2JCCA

Ah3 recognition of mutant hla-a2 w167a
Total Genus 73
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
73
sequence length
275
structure length
275
Chain Sequence
GSHSMRYFFTSVSRPGRGEPRFIAVGYVDDTQFVRFDSDAASQRMEPRAPWIEQEGPEYWDGETRKVKAHSQTHRVDLGTLRGYYNQSEAGSHTVQRMYGCDVGSDWRFLRGYHQYAYDGKDYIALKEDLRSWTAADMAAQTTKHKWEAAHVAEQLRAYLEGTCVEALRRYLENGKETLQRTDAPKTHMTHHAVSDHEATLRCWALSFYPAEITLTWQRDGEDQTQDTELVETRPAGDGTFQKWAAVVVPSGQEQRYTCHVQHEGLPKPLTLRWE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system
molecule keywords HLA CLASS I HISTOCOMPATIBILITY ANTIGEN, A-2 ALPHA CHAIN
publication title Single Mhc Mutation Eliminates Enthalpy Associated with T Cell Receptor Binding.
pubmed doi rcsb
source organism Homo sapiens
total genus 73
structure length 275
sequence length 275
chains with identical sequence H
ec nomenclature
pdb deposition date 2006-12-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00129 MHC_I Class I Histocompatibility antigen, domains alpha 1 and 2
A PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2jccA02
3.30.500.10 Alpha Beta 2-Layer Sandwich Murine Class I Major Histocompatibility Complex, H2-DB; Chain A, domain 1 MHC class I-like antigen recognition-like 2jccA01
1DLFL 3SKJH 4M9OA 5LGHH 3TO4C 3F8UB 4CNIB 2PXYC 5DJXA 3DBXB 4NQDA 4UILL 2VZ3A 4V3DB 3IXTB 1EEZA 3TBYB 1EX0A 5ANME 2C1OB 3QUZA 1NCTA 4FFWD 2NY2C 5B39B 5L2JB 3E2HA 1D6EA 4R96A 1ES0B 4KJQD 2EH8H 1DUZA 4Z7UE 2E7LC 5TQ0H 2Y5TA 3T8XB 5KSBA 1EHXA 1CG9A 2P4AB 1KBGL 4DVRH 3HCVB 2YEZB 4GXUN 3VW3L 2WBKA 5IB1A 4QXWA 3OXRA 1MSPA 1FSKC 1RK1B 4K3HA 1GOGA 3QNYA 2SEBB 1WIUA 5C0FB 5D5MF 3GIZH 1I1CA 3WE6B 4U7KA 5FO7B 4HMDA 4PRAB 4J7RA 5LGKA 2BSED 5A2FA 4D2NA 4NKQB 3IDJB 1GIGH 1X7QB 4X99B 5T3ZH 3UPAA 1FFNA 2OP4L 2OCFD 3H9SE 2NY4D 4S2SB 3TO4B 2PXYB 1ZLUH 5KS9E 1NGXA 1OQXA 3IDXL 4KKLD 1ND0A 5FA3B 4PLOB 1X4YA 5E8OA 3S9DB 1KCUL 2NNAA 2V5YA 1OAQH 3KDMA 3T1WA 1MUJB 2NY2B 2IH1B 2HTLD 2VAAB 4HXBL 4XP6H 5TH2B 4NQVA 2XN9E 2F5BH 2IANE 3NA4A 3CPLB 4LGSB 2I9LB 4Z7NF 5CP3A 1KTDB 3MFGB 1E6JH 5HD8D 4X99A 4DZBA 1F13A 1AKJA 3OMZA 2YUZA 1BJ8A 2Y7QA 4QXTB 1FSKB 2NLJB 3IAQA 5HDOA 3NGBC 5EU5B 1AE6L 2PXYA 2AEPH 5CJ5A 4P3DA 2OR8A 5FA3A 4N1CA 4O2CB 1NUDA 3UYRL 3ILPA 4G6FB 1XGQB 3SY0A 3MZTA 4EUPA 4KGLA 2E7LA 1ZTXL 4PYHA 4F2MA 3KPNB 1BQHB 1QFWL 3EHBD 5CGYC 3SDCA 4XXDB 3P4MB 4LARL 3S35L 4UMGA 3BP7B 5JZ7D 1ZSDA 4CADB 1NH6A 3B5GA 3DGCR 2HLAB 3C6LC 2D7PA 4BZYA 5IWLC 1PG7L 4NBXB 1LEGA 3PHOB 2IMMA 4Q7DA 1EXUA 4O2CA 4QHMA 4R8WH 1T22A 1DQQB 2X4RB 3WNPA 5C0CE 2ED7A 4RBPH 9CGTA 4UDTA 4HUVA 2X4PA 3T4AA 4I3RH 5J4MA 1JJUA 5E56A 1N2RA 1BWMA 4Y2DD 2DOCA 5J1AB 4M00A 1UJTA 3LSOB 1CFSA 3S34H 4LCWB 3PHOA 4WDIB 4U1NB 2HKFL 3MUGB 4N8CH 4WEBH 5BMFH 1FJ1B 3PL6C 1VA9A 3C8HA 1H0DB 4DVBA 1NC2B 1X4ZA 3L3JA 4QCIB 3IS0X 2J6EA 1UWEL 4NUGH 4F37K 1F58L 2EYRB 1DQML 3NCMA 2IBGA 4PJHE 4UU9A 4Q6IC 3VFSB 5LAXA 3S4SA 3C6LB 4WIQA 1U95B 3DVNB 2ADIB 3TFKC 3T0ED 2W07A 4RGMC 1QVOB 4TVPL 5C09D 4MNQA 4UIKL 4B0MM 1JGDA 5I17A 3TM6A 4NQUA 5JUEH 4LDLB 4X7SL 3PGDB 4N0FB 3O6MH 3V4UH 4JFZH 5L2KE 4U1MB 2VL5B 1JYVA 4NHUB 2A6KA 4QCIA 3IF1B 3MV9A 4MD5B 3MLSH 1VADB 1L0XA 3OKEA 3L7EA 1DBJH 1F4WL 3R0NA 4MJ5B 2C9AA 1U95A 4H8WC 3DV4A 5DQDL 1KJMA 3H7LA 5F1KC 1BIIB 3H3PH 1IGJB 4J8RB 4XMKL 3RDTC 4FXKB 1YJDH 4KI5C 4Z7VE 1ORQB 4YGVB 4XPAL 4WRLA 1MCHA 5SWQA 5ACMA 1DBMH 1L6ZA 4PUBL 5GSRB 3PGDA 3GSQA 3GSVB 4N0FA 4WENB 4X83A 1JL8A 4TSBL 1LP9A 1C7SA 4PY7B 4PLJC 4U1MA 4NHUA 4Q6IB 1U8IB 4RMRA 1MH5B 4MD5A 1IKFH 5C0AE 3RIFF 5MEQA 5GZND 1K6QH 1HNFA 4MNHB 4RGMB 2MFNA 5DSCA 5IJVA 5TE7L 4K3JH 4BM7A 4Q97A 1N6QL 5D7LE 1ZT4A 5E9DA 1F97A 2N1KA 1O7SA 4U1LB 5E8DH 1BIIA 3PWNB 4J8RA 1R5IA 1A6WH 3P77A 3PL6A 2OBGA 4GRWB 4ORGB 5GS0C 4HBCH 3DXAD 5D71H 2WBJA 1AXSA 2Q8BH 5GSRA 5KSBF 4L1HA 2EC9T 4JM4H 4PY7A 4KROD 1KPRB 1MH5A 5HYFA 1TVBA 3IDMB 5IHUH 1MRFH 1LO3H 5AZ2H 3RDTB 4JJHA 4DGYH 5I1DB 2DQIL 4IRZH 4PJAE 3P0VH 3EFDL 4XPHH 2WV3A 1OTUD 3GMNB 5F1NB 4F3FB 4G9DA 1KB5H 1GRWA 3PDDA 4GJTB 2GUOB 5HI5C 1RSFA 3TBVB 3V2AR 1CDYA 3FQUB 3VXOB 2F54E 5KVGH 4LLVA 2BJMH 4OLZL 1RMFL 3IJHA 4HFWA 3MLUL 4OV6F 2J2ZA 2L7UA 4Y7MA 3OKDB 1G7LB 4MDJB 4NO2B 1TNMA 1NFKA 2X44D 2OXHA 4JRWA 4OF8A 4C56D 2NMSA 3TNNA 3EKCA 2Q7YB 3FRPG 4BH8B 3ZYOA 5KVFL 2IF7A 5GS0L 5FGBA 2V17H 5GGTH 2HT2D 5GRXG 2AVGA 3SE3A 3PGCA 2EDTA 2YD2A 3O2VL 3VDAA 3OR6B 1UXWB 3MBXH 2GUOA 2HFGH 4Y5YA 3FFCB 4NOBA 4M1GH 4YHIB 2YD4A 5HI3D 3SGKC 4YQXH 3VJ6B 4XPTH 1CBVH 1OAUH 1RIHL 4K7PL 3T65A 1T6VN 2A6DB 2AV1A 5E6YA 2C4FU 5A1AA 5IB3A 3BKCL 1G7LA 3OKDA 1CFBA 1FVCA 1BFOA 1W8NA 1JZ5A 1EDQA 1NL0L 1Z3GL 3SGJA 2AXFB 1KLGB 2AXGA 4A6YH 5HHQA 4QHNA 1DQLH 2P5EB 1NC4B 1QA9B 5EIIA 3GRWA 3QEGH 4LKXB 4M6OL 4KRNA 3CFBA 1U3HD 2DKMA 3WXWH 4X8JA 1DZBA 1RUPH 3MRMA 3QCVH 4B50A 3DHMA 4BFIB 1A64A 3EO0B 3WEXA 1CE6A 2BRRL 4HIXL 4XWGH 43CAB 1MF2L 2ZJSH 4I48A 2AXFA 1CYGA 1XGUB 3WS6A 1WQVT 2V5SA 1EEYA 3VD7A 3RGVB 3QDJE 5KG9A 2P5EA 5ESAB 4ZD3L 3BGMA 3Q5TA 4FQIL 5ADPL 3QXUA 1PKOA 2O61A 2H9GB 1U8KB 3MRHA 4PJIE 2LFGA 4L8BA 1J12A 2AKRA 5JXAL 1DSFH 2FZ3A 4F9LC 2I25N 3IJSB 4UOJA 4S10A 2AJYL 3AROA 4OCSL 3ALWA 4G9FB 4U1JA 4W4OC 3WSQH 3HNSH 5AEAA 5FYKE 3SHSA 5E8NB 1WFUA 3B43A 4UB0L 2D31A 4PJ5B 3I75B 3WHE0 1HHHB 3MLWH 1RZFL 3L1OH 3QFJD 2DQHL 2JF1A 2PN5A 4HULB 4PJ7E 1WVZA 4NDMA 1FNFA 3X3GH 3V7MA 3ZLQC 3OV6A 1MI5B 3R8BB 1QACA 2X2YA 4XBEL 1ODAA 1YZZA 1AGFA 1TJGL 4HUXB 4X4MA 4YHOH 5T1MB 5F9AC 5F9WC 1RIVL 5HHXH 3WXVH 3OZ9H 1YNTB 4K94C 3WD5L 3RWCA 3T2OA 3GK8H 3D87B 3OB0K 4LNVA 5GJSL 2GSGB 4GQPH 2Y23A 5BRZA 4G8IB 3T09A 4CN6A 1QHPA 1E0OB 2IQAB 5FECA 4HKJB 2CR6A 1LP9F 1J5OL 4ZSOB 1TJHL 1RVFL 1LHZA 3T0BA 1LD9A 2F53D 1CZ8H 5DHVH 4GBXD 5CCKL 4QY8B 3QXVA 5C08B 5T1MA 1C5BL 1WFOA 3MYZA 1J1PH 1FIGL 5DUML 1X44A 2OK0L 3DUUB 3LPGA 3E3QE 3EYUL 1HQ4A 4L4VB 4MYWB 4F9LA 1M7IB 4LHUA 3PHQB 2E7CA 1CFVH 1ZMYA 1NGZB 3LVEA 3FQTB 4JFOB 3R0MA 4W4OA 4GRLA 2P45B 5F9WB 4X4YA 4JO2L 5ERWB 1AQDA 1EHLH 4XAKE 4E0RB 3VFGL 3CLFL 4UZGA 5I16A 4QY8A 2FJFA 2Z35A 4RMVA 2VITB 1T20A 3REVB 5INDB 4K94L 3U4EB 2MOVA 4X9FA 3W5NA 5DA4A 1KC5L 2ADFL 4ZAKA 4I77L 2BERA 4LBEA 3O81A 2AK1L 2CO7B 1DTUA 1KJVA 4O2FA 1M7IA 3LV3A 4MCYA 4YPGA 3FT2A 4YBLB 2F19H 4JFOA 3QWRA 3OG6B 3EAKA 5J11C 4EQ2A 5IGXL 4OZIB 3MRLA 3NCEB 2B1HL 1QKZL 1UYWL 3BXNB 5BZDA 4KI5E 4NM4H 1DVFC 1IZKA 3L3HA 5D4QA 3QUXD 2VITA 5HGDB 5IBTL 1XGYL 1K9TA 4PRHD 4NJ9H 2R1XB 1C16B 5HI4D 4ODXB 3DSNA 3D5OF 3ARBA 4MNGE 1IM9B 2FLRT 3GUTB 5B38A 1KCKA 1M4KA 4LDEB 3P0YH 3MPCA 1QOKA 1CXLA 2BK8A 2D0GA 2XKNA 4N0UB 5IG7A 4ZTPH 5JHLL 4PTTB 3SDXA 1K85A 3HZVB 4JG1H 4UNVA 5H37H 2DD8L 4JHWL 4NZDA 3CZJA 5FHBL 3BE1L 1HINH 3HZMA 2V5TA 1I8LC 5J12C 2ADGA 2VLRE 3CLEH 4JCMA 3WMSA 1VPOH 2AJ3B 4M7KL 3BZ4B 3QQ4A 4JKPH 1RZGB 1MRDL 1T2QL 2R9HD 4KK8C 4YHPA 1AGDB 3ZYIA 4XMPH 5IEHA 1JRHH 1MQKH 1FFQA 1NMBL 5J11B 2KQMA 3FFCE 3ESUF 4HK0A 4FQHA 3GMLA 4EEEA 1DVFB 1EZVX 1A3LL 1DUYB 4PTTA 5HHMB 3BJLA 2R0KH 3ARFD 1F45A 3S7GA 2DQEL 2CRYA 2XXMB 1RV6X 5K59F 5GJTH 1A9EA 2XZQH 3B9VA 3M45A 1B0RA 3D18A 3IU3B 5EH1A 1NBZA 4S0SD 1CLCA 3V7AG 3AXLA 4JFEB 2YA2A 2YK1L 2DBJA 1Q8MA 4OD2B 1B6DA 3WNOA 5MHSE 2OZ4L 5DK2B 2DI7A 3QYCA 1Y0LB 2D7TH 4N5ED 5F71A 5J12B 4P5MB 1A6TB 2ZSVA 4P57B 5BVPH 3RIFK 4CL7A 4YDKL 1F2XK 2DLGA 2ZG1A 5TDOB 1XF3B 1BBDH 3ZTJH 4BA8A 5CGMA 4DUVA 4KKBD 5FHAL 3EOTH 1TMCA 2UYLB 3MJ9H 4I4WA 2YN3A 4PGJA 1VFUA 3WIHL 2DMKA 3JTSA 3B2UD 2ZCHL 4XCEB 5MP6H 2OZ4A 5ID1B 5BZWA 2BNRD 4N0YL 5CIPB 2OJEB 5EZOH 1L7IH 5JW4M 4RQQB 5BV7C 1P7QB 2VLKD 4JRYE 2XIDA 5FYLD 1PYWA 4L8DB 4QRUB 4HX1B 3TPUB 3BVNB 5DO2C 1A6AB 2EDEA 1A7NL 1ZA6A 3P2TA 4MS8C 4KAQL 4OM0H 3GKZA 4G9FE 3WIHA 4MWFA 3KLAA 4NO0D 2YWYA 4NQCD 4Y4HC 3STLB 1I8KB 4JFDE 2ZPKL 5JXEA 1PY9A 4QNPE 1MEXH 2QV2A 1GHFH 5CIPA 2OJEA 4PJ5E 1BEYH 2GJZA 1YEHL 3CVHB 1AD9B 2V5RA 1ORSA 1J1OH 1V5JA 3VG0L 4NQEB 4LU5L 2LVEA 1RURL 5E00B 3K7UA 1HHIB 3HE7C 2WP3T 4ZQKA 3CVHL 3HC4L 1SEBA 2XFXB 4ZFGH 1MI5E 3VGDA 3HUJB 2DI8A 4XVTH 1U8NB 1JNNL 1MPAH 3FT4A 5EA0H 2ARJB 3QDMA 3BRDA 3O8XD 1R3LA 2XZCH 1NBVH 2BXZA 1AJ7L 4HV8B 4HWUA 2IC2A 3MOQA 5BV7B 3DNKA 5KSAD 3I6LE 2BDNL 4HUUB 3S98A 1JVKA 2GJJA 4XVUC 5BV7L 4MQ7A 3T1FB 4Q74A 4IRJB 3LS4L 3MGTB 1RHFA 5CBAB 5ALCH 3KPRD 4WU7B 5EIVA 2ITCA 2V9RA 4YEFA 4JVWA 2FIKB 1MIEL 4Y4HB 3UTTB 3HUJA 3OAZH 3QR2A 2WUBL 4ZSOE 2YD9A 3DLQR 3OJ2C 4KGJA 1JMXA 1S9KC 3QH3B 2L4OA 2HJFA 4OZHA 4N0CA 3LKRA 1UXSB 4FTVA 3I9GL 5DUBA 3VWJD 3RTQD 4EI5D 1KYOJ 3RVWD 4JPVL 5BVJA 1TZHA 4POZD 3HE7B 5KVDL 1G9MC 3QEHB 3TPKA 1Q38A 1S9XA 3BW9B 3VRLE 2RHEA 3E8UH 4DCQB 2IPTH 1BVZA 3UTTA 4AK1A 4NHCH 3ARYA 1YYML 3RIAF 3WKMH 4ZOAA 4KHXH 4G80A 5D6DA 3JWDH 4L8CA 1ZA3B 3OX8A 1YMMA 5K9QG 1UXSA 4Y4KC 5CILL 3DMMB 3T3PE 4PP1C 2J8UB 4XX1G 1MCNA 3K8KA 2FCBA 3V4VL 3V5DA 3VXSD 1IEHA 1MHCB 3ORJA 1X4XA 2W60A 3D39A 4M6ML 1YQVL 5GGVL 2X4SA 1CD9B 4X0KA 3BW9A 1ZVSB 3WBDA 5H94A 4G6KH 1D5XB 3TZVD 3WNNA 3GSNL 5DZNA 1ZAGA 2DLIA 1QG3A 4OZIE 4U49A 4Y89A 2APWA 1QSEA 2I07B 4NPYA 3K74B 2JIXA 3ZHKA 4X6FA 1ZA3A 3SDXF 35C8L 1ZLWK 4NRXA 1SYSA 4M5YH 3KPLB 1HQRB 4GAJL 5JO5B 1WICA 4IRSA 4L4JA 4NSKB 2NXYD 1NUFA 2RCSH 3RWDA 2VDPL 1G9ML 2R23A 5IB4A 1JWUB 1WC7B 2DLFH 3QWQB 1BFVL 3GSNA 3GBMH 2Z93B 3VFVB 4D9LL 2RFXB 1ZVSA 2P24A 3MJ7B 4N0UE 1D5XA 2EKJA 3S97C 3TGXA 5GGUB 4JFXB 4MB4A 3NAAL 4NNXB 5JORB 4Y4KB 4G8GB 3VD3A 1T03L 1NBQA 5CP7A 2EDLA 1T7WA 4V1DB 5I8OH 3VXRB 5I0ZA 2C1PA 3P4NB 1LO0L 5ACZB 3HAEH 2HLFD 3SDAA 1SJHB 4NRZA 2G9HA 1CXEA 1KLUB 2GITB 1A4KB 3S35X 3L5WB 2RFXA 3V8CA 1GGBL 4JANA 5HTSA 4JN2A 1UWXK 1PG7X 1DEEA 1HZHL 1KTLB 3P30H 4K3EL 4KTEH 4MZ2A 1T4KB 2IPKB 1PVHA 2Q8AL 4Q0XL 1JP5A 1U2CA 5I1AB 2BY0A 2VMFA 1MCBA 3T0VA 1ZANH 1R3JB 3VXUB 3IETB 3VFMA 1BVLB 4RDQF 3UTZA 5BS0D 3O6FC 1UA6H 2JCCB 1B9ZA 2QHRL 4EUPG 1LK3L 4AEFA 2GITA 2XNAB 5EZIH 1DLHA 3WO4B 5JHDE 5EO1B 4JLRB 5EU6B 3G08B 3W2DL 3TN0D 1N64H 3BRFA 2ZG2A 2FL5A 3OAYK 2OR9L 4KZDL 5E5MA 3QRGH 3VDCA 5A2JH 4RA3A 4JZJC 2AQ1A 3G5YA 2HWZH 5JIPA 4PG9B 3FQWB 4JO1L 3L7FB 3FO9A 3H9SA 2NY7H 1VERA 1F4XL 2MQ3A 2H8PB 4ZTOH 5KS9A 3C9NA 4KJYB 4ZS7H 2GJ6D 3DGGA 1NAML 5LWYH 5INCB 3CX2A 4P46C 2BX5A 3THML 1A1NB 1P2CB 3TVMD 1RU9L 3G08A 1WT5A 1OY3B 3TPUE 1IAKA 1DFBL 2VJXA 4CVZB 3KYAA 1FNEB 1KEGH 2XN9A 2IANA 3O6FB 4CRPA 1A3QA 1QRNE 1FFOA 2VERN 4S1SL 3L95B 3MROB 1NLDH 3QO1A 4M62L 1FLRL 3HPLA 4DKFH 1HH6B 2GY5A 1GGCL 4PJ8D 2F58L 4XNYH 5IROC 4N1HB 3QULB 3OKNB 3B83A 1NAMA 5CEZE 1ACYL 1CL7H 1MCQA 3U46B 1M7XA 3WDHA 2MMXA 4LCIL 2AJZB 5ESVB 4WFHE 3S4SG 5T5FH 3QRFM 1P2CA 3VH8A 4OF5A 4WEMB 1KN2H 1CLZL 2I60H 4JZJB 2BFVH 3ZL4H 3U0PB 2AJUL 1BVKA 5FKAB 5A16A 3VFTA 4E41B 4XCNA 3PDOB 2FBOJ 4JQVA 3WFCH 1LNUA 2PR4H 3PQYB 4YHZL 2P7TA 3HUJF 5C0GA 2NZIA 5GRUL 5IVXE 1U93B 3QULA 4L8SA 1IGML 4P46B 1AGBA 4OZHF 3SKUD 4OLVH 2VO5A 4FQ1H 3WJLC 3KNBB 4QO1A 3IFOB 3KG5A 1Q9KB 4TNWK 3QEUA 1MWAH 2FEDD 4KKLC 1TQBC 4OLWL 1QFUH 2DJSA 3C5ZD 5C0CA 4WHYH 3H42L 5HY9A 5FKAA 5DMKA 1RZ7H 3QXDB 1FLTX 2CPCA 5IFAH 3SJVD 3ARPA 2K1MA 1TZIA 3CFJB 3PABB 3PF2A 2FJGA 4MD4B 5HHOB 2I24N 3SGEI 4MAYD 5EWIL 4XPGL 1FL6B 1ZOXA 4OLYL 2AP2A 5DJAA 1MCWW 4OCRH 1DBKL 2B1AH 2ESVB 3MOBL 4FS0A 2N4IA 5DR5H 1ZHKB 1DL7L 2R8SL 4NNPL 4ODSH 3H3BC 4YAQB 5TE6L 5D9SA 3MRFB 5DHYB 1OGAD 3BZDA 5IHZA 1A6PA 3HPJA 1MHEA 2BCKA 2NY4B 5A3IC 2A9NL 4OGYH 2EDDA 2MNUA 1J1XH 2J8UE 1KCRH 3EHBC 4JCLA 4HKBB 3NN8A 4MD4A 2H45A 4PG2C 4PJCB 5I0DA 3I6KA 1TQBB 3CDGB 5BOPA 4PV9A 3C87A 1QTYT 4QXGL 2OL3H 2XZZA 5LBSH 3HZYB 3S88L 3WN5C 5D70H 3WLBA 3V0AC 1NSNH 1CLYH 2QTEA 5K9OB 1JNHB 3SE8L 4K7PX 4LSTL 4PJ9D 4F15B 1MCWM 3LDBC 4WUKL 4EN3D 5EU4A 4YFEA 2E8YA 3OXSA 2MHAB 4JO3H 4Z7VA 3OHXA 3MCLL 1U8LB 4NQXB 4UV4L 1QR1B 3GJEA 3PP4H 1EEUA 1EFXD 3TIDA 4Y2DC 5A40E 5F1SA 1MREH 4LASH 2P8LA 4QTIH 1Q94A 2BY1A 3H0TA 3WL9B 4C54A 1S7TB 3C5SB 2X70B 5C0AA 1PY4A 2E6QA 2CLZB 3HE6A 2ITDB 4HUNB 3ARTA 1JNHA 1YEGH 4V1DE 4EIGB 2ZOLA 4ODWA 5D7LA 4LPXA 1BGXH 1M7DA 1IRAY 4BSWA 3KPPA 1MCKA 2DQUL 2APXA 4J3XA 5FDWA 3HFMH 2PYEE 5D1XA 5DVMA 1G7MB 3WN5B 1JF1A 5DMGC 3T0EC 1JGEA 4HQQH 4PGBA 3ULVC 1P6FA 4QRRD 3T4YA 2YXFA 5HHPA 2EIZB 1FGVH 2A74B 3EOYG 1XR8B 3LDBB 5C9KA 4FQQB 4JVUA 3GMPB 2NXZD 4OV5B 1EJ6A 4PG2A 4PJAA 5CINL 4KVCL 5J6GB 4MCZA 3PG2A 2DYPB 4MDIA 1KXTB 1I3RA 4XNUH 4Y2DB 1UCTA 3L3IB 4JHAL 3O6KH 4NO3B 2AJVL 4RIRA 4OQTH 1IL1A 3BQUA 4YJZL 3WLWC 5DWUL 5GRZA 3WYRA 3ARDC 1P4IH 2F54A 5KS9F 4U1KA 1ZS8B 3FHAA 3H6JA 3HI5H 2FSEA 1QSZA 3DUHA 3NIDE 5F9JA 5EORH 3IKCA 3JXAA 3NCBB 4NGHL 4LGRB 4BQCA 4N9GB 3V0WL 5GZNC 1I1YB 4UI2A 4XI5D 4OGAC 1FPTH 4ZXBC 3T0EB 4H20H 3NFPA 5ADOL 4M8QA 1FNSH 3EOBB 5L88L 3ULVL 3MLRH 3I50L 3GSOA 5HDQL 4U6HA 2R1YB 5I1GL 5GISL 2BVEA 2RBLA 3P40A 2FB4H 1G7HB 1KCSH 3IFLL 2P5WB 4ZMAT 2EIDA 4F7CB 1YUHB 4QF1A 2ZKHL 1A7PH 4MJ2A 2DI9A 4XC3H 1CVRA 3CXDH 5EB9A 4JDVA 4HW6A 3VXME 4HPOH 3QNZB 5DJ0B 3Q0HA 2Y6SC 2ZUVA 5DF0A 2VSCA 5E2VL 2R4RL 1W2KT 3D9AL 3EJJX 5EUKB 4L29A 3KWWB 2R39A 1OTUC 1G7IA 5AWNL 1NGQH 2GK0A 2NY1D 2MSPA 4HK3J 2R2BB 2ATKA 3UTPD 5DD6B 1N6VA 1CFTB 2D0FA 3MRQA 4ZXBB 4U1GC 3VXTA 3OB0H 4G7VL 1JK8A 2H32B 1OPGL 4PJFB 2NPLX 1IFHH 1V7ML 4G6ML 3KVQA 3PQYE 3IU4L 4QOKB 2AABL 2HVJA 3ARDA 3TYGH 1ONQA 2V2WB 4BFGA 2G60L 3QDJA 5EUKA 3B3IA 3RP1A 4PB9H 3ZKMC 5E8EA 5CZVH 2VUOA 1BX2A 4P2QB 5DD5H 3F5WB 3W0WB 4XVJL 2R2BA 1FYTA 4KROB 2R0WH 1VSCA 3QG7H 3OKMB 5GZOC 4Z0BL 4Z7QF 4FXLA 5C71A 4JJ5A 4UUJA 5FYJL 5K9JH 4QRTB 3RPKA 4OIBA 1D9KD 4LHUG 3ILQD 2EE2A 4HG4J 4NKOB 4QOKA 4LK4A 2HTKC 2DLEA 1U41A 3WDIA 3M17B 1RFDL 1D5MB 3CX5J 3E6FB 4U1GB 2VLJA 3GMOB 1HN1A 2IGFH 1A5FL 3RX8A 2DS4A 3C08L 3JTCA 4ZFZB 4L5FL 2BVOB 4MX7A 1IBGL 5DEGA 3W39B 4C56B 1XF2B 4AEHH 1RUQH 4LEXL 3TBTA 5I66A 1JFQH 2VXVH 3GI9H 5ILTH 5FYKU 3D85A 4I8DA 4TRPH 3FB5B 4Y1AD 1N26A 4N68A 4WI7A 4PJCE 1RJYA 2H2PD 2YSSA 4KTDH 4WUUD 1GPOH 1AFVH 2VLLA 4OLUL 3DTXB 1X5ZA 4Z7VF 2IG2H 1G1CA 3OKOB 3GSRB 5I76B 1I9RH 2ADJB 1F90H 4KDTA 3CK0H 5EO0A 3D2UD 3QEQD 1MFDH 3MSPA 5JDSA 4V2CB 1WIPA 4TULH 5A2KH 5I1CH 1UQSB 2QSTA 3TO2A 2X09A 1CDIA 4NT6A 4LCUA 3ZDXE 5B38G 2WAHA 5EBLA 1IC7L 3EYQC 4ZO7A 2NY0D 3VXPB 3HNVL 1OHQA 2Z8SA 4JFPB 1UJ3A 2ZSWA 3N1GC 3E3QA 3MRBB 4PRNA 5KW9H 2X1PA 1Z5LB 1KJ2A 4HIJB 3DTXA 3N9GL 3MV8A 5MEPB 3DRTB 1A4JB 2JK5B 4WI3A 2FEEI 4ONFH 5JLZA 2OI9B 3ROLA 4WWKD 5F1IA 5CMAA 4HFUL 5I1HL 4OD3L 2A0LC 5C1MB 1T66D 1CICD 1ETZB 1IGTA 3K2MC 3MLYL 4HMEA 4NRYB 4G42A 1NKOA 4H1LA 2MTPA 1N0XH 4PJAF 2BOBB 2PW2A 5T1KD 1TQCC 3S96B 4JPKH 3IT8D 1RJZA 5IT2L 3ZT6A 3GMRB 1HH9B 2X4UB 1U9KA 4GKSB 5DI8B 5MEPA 3VMNA 1UT9A 4XBPA 4PJGB 3ARZA 5H2BA 4JFFD 3RZCC 2XY2A 1AP2A 4DWHA 3BSZL 1I9IL 3DV6A 1C08A 2UZYB 4D3CL 1FVDB 1CK0L 3RAJH 1S3KL 2CQVA 4K55A 5I15L 3FQXB 3AS2A 1S9VA 2Z0BA 3HLAA 4MVBD 4GBXC 2NX5A 1KENH 3LKSB 3MV11 4CVXB 4HKXA 3KPMB 1ZT7A 3BIKB 3MNWB 4MNGA 4EKXA 2ZUQC 3QFJB 3VFUA 3QDHA 2B0SH 3GJFB 3O9WD 5C0NC 3O3DA 3FO0L 2LU4A 2EEDA 3LIZH 1A9BB 4O9HH 4PJGA 1QLEL 4MJ6A 4RWYL 1N7ML 3OKKA 3NFSL 4APQA 2FO4A 4YNYA 3FOMA 5HPMB 3L5JA 5IHBA 4HS8L 1WBXB 1TQCB 1DCLA 5DRXA 3VFPA 2VLRA 3AUVA 1YY8A 1L9NA 5C09E 5M95B 1IEAB 4JAMB 1IVLA 2DLTA 5E0QA 5FAAA 3LKSA 1BZ9B 4XP9L 4F58L 3D3VB 2Z91A 1VFBB 2ZOKA 1ZHNB 4OSUL 3RZCB 3ULVF 1SJVA 1GH7A 3T77B 5EBMA 4LPVA 4LRNH 1XF1A 2N7AA 3IJYB 3ES6A 3EOAA 4G43A 1KBGH 4GBXB 2JB6B 2YKLL 4G6JL 5IMLB 1T83C 1D5ZA 5D7JA 2CGRL 3MXVL 4JRXB 4LP5A 1AGEB 1II4E 1LEKB 4KJPD 1I8MA 1Y6KR 1BZ9A 3LEYL 4NN6C 4P4RA 3U9PH 1ZHNA 3RZCA 2BNQD 2YUWA 4BQ6A 1WZ1L 1FN4B 3V4PL 3JBG7 5HI4C 1GXEA 4K3GA 1F6AA 5I1KL 2VDKH 5LQBL 4IHOA 4XNQB 2OP4H 3IJYA 2FD6H 4XCYB 1TTUA 4CMMB 3F6LA 1QPXA 3HG1A 5EOCH 1KCUH 4L9LA 5C0BA 1BP3B 4Y2OA 3K8MA 4XP1H 4M1DH 3DXAE 5F7EL 4PLNC 2D7QA 3HR5B 1EUTA 2DQTH 1LDPL 1FN4A 2R9HC 4JRYA 3AS0A 1XF5A 4LFHD 3UJJL 3GSWA 1NLBL 1KFAL 4IMLB 1G84A 5IBUB 4XNQA 1T04B 3ARGA 4KK5D 1FGNH 4KMQA 4X6CB 3BHBB 3MCKA 4PJDB 4WNQB 3QUXB 4Z77B 4H0GA 3D1MC 3HHRB 4NN6B 4LLYB 4PRHB 2XRAL 5C0IB 4U2YA 3ZE2F 3QDGB 5DRZB 1OSZA 1I3UA 3GHBL 4JFDA 4YFDB 3T0AA 2A38A 1I9JL 4J3TA 1AXIB 4TOYH 4XB7A 1YC8A 3ARED 1QFWH 3QIWD 3TCXA 4AH2B 4X5WB 5DD1L 2NR6C 2NYYC 1T83A 5F88B 1YY9D 3S35H 3KYNA 4P9ML 1CS6A 4WTWA 1OP3H 5L6YL 2AQ2A 4ONHB 1WCQA 3BHBA 4X6CA 4BH7B 4YK4C 4C56E 4WI9A 1IC1A 1PG7H 4G8EA 2YUXA 2E27L 5C0IA 5SWZD 2Y4SA 1NANI 3QDGA 3DARA 1A6VL 4ZUTA 4P5KA 3D0VB 4HC1L 4R4ND 1T1WB 3UBXB 1CT8A 1MAJA 3KJ6H 5CS7A 1TDQA 4PJEA 1UZ6E 5GGRB 3BZEA 1ZLWH 5ISZB 4X80L 1HKLH 3WFHA 1RUMH 5CJBA 5FM8A 4WO4A 4HS6B 1XGRB 3KJ4C 1DANU 4OFYA 4Z7WB 4ODHL 5FYKH 2V2TB 3HB3D 4HC1A 1RZ8B 3NCYP 1M05B 3EYSL 5SWSD 1T1ZB 4UQ3B 5K9QI 2BSSA 3TBSB 1X5XA 1MFEL 4AQOA 2IBZY 5D96C 1ZK9A 2HP4A 2HT4D 4ERSL 4PGDB 1F58H 1DQMH 5IHLB 2AK4D 3K81A 4YK4B 5J6HB 4JDZA 2NZ9D 2WQ8A 4TVPH 4TNVK 1WLHA 3N1FC 1HHJA 4P3WA 3FO2A 1R0AH 5LXGL 1D6VH 3BN3B 3UJTL 4PRPD 4Q2ZB 1LO4L 4AQ1B 1FG2B 4PBXA 5E03A 5C0DB 1T1ZA 3PWPA 1UWXH 5T3ZE 4ZPTB 1WK0A 5IMOB 5JR1L 4YO0B 1P5VA 3WS3A 3TBWA 5MENB 1K8IA 4DKDC 3FRUB 4GG6A 5IVNA 3P73A 4QT5A 3I02A 4HLZG 2CDEA 4FMKA 4MMXC 1ZVYA 3KJ4B 5JIKA 4M02A 5F70A 5J6HA 4U1SB 3O2WH 4MB5A 3CSYA 5HDBE 5DQDH 4PIRF 3WUWB 4AT6B 1T7XA 1DDHA 3V5KA 4PJGF 4WI5A 5D96B 4DQOL 4NO0B 4GW1A 1Z0NA 1RHHA 1MFAH 2VR4A 4PUBH 1BLNA 3BPCB 3OAYH 4I2XE 4JY6B 3TYFA 5MENA 2G5BA 1QBAA 4I18A 4XHJD 4NCDA 5IMKB 3O2DL 3BKMH 3BT2L 3QFJE 1RPQA 4NQSA 1N6QH 1U42A 5IK3A 5C92A 3FB6B 1GC1C 1DE4B 4TPRL 2ATPA 2FX8L 1WBZA 2VXUH 2DWEA 4HIEB 4AT6A 3RWEA 1S7VA 1W0WB 5IP4A 1AY1H 3D48R 4GRWH 5TF0A 5CD5D 3MA7B 3HRZA 2WUCL 1EA9C 1S7SA 4X9IA 5I8KL 4UQ2A 5E2WL 1QSFB 4OAWA 4HHAA 1DBBL 2BOCB 4H8WH 2DQIH 3C2SA 1VGKB 3SKOA 1K4DB 3FFDB 4F33B 4QRSA 4LVHC 1K2DA 2ZG3A 3LKQA 4Y0GA 5FOBB 2F53E 5IOPB 4XGZA 4F8QA 3TZVC 3SQOH 4UT7L 4DKAA 1NEZA 4FQXA 5CJQL 3MRNA 3VWJB 3WNMA 3VH8G 3W5MA 4FZEL 5DVOA 1QFWI 2WINB 1KF9B 2Y06H 3N50A 1RMFH 1LO5A 5IW3A 1IQDA 3FMGH 2UY7A 1M71B 3MZGB 2CDFB 5JHDA 2X7LB 2DQDL 4NQDD 3WFDL 3QA3A 1NUGA 4YXKL 4PJBA 5HJ3B 1HEZA 1K4DA 2XWBB 4S1QH 1J11A 2W0KA 4XH2A 4DN4L 1T5XB 2P47B 5GS0H 3CFKA 5GPRA 4EDWH 1FE8H 1J0YA 1E6OL 3MLTA 3QUZD 3RVXC 1YEKL 3O2VH 5FOBA 5IOPA 4H26A 4ZFOA 1P1ZA 1RZJC 1P4BH 3VD4A 1AD0B 3W9EB 4WHTA 2WINA 2OM5A 4KKCC 1RIHH 4K7PH 3HMWH 4EQ3A 4GAGL 5CSZB 1HI6B 4NYLA 4TTDD 1G1YA 1INQB 4LVHB 1MCIA 1IC5L 1KIUA 1R3HB 3JV4A 3CDFA 2J1KA 1NL0H 1Z3GH 1IGIH 2XTJC 5HJ3A 3TZVB 4D0DA 4CW1A 4AIOA 3AY4A 1FZJA 1VDGA 3BEVB 1QRNA 4Z5RB 4PRHE 1QRKA 4X6CF 5FUCE 2D2OA 1TETL 5IBLC 3HNTL 2IADA 3HZKB 3BH8A 1S5HB 4GSDH 2CJUH 2BSRB 4QWWC 1F3JB 2CKBL 2IMNA 4HIXH 1NFDA 3CXHJ 4PJEF 1MF2H 1R3KA 5H35B 5GHWH 4I1NB 1AIFB 1Q9OB 1RZJL 4M3KB 3BEVA 3RU8L 4PJXB 4ZD3H 1J8HB 3LRHA 3OR7A 4HH9A 5IVXA 4X6EB 2PXYD 4F80A 2DQFB 4HGWA 3S5LB 3MR9A 3X14A 3HS0B 4FXGB 5J9PA 2XTJB 5I19H 5IJKC 4HWEH 2B39A 4RGOL 2AJYH 3F12A 2CKBA 3A6BH 1NDGB 1RUKL 2BSRA 2WLYA 4NKDA 5C9JB 1NAKL 5D2LA 4OTXL 1XCTB 5FXCH 3RL2B 3RVTD 2DMCA 4D9RD 1QO3B 4FNLL 4QRQB 3DX7B 5T1DL 3CZFB 3PJSB 3X11B 4J23A 5H35A 3VRLF 4X7TB 3SDCD 3TVMC 4UB0H 2AGJL 1VENA 4PJXA 5EBGA 3BP5A 4K2UL 2XXCB 1RZFH 4YBHA 3MGAA 1UVQB 3VRJB 5T33L 2ZUYA 2QLVB 2DQHH 5BS0B 5E7BA 4NUJB 1UCBL 3NABL 1I7RA 2OTWA 4RISL 3ZE1E 4PJ8C 4LCYB 2Q86B 3TJHA 4M8VA 2QQLL 1ZHBB 1TJGH 1UM5L 5FEBA 4GG6F 3DIFA 3LD8C 2H6PA 4O5LL 1NCWL 2VWEE 4GMTH 3OWEA 5HVGB 3U0WH 2Z92A 3WD5H 2X4TA 4ALAL 3TC9A 3EYVB 4BFEA 3V6ZA 4BUGA 3X3FL 3OAUL 1D5IL 1OL0A 1V3JA 1J10A 5T3XL 1LO2L 1EV2E 1UVQA 3MNZB 2ARWA 1G7PA 3T2PA 5E08H 4CAGA 2OQJB 5L8KB 3VE0A 2BNRE 2Q76A 2C3VB 2VLKE 5FYLE 1YEDB 4EBQH 3RWFB 1AXTH 5D2NE 3TVMB 5CCKH 2PTUA 1UZ8A 1FIGH 4KK9C 1G0XA 2QQNL 1KACB 4XXCA 1UM6L 4UT9L 3F7VA 4YZFE 4JKLA 2FEDC 3EYUH 4NQCE 1HILA 5IJKA 4I5BB 4Y16C 4QTHB 3KYOB 5AD0A 4HF5L 1KELL 4PJ8B 2EH7H 3GB7B 2G2RA 3PV6B 1JN6B 5EFIB 5I73B 3V9FA 4LCWD 1L6XA 3U0TB 3X13A 2M2DA 3LD8B 4JO2H 4P2OA 4HGMA 3L3KA 1IILE 3VFGH 2KZ1B 3MV9D 4MQTB 4K94H 4MAYC 5D1QA 1KC5H 2ADFH 1OARL 3RY5A 4TVPD 4LSUH 1NPUA 4N8VB 2IQ9H 3C6LD 3U36A 1AHWA 4MHHG 3G6JB 4E5XB 4QTHA 2P8MB 5KSUA 1IT9L 4R0LC 4FABH 2D7MA 3FAWA 5IGXH 1RIUH 5JW4N 5HGBB 2BVUA 1P4LA 3C09B 4XRCA 3REWB 2YXMA 3KPRE 3SGDI 1T2XA 3CFCL 3PWLA 3BWAA 1FYHB 4Y16B 5DS8A 3U7WL 4EI6B 4U6XA 4N8VA 4PJBF 5DURD 3FN0L 5F6HJ 4K7FB 4ZUSB 3SJVB 2P8MA 4OF7A 4J4PC 7FABL 4OCWH 4WTXA 3PL6D 3RUGA 4TUJA 4WV1A 3H7BB 4N8PA 1AO7B 1VEMA 3OG4B 5DJ6B 2WBJD 1TVHA 3PHSA 4MAYB 2DD8H 3DROA 2DIAA 5FHBH 1KIPA 2QR0B 3ULUC 1HDMB 1BZQK 3JTTB 1HNGA 1P5UA 3QIBA 3TFKD 2ZNXA 4M7KH 3K1DA 3HRPA 4G3YL 5C3TA 1T2QH 3ALPA 2EC8A 4R0LB 3DO7A 2O26U 3D6GA 1NMBH 1QFPA 1CDJA 4F57H 3UC0L 1OGAB 3EFFA 5E6IC 1J0IA 3QHFL 5J1SC 5IVOA 3P3YA 1T5WA 4LIQL 2WSKA 1JHKL 1A3LH 4I0CC 3F7QA 4FZ8L 3VXSE 1UM4L 3PE9A 4MJIB 1OW0C 2DQEH 4GUPB 1MFBL 4HCRL 3MRIA 3FONA 3L5XL 4PR5A 1M6OA 2QR0A 3NZHL 3MUZ1 4GKNA 4QRPA 1NGPH 1YPZB 1N5YH 3H9ZA 2AS5M 4M5ZL 3RDTD 1JZ3A 1MRCL 3CMOH 4DKEL 1JZ4A 1MJUL 3MJ8A 4R0LA 1I7TB 3MYJB 1X5GA 4WI6A 3U9UB 1TIUA 5DJ8B 3VXMA 1NFDF 4XP4L 1KT2B 3RKPA 2HJKB 4YXHL 4HCRA 4H0IA 5JPNA 4XNXL 5AYUL 5HYSA 3KXFE 3GKWL 4M1CC 1QLFB 2V5MA 4IIQC 1GSMA 3VFOB 1MHHB 4GXVL 4WFED 5IVXF 3ULUL 4AEEA 1K4CA 4L4TB 1N59B 2WLZA 5DRNA 2XWTB 1QNZL 5FHAH 3TA3C 5DD3L 3IDGA 3FOLA 4LSVH 5IR1A 3QUYC 5C7XL 3N0PB 1CI5A 5GS0D 1YEFL 2AXHA 3GJFK 3SE4C 2ZCHH 5D2LF 5FV1L 2KBGA 1T1XB 4HT1H 3QUMB 4ZUUB 5CIPH 2VDQH 4PJXF 3ECBA 5DXWA 5BCAA 2VDNL 5I71C 5IQ7H 1OLLA 1PSKL 3STBA 3TV3L 3QUML 1A7NH 2X1WL 4ZUVB 4L4TA 4LCCA 4RNRB 4WCYL 7CGTA 1RAMA 5GGSB 1D5BB 2QKIB 2VOTA 3PWJA 1U8MA 1A7RH 4R3SA 3H8NA 5E6IA 4ODUA 4D0BB 4XAWL 5DDHB 3CCHA 1I1FB 1QBLL 2A6IA 1RJLA 5HI5D 4IIQB 1EAPB 1I1RA 1NCDL 3NCFB 1YEHH 4ETQB 5CEZH 2Z31A 2A1WL 3ZHLA 5BS0E 4OGXL 5TGBB 3TA3B 2P5ED 1BOGA 4HDIB 3CVHH 3HC4H 4F7MB 3QUYB 5ICZA 1MCDA 1JPFB 1JNNH 3RWIB 4Q6YA 1LE9B 3GIVB 1AJ7H 1D5BA 1MCFA 1WCBA 2P44B 5FUOL 4H1LG 4XCCL 4RCAA 3MGOA 5CZKA 1CFNB 4NJAL 5DDHA 1AI1H 1I1FA 2BDNH 3LN4A 3FB8A 4Y5XC 5K33A 1FO0A 5BV7H 4MLSA 5I71B 1JTPA 2HAZA 4JPWH 2VKWA 4OI8A 3QIUC 4U6VL 5D7SL 1JNLH 3D25B 2J12B 1FVEB 5JQ6H 3EIFA 3LKOB 1XFPA 2PYFA 2GJ6E 4AZ8A 5CKGA 5IQ9B 3BO8A 3SE4A 5TFSL 1R3IH 3G5ZB 1UG9A 3JWNC 1OWRM 2O5XH 2V7HA 5EBWA 5E94B 3MREB 3L9RB 4FP8H 5JW4R 3KYMA 1IGFL 5EO9B 1MIMH 3VI3E 4ZUWB 1C7TA 4KMTL 1GYAA 3A67L 2P43B 4ZNEE 4ISVA 4DAGH 5CUSH 2ICEA 4HJ0D 3MOAH 3UX9B 4FQJH 4BELD 3MXWH 1FORH 3HTLX 2E3VA 4O02H 5LJYH 4JG0L 5F7DA 1ZHLB 1JHTB 1YYMH 2H1PH 1HXYA 4OZFA 4Z76B 2JJWA 5JOFA 4Y5XB 4KFZC 3LPFA 3QIUB 3SDDC 1UKTA 1I7UA 1WEJL 3VRIB 5CEXA 3ZDYE 4LLUB 2F8XC 3V4VH 5EO9A 1G0DA 1TZGL 3TP4A 3WIFB 2FNBA 2IALA 1YQVH 5GGVH 4KQ3L 2LE9A 4ELMB 5F89A 4EXPX 4EVNA 4JQIH 3MODL 1ZEAH 2GTZB 1ZGLP 3W9DB 4DZ8A 4RSVA 3V0VB 3RUGF 4LAJH 5I1JL 4GRLD 3SO5A 2WNGA 35C8H 3C6SA 1Z9LA 4MGXA 2H2PC 4P2CG 1CDGA 5CEYB 4DFHA 2UWEB 5FGCE 4GAJH 1F02I 1H3PL 1G9NH 2OTUB 2VDPH 1G9MH 4LSSL 5C08D 1N4XL 4LEOA 5CGTA 4MXQA 3SJVE 5HHVL 5C07B 4I9WD 1FDLL 4D9LH 2YZ8A 3UPRB 4HSQA 4HJGB 3BMWA 3EDKA 3QXAA 5IW1A 2XPGA 1EMTH 5EU3A 4XPFH 1F4YL 4L4VD 3W9DA 4OCMC 5DLML 3UYOD 3SDDB 1B2WL 1OQOA 4HPYH 4NNYB 3A6OA 2DWDA 4LAQL 1LO0H 1HYRC 4ONOA 2YPLB 1DQJA 5DJDB 3RBGA 3PUCA 2QSCH 1SQ2N 4BSVA 1F11A 4X8XA 1OGAE 4Y1AB 1M1SA 1RZKC 2UZIL 4WWKC 5C09A 3QB7C 2VAJA 5D7IB 2FBJL 4J6RH 3DWTA 5DJYB 3KHOA 5AUMA 3WHXA 1HZHH 4K3EH 4OZGB 4V3EB 4PGEB 1C5DA 1A6UH 1JZ8A 5IB5A 4BZ2L 4Q0XH 5K9KB 1PKQB 5EC2A 3L3OB 3RNKA 1A7QL 3BISA 3UTSE 3QEQB 1CXFA 4R7NA 2YPLA 2LAGB 1KCVH 1X9QA 4P4KA 5DJDA 2VLMD 3TCLB 2QHRH 3GSUA 3G5XB 1LK3H 3U4BL 3A6CL 2CIKB 1KJ3L 3CAFA 3UEZA 2DL9A 2V7NA 5E8PA 3KPQB 4OLXL 3O45A 1IM3A 3W2DH 4ESKA 2WIIB 2H3NA 2OR9H 4IOFC 4PGEA 5AG8A 4KZDH 2CKNA 3QJFA 3ULUF 4YDVA 3NA9L 4OZ4A 3DYPA 3V6OE 1QEWB 4LKCB 1MCLA 4HUWA 5D6CB 4JO1H 4WWKB 3O9WC 4RAVA 2YN5A 1ADQL 3LPWA 2Y36L 4PBVC 1F4XH 3NCJL 1T0MB 3G5XA 1UENA 1N3NB 1RZKL 1RZIB 1XAUA 3F58H 1L9MA 1ZT1A 1OAKH 4PP2B 3T3ME 2MQCA 4HAGA 4LOUD 3THMH 3U6RA 3CH1B 4I3SH 1T1YB 1RU9H 2FO1A 5T1KB 1Q9LA 1FHGA 1Z6JT 2KH2B 2GHWB 4P23C 3AFLA 3LN5A 1DFBH 3E0GA 1J88A 1K5NA 4KQ4L 1H8SA 4BKLB 2Z8WC 3PWUA 1FNGB 4QRRE 3CFDB 1A8JH 4JQXC 4S1SH 2UUDK 5HHMD 2VABB 3CC5B 4M62H 1IGCL 4LKCA 5EN2B 5DC9B 1MCCA 1Q0XL 5JOPD 3PWVB 2JB5L 1IGYB 1RQ5A 1ACYH 1VGEL 2D9QB 1CQYA 1P7KA 2ZZUT 3BDXA 4LCIH 4X9BA 5CBEB 4CVWA 4PP2A 4WU5B 1HYSC 2VZUA 3C5JA 2CH8A 4JFED 3B2VL 3HMXH 4M7LT 4UIMA 3TNMA 1CLZH 3LS5H 2DTML 3WFZA 3ERYA 3O9WB 2R2EB 4GOSA 1UH2A 5CWSA 4YHZH 2PTTA 5GRUH 3P9LB 1DN0B 3BZFB 1ITCA 2R0LL 3W82A 1EO8H 2R1WB 4KK8D 4AMKL 2W0FA 4P23B 2CR3A 1B3JA 4R4BB 3T0DA 1HOCA 2A9MH 5JXED 5DTFB 5EU7E 5DYOB 4OB5L 1R5VA 1JV5B 3IB4A 1P7QD 4OLWH 3MRGB 3PNWA 3STZA 2FR4A 3H42H 3TF7C 2R2EA 2OSLB 2ZUXA 4TUOA 4DVRL 3BKJH 1INDL 1BFTA 1B0GA 4TUKL 1NDMB 1U8HA 3BZFA 3TH4T 2R1WA 1QFHA 2UV3A 3AAZB 2AV7B 2X89D 4WHCA 5CZXD 4XPGH 1OD9A 4ZYKA 4QHLA 5DYOA 1I1AC 1Y18A 3P4OA 4PTUB 2Y72A 5T3ZL 1FZOB 4NNPH 4NQED 5TE6H 4DW2H 2OSLA 4IMKC 4Y19B 3UTPE 4GAYA 5HHNA 2ILLA 1CGVA 5KVMC 1U3HA 1FZMA 1PLGL 2XKSA 1OAQL 2A9NH 3QIWC 4MA1C 2IFGA 1WV7T 4K8RC 2KL6A 2M8XA 2X1OA 2ICWA 4GT7A 4OBSA 2F5BL 4YR6A 4ODVH 5DO2D 4K7PY 1S7QB 4ELMF 5IFJA 4MS8D 1MELA 4H25B 1ZKAA 4X98B 2UVFA 3S8WA 4C58B 1NEZG 3FQRB 1S7RB 1T3FB 4Y4HD 3UTTD 1OGTB 4HZLB 5LCVH 5DMJB 3ZT7A 3MCLH 4JGMA 2GT9A 5GGQL 4KDWA 1YMMD 5HYJB 2BSTB 4LVOB 2UWEF 5DEFA 3MV7B 2GKIA 5EPMB 4PP8C 4I2XA 4LLWB 5D5MB 4LF3B 1N5AB 2NW2A 2AJSH 3D39D 4FQPA 1CGYA 3AREB 4K71B 4D8PB 1CLOL 4H25A 3RL1A 1RK0A 3QIWB 5C2UB 5KOVC 4MA1B 4WEUD 3VXQA 4Y5VC 4KZEH 3C8KB 2W0PA 3BD5A 4K8RL 4Z78A 3TIEA 3IGAA 1I1AA 4R97C 1J05A 4R8WL 4XVUD 5FF6A 3E6HA 1F3DJ 2W65B 3NZ8B 4Y1AE 4JM2A 4IRSD 4M48H 4OUUA 2R0ZL 1MJJB 3NIGF 1N5AA 4I3RL 4WUUE 3SPVA 3MV01 1HE7A 2AI0L 3G9AB 2O5YL 2BNUA 5D7KD 2I9TB 3QEQE 2JJVA 3BFOA 3B8YA 4N8CL 4GMSH 3LZFH 5GSVB 2F53A 2AJVH 3QXWA 4NO5B 4RA0C 4NUGL 3DRQA 5SWSB 1E28B 4IM8A 3SDAD 2VDRL 1S8DA 4Y5VB 4M6NL 2JELL 5E4IA 1PQZA 1C12A 2GFBA 2MCPL 1TITA 2AK4B 3O4LB 3LKNA 4O51B 3QFDA 2YS4A 4R97B 2XA3A 3V0WH 4S11A 3RVUC 5DRWB 4G8GD 4GS7C 4TN9A 3O6ML 4PP1D 1A2YB 5ADOH 5GS1C 3VXRD 3ALXA 4PRPB 1TPXC 4PREA 3CD4A 4JZOB 3GBNL 1DBJL 3I50H 3QG6A 5HDQH 1YEIH 5I1GH 2VIRA 4F7EA 2FECL 3IFLH 1EUUA 1S7WB 4QHKJ 3U4AA 5DVLA 3O11B 1FAIH 3H3PL 1YJDL 2ZKHH 4GQ9L 5B8CA 3S36X 3N1QC 3JV6B 3LQMA 1E27A 2JLLA 4JFFE 1JPST 2HN7B 1KPUA 3ULSA 5ENWA 3LEXB 3UZEA 2Y5EA 1ZLVK 3BIBX 2FLBT 3R4DA 1NCBH 3BKYH 3CNKA 3VXUD 2CDGA 5IMMB 3G5VB 1K6QL 5C0EB 1GOHA 4WGVB 1KB9K 4K3JL 1KEML 4NZTH 2XYCA 4GW5A 4RFOL 2Z4QA 3BPLC 2OX5A 4ZPVB 3QCTH 1UWGH 3EYOB 3LMJH 3QQ9D 4GS7B 4G7VH 1A1MA 3IDIA 1A0QL 4FQ2L 4KTYA 1L7TH 3KPSB 5GS1B 1A6WL 2BMKB 5EU6D 3C2AL 4NM8L 5D71L 2FJHA 2GAZB 4ZOCA 1V7MH 2YD8A 1TPXB 1WSST 3IU4H 2H32H 4IDJH 2XN9D 3IRPX 1FZKB 4JM4L 3BESR 2BXYA 4JFYB 3IXAB 2DM7A 2XQBL 2W9EH 1A7BA 1MRFL 4X6DE 1LO3L 5C0EA 2CRIA 3QUZC 3H9HB 1HXMB 3E2HC 3KPOB 4IRZL 4XNMA 3P0VL 4XPHL 3X12A 4Z0BH 5DQJB 2A73B 2H2SC 5HGAB 3UMTA 2V9TA 3KPSA 5I30H 1TLKA 4JB9L 5MEOB 4TTDC 3BP6B 2Q6WB 3ARFA 2CLRA 4RGNC 4HIHA 1OD7A 3VCLB 5KVGL 2BJML 1HIMH 1MAMH 3BH9A 5IM7B 4XBGA 2YRZA 3B9EA 5E99L 2A83A 1G6RB 5I2IA 2BC4B 2OMNA 4ZDHA 1KB5A 4YHLH 3F65A 5F7NC 1MJ8H 5IIEA 1IBGH 2BNQE 4HD9A 3T2QA 3WJJA 1URLA 2V17L 4UINL 5DJXB 4NQDB 4LEXH 4N5EA 1EO5A 2HFGL 3RHWF 4M1GL 3QUZB 3S6CA 3CDCA 4E41D 3E2HB 3VCLA 1D6EB 4R96B 4U6TA 4XPTL 4Y8AA 5I1IH 5HXMA 1DUZB 1E4KA 2A77L 1S7UA 2Y5TB 3PV7A 1JMZA 5KSBB 4P46D 4OLUH 3U82B 1CG9B 1NFIA 5IB1B 2FGWH 2KUTA 3CDYA 3OXRB 4N8VG 4HWZA 3P9MB 4RGNB 2VLKA 3QNYB 4P49A 5D2NA 4A6YL 4C4KO 1DQLL 3VMPA 5SV3A 3LKPA 2BVTA 2DQJH 3VA2C 3RVTC 4NQCA 3I6GA 3LY6A 1CDHA 4MHHI 1FFNB 3N9GH 1RUPL 5DC4B 5HHOD 3SDCC 1NGXB 3QCVL 1ND0B 1XZ0A 5D5ME 5E8OB 4DK6A 2NNAB 4A6YA 4JM2F 3KDMB 4XWGL 3P9MA 4PGCA 4Y4FC 5IV2A 1PZ5A 4HFUH 5I1HH 4OD3H 3WIIL 4ZO8A 3BAEH 4LVNB 2ESVD 5E70A 4CMHC 3BDBA 4NQVB 3MLYH 1T0NB 2X9YA 2MCG1 3O8XA 5E1AA 5D1ZC 4JN1L 4DZBB 2EDRA 3CSPA 3WNKA 1AKJB 2Y7QB 5SWZE 1IZJA 5DUPL 3VD5A 5F6HI 5KSAA 4P3DB 5ID0A 2PUQT 5F96H 5ECJE 1H15A 1NCAL 3RNQA 3WSQL 3U83A 2HRPH 1BFSA 3HNSL 4NN5C 1OTTD 1AQKL 2WBWB 3ILPB 3BSZH 1I9IH 5E5UB 1L4IA 1JGVL 4QEGA 3KPRA 3SY0B 4AIZA 4Z7NE 5IKCB 1S3KH 4EUPB 4F2MB 1T0NA 1QYGH 3OF6A 3HE6D 4L3CA 5HYSG 3RQ3A 5HPOA 3SDCB 4MXVF 3MC0A 1CXKA 5IW6A 3QO0B 3V6FA 1JUFB 5SWSE 1ZSDB 4Y88A 4EI5A 4Y4FB 2PKDA 3RTQA 5I9QC 2L7JA 3U1SH 5C8JB 2L0DA 5L9DH 3QCUL 1RI8A 5FO8A 1N7MH 4YHOL 1PBYA 2VISA 1LEGB 3OGCA 3GJFH 4DK3A 5HHXL 4AG4H 1EXUB 1C5CL 3WXVL 4QHMB 1S7XA 3OZ9L 2AK4E 4G7YH 3KLHC 5IKCA 5D1ZB 2Y07H 1T22B 1UACL 1YMHA 4FFZH 5A3ID 4UDTB 4HUVB 1XR9B 2X4PB 3T4AB 2J88L 1XEDA 4PRPE 1N2RB 3QO0A 2XKUA 1JUFA 4NN5B 4Y4FA 4EDXA 1CFSB 5C8JA 3MBEC 2ZWLT 3BQUD 3VXSA 1J1PL 2FIRT 1KV3A 1T89A 1CFQA 3M1BA 4DVBB 3WFBH 3L3JB 4G6JH 5D1ZA 2EEAA 2NW3A 2CIIA 5FK9A 3RWGA 3NGBB 4UU9B 1XR9A 4R6UA 2J6EL 5I9QB 5LAXB 3H9YA 3S4SB 5JOEA 2F74A 2DYPD 1P84J 1EHLL 3TWCL 4MNQB 1I7ZA 5DK0A 1JGDB 2EDJA 5I17B 1SVZA 1SVCP 3QWOA 5C0JA 4JGJA 3ZE0F 2A2QT 4XMLL 5I1KH 1P9MA 3KXFA 5LQBH 5I1LA 3SKNA 3DURB 3GMMA 2A6KB 5DFTA 3MV9B 1H3XA 2WBJC 3OKEB 1KGCD 3L7EB 2IBZX 3MACL 3OKLA 4L3EA 3U30C 5F7EH 2F19L 5F3HA 2IJ0C 5DMGD 3DV4B 1KJMB 5M7QA 1S5IH 25C8L 3ULVD 5JW5A 5GGVY 1EIBA 4V2BA 4NM4L 3UJJH 5SWQB 1NLBH 3V8OA 1U8OA 3GSQB 5T1LA 3VMOA 4NJ9L 1LP9B 2G75A 3DURA 4AJ0A 1XIWC 43C9A 5HVHC 3QI9C 4RZCA 5MEQB 2XRAH 2P5WD 1AGCA 3ZE1F 5IJVB 5DSCB 3DI3B 3AM8C 3GHBH 3ETBF 4R4FL 4NIKB 3MBEA 1QSVA 1ZT4B 4J1UA 5E9DB 4ZTPL 3LQZA 5DURB 3FL7A 3WLWD 3F62A 5L0QC 3VGHA 4JG1L 5C6PB 1R5IB 1GZQA 4OZFG 3P77B 3ARDD 3PL6B 3FZUC 5DVKA 1K3ZA 2R2HA 3DSFL 2WBJB 1AXSB 4UTAH 5F9OH 3CLEL 4P9MH 5FGBC 3SE3C 4NCC1 1FYTD 3U30B 4Q9QL 4NQDE 1TVBB 2GTWA 4LNRA 4Y5YC 4XMPL 4OGAD 1JRHL 1Q0YH 4N0RA 4ZXBD 3TN0A 4HJJL 5FM5M 1A6VH 4TSCL 1QLRA 4IEFB 1B4RA 2BHUA 3GHEH 2AEQH 3UYPA 3S37L 1J0ZA 3EJYC 4HXAH 4QOKD 4HKZA 5KSBE 2R0KL 2EO9A 2Z8VC 4G9DB 1XIWB 2J4WH 1WAAE 5JPMA 2FH6A 2VXSL 4EZMA 5GJTL 2V6HA 2XZQL 3SGJC 2VLJD 3UZVB 2GJ6A 1OM3L 4P2QD 3W0WD 3R06A 5FYJD 1Y6MR 3JZ7A 4LLVB 5AZEH 5L7XL 1SJEA 3IJHB 4HFWB 4WTZA 5L0QB 1KCLA 1J18A 3EYSH 1ROWA 3EGSA 2Y6SD 2F15A 1MFEH 3LQAH 3TNNB 4S0UC 3BP4A 2D03L 2D7TL 3MRCA 4FQLL 2B4CC 4ZNEA 3PGCB 2XOTA 3NFNA 1XIWA 2VQ1A 1BBDL 3QI9A 4JZNA 4Y5YB 4JHZA 1PD6A 1ZLSH 3MJ9L 5KBNC 3AM8A 3WS6C 5EZJA 3T65B 5LXGH 1S9YA 3UJTH 1GZPA 2AV1B 3RA7H 5IB3B 3BEWA 5EZOL 3W81A 2EE3A 1FVCB 1BFOB 1ITBB 5TF1L 3ZKMD 2WWMD 1JPGA 2D7OA 4X9HA 3QHTC 2XZAH 4X7DC 1ZWIB 3MJ9A 1LVEA 2AXGB 2F5AH 3VG9C 5HGGS 5HHQB 4QHNB 1UB6A 4LQFL 4OM0L 5GZOD 1A3RH 5EIIB 5FYLH 3TJEH 2DKSA 2MPAH 15C8H 2ZNWA 5FKPA 3MV8D 3CFBB 2VDOL 5KAQF 2O93L 3GRWL 3SOBL 2CMRH 4PRBB 4HEPG 4D9RE 1MEXL 2E7LE 2NY6C 3GI8H 2HTKD 4X8JB 1BEYL 4FG6C 2CXKA 3MRMB 3C5ZA 1J1OL 4OCNC 32C2A 2V2XB 2B4CL 3WEXB 1CE6B 4QKXB 3O2DH 4M7JH 4UT6L 4ZFGL 3BT2H 5JMOC 4YWGH 4I48B 1ZWIA 2VDMH 5DQ9A 5EA0L 1EEYB 2XZCL 5KG9B 4DOHB 1NBVL 3ABZA 4B53A 4TPRH 3B8SA 3BGMB 1BZ7A 2FYYA 1Z9MA 3CU1A 4HJ0C 2O61B 3MRHB 4L8BB 4PRBA 2AKRB 4NC1C 2FZ3B 1NMAH 1Q9WA 1BJ1H 4CBPA 4OF6A 1N0LA 4HWBH 4U1JB 3RHWK 2WUCH 1YDPA 5I8KH 5ALCL 2Q20A 2V2XA 3MO1A 4YIQA 3DX6A 1B4JL 2UUDH 3F6IA 3NVQA 1DBBH 4CGTA 2NX5D 1U91A 2D31B 2JKXA 2VZOA 1F42A 3O3BA 5KSVA 2E7HA 1V7NH 4NDMB 3LRSA 4APQD 4KH2A 5JIIA 3EYQD 4B7IA 3UTSA 1CE1L 2ZUUA 1AGFB 2HFTA 4GRLC 1X5AA 3E8UL 4GKZA 4OIIH 4PJ9A 2IPTL 1KNOA 3V5HA 1FRGL 1QR4A 3JV0A 3GDBA 4EN3A 4B5EA 4P9HC 3MLZL 3RWCB 1GC1H 5F7LB 5IF0A 3DYOA 1LK2A 4JKMA 4YXKH 3ZT5A 4LCWE 3VI4E 3EDEA 4ZAKC 1YEKH 3N06B 5BRZB 3GMQA 4R2GC 2A0LD 3C8DA 2IFFL 3MV9E 2ORBH 4LMQI 4X7CC 3L6FA 5FA4A 3V6OA 2YD7A 5FECB 1OCWL 3ROOA 2HJLA 1LD9B 4TVPE 3UBXI 3GSXA 4LSPH 3OB8A 5D7JD 1IC5H 1EK3A 3O0RH 3MNVA 4OFDA 4N9OB 4AY0A 1HQ4B 3D3VD 4UAOC 4LHUB 3RZCD 1H5BA 4M5YL 5DJCB 3DPBA 1LP9E 4F7PA 2FATL 4TSAH 4NHUE 4GRLB 2RCSL 4QRRA 4WY7H 3ARBC 4X4YB 4RAUA 1AQDB 2GCYA 4K3DL 1J9CT 2CUIA 4JPIA 3GBML 3EJZC 5I16B 2FJFB 2Z35B 4FQCL 3SDYL 3HNTH 1T20B 3HG1D 5DZOA 4P9HL 3MMEA 4DEPC 1RUAH 1HCFX 4MA7H 4CDGC 2R56H 1L0QA 5C0BD 2Y25A 4JRXD 4ZAKB 3DX9A 5C0ND 4J3VA 4R2GB 3UTQB 4LBEB 5I8EA 1WBYA 5KTEH 4O2EA 1KJVB 4O2FB 1CVSC 3LV3B 1EGJL 4RFEA 4MCYB 4YPGB 5DJCA 3FT2B 4LDOB 3HC0A 2XQYG 1RZJH 2ICWJ 3RU8H 4RFNC 3MRLB 3FCTA 4PV8A 3MLXL 3VXNA 5BZDB 3L3HB 1VFOA 8FABA 4UAOB 4KTEL 3P30L 4RGOH 1BD2A 3B9KA 1KIRA 4GRWE 2GY7B 4P3CL 1EGJA 1NAKH 4NWTL 3UTQA 5I18H 4M61B 1RJCA 3HAEA 3ARBB 4MA8L 4FNLH 5B38B 3AU1A 12E8H 4IBLT 4LOUC 5DT1H 5HSFA 4N90D 3SKMA 2XKNB 1UA6L 5IG7B 2HG5A 3SDXB 4DEPB 3HC3L 5EZIL 5T33H 2YWZA 1OAZL 4OF3A 1KPVB 3NABH 3HZMB 3T0XA 2ADGB 3FN9A 4FFYL 1N64L 4RISH 3QDGD 3QQ4B 5FO9A 4WI8A 2LV4A 2BVPA 2QQLH 4YHPB 1UM5H 3Q3GA 4M61A 1DBAL 5IEHB 2VXQL 4GKOA 4RFNB 4O5LH 3FQNA 2HWZL 4HK0B 4WFEE 3OJDB 1U8JA 3F7YA 4FQHB 2XWJA 4NC0B 3GMLB 3ZMRA 4ALAH 4WJ5A 3VWKC 4OT1H 1REIA 2NY7L 2VH5H 5T3XH 4ZS7L 1LO2H 5FUZL 4ZS6C 1F4HA 5LWYL 1KPVA 4OFYD 1A9EB 4FRWA 1B0RB 3S36H 3D18B 5DHXB 1S9WA 1NBZB 4YLQT 4BUHA 3ARUA 3AXLB 3IAPA 5EUOA 5GRJH 3W11C 2EYSA 2OS7A 2XG5A 1NLDL 4GRMA 2APBA 3FAXA 5JXEC 3OJDA 2HT3C 3OBAA 2B20A 1BOYA 1LWRA 1UM6H 4UT9H 5ISZD 4CDHA 1JE6A 3I3DA 3SN6N 1CL7L 5HYQA 2ZSVB 5EOQL 1JWSA 1IAIM 2EKSA 3NCYS 5T5FL 3AS3A 2R2CA 1BIHA 3CIQA 2N7BA 1TMCB 3OJMB 1HSAA 1KN2L 2I60L 4I4WB 2BFVL 4X4XA 1D9KA 1KYOK 2O5ZH 2X1QA 3KS0H 1BQSA 3PWPD 1CU4H 3JTSB 2NR6D 2EZ0C 2NYYD 1L0YA 5BZWB 1MFCL 2P5EE 4YFLF 3WFCL 5J0BA 5CZXC 2PR4L 4NZUH 2F8OA 3D69A 1OARH 1PYWB 4GG8A 4OLVL 3DO3A 5E2UH 2DF3A 3LB6C 4FQ1L 1YNKH 1ZA6B 4Q9RL 4UV7H 1IT9H 5E2TH 6CGTA 4MWFB 3KLAB 3OQ3B 2GIYA 4DGVL 4HLJA 5MEND 3VWKA 3JVGC 4YDIH 1JGUL 3UAJC 4N0CC 1ZLVH 2GJZB 1F5WA 3U7WH 5IFAL 4WUUA 1KXVC 1HWGB 1ORSB 1U0QA 4NP4H 1MVUA 1N6UA 5F44A 1WZKA 1CD1B 4ZQKB 1DQDH 2DBLH 1SEBB 3FN0H 5IEKA 1MWAA 3O3EB 1ERNA 1SY6L 3D2UA 2A6JA 3FT4B 3QDMB 1R3LB 1U36A 2X5PA 4R9HA 4KPHL 5HGHA 2B1AL 2LABA 4ODSL 5D6DC 1I8IA 4MQ7B 3EO9L 4Z7OE 3L3DA 4K07A 5JW3H 4G3YH 2NTSP 2VZ1A 1C1EH 1FNAA 1I3VA 3QAZC 1SY6A 2YD6A 3RWJA 4PLKC 4OGYL 2ITCB 1J1XL 1MQ8A 1CD1A 3O3EA 4KDVA 3QHFH 1LQVA 1U58A 2HJFB 4OZHB 2OL3L 5A43C 1I75A 2LVCA 3LKRB 4FTVB 3AMKA 5DUBB 1MFBH 1WITA 4HCRH 5BVJB 1TZHB 4FN0A 3OPZL 1UEYA 1QSFD 2ZCKH 3QNXA 1AH1A 2WY3A 4G5ZH 4IRSC 1CXIA 1MJUH 1S9XB 5C2BL 2KKQA 4P2RB 3B5TA 4Q9BA 4UTBL 1KN4L 2OL3A 3EYFA 3NACH 4XP4H 1NQBA 1J0HA 1MREL 4G80B 4QTIL 3JVGA 3K0WA 5C08E 4L8CB 3OX8B 2IPUG 1YMMB 1JNJA 4ZFFB 2BZDA 4RRPA 3RRQA 2PW1B 3ULUH 2ENSA 3DX8A 4I9WE 3QAZB 1A47A 1QNZH 4AYFA 1YEGL 3LHPL 3V5DB 4ZOEA 1FCCA 5DMIH 5I8CA 4L4VE 2W60B 3D39B 3IDNA 2X4SB 1BGXL 3MA9H 4X0KB 1JTOA 5GQBA 2PO6A 1YEFH 4OLEA 5H94B 3SDAC 4P2RA 5J1TC 2C4FT 1QSEB 3C60C 3LRGA 3RPIA 1FL3A 2X4OA 5LGJA 4NPYB 3MCG1 3DETD 2JIXB 4HQQL 1OF2B 4NN7C 4X6FB 4JVPA 4S1RL 2C7UA 4LPUA 4NFDA 4LSDA 4XB8A 4ELKA 4ZFFA 1PSKH 4NRXB 1SYSB 2YRLA 3QUMH 3TV3H 2PW1A 4F9PA 2JE8A 4M43H 4IRSB 4X6DA 3FT3A 3IFNL 4WCYH 3RWDB 2R23B 5IB4B 2XV6B 1ZGLA 5H8DA 4YDJA 5E6ZA 3K1KC 3H2WA 5CLTA 4S0TD 1JIBA 3GSNB 3UJIL 4XNUL 4AM0A 2FX9L 2P24B 1QBLH 4QLRA 3O6KL 4PRIA 1NCDH 4OQTL 3SDXE 4LHQB 5J3HC 5CP7B 2LU7A 3VFRA 2A1WH 1FH5L 1OF2A 1P4IL 2VLME 2DQGL 2C1PB 4E42A 1DR9A 5ELIA 3LEVL 5EC1B 4KV5F 4XC1H 1CIUA 3QPQC 3QJHA 2B7DT 3SDAB 5IESL 4NRZB 2YC1A 5B3JE 2G9HB 3HI6H 4KKAC 4XCCH 3RVXD 2EDOA 4OQTA 1YEEH 1ZV5A 2BNQA 3MRDA 5EUOF 5GS2D 4NN7B 4JANB 2X4QB 4JN2B 3SGEH 2VQUA 1DEEB 5F6IC 3QQ9C 3MLRL 4U6VH 4XCFH 4EOWL 4KKCD 3QSKB 1WT5C 4I3GA 1J8HD 1QBML 3LH2H 1VKXA 5EC1A 3O6LL 3VFMB 2FB4L 1KCSL 1UEMA 3UTZB 2HMID 5BQ7B 5TFSH 5DVNA 2XTJD 4XC3L 3U2SA 4LPCA 4KI1A 1DLHB 3C60A 3MJGX 3NPZB 3TJHD 1VACA 2VKXA 3FHQA 2FWOA 3MFFA 5TE4H 2X4QA 5CHNA 4F37F 5HHME 2FL5B 4KMTH 3A67H 5F7HA 1NGQL 3RX5A 5E5MB 5JOPE 5ANMA 5KAQG 4OJFL 1P69B 1SYVA 4WW1A 5IBLD 5M94B 3G5YB 4HEME 4Z7UA 2NY3C 1SM3L 4KHTL 1XF4A 1F2QA 3FO9B 5BQ7A 3H9SB 3HI1B 4JFEE 4GO6B 4LLDA 4JQVC 5KS9B 4QWWD 3C9NB 1ZXQA 1HHGA 1INEH 5F6IB 1IFHL 3DGGB 2N56A 3CFEA 3BGAA 4L8SC 2VE6A 3CGTA 2RAMA 3BIAX 3BUYA 3TYGL 3GO1L 1IAKB 1TZGH 2YD3A 4GAFB 2CXGA 4UNUA 4PB9L 2YA0A 1F8TL 4KQ3H 5CZVL 5T3XD 2XN9B 2IANB 5FCUH 2DM2A 5DD5L 1FFOB 3MODH 3QO1B 3HPLB 1NGWB 3QG7L 4XWOC 1Z9OA 5IB2A 1FP5A 1NAMB 1MJ7H 3HI1A 3NIFE 4R90H 4RMSA 1JWMA 1EEQA 2YPVH 4P2OD 2HVKA 1H3PH 4A2MA 5IFHH 3VH8B 2EC9U 4X6BA 1BVKB 2D9CA 1U8PA 4J3OC 5D1QD 1I85A 2NY3B 3DUSB 3U7YL 5A16B 3VFTB 4XCNB 1TCRA 3Q5YA 4H0HB 1LNUB 1F4YH 5CJOH 2P7TB 5C0GB 1NGWA 3GGWA 3Q6FA 3JV5A 4L8SB 1KTRL 2ERJC 3IVKA 5DD0H 1AGBB 4ZODA 4OKVA 4AEHL 1RUQL 3S3JA 3VDBA 3DVIA 4TRPL 1SBSL 3QEUB 2YBRA 1FIEA 1NCCH 4NQEE 5DFVC 3L3GA 5TDNA 4NCC2 4YBQC 1XCQA 2EYTA 3ISWA 3HUJE 3DUSA 5C0CB 4M6AA 5HY9B 5DMKB 5T5NF 2IG2L 4KRPC 3SCMA 4OZHE 4U1HA 5B4MC 1A6ZA 3CK0L 1KTKE 1MFDL 5ESQA 1TZIB 1WISA 3T04D 5MERA 2FJGB 1WF5A 2ID5A 2GSIA 3S37X 1A7QH 1OP5K 2P8PA 4KK9D 2H26A 1X5IA 4AL8L 1J8KA 3OGOE 3MRPA 2Q1EA 5D93C 5GGRY 3VA6A 5DJAB 3U4BH 5BXFB 4Y16D 3A6CH 2DRUA 3QIBD 1KJ3H 2VZTA 3SBWA 3UTTE 1LE5B 5KW9L 4C83B 1BAFL 1OTTC 2ERJB 2DIJA 3FTGA 4P59H 4U3CA 5ICXA 4PJHB 4OLXH 5D9SB 3VGEA 2QADC 4D94A 4PD4J 2X41A 5IHZB 3HPJB 1MHEB 4ONFL 4QGTA 2BCKB 3HE6C 5DJZA 4MA3A 3NN8B 1AO7D 1K8DB 3I6KB 4CUCA 3NA9H 1IAOA 4P5TA 4PV9B 3D39E 3MRRA 2EXWD 1WFTA 1ED3A 4GW4A 3M07A 5H37G 4FFVC 1ADQH 2Y36H 3IKKA 4KRPB 4QRPD 4WFGD 5D1XC 5BXFA 1YN7A 1LE5A 3WLBB 2PETA 4BJLA 3EO1B 2GEEA 4C83A 2UZXB 4PRDA 4J3UA 2WW8A 5A2IH 4PJHA 2EDXA 3FO1A 1OAXL 2R69L 2IH3A 6FABH 5EU4B 2DMBA 1IJ9A 4NKMA 5D93B 1E4JA 3OXSB 4UOW1 4Z7VB 3OHXB 1KLFA 4WTZG 1K8DA 3MRJA 1IGCH 3GJEB 3RAJL 4W68A 4MJID 3TIDB 1UB5A 1CD0A 1Q0XH 5ICYB 1YA5A 1KSRA 2JB5H 4UDUA 1IKNC 2P8LB 5L2KA 1Q94B 3H0TB 5C0AB 5D7KE 3BQUC 2VR5A 4J4PD 3EO1A 2R15A 3KS0J 3HE6B 1SBBA 4LRIA 3IDUA 2ZOLB 4ODWB 3LIZL 3P9WB 5D7LB 3UDWA 3B6SA 1M7DB 4BSWB 3KPPB 2DTMH 1NJ9A 2C5DC 3ULUD 5FDWB 1IAMA 1QPPA 5D1XB 2FRGP 2VB5A 3ZDZF 1JF1B 5ICYA 1JGEB 4PGBB 4P0DA 4X5XA 4L4TD 3T4YB 2E9WA 4HK3N 1NBYB 5HHPB 3ZTJG 3S3PA 1WTGT 4AMKH 4QYOA 3JSSA 5E6ID 2WWKO 4JY5L 4G8GE 5JNYA 4OB5H 1T21A 4PJAB 3VXRE 1AR1C 4LLQA 4KKNA 3G6AA 4MCZB 4MDIB 1I3RB 2Z31D 4LRNL 2DJ4A 5ITFA 1WAAA 4RIRB 1U8QA 4BQBA 1IL1B 1INDH 3BQUB 1KB9J 4Z7UF 5TDPA 4TUKH 3O41B 4JY4B 1NBYA 2DQCH 2F54B 4CNIA 4U1KB 3DBXA 3IXTA 4YUEH 5GRVL 3TBYA 3U9PL 2FSEB 2C1OA 5F9JB 1OOAA 3QBTB 3IKCB 5I1EL 4HG4K 5B39A 5E7FA 4M1CD 5L2JA 1ES0A 3VXUE 4ODTH 2VDKL 3PGFL 3T8XA 3NFPB 1IKNA 3BDYH 3CX5K 4M8QB 5ALBL 2FD6L 1EJOL 3TA3D 2JCCE 3HCVA 2YEZA 2AW2A 3QUYD 3T2NL 1F6FB 4OM1H 5EOCL 1DJSA 3O41A 1YNLL 1PLGH 3GSOB 2QJDA 4JY4A 4U6HB 1RK1A 4XP1L 1WGOA 4M1DL 5EU6E 2SEBA 3VGGA 5C0FA 2YD5A 4OIAA 3WE6A 1EFQA 1L8JA 4MB3A 2CK0H 5FO7A 4PRAA 2XTLA 3O4OC 2DQTL 4QF1B 3WO3B 2X6MA 1QD0A 3NTCH 4JDVB 3RIAK 2X40A 3MRKB 2RJMA 3IDJA 1X7QA 1FGNL 2NCMA 4S2SA 3TO4A 4L29B 1G7IB 2GK0B 1OSPL 1MY7A 1C8PA 2ATKB 1MUJA 3CFIC 5FOJA 5GGQH 2IH1A 4Q58C 2VAAA 1T7YA 3MRQB 3VXTB 1PJ9A 2BY3A 5TH2A 4TOYL 1JK8B 1A21A 4G6AC 4JKWA 3CPLA 2I9LA 4PGZA 3MRKA 5DZLA 1KTDA 2HVJB 1CLOH 2VUYA 2GW5A 3ARDB 4QXTA 2NLJA 3BN9C 1JF6A 4CU8A 5EU5A 2HKHH 1ONQB 4I0PC 3QDJB 4OKDA 3B3IB 4R7DB 5E8EB 3UO1L 3O4OB 1BX2B 1W72B 1VESA 1EERB 4K8RH 1EHAA 1FYTB 4HBQA 1RY7B 4RMUA 2P1YA 1XGQA 4PJIB 1W72L 4JJ5B 4UUJB 1OB1B 3QIUD 1LILA 4FMFA 3EW3B 4YX2L 3KPNA 1BQHA 3KJ6L 4IDLA 4E41E 2R0ZH 5DGRA 2DKUA 4KDTC 4XXDA 1HKLL 2DDQL 3P4MA 4MXQD 1RUML 4D9QD 2AI0H 3BP7A 1RULL 1YEJH 4CADA 2O5YH 2HLAA 4R7DA 2WWMC 3K3QA 5FYKL 1V3LA 2VLJB 4Z7QE 1IMHC 1IAIL 1T7VA 4DN3H 2VC2H 4JREC 1W72A 1BQUA 4PJ7B 1UJ3C 3E3QC 4YHKH 4PJIA 5BO1H 1T0PB 3GEWB 4MX7B 1OB1A 1JPTH 1DQQA 2X4RA 5DEGB 4XVSH 5I66B 2VDRH 3TBTB 2R29H 4I0PB 1U3ZA 5TPWH 4KWUA 5J89A 3D85B 1BQLH 2JELH 4M6NH 4O4YL 5C07D 4CJ1A 2MCPH 4BK4A 3UTOA 1CIDA 4PJHF 1MCEA 5J1AA 4XT1C 3LSOA 4KY1L 5HHOE 2AJXL 1RJYB 1R0AL 4LCWA 1YECH 2YSSB 1D6VL 1WJ3A 3SDDD 3KR3H 4WDIA 2VLLB 4U1NA 3MUGA 4MSWB 1FJ1A 1H0DA 4PJ7A 2P48B 1NC2A 1A14L 5EO0B 2ESVE 5JDSB 1IC4H 2EYRA 2YPLD 3GBNH 3HAEG 4P4KD 4OD1L 3TO2B 4NT6B 4LCUB 1IE5A 4I0PA 3VFSA 3C6LA 5EBLB 5IWLA 3O2WL 3DVNA 2ADIA 4JREB 1QVOA 4GQ9H 1UJ3B 1OTSC 2ZSWB 1VCAA 2WM0A 4PRNB 4K23L 1HSBB 4M4PA 1MFAL 5CJ8A 1KJ2B 2DJUA 3MV8B 4MSWA 5DEZA 2VL5A 5C0RH 3IF1A 1KJ2L 2ICWI 1VADA 5JLZB 4N1EA 3HR6A 3ROLB 5F1IB 5CMAB 3BKML 1KEMH 4RFOH 1MCPL 2YRPA 4MJ5A 3CVIH 4APQC 1IGTB 4TTGA 2VXUL 4G42B 2OR7A 1A0QH 1IGJA 4FQ2H 4OFPA 4H1LB 4FXKA 3VFNB 1MOEA 1H8OA 2PW2B 1ORQA 3C2AH 2QBWA 4NM8H 4YGVA 3LCYA 1RJZB 1HSBA 1AY1L 4TVSa 2RR3A 3GSVA 2BVQB 1WAAF 4XBPB 4Q6IA 5H2BB 2XQBH 1U8IA 2OJZH 1MNUH 1X5JA 1AP2B 2VN4A 3TFKA 4E9LA 4MNHA 1GJIA 3DV6B 1C08B 4H8WL 1UH3A 2FX7H 4OFVA 4CVUA 4U1LA 1S9VB 1GGIL 3PWNA 3HLAB 1J86A 3VFNA 4ORGA 2NX5B 4JB9H 4MQXC 1NANH 4HKXB 1ZT7B 5DA0B 3SQOL 4MNGB 3VFUB 4NZJA 5D7JC 2BVQA 3O3DB 2MJWA 3ZTNH 4MJ6B 2RGSA 1KPRA 2Y06L 3INUH 3OKKB 4BK5A 4APQB 4DGIL 3IDMA 2FO4B 3FMGL 3FOMB 4YNYB 3RDTA 2NY5C 5E99H 5I1DA 5DRXB 3VFPB 2VLRB 4S1QL 5D8JH 1YY8B 4IOFD 3GMNA 1G6RH 5F1NA 4F3FA 2EDBA 1XGTB 4EDWL 1FE8L 1JYXA 4UINH 1UFUA 4O58H 1V3KA 4AEIH 2Z91B 4L9LC 4YPJA 2ZOKB 1P4BL 4R26H 3TBVA 3TT1L 3IDYC 2KPNA 3FQUA 4WHDA 5EBMB 3VXOA 3OKYA 3RGVC 3HMWL 2EIBA 1KGCE 2A77H 3ES6B 3EOAB 4G43B 4MDJA 4NO2A 4Z18A 1PGRB 2B2XL 1BREA 5IUSA 1U3JA 4WGWB 3BX7C 4P23D 2Q7YA 1IGIL 1D5ZB 4BH8A 5D7JB 3T0EE 3ARGC 1DLFH 3ARWA 3ULVE 1XGTA 1I8MB 4UILH 3OR6A 4P4RB 1SEQL 1UXWA 2I5YL 3FFCA 4U2ZA 4XNZC 4YHIA 4WHYG 3VJ6A 1CGSL 3V79C 1F6AB 1RD6A 2A6DA 2NY5L 4IHOB 4YE4L 2P5WE 1HYSD 4GSDL 2DTSA 3CMGA 2CJUL 2Q87A 3VW3H 3HG1B 2J3SA 4L9LB 2ZUQB 5C0BB 3IDYB 5T3ZD 2VZSA 1KLGA 5GHWL 3WIIH 3I2CL 5J57B 1NC4A 1QA9A 3QPXL 4LKXA 4JRYB 1XF5B 4Y19D 3ZHDA 1XMWA 1FYTE 3GSWB 4JN1H 4LSQL 5I19L 4HWEL 4PS4L 2FECI 3ARGB 5DUPH 5CP3H 3MCKB 5DK3A 5F7KC 2K7PA 3A6BL 3IDXH 1UGNA 4PJFE 4PJIF 4BFIA 1NCAH 3EO0A 1OSZB 4QOKE 4WO4C 4XNZB 1AQKH 4JFDB 3SGKA 5T5NG 43CAA 5FGRA 1XGUA 4WVRA 1JGVH 4U1IB 3RGVA 5F8QC 4Z95L 4HXBH 5ESAA 2JJTC 2VLJE 3DI2B 3CU7A 5KOMC 4P2QE 3W0WE 5FYJE 5GGSY 4EUPH 4RRPG 4JKKA 2H9GA 1U8KA 1JI1A 3KYNB 3VI4F 4KUCF 3ZE2E 3IJSA 3RJDA 1AE6H 1I1AD