 2KPNA 1JNJA 1MWAB 5ALBL 2VAJA 1JPTL 4WWKA 1QHOA 2OTWA 2A77H 3QQ3B 2VITA 3FN3A 3EDJA 5GJTH 5T3XE 4OV5A 2WW8A 4I2XE 4HS6A 1G6RL 2IANB 3O3DB 1U8HB 5D1XA 4YZFE 1WBZB 4RWYH 1T0MB 1IQDB 5L7XL 2I26N 4HMEA 3MV9B 4GUPB 1FGNH 4Z7VA 1RJLB 5MEPA 5FO7A 1KF9B 4XGZB 4X8JB 2QQNH 5TE7H 3O4LB 3AVEA 4WU5A 5IT2H 2ZOKB 5CP7A 2QSVA 5C7XH 3RY5A 3NCYP 3ARTA 4FQJH 5F96L 4KDWA 3N0PB 4LLVB 4F3FB 2CQVA 5I1KL 3JWOL 3MLUL 1OHQA 3U46A 4P9MH 2D4DA 3WFDL 1J1PH 3QEUA 5IBTH 2BXZA 4O2CB 4LAQH 3QFDA 1CG9A 3O6FA 4L4JA 4HD9A 2HN7A 3FQTA 2XOTA 1NAKL 1CFVH 1QFUH 1A2YB 3Q3GA 4G7YH 1WCQA 4TPRL 5HGGS 1CQYA 3QZWG 3CH8A 4S1QH 5IM7A 1GGYA 1OY3B 3MV7B 4IS6B 3KHQA 3ZDZE 1CS6A 1FZKA 4YWGH 1FJ1A 4OT1L 4NOBA 5EOQL 1NBYB 1K2DA 4S1SH 5DJ6B 4P4KD 4QHKJ 4KVNH 1MHPH 2XA3A 2BJML 1FN4A 4ZXBB 4N8PA 4BQ8A 3L3GB 1GH7A 4ZAKA 3VRIA 3L5HA 4HGWB 3ULVF 4YAQB 1QEWA 5EOTB 1MLBB 3BPOB 5E6ZA 3QIWD 1BHGA 3IETA 4CMHC 3IS0X 1QR1A 1ES0A 1ED3B 1RZ7H 2XA8H 3FOMB 5IVXA 1CL7I 3TO4B 2XZAL 1QBML 1OB1A 4GKSB 2CIKA 3HFML 2OK0L 3CC5A 2P8MA 4P9HL 2HWZL 4LP5A 1PDKA 3WNNA 4P2OB 3CFDB 4PP2A 4LDLB 3E1F1 3DHMA 1HK6A 5FDYA 5LQBH 2NYYD 2NY2B 1A6ZA 4Z7VF 1P4LA 2VDLL 1EAJA 4PB0L 4G8FB 3VGEA 5DUMH 2FL5B 5FYJL 2EE9A 3VW3L 2VE6A 4M9PA 3LSOA 2BSRA 3T0EE 4KJYB 4PGEA 5IVXE 3H8NA 3O3AB 1CIDA 1QLFA 2Z92B 3F58L 4YDLC 4OD3H 2XTJE 4XX1E 4K94C 4XVSH 2FX8L 4LF3B 4K3EH 2ORBH 1S9XA 1WBYA 4LAJH 4B7LA 3SCMA 2NX5E 4XX1G 1KOAA 2NY0B 3H0TA 4XPTL 3RJQB 3QCVL 3W5MA 3KG5A 2PTTB 1T7ZA 4OGAC 3N1GC 4X6DA 3R8QA 5HGBA 1YN6A 1P7QA 2LV4A 4YR6B 2AV1B 4N9OB 3TIEA 5E4EC 1SBSH 3T4YB 3CFKA 4NQCD 3OX8A 3JZ7A 2CRZA 2EC8A 4I77H 3VFSB 4Q6YA 3OXRA 1U8NA 3LEYL 1M7IA 1AFVH 3VXUD 1D5MB 3LHPH 1LEIA 3VRJB 2HKFH 4QRRE 5TDOA 4FZEL 3OKOA 4UBDC 3MRPB 5EZIH 2XTJD 3QYCA 2YA1A 5CLTA 2XYCA 4LEOA 5KVEH 2AK4B 4GW4A 4RBPK 4J6RH 2EH7L 2NXYB 4LLDB 3MJ7B 1MWAH 2AJVL 2EXWD 4YBQD 5MI0C 1CD0A 3WUZA 1BEYL 2NX5D 4H0IA 1A3RL 5FYKD 1Q8MA 4LQFH 3SDAA 3F7RA 4XVUD 3WS3A 3OGOE 5CD5D 4TOYL 2O5XH 4C56A 3KPPB 1JVKA 1P7KA 4Z7UB 1QA9A 1KYOJ 5D2NA 3FAXA 5GGRA 5E1HB 1KXQE 4CN6A 5DA4A 1ZWIB 1L7IH 1MWAA 3N9GL 3EYQC 4XPAL 3HUJA 3ARUA 4PIRF 1GL4B 3QQ3A 4NQUA 2ZJSH 2X10A 5BV7B 2J3SA 2IANA 3O3DA 1U8HA 4HMDA 2PYEB 3BKCH 1RULH 1DN0A 1WBZA 4DTGH 5GS2H 1J1XL 1AGBB 4KJQC 1KUMA 1T0MA 1IQDA 5JR1H 1R3HB 1NCNA 1IGML 2FECI 3MV9A 5CINH 2IFFH 4GUPA 1YC8A 1RJLA 3C6LB 5CJBA 5C3TA 4A2MA 4JGMA 1MF2L 4XGZA 4X6DF 5B8CB 4X8JA 3ZHDA 4U31A 3O4LA 4RMSA 1T80A 1C08B 2ZOKA 3MMEB 5IKCB 4JFEB 3HUJE 4NN7C 4LLVA 3ZE2E 5IFHL 4F3FA 2MKWA 1O7SA 4LSTH 1NC2D 1UM5L 3ZYJA 3D0LB 2MWCA 4KKNA 5C0CB 4Q2ZB 3S37H 3HC3L 4NIKB 2R2CA 2IANE 2VABB 1KGCE 1I1RA 5L0QB 1F90L 4W6YB 5SWZB 1X4ZA 4JPVL 4MXWL 1JGLL 1EO7A 1W72B 3B9KD 2D7TL 4Y16B 1F00I 5KSAC 1VESA 1Y18B 2HTLC 3FMGH 4N90D 3PDOB 2JJTC 3PIQB 2BFVL 1A2YA 2MCPL 1GGIH 5HYJA 5AYUH 2N56A 3VA6A 5JHDD 3MV7A 2Y6SD 4Z78A 3O4LE 4IS6A 3HI1B 1I7UB 1C12B 1NBYA 5DJ6A 5I1GL 4U3CA 2DI9A 4EBQL 2H26B 2UZIH 1RU9L 4XMPH 4ZXBA 2J8UB 2C4FT 3MV01 3VWJB 3L3GA 4M02A 1I9JH 1S7WB 2IPKB 3U36B 2GIYA 4HGWA 4JB9H 1Q9OB 2DQTH 5EH1A 4YAQA 4P3DB 1Q1JH 5EOTA 5HYJE 1MLBA 3DMMD 3JTTB 4KUZL 3MV7E 4UBDD 4U1NB 1ED3A 3FOMA 4JRXD 3BW9B 1KGCD 3TO4A 4Q9RL 1F2QA 3HE6B 4KQ3L 4ZUVB 3ZE2F 3HI5L 5E5RB 3GI9L 2APVA 2A0LC 3BDBA 4GKSA 3IB4A 1BAFL 1J0YA 2AS5M 1Z9MA 2X2YA 1CFSB 1WZ1H 4P2OA 3CFDA 1JI1A 3H3KA 1ZT4B 3Q6GH 25C8L 2IPTL 3I6LE 2VC2H 3LS5H 4EUPB 4OLYH 4IJ3B 4WGWB 2QQKL 3U0WL 1MQKL 4G8FA 4R4FL 4AL8L 4JM2B 1H3VA 2YD4A 2FL5A 3QRFM 4D9QE 2X44D 2YWZA 4FQXA 3QUXB 1M7DB 3O2VL 4ODHH 5L2KB 4KJYA 5JDJA 4Y5XB 1S9VB 3KAAA 3O3AA 3P0VL 3UYRL 1OTTC 2Z92A 3U7WH 3RDTC 1FV1B 1NGQH 3MLWL 4PGBA 1E4KC 2VJXA 4XXCC 4I3RL 1MI5B 4LF3A 4JQIH 1NCBH 4IEFB 5BS0B 1I3VA 2Q1EA 5D7SH 4XC3H 5EO1B 5TQ0H 2PTTA 3ARPA 4I13B 1I1YB 1WWCA 4HQQL 2Q7NA 1VDGA 5HPMB 4YR6A 1TJHH 3KPMB 1KELH 1U8KB 2AV1A 5IBLC 5C0EB 4YNYB 3HAEH 4OCWH 4Z76B 3T4YA 1WEJH 4J3XA 3VFSA 5H94B 4DGVH 3NA4A 5DJ2B 3I02B 4U49A 4K3JH 3DROB 1UZ8B 4YHLH 4D9QD 1JFMA 1D5MA 2AV7B 1B0RB 3VRJA 2V2TB 2V9TA 1QPPA 4I4WB 3ILQC 2VDOH 4HJJH 2QSQA 5KSAD 1EERB 2HTLD 3RGVC 3MRPA 2QLVB 3NFSL 4HFUL 1ZGLM 3A6OA 4OQTL 4OSUL 4WHTA 4LLDA 1MCNA 3MJ7A 1YYLL 2J1KA 4RX4A 5GZOC 4ZTOH 2GJ6D 1L6XA 5B22A 3HAEA 1KTDB 1H3PH 5BV7H 4BSVB 1IAKB 1EFXD 5JZ7C 1INDL 3A6CH 2FATL 3ULUD 2GY7B 3SO3B 5HDBF 2IJ0C 1FORH 1DFBH 2J8OA 3TJHC 3KPPA 1NANI 1HINL 4NN6B 1IGJB 2UUDH 2AJSL 1MCPL 5BCAA 4XP6L 2FHFA 1U8QB 5A3ID 2VZOA 3U4BL 2EIZB 5CJOH 4MAYD 2CR6A 3ROLB 4LKCB 4TSCH 1EX0A 2ZUYA 4HAGA 4YGVB 3SHSA 3HB3C 5DJDB 3QNYB 3SEPA 4M1DH 2WNGA 2DQUL 2B4CL 4LVEA 2A0LD 1XEDA 2PYEA 4R7NB 1KEMH 1SEQL 4QTHB 1W72H 1AGBA 1Q94B 4XHQA 1R3HA 2M2DA 5F7HA 2AJZB 2BVTA 3C6LA 3ALWA 1RQ5A 5L8KB 1OOAA 5B8CA 5J3HD 3GBMH 3C2SA 5B3NA 1GJIA 3HG1B 1C08A 2XWJB 5KSUB 1F8TH 3MMEA 3GHEH 5IB1B 4JFEA 4JG0H 4DVBB 5IKCA 1E6JL 5L8LB 1RD6A 3D0LA 4G9FB 5F7MC 4NQVB 5C0CA 4Q2ZA 5TF0A 1J8HB 1OTTD 2Q7YB 3BVNB 2HMID 1NAML 2C1OB 4L3ED 4K8RC 2VABA 2H41A 3BMWA 2NY4C 5SWZA 4RQQB 4I0PC 4PS4L 1W72A 4Y16A 5D7LB 3L5XH 3O9WA 3PDOA 5IJKA 3PIQA 4G8EB 3GKWL 4G42B 1MFCH 2DYPD 4I18C 4Y89A 3SY0B 4JZJC 1BOYA 1N7ML 5DRNB 4PGCB 1NJ9B 3WS6C 2AJYH 2X41A 1E6OH 3HI1A 5HHXL 1I7UA 2EC9U 4WHCA 1C12A 1AQKL 4FZ8L 4JFEE 1AR2A 4BQ6A 4FQHB 1KCGC 1E4XH 2H26A 3BISA 2VSDA 2D9QB 2J8UA 3NZHH 5EU3B 1IAIL 3ALPA 5SWZE 5C0BB 5KW9H 4EUPH 1RZJC 1S7WA 3NA9L 5C6TL 5CCKH 2IPKA 5BO1L 3U36A 4Z7UF 2Y36L 2EDEA 2MOVA 3MZTA 3WMSA 4EIGB 5CJQL 2R29H 1Q9OA 3GSQB 4P3DA 5IV2B 3ILQD 4JHZA 4W70A 3JTTA 3FONB 4FP8H 3RGVD 4U1NA 2X09A 1ITBB 1UJ3C 3BW9A 3IRZA 4LHUB 3BPCB 3HE6A 1WAAF 5GZOD 4WFGE 1YZZA 3QDJB 2PO6B 1CFSA 3B5HA 1ZT4A 2J8UE 3EDFA 4P3CL 3WO3B 2VIRA 4EUPA 1JPSL 1X5XA 3A6BH 4G9DB 1KB9J 1J18A 2VISB 4P99A 5AG8A 3G6DH 4JM2A 4JY5L 2ERJC 2A2QT 3FFCD 3S36X 3QUXA 3U0TB 1M7DA 3N1PC 3VXRD 2DI7A 3QIUC 5L2KA 4NP4L 4Y5XA 4XNZC 2HJFB 4YHPB 2JIXD 3L3HB 3ZT5A 5L88L 1FV1A 3F7YB 3AS0A 1G9MH 1YEEL 4NQXB 1N64L 2EDTA 2DTML 1MI5A 2E6JA 1SEBB 5BS0A 2IALB 2GITB 2E6PA 4U1GB 4MQXC 1DEDA 4JJHA 3O8XB 5IB2B 4UV4L 1N8ZB 2JB5H 3D48R 1I1YA 2AI0L 4XVJL 1MPAH 4H5SB 1U8PB 1FL3B 4N8VB 3HZVB 1RZFH 4WFGD 5HPMA 4NHUB 3WHE0 4EUPG 4BK5A 3KPMA 4X5XB 1U8KA 1I75A 5C0EA 4OGXL 4HLJA 4YNYA 4Z76A 3DVNB 2JJSA 4PY8I 3CGTA 1QSEB 4XPHL 5H94A 1T7WA 1MI5E 2WQ8A 4TNWK 1NUNB 2YZ8A 5DJ2A 3HNTL 1GC1H 3I02A 3CSYB 3DROA 1UZ8A 2HRPL 3UJTH 1INQB 5GGTH 1HKLL 2AV7A 2VB5A 4K8RD 1B0RA 2CDFB 4ZO6A 3T3ME 4CRPA 5GS0L 2V2TA 2VWEC 2XN9B 4I4WA 1MCOH 4R90H 3S36L 4PYGA 3WKML 2I9LB 1YC7A 1I3RB 1OGAA 3VDAA 3PP3K 1UADC 3D85D 4C4KO 4OM0L 2ZUTA 5EZJB 5C09D 4UQ2B 4RAHA 3NAAL 3SDDC 4OCSH 1KTDA 3EYSL 4IRSC 1IAKA 4BSVA 3REVB 3NPSC 3V6FB 5T1KB 4RGNB 2HT2C 3VGAC 4HW6A 5GGTA 2Q86A 5IVNA 4HF5L 4RFNC 1KV3A 2AXHA 1WVZA 4N1HB 3T0VA 4JM2F 2K9UA 1IGJA 3NCJL 1A9BB 3EYVB 5EDXA 1OGAE 1U8QA 5MP6H 2EIZA 3IXTB 1FSKB 3BJLA 3ROLA 4LKCA 1H8SA 4YGVA 3DUHA 4Z0BL 4U3HA 1DQTA 5DJDA 3QNYA 3O6KH 3UTTD 4LSUL 5F7UA 1YNTB 4QLRA 2GY5A 3BAEH 4YHNA 3QI9B 4JFDD 1MLCB 4R7NA 5DVLA 4QTHA 6FABH 3T3MF 5B4MC 1Q94A 1KSRA 4P2QA 5E6IB 3HE7B 2P5WD 1YEGH 5AWNH 3GSUB 2AJZA 4HK0B 1A6UL 2I9TB 5BVJB 3HG1A 2FO1A 2XWJA 3LZFH 4P2YA 3C6SB 5KSUA 5DHXB 2VXQL 3WEXB 5IB1A 1RURL 4DVBA 4QXGH 2FCBA 4G9FA 5HVWA 4NQVA 1FE8H 1J8HA 2JCCB 3ZKND 2Q7YA 4EI6B 3VG0L 3BVNA 3NIFE 2C1OA 4XP9L 3FQUB 2KH2B 2IAMA 4RQQA 3WFZA 2ESVE 2VDPH 3QEQD 3BX7C 4X7EC 1MAKA 4P2QE 2B1HH 5D7LA 3CK0H 3IJSB 3NPZB 3KYMA 4MQXD 3AS3A 2X4TB 4G8EA 1TCRB 4G42A 5SWSB 5KOMC 3DYOA 5LCVH 3SY0A 5J12B 1L0QA 5IVZB 3QCUH 5DRNA 1DVFD 1NJ9A 1XGUB 4PGCA 3HG1E 4LCWE 4LGRB 1TQCC 4JAMB 4OUOA 4KHTL 1FNGB 2GAZB 4M48H 4FQHA 3KPLB 4QHMB 3K2UL 2YEZB 4OV6F 4UNTA 5EWIH 1J8HE 1NDGB 3LKSA 4L4VB 3F5WB 3MBEB 4PJXF 5K9OB 4BZ2H 5EU3A 1AJ7H 2B1AL 1QPXA 4KRPC 5C0JB 5C0BA 1ZMYA 2HH0H 3WD5H 5JNYB 1MFEL 3LB6D 5D7LE 4OI7A 4G8GD 5IFAH 4MQTB 4X8XA 1A7PH 1P9MA 4M9OA 3QWRA 5IV2A 2BZDA 5I1HH 3FONA 4PUBH 5IOPB 3D1MC 1A4JB 1S7VB 1AXTH 1ZT7B 3BZFB 1OAQH 2G5RA 3BPCA 4MVBA 1EHNA 4G3YH 1HHJB 3U9PH 5C92A 3QDJA 3OG6B 2F5AL 2DD8H 2PO6A 3SDDD 4L9LB 4N5EA 3EGSB 3DETC 5KS9B 4LCUB 3TYFB 2R0LL 1I3GL 2VR5A 2HT2D 4GSDH 2FEDC 4QRPE 4RRPA 5DJ0B 4LCWD 1BFVL 1MELA 4G9DA 5KTEL 2VISA 3KYKH 2I24N 4LVOB 4NKIH 2VXTL 1YECL 4DOHB 5C6PB 4M4RA 5DEZA 1NBQA 5J4MA 4PRHB 2VDKH 1KIQB 4OGYH 2ADGB 2HJFA 3MNVB 4YHPA 4FFEX 3L3HA 2NY5L 3F7YA 5D7JA 5E7FA 4TUKH 1C1EL 4A6YL 3FB6B 4JQVA 3O4OC 5DURB 3BJ91 3QDJE 1IM9B 4LHUG 2PTVA 4UNVA 4YHZH 1SEBA 2DOCA 4PBXA 2EE6A 5FGCB 4OCRH 2GITA 4P2RE 4WUUB 3QUML 9CGTA 2AJ3B 1IAIM <