1INQA

Structure of minor histocompatibility antigen peptide, h13a, complexed to h2-db
Total Genus 70
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
70
sequence length
275
structure length
275
Chain Sequence
GPHSMRYFETAVSRPGLEEPRYISVGYVDNKEFVRFDSDAENPRYEPRAPWMEQEGPEYWERETQKAKGQEQWFRVSLRNLLGYYNQSAGGSHTLQQMSGCDLGSDWRLLRGYLQFAYEGRDYIALNEDLKTWTAADMAAQITRRKWEQSGAAEHYKAYLEGECVEWLHRYLKNGNATLLRTDSPKAHVTHHPRSKGEVTLRCWALGFYPADITLTWQLNGEELTQDMELVETRPAGDGTFQKWASVVVPLGKEQNYTCRVYHEGLPEPLTLRWE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords H-2 CLASS I HISTOCOMPATIBILITY ANTIGEN, D-B ALPHA CHAIN
publication title How H13 histocompatibility peptides differing by a single methyl group and lacking conventional MHC binding anchor motifs determine self-nonself discrimination.
pubmed rcsb
source organism Mus musculus
molecule tags Immune system
total genus 70
structure length 275
sequence length 275
ec nomenclature
pdb deposition date 2001-05-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00129 MHC_I Class I Histocompatibility antigen, domains alpha 1 and 2
A PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1inqA02
3.30.500.10 Alpha Beta 2-Layer Sandwich Murine Class I Major Histocompatibility Complex, H2-DB; Chain A, domain 1 MHC class I-like antigen recognition-like 1inqA01
2W0FB 4U6HB 5ACMA 2D0HA 3B43A 2Y36L 3GMNA 1WWBX 2BSRB 3H7LA 1MF2L 3CDGA 4JFOB 3SGEI 2JIXA 3UXFA 2BY3A 1F90L 2GT9A 4JLRB 4JM4L 2J8UA 5SV4A 3TWCH 1NDGA 4BQ8A 5E8DH 1A7RH 3NTCL 1HXYB 1JWSA 4FQXA 1T1XA 2W1NA 5IEHA 4X7DC 3VXRD 3VWJB 3C5JB 2XFXB 1PD6A 4P5KA 3ZYIA 2NXYB 5IBTL 2Z92A 5EOTA 5HY9B 1GVIA 4R90L 2F54D 3VFMA 3P11H 2GUOB 1MI5D 4G7YL 3CFCL 5DD3L 5I1CL 4M4PA 3ZE2F 4LKCA 5J1AA 3VI4F 4LDLB 3P30H 1KJ2B 5FM5M 5D2NA 3N50A 1IGTA 2DYPA 2PR4H 4M7KH 4AEIL 3TBWB 4LCYA 1CICA 3EKCA 1GIGL 4M6AA 1NLBL 2GAZB 2NZ9D 4MGXA 5H94A 1U93A 1M7IA 4X4MA 4I48B 1BD2A 1D5ZA 2I60H 2KBGA 3MNZB 1RHHB 5IQ7L 1ERNA 2K3TA 5FCUL 5TF1L 2NY6D 2AK1L 2VL5A 1QRNA 5C8JB 1MFBH 2IFFH 4FQQB 4XPBL 3TYGH 4ZFZB 1U8MA 3V0VA 2Z31C 5T5NF 4XCFH 4MA8L 3VFTB 3WJJA 4KK9C 4X6DA 3BHBA 3IKCA 1MEXL 4HK3J 5LGJA 3EJZD 5BO1H 4S1RL 4JM2B 1WBZB 4AG4H 4GXUM 1K6QL 4ODSL 4ZUWA 3HKFA 3ARGA 3RUGA 1E27B 3KR3H 4GJTB 4ZOEA 3BRGC 4N8CH 2M8XA 3MA7B 4CJ1A 3F5WA 4MD0A 5JR1L 1WUNT 1K5NA 3WFZA 2CLRA 3UPRB 4CMMB 1NGXB 4KRNA 4XCCL 1KENH 5IW6B 5DEFB 4M6OH 5KBNC 3PWUA 1EEQA 5DYOA 4PTTB 4E42A 4L4VE 1ADQH 3EYOB 1SY6L 3SOBH 4WUUE 2LTQB 1FLRL 4G9FB 1XF3B 4XVUC 5K9OB 3B5TA 3WNLA 3VMNA 3IFOA 5K59F 5ETUB 2WUBL 1S7WB 4KKAC 4LHQB 2WP3O 4M61B 3OKDA 4YFDB 1HIMH 4LCCB 1B4JH 5J9PA 1I4FA 3V8CA 2A9ML 3QUXD 4NZUL 3STLA 4HWEL 2EYRB 5E56A 5JXAH 4UTBH 4YDIL 3KPQB 2V2XA 1ZGLB 4X4ZA 1RK1B 5DK2B 4XBGA 1FVDA 4H88L 2FR4B 3ZHDA 3VGAC 1WT5A 4F7PA 5DR5H 4WW1B 3SO5A 1I7UB 4D9LH 5DQDL 2P8LB 4QY8A 2AXHA 4U6TA 2P5EB 4YR6B 1I3RA 4FHBD 1OCWL 3GMMA 3QUMB 4NCC2 3H42H 3WFHA 2GYSA 4FFYH 1ZHLB 2C3VB 1Z9MA 1PZUB 3BWUC 1PEWA 4JFPA 2I9LA 1TDQA 2W65A 5IT2H 5HGDA 4PR5B 1NSNH 3EDEA 4U7MA 1H8NA 3EGSA 5FKAB 4OI9A 5KG9A 1UCTA 3OKOB 1VEPA 2M1KA 4XB7A 4ZYKA 4PJCE 3HG1A 1Q0XH 1D6VH 3S36H 1MPAH 4Q97A 4I5BA 2PETA 3K8KA 2XQBL 1VFMA 4PJIF 3G5VB 4W4NA 3T8XA 2F53A 3DROB 4X7FC 1CLOH 3OF6D 3MRPA 1RJYB 3SKOA 3TCXA 2GSIB 5IB5A 2DQJH 5TDOA 4NUJB 3O6LH 1YNTA 1H15A 4OD3H 4MJID 3SGKC 4X8JB 3SQOL 2B1HL 3HRPA 5I8KL 3ARQA 3TPUE 1G9NL 1PZ5A 4K8RL 4LASL 4QOKE 4LLMB 4OI7A 4MA3A 3O4LB 1MFDL 1KJ2L 1F6AA 2BCKA 5BZWB 4Y19D 2W91A 1E4WH 1BZ9A 3W9EB 3VD4A 4KHTH 2QTEA 4GO6B 4QYOB 5ID1B 3KXFB 4YHYC 1PG7H 5C0FA 4BQ9A 3NAAL 3BZ4A 5C0ND 5IV2B 3IDXL 1XZ0B 1HH9B 3OKNB 3MODL 3WUWB 2GJ6E 2WZPD 2VERN 1G6VK 4YC2C 4J3SA 5H37H 4OQTA 1KNOA 4XAKD 3PL6B 5KANI 4YHOL 4HH9A 5AYQA 5BRZB 2VDKH 5LG1A 1I7ZA 3GUTB 2D03H 4HGMA 3OG4B 4OM1H 4JKKA 3QA3B 2YRLA 3EO0B 4KQ4H 4S2SB 1MJUL 1VGEL 4EXKA 3FRUA 3NPSB 1J1OH 1OAQH 4PJ5D 4I0CC 2W9EH 3U7WL 4L8DA 1KTLA 3V5HB 3X17A 2R39A 5ITFA 4XCYA 1RU9L 3KAAA 4JKLA 3ULVL 4YPGB 4OFVA 3TIEA 4F9LC 4L4VB 3X13A 1TCRA 2VUOA 3QO0B 1QFWI 2WIIB 5C0BD 3RL2B 5C0CA 3HC3L 5GGSY 3HMWH 4OF5A 3UBXI 3GSUA 4N0CD 5AZEL 3X3FH 1TJHL 1FJ1A 1JK8B 3DTXA 3TJHA 4P2OD 1R5VB 1YEEH 4GSDH 4Y2DA 3GSVA 2IPTL 3AC0A 1LILA 4KUZL 5CJOH 1C8PA 2C4FT 3BPLC 1ZT1B 5I8EB 1HOCB 1LO4H 1YEDB 4X6BB 5JOPD 5MEQA 1QZ1A 3CDGB 3U4EB 4CNIA 5HYJD 2JCCE 4JREC 1MHPH 5DFTA 2NW2B 2GT9B 5EC1A 3DLQR 1FNFA 5IK3A 1RZ8B 3WXWL 4PGJA 2IQAA 5FO7B 4X7SL 1OTTC 4MXWL 4DZBA 5D1XD 5JXEA 2CJUL 4ZS6C 4HWNA 4ZUVB 1AKJA 1YC8A 2XZCH 2COQA 1V7ML 3CCHB 3BW9A 3MLYL 4PJCB 3BKCH 5FKPB 3NZHL 4GW1A 1RIVH 1KPUB 1KJVA 1KTRL 1Q1JH 4FFVD 4HUUA 4YX2L 2Z31B 4GKZB 5C0GB 4L5FL 5KAQG 2CLVB 3FT2B 5L8JB 4XPGL 4RAVB 4JO4L 8CGTA 3BPCB 3FB8A 4IMKC 1YECH 4N1HB 2ARJB 1D5XB 3REWA 5ERWB 4LSRH 4Y1AA 4NDMB 2J7LA 3SE4A 5IF0A 1GRWA 3DRTB 3TPUB 3WL9B 1QNZH 4M1DH 4LCWD 1RIUL 3QUZB 3QPQC 2ESVE 4NCC1 1MFAH 4JFHE 1C08A 4ZQKA 5IWLA 2MCG1 2FIRT 3IJYA 1U8MB 3MGOA 4WU7B 2R2EB 3Q6FA 3CIQA 1NDMA 3CSPA 1I7TA 5LWYH 1BFVH 3P2TA 1CCZA 2GJ6B 1T22A 5GGSA 2V2TA 2FEEL 5F9DC 2NY7H 2H2PD 4DGIH 4IIQA 3NCFB 2V7HA 3NACL 3ZE0F 3U2SB 2OTUB 4NKMB 3CPLB 2OX5A 3SY0B 4PLJC 4WTWA 3MLXH 2EDQA 3JTTA 3OXSB 3VGAB 1G9MH 4YEFA 4Q9QH 5ALBL 3EOYG 5I73C 1QSZA 5IVZA 1SYSA 4MCZB 3HUJE 4JJ5B 3MJ6A 3OKEA 5JORB 1W2KT 5D7IF 2V17H 4HHAA 4GLRH 2DB8A 3PHQB 2Y06L 3H9SD 3W2DL 3DETD 4PB0H 3CK0L 2DM7A 5E99L 5BQ7A 1JHLL 3KPNA 3F6LA 1R3IH 2FGWL 1DSFL 3DO3A 4PJFB 3S97C 3P4MB 5F7EL 4WEMB 1TMCA 1JFQH 5CEZE 1I4FB 1A3RL 1P5UA 1HHIA 2BJML 1AO7A 4JN2A 3W39B 1ZLWK 3C2AL 5ICZB 1SBSL 4ZXBB 3MRFB 3PWVB 1KXTB 4YBQC 4ENEC 2VKXA 5DUMH 4GBXA 4AMKH 1AXSB 3D3VE 3K1DA 3MLVH 1S9KC 1YYLH 2OJZL 2W59A 1FZOA 2RR3A 3I3DA 4CVZA 5I76A 5KVFL 1R24B 4PJAE 1FGVH 4X99B 4DN4H 1JUFB 5HJ3B 3K8LA 1LP9F 4QY8B 1OAKH 3EBAA 1IGYB 2HJLA 5GJTL 2YD3A 1UKTA 5D5MA 2R2HA 1XGRB 4JY5H 4NQSB 2GQHA 3KYKH 4GAJL 4HCRA 1X6LA 4FNLH 3FO1B 4M7ZC 4D0DA 2ADFH 3BX7C 3UJTH 4QTHA 4WFFD 3JV4A 2NY0D 2JJTC 1MJJA 1FG9C 4N1EA 1J05A 2RBLA 4X6EB 1S9WB 2ZCLL 2P1YA 4YHYB 4X80H 4R3SB 4I5BB 1FL3B 4DKFL 1H3PH 5D1ZD 4UU9A 4LAJH 4NQVA 3BZFA 4ZO8A 1I1YA 4OKDA 1FCGA 2EC9T 5DHYA 5DWUH 4YC2B 4PY8I 5EO9A 3SKOB 2EIZB 3TT3L 1LVEA 1ROWA 1FP5A 3MV7A 4JB9H 1HHJB 3GB7B 1JRHI 1MRCL 4OZGE 3QAZC 2AXFA 5IIEA 1EEYA 1TTGA 4PGEB 1LO0L 4XPAL 2DLFH 4TTDD 1PZ5B 1XR9A 3WS6A 3O2DA 4YGAB 4YO0A 5DSCA 4HGKC 1QHOA 1GCFA 3TO2B 5F97E 2DQDL 2ESVB 1A6TB 3PDOA 1BZ9B 3SE8L 2Q3ZA 1BIIA 1FAKT 2RCSL 4KJQD 3RDTA 3VH8G 1WVZA 5C0IA 1DQLH 5EBLA 3T2NL 5I66B 2YPLA 4KTYA 3D39D 3D85D 3G9VA 1OAUH 4XX1G 3UDWC 5D4QA 2ZUUA 1IC4H 5CP3H 1F8TH 4UT9L 4PRAB 5FK9B 4F58H 3L3DB 4N90E 7FABH 5DVKA 2Q6WB 4PJ9D 1J1XH 2VTFA 3VXOB 1MREH 4OIAA 3VU2A 2YRZA 2P5WA 3IRZA 3P77B 5FYLL 1I1FA 3T04D 3QHFH 4NO2A 3DUUA 4HZAA 1CS6A 4TUJB 4EN3D 4OCWH 1DQDH 3L5XL 4MA7H 1MQKH 2JK5B 2EXYC 3QEQD 3Q6GL 4DK3A 4YH6A 1A64A 1KTLB 4L8DB 5FA4A 1DEEA 3BPLB 3HUJB 3MRCA 2WUCH 4OLWH 4YDJA 4FP8L 4DEPC 2HFFA 4OFIA 3RY6C 2AEWA 2HKFH 4X5WA 3EOAA 3S98A 4OGZA 4N8PA 4XC1H 3GSWA 2FECI 4OGYH 1HHGA 5GRJL 2G9HB 1AQKL 2EDJA 1MCEA 5C2BH 1NFDA 4HUWB 1MFCH 1CD8A 3FZUC 4JDZA 4RGOH 4XMPL 5F71A 4ODVL 3I6KA 1F3DH 3S36X 2DBLH 4TULL 3INUH 5J3HD 1I7RB 3FOMA 1JJUA 4MB5A 2R0LH 2VXSH 4Z7WE 3DV4A 3J7HA 4UQ3B 3MNVA 3DXAA 3TP4A 2YMXH 2R0KH 2B0SH 5L2JA 3D3VB 1IGCH 1UWEL 3O6KL 1T5XA 4NO0A 4PJAB 5L2KA 4GUPA 4HBCL 2RGSA 1G9MC 1OB1A 1N5AA 4LPTA 1R3HA 5KANG 3DV6A 1ZA3B 3MJ9A 4OT1H 1WFOA 3WS3B 2X89A 1RV6X 1Q9KA 4LRIC 5D2LE 5SX5H 1RUMH 4RCAA 1Z0NA 2EEDA 3QIUA 3A67L 3JV6A 5KAQF 5KSUB 2IG2H 3P9LA 3LS4H 3BGMA 4Z7UE 2PXYC 3B8YA 4PJGF 1P84K 4Z0BL 4PP2A 3TIDA 4YLQT 3S88L 5I8CB 5IR1A 1ED3A 1L0YA 4PRHB 1PG7X 4F33B 4GKNB 5DMIH 1AKJB 1C5BL 5KVEH 4NQUA 5C09E 4MNQA 1TFHA 4N9GB 2BP3A 2IMNA 5CIPH 1CZ8H 2E9BA 1LK3H 1IM9B 1NBZA 1G6RH 4KZDH 4U6VH 5B22A 5JOFA 2FO1A 3SDYH 4X9HA 1QBMH 2R4RH 3CLEL 3U7YL 3B5HA 1YY8B 5IFHH 1JNLL 4UB0H 4LPWA 5C86A 3WXVL 3MLUH 1T7ZA 5EO1B 1IAIM 4NWTL 4TOYL 1OD7A 3MCKB 1QR1B 2UYLA 2OK0L 4HPOH 4OZHA 3UBXG 1UFUA 3H3BC 4JANA 25C8L 1X5AA 1B3JA 1GAFH 5FM8A 5ESAB 5DRNA 1VKXA 3ZE2E 5IUSA 5DFWH 5JLZB 4NNPH 4POZD 2KDGA 3VI4E 2FWOB 4Y16D 5I73B 2VDQH 3RPKA 4R0LC 3DBXB 3GK8L 3C08L 2Q8BH 3PWPD 4BA8A 1GGBL 1EEUA 3SKMA 4ORGA 4ODWA 2X1QA 3E2HC 3IF1B 2YA2A 3VFSB 3WLWD 1R5IB 4FQIL 1UACL 4LPUA 4XP9H 5EZLA 2FEDD 1RVFL 1BOGB 1IQDB 5D6CB 32C2A 4PB9L 4Y4KC 1UCBH 1UWXH 4YIQB 5EZJB 5D6DC 5SWZA 2HH0H 1PDKA 1WIPA 3QDAA 4KJYA 4N5ED 3KYOB 1CE1L 1KJ3H 3DYMA 3IDMB 4F7EA 4D9QE 3L3JB 5EWIL 1M6OA 3E8UL 1FO0B 3RVVD 3KJ6H 4DN3L 4JHWL 1CG9A 4OQTL 1RIHH 2UZXB 4NBZB 1P9MC 1NGZA 2BVEA 3RWCA 3QUYC 4HIIA 3CUPB 2X41A 4EOWH 2CR3A 1J0KA 1C16A 3TBSB 5DT1L 5BQ7B 3LZFL 2P46B 4HWZA 4UQ2B 2DMBA 4BUHA 3AU1A 1FE8H 4M7ZB 3TVMA 3LEXB 5BVPH 1FL5A 4JKPL 4BH7B 4UINH 3ARBC 3CSGA 3N85L 5T1LB 4JN2B 1IGFH 2DS4A 4RISH 3VFGL 4Q9RL 1MLBB 1RJLB 3OX8A 4HFUH 5I8OH 5JZ7C 1NEZB 3OJDA 3MV8E 4YZFF 4TPRL 1QLRA 2OMBA 1CDUA 4UUJA 4P23A 3UTPD 5KVGL 2WBKA 2EXWC 4L29B 5K59E 1YNLL 2CDEA 1NH6A 4ELKA 3C8DA 2ZUQC 5CEZL 3QXAB 1UEYA 4WCYH 3MJ8A 4HPYL 2VXVL 3A6OA 4AENA 1BEYH 3KLHD 1QBLH 3F58L 3QWRD 3T1FB 5E94B 4OD1H 2C9AA 3TC9A 3QAZB 4IRSD 3RFZC 3O9WA 1KT2B 5D2LB 3IAQA 5C0JB 3LSOB 3H3PL 1G7HB 4Z7UB 5LQBL 4J4PD 1HWHB 4BFIB 1IGJA 1MAMH 5FV1L 3L9RB 5E2TL 3RWFB 1KPVA 1GXEA 2N56A 2AERT 3PABB 1QFOA 3TN0D 1QTYT 3A6BL 1GZPA 2IGFL 2JB6B 1KCRL 1MCWW 4XGZB 5BW7A 3FN9A 1AHWC 2A6KB 2EYSA 2DTMH 3NGBC 3P4NB 5CP7B 1OOAA 4A2LA 2CK0L 1I1YB 4LLWA 4LSQH 5DS8A 4XP1H 4HKBA 3SJVA 1OF2B 2A9NL 5E8PA 4L4TE 4Z0XB 4Z76B 1OGAA 3UAJD 4YXKH 1DN0A 3SGDI 3ZYJA 1OAYL 3L3IA 2BFVL 3IJSA 4M7LL 4IOIB 3EYSL 4PJIE 5IVXF 4PRNA 5JPNA 3T08A 4WI2A 1CXIA 3S35H 1UZ8B 4FMKA 3S34H 1P7QA 5LBSH 4ODTH 2VLLA 3KPRB 1EGJH 1B6DA 3HR5A 3CFEA 4U1MA 5D70H 5C0IB 1A6PA 5DHVH 2XZQL 2QHRH 2WBJC 3BYTA 5A2IH 1EHNA 4U1HA 1F97A 1TCMA 3VFNA 3GIVA 3C8KB 4F3FB 5J6HB 1XH3A 4OQ1A 4Y4HD 2AJZA 5B8CA 1ZVSA 1DBML 2D4FA 5HHXH 1WK0A 4JFXB 1TJIH 4YBLC 4ZNEA 1NUFA 1PY4A 1RZKH 4K2UH 5JIKA 3WNOA 5EU6E 4DGYH 3MOAH 1SJEB 3H9ZA 3NIDF 4HUMB 1JZ5A 5GS2D 1ND0A 4WFHD 4FABL 1U41A 1XFPA 3KPLB 4OCLC 4ETQA 3DYOA 5I6XC 4M93C 3O81A 3KNBB 4NNXA 1VEOA 3W5NA 4NZTH 3V0WL 1UXWA 4UV7H 4LBEA 4JQVA 3EOAB 1MJ7L 3UTTE 5BCAA 1LE9B 1EZVX 1FO0L 2R8SH 1BF8A 4JVUA 2NLJA 2PXYB 1R3JB 3V0AC 1N8ZB 3EYVB 2JJUA 2MMXA 5AZ2H 3IDIA 2IALA 5I1JH 1TVHB 1T03L 1U58A 1U8JA 4FFZL 3QG6B 4HK0A 2DMKA 4NNYA 3IB4A 1HCVA 5FHAL 1NFIA 2NZ9C 3FO9B 4KGLA 2AP2A 3GRWH 5CHNA 5I16A 2PO6C 1QLFA 4PRPA 5A2LH 5F7FA 2X6MA 3MV8B 3LV3A 2VDMH 2ZUSA 4XCNB 2BY2A 3MBED 1QYGH 4HUXB 4I18C 3QJFA 3NH7H 5GGRB 4TVPH 4GRLD 1NGQH 3KYNA 2R9HD 1M71A 1A4JB 4MWFB 2J8HA 3HTLX 4F57L 1I1AD 3MA9H 5GS1C 4DUXA 3FN0L 2EDDA 2BOCA 3VA2C 5DJ2A 1MHEB 4BELD 1G84A 3Q5YA 1S7SA 3RZCD 3V5KA 4HIHB 1AH1A 1T3FA 4HBQA 4C57C 1FDLL 3U46B 1GGCL 4U7SA 1EFXD 4LL9A 3U9PL 3WFBH 3IXTB 4R0LB 1U91A 2HG5A 1D5MA 4S1QL 1VFOA 4MNQB 1FGNL 1T20A 2D2OA 2QHLA 4JFZH 4I2XE 4NQCD 5E7BA 1G7LA 3S6CA 1HHKB 4OD2A 5SWQB 5HDBF 3WE6B 3K4AA 3E2HB 2DQEH 3V9FA 4HCRL 4EDWL 3QEGL 1ZANL 2H26A 3QDGA 4X9GA 1IAOA 1XCQA 2Y7QB 4ZOCA 2OR9L 3QCTL 3QPXL 3QQ9D 4HJGA 3GI9H 1BBJA 1IVLA 5IMOB 2UYLB 3KG5A 4XRCA 1GOHA 4WUUA 4HIJB 4NKDB 2L7UA 1KIRB 1YNKL 4L4TB 4JANB 2CKBH 2LAAA 3MLRH 5JW4M 1I85C 1JYNA 5I1LB 1G1YA 1PLGH 1NCTA 4JDVB 3HNVH 5HGGS 4L8SC 3QUXC 1JPFA 1ACYH 4JKMA 5KW9L 2EDLA 1UB5B 3ILPA 3GJFB 1MLCB 2F54E 1MI5E 3IDJA 2YEZA 2OJEB 1OGTB 3BP5B 1DR9A 5ESVA 4HQQH 1MJ8L 2V5RA 4XVSL 5L88L 4LARH 5KSVA 4YJZL 3D69A 1NAMA 3DX9B 1VSCA 1LDSA 1BQSA 3LS5H 3BT2H 2UVEA 1JZ7A 3S5LB 2DQCH 1B2WL 3STZB 1KB9J 1AQDB 3ARBB 1NCWH 2ZCKL 1JWMB 1INDH 2X4RB 2YKLL 4NM8H 5DRWA 1KFAL 1C5CH 4CMHC 4MCYA 3PV6B 4RFEA 5EU6B 3WMSA 1JNJA 1IT9H 1S7QA 4F7EB 4LFHD 3KPPA 2VJXA 3LKSA 2LAGB 4BH8B 5GZOD 4M1GL 4XXCC 2YPVL 1CG9B 3MRQB 4ZPVB 4V1DE 1KELL 5E6IC 3T65B 5JIHA 1UYWL 4Z78B 4H8WC 4HIIB 2RFXA 1NJ9B 1NLDH 1FNLA 3I9GH 4JG1H 4BQCA 5A40E 3B4NA 1P6AB 1FH5H 4MJ5B 3LPWA 1S7XA 1JI1A 4FZEL 5B38A 1BM3H 1J8HD 1TENA 2ZCHL 3RA7H 2V9QA 3TVMB 5GISL 3VXSB 4NSKB 3QFJE 4H1LB 4BSJA 2A74A 2VL4A 5EORL 3VRIA 4QOKA 3T4AA 1W72B 4P57A 3KPMB 4DW2H 2DLGA 3BQUC 3O6ML 2IBBA 3OJDB 4U1KB 1K8DA 4PP1C 3TBVB 5D7SH 3I50L 4APQD 2FX9L 4WW2F 1C12A 5AYUH 4OLVH 1AHWB 3DVNB 4KH2A 4D3CL 3NGBB 4MAYA 2OL3B 1LEGA 1B0GA 2EE9A 4R7DA 3V4UH 5E2VL 1NBQA 2PW2B 2VXQL 3HPJA 4ZSOA 4YHLH 3ZTJH 1ZTXL 2HTKD 5DJXB 5C0NC 1PFCA 5CUSL 4W6YB 2VN4A 2WK2A 4JQXC 1H5BA 3SBWC 2CLZB 3VCLB 3QNZA 4KTDH 5AAMA 3O3DA 4LAQH 4QHLA 2AKRB 4M5ZL 3WIFA 4IEFB 3BDXA 2GCYB 2N4IA 1V3KA 1K3IA 1OP5H 1IGJB 3I3BA 4N0CA 4ONFH 1GGUA 1LP9E 2XZZA 1KB9K 4K7PH 3MJ9L 3IU4L 2IAMC 2AJ3A 5J1TC 3ERYA 4I2XB 1G7MB 4ODXB 1XGUA 4TYUA 2WBJB 2W60A 4WI4A 4CADB 4H0HB 3GBML 4XPTL 1MCDA 3WV0A 1IQWH 4O2FA 2ICEB 2P8PA 5T1KB 4HWBL 2VQ1B 3BEVB 3S37H 4GH7B 1QP1A 2VDRL 1AD9A 4RAHA 4HX1A 4NKIH 3T0AA 5FO8B 3K8MA 4P5TD 1QFWM 3IJSB 2FYYA 4WVRA 3VXRB 4LSPH 5TH2A 4UILH 1NKRA 5IOPA 3R8QA 3CDYA 2BRRL 5CD5D 3TZVC 1Z2KA 4MXQA 1T0NB 4M93B 3DO7B 4R8WH 3CXHK 2F54B 1MI5B 4EUPA 3WSQH 1TXKA 5DO2C 2W0LA 5JO5B 4P3CH 5IM7B 1ZK9A 1OSPH 4PS4H 1HKLH 1F13A 5D7LE 4CVWA 2YD2A 2PTTB 3HZMA 3SGKA 2D31B 3V4PH 3EO9L 3C60D 4MJIE 1BVLA 1QKZL 3AS2A 1A7OL 3KJ4C 3W5MA 4NRYA 4LDEB 4WUKL 3EDFA 2W9LA 4XVTH 3HNSL 4X4YB 1SEBB 4LCWA 4Y19E 5D1XC 4HDIA 4AQ1B 4Z8FL 4QRSB 4PJHF 1D9KA 3F7YA 1T6VN 3U30B 2EDEA 4I18B 5BZDB 2ZSVB 4M7JL 1KEGL 1S5IH 2HLAB 3MRGB 3L5JA 5GS1B 3LY6A 5KSBA 3PUCA 1NC4D 4FG6D 4K3EH 2A6DA 1UM4L 2NLJB 1U8OB 2VZTA 5C7XH 1OP9A 2IWGA 1CYGA 4XAKE 1Q8MA 2ILLA 4OV6F 2ZWLT 1WJ3A 4PJEB 1II4E 3WNMA 4PJ8C 5HGHA 8FABB 3G08A 2VZ1A 4NNYB 1JPTL 3L3GB 3ARTA 5F44A 5F9OL 4LGPB 3UTSD 5KS9A 4PJ5E 1XF5B 1SEQL 5IKCA 4MA1B 3SCMD 1MCKA 2HTLC 2R1WA 1ZSDB 4OUUB 1P4LA 3D0LB 2QSCL 3B2VH 3QJFB 5DD6B 3C09C 1UB6A 4PRBA 2G5RA 4J3WA 3KYNB 2R2BB 1YEKL 1FVEA 3H9SA 3QJHB 4I13B 3CDCA 3GSOB 3LPGA 4NN5C 4GG6A 4IDJH 2FH6A 5DJDB 4TVPE 4HAFA 3CSYA 3S35X 1RUKH 5HDQH 2VR5A 4C56D 5C0BE 2OL3L 1A5FH 2O5XH 1FN4B 3OZ9H 1LEIB 3PE9A 1JNHB 3ZDZF 4L8SB 3QUXB 2H2PC 1ZHNA 2Y07H 1FFPA 1QFWH 4R96B 4ZTPH 2R29H 1XF2A 1Y0LB 5CJBA 5H35A 4RIRB 1G7LB 1IJ9A 5TE6H 2UV3A 1AE6H 1RUPH 1MQ8A 1BLNA 4DZ8A 4ZG1A 1WIOA 4PJGE 4IJ3C 3DIFA 3GMOB 1RMFL 3AFLA 2H3NB 1U3HD 4GQPH 1EEZA 4Y88A 1NAKH 4A2MA 1EJOH 4I0PC 5D9SA 1IEAA 5HYJE 5E9DD 4Z7OF 4UTAH 2P24A 1OTUD 4M02A 4BSVA 3AUVA 3A6CH 3BPOC 5BXFB 1NCAH 3LRHA 3G6AB 2CIKA 3LQAL 4D0BA 2VQTA 1ADQA 1WCBA 4NZDA 5SX4I 5I71C 4Z7NF 5EU4A 4UIKL 3T2QA 1KIUA 1DVFC 4PGBA 3KPSE 4R97C 3Q0HA 3R8BB 4EVNB 3TO4D 5DVMA 4DKEH 3U36A 1G7QB 3IDUA 1F3JB 1D6EA 1FVCB 2W0PA 4O5LH 4PRID 2BNUB 2FSEA 5FYJH 1ZXQA 2X7LA 5FO9A 3RI5F 2XN9D 4Y5YC 3IFNL 4N1CA 1MCNA 3V95A 3GSXB 2FEEI 2A0LD 4GAGL 1GH7A 5CKGA 3UROR 1IFHH 3JVGA 4MJIB 3VGGA 4BKLB 3LIZL 4HUNB 1A21A 1MHHA 1E4XH 3WEXA 4F2MA 4JO2H 5FECB 2FCBA 3VE0B 3VDBA 4FFWC 3K80A 4Y19B 5CBEA 4B7LA 1JVKA 5JMOC 2NY0C 1B4RA 2DQTL 3ARZA 1HXMA 2O5YH 2YD9A 4ODHL 4E41D 1MFEL 1U8NB 2Z4QA 3HFML 4YHNB 3MLZH 4XP6L 4AYFA 4C55A 3GSQA 3BKJH 4HUVA 3EJYC 1A1OB 4WDIA 3FQNA 1PQZA 1WWCA 2E5EA 5D1ZC 4FFEX 5IB4A 3THMH 5I74C 1YEFH 2R15A 4KC3B 4ZOBA 5I19H 1JGVL 5FYKH 3CC5A 5MEOB 2YC1B 1NUGA 4LIQE 1CFVH 3B6SA 5AUMB 1QPPA 1I9IL 4OZIA 2IAMB 3DMMD 2VDNH 1J1PL 2UVFA 4TTDC 1INEL 2LU3A 4H20H 1EX0A 4MMXC 2MQ3A 4LU5L 3QEQA 4PJ5B 4U3HA 4KKBD 4DQOL 3OAUH 1S7RA 2VOTA 1SJXA 4KJQC 4WHTB 1VB9A 3BN9C 5EB9A 3U4BH 2C1OA 4NPYA 4NIKB 4N0YL 3OG6B 1E4KA 3UYRH 1KLGB 4DAGH 1WZKA 4LSDA 1IBGH 5HI4D 4ONHB 4YZFE 3PIQB 3CH1A 3VDCA 3BKYH 3QNZB 2CDGA 1G0XA 4G6MH 5C0BB 1OSZB 5IQ9B 4OCRH 2LQRA 1CGUA 1NMBH 1UM6H 5BS0A 2ITCB 3PGFH 5LJYH 2GSGA 4DUVA 4EI5D 4KK6D 4P2OB 2UZIL 4EN3C 3QWOB 3UP1A 2BK8A 2D0GA 3MO1B 1BFTA 1JP5A 3VFUA 5GRYA 1RD6A 2W60B 4MJ6A 4QXGH 1HYRC 4WFED 5IGXL 2E6PA 4M43H 4PJGB 4AEHL 4PLKC 3C5SA 1H9VA 3R0NA 2XKNA 4BFBD 3SKJH 4KQ3H 1BAFH 4XC3H 2GTZB 1MH5A 4MD4A 5HYJB 3KJ4B 3P9MB 4K9EL 4LQFH 1CN4A 1E6OH 4D8PA 1QO3A 5F96L 3PV7A 2EC8A 4M8VA 3CMGA 1QFUH 4O02H 1D3CA 2JJTA 5D1XB 2XWTB 2H9GB 1UM5H 4ELMA 3T0BA 5J3HC 3D1MC 4QHMA 4ZPTA 1FHGA 4Z7WA 3B9EA 3KPSB 3ARDC 5F7UA 4OJFL 4OM0L 2GITA 1AR1D 2AV1B 3SDDD 3EFFB 3WJLC 2EKSA 4LMQI 2LABA 5IHZA 4EUPB 2MWCA 4XX1E 4I3SH 3G6JF 2FO4A 1EMTH 1TZGH 2VLMD 5DJ6B 5IVXE 4YDKL 4LSTH 3VXQA 2YHGA 4UNTA 5C0AD 2NNAB 3QEUB 2C3WA 4LCUB 1M7DB 2VZOA 1SJVA 3RWHB 3OHXA 1QLEL 4H8WL 1CFNB 1FYTE 2FD6L 5FFLA 3UJJL 1T21B 2V7NA 3RX7A 1TQBC 4JFDE 1FG2A 3B9DA 3SDXB 4OLXH 5FM4A 4XTRD 4PGZA 1JRHH 3C6LD 4TSBH 4Y16A 4LCWB 4B53A 4Z9KB 5C09A 4CU7A 5LXGL 4JFEE 2VE6A 1NAML 4LVEA 4JO3H 5H2BA 3TYFB 5EBMB 4AZ8A 1JWUB 2O61B 2APXA 5T3XH 1WBYA 3ZKSD 5IB1B 4LVNC 1QQDA 4NN5B 2FRGP 1N2RA 1U8IA 4S1SH 5GGRY 1GHFH 2APWA 2VXUL 3NIDE 2HMIC 5F3HA 1MVUA 4K7PX 1T1WA 2FBOJ 2XA8H 3C2SA 2ATKA 4MLIA 2WQ8A 3FQTA 2B2XL 4YE4H 4IRJA 2VITB 4NRZA 5K9QG 4JDTH 4HT1L 5HGHB 4JY4A 4LRNH 4DVBA 5KN5A 1FC1A 2K1MA 2RAMA 5MERA 3RPIA 3CFDB 3ES6B 4RDQF 5IEKA 3S37X 2EE3A 1K4DB 4LF3A 3FB7A 4IJ3B 2YPKB 4WHYG 4OBRA 4YEEA 2A1WL 1P4BL 1EZVY 1FRGH 5B21A 5DEGA 3H9SB 1Q38A 2X5PA 3WLWC 4YUEH 5I1EH 3BPOB 1ONQA 1HZHL 3CSYB 1DFBH 4NN7C 2AW2A 3OTTA 3IU3A 5I71B 1ZLVH 4QO1A 2J4WH 1DVFB 1Z3GL 5TF0A 4P5MB 4N5EC 4R97B 5DMGD 1BQUA 2CKNA 5BV7H 3GSRB 1ZT4A 4I9WE 3HHRB 1OARL 3HPLA 1IRAY 3RVVC 4MNGE 3QO1B 3CVHA 4S1DD 3EAKA 2OMNA 5E8NA 4MDIA 4Y5YB 1KEML 2JLLA 4HH8A 4TSCH 1DUZA 3MR9A 1M4KA 3QWRA 1K85A 2BOBA 2OCFD 5JNYA 4M6ML 4X98B 3TT1H 1XGPA 3CH8A 3VW3L 2R1XB 5HDBE 2PYFB 3DX7A 2OSLA 5I17A 4D0BB 2X4UA 4JFFD 3ALXA 4WW2C 3SGJA 4J4PA 5L0QC 2FATL 3K1KC 3AXLA 4PJBA 3MRRA 2NY1D 2NY0B 3G04A 4U6YB 1VADB 4FXKB 1SQ2N 1A3QA 1A2YA 3VH8B 4C58B 1DLFH 4K23H 5E08L 4OF6A 3TA3D 1KGCD 3L3HB 2VIRB 3ZYZA 5DLMH 1D6EB 4LCIH 1G7IB 3MUHL 4GQ9H 5D1ZB 1L7IH 1KCKA 5I74B 43C9B 1GOGA 4OLYL 5BJTA 4HKZA 2JELL 4KROD 3FFCE 4YHIB 5C08A 4Z5RB 3HE7D 1HILA 3WDHA 5HHPB 5CEXB 5DC4B 4I3RH 1FYTB 2GTWB 1MCOH 4X5LA 4JFDB 3WIHH 4U1NA 1JPSL 4M03A 1BFOA 5FB8B 5ICYA 3GNMH 3PWPE 5HYSA 1MRDH 4NQEA 5E5UB 2FX7H 2ZKHH 3ULUH 3WCYA 1U2CA 2IFGA 3QFDA 4JR9L 1DBAL 4HULB 4YXHH 3TN0C 1HEZA 3MLWH 4TSAH 2QKIB 3EOTL 3HN3A 3NCCB 4OZFA 5GS0D 3D39B 3D85B 3L6FA 3QIBD 4U7KA 5F6IC 3TBYA 3OKMB 2MSPA 4FN0A 3TWCL 4F9PA 4KVCH 1A7RL 5E8DL 3DHMA 4Y4HA 3BZEB 4PJ9B 1JV5B 1MNUH 3AGVA 2E9JA 1D5IL 1IL1A 3KS0J 3UAJC 1FL6A 4P2QD 4PJIA 2C7UB 1JNNH 5F6HJ 3RGVD 4EN3B 3P11L 3P40A 3QEQB 2Z8SA 4RNRA 3U48A 1K3ZA 5FA3A 5F7DA 3LKQA 1I1CA 3QUYA 3IDGB 4FQ2H 4WNQA 5IHUH 3EDKA 3MXWH 3BZDA 3P30L 2EH8L 1S7RB 5F7MC 2G5BB 2PR4L 5L6YH 5GGUB 3RNQA 4L9LA 4JRYD 1A3LL 3RGHA 5I1AA 3S3SA 1YMMD 3U0WH 2YD4A 5K33A 3EFDH 3IJHB 5CBAB 2IQ9L 3FB5A 2CMRH 5DJAA 1J0JA 3CDFA 2VLJD 1CDIA 2VR9A 2VLRD 1X5FA 1IKNC 2XTJD 3DVIA 4JR9H 5IB2A 5CP3A 1F4HA 5GGVH 4RRPG 3U9UA 3FFDA 2ORBH 4N0RA 1KB5B 2AJXL 4LNRB 3FCTB 2F5AH 3FB6B 2BNQD 4YK4C 2LVEA 35C8L 2AJVL 4XCFL 4QT5A 1MCWM 4MNGB 1MCRA 3L5WB 4O4YL 1YDPB 3W9DB 4GW5A 3UBXB 2DWDA 3H0TB 2P8MA 2GY5A 2YK1H 1CXHA 4HAGA 4KMTL 2JIXD 3UTTA 4M4RA 4AG4L 4NZRH 1INQA 4LLDA 2Q76A 3VFRB 4AJ0A 2FZ3B 4ZTOH 2AABL 1TQBB 1J86A 1R0AH 1PAMA 1UXSA 2FHBA 3ULSA 4K3JH 4BQBA 1AJ7L 1GPOH 3CZFB 1HNFA 3QXDB 4XBEL 1YJDH 1IZJA 1R3KB 3VGDA 4F37F 3CD4A 4OCYL 5IHZB 4HK3N 5IW1B 3WFEH 4RGMC 4PREB 5IJKC 4MSWB 1P5VA 5IBUG 3O6FA 3GHEH 3HI1A 4GRLC 5SX5K 3MJ7A 2DYPD 2DQGH 3FFCB 2AJUH 4QCIB 1CICD 2DWEA 1I1AC 4K3DL 3FHAA 1N4XH 4UOJA 3P73B 2EDNA 1KG0B 1W0VA 2VO5A 3RZCC 3FTGB 2YUVA 3GMQA 3PF2A 3GHBH 3RJQB 1JTOA 4LK4A 1ZWIA 3UCRA 3K3QA 4U1JA 4JGUA 4MX7A 3SGDH 4GAYA 1GZQA 1JN6B 3EOBB 1V3LA 5D8JH 3PWPB 4R26H 2P42B 2L7JA 2ZOLA 5HHVH 3BN3B 1S7TB 3W11C 3LQZB 5EA0L 4WHDA 3QUKB 3Q1SH 2FHFA 1QRND 2H1PL 1MIEH 4HJ0C 3O11A 1WBYB 4FZ8H 4J23A 5F9AC 1VPOH 1Q9WB 4TUOA 5CIPA 1AP2B 5DUBA 4FQ1H 3H42L 1G6RA 2APFA 1JI2A 2APTA 5CSZA 4FFYL 3D25A 3G6DH 1W8NA 4NN7B 2X4SA 5D71L 3MV11 3BDYH 4OIIH 3MGTB 4PJHE 2L0DA 5LGHH 4KXZH 2E7CA 3VXUA 2F5BH 3RU8L 5C9JB 2R23A 2EIDA 1KTKE 4JY4B 2BHUA 2OQJA 5DD1L 3ARGD 5CZVH 5DQJB 4KVNL 4QTIH 1FZJB 2QSQA 1MPAL 4KHXL 5D7KE 4C59B 1RK0B 3MCLL 1Q72L 1FORH 4NJAH 4LF3B 5EU5A 2ZUYA 3ULVF 4Q2ZB 4P3WA 3ARFC 5L8LB 5ILTL 5I1KH 1MHCB 1P2CA 4NOBA 4JRWA 1KPRA 1KC5L 1UWXK 5T3XD 4IOFD 3S4SA 3UTQA 2X05A 2NXZD 2C4FU 5L0QB 1W0WA 2XXCB 2HJFA 4NQDD 1BGXH 4HMDA 3DVGA 5I30H 3TPKA 2DAVA 3OR7B 3EYQD 2PO6A 4OGXH 3QYCA 1E4WL 4JHAH 2X09A 5CFHA 2PYEE 4KHTL 3NMEA 2AAVA 2BZDA 2BHYA 2ENSA 1YQVH 3GO1L 4M7LT 5MEPB 4Y5XA 3NABL 3BE1H 1T5WB 3CVHB 1A4KB 4V1DA 4DFHA 3ZDZE 3IDNB 5K9JL 2XT1B 2DM2A 3PQYE 4KRLB 4LLYA 2MPAH 3CXDH 5E95B 5IJVB 2E8YA 1QBAA 1KB5L 3C6SA 5EUOA 1JF1B 3K81A 4IRSB 1I9RH 2P4AB 3LEYL 5IBLD 4OM1L 4Y0GA 5CMAB 1JPGB 5DZNA 5I17B 1MF2H 1CDHA 1F90H 3QFJA 5D7IA 5T3ZH 3PGDB 4X6FB 2X4PA 2ZUWA 4PJBB 3HS0B 4QF1B 1UWGH 4PJDA 2DKMA 3MRRB 4NQCE 2C3GA 3NTCH 3MMEB 5JUEL 3WYRA 3ZKND 4D2NA 1CD0A 4Z7OE 3TN0B 3HG1D 4WRLA 3SKNA 4WI6A 3MRIB 1P4IL 4XAWH 5EFIB 1J0YA 4Z7QF 1JGLL 5IBTH 4PG2C 3BH9B 4Z7NE 5AG8A 5F6IB 2UY7A 2F53D 2EH7L 2P7TA 3QNYA 3BYYA 3E6FB 4R90H 5BJTB 4G7YH 1PEZA 5GQBA 2PW1A 2VABB 5I1CH 3G5XA 2HTKC 1QSEA 4HLJA 3T0XA 1I85A 3GIZH 3ILQD 4Q6IA 4H5SB 2KQNA 3X3FL 4GRWB 4AEIH 1HSAA 1GIGH 4F7CA 1HKFA 1HINL 5TQ0L 5FUOH 1LP9A 2DQFB 3RIFF 1K4CA 4A6YH 1J0ZA 4O2EA 5JW5A 4FXGB 4BZ1L 2HRLA 1S7VA 3Q3GB 1LO4L 5EUKB 3NFSL 4X5XA 5K93A 3LN5A 2FB4H 1T89A 2FX8L 3TBTB 4F15C 1FPTH 2AK1H 4OZFB 4PD4K 3JWDL 1MHPL 2AS5M 2WP3T 2FIKB 5CCKL 4PJ7F 2LE9A 1KXVC 3JV0A 1WCQA 5HYQB 3LDBC 1DN2A 1HHHA 3I85A 3C60A 1LNUA 4PJHB 3RKDC 1MEXH 4N0UA 4Q6YA 1LEKA 2Y6SD 2NY3D 4D9RD 4S1RH 4P5TC 1SM3H 1KTDA 1XGTB 3X12B 2IH1A 3OSKA 2HJKB 4YK4B 4BQ6A 5B39A 3RJDA 1BQLH 5J12C 3S96B 3GFUA 5E6IA 1T0PB 4UBDD 3B2UD 2VSDA 4WNQB 1T7WA 4WWKA 4QHNA 5JR1H 3MGAA 2BSTA 1EUUA 1YECL 4V2BA 3ULUD 1PJ9A 2XWBB 3VDAA 4CW1B 2IPKB 5D7LA 1V5JA 3LMJL 1Z0MA 5ADOL 3MUGA 5DHVA 4U1LA 1J8HE 1SY6H 4OB5H 5C0CD 5J6GB 4IM8A 3LHPL 1ZE3C 3WDJA 4EI6A 5FYJU 3BQUA 3QZWA 5DUPH 1SHMA 2WUBH 1P1ZB 1AGCB 2GHWB 2PYEB 2ADIB 3FONB 1UJTA 2BVPA 3TJHD 3UTSA 3MRMB 3B9KA 5HHME 4Y2DD 3BRDA 4LSVL 4BK5A 3MQIA 3KYAA 3MBEB 4RGMB 1IMHC 3HCVA 5LWYL 4E5XA 4H88H 1BFVL 3CVIL 4GW5B 4GRLB 4KDWA 3MV9A 4ZUUA 2V6HA 3NCYS 1AC6A 4FQHB 1I1AB 4P9HC 3OXRA 4IS6B 4FG6C 3B8SA 3F7RA 4P4KA 3RZCB 1RUQH 3PGCA 4C56A 1GC1C 2ICWB 1OCWH 3CVHL 2ADJA 2DQHL 5A16B 2UWEF 4YGVB 3D18B 4G3YH 3C8HA 1EFXB 2EC9U 3BAEL 4QRUA 4Q9QL 5H8DA 4MS8D 2HT2D 5JXED 5CEYB 1FBIL 4H26A 4DFIA 4NQCB 4I4WB 1U8PA 1EO8H 4BSWB 1X44A 3LRSB 1X5HA 3PWLB 4W4OA 3S9DB 2J8UF 3HE6C 1JZ2A 3GRWA 4PB0L 4FTVE 4NN6C 1AFVL 3SCMC 1R3IL 3ZL4L 1JHTB 1KBGL 1RUAH 1ZS8A 1ORQB 3VJ6B 3JTCA 1UQSA 4WEBL 4Z77A 2MKWA 3PP3H 1IEBA 1JFQL 4X0KB 2GK0B 5HHNB 5TQ2L 1S7UA 2ITDB 4PJCF 1ZGLM 4D0CA 4EQ2A 1G7JB 4KWUA 5FGSA 3IXAB 1A7QH 4Y1AD 4EDXA 1NUDA 5DFVD 3G6JE 5F1KC 4AMKL 4P46C 1TJGH 3TZVA 1BHGA 2WWMD 2B1HH 4TN9A 2VN7A 4HKXB 1C7TA 3DRQB 1G9NH 4LDOB 4UT7L 4K8RH 4LASH 1B6UA 3TO4A 4DN4L 3KLSA 4HZLB 1NBYA 1U6AH 3FQUB 2VUYA 1KJ2H 4JRXD 4PUBL 1WEJH 1T83A 2HWZH 4OKVB 3ARFB 4Z6AT 1U8KB 4OF7A 4UT6H 4LHUD 3KYKL 5TE4L 3VMPA 4FNLL 4O2CA 1U3HC 3NAAH 3BPNC 1ETZA 5ISZE 2VLKD 3IDXH 3UJTL 3CFKA 3MODH 5E00B 1CD9B 1OTUC 5DJ8A 2FL5B 4LP4A 5EC2B 3O4OC 4X6DF 2CKBA 3MTRA 4X80L 3I6GA 4YHOH 4ERSL 3KLAB 2HN7B 3VXNB 1J0IA 2HFGH 4U1IB 5D7JD 1MJUH 1VGEH 5SWSA 2FJHB 2XYCA 3GMLA 3U7WH 3NOIA 5F1NB 3RTQC 4HS8L 5CAYB 1B0RB 4JB9L 4K7PY 5FDWB 1MWAB 1UH4A 2ATPB 1T66D 3RWDA 1QFHA 1DANU 5ALCH 3ULVH 2DLFL 5TGBA 4UIMB 3VFWB 3SDCD 4PJ8A 1J8HB 2A0LC 4U0RC 1VA9A 5LCVL 3RVTC 3WNKA 5DJZA 3NFNB 1AO7D 4F7MA 1LQVA 5C0DA 1BQHA 3HC3H 4PJFF 3L1OL 4ZUSB 1DQLL 2VISA 4GBXD 4APQB 1YEJL 4MQ7B 2EDTA 3BIKA 2ZNWA 3TV3L 4S10A 1OAUL 2I5YH 2BSSB 5C0EB 2MHAA 3HR6A 1WGOA 3AB0C 2IPTH 1A6WL 3HLAB 5ICXA 5FEBA 4F58L 3RWGA 4J6RL 4KUZH 5ABDE 2HA1A 3WUZA 3ZZ1A 5JHLH 3V7AG 1TZHB 2X9WA 3O45B 5DTFA 1J7VR 3QHFL 1LD9A 4N5UA 4ODUA 5GRXG 3MBXL 5AWNL 4MA7L 3MYJA 5CJ5A 4HG4J 1Z5LA 4PJDB 1MUJB 3WXWH 1I8KB 1OPGL 3P4OA 2J6EL 3DMMC 4OLWL 4X7SH 5JPMB 4OV5A 2Z35A 3L95A 5DQ9A 5GSRA 2HKFL 3QIWC 1H3WM 1PKQE 2AGJH 3VGHA 1UH3A 2WW8A 4KKBC 3QUMH 4XC1L 4I0PA 1A6AA 4LEXH 4OGYL 1G1CA 4HEPG 2E7LC 3LDBB 5ITBL 4IMLB 4X4XA 4YX2H 5E4EB 4U4BA 1MFCL 2EE2A 5HPMA 4XCEA 3RX5A 3MV7D 3RL1A 2DBLL 2QEJA 4CDHA 1IZKA 3WN5A 4ZDHB 3ETBF 4O51B 1N59B 4P5TB 2R0WL 4FMFA 1OP5K 2A77L 5DC0A 5JDJA 1JGEA 3G6JB 3FQXA 5DVOA 3OGCA 3QHTC 4GW4A 5I1GH 1IKFH 5J12B 1GGTA 3RAJH 4PGCA 4HEME 3V4VL 5SX4H 3BMWA 3HC0B 3O3AA 2ADGB 5DDHA 1S7VB 4EI5C 3G5YA 1P7KB 4M00A 4BFEA 4MVBA 1RIUH 1T0MA 3IFLH 4P3DB 1CXEA 1AY1L 1HQRB 3O8XA 4PRIE 5GGQL 2X4NA 5HHOA 4B0MM 5TE7L 5DI8B 4JPWL 5EO0B 3RQ3A 1RUML 5EBWB 1GGIH 2ZUXA 4YDLC 5F1OB 2IG2L 2YD8A 4U3XA 4XPHH 3V6ZB 1EDQA 2I07B 3C60B 1A02N 2HFEB 1AGEB 5KVEL 1RJZB 1IAKB 2EO9A 1Y18A 2HVKB 5I2IB 2AQ1A 2P5WD 2Q86A 1GOFA 1TZIB 1LK3L 3V5DB 1U8QA 1G6RL 2NY4D 1VFAB 4KZDL 2IH1B 4TRPL 3NACH 2HT4C 3VWJC 3SDYL 1IC5L 1QBML 2AV7A 2R4RL 3QI9D 1S9YA 5IFHL 4E41E 3MLUL 3CSBA 4XXDA 4L3ED 4LEOA 4PY7B 3FQWA 1L6XA 1RZIA 4QHNB 5ALBH 1AR1C 3SDDC 3REVB 1PW3A 5C07E 4OUOA 3RNKA 5EN2A 3SPVB 1ZVYA 4RBPH 5GSVA 2RJMA 4HS6A 1NGPH 1GAFL 3ZKQD 3QDME 1G9NC 3OB0H 1NC4B 4K8RC 4PV8A 3CX2A 3I6LE 4P0DA 4Y5VC 3W2DH 4R7NA 5E99H 1JHLH 4KU1A 4OGAD 3L3KB 2Q8BL 3VWKD 4GMTL 3RVUD 2QQQA 3KDMB 4QRRE 1FZMA 1NPUA 3UTSB 1DLHA 4PG9A 1X5YA 1EH9A 3HE6B 2BJMH 3DXAD 4JFEA 2IH3A 3C2AH 3C6LC 3FO2B 1QPXA 2XTLA 1SBSH 4NN6B 3GZKA 3SCMB 3VXTB 3UO1H 2E7LE 5EPMB 4E5XB 3CFBA 4NO0D 1UCBL 2VZVA 3MXVH 4J3TA 3MRLB 2HH0L 5KVFH 3HC4H 2X89D 1KN2L 5JQ6L 2ZUVA 4JY6A 3R06A 5GJTH 4J3OC 4QRTB 5HDOA 1Q9LB 4XH2A 4EJ1C 3MRJA 3NCMA 4NQTA 5ANME 4PTUA 3D2UA 1RIHL 4H26B 3W0WA 3MUY1 4WV1B 1F4AA 5E8EA 3MRNB 3BEWB 2BNRA 5EIIA 4EOWL 4MAUL 1VGKB 2EYTA 3HZYA 4YPJA 4JKWA 4OCSL 4H25B 1PKQB 1L9MA 1T2JA 1QVOB 2ZCLH 4HXAH 5D1QA 1BJ8A 1U3HB 1JGDB 3G5ZA 1SMOA 2CDFB 1FE8L 5E2JA 4GFTB 4DKFH 5BVPL 2NCMA 2QSVA 5E9DB 5DJ0B 4D0CB 4RISL 1IGFL 5DJCA 5CWSB 1Q94A 3TT3H 5I8OL 3U83A 3O4OB 1TETL 1JYXA 1DUYA 3MRDA 1MRCH 1JZ6A 4BYHA 3IGAB 3M17B 5F9WC 2MTPA 1LO0H 5IG7A 1CL7L 3NN8A 5DMGC 3WBDA 3STBA 4WCYL 3TO4B 1UA6L 2WV3A 1QBLL 2P48B 2XRAL 3TA3A 5AD0B 2VC2H 3RTQB 2ZJSL 4I77L 4PRIB 2DQDH 4ZFFA 4OD1L 1AGBA 2L4OA 4WJ5A 2VLME 1IC7H 1BZ7A 3B83A 4XNUL 2RCSH 2XN9B 3ROLB 4HV8B 2AI0L 4UDTB 5C0AE 4KRMB 4P4RA 5F8QC 1J87A 4U0RB 5HHQB 4XWOD 3HE7A 5SWZD 5F70A 2NX5A 3FOLA 2BMKA 3I75B 1O7VA 3QDJA 2AQ2A 1A7NH 2XACC 4PV9A 2CUIA 1JZ4A 4U0QB 1CU4L 5FYLH 4U31A 4UV4H 3EHBD 2NY1C 1BJ1H 4G8EA 1FV1A 2WMPA 4E41B 3ECBB 3AB0B 3F7PC 1HE7A 5C3LD 3HAEA 5I18L 1WFUA 2N1KA 5C07B 3VXMA 1E28B 2CIIA 4KI5D 3AAZB 1O7SA 4FP8H 4G42B 1LQSR 3RWDB 3QQ4B 5GPRA 3B3IA 5J7CC 3VRJB 1OLLA 4I3GA 2YWZA 3X14B 2A83A 4LLQA 4HFWA 2AEQL 2HLFC 4NP4H 4QWWC 3S35L 5GRJH 4QNPE 3ULVE 1AQKH 1RULH 3QH3A 4G8FB 5DJYA 1N3NB 4RA3A 4RGND 4XNYL 3DMMB 4XMPH 4CVXB 3AREC 1U8HA 2NY5L 4P9HL 4QRRB 3LKRB 5KZCD 5GGTL 4TULH 3QIWB 1GC1L 2XNAA 4P23D 6FABL 43CAA 2OTWA 3PXHA 1KCUH 1MCPL 2FJGB 1UWEH 3O6KH 5HHXL 3FRPA 4HS3B 3CU7A 1TJIL 4UDUA 3SDAC 1YMMA 4G9FE 4HBCH 3QIBC 5KSAA 4BM7A 4K2UL 2H8PB 4WO4A 2ICES 2G2RB 4M8QA 4K7FA 1VFBA 1HCFX 1OAZL 5E6ZA 1S5HA 1Z5LB 3WLBB 1DEDA 1AGDB 4IHOB 1FFOB 1KLUA 4P9ML 5ANMB 2Y5TA 3VRLF 4EI5B 3S88H 4JAMA 2GFBB 2X70B 3RGVC 2VAAB 4UV7L 2BNQA 1C5BH 4M3JA 3A0OA 3HNTL 3Q5OA 3VFOB 1A6AB 1JHKH 1U95B 1H0DA 5IMMB 2OZ4H 3SJVD 1EXUA 1KYOK 4PY8J 5F89A 3U7YH 5I1JL 1JNLH 4ZUTB 3RL1B 3WXVH 2YD1A 5DD0L 1A1MB 4ZFGL 1OGAD 4NWTH 3BXNB 1NGWA 3LVEA 4YXLL 3V6OA 1XR8A 2OK0H 2CUHA 3NA9L 5CJQL 1A6ZB 1IC1A 1WC7B 2VZ3A 3LB6D 5HVWA 4NGHL 5B3JF 4Z7QE 25C8H 2XTJC 4CKVX 1ORSB 1WSST 2VDML 3BP6B 5I0DA 1N0LA 2W0KA 2R56L 1QYGL 4AM0B 2QR0B 1P7QD 5CD3B 1F4WL 3LKOB 4NHCL 5ENWB 3SDDB 3MRHB 4KV5E 1WTLA 3MA9L 3Q2CA 1GGBH 2VSCA 3NIFF 5I1DB 1Z9OA 2EDXA 4JVWA 3O3BA 3MUZ1 3BWAA 3LKPA 4CJ0A 3QULA 2N7BA 5INDA 4Y5VB 1TVBB 4KRPD 5DRZA 5C0AB 1F11A 1KACB 1UACH 1U92A 4OIBA 1BZQK 2YSSB 4ETYA 1XF1A 1RVFH 3I02A 4U3CA 1I8IA 5E1AB 4R4FH 1V05A 4XHJD 3O4LE 1MOEA 1AIFA 3T2PA 4FQXC 4OZ4A 5FHBH 4CN1A 2FJFB 3CFJB 3C6LB 4G8GA 1NEUA 3U6RB 4PJ7E 1X7QB 1Z9LA 5HYEA 3SKUD 1A9BB 1JF6A 4WTZA 5DVNA 3OKLA 1N7ML 4YFLI 5EZOL 4XXDB 3KXFE 5EWIH 3GMPA 3E8UH 4WI3A 1LK2B 4L8CB 1T7XA 4DN3H 4NYLB 4JHWH 4XNMA 2CKBL 3K7UA 3MLRL 1CQKA 2E27L 3UX9B 3VG9C 1LE5B 4P48A 1ZVHA 3NZ8A 1I8MA 1WAAA 5JDSB 9CGTA 3FQRB 3IAPA 3HNVL 4GKSB 5ELIA 5D2NC 5ACZB 4R7NB 1T1ZB 5DT1H 1I3UA 1CICC 5BRZE 1VENA 1ACYL 4EXPX 1A14H 4P2QE 5F9JA 3QEHA 5INCB 3DURA 4PRPD 4L3CB 4QRPA 1QSFE 3N85H 4N8VA 1MY7A 4MDJA 1NFDF 3VFGH 3QUZC 1I9EA 4XI5D 4DCQA 4TPRH 3E6HA 1T04B 3VXPB 1C7SA 5FUZH 2BSED 3LS5L 3P3YA 3BT2L 4QKXB 3WFCH 2AXGB 3T3PF 5CEZH 1NCWL 4HPYH 4ALAL 2VXVH 3HB3D 3VD7A 1INDL 3R06B 5E2WL 4NM8L 1C5CL 2VLJE 2VLRE 3AY4A 1IT9L 4YDVB 2XTJE 2WY3A 1A1NA 2W07A 5EU3A 4NQDA 2YUZA 2Y72A 1J10A 5F9WB 4JPIB 3M1BB 3H7BB 3ARGC 5LQBH 1FNSH 1JMXA 1PBYA 4XWGL 1Q9OA 3BVNB 3O41B 5E2TH 2D7TH 3RWJA 1DQQA 3PWNA 2ZP0T 4PIRF 3H6JA 5F7YC 1WFTA 2JJSA 1QA9A 3DX6B 3QDGD 1FFNB 1JPST 3T4YB 2UWEE 4KKLD 3E3QA 5DVLA 3A6BH 5IVNA 4NFBA 2IGFH 2V2WB 4JZJA 3RA7L 2IBGA 4WUUD 5T33L 1MRFH 3ALWA 2CK0H 1IGIL 4IOFC 2J8UE 3E1F1 4JFFB 4Y8DC 5HYFA 2NXZC 5D7SL 3MRDB 4YNYA 4OLVL 4NZJA 2XQYK 1MCIA 4OZHF 2NY1B 1T1YB 2BFVH 4M7LH 4RZCA 4ZXBC 2YXMA 3EYSH 3Q48A 4MNHB 3V4UL 4ODBD 3GMRB 4HLZG 5EOQH 3FT4B 2Y5EA 5JW3L 1WT5C 1KSRA 4ISVB 1AGBB 1AGFB 3DOSA 2H32B 4JHZA 3X3GL 1BZ7B 4U33A 2G60H 3PQYA 3MRBB 2XWJB 4KKCC 4KTDL 5HTSA 5D2NE 1OW0A 4QLRA 1T7VA 2XZQH 3BP7A 5T1MA 1ZHBA 3PNWA 1OAXL 4NWUL 4PJXA 2PCPB 3T77B 4P2RA 3RWEB 1VDGA 4PGDA 4LMQE 5FOBA 5DD5L 4XZUB 1BX2A 3AREB 3GJEA 3DWTA 4X4ME 2YUWA 1Q0YL 2YBRA 1DBMH 3P9WB 1HSBA 3VFPA 1BD2E 1DE4B 3EYFB 5E2UL 2GIYA 4W81A 3D0VA 4PJ7B 4DOHE 3PWJB 3WO3B 1HDMB 1QRNE 5LAXA 3DSFL 4CGTA 3ZKNC 3BUYA 4G43B 4FABH 4B5EA 3QCVH 2X9YA 5FYLE 5GGVY 2IANA 4N9OB 2BDNH 3SDAB 2F58H 4OLZH 4X6DE 2E6QA 5EOCL 3GGWB 3QIBB 1CVRA 3BP4B 3V0WH 4Q7DA 1K2DA 2X4QB 3RI5K 2WLZA 4LSPL 4OFDA 2R1YA 4KK5D 5F1IA 1FO0H 3BDBA 3IS1X 4KDTA 1WWAX 4ZFOA 1NL0H 1R3LA 3PHOB 1OVZA 2CXKA 3RUGE 2BVOA 2IMMA 2HKHL 4QOKD 4P2QB 1ZHKA 3JTSA 1FNEB 3TM6A 4FFZH 1CD1A 3RGVB 2A6IB 1FYHB 1QSFB 5FHAH 2X4OB 2R69H 4JHBA 3WIHA 5IB3A 2R0ZL 4MAYD 1SYVB 4PS4L 1HKLL 4OTXH 4HUKB 4IOSD 5J8OA 4QHUA 1TVDA 3V4PL 4JFQB 3OR6A 4JRYB 3DGGA 3IETB 1HI6A 4KMQA 4J8RA 4PJFE 2F9BT 4XPFH 5DMJB 1F4YL 1NC2B 1EK3A 1YPZA 1S9XB 1DQJB 1CDJA 2VLJB 4F57H 2VLRB 3FN0H 4M8QB 5DK0A 2XTJB 5B38G 1RHFA 4JCMA 3F7VB 2LFGA 2QQNL 3TNMA 2Y6SC 1DDHA 1FDLH 2Y5TB 2NY3C 1RSFA 3L7FA 1S5IL 3JWNC 3U9PH 1ZA6B 2BNQB 5HBBA 4Y7MA 5CSGA 4S1QH 1FGNH 2IF7A 1LO5A 2E6JA 1C5DB 5IBUB 1PYWB 4UBDC 5KJRL 1CIUA 2UWEB 4U6XA 1JGUH 4LPYA 5DRXB 4EDWH 5ESQA 1ZANH 1KCVL 3GMNB 1JYVA 2JIXB 3GI8H 2H41A 3JBG7 3F7QA 4Z7VA 2BY0A 1U3YA 2OR9H 3QPXH 3EDDA 1CBVH 3DX8A 5HGBA 2J8UB 1NDGB 4NHUA 1B0WA 1YNKH 5L7XH 5MENA 1JWSB 4FQXB 1T1XB 5IEHB 4P5KB 4PBWD 4MS8A 1CDBA 4JG0L 3B2VL 1A8JH 3FL7A 3O0RL 4MXQD 1P53A 4FA8A 2Z92B 3TJHC 5HHMA 5EOTB 1YEGH 3D5OF 5TDPA 3VFMB 4Y2DC 1G0YR 2GI7A 4LLUA 3VG9B 4LKCB 2F53E 3O3BB 5J1AB 4K3HA 2VDPL 4YAQA 5D2NB 2O5XL 3ZKXC 1IGTB 5DRZB 3KPOA 2DYPB 4GRMA 4JPKH 1U92B 2MCPH 4LCYB 1CICB 2HP4A 4Y4FA 2HRPL 2Y07L 1A22B 1MJ8H 4XVSH 5L88H 5F3BA 4ZTPL 3QQ3A 1NBVL 1OQXA 4YHML 3NVQA 4NT6A 1IM3A 5H94B 5TE6L 1U93B 3LPFA 1M7IB 1YY9D 3OKKA 1YMHA 2OI9A 3QHZH 2ZCKH 3UMTA 1ZT7A 1H3UA 5JXEC 1BD2B 1D5ZB 4JFYA 3X11A 1D9KD 3H9HA 4PYHA 4DOHB 2EDHA 3JUZA 2VL5B 1QRNB 4JRXA 5CJXA 1CFTA 1EJOL 4R4ND 4FTVA 4O9HH 2YPVH 3V0VB 4NC1C 3IFPA 4KDVA 4EUPG 4LHUA 1KELH 1NCAL 3BO8A 3BHBB 3IKCB 4X6DB 1H8SA 1NCDL 1UYWH 5FCSH 4TTGA 3LKNA 5LGJB 2VLKA 3MPCA 1S9VA 2FHCA 4J3XA 5JA9A 3TLRA 4HMEA 2NW3A 5IFJA 2DQIL 3U0TA 4ZUWB 2Z93A 1CT8A 3ARGB 3RUGB 2ZCHH 4LSSL 5GS0L 1MELA 5GISH 3QEHB 4YHZL 4HF5H 1MVFA 3SE4C 3RY4A 5DFVC 4NC0B 3F5WB 2ESVD 1LDPH 4MD0B 5EORH 4G80A 1NQBA 5I75B 5FYJL 1K5NB 1YEHL 4AH2A 2CLRB 5FF6A 2F74A 4PJEF 5D7JA 5BMFL 1F58L 5TDNA 4XMKH 4X6CA 1N6QL 4GXUN 4HGWA 1AI1L 2C1PA 5IWLC 3I50H 3MLPA 3U0PA 4WWID 3PWUB 3KPTA 3ARRA 5DYOB 2AK4A 3O3EA 4E42B 5BVJA 4D3CH 1XIWA 2QJDA 3MACL 5E2VH 1ZEAH 1ZTXH 3IFOB 1E4XL 3HZVA 5C0CE 1UGNA 1KIQA 3SDCA 2NXZB 3U79A 3ZT7A 3AS0A 5CUSH 4JPVL 4JO2L 3OKDB 5EU3B 4NQDB 5J9PB 2GK2A 5EDXA 4IIQC 3STLB 3T2OA 1XF4A 1FNGA 1ZLSL 1UJ3A 5HD8C 5K9KA 2O5YL 2XI9A 2V2XB 4M5ZH 4XBGB 5CSBA 3TESA 1FVDB 1X4XA 1CLZL 4XP5L 3BKJL 4DGVH 3MJ9H 1ES0A 4F7PB 5JHDA 1YEFL 2Q3AA 5I19L 3WKNA 5FYKL 5C1MB 4JZJB 3OMZA 1I3RB 3LH2L 3QCUL 4XPTH 3LN4A 1MCFA 3GMMB 4F8QA 2GJZA 3WFHB 1T66C 4WFGD 2I26N 5T5FH 4HWBH 5C92A 2VDNL 3UTZA 3F12A 4JFPB 2I9LB 4H20L 2W65B 3PDGA 2B1AL 1ZLUH 1A6UL 1BECA 4PRHE 5D96C 5F7WC 1FAIH 5HGDB 2AJYH 3EGSB 1KCSL 5KG9B 5CS7A 1QEWA 1N26A 4L1HA 4MZ2A 5IMLA 4ZYKB 3HG1B 3OAZH 5DMKA 1DQMH 3U4BL 3RIAK 2R2CA 4NC1E 1FCCA 3UYRL 1EAPA 1SBBA 5E6YA 3T8XB 2F53B 4QGYA 5CILH 3MRPB 3VG0H 5IFAL 3S8WA 5IB5B 1DBKL 4QXUH 5TDOB 1NMBL 1ZHBB 1UM6L 1YNTB 3ARYA 1H15B 2I27N 2DD8L 1A9EA 4DTGL 1YUHA 1M05A 4Y1AE 4P46A 1PX4A 5F1SA 3GJFH 2DIBA 4OAWA 1LWRA 1QKZH 2PNDA 4MA3B 1A7OH 1FNAA 3L7EA 2BCKB 1F6AB 4RAUA 3MJGX 1RZJL 4MD5A 4WUKH 3D6GA 2RIKA 4PP8C 1D7FA 3AM8A 4G8IA 3HNSH 5LAXB 4HSQA 4W70A 2ZG1A 3ROOA 5C0FB 4OSUH 3BZ4B 2XPGA 4XNXL 3T0EA 1CFQA 1KEGH 2DLHA 4PRDA 3DYPA 4XNQA 3WIIL 4KK8D 2HYMA 4KJWC 4RMWA 3N9GL 1M1SA 1KNOB 1UM5L 1UM4H 4HH9B 5E5RB 1I7ZB 2NY3B 1XGQA 2E9IA 3V2AR 3CX5J 1P7HL 3OQ3B 3FRUB 3QI9A 4I3SL 3BGAA 3NA4A 5C2UB 3ZKMD 1EMTL 1CFSA 2Z91A 2CXGA 3IS0X 3C9NA 5ITFB 4L3EA 4C83A 4WTXA 4A6YA 1MAJA 4LSTL 4XCYB 1AD0A 3RDTC 3QQNA 3V7AE 3WKMH 3JWOC 2CO7B 3C5ZA 3GM0A 3TIEB 3MNWA 3NFPA 5IMKA 1RPQA 4H1LH 5GIRA 3ZSSA 1NKOA 4JZOA 1IGMH 3X13B 1TCRB 1JF5A 1YEKH 1W72H 4GS7C 5I1HL 5C0CB 1HH6A 4XBPA 1PX3A 1A0QL 1AO7E 5BS0D 3GSUB 3VWKA 1K8IA 2EZ0D 4YBQD 4ENED 1FJ1B 3TNMB 4HIEA 1DDHB 2OL3H 3HZKA 1QACA 1CE6A 3DTXB 2G75A 2NY4C 5T3XL 3BJ91 3KS0H 2ICWI 4Y2DB 3GSVB 4OCXL 4XMLH 4CVUA 2QQLL 2Q8AH 1DANT 1KCGC 4HWUA 2GW5A 1T4KA 1LO5B 4PLOB 1GHFL 2BVQA 4RX4D 2EDBA 3IKKA 5BOPA 3ZKXB 5D5ME 2XA8L 1VACA 3M8OL 2ZSWA 1S8DA 5MEQB 1VHPA 3VRLE 4JDTL 1RMFH 4CNIB 5F7LB 1J5OH 5EC1B 4NKOA 3KYMA 1ITBB 2K9UA 1CVSC 2A6JA 3FHQA 5IK3B 2IQAB 5ADPL 3K46A 4N0FA 4DZBB 2ZZUT 2BVUA 3N1PC 1GSMA 1SY6A 1NANI 3LN9A 3V6FA 4UIKH 3BW9B 5H37G 2YA1A 4G9DA 1H3VA 3DARA 1G7PA 2NTFA 4GW1B 4U2ZA 1KJVB 4HUUB 2WQRA 5I1EL 3QXWA 4LLUB 4HJJL 4UNVA 5B3JE 4M1CC 4YHPA 3L5HA 3SO3C 3R1GL 1BVKA 4YAQB 1PSKH 4R6UA 4O58H 1CR9L 3MV7E 2J4WL 2NYYC 3FB8B 4J1UA 5DURD 1BOYA 1BFSA 3IFNH 3REWB 4NOFA 5F3BB 1RZ7L 4M5YH 2SEBA 3QIUC 4QHKI 4Y1AB 2AEPL 1NCBH 4GAGH 4PDCE 1OTSC 5IF0B 3NIFE 2DI9A 3OPZL 1XCTA 4RQQA 5C09D 3BGFC 1D5BA 1WZ1L 4LLVA 1C08B 1N64L 3KPRE 2VH5L 1YN6A 1URLA 4ZQKB 4ZAKA 2DLEA 3TH4T 4RMUA 1CFTB 3HRZA 3IJYB 2QADC 2DQTH 3SDXF 3TT1L 2YPLE 2NY2D 3MGOB 2EDFA 3PP3K 3Q6FB 1NDMB 2W0FA 3HFMH 4U6HA 1I7TB 3WD5H 2BSRA 4JFOA 5J0BA 3TFKA 1T22B 4FQCH 5GGSB 1EUTA 4OLUH 2PTVA 2V2TB 1S9VB 4JLRA 4IRJD 4IIQB 2V7HB 1JGVH 1HXYA 3VWJA 1DLFL 2XFXA 4K23L 5KSBF 2XZAL 1RAMA 2EXYD 3JTTB 1RZFH 5DLML 4LCIL 1I9IH 3AS3A 5IVZB 1SYSB 1J1PH 4YFLF 5FIEA 5HY9A 1INEH 3OKEB 2GUOA 4HHAB 3T0DA 3O3EB 1CLYL 5KS9F 4CU8A 5HI3D 1KJ2A 3KPNB 3K2UH 3FZUD 5JIPA 3TBWA 1NFDE 4ESKA 1KJMA 4N0YH 1TITA 1TMCB 3ESUF 3SDCB 3HI6L 1WTGT 5D96B 2GAZA 2ED9A 3QXTA 3GNML 1DL7L 1HHIB 1AO7B 1XF4B 4Z18A 4GG6F 2AQ3A 3ULUL 3ARVA 4I48A 3P4LA 3DXAE 3MNZA 3T3PE 1RHHA 4GBXB 3V7MA 5C8JA 3EHBC 4R2GD 1FZOB 4G7VL 4FQQA 4CVZB 5I76B 5L2KE 4ZFZA 2AVGA 1UKQA 2HJLB 3VFTA 2VRAA 5D5MB 2R2HB 3EYUH 1IAIH 4KI5C 4AEHH 5E8OA 5IESH 2R4SH 4JM2A 2OXGA 4ONOA 1DQTA 3ME0A 1JNNL 4D0DB 3TVMC 5FGBA 2D7OA 4QTHB 1E27A 3JV4B 5F96H 4MNQE 2CGRH 1CL7I 4FQ2L 1MJJB 3MA7A 3MXWL 1J05B 4RGNC 1UADC 2I9TA 5T5NG 3UPRA 4CMMA 1NGXA 5C6PB 5IW6A 2BY1A 5DEFA 4UU9B 4NQVB 3BZFB 4DJMA 4OJFH 4XB8A 4OM0H 4PTTA 3GBNH 5DHYB 1RJCA 3EYOA 5EO9B 4OZHE 3MV7B 1S78D 1XF3A 5C08D 5ETUA 1OT2A 1S7WA 2AXFB 3O9WC 1FIGL 2CRYA 4M61A 5IIEB 1EEYB 4LCCA 5KVDL 5EG6C 1XGYH 1XR9B 3F65A 2EYRA 2F5AL 4H8WH 3KPQA 4YO0B 5EZIL 5DSCB 1ZGLA 3UJJH 4FQJL 1RK1A 5DK2A 3MOBH 2VXTH 3FJTA 4NQED 3PDOB 2FR4A 2JKXA 4NKQB 1BIIB 2DJUA 3RDTB 4WW1A 5LXGH 5EBLB 1I7UA 2Z9TA 3LQAC 5BW7C 1CIDA 2YPLB 2P8LA 4Y4KD 4CU6A 2P5EA 4YR6A 2EKJA 4GS7B 1QSVA 1YEIL 3QUMA 5SWZE 1ZHLA 4Z95L 1K9TA 2C3VA 2VXUH 1GPOL 4BFGA 3GSNA 2P5WB 1I1FB 2X1WL 4NO2B 1YJDL 2NY4B 3LB6C 5HDLA 3DUUB 2B2XH 1A6VL 5FKAA 5MI0C 4X7TA 4EEEA 4HT1H 3OKOA 1BP3B 3MUJA 1VEMA 3WFEL 3OJ2C 2XKSA 3UC0H 3QUYD 5FA4B 1DEEB 5HYSG 3MRCB 4YDJB 4OZIF 2HFFB 3G5VA 4X5WB 3DROA 1N4XL 2NZIA 4M62H 4EKXA 3MC0A 1RJYA 2GSIA 3GSWB 2A1WH 4OZFG 4NUJA 1HHGB 1NFDB 4KRPC 3VXSE 4JDZB 4RWYL 1HH6B 5B8CC 1F02I 2VKWA 1HZHH 3I6KB 3MYZA 4TNWK 5JZ7D 4R26L 2UY6A 4RGNE 4LLMA 5JMRA 3O4LA 3FOMB 3Q1SL 4XHJC 2EXWD 3DV4B 1TLKA 4FZ8L 3J8F7 3MNVB 1F4XH 1VPOL 3DXAB 4JN1L 3W9EA 5L2JB 2XY1A 3UJIH 4QYOA 5ID1A 3KXFA 3U30C 3OKYA 2NY6C 1T5XB 3DI3B 4NO0B 4RBPK 3SO3B 5L2KB 5IV2A 4GUPB 1OARH 4WHCA 4C4KO 3OB0K 1XZ0A 1OB1B 1HH9A 1N5AB 3OKNA 3WUWA 1R3HB 3UTTD 2B4CC 3DV6B 5J4MA 1KEMH 1E6JH 1Q9KB 1U36A 4RFNC 3QIUB 3JV6B 3P9LB 4JE4B 1V7NL 4QTIL 4DVRL 3BGMB 4NM4L 1NCCL 4M6MH 3EJZC 2A6JB 3PL6A 4M6NH 1BPVA 1IEHA 1V3JA 4PP2B 3TIDB 3VW3H 4PYGA 5MP6L 3GUTA 5IR1B 3MREA 1ED3B 3BGFB 5CLTA 3QA3A 3EO0A 1KUMA 4S2SA 4U05A 1I8LA 1N5YL 1NBZB 2YUXA 3VGFA 2NR6D 2QADB 3V5HA 5JOFB 4MA1C 5D93B 5E08H 4XI5C 4WGVB 6CGTA 4YPGA 4ELMF 2EEBA 12E8L 4S0TD 3WFDL 3O6FD 4L4VA 2IEPA 4DWHA 1CLCA 4OZHB 1SJHA 4Q0XH 4F7TA 1CGSH 5ID0A 1OGAE 3QO0A 4OGXL 4OLYH 1CQYA 1WIUA 1WICA 2Y4SA 2H6PA 3HB3C 3RL2A 2M26A 1BJ1J 3SGEH 5DRNB 1VKXB 3VXRE 3NCJL 1YQVL 5IHLB 2JTDA 4EUPH 1JK8A 2EECA 1CK0H 1R5VA 1VCAA 4LLVB 3SKMB 1JPSH 4GXVL 1ZGLP 4ORGB 4ODWB 3ZHKA 3H2WA 3P0GB 2WBJD 4K9EC 3HRZB 3MLSL 1ZT1A 5I8EA 5T1KD 1HOCA 5EZLB 3O2DL 1DBAH 1YEDA 4X6BA 1AXTL 32C2B 3EZJB 4MJ2A 3U4EA 3DJ9A 3EOTH 3CLFL 5T3ZL 3I2CL 2NW2A 5SWZB 1UWGL 3VXUD 4KJYB 4NBXB 4ZNEE 5JQHC 3JWOL 1RZ8A 1PVHA 5FO7A 5B4MD 3ARSA 4OF8A 4ZUVA 1D5IH 4CN6A 5FM5O 1M6OB 4ONGL 3CCHA 4XAWL 2X9XA 4ZMAT 4PJCA 5FKPA 1KPUA 4E9LA 4EIGB 1MCCA 1NGZB 2Z31A 4GKZA 3RWCB 5C0GA 4G6JH 2CLVA 3FT2A 3GIZL 3LD8C 1C16B 4RAVA 2EH8H 4LIQH 4HWZB 5CZXD 3BPCA 2XKUA 4Y89A 4YBHA 1KJMB 2ARJA 3AU1B 2FH8A 1A3LH 1D5XA 4TUKL 5ERWA 4PJEE 5FUOL 4A6YL 1FL5B 3VI3F 4KY1L 4K94C 2PO6D 4NDMA 2I25N 2IQ9H 3DRTA 3TPUA 2FLBT 3WL9A 4RGNB 4JQIL 4PRPE 3OX8B 5KZCB 1B90A 1U42A 3QUZA 1QLRB 4G6KL 4UUJB 2FB4L 4P23B 4LFHG 1FPTL 3CFIC 3MZTA 4EBQL 4V1DD 2CDEB 2AJXH 4ELKB 5T1DL 1CGTA 3MJ8B 3BJLA 1DBBH 4AENB 1AC0A 4NO3A 4WU7A 35C8H 2R2EA 2AJVH 3AS1A 4KMLB 4O4YH 2GJ6A 3KVQA 3O9WB 5E8OB 4KAQL 1SM3L 3QXUA 4KMTH 3S4SG 3U2SA 2OTUA 4JGMA 4G5ZH 4NKMA 3QFJD 1CI5A 4PPTA 3CPLA 4KK5C 4AEEA 3SY0A 2F8OA 2AABH 1BQLL 1KPVB 3OXSA 3QB7C 1TQCB 1L0XA 1UG9A 3G9AB 5GRUL 2I9TB 3LEVH 1AJ7H 4MCZA 1GZPB 4HXBL 3QDGE 4JJ5A 5JORA 4RWHA 3MFGB 4XBEH 2EYSB 2EDWA 4PJBF 1A7PH 3NIGF 4MAYC 3PHQA 4P49A 5DS8B 4LLWB 2DKSA 4HKBB 4OCYH 3SJVB 4OB5L 1WF5A 5E8PB 5TFSH 1C1EL 2B39A 1QSED 4PJFA 1OGAB 3P4MA 4UAOC 5DUPL 1DN0B 1H5BC 1NMAL 4I1NB 2C5DC 4R4BA 4OLEA 3L3IB 1BVZA 4NJ9L 4K3DH 5MI0B 1I9JL 3W39A 4PRNB 5JPNB 5ICZA 4ZXBA 1U0QA 3MRFA 1CGYA 3PWVA 3ORJA 5J57B 4N0CC 5K9QI 3W81A 3QG7L 15C8H 1P7QB 1AXSA 2VLLB 4JZNA 4P2OC 1BBDL 3ZYOA 2ARJQ 2IBZX 3FKUS 4GRWF 3HR5B 3CFEB 2ED7A 4U1MB 3RVXD 1R24A 2JJWA 1WISA 4X99A 1JUFA 2XA3A 5HJ3A 5EA0H 2VDOL 3B9AA 2H1PH 4U1HB 1IGYA 1RUQL 3VFNB 1XGRA 3GIVB 4O00A 2A38A 4G3YL 4KRPB 1XH3B 1MCSA 2AJZB 3DI2B 4NQSA 5B8CB 1ZVSB 2JCCA 3NBNA 3S3PA 4OFKA 2OZ4A 3FO1A 5D71H 4AIXA 5KVMC 3GSNB 4X9FA 1EO8L 3NCEB 3VA6A 3ARPA 1I1RA 3RU8H 5DHXB 4X7TB 3T09A 4P99A 1ND0B 5C6TH 4X6EA 5DD1H 3QNXA 3ZDYF 1S9WA 3CNKA 4KVNH 2H2SD 5E6ID 1RUAL 3RRQA 4ETQB 3RY5A 2NY6B 4R3SA 4KHXH 2HFTA 4MXQC 1FL3A 3MCLH 4WWKD 4NNXB 1Q72H 4FFVC 1UXWB 2MNUA 2QV2A 2KKQA 4LBEB 4BZ2H 3HA0A 4RFNB 5IW3A 2EIZA 5D7LD 5I0ZA 1A7QL 5ILTH 1HHJA 3GB7A 2IALB 3IDIB 2DDQL 1TJGL 1KC5H 1U58B 1U8JB 4PGEA 3OL2A 4HK0B 3PP4L 3BQUD 4PP1D 1NFIB 1U6AL 5CHNB 3U1SL 5I16B 2ARWA 1QLFB 4PRPB 3ARUA 1WEJL 2W9DH 1YY9C 3B9KD 2HWZL 3TO2A 2ESVA 2IPUK 1A6TA 3LV3B 2J8OA 4UT6L 3DHJA 1D9KC 2PKDA 5B39G 4XVJL 2DRUA 3RHWK 4ZSOE 4F9LA 3GO1H 5I66A 3NABH 2BERA 4R4NC 1M71B 3MV9D 3GDBA 2KH2B 2BOCB 5K9JH 4PRAA 3CMOL 5DJ2B 4P4KD 1S7SB 4X9BA 5FK9A 3L3DA 3V5KB 2ZPKH 2EIBA 2Q6WA 1T3FB 1KB5H 2EICA 2AJSL 3VXOA 3P77A 1XMWA 3LEYH 3MREB 2VAJA 2IAMD 4NFDA 1U91B 2HG5B 1D5MB 2HFGL 3OJMB 5J1SC 4TUJA 1T20B 1NCUA 3QZWG 2JK5A 4OD2B 3GM8A 3ZHLA 2H26B 1FSKC 3HUJA 3QDGB 5JUEH 1IAOB 1RFDL 1XCQB 5ALCL 2X1PA 3EUUA 4HJGB 1BBJB 1P4IH 5JOPE 2J88L 1JGLH 4XRCB 4WUUB 1SJHB 4YWGH 3DETC 4F7TB 5ID0B 2EH7H 1JYWA 4TVPD 2G9HA 3HI5H 4HUWA 2BHZA 4GMSL 2H6PB 5FGRA 2DN7A 1H3TA 4IRZL 5FV2A 2EE6A 1I7RA 3I3EA 3VFVA 2ZG2A 3TZVD 1JPFB 2I5YL 4UQ3A 3ILPB 1HINH 3D3VA 5DO2D 5TQ0H 4OF0A 3IDJB 2YEZB 5JW4N 1PY9A 3LD8B 2B20A 4BZ1H 1DBJL 4PJAA 5JHLL 5ESVB 3B9VA 4P59H 2CH8A 3NFSH 1O0VA 4IMKA 1ZA3A 1T80A 2FX8H 4L9DA 2ID5A 4RFOL 3TJEH 3WS3A 5KSVB 3D69B 1NAMB 3MRKA 3JWDH 5KSUA 4TQEH 5CCKH 5E70A 4V3DB 5I8CA 5DRWB 3SDXE 4MCYB 2LV4A 4F33A 4PRHA 4RFEB 1S7QB 4GKNA 2D4DA 4LCWE 2D7NA 2ENYA 3KPPB 4N9GA 2AGJL 4N68A 3KPSD 3QUML 1IM9A 3LKSB 1DTUA 4LEXL 2OBGA 4M48L 5SWSD 3BKMH 2VZSA 3SHSA 3P0YH 3GSNL 1YY8A 4EIZC 2RFXB 5EO1A 5KSBE 3MCKA 1QR1A 1WITA 1REIA 1LO2L 1X5LA 1E4XI 1S7XB 4ZO6A 5B38B 5E1HB 3PJSA 4PJ8D 2F19L 4OZGA 3LMJH 5I1GL 1IKFL 5ADOH 5ESAA 3JVGC 2RQ8A 4X7EC 4Y2OA 5AEAA 3RAJL 2QQKL 2A74B 5JLZA 2B4CL 3VRIB 4QOKB 3T4AB 2E3VA 5GJSL 3QRGL 4P57B 2FWOA 3LHPH 5KS9E 3IFLL 2QBWA 1X6NA 3DBXA 1K8DB 2HTLD 4XP4L 5F21B 1C12B 1OLZA 4URTB 3H8NA 1GGIL 4MAYB 1LEGB 3IF1A 1B0GB 3GKWH 4R7DB 4XPHL 3VFSA 1R5IA 4LSVH 3HPJB 3H9SE 4NO3B 4WY7L 4ZSOB 1BOGA 1IQDA 5D6CA 4GG6E 2X1XR 4U2YA 4UAOB 1OWRM 3O2VH 1H5BB 1EAJA 3CVIH 4YIQA 2P43B 3F62A 3GKZA 5EZJA 4YQXL 3O3DB 1CGXA 1WV7T 2F8VA 3KYOA 4QHLB 3WIFB 2C26A 3V52H 4KK8C 2EEAA 1OWWA