3ARFA

Ternary crystal structure of the mouse nkt tcr-cd1d-c20:2
Total Genus 74
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
74
sequence length
294
structure length
293
Chain Sequence
NYTFRCLQMSSFANRSWSRTDSVVWLGDLQTHRWSNDSATISFTKPWSQGKLSNQQWEKLQHMFQVYRVSFTRDIQELVKMMSPKEDYPIEIQLSAGCEMYGNASESFLHVAFQGKYVVRFWGTSWQTVPGAPSWLDLPIKVLNADQGTSATVQMLLNDTCPLFVRGLLEAGKSDLEKQEKPVAWLSSVPSSAHGHRQLVCHVSGFYPKPVWVMWMRGDQEQQGTHRGDFLPNADETWYLQATLDVEAGEEAGLACRVKHSSLGGQDIILYWGSLHHILDAQKMVWNHRHHHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system
molecule keywords Antigen-presenting glycoprotein CD1d1
publication title A molecular basis for the exquisite CD1d-restricted antigen specificity and functional responses of natural killer T cells
pubmed doi rcsb
source organism Mus musculus
total genus 74
structure length 293
sequence length 294
ec nomenclature
pdb deposition date 2010-11-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3arfA02
3.30.500.10 Alpha Beta 2-Layer Sandwich Murine Class I Major Histocompatibility Complex, H2-DB; Chain A, domain 1 MHC class I-like antigen recognition-like 3arfA01
1IM9B 4LAQH 4OD1H 2DQJH 4RGND 3QEHA 3MRMA 4NHCL 2G9HA 3WFBH 5CINL 4XVUC 2EE6A 5J9PA 4MA7L 4PREB 3BP6B 4NO2A 4ZUVB 3QJFB 4AQOA 1OD7A 2CK0H 1WBYA 1BECA 4XVTL 3DX9B 3T8XB 3U6RB 1NUGA 1ZGLP 1KC5H 3AC0A 2I60H 5FA4A 5CILL 1CGSH 3S37H 3ULUL 2APWA 4JN2B 3SGEI 5DVOA 5K9QG 1M05A 2E7LE 1KTKE 1FZJB 2X4SB 4IHOB 4KV5F 4QOKB 4LLYA 3NCYP 3HPLA 5KW9H 2P44B 4ZFOA 2OR9H 4RISH 2ENYA 3CLFL 35C8H 1BM3L 2LVEA 2D7TH 1DQMH 4PJ7E 2CSPA 1K8IA 5KVFH 1K3ZA 1A6VL 1RI8A 1L7TH 2R1XB 5CHNB 4ZS6C 4N5EA 2WUBH 4YNYB 2R0ZH 2VUOA 1T2JA 4R2GB 2P5EB 3EHBD 2VIRB 4QXTB 5JR1H 1BFTA 1JWSA 4PJAE 2VDRH 4YHOL 4MVBD 2CJUL 3GSQA 4QXGL 5C3TA 5B3JF 2P43B 2CLVA 3JV4A 3P4NB 5J3HD 5EWIL 2CK2A 4R4FH 4OCLC 1D6VL 3RDTD 1K2DB 1VERA 3AAZA 3DMMD 4LSQL 1V3LA 3IB4A 1E6JL 3VXRB 3VH8G 4I13B 1TPXC 3ARFA 4KJWD 4U7KA 3G08B 4JM2C 3TWCH 2DI8A 3HTLX 3KYKL 4PJDA 3X14A 4NQDA 5JZ7C 5GGTH 1G9EA 3QIWB 1O0VA 2X41A 3W0WE 4Q6IC 2LU7A 2R0WH 2LAGB 1W72B 4OFKA 2CMRL 3UTQB 5E2TL 5FECA 2OMBA 4X6FA 3P4LA 4U1MA 1RK1B 2BVUA 4PPTA 5DC4B 2ZSVA 2VLRD 3OMZA 1EJ6A 3PHQB 3LN4B 4Z7UA 2P8LA 3MREB 5D1QA 4HLJA 5GGVY 3SDDB 3ECBA 1HH6B 1S3KH 5C2UB 1U3ZA 1UGNA 1JZ2A 2QJDA 5DMJB 4JFHE 1TJIL 1DN0A 3P0YL 4XP4L 4BKLA 2JK5B 4MA1C 1DQQB 2YKLH 5KSBB 1YPZA 3O6FC 1RUKL 2IPTL 1JYNA 4HS3B 4JKPL 4N0UB 5F7DA 5IW6A 5GRVL 4BH7B 5GIRA 3H9SA 4J2XA 5L7XL 1G6RB 2ZSWB 1N7MH 1OTSD 5DD0H 4YHML 2H3NA 3RBGA 3BUYA 2BSRA 4P5KB 4ENEC 3P0VL 2ED8A 1MCKA 3WS3B 3ZT7A 4ODVL 3RPKA 3EYSH 1T7VA 4XAWL 3ARDB 3X13A 5EU7E 1I4FA 4HLZH 4XPGL 3K0WA 4GBXB 5H2BB 4Y88A 5KG9B 3MLSH 4RGOL 5I75B 2RAMA 1S7VA 2FATL 5IJVA 1G7HB 3DV6A 4GXVL 2DQUH 5F8RC 2VC2H 3STLB 2HFFA 3O4LE 5DO2D 4JKKA 1NDMB 1NUNB 4LHUA 5SWZA 3KPLA 5TDNB 2CDEB 2VR5A 4OZHB 4WU5A 4F8QA 5AZEL 3ZE1F 2GSGB 1OSPH 2VYRE 4Z5RA 4GQPH 2AXFA 2NY4B 3JSSA 3SDCC 4KPHH 4OZIB 4QF1B 4XC1H 3G6JB 4JG0H 1ZVSA 3BPOB 1KT2A 4K3JH 1E4XH 4K8RD 5DVNA 5IEKB 3FKUS 1FN4B 4WEBH 3OKDA 3VXME 2V9TA 2XA3A 3GJEA 4KC3B 4CJ0A 1SVZA 4G9DB 2EC8A 1MJUL 1UWEH 1FNGB 5F21B 4PJBA 1ZLVK 4B7IA 4L8DB 1HWGB 2OZ4H 3C8KB 4ZFGL 1P1ZA 1SJXA 4AYFA 1WISA 4LGPB 2DQHL 1BQLH 3R0NA 4XMKL 3BESR 4N8CH 1BPVA 4LSPH 5JPNB 1I3UA 4UTAL 1CFQB 1NCBH 3H6JA 1MCSA 2Q20A 4HUUB 5DWUH 3FL7A 3MCG1 3ZHLA 1KENH 2EDNA 4NFBA 5FUOL 1FORL 4ZS7H 1ZWIB 4WHYG 3SO3B 2Y07H 2DDQL 1IAIH 3BP4A 3CGTA 1WFNA 4P48A 5F97E 5HD8C 2ZWLT 1MHCB 1FP5A 2V17H 3HHRB 3LKOB 4MMXC 4XXCA 1GCFA 1AD0A 4PJ7F 5FUCC 5HJ3B 1BFOA 2PYEA 4RMWA 1BVKB 3P30H 2A6KB 5DGRA 3B4NA 1AC6A 4DVBA 1UZ6E 3CVHB 4HFUL 1VFAA 4OLVL 3BW9A 3CCHB 4FQJH 5JHDE 1NAMA 3NH7L 4EUPG 4PJAF 3U7AA 4OSUH 5I1CH 3FB8A 3T4AA 4ELME 3TBVA 1BZ7A 4TNVF 5DHYA 5I1LA 1LE5A 1OGAD 3NA9H 3TBWB 3NFSH 2WW8A 4FQ2H 5CGYD 4UINL 1KG0A 1H5BB 3VFRA 4YX2H 3T77B 4XZUA 3BN3B 4ZFZB 1YQVL 1J1OH 3WO4C 3S96A 4Y5XA 2NTFA 3MLWH 4UT9L 4NP4H 2WBKA 3HR5B 5D1ZD 2WIIA 1A3RH 3D5OF 1Y0LB 2H1PH 4WV1A 3QRGH 2OYPA 4Y4FC 5GRXG 1VCAA 1KXVC 5I30L 4GW5B 4N0FB 2VLLA 4Y4KB 5IFAL 1CT8A 1DDHB 2EYTB 5KOMC 1WWWX 4HMDA 3LKPA 4XVSL 1S7UB 4S0UC 3OR7B 4GG8A 4MMZC 4M9OA 4MAUL 4S1SL 3SQBA 4OT1H 5GGRA 1V8HA 3QCVH 3W39A 3T09A 2H6PA 3LV3B 3VGHA 4PGEB 4AENA 3GMPB 1HSAB 4M4PA 1Q0YL 5ISZA 1TNMA 2VL5A 2DWDB 4NNXA 3O2WL 5BS0B 1XIWD 3K4AA 3V4UH 1T5WB 5EBMA 2RCSL 5AD0A 2PF6A 4KRPC 1NAML 3C6LC 4V2CB 5E5RB 1BZ9A 4IRJC 4ORGB 5C0CD 4NQEE 3OXRA 1JNNH 1IQDA 5C09E 4ONFL 3V52H 4X0KA 1XCTB 3BKMH 3RWGB 5E08H 5HHNB 4DKEL 4E42A 1VGEH 2FBJL 2R1WB 2ZUUA 4I0PC 4P23C 2I25N 1FRGL 3BRGC 1U8JB 4X99A 4LLAA 4Y19D 3ZE2E 4Z7VF 3WFHA 2DQTH 2XKNA 4HGWA 3IU3A 3ULUE 5KAQG 4FQHB 1NGXA 5I6XC 4HIHA 2K7PA 1CIDA 2EDDA 1K6QH 3AM8A 2NX5D 4NHUB 3FQTA 1RU9H 3F7VB 2DQEH 3ROLA 3EDDA 5FOBA 1HILB 2X4QA 3LH2L 2RB8A 3LQAC 4WWID 2QHRL 4S1DC 3EZ8A 4J3OC 3AVEA 2ITDA 2HN7A 3QWOB 2QSCL 1NAKH 1LO2H 1YY8B 1AE6L 3G6AB 2VXVH 2YD2A 1NMBL 2MCPL 1WIPA 2WLZA 3CSBA 3TIDB 5MI0B 4MB5A 4P2OB 4OCYL 4FQIL 1TTGA 4P59L 4JFZL 4NUJB 1I7TA 3BMWA 3K4DA 4OD3L 1EGJH 1KIRB 3H9HA 2JF1A 1NFIB 3SKNA 4LEXL 1OTUD 3RWIA 3V5KA 3QIBA 2BNRA 4JFQB 2Y72A 4PR5A 3VFVA 1BFVL 3HNTL 2AXGB 3ZTJG 2YK1L 3A67L 5IMMB 3KJ4C 1QFWH 4JQIL 5HYJB 1F4AA 1YMMA 3H8NA 4Y5YB 1BF2A 4X98B 4KROD 2PXYB 1QPXA 1ERNA 1RUPL 5F7UA 4EIZC 4EJ1C 3QDJB 1TETL 3QEUA 4ZPVB 2HKFH 4M5ZL 5D6CB 1KN2H 4X6EB 5E2UH 1A6UL 5IB4A 3MCLL 5CSGA 2CLZA 3BEWA 3PWUB 4PJ9C 1FYTD 3D2UB 5DD6A 4M7KL 4QRPA 5EUKA 3L95A 3CFDA 5L6YH 5INDA 4X6DA 1FIGH 1QFWM 4R9HA 4AH2B 4K9EH 4K94L 3VJ6B 3BN9D 3BQUC 4KKLD 4KTYA 4JFDB 3DX8B 1J10A 5IMLB 4HKJB 5L2JB 4ERSL 1T22B 1AFVH 4HV8A 3BIAX 1JNHA 4HK0B 1OF2B 5MENB 3UTPE 3VXQA 3WDHA 3S88L 3GSNA 1UZ6F 1ZANL 4WEMB 3KYOB 1ZLSL 4KTDL 4YFLF 5KS9A 3WKMH 5T3ZD 1FAIH 1QNZL 2X9WA 2HMID 4DTGH 4ELMF 4B41A 1A14L 2NW3A 5JPMB 5CWSB 4KDVA 1G6VK 1N4XL 3P0GB 3JWDL 1A6AB 3U0PA 4L9LB 1NKRA 1YEGH 3MGOB 4P4RB 2X70B 1P4BL 5EO1A 1NCCH 2WBJA 1PZ5A 5AG8A 4BQ6A 3QPQC 2YPKB 3KPOA 5F44A 1WK0A 1QSEB 1BJMA 4QRRD 5J12B 1HOCA 3HPJA 1CD9B 2BRQA 1S9XA 4HX1B 1DFBL 2GJZB 4NRYA 4XCCH 3ARGB 7FABL 1JBJA 1LEKB 5KSUB 1A1OA 2PUQT 1G84A 3INUL 1N59B 3BGMB 4Z7UE 3UYPA 4QRQA 5EPMB 5C08B 4FG6C 4NKQB 4FFWD 3GSNL 3NCFB 1AKJB 1YPZE 3BEVA 1MRDL 1QUNA 4WUKH 4WI2A 5FYKL 5BO1H 3G5VA 2V9RA 1UVQB 3DXAB 3H9SE 1BX2B 4BZ1L 1YNLL 2GTWB 4XCEA 4X5WA 4M48L 1Q9OA 3SOBH 3BPLB 3BP5B 1G7PB 2YZ8A 1ZGLM 3GIVB 2NR6D 4WDIA 3KPRA 2HLFC 1JGUL 3MRDA 5D70H 3FT4A 4EBQH 1XGPA 2D31B 5SX5K 1AGDB 2LQRA 2DIAA 1Z5LB 5BW7C 2XACC 3Q5YA 3L3IB 5EZIL 5IVXE 2R0KH 1X7QA 3JV0A 3TVMC 3ULUF 1PKQA 4ODXB 1VENA 1EEQA 3QEQA 5H37H 1MCIA 3U0WH 2Y6SD 4FOMA 4PBXA 5CEYA 4ORZC 3WIIL 4EN3D 1QFOA 5BVPH 4HMEA 3MLVH 2VRAA 2UVFA 1N0XH 3LS4L 4LSSH 4TNWK 1NSNL 3TYFA 4HZAA 1C5DA 1JK8A 4KQ3L 4MNGA 1D5ZB 1LEIB 4KUZH 5FDWB 1TDQA 5D2NC 1KCGC 1T7YA 4LCCC 1O7VA 2F19L 1ZEAL 3EIFA 4QNPE 1DZBA 1K4DA 5T1KB 4EQ2A 5KSAB 4M03A 5EOCJ 4G7YL 3MBXL 1IM3A 1D9KD 1I7RA 3RWFA 5BZWB 4ZOCA 5KVGH 2I9TA 4X9HA 3F7RA 3I2CL 3ARQA 4LLUB 2PN5A 3DV4B 2R1YB 4WFED 1BF8A 3QP3A 3QUYB 4PJBE 1DBJL 3LB6D 4PP2A 4K71C 3IFNH 4O2CA 5HYSA 1QRND 3S8WA 3VWKA 3UTTA 4OF6A 2EZ0D 2O61A 5KVMC 1FFNB 1U3HA 1ZT7A 1Z3GH 4OI9A 4P4KA 3IJSB 4ZO6A 4N8VA 2FR4A 3WFDL 1J8HA 2ZUWA 4Y8AA 4NHCH 3QXTA 5CINH 2MQ0A 4M7ZB 2FX8L 3TA3B 2AJ3A 5KZCD 1YEDB 4HKXA 1BQUA 4XI5C 1NJ9B 1BBJB 4XVTH 4JPWH 3IKKA 5DEZA 4PRBB 1IMHC 3T0XA 3LZFL 4K3DH 1NBYA 2IANB 1CICA 4U6YA 1CS6A 3GSWA 5CILH 1HQ4A 3ULUH 1RZKC 1AGCB 4OI8A 2R0LL 1WCQA 2YC1A 4GKSB 4AQ1B 5FB8A 4L4VA 3CJJA 5BRZB 1OTTD 1GSMA 3R06A 4NDMA 2EDLA 2EDHA 2ESVE 1ZK9A 3F7YB 3H3PH 3CLFH 1BM3H 2FNBA 4AIXA 2DMBA 1M4KA 3A6BL 4CU7A 5TF0A 3BVNB 2F8OA 3NCMA 3D0VB 3JBG7 3LKNB 2Z4QB 4HMCA 4MA3A 3PHOA 4HJGB 3TN0B 1CBVL 1QLFB 3DURB 1U91B 2B2XL 4S1QL 1F58L 3Q3GB 3GHBL 3RVWD 4YHOH 2QL1A 3UPCA 2A2QT 5DYOA 2CJUH 4QXGH 2VXTL 5BVJA 2IADB 5EWIH 2CRMA 4PJ7B 4PJDF 1XF3A 5J1SC 3WUZA 4UB0L 5JXAL 5C2BH 2DF3A 3VFOB 1D6VH 1L7IL 1BWWA 4WW1A 3K1KC 1YNTB 2J8HA 3L3JA 2UV3A 4LSQH 3L3DA 4S2SA 1E6JH 2X6MA 5TDPB 5CCKL 2WP3T 1A9BA 3WHXA 3OR6A 4JFFB 4MJIA 4X7SL 1N3NB 1JYXA 4PJAB 4OLEA 2BRRL 3UO1L 2X4NA 2JIXA 2R4SL 3DSNA 5ISZE 5FYKU 4JB9L 1U8QB 1H9VA 1IT9L 2QR0B 3KYKH 4U3HA 1FFOB 2XIDA 3MNWB 4Z7UF 3IAGC 1CD0A 3SGJC 2JLLA 4MD4B 3BJLA 2EH8L 3EGSB 2DLTA 5F9JB 4TUJA 4YHIB 2GEEA 4RMQA 2VZTA 4MQXC 1HXYA 2EXYC 4L3ED 1B0RB 2CMRH 1YPZF 2L4OA 5B39A 3BHBB 1OLLA 3TBSB 2AV7A 2M2DA 2HFEA 5E2TH 4QRTB 3MRRB 1FZMA 5FHBL 1MOEA 4AG4L 3EDFA 5I66A 1KB5A 4U1HB 3MRCA 4MNHA 2OTUB 3V6ZB 4PRHD 4LPXA 3QDAA 2OJZL 1T20A 5AEAA 2IBZX 3W0WB 1AR1D 4IOFD 1TJIH 4P2QD 3P0YH 4XP4H 5DURD 4X9IA 3IETA 1RUKH 2IPTH 2OS7A 5GGSB 1QKZL 4JKPH 4LCWB 4M7LL 5TH2A 3QJHB 4D94A 5L7XH 1RIHL 5DZOA 4HUNB 3KNBA 1WC7B 5CSZB 4YHMH 2BSTA 3V8OA 5C1MB 1NEZG 2ATKA 3P0VH 4LP4A 2GK2A 3BISA 3RY6A 3MLXL 4CGTA 2APTA 5D7JD 4ODVH 4LSVL 3ZHDA 3AU1A 4XAWH 3QHZL 3MV8A 5EDXA 3I9GL 3RWJA 4XPGH 1IGML 1BBDL 4Y4HC 3PXHA 4QNPF 4RGOH 4PTUB 5DQDL 2FATH 4HDIB 4NYLA 4GXVH 2G5BA 1CL7I 4Z7VB 1F00I 3WV0A 5K59E 1KNOA 4YFEA 1SJEA 1PG7X 2BNRE 4X7EC 1MCJA 4HW6A 3FTGA 1S7SA 1QA9A 4PJBF 3FN0L 4UUJA 5AZEH 3QUZB 1KB5L 3TCLA 5FGRA 3VE0B 1YMME 5TE4L 4YAQA 4WTXA 5HGAA 3R4DA 1JPFA 1F11B 4OF3A 4YIQA 2ICWA 2UZIL 1F6LL 1WBZA 2AEIT 5IMKA 3WS6A 1D6EB 4HWEL 4I5BB 1KLFA 3UAJD 2IFGA 3P3YA 1MJUH 5CBEB 1E6OL 1U8HA 3GJFA 3BH9A 4X6DE 3QIUD 4ZFGH 4LLWB 3RX8A 2DQHH 2OCFD 4XMKH 4LHQB 5HY9B 5I0DA 3D9AL 3DGCR 5CMAA 4UTAH 2CIKB 2NY0B 5E24E 5D1XB 3L3OA 2CDFB 3VXMB 5ITFA 3GK8L 5FUOH 1M71A 2C7UA 2UY7A 1FORH 3QUXB 2FSEB 2X9YA 5EZLB 5EC2B 4HUWB 3UBXA 4O9HL 4HUKB 2DDQH 5FOJA 5FYKE 4GFTB 3N1PC 5KS9E 5EBGA 3GMNA 3Q6FA 5FXCH 3VXRD 2FECL 5DEFB 5IMOB 4LMQI 3OAZH 4KI5D 4ZOAA 4MWFA 3MOBL 1T1YB 3LEYL 4O2EB 1FDLL 4HFUH 3DVNA 2EICA 4WUUA 4KVNL 2QHLA 4XRCA 3RU8L 2VE6B 2C3XA 1R5IB 3EFFB 2F74A 4NKMA 3NH7H 4YO0B 2IAMC 4MJ6A 1AGEA 1I9EA 5DVKA 1HQRA 2DQIL 4R96B 3BYYA 3C5ZC 4ZNEE 2YBRB 4EI5A 3G5YA 4E5XA 5DTFA 2LV4A 1MELA 3MCKA 4NJ9L 3IKCB 4XAKD 1XFPA 5FF6B 4NZJA 2AK1L 4UINH 1ONQA 4QKXB 2R2BB 1GZPB 1OT2A 2K1MA 3EUUA 3THML 5DJXB 1YQVH 3SDDD 3RWCB 5C0AD 5JHDB 1JFMA 3RZCA 4UT9H 5FDYA 4JRYD 1H0DB 4QRSB 1JN6B 5I1AB 2XWTA 4KDTA 4ELMB 1REIA 3B2UD 5I30H 2HT2C 4D9LL 1JV5B 3GGWB 3I02B 3VXNA 1G9NL 5IFAH 3UTZA 4XVSH 2Y36L 4FQXD 1T0MB 3STZB 4APQD 4MAUH 1A7PL 4NQXB 5IHLB 3PDDA 3BIKB 1Q0YH 3KPRE 2F53B 3MROA 4JVWA 3O2WH 1GOFA 4OBRA 2NZ9C 2XWJB 3SE4A 2BHZA 2RCSH 5ADPL 3VH8A 1A6TB 2VQUA 1FL6B 1NAMH 1PKQE 4I1NB 4JCLA 3CU1A 8FABB 4RGNC 3FB7A 3CXHK 4ONFH 1FFQA 5IQ7L 1QBAA 5IT2L 2HJFB 2A6DA 2FBJH 3ZKXB 4UT6L 4F80A 1FRGH 4DK6A 2X7LB 3FQUA 1MCFA 3KDMA 2GIYA 1F4WL 2CIIA 2FEEI 3MJGX 4HUVA 3FQRB 3GBNL 3ZE0F 2R2HB 5CD3A 2DQFA 2NY4D 4DEPC 5JQ6L 5HYQB 3VFSB 2DBLL 5IVZA 4QRUB 4CMHB 4UDTB 3MRQA 2XZQL 2SEBA 3KR3L 4NQEB 2OI9C 4KFZC 3FAXA 4MD0A 3LH2H 2PNDA 3BMVA 2QHRH 2MKWA 3M17B 4PJGA 1UJ3C 1QSZA 2RGSA 4PTTB 5ENWB 4B0MM 4IRSD 2QSCH 1GXEA 1OCWL 4RA3A 5KBNC 5F7NC 5K59F 2ZJSL 1AE6H 5ESVB 5BCAA 2NXZD 1HSBB 1NMBH 4ACPA 2MCPH 4C58B 4HPOL 5ICYA 5JO5A 3EJZD 3UTTE 4EDWL 3MJ8B 1IGJA 4OCYH 5T1LB 2P8PA 3S98A 1EHAA 4P59H 3FO1B 3MACL 4JFZH 2E8YA 1J8HE 3EHBC 3UDWC 4NZRL 4OD3H 5E6YA 1S7WB 3PNWA 5DI8A 4MVBC 2CUHA 2CLRA 5ELIA 2HH0L 1IC1A 1UEMA 5J3HC 5I16B 2WZPD 3FOLB 4LEXH 3JZ7A 4MAYA 1S5HB 1G7LA 1BFVH 3DX6B 3HNTH 1U93B 3RDTC 2YK1H 3A67H 4DUXA 4JQIH 5ANMB 4X6DF 4RSVA 1I1CA 1RUPH 2MQCA 1T21B 4G80A 1K8DA 3G04A 4KJWC 4URTB 1TETH 3ULVE 1FC2D 3QEHB 3MRMB 4M5ZH 3Q5TA 2G9HB 4XMPL 3OKYA 5IB3A 1A6UH 3MCLH 1YZZA 5J9PB 3LMJH 3T08A 2BVTA 4L4VE 4M7KH 4NO2B 1OGTA 4P9HC 5CEZE 1WBYB 3IDXL 3VG9C 1V3KA 4JM2A 1G1CA 4YUEL 4K94H 4WGVB 5KS9F 5FA4B 1IC4H 1GHFL 2CO6B 4Q6IA 2YPLD 3W82A 4ERSH 2YD3A 4NUGL 1M05B 4LLYB 3S88H 2VDML 1OPGL 3HPLB 1YN6A 4ZFOB 1ZANH 4M61A 1ZLSH 1NL0L 4HWNA 2C3WA 2BVYA 4M1CD 5F8QC 1K8IB 3BRFA 1QNZH 3UMTA 4P3CL 2E6PA 3TGXA 1A14H 1A3LL 3GKWL 3ZO0A 2HT3D 3FT3A 1OTSC 2D7PA 3PP3H 3O6FA 3ZL4L 3JWDH 3BSZL 4MJIE 1S9KC 1JWSB 1P4BH 5HYFA 3QFJA 1CZ8L 3GSQB 4ZOEA 2CPCA 2CLVB 3JV4B 4YGVA 4MCYA 1CXKA 2AEQL 3RNKA 2YWYA 5KTEL 3MUJA 4PUBL 3AAZB 4JM4L 1OL0A 4J6RL 1Q38A 1EX0A 4NWTL 4G5ZL 3ARFB 1DFBH 3ES6A 4EUPA 5D5MA 1NGWA 1ZA6A 3ARBD 3DRQA 3INUH 3PE9A 4PJDB 2EEAA 4NQDB 3X14B 2DQCH 2OQJA 3FQNA 1LMKA 3KHOA 4CU8A 3B8SA 3QFDA 1I8KA 4J23A 5CZKA 3CZFA 2HVKA 3GSNH 3ILQD 3RVUD 1Q9WA 2R9HD 2C9AA 1F13A 1MRDH 2ZG3A 3DVIA 5FYKH 3CDYA 4K8RC 3UC0L 5LAXA 5FECB 4BZ1H 5F9OL 1YNLH 4X6FB 4U1MB 4M48H 5HDOA 3VDAA 4Y2OA 3SDCA 2ZSVB 3QUMA 3OB0K 4M1GL 1WFOA 4Z7UB 5D1QB 2P8LB 3O6KL 3ECBB 1JGUH 4JAMA 1MEXL 5GS0C 2EDEA 1DN0B 5FYJD 4BKLB 3MV8E 4Z95L 4A2LA 2Z91A 4XWOD 5EZIH 1YPZB 4NOFA 5F7DB 5IW6B 1WAAA 3NBNA 5GIRB 3H9SB 9CGTA 3VMPA 2XTJB 3WIIH 2EECA 3TO4D 1Q1JL 3LS4H 3RJDA 5MHSD 1ZHLA 2H3NB 4U1KA 1NSNH 3BUYB 3FHQA 1P7KA 2BSRB 1EZVX 5JDSA 4DGYL 5E4IA 1E4JA 5HYJD 5DFTA 1H3GA 4JRXE 2WP3O 3X13B 2PXYD 5DJ6A 3V6BR 1I4FB 2F19H 1ZEAH 2Y5EA 4PLNC 5B38G 2P46B 3X11A 4G7YH 3MBXH 4JEGB 2WANA 4LKXA 5D72L 1X5AA 5IJVB 3DV6B 3SCMD 4L4TA 5FM8A 1INQA 1FG2A 4BQBA 1F4YL 2HFFB 4CN1A 2Z8SA 3I2CH 3PWNA 1NMAL 4WHDA 4LHUB 5SWZB 3KPLB 3MOAL 1FAKT 1DBJH 4DW2L 2IPKA 4F37K 4JFDD 1EHLL 4Z5RB 3QUML 1IE5A 2AXFB 4IOIA 5CGYC 2XV6B 1KULA 1ZVSB 1KT2B 3FFCE 5MEND 2WQ8A 3WFDH 3OKDB 2CUMA 2RQ8A 4RAHA 5D1ZC 3ZDYE 4WHTA 3GJEB 1MCNA 3GNML 1EDQA 1XR8A 1IGFL 2FX8H 4PJBB 4P3DA 4NT6A 1M7IA 5DQJA 1NH6A 1P1ZB 3CK0L 1W0WA 5SWSA 1VFBA 2QQLL 1FGNL 5C0JA 4Q0XL 4S1RL 3RGVD 4XP9L 3LZFH 3H7BA 4Y4FA 4JANA 4DN3L 4X4XA 3CPLA 4NN7B 2XWBA 1ZHNA 3FOMA 5DGQA 2R0LH 2AQ1A 1DVFD 2NY5C 7CGTA 1MPAH 1XIWC 4XBGA 3BP4B 1XCQA 5FHAL 3JTTA 1NUDA 5IKCA 3TPKA 5DT1H 3A6BH 2MJWA 4FS0A 3MNZA 1AD0B 1Z6JT 2ED7A 1BFOB 2D0FA 2PYEB 4TULL 4M62L 1URLA 1J05A 5JXED 4LEOA 3O9WD 3LQMA 3Q0HA 1CBVH 2B2XH 4S1QH 3C6LA 4DVBB 1VFAB 3RKDC 1F58H 2IC2A 3BW9B 3UP1A 4IRJA 3GHBH 1LILA 1NAMB 1NDGA 5C71A 2A38A 2A6IA 1HHGA 2YMXL 1GOGA 1H3PL 1AKJD 2AXJA 2VXTH 1J11A 3FB8B 3T4AB 3TBVB 3QXUA 1BZ7B 4I0PA 5DHYB 4K23L 1CFSA 4P23A 5I1LB 5I71B 5JXAH 3BIBX 1LE5B 1KTDB 3QO1A 1L7IH 4G8GA 1KG0B 3VFRB 2GCYA 4XZUB 5CCKH 4X7TA 1NKOA 1RVFL 3VD5A 3S96B 4X7SH 4Y5XB 2NTFB 2BRRH 5I1JL 3UO1H 2R4SH 2WIIB 1MHHA 3IVKA 4WV1B 1ZV5A 1XF1A 1G7JA 4JB9H 3WUWG 1IT9H 3IDJA 3RVTD 3VGAC 2VLLB 3MYZA 1CT8B 5DRZA 2NY3D 4NKOB 2Q7YA 4O5LL 2OL3A 5GSRA 3LKPB 3F7QA 2EH8H 3V5HA 4G3YL 4GG8B 4XCNA 3WFZA 4A6YA 4YZFF 5F7YC 3ZYIA 5GGRB 3PWPA 5ITBL 1Z0NA 3W39B 2H6PB 5FHBH 5MEOA 4LVHC 4AENB 3U83A 4JZJC 3C08L 4ZPTA 4AG4H 3OZ9L 1IGTA 1OTUC 2KBGA 5ISZB 2VL5B 4NNXB 3I6LE 2OJZH 1R24A 3NFNA 2NMSA 5EBMB 5T1KD 5AD0B 2C3HA 4KROC 4M7JH 3DVFA 3S4SG 5J11B 1EH9A 1BZ9B 3FB5A 5K33A 5I2IA 2HT4C 3FRUA 1QKZH 4M7LH 2A0LD 2D9CA 3OXRB 1IQDB 4R7DA 1S9YA 4X0KB 2ZUYA 4GKNA 1RIHH 4E42B 5HI3C 2P48B 4OTXL 4PJGE 1VPOL 4X99B 4TOYL 4GXUM 5L88L 3WFHB 3VFPA 4NN5C 2XKNB 3MLXH 3BN9C 2VO5A 3IU3B 4HGWB 4LSVH 4G6MH 4PJ9A 4KKLC 3QHZH 5JLZA 2AK4A 1NGXB 2V2TA 4HIHB 1HHJA 3I9GH 3QDGA 4WFHD 1F3DH 2YD1A 3D85D 1IGMH 1BBDH 4M6AA 1IQWL 3VXUD 4WFGD 3FQTB 4GJTB 3ROLB 5FOBB 1JF6A 5DQDH 4WTWA 2X4QB 4UILL 5C6TL 2OL3L 3BQUA 5EOTA 2ITDB 2HN7B 2KH2B 4A6YL 2F54D 3GSVA 5D4QA 3ESVF 3VRLE 1G0DA 2IAND 2HMIC 4PBVC 3FN0H 43C9A 3MV7E 1KB5H 1EPFA 5TE4H 3WDIA 3F65A 4J3XA 1I7TB 2ZUSA 1YA5A 1T0NA 2G60L 4UTBL 5BRZD 2Y5TA 2ARJQ 4HWEH 2XYCA 3D6GA 2NY1B 1LO3L 3H9HB 4RQQA 3SKNB 1ACYH 1CLZH 3RWIB 3V5KB 3ZDYF 3QIBB 2BNRB 2JTDA 1X4YA 1MLBA 1E6OH 4HUXA 4PR5B 4Q7DA 4QY8A 3VFVB 4DAGL 4P46D 2XRAL 4GLRH 5LGJA 3QI9A 1YMMB 5L2KD 2BNUA 3D9AH 2HRLA 5JMOC 3QEUB 4LGSB 4F7CA 4YDLC 4CADA 5IB4B 2CLZB 3BEWB 4RMSA 5HGDA 5DD6B 4V3EB 4QRPB 5EUKB 3L95B 4O9HH 2BY3A 1XT5A 1YN7A 3NIFE 3CFDB 3RVXD 4FFWC 4U0QB 5INDB 3V6OC 3IFPA 4PJXE 1FYHB 4X6DB 4HFWA 3W9DA 1JZ4A 5E4EB 2CUIA 4N1CA 3QQ9D 3IAQA 3D39D 4F15C 4HV8B 4JFFD 2BOCA 4NQCA 5GZOD 5D96B 1FZOA 1JNHB 3MOBH 3PGFL 5HHXL 2VXQL 3D0LA 2WWKT 3LEYH 1HZHL 2NR6C 3VXQB 3GSNB 4H20L 3CNKA 4Y1AD 1FDLH 1ITBB 1SEBA 3RU8H 3OAYK 3QFJE 3SGKA 3OG6B 5JOFA 1BD2D 4X4ZA 5KS9B 1LP9A 2DQIH 3IU4L 3GDBA 5DJ2A 2Y6SC 2NW3B 3S3SA 4EN3C 1I85C 4NJ9H 3OKOA 3EOYG 5BW7A 1P6AB 2AK1H 1LO4L 3U0PB 3THMH 1MY5A 1WWCA 1TCMA 5EO1B 4QTHA 2WBJB 4X4YA 3IDUA 1PZ5B 1UA6L 4X5XA 3QZWG 3QAZC 3KPOB 1YQ2A 4LCWD 4D9LH 1G9NH 2E6QA 2Y36H 1D9KC 1HOCB 1SHMA 3HPJB 4KGJA 4LCCA 3RVVC 5GS1C 1S9XB 4NRYB 3MMEA 1DLHA 4H88L 4UBDD 1A1OB 1NMCC 1A7PH 3QDMA 2YR3A 1VEMA 2WK2A 4K2UL 4GRLD 4PRID 4QRQB 3VXTA 3LN5A 2EZ0C 2LAAA 4OLWL 1JTOA 1KPUA 3K8MA 4UT7L 5ADPH 3BEVB 3MV9E 1WAAE 3G5VB 2P45B 3FMGL 4JJ5A 4LASL 5BOPA 4GMSL 1DANU 1ZLUK 3GSUA 1NCDL 4XCEB 4X5WB 1ZVHA 1Q9OB 4PD4K 4ELKA 5IQ7H 4DOHE 2LTQC 5IT2H 4WDIB 4W81A 2NNAA 2NW2A 3KPRB 4UT6H 3MRDB 2BY2A 4QGYA 2CKBA 3FT4B 4PJGF 1XGPB 5BJTA 1F4WH 4DKDC 1F02I 4XCFL 3GBNH 2ICES 1X7QB 5JQ6H 2C4XA 3SKUD 1PKQB 3QEQB 4JN1L 3O81A 2DBLH 2XZQH 5CEYB 3KR3H 3FN3A 12E8L 1MCRA 1M6OA 4CVUA 1QSFD 5FUCE 1GOHA 5A1AA 3TYFB 1NPUA 1OTTC 1C5DB 1JK8B 4MNGB 4FZ8H 4K7PY 3TBYA 1OCWH 2EDFA 2A1WL 5TE6L 1CFBA 1OP9A 4HPOH 1UG9A 2XNAA 4OFVA 1K4DB 4R90L 2YUVA 1T7ZA 4PRPA 4EDWH 1IM3B 4OCXL 4GOSA 4N0YL 2ZG1A 4CJ1A 1I7RB 3RWFB 4P57A 2KQMA 3QUXD 3MACH 1NEZA 2I9TB 4NZRH 3DUUA 5BQ7A 1WVZA 3RVWC 4OLXL 3O45A 4M7LT 2HH0H 4MQTB 2R2CA 3NCCB 1J87A 3WN5A 4PP2B 5HYSB 4O2CB 1M1SA 4KRLB 5EZJA 4EKXA 3VWKB 2VZVA 1U95A 3UTTB 1OWWA 2O61B 1U3HB 1ZT7B 4JM2F 2CKBL 4KZDL 3B9KD 1JI1A 3RPIA 1KGCE 3D3VA 5T33L 4P4KB 5E70A 4N8VB 3VCLA 2FR4B 1J8HB 4XNQA 2XG5A 5CFHA 1MHPL 4JG1L 4OF8A 2DD8L 5TJWK 1ETZA 5J57B 5CJBA 5HVFB 2AJ3B 4J7RA 4HKXB 3CX5K 4NCC2 5FGCE 3IDXH 3N1MC 3NIFF 3FO0L 4YUEH 3KXFA 1NBYB 5E95B 4U6YB 1CICB 1RZKL 3GSWB 3WYRA 4I0KA 3H3KA 1GHFH 1HQ4B 2FWOA 5JIHA 3SGJA 4NUGH 1FBIL 5JW3L 2YC1B 1FSKC 2OP4L 4RDQG 3S7GA 5L9DL 5FB8B 4L4VB 4Z6AT 3JTCA 2VDMH 1OPGH 1NEUA 5DK2A 1F3JA 3GI8L 4OKDA 3R06B 3IDIA 4NDMB 5CKAA 2KKQA 4IOFC 1CVSC 5B8CC 1DQDL 1NL0H 5FYLL 3S36L 3SE8L 2QKIA 3IDMA 4PLJD 1RHFA 4PGBA 4O51A 3FN9A 4WCYL 4M93C 4D0BA 5ALCL 4HZLA 5IG7A 3U2SA 4P3CH 2B0SL 1GH7A 4G8GE 4MA3B 1A3LH 1EO5A 3GKWH 3PHOB 4JE4B 2JCCA 4EVNA 3ZL4H 3BSZH 2KL6A 4N0CD 4UOJA 5IVNA 2F53D 3CAFA 1UCBL 3RI5K 5DYOB 1CZ8H 5D5MF 5D7JC 2VLJD 5BVJB 4G6KL 2AEQH 1XF3B 3HZYA 5KTEH 3O3AA 4PUBH 4TUKL 4WI8A 4WW1B 5CP7A 3L3JB 3UJJL 3BD3A 4JM4H 3L3DB 4S2SB 3OBAA 4XNZC 4J6RH 1FVDA 2ERJC 1A9BB 3HC0A 3WHXB 3FO2A 2DAVA 3OR6B 4NWTH 4G5ZH 2YA0A 4MJIB 4Y4HA 5ADOL 4CMMA 2IWGA 3VWJC 2X4NB 5HGBA 2JIXB 4TVPL 3BWAA 2PW2A 5ACZA 2FH8A 2WSKA 1HNFA 4L8BA 2PYFA 1RK1A 5F1KC 5E2WL 4TUJB 5C07D 1HXYB 1P4LA 1L0XA 4RAVA 4ONOA 5B39B 2AV7B 2HFEB 3UC0H 3VXOA 1WAAF 5F9OH 1FZMB 1OD9A 3MFGB 5T3XE 3UAJC 1GGBL 5I66B 1SY6A 1KB5B 3MRGA 3MRCB 4MNHB 3T2OA 4M1GH 3ORJA 4WHYH 3O6KH 1T20B 3QIUC 2PTVA 2YZ1A 1HKLL 1MEXH 2AK4E 3NFPA 4Z95H 3U46A 2GYSA 3IETB 4OV5A 4QT5A 4I9WE 1N6QL 5IB2A 3VRIA 3T2QA 3L3GA 5TH2B 3QNYA 3WS3A 3X17A 5DMYA 4W4NA 1MFCL 3HI1A 3KNBB 2BSTB 1Q1JH 2IJ0C 4NQVA 3QHFL 1EEUA 2ATKB 3CH8A 2F5BL 4DGYH 5KAQF 3AU1B 4XNUL 1Q94A 4EUPH 1MVUA 3MV8B 4LDEB 1MJ8L 2AV1A 3RQ3A 3RWJB 3ARVA 4KI5C 1JTTA 1KEGL 1AO7D 5D72H 1CE1L 2YUZA 4NYLB 1P7QA 4G8FA 5C0BA 4E41D 4EI6A 2G5BB 5I1IL 1F4YH 1KNOB 1SJEB 3V5DA 2O5XL 1NMAH 4OZIA 4HBCL 3E1F1 3FTGB 2GJ6A 1S7SB 3MOAH 1QA9B 4DW2H 4UUJB 1SY6L 2Q86A 3TCLB 3W9EA 2EDKA 5HVHC 2GUOA 1EHLH 3QUMH 4YAQB 5HGAB 3IGAA 2VLMD 3K1DA 1JPFB 3LS5L 4YIQB 2ICWB 2VDLL 3EJJX 3C5ZA 3MV01 2OLDA 1WBZB 5IMKB 3T0VA 5EC1A 1KCVL 4V1DA 4HXAL 1IGFH 3U30B 1U8HB 2VB5A 3GJFB 4OIBA 3B2UC 3BH9B 2L7JA 5D93C 3QNXA 3G5ZA 5EIQA 2IALA 3CK0H 2QQLH 1T0PB 5DD3L 1FGNH 4FQXC 4Q0XH 4S1RH 4XP9H 2VABA 4KK5D 5CMAB 4ZQKA 4APQC 5EH1A 1BVLA 4DN3H 3L3OB 5ITFB 1FH5H 1M71B 2C7UB 1ZTXL 2AAVA 5ESQA 5ABDE 3UBXB 4NPYA 4GS7B 5EZOH 1AJ7L 3CX5J 3HI5L 4UAOB 4YK4C 5FHAH 4DUWA 5I9QB 1GAFH 5I75C 1KJMA 1LP9E 4HK3J 3T4YA 3GMNB 3Q6FB 2A9NL 3GO1L 2YRZA 3ARFD 4TULH 4M62H 4MWFB 1NCUA 5DSCA 5DUBA 4NQDD 3DVNB 4WUUB 3RIAF 3S5LG 4XRCB 1QPPA 4JO2L 2F74B 4NKMB 1RMFL 4NBYB 5IR1A 5D71L 1Z9LA 1AGEB 2C4FU 4XNMA 2NY4C 1H3PH 1HQRB 1NLDL 2FYYA 5F9WC 4EI5B 4K23H 3G5YB 4TTDD 4E5XB 5DTFB 1J8KA 3MCKB 4YBHA 5D2NE 4JPIA 3O2VL 3HC4L 4PBWD 1ONQB 3I3EA 2WINA 2X89D 1RVFH 3QG6A 2X1WL 3QDME 4IRSC 3RZCB 5I1JH 3WFEL 2NXZC 3NCJL 1FVCA 2XWTB 5CIPA 3BGFC 3EJZC 5C0IA 4CDGC 1ZLWK 4PS4L 3I6KA 1UJ3A 3LV3A 3VXNB 4FXLA 4O5LH 3UTZB 3LD8C 4ODTL 3ZTJH 2XTJD 1KB9K 4RFNB 4G3YH 3FZUD 1B6UA 4MDIA 1CDGA 5ITBH 1T1XA 4ZAKD 3UTSA 3KG5A 1X5YA 3MLZH 5EBWA 4K55A 3C08H 4WFFD 3EDKA 3OZ9H 1AGFA 3S9DB 2ADGA 5HGHA 3MROB 3UDWA 3BUTA 2VWEC 5DVLA 5E6IA 1IEAA 3VH8B 4G8IA 2Q3ZA 1CQYA 1YEEL 1PLGL 2JJWA 5DA4A 4PY7A 2FHBA 1FNAA 3FB7B 3RAJL 1XGYH 1IARB 5F7MC 4TSBL 5SV4A 4XBPA 2W65A 1KSRA 3T1FA 5SWZD 2A6DB 4HG4K 3OWEA 1MAKA 1OARL 4M3KB 4OTXH 4YEFA 1VPOH 4TOYH 3FQUB 3U0TA 5L88H 3KDMB 2CIIB 4YPJA 4HUVB 5CD3B 2DQFB 5HHVL 4PLKD 4PRPE 5IVZB 2Y06L 1IQWH 3MRQB 2DB8A 2SEBB 3LQAH 2D03L 4MD0B 4UILH 5C6TH 2OL3H 1UKSA 5FYLE 3VFMA 1AR2A 2Z0BA 3NIDE 4PJGB 3QH3A 3MRFA 4ETYA 1FV1A 5I15L 2A77L 4A6YH 4P2RA 4Q74A 2YRLA 4KK9D 4N1EA 4M1CC 2AABL 1AP2A 5ICYB 5JO5B 4U6VL 2H45A 4Y2DC 1HK6A 2D0GA 2AJSL 1IGJB 1SJVA 2HT3C 3D3VE 2P8PB 3VI3E 2W91A 3TYGL 3PNWB 1KTLA 5DI8B 2G60H 4UTBH 2BX5A 2CLRB 1A7BA 2AERT 1LO3H 3C5JA 1BQHG 5IHBA 3QDJA 5K9KA 4M02A 4MAYB 5B38A 4DAGH 3BRDA 1G7LB 3KLDA 5AAMA 2F9BT 2XRAH 1A1NA 2PYED 3SN6N 1CGTA 3JWOC 4G80B 1RULL 4TVPE 1K8DB 4YGAB 3G04B 2YUWA 2B4CC 1FHGA 3ARBC 3V9FA 1KXTB 4P9HL 4RMTA 1OGTB 4LSTL 1TPXB 5CSBA 4Q2ZA 3ILQC 3RVUC 4JM2B 4GG6A 2R9HC 3C2AL 2KPNA 4DKFL 1LP9F 1WT5A 3BI9X 4MXQD 4CUCA 4Q6IB 3HG1D 2PO6D 1EAPA 2HKHL 3F12A 2ADIA 3PGFH 5HHXH 5IM7A 2VXQH 1HZHH 1P5VA 4H20H 4BSJA 1JHKL 1YN6B 4M61B 5BXFA 4XWOC 1TQCC 1QD0A 3EYFA 5D7SH 2UUDH 3IU4H 4OCRL 4DFIA 2D0HA 1G7IA 4U3XA 3J7HA 2XKUA 2H2SD 3FT3B 4LOUD 3TO4C 4MA1B 3O6FB 1LO4H 4I3GA 1IFHL 4XHJD 1QSEA 2W0FA 2PTUA 2HFGL 3QFJB 4OIIL 4YGVB 1UA6H 4MCYB 2PXYC 3RNKB 1JPGA 2VKXA 2Z31D 1UFUA 3BE1L 3SDXA 1CR9L 1AD9A 3SCMC 2VDPH 4OZFG 1U41A 2YD4A 1DBBH 1J0HA 3C8DA 3ES6B 4EUPB 1LNUA 4H88H 5D5MB 4UZGA 4I18C 1NGWB 2AEPL 1ZA6B 3DRQB 4LNVA 2OQJB 3FQNB 3Q48A 4K2UH 3NVQA 1ZSDA 5J1TC 2FGWL 3FRPG 1I8KB 3QFDB 3ZDZE 5K9OA 3CZFB 2HVKB 4OLWH 1Q9WB 4K8RL 4DWHA 4UT7H 4KZEL 5HI4D 5I1EH 4LASH 1JWUA 4ALAL 4GMSH 5LAXB 1ZOXA 2FX9L 3ULSA 1NCDH 1NCTA 2Z93A 3WUWA 3SDCB 3VG0L 3CFKA 1FNLA 3QUMB 4JQXA 5I1KL 4PJHA 1L0YA 5GS0L 4JAMB 1GGIH 5D1ZA 1SYVA 4XCFH 3RGVC 2Z91B 3T3PE 4CL7A 4U1GC 3VXPA 3VXSE 4JN1H 1MI5E 1KJ3L 3SGDI 3AFLA 3RZWA 4IS6A 4IOSD 3PGCA 12E8H 5C0BE 4DOHB 1I1AC 1DVFC 1EBPA 1ZHLB 4FFZL 1F6AA 4U1KB 4NQSA 1P7KB 4XPBL 5JDSB 4RBPH 2ENSA 3E8UL 3S4SA 3NIDF 4MXVE 2A1WH 5TE6H 2GJ6E 2VLKE 4LCYA 1AGBA 3DECA 5DJ6B 1SMOA 3BH8A 4EZMA 1XIWA 3O2DA 4R90H 3X11B 3VI4E 3O9WC 4W6WB 3CMGA 4OCXH 4N0YH 4LKXB 3L5HA 1SBBA 4L4TB 5GQBA 1INQB 1LK3L 1FG2B 3VI3F 4QRPD 5C0CA 4OLXH 4F7EA 2FH6A 3PWNB 2NCMA 4JZOA 4F7TA 1EMTL 2DKSA 2IPKB 2ZCLL 5EOCL 4DJMA 1T2XA 4Y19A 4IOIB 1WV7T 5IEHA 2CKBH 4KZDH 3BPLC 5T33H 4C4KT 3B5HA 3UJTL 4KKAD 3V79C 1ORSA 1I9RL 4J1UA 1KYOK 4UV4H 2NX5A 1MHPH 4JG1H 4WHTB 1INDH 2DD8H 4QXWA 4P3DB 3TH3T 4NT6B 3RVTC 1M7IB 5DQJB 2NY3C 1W0WB 5SWSB 3WO4B 1VFBB 5C0JB 3FO0H 1KCSL 3AXLA 3TFKC 32C2A 3H7BB 5JOPD 1RZKH 4Y4FB 2B5IC 4JANB 4KH2A 4ZTOL 4X4XB 4X6BA 3CPLB 2XWBB 1MREL 4B53A 1ZHNB 2NY5L 3FOMB 1IAMA 2WBJD 1HIML 3O2DL 5JW3H 5E56A 5EO9A 1FFPA 2OP4H 3PP4L 1GGUA 2JCCF 2WMPA 5L9DH 4Y8DC 4RGNE 4XBGB 1XCQB 3GI8H 1W0VA 3JTTB 1DQDH 5FYLH 3S36H 5IKCB 4JZJA 3SE8H 3D87B 4P0DA 4X6CA 1DN2A 1H8SA 2IQAA 4WCYH 3MNZB 4I77L 1C8PA 5ALCH 3EO0A 4JFPA 2A0LC 4UV7L 3TBTA 1HHHA 1V3MA 2B0SH 4PY8I 5I1CL 3F5WA 1J05B 2VDOL 4LEOB 4KRPB 4O58L 4OV6F 3C6LB 3LRGA 4NO3A 2DLHA 4IRJB 3VGDA 1NDGB 1UCBH 2A6IB 2DLGA 4J3WA 1HHGB 4YX2L 1FYTA 4YE4H 3V95A 4D8PA 1FJ1A 1V5JA 3D48R 4G6KH 4F8TA 4I0PB 4P23B 1CFSB 4NP4L 1T89C 3QO1B 4TUKH 2C3VA 4G8GB 3UJJH 4M7ZC 4XMLL 2GCYB 5I6XB 4Q9RL 4X7TB 4Y7MA 1JZ8A 1R5WA 4H0IA 3ULVC 4MCZA 3EBAA 5J13B 3MRBA 1CLOL 3ARPA 4G9FD 5ADOH 2KQNA 1U2HA 3CDGA 4WI3A 5GPRA 4TVPH 1MHHB 2APXA 3IVKB 3ARYA 2OXGA 1G7JB 3IDJB 4YR6A 1Y6MR 3P4MA 4PV9A 4D0CA 4XP1L 2K3TA 3ZKMD 5DRZB 3CSPA 3FJTA 2OL3B 3QEQD 5GSRB 2Q7YB 3ZDZF 3DOSA 5E2WH 3QXWA 3V5HB 4AK1A 4XCNB 5D6DC 4A6YB 3PWPB 5F7EL 3TT1L 5DJZA 4ISVA 5MEOB 1JJUA 3QZWA 4ZPTB 1GGBH 1IGTB 2YUXA 4E0RA 1CDYA 1R3JA 2X9XA 3FCTA 4P46C 3FO9A 1R24B 4N9GA 3NFNB 1HKLH 3K2MC 1NGPL 2J8UE 1VHPA 3UTOA 3FB5B 5I2IB 5IF0A 4I8DA 3FRUB 3T3PF 2VXUL 3ZKSD 1N6QH 2OR7A 3KJ4B 4R7DB 1U2CA 1S9YB 2CDGA 4KMLB 4QRRA 4GKNB 3F6IA 1RJZA 5GZND 1MFCH 5GJSL 4JGUA 3QHFH 4HJ0D 2QQKL 5D9SA 2CXGA 2F5BH 3VFPB 3B9VA 5DJ0A 2GW5A 2XZZA 4PJ9B 1JMXA 4XNUH 2VLRE 2B1HL 2AK4B 4W4OA 5JLZB 5IV2A 2V2TB 1HHKA 1C5BL 1PQZA 3QQ9C 1HHJB 4MXVF 1MJ8H 25C8L 4KGLA 3MA7A 4H8WC 5GZOC 3VDBA 3DETD 2C1OA 1KEGH 1CE1H 3VI4F 3ARUA 1A3QA 3BQUB 1I9JH 5I1IH 3PJSA 5ECJE 5EOTB 5DHXB 2VXSL 3G6DL 1DQTA 4WWKA 5T3ZL 1JFQL 2O5XH 5TF1L 3GSVB 4HBCH 4HUMB 4JFYA 2XZCL 4PFEA 4F9LC 1CICD 3K46A 43C9B 1KCUL 1SY6H 1MH5A 4YWGL 3O4LA 1HEZA 3RWEA 4W70A 3LS5H 1YEHL 1CK0L 4IIQC 3PDGA 4AEFA 1T0NB 2AJVL 3MRNA 2Y5TB 4EN3A 1I85A 1KCVH 1W8NA 3S3JA 5F7KC 2D7MA 4RQQB 4HXAH 1MLBB 4HUXB 4QY8B 4Z9KB 2D7QA 3LSOA 4JFOA 5LGJB 4GG6E 3QI9B 2XTLA 5DD3H 4LFHD 1JHLL 2BNUB 2QV2A 4NC1C 5F6HJ 1E0OB 3BWUC 1J0IA 1FIGL 4F7CB 4P5MA 5HDQL 2JB6A 1KYOJ 4CADB 3GMLA 1D9KA 5HGDB 1Z9OA 5IOPA 4GRLC 5E8PA 1YN7B 1AHWA 3VD4A 4WTZG 1AJ7H 3TV3L 5JW4M 3HI5H 3IFPB 4PYGA 4JRWA 4HFWB 3W9DB 1ES0A 3CD4A 5H35A 4OFPA 4D3CL 5MERA 3T2PA 2FB4L 3WEXA 2A9NH 3GO1H 1GYAA 4K9EC 2BOCB 4NQCB 5ALBL 3WIFA 5EU6D 1FZOB 3MLRL 2JIXD 3D0LB 3X12A 2C3GA 1SEBB 2W1NA 1RQ5A 1UJTA 3IJYA 3KVQA 4JO2H 5DJ8A 1RMFH 5D71H 3V6FA 5JOFB 3L7EA 1DEEA 1LP9B 1NLDH 4LSDA 2VUYA 4M8QA 4U49A 3SDXE 4BA8A 5DJ2B 5E0QA 1RZFL 2CXKA 1F97A 2WWMD 3OKOB 3O8XD 3O2VH 4JY5H 3HC4H 4AZ8A 1QP1A 4YHYB 3M8OL 1C5CL 4GRWE 2UY6A 1CLYL 4P5TC 4QTHB 4X4YB 1CD8A 4PGZA 4X5XB 2V5MA 2XPGA 1YEJL 3WFEH 1PG7L 3NCJH 4E9LA 4HGKC 2GK0A 1UB5A 2F8VA 1CG9A 4PS4H 1ED3A 1B4JL 1UZ8A 4ODTH 5EUOA 2Z9TA 4MJ4A 3QRFM 3QUXC 3K8KA 4LCCB 1NANH 1A0QH 2UYLA 1OGAE 3MMEB 1DLHB 3OGOE 3QDMB 4BM7A 4PJHE 1TXKA 2NLJA 3MTRA 3ARED 2FLBT 5C0ND 3VXTB 3LN5B 4HIIA 2ADFL 1KPUB 5DJDA 2IPUK 3B9KC 3TH4T 1A9EA 2B20A 1YEEH 2J8UF 1PLGH 1QOKA 3MNVA 4JJ5B 3E2HC 2BCKA 4K71B 3UZVB 2BHYA 1C16A 5B3NA 3GSUB 3RAJH 3FONA 2DLIA 4ELKB 4TSBH 2VDKL 2EDJA 1SYSA 3DGGA 2NNAB 2NW2B 2J88L 1OARH 2YSSA 3VFGL 4Y5VC 5EB9A 2CKBB 2HAZA 4MS8D 3AMLA 5BJTB 5C09A 2AI0L 3KPSD 3DYPA 1E4KC 5F71A 1XF2A 5HHVH 4FFYL 1J0YA 2J12B 5LCVL 2R15A 2Y06H 2R69L 1WTLA 2E5EA 5CIPH 3ME0A 4ZUSA 3P4OA 2D03H 3SGEH 4LPTA 2ZPKL 2EYRA 3O11A 1M6OB 4PY8J 5C0CE 3REVA 3MYJA 3TBYB 2A77H 1QHPA 5I15H 1EEZA 3AROA 4BFGA 4PLJC 3U4EA 4RMVA 4KI1A 2AABH 5FGSA 4FABL 2P7TA 4PRHA 4Y19E 2XNAB 4NWUL 4U6VH 3UBXI 4PRPB 4P2QA 2AJSH 3KGRA 5B8CA 4P57B 3TYGH 1NEZB 4N0CC 4YFDB 2BXZA 3DUUB 5BQ7B 2NX5E 2XICA 5C0EA 1CDBA 2VZ3A 3O45B 1HCVA 2IH3A 1C7TA 4WGWB 5HHMD 1WLHA 1T4KA 2IFFL 3WN5B 3TJEL 1XMWA 3MBED 2BDNL 5EZJB 2VN4A 1U95B 3VMNA 4X9GA 3PGDA 5D7JA 4GG6F 3RPIB 3D3VB 2BK8A 4NNYA 1RULH 4R0LC 5ICXA 3VCLB 4XNQB 4JPWL 4WUUD 1WZ1L 3RIFK 4K3DL 2FHCA 1ETZB 1Q72L 1NUFA 3PWVA 1MFNA 4P9HH 2XG4A 2LABA 3V0WL 3N0PB 4OGAD 4LSTH 1T80A 1WZLA 4EI5D 3H9ZA 4MLSA 4HC1A 3VWJA 3RUGA 3T0BA 4X6CE 3C2AH 3GMQA 3KXFB 3L5JA 4DKFH 4MD5A 3L1OL 1Q9LA 5IP4A 3O0RL 1X6NA 2VH5L 3KJ6L 4MA8L 3H3PL 2EIBA 1P7HL 1FC1A 2FWOB 2HKHH 3QG7H 1J5OL 3QCUL 1ZLVH 1E27A 2FD6L 3HKFA 5ICZA 4RMUA 1BEYL 4UQ2A 5DK2B 1F3JB 3F7PC 1JHKH 3IDIB 3RA7L 1FYTE 2QKIB 3IDMB 3MXWL 5DVMA 4PGBB 4D0BB 2XN9D 4O51B 3WE6A 5FV1L 5I1HL 2R39A 3OAUL 1YECL 4HZLB 4OCRH 5IG7B 1MIML 2R2EA 3U2SB 3QIUA 4QGTA 3SDXF 1FQ9C 3HC3L 4X80L 2JCCB 4EVNB 2YXMA 5C2BL 1IFHH 1JPTL 5D7LD 2HFGH 1BLNA 1AXSA 4ZUUA 1TIUA 1MFDL 4GRWF 3SE3A 4OIIH 2J6EA 4PJ5D 1R5VA 3MRLA 3HZYB 4NKDA 2WBWB 4RFOL 3BE1H 3O3AB 5CP7B 4UNTA 5IB1A 4I4WA 1KFAL 1CR9H 5T3ZE 3S5LA 1FVDB 3HC0B 4HC1L 3ARTA 4JR9L 3FO2B 3ZKQD 4KXZI 5CD5D 5GS2D 1OP3K 4Y4HB 4GSDL 4OCWL 3OX8A 1IEHA 1CL7L 4PJ8D 4CMMB 5HGBB 3KWWA 4KUCF 5IWLC 2AEPH 4ZFOL 3BWAB 2PW2B 5FIEA 5ACZB 4XVUD 2DMKA 5JIIA 4PJHF 2FGWH 4L8BB 2PYFB 2YPVL 2EC9T 1JGDA 4FA8A 3TZVD 1GJIA 2AP2A 4K8RH 1P4LB 4P49A 4RAVB 4KZEH 4JGJA 3QWQB 4ALAH 1N64L 3VXOB 5EN2A 2D4FA 3MLYL 4QRRE 2FX9H 1CYGA 3MRGB 2LU4A 3VG0H 5I1KH 5GS0H 4M5YH 2F15A 1KN4L 3HZMA 3VD3A 3WJJC 5C0AA 4Q58C 4JREC 5JA8B 4JRYA 1MRCL 3NFPB 4KK5C 3U46B 1A7QL 5HDBF 1UM5L 2BMKA 4OV5B 4QT5B 3V4VL 5IB2B 3VRIB 5E9DD 3L3GB 3V6OE 3QNYB 4OF0A 1KJ3H 2J6EL 4N9OB 4GW4A 3CFEA 5IVXA 4FQXA 4JKWA 3HI1B 2NXYB 4APQA 4NQVB 4FFZH 2E8ZA 4MAYD 1KIUA 4XPBH 5DRXA 4ESKA 1I8MA 4HEPG 3E8UH 2X4RA 1Q94B 1MVUB 2C1PA 4LSRL 4GRWH 2AV1B 2C5DC 4AJ0A 2XQYK 1A6WL 4LLVA 5LJYH 1TQBC 1P7QB 4G8FB 4KJYA 5C0BB 4EI6B 2VR9A 1LK3H 4I2XE 4CDHA 5MEQA 43CAA 4NCC1 3V5DB 1EO8L 3HE7A 5E7FA 1VFUA 1HE7A 1HH9A 2GJ6B 1EMTH 4TTDC 2ZCLH 5EOCH 2Q86B 5LGHL 3W9EB 2GUOB 5CEXA 1N6UA 5F72S 1I9IL 3WHE1 4DZBA 5JQHC 3IGAB 2X4TA 2O5YL 4C56D 4EQ3A 5JW5A 3K2UL 1CCZA 1MLCA 3UJTH 3C5ZB 3T04D 4KVCL 1A5FL 4J8RA 4KMQA 1MHEA 3VFUA 1I9RH 2JELL 1YJDC 2A83A 5EC1B 3NPSC 5CLTA 4JHBA 4V1DB 4M1DL 3E3QC 3SDAD 2DLEA 3QNXB 3G5ZB 2IALB 4X4MA 4WFEE 4QLRA 1CTNA 4IRSA 1D7FA 2VAJA 3RTQC 4N90D 2XTJC 1KCSH 3KYNA 5FKAA 1KCKA 2VABB 4ZQKB 3FZUC 2E9WA 3KHQA 4X6CF 1ZS8A 1C7SA 3UROR 1KV3A 2FBOJ 1QRNE 2GKIA 3EYQD 2AJZA 5EU3A 4Y16D 1BVLB 4ZAKC 4ZTOH 4ZUTA 5GGSY 1MREH 1BQHA 1DBML 1N5AA 2NY5H 4O02L 1TNNA 5ESQB 1HIMH 3O2DH 3PP4H 4NPYB 2I9LA 4ZDHA 5CLWA 1XGTA 1B90A 1I8LC 2A9ML 4ENED 2ZNWA 1KJMB 2VISA 3T4YB 2W0LA 1IAIM 1U3JA 3Q6GL 4I77H 5I1GH 2IQ9L 2V7NA 4UV7H 2ESVA 1OAXL 2VDOH 4O58H 3ERYA 2N56A 3KLHD 5DSCB 3A6CL 5DUBB 4RGMC 3JV6A 1KTDA 4RGNB 3EOAA 1V05A 5IR1B 2CH8A 4XNMB 1LWRA 2XA8L 3HAEG 3B6SA 1IC7L 2FEEL 4JFED 2FYYB 4PLKC 5CGTA 5DRWA 3HRZA 5EUOE 3VFTA 4XXDA 1I1RA 3OKEA 4JPIB 4J3TA 4XMLH 3OPZL 3AY4C 4LVOC 2RBLA 4Q9RH 1JP5A 2WINB 4NKOA 3QG6B 2V2WA 1JPST 1CLOH 1L9MA 2YPLA 4LKCA 3LVEA 2EEBA 4IRZL 4KK9C 3TF7C 1UWXK 2X09A 1FVCB 4LPYA 1WWBX 1UQSA 5CIPB 4N68A 5C0IB 5B22A 4XP1H 3I6KB 1UJ3B 4LF3A 5HPMA 4CW1A 4L8SC 1H3WM 4TNWF 1NC2D 5GRWA 2Q6WA 3QB7C 4C83A 1TZHA 5JW4Q 2NY6B 2J2ZA 3MPCA 5F96L 2P5WD 4HH9A 1F90L 3MRPA 4MDIB 2DIJA 5F7EH 1T1XB 5FV2A 2UWEA 4Y2DA 3TT1H 3UTSB 5EBWB 4JY4A 4EOWL 1AGFB 4XTRD 2ADGB 4PYHA 5HGHB 4YHPA 5C6WH 1TCRA 5E6IB 1E4WH 4HF5L 3EYUL 3ZT6A 1IEAB 1NGPH 4OZFA 4G8IB 1KF9B 3VD7A 1SEQL 2W0PA 1YUHA 4L4TD 1C08A 4PY7B 2VXUH 4JDVA 2W65B 4XBPB 4L3EE 3T1FB 3RY5A 4FQQA 5GJSH 2EO9A 4F58L 5I71C 2QQKH 3G5XA 1F42A 3U0TB 2VQTA 3ARBA 1INEL 3BKYH 2B1HH 4PRHE 4QWWD 1C5BH 4MXQC 4XT1C 25C8H 2BVQA 1Q9KA 5AYQA 4UI2A 2PO6C 4P2QE 4XB7A 1LQVA 1NLBL 2AVGA 5DMIL 1PDKA 3DVGA 3VFMB 3VGEA 3EYOA 3MRFB 3QH3B 1FV1B 2VXSH 5SX5H 3G6DH 4P2RB 5SWSD 5T3ZH 1X5HA 1JFQH 5TF1H 2XZCH 4L29A 1RIVL 1AP2B 2MNUA 3PL6C 5JTWA 1KCUH 5EO0A 3MSPA 4H0HB 2Q76A 3CZJA 2NTSP 4YWGH 4LOUC 2H2SC 3WXWL 2APBA 4P9MH 3FFDA 2N7AA 3HZKA 5HXMA 1YEHH 4XHJC 1CGWA 1CK0H 4OCSL 3EYVB 1KTLB 2PKDA 1U8LA 4QHUA 2AJVH 2CD0A 3C5JB 1JNJA 1S9VA 1EFXD 3TO4A 5K9KB 1JRHI 5B38B 5T5NG 2Z31C 1J1XL 1FLTX 4IJ3C 1FNSL 3RUGE 3JWOL 1A1NB 4YQXL 3LMJL 3K80A 1JHLH 2ICEA 1H3XA 3OL2A 4MHHI 5DEGA 3C9NA 2MFNA 4XWGL 2B4CL 4NZUL 1EUUA 3IXAA 1R3LA 1SVCP 4K7PX 5HDQH 3GFUA 3F58L 4BELD 5I8EA 5IJKC 3SCMA 1IC4L 1MSPA 1H8OA 4Q2ZB 3TV3H 2ZUTA 5HHPA 3BP7A 4GG6B 4I18A 8CGTA 5I8CA 4DCQA 5HI4C 4D3CH 5LXGL 3MRHA 2FB4H 4PRAA 4R26H 2P1YA 5ALBH 1EAPB 3F12B 2FO1A 2ADIB 5IM7B 3MLRH 4RDQF 5FYJL 2OMNA 5F3BA 4S1DD 4YC2C 4M9PA 3OHXA 5BXFB 4LSUL 4Z77A 3EYFB 1OAZL 3DRTA 4TUOA 2YEZA 1G7IB 3PQYD 1S5IL 1RZFH 3PWPD 3DHMA 1QQDA 4ZXBD 3RGVA 5EUOF 1DL7L 3VXRE 4LVNC 4ZNEA 1RUML 5A43C 2W0FB 4KI5E 3M8OH 1C5CH 2BZDA 1CLYH 4OFYD 1XH3A 1RK0A 2G75A 2QADD 1YEJH 1PG7H 3CFBA 1I1AA 1DVFA 1JPGB 4LMQE 1GPOL 3NCEB 1LE9A 2HTKD 2DL9A 3SDXB 2W0KA 3B5TA 1B4JH 3WCYA 2DQCL 3TPUA 1AD9B 2M8XA 1SJHA 1KELL 1LNUB 5TPWL 1R3KA 4XAKE 4BK4A 3O9WA 5E4EC 3MX0A 4K3HA 3EW3B 4OM0L 1ZSDB 3IT8D 3QDGD 5C0AE 4JHWL 5K9OB 3MR9A 2ADFH 4JRYE 5EBLA 3RX5A 3C60D 2YOCA 2FJGA 4KKAC 4N0UE 1JWUB 3T65A 1MFBH 1XF4A 3SHSA 3ULSB 3ZE2F 3AS0A 2Z93B 4FTVD 3WUWB 1FE8H 2VDKH 4QTIL 5BZDA 3LDBC 4FHBD 4HIJA 3CFKB 4MZ3A 4PJHB 2J88H 3VFGH 4WW2A 3MRJA 4Q9QL 3F6LA 1UKQA 1FFRA 2H8PA 2HJKA 2AI0H 5D1ZB 5GRYA 1SYVB 1RFDL 3D18A 2X42A 2ZOKA 3T0DA 3QBTB 3SE9L 4FFYH 4JO1H 3VXPB 1JZ7A 1T7WA 2HYMA 5LCVH 2R69H 2ARWA 4IS6B 3VD9A 3PGCB 1C12A 3TFKA 4XNXL 2ZPKH 1F6AB 4LQFL 4NQSB 1RZ8A 3SJVD 5IBTL 3S4SB 5EFIA 3QI9D 3Q1SL 2ZP0T 3GHEL 4LCYB 2A74A 1AGBB 1U92A 4OZHE 2ITCA 3BH8B 4GKZA 4FABH 4GAGL 5IGXL 1XIWB 4NWUH 2EDXA 4YDKL 3EZJB 4F7MA 1F4XL 4CRPA 4OUOA 1S9WA 4L3AA 1MAML 3G6JE 4HWZA 3C5SA 5HHQA 1AI1L 2X4OA 1CXEA 4FFEX 1HDMA 4OFIA 5C0CB 4F7EB 3BYTA 2PETA 4U33A 4PJEA 4FQPA 1NGYA 4JZOB 4F7TB 1X4ZA 5LKNA 2IFFH 3AMKA 1WZMA 3C2SA 1UH4A 4X4ME 3TJEH 2BDNH 4Y19B 3TJHD 1X5JA 4FG6D 3HI6L 4NQCD 1PBYA 3MGAA 5IEHB 3RUGF 1YYML 4RZCA 2WAHA 5SWQA 2QSTA 1ORSB 5C86A 4R3SA 3D85A 4J1UB 2NX5B 1T89A 3VXUA 5DUML 2RFXA 4X83A 1UXSA 1WZ1H 5DUPL 4BFIA 3WLWD 1Q72H 3HE6D 3V0WH 2ZUVA 3ZKMC 2N1KA 3SDYL 2F54A 5I17A 3W11D 4GQ9L 1YY9D 2E7HA 3AXLB 4H26A 32C2B 5FYJU 1MFEL 1MPAL 1IC5L 1JGLL 2P47B 3L1OH 5F1OB 4JHZA 3O0RH 2X44D 2VWEE 3KJ6H 2VH5H 3VGAB 4MA8H 4X6BB 1BAFL 4HPYL 1IKNC 5DT1L 1J5OH 3QCUH 5EO9B 4YDVA 1FFPB 3RNQA 1MIEL 2FD6H 3JTSA 5F7HA 1BEYH 2Q7NA 1K4CA 3KAAA 1W0VB 3DARA 3RA7H 1UACL 2Z8VC 4LVHB 3WNPA 4JZJB 4X6CB 3MXWH 5I1HH 2FIKA 4DUVA 2IQAB 3OAUH 1YECH 1TITA 3EO0B 4JFPB 4P46A 1MIMH 3TBTB 1HHHB 1IGYA 4JO3L 3F5WB 3AUVA 4ODWA 5C3LD 1TVBA 4KROB 5GZNC 5L2KA 1EBAA 3HC3H 4X80H 1CGXA 4WTZA 1CXHA 4NO3B 4OCNC 4HJ0C 1JPTH 2YPLE 2X1OA 4FMKA 4KI5F 1MFDH 5EA0L 4YBLC 1FYTB 5ID0A 4D8PB 1FJ1B 3V0VA 5D7IA 1PW3A 1MF2L 3DETC 2HFTA 4RFOH 2P42B 2BSSA 4EDXA 2C3VB 4G42A 4NN5B 5IIEA 3ULVL 1KFAH 1OQOA 4HC1H 4RX4A 4JR9H 1R5WB 4MCZB 2UWEE 3D39A 5GGVL 3MRBB 4GSDH 4OCWH 5LQBL 1CL7H 4WO4D 1I75A 4B50A 3RWDA 3CDGB 4XC3L 5FA3A 5CEZL 4IMKA 1I7ZA 3HLAA 4UQ3A 4YR6B 1CICC 3N1FC 3P4MB 4PJIA 4PV9B 4Y1AA 4D0CB 1RY7B 1TVHA 2YPVH 3BPNC 5TGBA 1EV2E 1BD2A 1CFTA 4G6AD 4F9LA 1ORQA 4MNQD 1N64H 5DJZB 3T0EC 3B83A 4LHJB 4ISVB 3MLYH 3O4OC 4M7JL 4ZTPL 3QZWB 1P5UA 5IVXF 4E0RB 4MGXA 4L1DA 1R3JB 3LY6A 3U7WL 3FCTB 1DEDA 4IIQA 3FO9B 4N9GB 1KN4H 5IHUL 4U4BA 4Z0XA 5J6HA 4ETQA 1MRCH 4OCMC 4KK8D 1A7QH 3WSQL 5ILTL 1UM5H 5IF0B 1EUTA 4QHMA 3V4VH 5M7QA 5A2KH 1MVFA 2BNQD 2J6EH 4G6ML 4QHLA 2CDGB 4QRRB 1RJZB 1WJ3A 3GSOA 4XCYA 5HHOD 1VADA 2D4DA 3CVIL 1IM9D 4NN6C 5D9SB 3SY0A 3BAEH 5DJ0B 3WO3B 1JZ6A 4LSRH 4LPCA 5IV2B 1F6FB 4H8WL 1HHKB 1PQZB 2FX7L 1S7RA 4GRLA 4PRIA 3MA7B 5FYJE 2C1OB 4IMLA 1A6WH 5C0RL 1JNLL 4J3UA 4JRXA 4PRDA 3PJSB 4F15B 4AT6A 4PV8A 4WWKB 4NIKB 1EO8H 1OM3L 4NZTL 4QOKD 3DX7A 4JFYB 5MHSE 4LP5A 4WNQA 3KXFD 3WHE0 1G1YA 4K3EL 2D7OA 5FO8A 5LGHH 1MH5B 2WWMC 1ACYL 1I9IH 2EIZA 3O4LB 1CLZL 5HYJE 4DGIL 3O8XC 1HEZB 3RWEB 5AG9A 2O5YH 2MWCA 3K2UH 3FAWA 2KZ1B 2N4IA 1B3JA 4LIQL 4KVCH 1A5FH 3MRNB 2K9UA 3BOVA 2JELH 4EN3B 4R2GD 5GGRY 5FO7A 4WJ5A 4M1DH 2P5ED 1KJ2A 5BV7C 4U1IA 3FFCA 1QSFA 4GXUN 3LSOB 4JFOB 1ZVYA 2HTLC 4P5TA 5C8JA 2PR4L 3U1SL 3N1QC 1MCDA 4PIRF 3QAZB 1UYWL 4JFDE 2X1PA 4BFBD 3STBA 4P5MB 2JB6B 5E5MA 3OF6A 1WIOA 1HKFA 3N50A 5FM4A 3MQIA 3GMLB 1DBMH 6FABL 1D9KB 4O02H 5IOPB 5MENE 5A3ID 5E1AA 3AREC 5C0NC 5E8PB 1AHWB 1TZGL 5E00A 2LFGA 1RZIA 2A9MH 1ES0B 5H35B 4Z18A 4OZ4A 5MERB 3HFML 3WEXB 3E6HA 1J0KA 3QIWD 5MEPA 2GY7B 3Q6GH 2IQ9H 3L5WA 4ONHB 3O6LL 3WIFB 1ZGLA 1CGYA 1OAXH 4KV5E 3TP4A 5A2FA 4NC2B 1XGQA 3B9KA 3REWA 4Z8FL 4MYWB 3X12B 2GAZA 3BXNA 1AH1A 3A6CH 3KPPA 3E2HA 1MAJA 4NCDA 4MS8C 2IPUG 5F6IC 3IJYB 1VDGA 2FRGP 3CU7A 3MOQA 5DJ8B 1XZ0A 3CSGA 4BZ2L 3V6FB 3L7EB 3GRWA 1DEEB 2XA8H 2MSPA 4V2BA 4N8PA 4GH7B 1OP5K 1IC7H 3RFZC 5KZCB 2LTQB 3ZT5A 4M8QB 4Y5VA 5E6ZA 3BZEA 2W9LA 4AIZA 1KJ2L 2EEDA 3TPUE 1MCPL 4GMTL 5SX4I 1U3YA 3CSYA 4XBEL 3OPZH 1CGVA 1A6ZA 4I48A 1LO5A 4G6JL 3RGHA 2MOVA 2UWEF 4LAJH 1KCRH 4IRZH 2XPGB 4DFHA 2I5YL 3C8HA 5T1MA 4ZFFA 3QWRA 1GIGL 1T1ZA 2GK0B 1UB5B 2Q1EA 1CG9B 2MHAA 1MUJA 4NJAL 1ED3B 1UZ8B 4YHNA 5EUOB 1WUNT 4XVJL 3ARDD 4HKBA 5F96H 2Y1VA 5DRNA 2NXYD 1F90H 2UYLB 4GBXD 2Q8AL 4CU6A 4UAOC 1G7MA 4Y0GA 3O3BA 3GMMA 2JJSC 4EOWH 2NLJB 3LQZA 4N0CA 3MBEC 2ZUXA 4HIIB 4U7SA 4YPGA 3HN3A 2Y4SA 1DQJA 4HF5H 3EYUH 4UOW1 4W6YB 2VLJA 5DJDB 3W2DL 1A9EB 1IGCL 1SEQH 3QQNA 3MNVB 2BCKB 3GRWL 1VGKA 1C16B 1V7NH 2H2PD 4NNPL 3AS2A 3FONB 2EYSA 1AQKL 4KDWA 4F37F 1SYSB 3DGGB 5HI5D 3WNKA 2YSSB 4OGAC 1NFDA 4R0LA 4EI5C 2ATPA 4F58H 5C09B 3LRSA 1XF2B 1INEH 4BQCA 3PWJA 4LLMA 4FZ8L 1TTUA 3BFOA 4ZSOA 1TMCA 1ND0A 3OTTA 3DI2B 4ZUSB 2X1QA 2BY0A 4V1DD 3P4OB 1NLBH 2BVPA 2GSIA 3OB0H 2VDNL 5C07A 5DMIH 2FJHA 3O11B 2EYRB 2DM7A 3REVB 1JYVA 4HEME 4KDTC 1MNUL 1G7QA 1IILE 3OSKA 4PJEE 1EFQA 3MYJB 1EEZB 1MQKL 2EDBA 3U4EB 4X7FC 1FSKB 4NSKA 1RIVH 5M95B 4IDLA 2P7TB 1EVUA 4PRHB 1KJVA 3MRIA 1RAMA 3JWNC 4P2QB 5L0QC 3WXWH 5DURB 5B8CB 1P53A 5AUMA 1HCFX 1DUYA 2NQCA 4WFHE 3CMOL 4M93B 2H26A 1OSZA 2N7BA 3EKCA 3MV7A 4JKMA 4OCSH 4OZFH 3VXUE 4WFGE 5C0EB 3DMMC 2DQDL 2IH3B 2DN7A 1T4KB 2QSQA 4PJCA 1YC8A 4KHXL 3WNNA 1J1XH 2F54E 3UBXG 1FNSH 2OTWA 3JWOH 4LRNH 3PGDB 4YQXH 5D7JB 2V2XA 3HUJA 4NNYB 1LK2A 3B3IA 4XWGH 5E8NA 5ICXB 2B4CH 4L9DA 4NZUH 5CD5C 2WV3A 4PJ8C 1N8ZA 3LAFA 3F58H 3I3DA 4U1SA 1AO7A 3PWVB 2A6JA 4XNZB 4E41A 2ERJB 3FQXA 2P4AB 5BRZE 2DM2A 3MV11 5JA9A 3V7MA 3HMXA 3TZVC 3VWJB 3RUGB 5IWLA 4JGMA 4S10A 1XF5A 3GMQB 4MD5B 1Q9LB 5LXGH 4PGDA 4GO6B 1QBML 4Y4KD 5INCA 1OLZA 1VKXA 2W9DL 4PJXA 1WIUA 5L2KE 3P73A 1E27B 5ICZB 3IRZA 3MO1A 3NZ8A 4R97C 5FYJH 5F9DC 4UQ2B 1PYWA 5FKPA 4BZYA 2FEDD 5JNYA 4LSUH 5D7IE 3GSXA 2X4PA 3WE6B 2VDQH 2NY6D 1OAZH 5BS0D 5CJQL 1MCLA 2R2EB 3QIUB 5ESAA 3WJJA 1S5IH 1A2YA 3UTSD 2IMNA 6CGTA 1BJ1H 1DL7H 2EE2A 3WDJA 5C70A 3D39E 4MAYC 5LWYL 4JFFE 1RUMH 5HYEA 5IHZA 1BLNB 1AXSB 4ZUUB 5E6ID 1JHTA 4D9QD 3L3HA 4PJIE 4Y1AE 1R5VB 3MRLB 1GPOH 1G9MC 1IAKA 2GITA 1NGZA 1QR1A 4NKDB 5DO2C 5I73C 5IB1B 1BD2E 4I4WB 4WI6A 5C0DA 1B2WL 3S5LB 1U8OA 1QHOA 1U8IA 3HMXL 1TENA 1X9QA 3BPCA 1KELH 5TPWH 3SBWC 3OX8B 3NIGE 3KWWB 3HAEA 5GGQL 4OGYH 1QYGL 3L3KA 4KHTL 2OJEA 3CFCL 1QO3A 2HRPL 2XQYG 1RZGA 4OM0H 5F88A 4AMKL 4TQEL 4JHWH 1JGDB 4WW2F 4LIQE 1EEYA 4LCWE 1I3VA 5EN2B 2KDGA 5HVHB 1RJYA 4YHLL 2J5LC 2WNGA 4UU9A 4P2OD 4P2RD 4Z7NE 4BSWA 4NC1E 4QTIH 1T83C 1RZJC 3MV9A 3SDAC 2NY2B 5DFWH 3ALPA 2X89A 3HZMB 4Q9QH 5IBUG 1TFHA 5C0AB 1B4RA 3T2NL 1MFAL 4F3FA 4JRYB 1B6DA 1RFDH 1XEDA 3IXTA 2XQBL 2BMKB 4JHAL 4PRIE 4MDJA 1IJ9A 3SE9H 3EYQC 3E3QA 4Y16C 3LEXA 5D93B 2X4UA 1QTYT 4P3WA 4GW4B 3CFEB 3RTQA 5IVXB 3JVGC 4FQXB 4Z7OE 4APQB 4XNXH 3QDJD 1OAUL 3L7FA 4LQFH 4Z7VE 2R23A 5DRXB 1I8MB 1JGEA 4J3SA 4ZAKA 2BJML 5IBTH 3TO2A 4PJEF 2X4RB 3UJIL 2C1PB 3Q1SH 5JOEA 3GHEH 3D2UD 3X3FL 4QYOA 4U6HA 4XPTL 4I3RL 4GAGH 5IGXH 3ET9F 4YK4B 5TQ0L 2VKWA 1I8LA 1IGIL 4YDKH 5J4MA 5GSVA 4LLVB 1F4XH 3KLHC 1MAMH 4KJYB 3V2AR 1IZKA 1AI1H 5MEQB 2I07A 5AWNL 3DIFA 3P11L 1DSFL 43CAB 3QXAA 4YDIL 3HE7B 4HIEA 5L8LB 3ZLQC 1HH9B 1QSFE 1VEPA 2ZOLA 3K3QA 3ULVF 2FCBA 5CEXB 4L1HA 4DZBB 3T0WA 3HI6H 3P9WB 2X4TB 5JW5B 5E1HB 1YYMH 4YBQD 4DN4L 1YJDL 1MLCB 4Z7QE 1CVRA 4D9RD 5F9WB 1J88A 4J8RB 4IBLT 1CIUA 1MHEB 2XOTA 3VFUB 3EOBA 2A83B 3C09B 5DUMH 5DUPH 2I26N 4RWYL 1DBKL 3AY4A 4TPRL 5D7KE 4F33A 4V3DB 2IH1A 3MXVL 1IAOA 3SDYH 1FH5L 4IRSB 2GY5A 3ABZA 4GQ9H 3KYNB 5GS0D 5FKAB 1A7OL 3TF7A 2DQGL 5EZOL 2NXZB 3VFWA 1MFEH 1IC5H 1JGLH 1ZS8B 2DJ4A 3BGFB 5EU3B 2AJZB 2E7MA 4MB3A 1GAFL 1QSED 4GAJL 4ZUTB 3H0TB 4LBEA 1BAFH 4KKCD 1BJ8A 1BQHB 4L8SA 4HPYH 3LD8B 1N5AB 1R6VA 1ITCA 2XFXA 3S34L 4XTRC 1WZKA 1MIEH 2I9LB 4MZ2A 4U3CA 4ZDHB 3MJ7A 1FG9C 1J0ZA 3ARGD 1XGTB 1U0QA 2ARJA 1UACH 2VISB 5JW4R 5ID1A 4YXHL 5D7IF 5C08D 2VQ1A 2V7NB 4BUHA 1EXUA 3BX7C 2ESVB 4JO3H 4R8WL 4WIQA 1I1YA 5DJCA 4ZUWA 1NBZA 1SM3L 4CVXA 1RJLA 3ZDXE 3DXAD 4OZGA 3JV6B 1GC1C 3EOAB 3CLEL 2HJLA 1IL1A 1E4XI 5EA0H 3B6SB 3NGBC 3K4ZA 4QWWC 3NZHL 4L5FL 1KUMA 4PJIF 1UC6A 2GT9A 1MF2H 1U8MA 5DRWB 3HRZB 3VFTB 4XXDB 4KUCD 3OKEB 5BMFL 1DJSA 3IF1A 4FP8L 3ULVH 5KOVC 1PVHA 1W0YT 1YMHA 3OAYH 4ODBD 1PY9A 3LKQA 3SO5A 4MXQA 2V2WB 5GGVH 2YPLB 5LQBH 4LKCB 3HG1A 2PO6A 1KPRA 4XC3H 3NIGF 5CEZH 1J12A 1GGTA 2A73A 1UQSB 2F53E 3UYRL 3MLZL 5HPMB 4LF3B 4CW1B 2VLJE 3GB7A 2Q6WB 2EO1A 2DJSA 4C83B 1TZHB 4XP6L 2JB5L 1JTPA 1IAII 3K74B 3QCTL 4HT1L 4Z7WA 4NRXA 4HH9B 3MRPB 1RJCA 3PL6A 5HGGS 5KSAD 2H9GA 2UWEB 1CFNA 4Y2DB 4ZTPH 5AYUL 5A40E 4JFXA 4XGZA 4RNRA 4JY4B 5KANI 3S37X 1NFDE 4Z7NF 3MLPA 4YHPB 2IGFL 3U7WH 3WD5L 1XGYL 3CC5A 1RUAL 5ERWA 1TCRB 1J7VR 1PAMA 5IHUH 3RWHA 5CKGA 1L6XA 3V8CA 3M07A 1EVTC 3QUYD 4OZFB 3WSQH 3H2WA 4ZSOE 5ILTH 4PP8C 1UM4L 1YUHB 1L6ZA 1C08B 1D3CA 1HINL 5GHWL 2Z31A 5ACLA 4B7LA 3E0GA 4KAQL 5C07E 4JDVB 4GUPA 4FQQB 1HN1A 1ZAGA 4Z7OF 2GJJA 3TCXA 3ROOA 4X8XA 3CVIH 3RKDD 4QXUL 3G5XB 3LQAL 3QQ3A 1WWAX 4D2NA 3ARBB 1YEIL 3TA3D 5IJKA 4CNIA 4H8WH 5DD5L 2R29L 1ZLUH 2FX7H 5JIPA 1TTFA 2BVQB 2NY7L 2R56L 5E94A 1Q9KB 1WEJL 1A8JH 5TE7L 5J13C 4MSWA 2OM5A 4NRZA 4WI4A 5KSVA 1F2QA 5C0RH 1JNLH 3DVGB 1WCBA 3B2VH 3EYOB 1ULVA 3EO9L 1I3GL 2J7LA 4U1LA 1OM3H 3A0OA 4PJCE 4NZTH 4L29B 5MP6L 2FDBP 5F70A 4K3EH 1QEWA 5EO0B 3HA0A 2Q76B 4KJPD 2PTTA 5ANME 4ZXBC 4F57L 4DGIH 3HUJE 3VA2C 1TQCB 3FFDB 3WLBA 5KJRL 3HZKB 2RIKA 5T3XL 4LIQH 3TC9A 1N6VA 1U8LB 2FHFA 4QHUB 4Z7QF 3CXDL 4C57C 5DR5L 5K9JH 1AO7E 3TN0D 4HS8L 2QADC 4I3SL 4LPVA 4R7NA 1S9VB 4E41E 4M6NL 3TO4B 3LPFA 1KLGA 3G9AB 2HTKC 3MJ9A 1LHZA 1S7TA 3SKMA 4OLUL 3K81A 2PR4H 2ICEB 3U1SH 1IEBA 5DEGB 3RI5F 3C9NB 4Q9CA 1UYWH 3M1BA 1BIIA 3IXAB 1R3LB 5GS3A 2EDQA 2HT4D 2PCPA 3UPRA 2VLME 5I8EB 6FABH 3VU2A 4B5EA 4LNRA 4HH8A 3SCMB 1FLRL 3LHPL 5HI3D 4ODUA