1INQA

Structure of minor histocompatibility antigen peptide, h13a, complexed to h2-db
Total Genus 70
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
70
sequence length
275
structure length
275
Chain Sequence
GPHSMRYFETAVSRPGLEEPRYISVGYVDNKEFVRFDSDAENPRYEPRAPWMEQEGPEYWERETQKAKGQEQWFRVSLRNLLGYYNQSAGGSHTLQQMSGCDLGSDWRLLRGYLQFAYEGRDYIALNEDLKTWTAADMAAQITRRKWEQSGAAEHYKAYLEGECVEWLHRYLKNGNATLLRTDSPKAHVTHHPRSKGEVTLRCWALGFYPADITLTWQLNGEELTQDMELVETRPAGDGTFQKWASVVVPLGKEQNYTCRVYHEGLPEPLTLRWE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system
molecule keywords H-2 CLASS I HISTOCOMPATIBILITY ANTIGEN, D-B ALPHA CHAIN
publication title How H13 histocompatibility peptides differing by a single methyl group and lacking conventional MHC binding anchor motifs determine self-nonself discrimination.
pubmed rcsb
source organism Mus musculus
total genus 70
structure length 275
sequence length 275
ec nomenclature
pdb deposition date 2001-05-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00129 MHC_I Class I Histocompatibility antigen, domains alpha 1 and 2
A PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1inqA02
3.30.500.10 Alpha Beta 2-Layer Sandwich Murine Class I Major Histocompatibility Complex, H2-DB; Chain A, domain 1 MHC class I-like antigen recognition-like 1inqA01
4L9DA 4NQSA 5K59E 4MA1B 2XKSA 3UAJC 3WNMA 5I17B 4WTZG 3RI5K 2EIDA 1BD2D 4LEOB 1B0GA 3SE4A 2V5RA 1SVZA 1IGCH 1V3JA 4PGBB 3LQAH 4WCYL 2GY5A 1E6JH 1IQDA 1FH5H 1A1NB 1AKJA 4WNQB 5FOBA 3PWPA 5FECA 1EA9C 4FQIH 3RUGE 1AXSA 5BVPL 3KPSA 1KJ3H 2UV3A 4RMUA 5DFVD 3GSNL 1H8SA 4YQXL 3SPVB 1I7UA 2PTTB 2AGJL 2BFVH 4LIQE 2VISA 3WN5B 1H3XA 2Z8WC 5E03A 1AFVL 1P6AB 3UC0L 4E42B 2AJSH 1EMTH 4XPBH 1MRFL 5DT1H 1R3KA 5EPMB 1RZKL 4DKFH 1ZA3A 4FMKA 5KANI 2E7LE 1FG2B 2EH7L 3GHBH 1XGTB 5BW7C 1J86A 1UWGL 3RY6C 1JGUH 1AE6H 1I1FA 3ZKSD 3CFJB 3ULUL 3HNSL 2OS7A 4NKOB 3I85A 1UACL 3QFDA 2HFEA 1UVQA 1XF4B 2WAHA 2DL2A 4HFWA 3P11H 3CFDB 4ODBD 2PETA 4PGCB 2V2WA 4OZFB 4WI6A 3VFSB 3GIVB 3GMMA 2QKIB 1JE6A 1HQ4A 1RJLB 5ID1B 1AGFA 1N0XL 4WFHD 3T0BA 5K9KA 4XPGH 1ZTXH 2H8PB 4YDVA 2J8UA 4Z7VE 4R0LA 3DRQB 5F3HA 3IU3A 4PBXA 1JL8A 3S37L 2DLFH 1E4KC 4H20H 1U8MB 3FN3A 5DMIH 5KSVA 2PYEE 1FORL 4MD4A 5E6IB 2YD2A 4IRSB 4CMHB 4BUHA 4XPTL 4PRDB 3U6RA 5BRZB 1QFWM 1MFBL 3NA9H 5HYSA 1JGVH 1EIBA 4BYHA 1UH4A 3MROA 1FN4B 1F6AB 1WIOA 2JLLA 4GW1A 3DECA 3R0NA 5KJRH 4HC1H 4F37K 4HC1A 4ODUA 1T1WB 3EGSB 5B3JE 5B38A 4JPKL 1F3JB 4MA8L 3ROOB 3K80A 1XGPB 5KVDL 3IXTA 4NZDA 4PJAF 3C08H 3SE4C 2F5BH 1T2QL 4YHIA 1J8HA 4K8RH 5DDHB 5FYKD 3CLFH 2ED9A 3LQAC 4R2GB 4KRPC 1XF2A 3HUJB 3RKPA 4F57H 1T66D 2QLVB 4YC2C 43CAB 2VIRB 2R0KH 3VJ6B 3M8OL 1OAZL 5HHMD 3DO7A 1BX2A 3BMVA 4TULL 2WBJD 3D69B 4NKDB 4PLOB 4GSDL 2IGFL 1G9NH 4XP9L 1QFWI 4NHCH 4XP1L 1TNMA 5AYUH 2J2ZA 5K9QG 3RP1A 15C8H 3LOWA 2X10A 3VXPB 3GBNH 4OM1H 4HF5H 5F9WC 3HI5L 1T5WA 1X9QA 5FAAA 3MLUH 2Y07H 4OKVA 5HYSG 2ZSVA 1QSZA 5FDYA 5BV7B 3VGHA 2JK5B 1UXSA 2KQMA 4Q74A 4QEGA 1BEYL 4FXKA 5DJYA 4MJ5A 4R4BA 4E9LA 3TIEA 4PDCE 4CADA 1VHPA 1K2DB 1M7IA 4OKDA 4PJEB 1CDJA 4I0PB 4LVNB 3WJJA 3FQTA 4G6ML 4RGOH 2FECI 3QUYC 3K3QA 3EYFB 1U95B 3VGFA 5CEZL 4N8PA 4I48B 2VZVA 4R97C 4R3SB 2X41A 5IG7A 3O3AB 3MGOA 5EU6D 4F7MA 2KDGA 2BNRD 4M6ML 2F58H 3EOYG 1I4FB 3HPLB 1WAAF 4R0LC 1QBLH 1U3HD 1FL3A 4JM2A 3CFCL 1SEQL 1XGYH 1T5XB 3PDOB 4Q9BA 4IOIB 2P8MB 1WEJH 5IF0B 2LU3A 3MXWL 1KPRB 4X6DB 1KN4L 2IPTL 4J3XA 4B50A 1VEMA 3ARPA 2AXFA 2DYPD 5DRXA 3DROA 5FA3B 2YD3A 3H9HB 1MSPA 1KIQA 1BOYA 5DJ2B 2AP2A 2XKUA 3T2QA 2W60A 4WI7A 1VKXA 1HNGA 1F97A 4IDLA 1TCRA 4RZCB 2ZCKL 4UNTA 1NCAH 1SHMA 3G5ZA 3DX8A 3TIDA 3QHFL 3SDDA 3X3FL 3C6LB 4LHQB 4D0DB 4JLRB 1G7HB 4K8RC 2HT4D 2MHAB 3RPIA 2HTLD 5J0BA 1YPZA 1IKFL 1NAMH 3FO0L 1GGTA 1U2CA 3ZDYF 4NUJA 4I13B 4TSCL 4Z95H 3FB7A 1LWRA 1JHKH 1KCUL 4ODXB 4FQXB 2Y6SD 1OSPH 2OL3H 2DKMA 3CFBB 4MGXA 2JCCB 3IDXH 1RULH 4O2EA 5D5MA 5TDNB 1X5JA 3KPPB 1IGML 1G9NC 3IVKB 5ACZB 3QCVL 5IESL 4G6JL 5DJ8B 1X5FA 4ZFZA 5IT2L 3EYOA 2ZUXA 2A73A 4AQ1B 3RIAF 1QFHA 3G6JF 4HGWA 2E6PA 1I7ZB 4EN3B 1KEMH 2RIKA 4YPJA 4N8VB 5D7LB 4RSVA 2I9TB 5ICYB 1TITA 4P46A 4QGYA 4W68A 1ZT4B 1U6AL 3GNMH 2FBJL 3V52L 4ZUUA 4DVBB 3WSQH 1W72H 3MV11 4K71C 3A6BH 3K8MA 1W72A 5EFIA 3I6LE 3UYPA 4RFOH 3JTSB 4PJIB 1ONQA 4XC1L 3QWOA 2ZG2A 4GXVL 1L9MA 1JYXA 1NCBH 3ARSA 3D87B 3GFUA 3B5TA 4ORGA 4DK3A 4EXPX 3BZEB 4Y5XA 1M05B 2FH6A 3KDMB 1XGUA 4UQ3B 5GS1A 2FR4B 2EXYD 4JM2C 5GGRA 4DUXA 3LKPA 3QUMB 3QQ9C 1PLGH 1MIEH 2ZUVA 2R4RL 1HHKA 1ZVSB 4GW5B 3WL9A 5LXGH 5FYJL 1MIMH 2NZIA 4CVUA 4V1DD 1RZJL 2Q7YA 4KK5D 1ITCA 1YNLL 2HH0L 2QSVA 3OGCB 4G8GE 4EQ3A 3MRMB 3WHE1 4P9HH 1GGCH 5CEXB 4PJAE 2DTML 3K2MC 3KJ4C 4YHOH 4D9LL 1J1OH 4X7TB 1IBGH 2GCYA 2MWCA 5EZJA 1I8MA 4OF7A 2BVOB 4JFYB 4ZUTA 4O58L 1S5HB 3SDDC 3ME0A 2X4TB 3G08A 1S9WA 3MJ8B 2BRRH 2H2SC 4M48L 1NCWH 2A0LD 3CMGA 4ZNCD 1G7MA 4GRWB 1BZQK 2X70B 1PZ5B 2VLLB 4Y5YA 2D7QA 4PY7A 1E6OL 1KNOB 5ITFA 2DQFA 3CIQA 3ZDZF 5ADOH 4MA3A 5H94B 3QXDA 4OGZA 4R9HA 5I16A 4ZPTB 1ZOXA 1OGTA 3MV7B 2EIZB 5DHVB 4TYUA 1YUHA 4Z9KB 3UTSE 3GSOA 3GM0A 3SGKA 3WXWH 4JO3L 5L2KE 1PYWB 2Q8BH 4X6CF 5GGSY 1U8KA 3VH8A 4M8QA 1WFNA 5F97E 1EAPB 1Z0MA 5JOPD 4WO4D 3DUSA 1QRNE 4P46C 1VFUA 2NXYB 4KDTA 4NQSB 1OP3K 4NJAH 5MHSE 1QYGH 3KVQA 1Q0YL 1N6VA 1B0GB 4MD5A 1SBBA 1NMBL 4LRIC 1IQDB 5C0AA 5D96B 4YXKH 3O11A 3H9SD 4GH7B 4PB0L 5FO9A 1AKJB 1IAIL 3MXVH 4KRPB 2HKHH 5FOBB 3GO1H 4UOW0 3PWPB 2DQJH 5FECB 1D5ZA 4YC2B 1R0AH 1AXSB 1KTKE 4XCFH 4Y5XC 3BH9A 3KPSB 4HJ0D 5JLZB 1KN2H 3ZYOA 5GS1C 5C07D 5DQJA 1I3VA 1BFVH 5DWUH 4MXWH 2VISB 4CN6A 4MDJA 2FBOJ 2PCPA 5F9WB 1R3KB 1WCBA 5E5MA 5CBEA 4CNIA 3K2UH 1ZA3B 4O02L 5JHDE 4OZGF 4RAHA 4EIZC 1QBMH 2OMBA 4LP5A 1FL6B 3T2OA 5AYQA 2FD6H 3MUGA 3QFDB 2HFEB 1UVQB 4G3YH 4HFWB 4O2CA 4F15B 3UCRA 3EFFA 3VFOA 1XT5A 2V2WB 3D1MC 5GIRA 1NMAL 2IMMA 4J23A 2ICES 1DBML 3GMMB 4JGMA 3BP5A 1CG9A 1HQ4B 5E8NA 2IADA 1AGFB 4KY1H 5K9KB 3UO1H 4Y5YC 4HWUA 4YDVB 2J8UB 1BQLH 4G8EA 4R0LB 2XTJD 5F3HB 3IU3B 4XBEL 1CL7H 3RKDC 2CK0L 4GLRI 1OCWL 4U0QB 4TN9A 5IV2A 4PRIE 2LFGA 4MA7H 5KSVB 1RHFA 4MD4B 3LB6D 5EUKA 1UJ3A 5BV7L 5DK0A 3G6JE 1J12A 1KLGA 4LVHC 3C9NA 4J3SA 3U6RB 5FGRA 2X4QA 5HYSB 3NCYS 2VKXA 3MROB 4IRJA 1T20A 1AO7D 4GW1B 2IBZX 3IFLL 4D9QD 1EJ6A 2R1YA 1UC6A 2OLDA 4ODUB 2VABA 5HHNA 4IDJH 3K8KA 4LVEA 4BELD 3IXTB 3WD5H 4LHUA 3RIFF 3FRPG 4YHIB 1J8HB 1VA9A 2C5DC 3KLAA 1YMME 1KJ2A 1RURL 2A6KA 4FABH 1UCBL 1XF2B 4ODSH 1KCGC 3AS1A 3IFOA 3WKML 2BSSA 2HJFA 3A0OA 4JKPH 3VXRE 3DO7B 1BX2B 1TPXB 3BP4A 5IHLB 3U4BH 3LEVL 4P2OC 5C0BA 3CSYB 5GJTL 1OQOA 4K3DL 5E2TL 5T5NG 2EDHA 1CDCA 5IGXL 1T5WB 5I71C 3OB0H 2QQNH 4QXUH 4OKVB 3LEYL 1JRHH 1F6LL 2ZSVB 2VDLL 1AD9A 2XYCA 2CJUL 3JBG7 5A3IC 1UXSB 3ULSA 1QACA 5ADPH 4FXKB 4GKOA 4G43A 5DJYB 5HGDA 4MJ5B 4R4BB 3TIEB 1F3RB 4CADB 1A14H 5CUSL 1RK1A 4M6NL 1FFNA 1M7IB 4K71B 3FQTB 5T5FL 1WSST 5F9JA 3C5ZD 3DMMC 1DZBA 4QTHA 3VFGH 5E2VH 5J3HD 4MAYC 2O5YH 3HB3C 3MJ7A 2BXYA 5IG7B 3MGOB 4U6HA 4F7MB 5J12C 3QIWD 3BD3A 2YD8A 3M45A 4K3JH 3S8WA 2IBZY 5I1EL 1AQDA 1RIHH 4OZHF 1FL3B 4UB0H 4JM2B 3MYZA 3OPZH 4YZFF 3PWJB 1R6VA 4B7IA 3AU1A 4RFNC 2IF7A 1BBDH 1AXTH 1JI1A 5I75C 4X6CE 1GZPA 1QZ1A 3CZFA 2AXFB 2FLRT 5DRXB 1A6WH 5K9OA 1NLBH 3DROB 5DQ9A 4QWWD 1L0YA 4JQIH 1KIQB 3MLSL 2I07A 4G9DA 4KTDL 3DV6A 5BOPA 3WYRA 2NY7H 4PGDA 2W60B 3NTCH 4CDGC 1VKXB 5F8QC 4L4TE 4YHKL 3KJ4B 3VWJA 3FCTB 1TCRB 1TETH 3G5ZB 3DX8B 3TIDB 1OAXL 4OI7A 4XVUC 3SDDB 3RPIB 4M02A 5JZ7C 1QG3A 4L5FH 4KQ3L 4N68A 4Y2OA 5CS7A 1YPZB 1HH6A 1NAMB 2NXZD 4JHAH 4GW4A 4JO2H 4NUJB 4XB7A 4KK9D 4NN5C 2X9XA 3FB7B 1BZ7A 3ULVF 1ZMYA 4JDZA 5HI4D 5I1IL 4NO0D 4O2EB 2JB5H 1PFCA 5D5MB 2OL3B 1NBYA 4NQEB 1V7NH 1U93A 4D3CL 3Q5YA 5DXWA 3VXMA 3DGGA 4ZFZB 3BP7A 3EYOB 5IEKA 4OZGE 4HGWB 1KBGL 5L8KB 1GYAA 1OW0A 2IQ9L 2DLGA 4P48A 4PJ9A 4NZUH 2W65A 4OM0L 1MEXH 2NY3D 3HI1A 3L95A 3OG4B 1LO4L 3ET9F 4WW2A 1M4KA 2DIBA 2OI9A 3TA3C 4P46B 1H8NA 3SBWC 1MFEH 4ZUUB 1CBVL 1PG7H 1W72B 5EFIB 4NC0B 1GZQA 2JJSA 1IL1A 5MI0B 5IJKC 3ULUF 5BMFH 1UYWH 1ONQB 4LSSL 4N5ED 1FCGA 2W38A 4ORGB 3MGTA 1CXFA 1NGPH 2BY0A 1XGUB 4G9FD 5GS1B 1N7MH 5GGRB 3TH4T 2F8VA 2DQTH 1VFBA 3LKPB 3RVWD 4U33A 2IANE 2ICWI 4M1CD 1HHKB 1DL7H 3WL9B 4YUEH 3KS0H 1DEDA 2Q7YB 3N06B 4Y2DC 4CDHA 5MENA 2DQGH 4NQCD 5E5UB 3O4LA 4P23B 5D2LF 3N0PB 4UV4H 1IGCL 3VWJC 1E6JL 1DQJA 2GCYB 5EOQH 1FH5L 5EZJB 1I8MB 4ZUTB 3RWDA 3MV9D 4HZLA 3QCUH 4LSQH 4FQIL 1QFUL 3G08B 1S9WB 4RAUA 1LMKA 2VLKD 3S7GA 4KMQA 5DUPH 1G7MB 4QOKD 3U83A 3UYRH 4OGAC 2F53A 4Y5YB 2JJVA 4PY7B 1MHHA 2BFVL 4O9HL 4MA3B 5BS0E 1EMTL 3QXUA 5IB4A 4U1MA 3QXDB 2OR7A 3EDDA 4XPBL 4M1DH 5DT1L 5I16B 1JZ8A 3VD5A 3MMEA 1OGTB 1UEMA 4LVHB 1YUHB 2WQRA 3GSOB 1OW0C 1N64H 3VH8B 1U8KB 2R2HB 1JGUL 1GAFH 5A2KH 5IROA 4XMLL 2OI9C 3DUSB 3O6FD 4UTBL 4JB9H 3V8CA 5DFTA 3P11L 3QB7C 2AABH 4PLKD 4FQJL 2JJSC 1IC4H 3HMWH 4OV5A 5C0AB 5E8EA 4IMLA 1DE4A 3BRDA 3RTQA 3O11B 3V2AR 1J88A 1F4YL 1WFTA 2ESVA 5FO9B 4XPGL 1ZTXL 2WQ8A 4RMVA 1TDQA 3QDHA 1XR9A 3CSBA 1WWWX 4PJ5A 1YJDC 1D5ZB 2DLFL 4OZHE 5TE6H 4YZFE 4H20L 5DMIL 3BH9B 2VLRA 4M61A 2APXA 2FHCA 1G0DA 3VE0A 3GGWA 4UT6H 4TQEL 5DQJB 3RZCD 4LBEB 2J5LC 1OTSC 3O41A 3SDAD 4PLJC 1BD2A 3NA9L 1JGVL 4HXAH 4PB9H 2Q3ZA 3IS0X 4JVWA 4MDJB 2PCPB 3IKKA 4OCRH 1U8PA 3ERYA 1WZ1H 1PDKA 3OAZH 4L3EE 4ZOEA 4HC1L 4QYOA 5I71B 5KJRL 1WCBB 1CGTA 1Y6NR 5E5MB 5CBEB 4CNIB 4OLEA 1KGCD 1B4RA 3BGAA 3QXVA 2HMIC 2JELL 3C08L 4FFVC 4NP4H 4ENEC 2F5BL 1IM3A 3FJTA 4KI5D 2HT3C 3ARDD 4R8WL 4R7NA 1L9NA 3CLFL 4KKAD 4DEPC 1J7VR 1KF9B 4YHNA 3UTOA 3C09C 5C2BH 3PXJA 4CW1A 1PKOA 3GMQA 5B4MC 4F57L 1Q9WA 4O2CB 3VFOB 3EFFB 3VRJA 5GIRB 1WIPA 2HKFH 2P24A 3OKNA 2BSRA 1OT1A 3BP5B 1BAFH 1CG9B 5E8NB 2IADB 4TNWF 4JFFD 1G9NL 2VXSL 1P7HL 2OXHA 3ARGD 4G8EB 2R9HC 5AYUL 4H26A 2DD8H 5IV2B 15C8L 2BHYA 3GBNL 4OFDA 5ALBH 4N90E 4RFNB 5EOTA 5DZLA 1K4DA 3DGCR 3B9AA 5EUKB 1KELH 1UJ3B 5DK0B 2EEBA 5I75B 1KLGB 3C9NB 1G0XA 3BI9X 3PP3H 2X4QB 2DMKA 4S1RH 2K7PA 2Y1VA 3FO2A 4WFGD 5IOPA 4IRJB 3H2WA 1T20B 3CDYA 2WIMA 4KKCD 3B2UD 1Z2KA 5BO1H 5IROC 1JNLH 3FONA 2R1YB 2VABB 5HHNB 1SYVA 4CUCA 3MNZA 2KQNA 1L0XA 4KHXH 1PJ9A 3QULA 2ZWLT 5L8LB 4LHUB 1D9KD 2X9WA 3JWDC 2UY7A 3N1MC 1KJ2B 3KYNA 3RTQC 1OAYH 2A6KB 5I74C 2ATPA 2GI7A 3W5MA 3H0TB 4HK0B 4QNPF 3UEZA 3IFOB 1IAOA 1XGYL 2BSSB 1EDQA 2HJFB 1CD8A 3MBEC 3FL7A 4UT7H 4NN5B 4EDXA 1WEJL 3DOSA 2H9GB 5EZIH 3BP4B 4JZJA 5C6TH 5GGQH 1HHHA 5C0BB 1R3HA 5FYKH 4LU5H 3BKCH 1PEZA 3PGCA 4PJ8C 3OHXA 2AJ3A 4V2BA 3BO8A 5I8EA 2OTPA 1AD9B 5D7IA 3OKLA 4PRBA 3ULSB 4P5KA 1NCAL 5HHMA 5CJOH 1QSFE 4GXUN 5DFVC 4G43B 5HGDB 4EOWL 2WBJA 1C08B 3QUKA 3RL1A 1RK1B 3Q5OA 3TNMA 1FFNB 3VFRA 1I9EA 1A7PH 1QQDA 4X6FA 1NAML 4CBPA 4OIAA 2FEDD 3V4PH 1A64A 1K9TA 4JKLA 5A40E 1ULVA 5F9JB 4ZQKA 2M1KA 4QTHB 1A1MA 1JHKL 3MJ7B 1OHQA 2VQ1A 1HINH 1OSPL 2OL3L 4U6HB 3I3DA 3IDXL 1RULL 3B9DA 3TBVA 4F37F 4JRXD 3QFJD 4CU8A 1OOAA 3CSGA 1AQDB 5KANG 2JJWA 1TZHA 4L4VE 3WE6A 5CZVH 1MOEA 3AU1B 2AV7A 4FFWD 3K4ZA 5EOCL 2BNUA 2UUDH 2JF1A 1KEML 1GZPB 3CZFB 5GGTH 4NDMA 4WHYH 3W0WD 5GGTA 5DQ9B 4U2ZA 1C5DA 3P4MA 4G9DB 2I07B 4LEXH 5EU6A 2YXMA 2BNRA 3DV6B 3KPRD 3GNML 5IHZA 3WSQL 1W72L 4PJGA 4PGDB 4Y16C 3A6BL 4TVPD 3QDJD 1MNUH 1U3HA 4RFOL 3VWJB 2EO1A 2DI8A 4FQQA 2FZ3A 5JUEH 1QFWH 1P9MA 5EIQA 2MCG1 4M6AA 4JEGB 3SQBA 1T83A 1NCBL 3V6FA 4XP6H 1GH7A 3HNVH 3NVQA 3ZKXC 2DYPA 4ZUWA 3CK0H 3T77A 1OTUC 3OB0K 4JCLA 1Y6MR 1HH6B 5CILL 5CEZE 4NHUA 4FG6D 1EVTC 5KS9A 1JN6A 2QTEA 4GW4B 1EEZB 2ZG1A 1ZLWH 1BZ7B 2QEJA 4PJCA 4JDZB 1PLGL 4JZJC 2YA0A 5LXGL 3MRQA 1MIML 3GIZH 1U93B 2DRUA 4BJLA 5T1MB 3D3VE 4Z78A 4M4PA 3VXMB 3DGGB 3BP7B 5ILTH 1NGYA 4YFEA 5E94A 5IEKB 4FFYH 4FFZH 4P9HL 1GGCL 3OKEA 1JYWA 3ZKMD 4PJ9B 2QHRH 4WHYG 1VB9A 4YHOL 2W65B 5GRYA 3HI1B 1J1OL 3L95B 1IBGL 4BUGA 5GSRA 3MUZ1 1FYTD 4WW2B 2YMXH 2OI9B 4AMKL 4I2XE 2WBJC 4NN7C 2AQ3A 4LPWA 4UAOB 5DJZA 3B6SA 4WUKH 5KSBE 4K9EC 2BMKA 3QCTL 2X2YA 1FNSH 1GZQB 2BRRL 5FUZH 1DANT 4WW1A 1IL1B 2ZNXA 1NCWL 2HJLA 1F4XL 1R5IA 5D4QA 4RQQA 2B7DT 3ARRA 4LLAA 3QEHA 2Z91A 5J6GA 1UWEH 3HUJF 5IP4A 3LAFA 4WFED 3W9DA 4HZAA 2NNAA 5ADOL 4K3EH 1SJEB 3MGTB 5LJYH 1UG9A 5LGHH 2HVJA 1WBYA 1MF2H 5ESAA 2IWGA 4Z8FH 3TO2A 1OT2A 2J5LB 3RVTD 1VFBB 2FIRT 4JRYE 4XH2A 1PY9A 3WXWL 2EC9U 2Q8BL 5H35A 1P4BH 5D9SA 5F9AC 5A43C 4MNQD 4L29A 5MENB 4UBDD 4NJAL 3M1BA 2EH8H 4WU5A 3UZQA 1QYGL 2B39A 1P53A 1U3HC 4IOSD 5MEPB 7FABL 3NGBB 1J0HA 2KL6A 1DQJB 4M4RA 1P9MC 1XR8A 3DUUA 5F88A 3C09B 2QQKL 3MXVL 1T83C 4RA0C 2HKHL 4D0BB 1INQA 3RGVD 4WVRA 3GO1L 4HZLB 5E7BA 3RWDB 3F8UB 2DQJL 3OKOA 4QNPE 2V5YA 4V1DA 4XCFL 2CGRH 4RAUB 4U3XA 2DQUL 5L9DH 3S88H 3S9DB 5D1QC 1KN2L 1CTNA 1ZV5A 3DHMA 4HHAA 2BVTA 2F53B 4MLSA 4E5XA 3BOVA 3O9WD 5C0CE 1MHHB 1ODAA 1EERB 5DWUL 4MXWL 2P42B 5IB4B 3F5WA 4U1MB 3W11D 2NCMA 5F70A 1YEEL 4X6DF 4HGKC 3K2UL 3MMEB 1F3DH 1CDBA 2HT4C 4ZG1A 2HTLC 4GG8A 4X98A 1DLFH 2YN5A 3V0VA 1BREA 5FO7A 5FYJE 3MRPA 3CFEA 1QBML 3VFPA 3NFSL 1FFPA 3DHJA 3QJHA 1DBAL 2IH3A 4LLWA 1FNEA 2FD6L 4GS7B 4MAUH 2Y6SC 4CVZA 4G3YL 4WI8A 3Q3GA 3NZHH 1BBJA 5C0NC 4JFZH 4OV5B 3ZSSA 5E8EB 4IMLB 1DE4B 1FIGH 5D70H 3RTQB 1A6VH 5I74B 4XX1G 3OWEA 1A3RH 2VNCA 1BQLL 1XR9B 1CL7L 4PJ5B 5T33L 1OAQH 4MA7L 4L8DA 2VLRB 4M61B 4YXLH 5I18L 4WO4A 4JFED 3VE0B 2JCCF 5I73B 2HFTA 2YWZA 3O41B 1BD2B 3UTPD 2NZ9D 3A6CL 1J0IA 4ISVA 5IMLA 2V9TA 1U8PB 3H9SA 2IMNA 1YYLH 1SYSA 3TJHD 5I19H 3W82A 4BSJA 2GY7B 2J8HA 4IDJL 4IOFC 3W2DH 4OSUH 3WD5L 3U48A 4P99A 1IM3B 3EOBA 2EXYC 5C07A 4R7NB 4AEEA 4J3WA 2GW5A 1A3LH 1E4XI 4X5XA 4YHNB 4FABL 2VLJE 3TVMD 5GS0C 4CAGA 4CW1B 3ARFA 4N0YH 4ODSL 2KH2B 2A1WH 3GMQB 4WY7H 1Q9WB 4PJIF 3IS1X 4FS0A 4WENB 4F7CA 3VRJB 2P24B 5C09D 3IDYC 3TT3H 4JKPL 3OKNB 1G7PA 2BSRB 5ESVA 3RU8H 1CCZA 4H88H 3U4BL 5ABDE 5IM7A 1IGYA 5I66A 2D7OA 1QSEE 5DHYA 3G5YA 4O4YH 3PJSA 4ELMF 1GOGA 2FDBP 3EYQC 2GK0B 5EOTB 1K4DB 4K94C 4QXUL 2NYYD 2RJMA 2VZUA 5LWYH 1CZ8L 4XVJH 3FO2B 3LN5A 1LD9A 2A0LC 1YY8A 2W59A 1A14L 3FONB 1CI5A 1SYVB 2P5EE 1DN2A 3MNZB 2KPNA 1L6ZA 3HE7D 4FMFA 3QULB 3QDMD 1A4KA 3VFGL 5E2VL 1EGJA 3PL6D 3HUJE 4OFVA 3KYNB 3BRGC 4NNYA 2ATPB 2OTUA 4K3JL 3OAZK 4KUCF 1LQVA 1RIHL 3KHQA 4UB0L 3OPZL 1AO7A 2A9ML 1IAOB 5GQBA 2CKBH 5JIKA 3MLRH 4PD4J 4EDXB 1KCVH 25C8H 4WO4C 5F7HA 4QHLA 2CKBA 1AXTL 3PHSA 3MV8D 4WI4A 3MNWA 3PDGA 3PIQA 4JZJB 4XNXH 3WNKA 5F3BA 1HHHB 1R3HB 1A6WL 3ZT7A 4U1JA 5A1AA 4EJ1C 1AH1A 1FO0H 4JQIL 3PGCB 1CT8A 3OHXB 2AJ3B 4QRTA 2NY7L 4HJGA 3VG0H 2VUYA 3VXSD 4M7KH 1DCLA 3BO8B 5I8EB 3KYOA 5CWSA 5JIPA 5D7IB 3OKLB 4PRBB 4OZIE 4KVCH 1TETL 4L9LA 2C1OA 4P5KB 5HHMB 3WFDH 5D2NA 4HJ0C 4Y89A 3SGJA 3NA4A 1AJ7H 2Q86A 1G7LA 1P69B 2WBJB 4BZ1H 3PHOA 3IJSA 3QUKB 4JQXA 4YFLF 3OR6A 3RL1B 4L5FL 3TNMB 1MELA 3VFRB 5C86A 5JW4N 1QQDB 4X6FB 2K1MA 3ARFC 2ADGA 4ZYKA 4J2XA 3T0XA 4WWKD 4JHAL 4ZQKB 4JO2L 1FRGH 1A1MB 3PP3K 2J3SA 4HFUH 2BSED 1G6RA 2A6IA 2VQ1B 1IARB 2BY2A 4Z7OF 5FIEA 2JB5L 3CAFA 2XZAH 1A7NH 3TBVB 4PP8C 2Z31D 1V7NL 3GI9L 2DM7A 4DKAA 1TZHB 4X6DE 3WE6B 2VXTH 5JIHA 2AV7B 5ISZE 3TM6A 2BNUB 1WJ3A 1RU9H 3C5ZA 4HCRL 4NZUL 4XHJD 2VZTA 5DD5H 3DLQR 4YHYC 1C5DB 3P4MB 1RAMA 5EU6B 2BNRB 4NZRH 3QIWA 5IHZB 3QWQB 5I2IA 2XTJC 4PJXA 4OLWH 4MSWA 1U3HB 4I3SH 4OAWA 4JANA 3WV0A 1Z3GH 4FQQB 4UOJA 2FZ3B 1UYWL 3JV4A 1YY9D 3LB6C 1GCFA 3VWKD 2CLZA 1CVSC 1WITA 3MFFA 3V6FB 5F1NA 4F9LA 3CFIC 2DYPB 4ZUWB 4N0UA 3T77B 5DK2A 1AD0A 4NHUB 1N7ML 5KS9B 1JN6B 2DQTL 5DO2D 2J8UF 1N5AA 4GQPH 3NPSC 4PJCB 4KFZC 1DL7L 2VR5A 3CVHH 5JXED 4KTYA 4WV1A 3MRQB 3CVHA 4Z7UB 4QY8A 4Z78B 1NGYB 3WLBA 5E94B 2PN5A 4R4ND 3KYKH 5D7LE 4NQUA 4TSAL 5DI8A 3OKEB 2DWEA 2ZCHH 3ZL4H 3QNZA 4L9LC 2B1HH 5EOQL 5D2NC 3GSRA 1Q9OA 5GSRB 3SGJC 3CH1A 1QOKA 3VA6A 5F89A 5IB2A 4NO0A 2V5TA 1NEUA 3BEWA 1JFQL 4LSQL 4JQXC 5DJZB 2CMRH 4FNLH 3TFKC 3U4EA 2BMKB 1YC7A 4WW1B 4HV8A 2PKDA 1BF2A 5DUPL 2NY5H 1S78C 4PREA 3P9LB 4RQQB 5HVFB 2UUDK 3QEHB 4BH7A 1MCBA 2Z91B 5J6GB 2WUCH 4I1NB 2FSEA 4HK3J 3W9DB 5DRNA 1B4JH 2NNAB 2PYED 5IR1A 3LKRA 5LKNA 4RWYL 1LO5A 4ZAKC 5TGBA 4ELME 1WBYB 1U2HA 1JNNL 4M1DL 5ESAB 5B39A 2CK2A 3TO2B 1PQZA 3FMGL 3VMOA 4NZJA 4KI1A 3MA7A 4XH2B 2A83A 1I1CA 5H35B 2W1NA 3ECBA 4POZD 3C5ZC 4OD2A 2H1PH 2Y06H 5D9SB 1OWWA 5J3HC 3IDIA 4N5EA 3IFPA 1S9KC 5A2JH 4WHCA 3VGAB 4L29B 5M7QA 3QIWC 4FZEH 3BX7C 4JB9L 3M1BB 3OBAA 4WU5B 1KB5H 1KB5A 1ZLWK 4G9FA 4GOSA 1IC4L 3HMWL 3OXSA 5KVFH 1XR8B 3DUUB 5F88B 1G7IA 1ED3A 1INQB 3OKOB 5HD8D 4F9LC 1CFBA 4V1DB 1NKOA 3IDYB 4HIJB 2AI0H 4QWWC 2CUMA 3OKYA 4UT6L 4HHAB 5BZDA 2A6JA 3QR2A 3E6HA 4E5XB 1KJVA 4HXAL 3E0GA 4PB9L 3DSFL 4OCRL 1AR2A 3MV7E 1WZ1L 3TT1H 3IXAA 1H3WM 3MV9A 1ZK9A 4GG8B 4X98B 3V0VB 1DQDH 5FO7B 3SKJH 1IZJA 4LRNH 3CFEB 2VAJA 4NP4L 3VFPB 2LVEA 2VLKA 2NXZC 1FFPB 3BWUC 3QJHB 2IH3B 4LLWB 4QOKA 2JIXD 1FNEB 3PP4H 5KZCD 4KK9C 4GAYA 3BKYL 1FGNL 5C2BL 5HI4C 1ZANH 2C3HA 3ZYZA 4CVZB 4WIQA 2DWDA 3Q3GB 2P4AB 1BBJB 2FJHA 1MCIA 5EC2B 1PKQA 1MHEA 2ICWA 2CIIA 3VI4F 5E7FA 3MREA 3QJFA 1YPZF 2NY5C 4GAGH 4NWUH 5DQDH 4Z7OE 5EB9A 4RMTA 2DD8L 1CICD 5HHPA 1HSAA 2NY3C 2J88H 4L8DB 3QDAA 5ALBL 2GT9A 4WO4B 3NCYP 4YR6A 2X1PA 1A9EA 3O6FA 1KELL 4YAQA 3MFGB 5D5MF 5ICXA 3LQZA 3QAZC 3WDJA 3KLSA 3OSKA 3NCBB 1MFAL 4S1RL 4ISVB 5HHOE 5IMLB 4JPIA 3H9SB 5BO1L 1SYSB 1JNLL 4N5EC 3GB7A 3GUTA 5HYJD 3MRDA 4KHXL 2MKLC 1T89A 4X4MA 4RMSA 3BXNA 5DD0H 1CD1A 3EOBB 5C07B 4XP4H 3RZCA 3I2CH 2WIIA 4KGLA 5DEGA 1OAYL 3SDAA 4X5XB 1FZMA 1HWGB 4M1CC 2Y9RT 1QSVA 1UT9A 4F7CB 3DUHA 2EICA 4OLVH 4UT7L 1G7PB 4PJHF 3RX5A 2J8UE 3FQXA 4KUZH 5EZIL 2V9RA 3WIHH 1EX0A 1QRKA 5IKCA 5C6TL 1F4AA 3WIHA 2X89D 2OM5A 4G5ZH 3FFCD 5GGQL 5IM7B 1IGYB 1IQWH 1PY4A 1XMWA 5I66B 5DHYB 1T4KA 5FYKL 4LU5L 3G5YB 3ARDA 4I9WE 2YRLA 4DN4H 3MRHA 3PJSB 3IF1A 3QWRD 1G6VK 2RCSH 2M26A 3H42H 4OUOA 3U46A 1MCWW 1WZLA 1JGDA 1MCPH 4YDIH 4GRMA 3CJJA 5CJOL 3LN5B 4PR5A 1LD9B 4YHYB 1PD6A 1YY8B 3T0ED 2QSTA 5CMAA 4JFFA 4S11A 5GGRY 4O5LH 1A7PL 2XTJB 1PG7W 3V4PL 5F9DC 4KROD 4EVNA 1R5WA 4RGNC 1A4KB 5E4EC 2OJEA 3QRGH 5E24E 1HINL 2DQEH 3TBYA 1OP5H 2LAGB 4NNYB 5EORH 1OTTD 4G8FA 2APTA 2OTUB 3MACH 4UUJA 1SY6H 5DS8A 2DKSA 1SY6A 2BX5A 1AO7B 5IK3A 1SM3H 4QHLB 2CKBB 3HCVA 3O6FC 3EYSH 3IGAA 4KJQD 3MNWB 3PIQB 1FGVH 1TTGA 5F3BB 3EJYD 3IDMB 3NIFF 3U0WH 1ZHBA 3AXLA 4U1JB 3RZWA 5FKPA 1D9KA 4LEXL 1CT8B 4QRTB 4HJGB 1IGIL 1MNUL 5CWSB 4GRLD 3FAXA 1T89C 4LDLB 4OD1H 2C1OB 5JUEL 1QFWL 3VGBA 5D2NB 3P73B 4HUWA 2Q86B 1FVCA 1G7LB 5FKAB 4MVBD 2PTUA 2Q6WA 1F42A 3PHOB 3IJSB 4XP6L 4B53A 3OR6B 3HNVL 3SDAC 3P40A 4H8WC 3KLHC 1DN0A 3CK0L 3I6GA 2ADGB 4Y4FD 4ZYKB 3L9RA 4KGJA 3KJ6H 1BFOA 3BD5A 4OB5H 2A6IB 2DBLL 3BVNA 4U1SA 4CMMA 2EDRA 4B7LA 4B41A 1LE5A 1LDPH 1N5YL 3GIZL 1ZEAH 5FEBA 4KI5C 1DFBL 3ARDC 3B9EA 1XIWD 2FECL 5ILTL 5FYLD 5EIIA 3CH8A 1WTGT 4L8BA 4RISH 4RAVA 4FFYL 5TDPA 4QRSB 1N6QH 2APBA 1CU4H 3UAJD 3C5ZB 2QHRL 5E95B 1QRND 2FHFA 4GKSA 3N1FC 1T7YA 2YUVA 3KG5A 2YMXL 3O8XD 3BMWA 5MHSD 4M7ZB 2N7BA 3BKJH 3QIWB 5FCSH 3HPJA 4WUKL 4JRXA 3QFJA 5I2IB 5IUSA 4PJXB 4MSWB 4V2CB 3T65A 5FUZL 4OAWB 4JANB 2DDQH 4M3KB 5FB8A 4YHLH 3JV4B 3VI4E 5DZOA 1YPZE 1UWEL 4OLZH 3ESVF 2CLZB 3MFFB 2E8YA 1BIHA 1JK8A 3L3KA 1EO5A 4YWGH 4K3EL 2XRAH 5LGHL 4N0UB 3W0WA 3K1KC 5D71H 5DK2B 4FXGA 1AD0B 4Z8FL 2X4PA 3KPRA 5HGHA 5IW6A 3B2UC 4TVPH 1LDSA 1N5AB 4NQEE 3EDFA 2O26U 2AXHA 3QDJA 4D94A 1CDYA 3DJ9A 4WV1B 3JWOH 5T5NF 5F1KC 3CVHB 4QY8B 1P2CB 4JVPA 1D9KC 2XY1A 2Z8RA 5JHDD 3MR9B 1FAKT 3QQ4A 5GGVY 5IBUG 4ONOA 4JJHA 3WLBB 2EH8L 3RHWK 1GOHA 5DI8B 3ZLQC 1OM3H 1BVZA 4ZO6A 1EEQA 2DWEB 4ZFOA 2FCBA 2NXZB 1P84K 3MUJA 3QNZB 1Q0XH 1U9KA 3SO3C 4NBZB 5EA0L 3GSRB 1PAMA 1Q9OB 5HXMA 2BVUA 2ITCA 2D31A 3CH1B 4XAKE 4FQPA 5F89B 4AYFA 4NO0B 5IB2B 3BEWB 2QSCH 3U4EB 5J06A 5L9DL 3S88L 4HV8B 4PJHE 4ONGL 3HG1E 2EDJA 4PREB 4UIMA 1QLEH 3T0DA 4F8QA 2C4FT 3AB0B 2VERN 2FSEB 3OZ9H 5DRNB 3SE8H 5IR1B 3LKRB 2NY3B 1LO5B 5TGBB 1OARH 5B39B 1HE7A 1FYTA 5AG9A 1PQZB 5HHQA 3QAZB 1DLFL 3MA7B 1ZHNB 2R2BA 2FEDC 2A83B 3TPUA 3B3IA 3ECBB 3OG6B 3HLAA 4OD2B 3NN8A 2Q8AH 1IEHA 1HN1A 4MAUL 3IDIB 3IFPB 3ES6A 4GAJL 1MHPH 1XGRB 4Y8AA 3SGEI 3EDJA 4X9FA 1MCNA 4JFZL 1KB5B 1GGBH 1YMMD 4G9FB 3WNOA 3BPOC 3FN9A 3OXSB 1VEPA 1S8DA 3Q6FA 3QPXL 1A21A 1FIGL 5D70L 1A6VL 1AGDA 5HTSA 1MAMH 1NCCH 3D18A 1G7IB 5E99H 4FFWC 1A3RL 3KAAA 1ED3B 5GS3A 4ZO8A 3OQ3B 3TJEH 4YXLL 1NFDA 5BZDB 2A6JB 4NQCB 3E6HB 5DJDB 1B6DA 1CFQA 1KJVB 2X4SA 3LH2H 4LNVA 3NIFE 5EZOL 2I60L 2GYSA 4PRPD 4ZFGH 2YD6A 3JWOC 3GBMH 5I19L 3IXAB 3RGVA 4PGEA 3MV9B 2XACC 3OJ2C 1A7OH 1Y0LA 1MCSA 4OSUL 4HIXL 2QR0B 2VLKB 3GRWH 1OPGH 4FG6C 4AIZA 2Z8SA 4F7TA 3GRWA 1V05A 3HAEH 4QOKB 5LCVL 3QUYD 4H1LH 4P5TD 5IWLA 1A3LL 4GAYB 4E0RB 3O9WA 5L6YH 2CDFA 1PG7X 4N9OB 4N0YL 3BUTA 2A1WL 2DWDB 5C0AE 2FJHB 1CYGA 5E4EB 1PKQB 1MHEB 2ICWB 3RU8L 4BA8A 1Q94A 2E9BA 3MREB 3QJFB 4H88L 3ZKMC 4LNRA 1A6UL 4O4YL 5HHPB 1HSAB 1EFXD 3QQ3A 2GT9B 4YR6B 3EJZD 1A9EB 4LVOC 3O6FB 4LSRH 4IRZH 5ICXB 5LWYL 3LQZB 2Y5EA 4XVJL 2VO5A 4N1CA 2ZKHH 4JPIB 1L4IA 1I9JL 3OJVC 4ETQA 4L4TD 3GB7B 1NCUA 3GUTB 4PG9A 4DFIA 5C0GA 3MRDB 3FB6A 3MOAH 2GFBA 3BXNB 4WW2F 4JFEA 1G9MH 3HE6C 3HAEG 4LCYA 1CD1B 4H1LG 3RZCB 2P43B 5DEGB 2WIIB 3RVTC 3DRTA 1UENA 3SDAB 1FZMB 3SDCC 1H3GA 5DHXB 4NC1E 3TZVA 1UQSA 3MLRL 3TJHA 2XFXB 25C8L 1UCTA 1QBBA 3EZJB 2MPAH 3FQXB 3DNKA 2J12B 5IKCB 1EHLH 2VDMH 3EYUH 4P2RD 5C08D 1N26A 2ZSWA 4HIHA 1KC5H 3O0RH 4MDIA 1T4KB 1YNTA 4WU7A 4YDJA 4JKKA 3P77A 3ARDB 1BWWA 2OP4L 1FO0L 3MRHB 5KW9H 3IF1B 3TVMA 4UZGA 3VXUD 3VG0L 1L7IL 5IBLC 4M7KL 1UXWA 4U0RC 3U46B 1JGDB 4KVCL 5C09A 3WFDL 4GRMB 2HRPH 1AJ7L 4FQ1L 4KWUA 4Y1AA 1R3LA 5CMAB 4JFFB 5IWLC 3BSZH 3O9WC 3ARGB 3V6ZA 3V79C 1MFCH 5HDQH 4EI5D 4EVNB 3UTTD 3GSXA 5GS2H 1A1OA 4LK4A 3W11C 1R5WB 3TP4A 1DDHA 1FRGL 2OJEB 4RRPA 2OQJA 1V3MA 2R39A 4HFUL 2ZPKH 2DJUA 1JWMA 3TBYB 2B8OT 1A7NL 4G8FB 2ZUWA 4UUJB 4QRQA 5DS8B 4FZ8H 5IK3B 2IAND 5FF6A 3Q48A 2VXTL 5J13C 4KKLD 3HCVB 4GBXD 4S1SL 4ZXBD 3RAJL 3HE7A 1RU9L 3QDMA 1ZHBB 3AXLB 2B1AH 1PW3A 5FKPB 1D9KB 5DD5L 3PL6A 4YLQT 3PGDA 1LO3H 4NZRL 1EFQA 2QBWA 2DMCA 3I9GH 3SOBL 1GGUA 3MRRA 1SBSL 4I3SL 4Q0XH 1JJUA 3P30L 1Z3GL 4TOYH 4HUWB 1FVCB 1BOGA 3MV8A 4TTGA 1BM3H 1G9MC 2Q6WB 3V5KA 1WF5A 4BSVA 3MLVH 4LF3B 1DN0B 3WHXA 3I6GB 5GSVA 4LASH 1U8QB 3A67L 3L9RB 3SE9H 4M03A 3TZVC 5SX4I 1BFOB 3TJHC 2XNAB 5FM4A 1HKLH 3VXSA 5BS0D 2VWEE 3MA9H 3BVNB 5EC1A 4U1SB 2YA1A 4CMMB 5ALCH 1LE5B 5IVXA 3CVHL 3VXNA 4R90H 4UMGA 3H7LA 3PUCA 4FA8A 5CD5C 5SWSE 1GC1H 5EIIB 4L8BB 5DVKA 4OV6F 4RAVB 2YD7A 5TDPB 4XPHH 1VADA 5IBUB 2BERA 4WWKA 5J1AA 3ZL4L 3H7BA 4JN1H 1OP5K 2W07A 2B1HL 4GKSB 32C2A 4EDWL 3PGFH 1NLDH 3HPJB 2CMRL 3QFJB 4FNLL 4JRXB 4KZDH 2Z31A 3T65B 3L7FA 4HT1L 1RUQH 3BPOB 5FB8B 2Z0BA 1DBJL 3BPNC 1KTRL 2EDEA 2WUCL 4HS8H 1IAKA 1JK8B 3L3KB 4LGSB 1B4JL 4OQ1A 3JUYA 2H3NA 3W0WB 4U6XA 4FXGB 2X4PB 3KPRB 3RL2A 5HGHB 5IW6B 3O3DA 3QDJB 1QHPA 4L3ED 4YEFA 3VXME 2A77H 2VLME 3HE7C 2HFGL 2H1PL 3EO1A 2Y06L 1OY3B 4G7VL 5F7MC 3VWKA 3RUGA 3EKCA 1FPTL 1A02N 3PL6C 3QQ4B 1M6OA 2ZP0T 4M62H 2XZCH 4FZEL 2XA3A 1TZIA 3P4OA 5JA9A 4NFBA 4ZFOB 3FO1A 3ZKQD 4G7YH 5KVFL 4HPOH 4QF1A 2ITCB 2D31B 5F7YC 1MPAH 3SJVD 4WRLA 2NY4D 2GITA 1H3UA 1J05A 2YPLD 3FB5A 1CR9L 4JDVA 2AI0L 3T3PF 2E7LA 3DVIA 5HGGS 4BFEA 4B5EA 4UIMB 3R0MA 2D2OA 4J1UB 1K8IA 1N3NA 5GJSH 1VFMA 4N90D 1Q9LA 5DURD 5BXFA 2R8SH 1FYTB 1I3GH 4LVOB 3TT1L 3M17A 3ZHLA 5E8OA 1RY7B 4JFPA 5HHQB 4TTDC 1DQDL 2R2BB 4ODTL 3SKJL 1WUNT 3HHRB 4LRNL 3BKMH 3TPUB 1HKFA 3B3IB 3BESR 3V0WH 3VRLF 4WWKC 3HLAB 3NN8B 2F15A 4Z7VA 3PP4L 1U58A 3ZYJA 1YEFH 3ES6B 2IAMD 1ZANL 2PYEA 3DX9A 2YZ8A 35C8H 4MHHI 5DUML 4XNZB 3LD8B 4ZTOH 4HMDA 5ESQA 1BECA 4NZTL 3Q6FB 1S8DB 2M8XA 2FB4H 3V4UH 3OXRA 3PHQA 3JV5A 4GAGL 5DQDL 2BRQA 3D18B 5IVNA 2L7JA 2CRMA 4LFHG 4MXQD 2OSLA 3G5XA 5KVMC 4P2OD 3LEXA 3RWJA 2F53E 4XCNA 2J88L 5L8JB 3HRZA 4MNQB 1NFDB 2G9HA 2UVFA 1FDLH 1XGQA 4F8TA 5JW5A 3R06A 5HBBA 4OD3H 4RA3A 1F00I 1CFQB 2X4SB 4AG4H 2AJZA 3HR5A 3BFOA 5A3ID 2GHWB 3F7PC 5EH1A 3CXDL 3GEWB 2WZPD 3VWKC 4Q9CA 3RGVB 4PGEB 4JHZA 5D1XC 2WNGA 1Y0LB 4YHZH 1FBIH 3ZTJH 4LPTA 2IC2A 4C83A 3ROLA 4DN3H 3S96A 5DD0L 4AIZB 1FZJA 4XP4L 1MJUH 4F7TB 1QR1A 3DMMD 5DO2C 3O9WB 4MAYD 2CDFB 5I9QC 3MLYL 1HXYA 3HB3D 2DL9A 3IFNH 1A6TA 4EEEA 3LV3A 3U79A 2Y36H 1DBBH 1NFIA 2VDRH 4OLVL 4GXUM 5E8PA 2E7LC 5CKGA 4DAGH 4I77L 4KUZL 1Q94B 3WIIH 4G5ZL 4R4NC 5IEHA 1IQWL 1IFHH 4LNRB 3L1OH 5KS9F 3TV3H 2JIXA 4DN4L 3DBXA 3QQ3B 1PX3A 4PJCF 5J11B 4P3DB 4L3CA 1GVIA 4EKXA 3S34H 4HIEA 1QNZH 3H42L 5E00A 5IVOA 1WTLA 5ECJE 2KBGA 4HS3A 3ZSTA 4Z7UF 1PSKH 4YDIL 1UFUA 3S36X 4GG6A 3ZT6A 4C4KO 1NUGA 3O6MH 1RMFL 5IHUH 3G6DH 3UJTH 4O5LL 1IKNA 3JV6A 4XVUD 4PG9B 3ZTJG 1KCRH 5FYJU 5B21A 1CICA 5DJ6A 5B8CC 5C0GB 2G75A 3FB6B 5JZ7D 2J4WH 1TJHH 2GFBB 4JFEB 4LCYB 5FCUH 4NRXA 4IBLT 2DQEL 3DRTB 4EUPH 5EUOE 5EORL 2AS5M 2C3VA 3QSKB 3MACL 4EUPA 5IFHL 1SY6L 4U1LA 1V7MH 1T2XA 1SM3L 5GRJH 1UQSB 3LZFH 5HYJA 3LPGA 2Y7QA 1IAMA 1P4LA 1FGVL 3D3VD 4OJFH 1PVHA 2ZSWB 4HIHB 4MDIB 1HSBA 4WU7B 5D6CA 1YNTB 4YDJB 3RVUD 3U0WL 3P77B 4OZFG 2AAVA 2ICCA 4P59H 3SKUD 3TVMB 3L7EA 3TA3D 1UXWB 4Z7WA 3QEGH 2IALA 4FQ2H 5HD8C 2E5EA 3D9AH 4OD1L 5C09B 3EDKA 3ESUF 3NCCB 2YR3A 1R3LB 2X89A 1DANU 4G6KL 3FFCA 5ICZA 3DYMA 4OLXH 2R69L 3T3PE 5GGUA 4Z5RB 3HZKA 5CGYD 3GSXB 1A1OB 4MCYA 4C56E 1J5OH 1A6PA 3BPNB 4OT1H 1DDHB 3KJ6L 3QWRA 1FC1A 1BFTA 4X7DC 2OQJB 4OB5L 4EUPG 1JWMB 3CDGA 1CGVA 2EKSB 4YE4H 4UTAH 2QQLH 5TFSH 4QRQB 1LDPL 4V3EB 1ZEAL 4M1GH 4I18C 2XWBA 1CGWA 3T0EA 4QT5A 4WI2A 5FF6B 2NR6C 2UZYB 4X8JA 4D9RE 1SEBA 4LSPH 4Y2DD 1CXIA 5CJQH 3V8OA 1LNUA 5FYKE 1N6QL 3Q1SH 3HE7B 1CU4L 2QQQA 2Y23A 3QDMB 1FVDA 4MNGB 4NNPH 3PL6B 1TVHA 4NGHL 4UI2A 1OF2A 1JGEA 3PGDB 3E3QE 1ZGLA 2C3WA 3BKJL 5DVOA 3NIGF 1IT9H 3EJJX 4U1IA 1IGJA 3MRRB 2J1KA 2VKWA 5IQ9A 1CICC 1FNGA 4YHLL 4PJ7A 4HAGA 3GSWA 4GAFB 4IM8A 5HDLA 3MV8B 1BOGB 1WQVT 4OLZL 3BRFA 5J7CC 1F58L 3CX5K 4BSVB 4XMPH 2IFFH 3AUVA 1NQBA 5JDSA 4YWGL 2XRAL 2V5MA 3WHXB 4HIIA 5C0CD 2F8OA 4PJAA 1IAIM 4J8RA 4TVPL 3IAGC 3O3BA 3VXSB 1NBQA 3SQOH 1FNLA 1KG0A 3V7AG 1T7WA 2FX7H 5IVXB 1Y6KR 3VXNB 2EDBA 2OCFD 3O45A 3BN9D 4MVBA 1WGOA 1MH5A 4FQHA 4LLQA 1WC7A 1S3KH 1O7SA 3OAUL 1CXKA 1VADB 4NT6B 1OM3L 1CDIA 4Y4FA 1YYMH 3RWEA 4BFBD 1GPOH 4WWKB 5EU6E 5J1AB 2BNRE 3H7BB 1Q0XL 3CU7A 5D1ZC 5AZEH 1JMZA 32C2B 3T8XA 1KCKA 3WFZA 2QSCL 2EYTA 2CDEA 2FX9H 3MLXH 2Z31B 3L7FB 1ADQL 2I5YH 1QVOA 5FYLH 1XIWA 1IAII 2WANA 5L2KA 1HIMH 2FH8A 4HBCH 5T3ZD 1N2RA 3B9KD 1IAKB 3OZ9L 3MGAA 1FFRA 5KS9E 3X11A 1QRNA 2WINA 1OARL 2H3NB 4U6XB 3O8XA 3RL2B 4NWTH 3O3DB 5L0QC 4Z7UE 4KK8C 4XC3H 3FN0H 1RUAH 1J1XH 3O4LD 4FTVE 3SO5A 4R6UA 3EO1B 2Q8AL 4ENED 3GJFH 3VWKB 3RUGB 4YO0A 4KC3B 3U0PA 1MHPL 1RPQA 1TZIB 3P4OB 2Q87A 4DW2L 3WFBH 3FO1B 3TGXA 2VLJD 4QRRE 4QF1B 4MXVE 1MAML 1NCCL 1JWUA 1Z9SA 5F6HI 3U1SH 5E99L 3FQRA 1AY1H 2GITB 4P2QD 4LCWE 5JORA 1J05B 3FB5B 1CFVL 3TJEL 2XPGB 4JDVB 4N8VG 4HPYH 3RY6A 5JHDA 5JW3H 3EO9L 1ZT7B 4HH8A 3FT2A 1QSED 1KYOJ 9CGTA 4F58H 3LH2L 1K8IB 3LKSA 1N3NB 4W4OA 1X44A 1Q9LB 4XPFL 2F8XC 1KJMA 4ZFGL 4KXZH 5LG1A 3JVGC 4GRWH 3LKQA 3IJYA 5BJTA 3M17B 4MVBC 1NCTA 5E8OB 1A7OL 4JFPB 3U7YH 2PR4H 3ZYIA 4Y4FC 1ZGLP 1FV1A 3GRWL 4WGWB 1OPGL 4OGXH 1E4KA 2GSIA 4Z7VB 2P5ED 1WFOA 1U58B 2OBGA 4KAQH 4PRHE 5L6YL 5DHVH 4ZS6C 4KQ4H 2PYEB 3DX9B 2ESVD 1UJTA 5KVEL 5ESQB 3B5HA 4XX1E 3OXRB 3PHQB 3MBED 5JOFA 1OLZA 3RJQB 4V1DE 3D5OF 4E41E 3T0AA 3BQUD 1MY5A 3QNYA 2OSLB 1ERNA 3G5XB 3D2UD 3LEXB 3RWJB 3KPOA 4XCNB 2W91A 4XAWH 1OWRM 7CGTA 1C12A 3HRZB 3O8XC 2FL5A 2G9HB 4LAJH 4LSRL 4DGIH 1XGQB 4PJ8D 5JW5B 3R06B 4IRZL 4OZ4A 3Q5TA 5E4IA 3ULVL 1YMMA 2AJZB 3X13B 1INEL 3HR5B 2ZKHL 3CLEH 1ZE3C 1Q8MA 3ARVA 4BSWA 4LGRB 1T0MA 4BQ8A 3RWHA 5TF1H 5I30H 1MREL 3MOAL 4C83B 3ROLB 1G9ML 1FFQA 3WFHA 1TLKA 3B8YA 1FZJB 2C1PA 2ADJA 5C9KA 2CUIA 3WXVH 1KIRA 4ZOAA 4PJXF 4NJ9L 2V6HA 1HXYB 5F72S 2GSGA 1A5FH 4PRPA 1A6TB 2ORBH 3LV3B 1EBPA 1NFIB 1KLFA 5F9OH 4HKBA 5E8PB 3SGDI 2WW8A 2AKRB 2MPAL 3WO3B 2BVEA 2DF3A 1EHLL 1UKQA 5E70A 5F96H 5IEHB 3EYUL 4W4OC 4XP5H 1QKZH 1X4YA 2Q1EA 3O0RL 2WUBH 1S9YA 1XF1A 1YEJH 4CU7A 3TYGH 4APQC 3OKMA 3SGEH 2JIXB 3QUYA 2NX5D 5KZCB 4P5TA 3DBXB 4OCLC 5ISZD 2UZIH 5KW9L 3C6SA 2PXYC 4JREC 5F8RC 4L3CB 2EYSA 4LLYA 4W6YB 4HIEB 5E00B 1AGEA 4F33A 4HS3B 4U1NA 5BVJA 4Y16D 4GG6B 2HRPL 4WTXA 3MX0A 3L3JA 3N85H 3RX7A 5CKAA 5JHLH 3BSZL 4G59A 3QEQB 2YD5A 3JV6B 4AENA 5EG6C 1MFCL 1CICB 5DJ6B 5C07E 2G75B 1EFXA 4F80A 3UPAA 1OTUD 4X6CA 4NRXB 2ZPKL 3TCXA 4KJPC 4LPUA 5I8OH 2C3VB 4EUPB 3HNTH 4BFIA 1L0QA 4U1LB 1IGFL 1MRCH 1HNFA 3ILPA 4K7PX 4LMQI 5F93C 3PE9A 2YA2A 2XQYG 1JWSA 4LPXA 4XVTL 3RWFA 4DK6A 4L4TA 3P0GB 5HYJB 1TCMA 4X5WA 1P4LB 5DYOA 3UP1A 4MQ7A 1HSBB 5D6CB 3RWCA 3HZYA 1DQMH 4AT6A 4OGYH 3R8BB 4DVRL 3MYJB 3L7EB 3GMLA 3I9GL 1E4JA 1E28A 4Z7WB 3BPLB 2IALB 4Q0XL 1F6FB 1FNHA 1K8DA 4TOYL 2BJMH 2D7NA 4MB4A 1BM3L 1S7XA 5IW3A 3FFCB 3MLVL 4P2RA 5C08A 4I5BA 5ICZB 5HDOA 2VITA 4LASL 5GGUB 1MJ8H 5H37H 3HZKB 1C1EH 4MCYB 3HN3A 3MJ9H 3VXUA 1EJOH 2Z35A 3MJ9A 1KPUA 1HKLL 4UILL 3BE1L 1KTDA 3MA9L 1N59B 3CDGB 5B38G 3B43A 2VXVH 3QYCA 5ALCL 3WDHA 2D7TH 4LLUA 2YOCA 5F7EH 4R90L 1X7QA 2XWBB 2VC2H 3O3EA 3T0EB 5F6IC 4QT5B 4P5TC 1GC1L 4X8JB 2F54E 5L0QB 3O3UN 4XPHL 2EKJA 4AIXA 1LNUB 4EI5A 4KROB 3UTTA 4WDIA 5F7WC 1FVDB 1YEGL 4JN1L 2E7CA 3QDGE 1OF2B 1VDGA 1JGEB 3D39E 4Z0BH 5DD1H 4OF0A 5HGAA 5JQHC 1ZGLB 4FHBD 3QUXD 1BGXH 1NLDL 3T1FA 4WI5A 5MP6L 4K7PY 2UVEA 4U1IB 1IGJB 5IQ9B 2P5WE 1RUQL 1T0PB 5DJXA 1FNGB 2IANA 3ISWA 4PJ7B 6CGTA 1OGAE 5L7XH 3GSWB 5DRZA 4KUCD 3EJZC 5D1QD 1XZ0A 2D0FA 4GBXA 4BQ9A 4ZXBA 4NUGH 2MCPH 2F9BT 4HS8L 3S35X 4RMRA 2DB8A 3BW9A 1CTOA 2W0LA 5H37G 3SE3A 1FFOA 4N1HB 4I4WA 3X12A 5JO5A 1I9RH 5JW4Q 3O3BB 1I1AA 5CD3A 2VH5H 5CP7A 4GRLB 2A77L 1KG0B 1LP9A 5CEYA 2CSPA 4Q58C 2GEEA 4MJID 2EIBA 1MH5B 4NPYA 4LLQB 1WC7B 2XZCL 3VMNA 3FB8A 2IH1A 3LN4A 3D0VA 4Y4FB 1TIUA 3RWEB 3DTXA 1RUKH 2VSDA 4Q9RL 2D03H 3ZTNL 1JCKA 5C0ND 4HPOL 4OQTL 3G6AA 4R96A 4AEIH 3U7WL 5BS0A 4PJXE 1MPAL 3T8XB 2E6QA 3GK8H 3MO1A 2G5RA 3LPWA 3OJDA 2EYTB 2HJKA 3NCEB 2CDEB 5DR5H 2B5IC 1OSZA 3CSPA 1E0OB 1QVOB 1XIWB 3KYMA 5I1HH 3BZ4A 4LDEB 4MJ6A 4N0UE 2DLHA 1N2RB 1RJZA 3PABA 1J0YA 5KSAC 3DV4A 4MQXD 3X11B 1QRNB 2DJSA 2MKWA 2WINB 3I3EA 3AC0A 4HX1A 2R8SL 2GTWA 3S3SA 4EBQH 1I3GL 3O8XB 1Z0NA 1F45A 4LRIA 4OCYH 2Z93A 5DC0A 4XXCA 4U6VH 1CD0A 2D9QB 5HHOD 4CVXA 1G7QA 4KI5F 1J8KA 3BKML 3NOIA 3V0WL 4FQLH 4IOFD 1UA6H 4EI5C 3CUPA 3NBNA 3EIFA 4TPRL 2XZZA 3JUZA 2ARWA 4YO0B 1R3JA 1YEFL 3GJFB 3U0PB 4ZMAT 5GS0D 2GTZA 4XVSH 5E2UH 4ZTOL 4K23H 5I1CH 3RVVD 2NLJA 1FZOA 4XPAH 2FB4L 1LO0H 3V4UL 4KKLC 1JWUB 4TRPH 3CC5A 4GBXC 4PRAA 4ZXBC 4L3EA 5C0FA 5JORB 4Q7DA 1B0WA 1A0QL 4J4PD 5EBLA 3P0VH 3LDBC 3SE3C 5JHDB 1WBZA 4ZDHA 1LK3H 1MLCA 1FDLL 3FO9A 3FT2B 5FOJA 5TDOA 1CFSA 3GMPA 3EYQD 4OD3L 5DVNA 3LKSB 1I1AC 5C6WH 4AG4L 3GMRA 4ZUSA 1ZT1A 1YECL 2WM0A 4P3CH 1KJMB 2YHGA 3Q6GL 1QLFA 4JREB 4L8SC 3P0YH 2W9DL 1P7KA 4UOW1 3LKQB 3IJYB 2X1WL 3SJVA 5BJTB 5EIVA 5HI5D 1X5AA 4JFQA 2YPLA 3VFWA 5IVZA 1I7TA 4YHZL 1FBIL 2X1XR 3O6LH 5DZNA 3REVA 2KZ1B 4DN3L 3WS6A 1FV1B 4HG4J 1W8NA 2GSIB 4YPGA 3GSNA 2EDNA 4G9FE 2HYMA 1YNKH 3UC0H 2Y36L 1DBBL 2VDRL 3KPNA 2FATL 4DAGL 3LS4H 3MZTA 2YUXA 3RVXC 5JOFB 1A7RH 3FTGA 4OLYH 1X5ZA 3PNWA 3ARBC 3QNYB 3GJFK 1IFHL 2ZG3A 1VPOH 5HYIA 3VGDA 3RFZC 3L1OL 3TV3L 1D3CA 4NQCE 3KPOB 3SKNA 2AQ2A 4JGJA 1TMCA 3WJLA 1H3TA 2FL5B 2IAMA 4XCYA 4JFOA 4XXCC 3S34L 4OZ4B 2GJJA 3P9WB 2FRGP 2YZ1A 1YMMB 4BKLA 2OMNA 1WAAE 3N9GL 3FOMA 5IHUL 3G6DL 3UJTL 4UINH 3RWGA 1T0MB 4PUBH 2NTSP 3RWHB 3AROA 4MXQA 3BZFA 4P2OA 3I6KA 1CE1L 1I7UB 1NH6A 1TJHL 2J4WL 3WLWD 1S9VA 3ARFD 1RHHA 4G80A 3WFHB 1A6ZA 3WMSA 2C1PB 1VFAA 2ADJB 1B0RA 2J8OA 1FORH 4R4FL 3BIKA 4LKXA 1KIRB 4R26H 2FJGA 4Y4KC 4LHJB 4NRZA 1PKQE 4GO6B 1KIUA 1V7ML 4NRYA 4PRPB 2LABA 3VH8G 5I6XC 3T09A 2P1YA 2YKLH 4HKBB 5GRJL 2DMBA 1HZHH 2D3VA 3LZFL 4NM4H 1I1FB 1HEZA 5C8JA 5FM8A 4P2YA 5KG9A 4JPKH 4KJWD 4OJFL 1JZ4A 1S9YB 2AW2A 1XCTA 2JJTC 3W9EA 5T3XH 3OKMB 5F6IB 3QUYB 4P5TB 5GGVH 3DMMA 4P59L 1HHJA 3C6SB 4S1QH 3RIAK 3ZDYE 3HMXH 4N0CD 4OLUH 1X6LA 4MAYA 4R97B 5TJWK 2EYSB 3HMXA 4LLYB 2NY4C 3B8SA 4DJMA 3GSQA 1AGEB 3QEGL 4FQ2L 4F33B 4U1NB 5BVJB 2CRZA 3D9AL 5ERWA 3WS6C 3RRQA 5AWNH 1OAZH 2YPKA 4JPWL 4WHDA 3L3JB 3HA0A 3O6KL 2IEPA 1MCJA 4Y4HD 3RNKA 4C4KT 4L4VA 4AENB 4XP9H 5CP3H 4OLXL 1O5DT 5CP3A 1EFXB 3GZKA 1J5OL 4OT1L 1RIUH 3LHPH 5HPOA 1E4WH 3CXHJ 2CO7B 4YE4L 3MRKA 4UTAL 2QQLL 5TFSL 5CJXA 5AZ2H 1RZKC 5B38B 5IMOA 1NSNL 2P48B 4M1GL 1D6VH 1KGCE 3ILPB 5EULV 4D8PA 1ZS8A 4S0SD 1JWSB 4KPHL 3RWFB 4L4TB 1TFHA 3WJLC 2IAMC 1KJ2H 2KUTA 4JDTH 4LSPL 2FLBT 4X5WB 3Q1SL 5DYOB 1N8ZA 4MQ7B 2VDKH 4NOFA 2CR6A 3RWCB 3HZYB 4NNPL 2QJDA 4AT6B 1KT2A 3TO4C 5JNYA 2OZ4H 3GMLB 2R1WA 1IT9L 4X9GA 1E28B 2OZ4A 1MCLA 4MXQC 2XQYK 1PZUB 1K8DB 3TFKD 4XAKD 4JFFE 3LRGA 4ZNEE 5HYFA 2WLYA 3EYVA 3GM8A 5ID0A 4PJBF 1S78D 1FNFA 1S7XB 4QHUA 1MI5E 1VGEH 2G60L 3D3VA 4XMPL 2YN3A 3F65A 4P2RB 5C08B 4I5BB 1ZHLA 3HG1D 4KHTL 4MJ4A 4LKCA 2C4FU 2VITB 5HVGB 3UPCA 4HBQA 2EC8A 4ERSH 2H41A 4ZAKD 3VXUB 2Z35B 1KPUB 4WFGE 3TA3A 1KTDB 3GBLA 3DIFA 3SQOL 3DVGA 1HILA 5CZXD 3SBWA 4XCCH 1X5HA 1MAKA 2BK8A 2FX7L 4NIKB 4LLUB 3T3MF 1NFDF 4LHUG 1X7QB 5KSBA 4MMZC 4XNMA 3T08A 3F7YA 4Z77A 5IJKA 5C71A 1FQ9C 4TSBH 5ACMA 3P3YA 1S3KL 4ZSOE 4EI5B 1IKFH 3UTTB 3ZDZE 2YC1A 4B0MM 2IFGA 3V9FA 4WDIB 3BAEH 3K1DA 5AZEL 2I27N 4X99A 4ACPA 5CBAA 5HGAB 5HHVL 4JPVH 4JG1H 4AM0A 3T1FB 1LEGA 2FX9L 3MLXL 3WFEH 3IT8D 2P44B 4O2FA 5DJXB 2I5YL 5FYLL 1GGIL 2IANB 4G6JH 4WI3A 4XWOD 1QP1A 5DRZB 4HBCL 1XZ0B 4LSVH 4GBXB 2YXFA 4ZXBB 4Y2DA 1B6UA 2ADFH 3BW9B 5CJXC 4NM8H 2DQDL 5LAXA 3F6IA 1FFOB 4I4WB 3VXOA 5M94B 3X12B 4NWTL 5JO5B 3TH3T 3UPRA 1VGKA 5CD3B 5CP7B 4XC3L 3DURA 1J1XL 5JR1L 1LP9B 5CEYB 2Z4QA 5HJ3A 1EH9A 4PP1C 4NPYB 3IDJA 3QUML 3U9PH 3FB8B 3VD4A 3L5IA 3DXAD 3K81A 3LN4B 3D0VB 3DTXB 3KNBA 3WFBL 5C0CA 1DSFH 2AK4E 4LPCA 1WZKA 3G6AB 4R96B 5E08L 3S6CA 5BS0B 1WIUA 1AY1L 3MO1B 3OJDB 3RPKA 2HJKB 2A73B 3RVUC 1OSZB 4RNRA 5T1KD 4ZD3H 4HPYL 5JW3L 4LP4A 3KYMB 4HWEH 3BZ4B 4MJ6B 3QZWA 4P5MA 4F58L 1RJZB 3PABB 1X4XA 2O5XH 5L88L 2VXUH 3DV4B 3KPRE 1CIUA 4HX1B 5INDA 4TVPE 2EDTA 2ZOKA 4ZO7A 2Z93B 4HUXA 1T03H 4KTEL 4RX4D 3QWOB 2W0KA 1QEWA 4JFDE 4M7LL 1WWAX 4CVXB 1G7QB 3U7YL 1CGSH 1YJDH 4RGMC 2PR4L 1DLHA 5CGYC 4OGXL 2MMXA 1SJHA 3CUPB 5GISH 1NCDH 5T3ZH 4Y5XB 4KAQL 1XEDA 2BZDA 3PQYD 3LY6A 3B9KA 2YBRA 2BHUA 1OD9A 2E7BA 2APVA 4KQ4L 4Q6YA 1AIFA 1YA5A 1JF6A 2GTZB 1JHLH 3V95A 4XXDA 4Q97A 2PW2A 5J8OA 4PJDA 4PLNC 1EV2E 2NLJB 1FZOB 1QPXA 2VDPH 5CSGA 1HDMA 2ATKA 3ARQA 1WLHA 3ARED 3CC5B 4PRAB 1Y18A 4L3EB 2AEWA 3LIZH 1FG2A 5C0FB 4PY8J 1FSKC 5I6XB 5FGCE 5EBLB 4C58B 5KAQG 4ZDHB 3QZWG 3LQAL 5LVEA 1MLCB 4DGIL 3FO9B 5TDOB 1U8LA 5IMMA 3QI9D 1CFSB 1H5BA 3GMPB 5E1HB 3KR3H 1OLLA 5DD3H 3GMRB 5KBNC 4ZUSB 5LQBH 1ZT1B 1U0QA 2VLJA 3CLEL 5F7DA 2GJ6E 1QLFB 1NMBH 3RDTC 4X5LA 3ZO0A 1CFTA 1P7KB 1KJ3L 1YEDA 5C92A 3MUHL 3SJVB 2NY4B 3TPUE 4P2QA 1OVZA 3V0AC 2YPLB 3VFWB 5IVZB 4XTRD 2D7MA 5TF1L 5I30L 3REVB 5ITFB 2DQFB 2AJSL 1QSEA 4PJBE 4RGND 5E6IA 4YPGB 3I02A 3WXVL 3GSNB 4DKFL 1A5FL 1A7BA 2ORBL 5DURB 2DICA 1A2YA 2FYYA 3GHBL 5F9OL 3KPNB 1OP9A 3BN9C 1BLNA 1HCFX 1A9BA 1BQUA 4XB8A 1AE6L 4M8QB 1IEBA 1RZJC 5F96L 3FTGB 4JHWH 4M6OH 4NO5A 3PNWB 4XP5L 1QKZL 3T3ME 2WUBL 1YEJL 1NFDE 4MNQE 4CJ1A 4OI9A 3TYGL 5HDBF 3LPFA 3SKNB 2G2RA 2P5EA 4MD5B 2WP3T 3JWDH 1TMCB 3BWAA 3C2SA 1XF3A 2IAMB 4XCYB 4BQBA 2R1XA 4JFOB 4RCAA 4OBRA 5IVXF 1HCVA 1AXIB 1DVFD 3FT3A 4BKLB 4NN6C 4U6TA 4QHKJ 3KPLA 3MBEA 4K2UH 1RUMH 5JHLL 3FOMB 2W0FA 3B9KC 3BQUA 1WISA 2YK1H 1MCWM 4J3VA 3RWGB 3BZFB 3D2UA 5F7NC 4P2OB 2EDXA 3I6KB 5E9DE 1NGZA 3KLHD 4U1KA 1S9VB 1RHHB 4G80B 1A6ZB 2GIYA 4PJ8A 1VFAB 3UDWA 1B0RB 3EDEA 3BIKB 4LKXB 2FJGB 2VJXA 5I8OL 3CZJA 3VCLA 1FYHB 3HNTL 1T7ZA 2O5ZH 4NRZB 4NRYB 1MRCL 4NYLA 2PYFA 1AC0A 1EEUA 4OZIA 4K8RL 1HEZB 5C8JB 1H5BC 3MUGB 5KG9B 5TQ2H 1ZHKA 4ZUVA 3SDXF 5SWSD 4NQDE 1QLRA 3W9EB 1XCTB 4HEPG 3VFNA 1DQML 4OGYL 3DMMB 1QHOA 2R0KL 4I48A 4MAYB 3O3AA 1RURH 1HXMA 3ULVE 3GSQB 5J12B 3NH7H 2CLVA 3G9AB 1F8TH 4NHCL 3RUGF 3DWTA 5ERWB 2BJML 1UGNA 4IOIA 2YPKB 1TQBC 3RI5F 4OM1L 4HF5L 4MWFA 2ZUYA 5E6IC 5JXAH 1GXEA 2VTFA 4IRSC 1LK2A 2XXCB 3V6OE 5C9JA 5HGBA 3MLUL 2Y07L 1KB9J 4JFEE 3LEVH 1MJ8L 2NX5A 5ISZA 1OAKH 1C1EL 4Q2ZA 3UTPE 4L3AA 2H6PA 2LE9A 3MRKB 3T1WA 2VXVL 4Y16A 2D7TL 2FJFA 5IMOB 2NPLX 3ZKNC 1L7TH 1NJ9A 1VESA 4L1HA 4D8PB 4RGOL 2LV4A 1ZS8B 3ULUE 4MQTB 5JMOC 2BXZA 3C6LA 2VLMD 4R2GC 5CUSH 3KLAB 3L5WA 2XN9D 1B9ZA 2F58L 3ILQD 2VE6A 1N8ZB 1ZLSH 5D72H 3BP6A 2MQ0A 1QBLL 2P8LA 5DD1L 1KT2B 1BGXL 3GSVA 3FRUA 5T1DH 2R1WB 2DIAA 2X42A 4JR9H 3BQUC 1JI2A 4LGPB 4MS8A 4Z7VF 3QIUD 3IVKA 3S98A 5ACZA 4JE4B 1G0YR 5L7XL 5MEOA 4F3FA 2H32H 3GJEA 3IJHA 8CGTA 1NAKH 3EYVB 2H32A 4NUGL 2MCPL 5ID0B 3UDWC 1UZ6F 3D3VB 3VRIA 1ZHLB 4PS4H 5D2LE 4LKCB 1DQLH 4I0KA 4I0CC 1MFDH 1U8NA 2NTFA 3TA3B 3D48R 3DIFB 2VH5L 3DVGB 4K9EH 1HILB 3KLDA 5B3JF 4TUOA 4YHKH 4OIBA 5KSBB 4XNMB 4Z77B 3F7YB 3KXFE 2I26N 1OAXH 4OFIA 3MRBA 3OAYH 4Z95L 5I0DA 4J7RA 3QDME 3QG6A 3X17A 1ETZA 4MNGE 3ZT5A 4RGMB 3BZEA 4QRPE 1RUKL 2D03L 2OX5A 2YC1B 4AEIL 4X99B 3QO0A 4BH8A 4D2NA 5CBAB 1UADC 3GK8L 3V5HA 4ELMA 4AM0B 3JZ7A 1LEGB 5DR5L 4AH2A 3LN9A 4IHOA 4O2FB 2NMSA 3DYPA 1EBAA 3CDFA 2VR4A 5K9OB 1M1SA 2VMFA 3WFCH 4GUPA 4Y2DB 5DJCA 4RBPH 3RY4A 2VDNH 1NDGA 1LGVA 1KBGH 2XY2A 4KDWA 5HDBE 1MCOH 5LAXB 4X9IA 3VXSE 5BCAA 4EBQL 4OM0H 1HHGA 3FZUC 3VXOB 3QUXA 2HTKD 1IVLA 3UPRB 2B0SH 3E8UH 3C6LC 1VGKB 3DURB 2WBWB 3LKOA 3B2VH 2Z4QB 5HJ3B 2YD4A 1X4ZA 5D1QA 4HDIA 4UV7H 4ODVH 4LSSH 4WFFD 3IDJB 4OBSA 5FYKU 4GG6F 1MIEL 5I1DA 1FHGA 1MHCA 4XVSL 4K23L 5E2UL 4OUUA 1JZ5A 5I1CL 4MS8C 3KNBB 1BJ1J 5C0CB 1NBYB 1R24A 1LO0L 5CSZA 5EZLA 4TRPL 1S7RA 3P0VL 5GRUH 1LEIA 5KOVC 2OR9H 4MJIA 1LK3L 2GUOA 5EU7C 1H8OA 3NMEA 3WO4C 3QZWB 4P5MB 3NCJH 3I84A 4U7SA 4N5UA 5A2FA 5FUCE 3SDXE 4BZ2H 4FFEX 2YUZA 4BFGA 2X6MA 4AEFA 4P3CL 3P0YL 4UNUA 1QFPA 5INDB 3VGEA 2ZOKB 3BHBA 2COQA 4HUXB 1BFSA 3AS2A 1QEWB 3O6LL 2FX8H 3QIBD 2NY1D 4G6AD 1K3IA 1QFUH 4NN6B 1DLHB 1T1ZA 1SJHB 2CQVA 5JLZA 1GHFH 5F21B 3F62A 3UTQA 2WV3A 5DVMA 3HE6D 3B9KB 4Z7WF 2NY6D 4PV9A 2YBRB 3LRHA 1DBKH 2IBGA 4WUUD 4O9HH 1AIFB 1YNKL 3KPMA 4XXDB 1FLRH 2PW2B 3SDCD 4PJDB 3LS4L 3AGVA 1HI6A 1HDMB 2ATKB 4W70A 1V8HA 5HHOA 1A7RL 3S36H 2BNQD 4OLYL 1Y18B 3E1F1 3RY5A 2HT2D 1VPOL 5ANME 1T22A 5I8CA 4X4XA 3O4LB 1IE5A 4R7DA 3S3PA 1TXKA 1FL6A 3DYOA 4XMLH 1U8LB 3QUXC 4DEPB 5GS0H 4QXGH 5IMMB 1H5BB 4YXKL 4PJEF 2O61A 4UTBH 1I9IH 4P49A 5C7XH 3LMJH 4P4KD 2EXWC 2ZUQC 4MMXC 5IBLD 2VLJB 1EZVX 4FQJH 5F7DB 1R0AL 3MRFA 1CFTB 1YEDB 5SV3A 1W8OA 1XCQA 1F4YH 4UINL 5HHXH 4P2QB 4PUBL 4X8XA 4ZPVA 4YEEA 4J4PA 2WWKT 5C70A 1BFVL 4HUUA 4XGZA 5F44A 5L2JA 4X6EA 1MFNA 3VGGA 1TQBB 1QSEB 4TUKH 2V2XA 4K94H 4U6YA 4TQEH 3I02B 1UZ6E 4R26L 5DK3A 3IKCA 3ZE1F 4X80H 4C56D 1CK0H 4XHQA 4PJ7F 2HFFA 1A2YB 2FYYB 2YKLL 5E8DH 1HZHL 2P46B 2X4UA 1BLNB 1A9BB 4NM4L 5IMKA 1IEBB 4NO5B 4EXKA 2NXYC 3QXAA 5DF0A 5T3XL 2JELH 4D9RD 2G2RB 2P5EB 5GGVL 5IHBA 4S1QL 1EHAA 3HMXL 1D5IH 4OLUL 4R8WH 3BWAB 1XF3B 5D96C 2R1XB 1YEHH 4KY1L 2ESVB 1C5CH 3UO1L 4QLRA 3F7VA 5FV2A 3FT3B 4XZUA 5AWNL 5IIEA 3KPLB 3MBEB 2YRZA 2L4OA 1JYVA 2W0FB 3GGWB 3BQUB 2J6EH 4Y19D 2VXSH 2J6EA 3CSYA 3D2UB 4QXTA 4MQXC 1NGZB 2F5AH 1TZGH 4DTGH 5BZWA 4U1KB 1FZKA 1RIUL 3LHPL 1E4WL 2E9WA 4PJ8B 3C8KA 5CIPH 2QADD 3TZVD 4QYOB 3VCLB 5CIPA 1EZVY 5AZ2L 4H0IA 4N9GA 5HYQA 4C59B 5J4MA 1D6VL 4NYLB 2PYFB 4OZIB 5CD5D 1KJ2L 1Z9MA 2AJYH 4JDTL 5JMRA 3PWLA 3AMLA 1ZHKB 2VDKL 4ZUVB 1K6QH 4F15C 3RVVC 1QLRB 4XBPA 2VSCA 3VFNB 2CDGA 4H25A 3VU2A 4HMEA 2QV2A 2OZ4L 1HXMB 4GG6E 4Y1AD 4CRPA 2CLVB 3OMZA 1FIEA 5A16A 2KKQA 4J4PC 4H26B 3QEQE 1OAUH 4JVUA 3PWJA 3E6FA 4MWFB 1VGEL 5BRZE 1LK2B 2QQNL 4NBYB 5EN2A 5HGBB 5C9JB 5JIIA 1NC4D 2V9QA 5JW4R 3LRSA 1JRHL 2NX5B 5ISZB 4ERSL 1RZFH 4Q2ZB 5F6HJ 4N0CA 3D0LA 5ADPL 1MUJA 1NMCC 3T4AA 5IOPB 5HI5C 2H6PB 5IFJA 1BQSA 1D5XA 4XCCL 4Y16B 2FJFB 3UBXI 3FCTA 1I8LA 3N50A 5HYJE 1NJ9B 3DI2B 3QPQD 3HC3H 1EGJH 4TSBL 4Y4HA 4EOWH 1HYSC 2O5YL 1AP2A 1HHIA 2R0LH 4FTVD 4D0CA 2K7QA 3L5WB 1G9EA 1QD0A 2VE6B 1FG9C 3ZKXB 5JA8B 1NAMA 3BP6B 1T1YA 3BAEL 4QKXB 4GRWF 4CL7A 2P8LB 4Z7WE 1FP5A 5DVLA 1LHZA 3GSVB 4JPVL 1TPXC 3FRUB 4JG1L 1BBDL 5FGBA 4MNHA 3WFEL 1JZ7A 4PD4K 2AEQH 2OL3A 4QRRD 2EDKA 4NQEA 2VDQH 3FFCE 1MY7A 5MEOB 4F3FB 1NLBL 4YX2H 4LCWD 3GJEB 3IJHB 4LSVL 3V6BR 5LGKA 2H32B 1JGLH 3X3GH 2ADFL 5D7JD 3VRIB 4G6FD 3AAZA 5LBSH 2BVQA 5EOCH 4AEHH 3NTCL 4NM8L 2Q20A 2LU4A 3WO4B 2FNBA 3MOQA 4WEUD 4PJEE 3SCMD 1U8NB 2NTFB 4GLRH 4NN7B 3V7AE 3F58H 1EVUA 4OCSH 3T0EE 1PX4A 3UJJH 3TFKA 4TTDD 1S9XA 3WJJC 3WLWC 4TUOB 5EDXA 3N1PC 4CN1A 1ZVYA 3MSPA 4UDTA 5ITBH 3MRBB 3U9PL 4PJHA 1QTYT 1G6RH 3HG1A 5J1TC 4KRLB 3J8F7 3QG6B 1ETZB 4KMTH 5SWZD 2CKNA 4PRHD 4ZAKA 1DSFL 1UH3A 5CILH 3CCHA 3BH8A 3QO0B 4BH8B 3H3KA 4G42A 3ZE1E 3V5HB 4ELMB 4NOBA 1FNAA 3BDBA 4KJWC 4PJ7E 4X7EC 5AEAA 3VI3F 2PO6D 4AH2B 1JPFA 4M7LT 1HK6A 4IHOB 4ZD3L 1I3UA 5CSBA 4E41D 4HWEL 1MEXL 4N0CC 4NDMB 2WWMC 4URTB 3TC9A 2ZZUT 4GUPB 5DJCB 2MJWA 2O5XL 2VXUL 4P23A 3LS5H 1NDGB 1MFEL 4KK6C 4Y7MA 4PJGB 4K3HA 2WY3A 1PG7L 5I1GH 4YBHA 2A9NH 4KZEH 1I8LC 1HHGB 4S1DC 3QUXB 5BMFL 1T03L 4AMKH 4Y4HC 1H15A 1P4IH 2ZUQB 1RZ8A 4N1EA 1MCDA 1CGSL 1YJDL 3LKOB 5D1XD 3DETD 3QCTH 5FFLA 3OR7A 5GISL 1MRDH 1NCDL 5T3ZL 4XBGA 3Q0HA 1EXUA 1NGPL 5D1QB 1F4XH 4HDIB 2JCCE 5GRWA 3TBWA 5D6DA 4HXBH 5SX5H 1U91A 1LVEA 5FGBC 1JHLL 5I1DB 1MHCB 1Z9OA 4OUUB 2GK2A 4YUEL 3TBTA 1DUZA 5C3TA 2VDPL 1R24B 5GRZA 4OCMC 5CSZB 5EZLB 2YPVH 3EOTH 1OQXA 2B20A 3LIZL 3U9UA 2DQGL 2BOCA 5FYLE 1U8IA 1S7RB 1KSRA 3OAYK 1LEIB 2R2HA 4UV4L 1CXEA 4MJIB 2GUOB 1MVFA 3WHE0 3KR3L 1NUDA 3BGMA 5DD3L 3DXAA 5B3NA 2NY2D 3NABH 1SQ2N 5LQBL 5CJ5A 3QCUL 3B6SB 3TBSA 4PJIE 7FABH 4U31A 4NFDA 5MI0C 3TYFA 1X3DA 2UZXB 3BHBB 2HJLB 1R5IB 2QQKH 3UYRL 5FV1L 5T1KA 2P47B 4LCCA 1T1ZB 2DQUH 2DOCA 2X4RA 4YNYA 4RBPK 2JKXA 2HVJB 5HVHC 4YHPA 3UTQB 4XI5D 1XAUA 4LBEA 4PV9B 5HI3D 5CZXC 3KPMB 3VD9A 1BJMA 5I8KH 1N64L 1TTUA 1GAFL 3Q2CA 1HI6B 4RX4A 1YEEH 5HHOB 4RFEA 4JHWL 4M6OL 2A2QT 3GKWH 3OX8A 5J9PA 4P23C 1T22B