3ARFA

Ternary crystal structure of the mouse nkt tcr-cd1d-c20:2
Total Genus 74
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
74
sequence length
294
structure length
293
Chain Sequence
NYTFRCLQMSSFANRSWSRTDSVVWLGDLQTHRWSNDSATISFTKPWSQGKLSNQQWEKLQHMFQVYRVSFTRDIQELVKMMSPKEDYPIEIQLSAGCEMYGNASESFLHVAFQGKYVVRFWGTSWQTVPGAPSWLDLPIKVLNADQGTSATVQMLLNDTCPLFVRGLLEAGKSDLEKQEKPVAWLSSVPSSAHGHRQLVCHVSGFYPKPVWVMWMRGDQEQQGTHRGDFLPNADETWYLQATLDVEAGEEAGLACRVKHSSLGGQDIILYWGSLHHILDAQKMVWNHRHHHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title A molecular basis for the exquisite CD1d-restricted antigen specificity and functional responses of natural killer T cells
pubmed doi rcsb
source organism Mus musculus
molecule tags Immune system
molecule keywords Antigen-presenting glycoprotein CD1d1
total genus 74
structure length 293
sequence length 294
ec nomenclature
pdb deposition date 2010-11-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3arfA02
3.30.500.10 Alpha Beta 2-Layer Sandwich Murine Class I Major Histocompatibility Complex, H2-DB; Chain A, domain 1 MHC class I-like antigen recognition-like 3arfA01
1N4XH 3SKOB 5C2BH 1G7MA 4Y88A 1JZ4A 5TDPB 4POYA 1HSBB 3GBLA 2BSSB 1HE7A 1E4XL 2KPNA 3O6LH 1J8HA 5DHVB 1A6VL 1KB5A 4MXQC 5F7DA 3VG0L 1W0WB 5HYJB 1MQKH 4HAGA 3QISA 4CN1A 4HH9B 3OKEA 4TTDC 4J7RA 3EYUH 3MOBL 4O9HL 1ZT7B 1J0IA 3FQTB 1JP5A 5A3ID 4ZTOH 4WCYH 1ZHLB 4EKXA 2BSRA 4KAQH 4BH7B 2YPKB 4P2OB 4NQDD 4MJ4A 3UZQA 3OSKA 2C26A 4WTXA 4AM0B 1DN0B 3S36L 1GRWA 4JAMB 4M3JA 4JREC 5AG9A 2KBGA 5T1KA 2D03L 3T2OA 2X42A 1ZT1A 4F33A 3SE3A 1I1RA 1ACYL 5B3JF 1NC4B 5EC2A 5J12C 5GSVB 1MH5A 4H1LH 4LPYA 1SHMA 4L8DA 2JCCB 3FFCB 1O7VA 4QXGH 1FFNA 1IAKB 5ESQA 4UIKH 2NY0D 3DARA 2WIIB 2GJ6B 2A6KA 3FZUC 3IETA 2CIIB 3PGFH 5CZXD 3SEPA 4LRNL 5KSAD 3QUKA 4BSWB 2CDGA 2V7HB 4CJ0A 3P30L 1A1OB 2A38A 2YSSB 4HS6A 5IVZB 1EUUA 3NPZB 3HE7A 3O2DL 2AEIT 3TPUA 3CLFL 1WIOA 4K9EC 5GJSL 2OSLA 2YK1L 2Y36H 2Z93A 1CDIA 1FNSL 2YD6A 2Q8BL 1AE6H 1S8DB 4I0PD 3IXTA 1I9RL 4L8SC 3D85B 1DANT 3MUGA 4LIQE 5FB8A 4PJIF 1OPGH 3UDWA 1OWRM 4JRWA 2IAND 2HJFB 1D5MB 4H8WC 4GXUN 5IQ9A 4OZIF 5K9QG 4PLJC 5E2VL 2GY5A 3DLQR 2YD5A 1R0AL 3BPLC 3C5SB 5ADOH 3RPIA 5FOJA 4QXTA 3EAKA 4NT6A 5KSVB 4OQTA 2WMPA 3GRWA 3FT4A 1T04B 3CZFB 4PV8B 1HQRB 1DP0A 3RL1B 1REIA 3WSQL 1P2CB 4OLYL 3WJJA 3QG6B 2AEPH 3ZKMC 5GGQL 1KIPB 4X99B 3BDYL 3FRPA 1M4KA 4KH2A 5ILTL 1IGFH 2EZ0D 3MODH 2L4OA 2OJEA 3VXSD 1O7SA 3UPRB 1H3TA 3RUGA 1G7LB 3ILQD 3UJJL 2GYSA 5I19H 4JPIA 3D0LA 2VKXA 3C5JA 3K46A 5JW4Q 5KSAA 2ZCHL 3MLPA 4HK3J 2XG5A 1NGYB 1BP3B 1R3IL 3BISA 2WQRA 2XA8L 5E6IB 3JZ7A 1DQTA 1I9JH 3Q5TA 4LBEA 5C3TA 4Q74A 5C0JA 3WKML 3HAEG 5IFAH 3FKUS 2WBKA 4S10A 1ED3A 1IT9H 1SEQL 1U3HA 4ELMB 1MHPH 3ULVF 4OZIA 3C5ZB 3N9GL 5IWLA 2CUMA 5CUSL 4KQ4L 1N7MH 3BSZH 3L7EB 4GFTB 3CXDL 5FYKU 1JGDB 4EEEA 4ALAL 4DGYL 4XNXL 2J6EA 4OCRH 4FTVE 1EZVX 2GK2A 5IV2B 3MJ6A 1D6EA 1IAIL 4X5LA 3CFEB 3LQMA 5TE6L 3BIAX 2V5RA 4LLYB 3F7YB 3QXAA 4JG0L 4J1UA 4HULB 4G8GD 5LGHL 1AFVL 5AYUH 1G7IA 1S7XA 2XZAH 4XP5H 1CL7L 4CBPA 4D9LH 1KPVB 3BPOB 5FYLD 3GBMH 2IFFL 3K7UA 1F97A 4JFDB 4JEGB 3LEVH 4DOHB 4C55A 1L9NA 2EE3A 4NHUE 4PV9B 1OF2B 3INUH 1KYOJ 4YWGL 4WI4A 1L0QA 5IG7A 2WV3A 2DTML 1MRCH 4NC1E 1XIWB 1RZIB 1TVBB 5TFSH 4M43L 5KSUA 1AI1H 1YEHH 1NC2A 1BX2A 2UZXB 3KHQA 4CVWA 3P3YA 4J4PA 4M8QB 1TZIB 2K7PA 4I3SH 1NPUA 3RIFK 4AEFA 5EC2B 1Q9WB 4NDMA 5FGSA 1H15B 1IGJA 4NZRL 4YNYB 1AO7A 3MLTA 4LLWA 3V8OA 4G8IA 5DURD 3WFHA 3QUZC 2Z8RA 4S1RH 4PJ8D 1QVOA 3B3IA 5BS0A 5JIIA 5JDSB 3FOMB 5JMRA 3ULUF 5GJSH 5LGKA 2DLEA 4NN5B 5JHLL 1HH9B 2P8PA 5CSBA 1WZLA 1J8HB 2CRMA 2YBRA 4MVBC 3ULUE 4OUOA 4PBVC 4KGLA 1HSBA 5D1QB 3IAPA 3VXSB 4XNXH 3Q5YA 2NCMA 1LDSA 5GRUL 3RTQA 1CXHA 2YD8A 4O02L 2VWEC 4F7MA 2H32H 4PFEA 5DDHB 1TQCC 3FB5B 1KJ2A 4Q6YA 4OZGE 2VXSH 4U1NA 2ITCB 2X4TA 2W1NA 1PY4A 4DCQB 3BXNA 1J12A 1AFVH 3QPQC 3D25A 5AYUL 3VXRE 3NTCL 5ESVA 3PWPD 1RMFL 3BN9D 1D5XA 4JO1H 3OJVC 2OX5A 4R8WL 3GSUA 4WI3A 4MNHA 5T1LA 2E9WA 3UROR 5C9JA 2YRPA 1U8LB 1EZVY 4XC1L 4Y2DB 4EI5A 1KCUL 3T3PE 1UH4A 1A2YA 5DJDA 2NW2B 3MRDB 3RL2B 3I9GH 1JTTA 2DYPB 2DM7A 5H35A 4KXZH 5E5MB 3KNBB 4EUPA 3HMXL 1PSKH 2L7UA 2MQ3A 1PG7H 4PRHA 4M43H 4PJIA 1KF9B 4G9DA 1EFXD 5J0BA 5E5MA 3SY0A 5ECJE 4RWYH 1I7TA 4JPKL 5A3IC 2COQA 4C56D 2G5BA 2Z31D 5FO8B 4GKZA 1B6DA 4ZDHB 1D5XB 4XPHH 3SGEI 5F93C 4M03A 2H8PA 1SEBB 5HVHB 3CFKB 2OZ4L 1JPFB 5EORL 1RK0B 1YPZB 3VXNA 2AJVL 2NLJA 3LEYL 4YQXL 1PDKA 5IT2L 2YD4A 5GGRB 1H8SA 4JFYB 1IBGH 1K85A 1K2DA 3OX8B 1I3GH 1JWMA 3KYKL 2VSCA 4Y5VA 2ITDA 1HCVA 1KNOB 1MF2L 4AL8L 5EU3A 3GIVB 5K9OA 4XCFH 3W39A 2DQGL 3EJZD 3QUZA 3BHBB 4V1DD 4TRPH 5E99L 1Z0NA 3IDMB 1BBJA 1UQSA 4HS6B 4G7VL 35C8L 3QIUB 4X98B 2FJHB 3QA3A 3CK0L 2OTPA 1BFVL 1AC0A 3T4AA 4C56A 2X1XR 2HVKB 4DW2L 2OXHA 5BV7B 1Q94B 1D5BA 3GMRB 1MH5B 5GQBA 5MI0B 1L7TH 1H5BC 1W8NA 1HKLL 4XB7A 4APQC 2IJ0C 4JZJC 4JFYA 5DJXA 3S88H 4I2XE 1KCSH 5D2NA 4WNQA 2E9IA 1NGXB 2LU3A 5DQJB 4QOKE 1MJJB 4R26L 1KCRL 4JQXA 3ARDA 3QFJD 3I3DA 4BKLA 4JRYB 4ZUSB 5T3ZL 5JPMB 2V5YA 1EIBA 3BN9C 4N8VG 4RFNB 4XAKD 5GGTA 2JTDA 1ACZA 5SWSA 4CVXA 2WNGA 5DO2D 1F3RB 3OG6B 4G43A 1E4WH 4C83A 2HFGL 3GSOA 1MCDA 4QRTB 1BJ1H 2VE6A 3RPKA 1N6QL 1CLOH 3TVMC 5DC9B 3WE6A 2XNAB 2OMNA 3BGMA 1TCRB 2K9UA 2XQYK 5GS0H 4WUKH 5EORH 1R5WB 4CVZB 5HHXH 3QO0A 1I1AC 4KQ3L 4P3DB 1YJDC 2EDWA 5I1GH 5FA3A 1G6RB 3RAJH 5C0BB 5IROA 1WBYB 1JYWA 5EO9A 1GC1C 1I3GL 1DBKL 4HWEL 2F8OA 3RI5K 4HT1L 3U9PL 3VXME 3KXFB 3DIFA 5CILH 3UTTD 5D8JL 1WCBB 1F4HA 3QUYB 1RK1B 3QEQE 2Y07L 1R3LA 3OJDB 4ELMF 3G9AB 4V1DA 1AGCA 1XR8A 3QXUA 4ZS7L 4YE4H 4A6YH 4JLRB 4LVEA 2ID5A 4UB0H 2X1OA 4HUWA 2R1YA 3BXNB 3KYNB 3H9ZA 1OAXH 5B39A 3QPXL 4Y5XB 3LPFA 2FEEI 4EIGB 4KJQD 1EJOH 3K8MA 1PBYA 1QEWB 1WC7B 1BQLH 4PRPA 5GS0D 3VW3H 4ONGH 1G7LA 4LSVL 3PDDA 3UBXG 3VXSA 1NCCL 1Z6JT 1CK0H 1IGCL 3E1F1 2AKRB 1K2DB 3W11D 2XTJB 1JV5B 3AAZB 4I48A 4JPKH 2GKIA 2P4AB 7FABH 3GSQA 3EDKA 5IESL 1J0HA 1FGNH 4MJID 3MLZH 2FR4B 3ARGB 1DQJB 4UDTB 1QYGH 1DANU 1T3FA 2KZ1B 4QRRD 3DGGA 4G5ZL 4B7LA 2ZCLL 3BDXA 5IHZB 1E4KA 1S7UA 4FQJH 4O2EB 4GRWF 2R0KL 4E41B 3R0MA 4G43B 4K7PY 1NMBL 4MAUH 4YDKL 1U8QA 4KRPB 1IEAB 1H15A 3LEYH 4YQXH 3ET9F 3MRPB 1T22A 5CJOL 4QGTA 1B0WA 4PJDA 4LGRB 5E9DD 4BM7A 4P3CL 1K4CB 4KK6D 1P1ZB 3GJFH 4PD4J 4RMUA 5D9SA 3L7FB 2W9EL 4MCYB 1TENA 1G7QA 4EVNA 3CUPB 5JHDB 5E9DA 4NQUA 1G9MH 3E6HB 1KACB 3TZVD 4HFWB 2CDEA 1QSFE 3MJ8A 2QSQA 4M93C 3DV4A 3S98A 3B9KC 5DK3A 5C0CD 5E4IA 3FB8B 4JM4L 2NR6D 2NW3A 5JR1L 2AERT 3S35X 1JK8A 5D7LD 3SDDA 1CCZA 3HE7B 3V6BR 3F5WB 3NZ8A 3OXSA 3LKOB 3VU2A 4WV1C 4WJ5B 2YZ8A 4C4KO 3PG2A 5GHWL 3ARVA 4NO3A 4QY8A 1KXTB 1LVEA 1JNLH 2R1YB 3MV8E 2IH3A 2VLRA 5IHUL 3NFSL 3V6OA 3MGAA 4NWUH 3ARSA 5C0AD 3GKWH 5EU7E 4LKXA 4MJ5A 1MCIA 4Y16B 4FQPA 5MHSD 2OTWB 5TJWK 3A67H 1I85A 1AD9B 4OI9A 5DUBB 4EJ1C 4KMTH 5KZCD 1A21A 4Y4KB 3P9LA 4WFGD 4XXCC 3TJHA 3HZVA 1KCLA 1G0XA 5EO9B 4PUBL 3JUZA 4JO2H 4KHXH 4UINH 3C5ZA 4WDIA 2I60L 3FHQA 1RURH 5HY9B 5E8OA 3TLRA 3QDGE 5JA9A 5HI5C 1FVCA 3VWJB 5I1AB 4RFEA 2RFXA 2PF6A 1JGUH 3DWTA 3G5ZA 5ELIA 3D3VA 1JMZA 3PF2A 4IBLT 4ZXBC 4LQ1A 5F9WC 3OV6A 3U0PA 4K55A 2AW2A 5C0CA 4WWKC 2G60H 5AZ2H 1N64H 1JN6B 1I7TB 3MJ9L 1NL0L 1KXQE 4M1GL 2IEPA 5T1DH 1WBXA 1X4XA 1BIHA 4LLWB 4BUGA 3WEXA 5JORB 5L6YH 2BSTB 1JZ5A 1T0NB 4NKDA 3E6HA 3MRGB 1U2CA 4PTUB 2OR9H 5IKCA 4G9DB 1TZIA 4NNXB 3QHZH 5J89A 4XHJD 1IEBB 5DK2A 2JELH 1Q0XH 1P1ZA 5DXWA 3TH2T 2P7TB 1VADA 2P5EB 3F6LA 4C59B 5T1LB 3GMRA 4YX2L 1T5XB 4DFIA 3F7QA 2ESVA 3HUJB 5F7EH 3EOYG 3BYYA 3B2UD 3HI6L 3UJTL 3F7RA 4NQCE 1S7UB 1J1XL 1BVZA 5GGUB 1J88A 4FQLL 5JLZB 2IG2H 1CIUA 5GHWH 4YK4B 4TSCH 1O5DT 1FDLH 1N6UA 4MWFB 3VGDA 3CFBB 4I13B 5EOQL 1HHHB 4EDXB 3H7LA 4FP8L 2YR3A 3CXHJ 1AJ7L 3U2SB 1T03L 5ERWA 4PS4H 3V52L 3IFLL 4PJCA 3CX5K 4MDJB 5T1KD 2R15A 3SE4A 1U91A 2GCYA 2DQEH 3TVMB 2DBJA 5H37G 5IESH 2FH8A 5DJZA 4LHJB 4PREA 1R3HA 2BC4B 3GMLA 3QZWA 3FQUA 1KYOK 4GW5B 3SDCC 5IMMB 4X9FA 4Y5YC 1J8KA 3NIDE 2E8YA 4FRWA 3GEWB 4AT6A 2C3GA 2JKXA 3OGOE 2D4FA 2HTLC 5CMAB 1RJLA 1KV3A 1N5AA 1M6OB 4LPCA 2MJWA 1EFXB 2DI7A 3O3BB 1YEKH 3U0TB 4XHQA 1AC6A 2D03H 3RX7A 4G8EA 1ZWIA 4N0RA 3SKUD 3MV01 3OWEA 3D48R 1NLDL 3SJVA 1LHZA 2BSTA 5MEPB 3TBYB 5DRXB 4TPRH 1GGIH 3HI5L 4ZXBB 1MCWM 4BH7A 2IQ9H 2JK5B 5GRWA 3FQTA 3GDBA 1DCLA 3VD9A 2VDLH 4DVRH 1RSFA 2RFXB 2Q8AH 5C07D 5IW1A 5KVEH 43CAB 1YEFH 5ISZB 1CXEA 4JY5L 1IVLA 1HDMB 3GSOB 1ZAGA 5J12B 3VFWB 2VIRA 4IJ3B 2AXGB 3MBEC 3QJFA 1OP9A 4MQTB 4U1HB 3FO9A 4NQVA 4GW4A 2B20A 3TNMA 3SDAB 5DMYA 3JVGC 4XMPH 2CLRA 4BKLB 2ADFL 1KCVH 5BV7C 1YPZF 2VYRE 3ARGC 4Q2ZB 1DBMH 4PP2B 5C3LD 3AMKA 3PP3H 1F58H 5IGXL 3LN5B 2VQUA 3DVGB 4H5SA 5DA4A 2V2TB 2KQNA 1XF1A 3HCVB 1U8HA 3KPNB 3GJEB 1CXFA 3HNSH 1F6AB 1YPZE 4FQQB 4XH2A 4XPBH 3T77A 4TULL 1FZJA 5FDWA 3L5HA 4WWKB 3IRPX 1A1NB 3PWPA 3I6GA 1L4IA 3IJYB 4LBEB 1FYTD 2G60L 2R1XB 4NM8H 2BNRA 3HLAA 4TTDD 3HUJE 5JHDA 1T1XA 3VA6A 4LIQL 2R0WL 3P0YL 3T4YA 5E70A 1BD2A 3W39B 2Z8SA 2XKSA 3JBG7 2FL5B 2P45B 3RU8H 2IPKA 3PDOB 2W38A 3QDHA 1U3HD 4OZGF 3P9MA 1ZSDB 4F7EB 3LRHA 3RY6C 5FGCB 4L4VD 3EGSA 4LFHG 3RIAF 3LRSB 3W9DA 2ZOLB 2OYPA 1AGFA 3O3BA 4R4FL 4Z7VE 2YZ1A 2GW5A 2W65B 4WFGE 1HQRA 4G6FB 2IQ9L 1Z9MA 3DYOA 5F1NB 1JZ8A 3SDXF 4DFHA 4RMSA 5IB2B 1NANH 1T3FB 3BH9A 3ARGA 3WUWA 1MCPH 5HDQL 5C92A 3U30B 1Y6KR 3FQUB 1A6PA 3MV7E 5CSZB 4ZG1A 2IG2L 4WEBL 5I0ZA 5C0RL 1T89A 2YD2A 4ZO7A 1HKFA 4JFDA 4MNGE 1FL5A 4QRRB 3TH4T 1UM5H 2RR3A 2ZG1A 3QYCA 4QHUB 5D1ZD 4FTVA 4FP8H 4HPYL 4JDVB 3OJ2C 1GOHA 3TA3A 3O8XD 5H94B 2ADFH 3U6RA 2GEEA 4PRHD 1KB9J 3MFGB 1G7JB 4LLYA 1QLRB 4AYFA 1IM3B 4G8FB 4PYHA 2WBJD 4LVNB 4M5ZH 3ZE1E 2GUOB 4WEMB 4PGCA 5DC4B 3LQZA 1OTUC 1T2QL 3ZDXE 2B4CC 4GQ9H 1S78C 4H25B 4X6CB 5DJ6B 3CU1A 4ZS7H 2RJMA 3EDJA 4U4BA 2NR6C 2UY7A 5DJ6A 5ISZA 3QUYA 4GO6B 3ULVL 3SJVE 2MSPA 4MD4B 1LEIB 2XOTA 2AJUH 2ENYA 4NZJA 1KUMA 4PJ7A 1FZMA 1CG9A 1E6JH 5JOPD 2DQCH 4JFXA 5TE4L 1C5DB 4G80B 4HC1A 3BPOC 5JXED 4K3HA 3C60A 4R0LC 4WHYG 1FAKT 1Z5LB 5L9DH 4U6YA 1F4XH 5I8CA 1T0NA 1ZGLP 2O61B 3GKZA 4ZUVB 3EYSL 3OKDA 5D70H 3WFCH 1P84J 5DD3H 1FL5B 2RQ8A 4LGPB 2VDLL 4H0IA 4LF3A 4IJ3C 2XN9B 2XT1B 4S1RL 1U2HA 2N1KA 4JFFD 3G5ZB 1MNUH 4S1SH 3LDBC 1C12A 2FYYA 4QXTB 5DHVA 4YFLI 5K9QI 1QACA 4KQ3H 5DGQA 4UILL 1NAMH 1NGXA 1KCVL 4JZOA 4Y4KA 3GMMA 5B8CB 1N26A 4B5EA 2DJUA 3AMLA 4OZGA 4HJ0D 3DJ9A 3BEWA 3DVNB 3MCKA 3EGSB 3S35H 1WAAF 4JFED 5GRUH 4M6NH 2BRRH 1J8HD 5CFHA 3UPCA 2VB5A 1RZIA 3L3KA 1HINH 4HPOH 3TBSA 2VDPH 1MWAA 2C4FT 3IXTB 3MROB 3IVKA 2A1WH 5I71C 4FQXB 1TJHL 1YNTA 2C1PA 2P44B 4M93B 3ARYA 1ZVHA 1SBSH 4JRXE 1S7SB 4OZFG 3CLEH 4N0UB 1ZLUK 4OGXH 1WISA 2HRLA 1I75A 5DUMH 5GGUA 2R0WH 3P0YH 4L29A 3CH8A 3T0AA 4HJJH 4LCWA 2DS4A 5I75C 3C60C 2WY3A 3KPNA 1BQHA 2PR4L 2YKLL 4RGNE 4M02A 2EXWD 4PJ9D 2DI8A 1I9JL 1OP5K 5FXCH 5CINH 4BFGA 1INEL 2I24N 3P0GB 3KPRD 1V7ML 4AEIH 4AK1A 3IXAB 1S78D 5I1LB 2A0LD 3MA7B 4XNQB 4LLQA 4PJDB 4PY8I 2OI9A 5HVHC 2NY1D 3K4ZA 2GTZB 2R4RL 4F33B 5DJAA 1NBZB 4GKZB 3MACL 5ALCL 2NY6C 5TDOA 2G5BB 3U36B 2HTLD 1U3HB 4OZIB 3SKJH 1FSKB 4ZPTA 3ULVC 3BP6A 4ZTOL 1CDYA 2Q7YB 4KRLB 4C58B 4BQBA 1FYTE 5FF6B 1A3LL 3MLUL 2BSED 2ED9A 2AKRA 1CYGA 3QULA 2FGWH 1ACYH 1QRNE 1BFOA 2OJZL 2WUBH 3PQYA 4ETQA 1LWRA 2DICA 4IM8A 1I4FB 4R96A 2CXKA 4H88H 2EDXA 4U49A 4JE4B 4XCYB 3LKNA 4LOUD 3DXAB 1WQVT 4HDIA 5I1DA 5DQDH 2OTWA 3S34L 4QRPD 2DQFA 5CMAA 5GGVL 4DEPB 2B2XH 2EDKA 4ZSOB 4ZAKC 1UJ3A 2E9JA 2V2WA 5IJKA 5AUMA 5IVXB 4F37K 2NY5L 3UJIL 3O6FC 5GGSA 3LN9A 1EK3A 4NZTH 3AROA 1S7QA 4PJBB 3GSRA 2NXZD 1K8IB 1U8IA 3DURB 3VFVB 5DUML 2A6JB 4R97B 1BVLA 2W0PA 3BD3A 4DZBB 3CDGB 3P4NB 4F3FA 4BK5A 1S3KL 3S6CA 5J9PB 4HFUH 4HFWA 1Y0LB 4NKIL 3RWHB 3UTQA 2M2DA 5DFWH 5CSGA 4P5TA 4HG4J 5GGRY 1KPRA 3GGWA 2R8SL 1IM3A 4G8FA 3ULSA 4PUBH 3O3AB 3RWEB 5DS8A 1A7OL 4QRPA 4OIBA 2VDNH 4JY6B 3DX6A 1NJ9B 1U8PB 4JM2C 3FRUB 5D1QD 3PJSB 5SX4I 3O6MH 2XXMB 1OT2A 5CEZE 4HZLB 1CXKA 4QRTA 3UTTA 3FRPG 4RIRB 2ICEA 3WHXA 4FNLL 1IEAA 5JIKA 1UYWH 4ZO6A 1FAIH 3RHWF 4DKEL 1IKNA 4HKJB 3OBAA 3WUWB 5D6CA 4N8CL 3B43A 5F9DC 5EUOF 2PW2A 2A6KB 3FB6B 5J6GA 1MJ8H 2WINB 5KW9H 4X6DE 1F4YH 5INCA 3WLWC 3CFJA 5FCUL 4S0TD 1NH6A 4Z76B 1TTGA 3EJJX 1D5BB 3OJMB 3MRKA 2HH0H 5IK3B 3WFEH 1VESA 1C8PA 3SGEH 4DKFL 1KPUB 1OAQH 2VZUA 3IKKA 4LVHB 5ENWB 3HPLA 4YE4L 4A6YL 3QWQB 1SY6A 3OKNA 1KFAL 4RMQA 3TPUE 2MKWA 5DQ9B 2ADGA 1J0ZA 3VFGL 2YK1H 1H3VA 2XG4A 4KI5F 3G5VA 3QO1A 5GIRA 5IBUG 4ZFOA 4M7KL 2QL1A 1LD9A 4OLWL 2WP3T 2OMBA 2WW8A 3BRFA 3OKKA 4KV5E 1LDPL 1N2RB 1INDH 4LVOC 5CINL 4QWWD 4OCRL 4NP4H 4ENED 4U1MB 4LASL 3LN5A 4ODHH 2PTTA 2AJSL 3KJ4B 3PNWB 5IGXH 1K9TA 1T21A 3G5YA 4DVBA 5LGHH 2C3HA 3RNKA 5FA3B 4R97C 1QPPA 4NQVB 4TUOB 4U1HA 4V1DE 2CDFB 1CDUA 4LNVA 2W0FB 4FQJL 5IB5B 2QV2A 4OCMC 1V3LA 1ZHKB 1CFNA 5IW1B 2X70A 2DM4A 3W0WD 1TDQA 5T3XL 4NN5C 1I3RB 1WCQA 1JTPA 1IGFL 4NCC2 4YDJB 4PLOB 1ZGLA 1MJ8L 2FEDC 1U41A 2ENSA 2A77L 3IJSB 5E9DE 4PRNA 4MCYA 5INDA 3L7FA 1K6QH 4DZ8A 1D5IL 3WJJC 2BDNL 3L1OL 3IJHA 4L3CB 5DEFB 5IVXE 4WNQB 1JPTH 5ANMB 5DZLA 3RL2A 5LWYH 4PY7B 1A2YB 5DJXB 1XGRB 1R3IH 3NFPA 4UIMB 2J3SA 2H26A 4GBXC 3JV4B 3VE0A 1DE4A 2B2XL 4JGUA 1KN2L 4M48H 3PWNB 2VAJA 4CJ1A 5DVNA 3CMGA 3ETBF 1FORL 4JM4H 5JR1H 3ARED 5L2KB 3H8NA 1JGLH 4YHOL 1OT1A 3IF1B 4FQCL 3DI2B 4JCLA 2Y5TA 1KXVC 5IVNA 1E28A 3MLWL 2X6MA 5FA4A 4KUZL 1UZ6E 1VEPA 5DHYA 4U1NB 5ADPH 4YIQB 3OL2A 2NY4C 1NCAH 2FJFB 2ZJSH 2Y23A 4NKIH 5DI8A 2XTJE 5HI3D 3CD4A 4KI5D 1U91B 3O45B 4QHMA 4M7LT 2VLKB 1AGEA 3BAEL 2Q6WB 3D0VB 2PTVA 3U2SA 4PTTB 5B3NA 1GHFL 4JG0H 3WKNA 4KK5D 3GI9L 4UUJB 3AUVA 1H9VA 4ZNEE 1S5HB 1I3VA 3O3DB 3VGGA 5MENB 1HILA 4IIQC 5IJVB 2ARJA 3H9YA 3QCUL 2YD7A 3MR9A 4TNWF 2YSSA 3KPLA 4Y8AA 1CFVH 5CHNA 1XGTA 4KVNH 3TFKC 5GZOD 5FCSH 4XT1C 3VWKB 4Q0XL 5ICZB 2M26A 5AYQA 1MCWW 1YEJH 4XCCH 3OTTA 3QIWC 4EN3C 3NCYP 4NDMB 1TQBC 2DTSA 1WVZA 1DE4B 5A2IH 3HFML 5DYOB 1CT8A 1PX3A 1MI5B 1PG7L 5ICYA 1HI6B 4BFBD 1ZT1B 4O58H 4NQSB 2LV4A 1WBYA 4U6XB 3SGDI 5DD5L 5DRNB 1CTOA 3UTSD 4ZFZA 5B8CC 5I1KL 3QEQB 4MQSB 2HKHL 4L5FH 1FGVL 1F8TH 2XPGB 3ALXA 4X6BA 1ZGLB 3QO0B 1NC4D 3WNOA 4EXKA 1RZKL 3T2NL 5FGBA 1H3PL 3OKEB 5HDQH 1WBXB 4KHTH 3QH3A 5J4MA 3O11B 3CSPA 4P2OD 1RU9L 3DROA 3UCRA 1JRHL 2YXMA 4OLWH 4HKBA 4X5XB 4KDWA 2X4PB 3QNZB 5I1JH 1C08B 1SQ2N 4EDWL 1NAML 4KJWC 3HE6C 4JPVL 2FIKA 3QXWA 4TVPD 4ZS6D 4DCQA 3KPRA 2ITCA 1BOYA 3ZT7A 5IFHH 1IAIM 3TGXA 4HWBH 3P4OA 4O02H 2F58L 4FQ1L 4XPTH 4N0FB 4F9PA 2OL3L 4FQ2H 3GHBH 2JJSA 5EPMA 1RD6A 2LQRA 1JF1B 1U42A 4L9LC 2X44D 4D3CL 4GRLC 5FYJD 4BSVA 5AD0A 4UT6H 3BKCL 3L3OB 1WTLA 3ARUA 1N5YL 3B2UC 3RA7L 1S7RB 1YDPA 2X4SA 4HKXB 4PJXB 1W8OA 1SBSL 1XF2B 3GMPB 2I25N 1HXYA 1R3KA 2IPUK 2W60A 4ODWB 3KPSD 5C8JA 1HHGB 3VWJD 3QRFM 3STBA 4MJIA 1IGIH 3BPCB 3SDDB 2GAZA 1CLCA 4OCWH 3QDAA 4KKCC 2ATKA 3C5JB 4NFCA 3SO3C 5E1HB 1T0MA 3L6FA 2IAMC 3NCFB 4CAGA 4WI5A 1KGCE 1P7QD 3UPAA 1HHKA 2A77H 2V17H 2AABH 1R5IB 3FQWB 1CFBA 3DX7A 4JANA 3A0OA 3TA3D 1OAYL 5ICZA 2MTPA 4O51A 2DLTA 4GRMB 5D7KD 2AJ3A 3NCMA 4XNUH 4YHPB 3QG6A 2VXVL 3K8KA 2NX5A 2XTLA 3BD5A 2HKHH 5C0AB 2HMIC 1ZXQA 1UKQA 1YPZA 4TSAL 4N68A 2EYSA 3DV6B 5CEYA 3REVA 5I1AA 3KR3H 4DVRL 1NGZA 3BEVA 3TBTB 4S2SB 3RPIB 3FAXA 4ONOA 2OZ4H 4RGNB 4EN3D 4OF3A 4KMTL 2JJSC 3OAZH 1KEMH 4M6ML 1DDHA 4OB5H 5GS0L 1CGSL 4WUKL 3BKMH 3OZ9L 3L5XL 4DKAA 5GZOC 3TFKD 2FR4A 5FYKD 1MQ8A 2X4RB 4FXLA 1UEYA 4NPYB 4ONFL 2J88L 4JY6A 5A16B 2VTFA 3QHTC 5MENE 4IRZH 5FA4B 1C5BH 3K1KC 1EO7A 4PJIB 2HRPH 2ZOKB 3MLYH 1JUFA 5B39G 1MAMH 2B4CH 4JKKA 3WL9B 4LQFH 2HN7B 3SBWA 4DKDC 3TYGL 4DQOL 3TBWA 4OQTH 4DEPC 4HQQH 3RNQB 3EO9L 4GAGH 1FO0B 5IF0A 4RFOH 2FNBA 4PJGB 2HJLB 4GXVH 3MBED 4DW2H 3RUGE 4R2GC 4LCWD 2VDOL 5K9KA 3P11H 4XP9H 2OCFD 4HWZB 4YC2C 3DUHA 4FFVC 1G9NC 3ROLA 1QSFB 4YDIH 1IKFH 3QAZB 1S3KH 3HFMH 4X7DC 5L2KE 2OL3B 4F7MB 1FVDA 1A6WH 5GPRA 3VG9C 3X11A 1WCBA 3DIFB 4N1EA 1N3NA 2X4NB 1EEYB 4ODBD 4PJIE 2VQ1A 4XBGB 2G9HB 3L95B 4M4RA 5IEKB 1EO8H 4FHBD 1CD1A 5L88L 5TH2B 5F88A 3L3HB 1RIUH 7FABL 3VXQA 3RNKB 1HH9A 4LGSB 3VXUE 5FUCE 2YPVL 4BJLA 4KJPC 1R5WA 4MS8C 4CVZA 2ED8A 5BXFA 1MCPL 1QFUL 1FCCA 2BOCA 2VLLA 1A7PL 5CKAA 5DA0B 4MZ3A 2X9XA 4G8IB 4X83A 1QR4A 3PHSA 5HHXL 4PJ5B 4N0CA 3HG1B 1NGWB 4N8CH 3SKOA 3E8UH 1ZS8B 2ARJQ 1OLLA 4QWWC 4CNIA 3ULUD 4ONFH 5DD0H 2F58H 3MA7A 1CLYH 3M8OH 4FQ1H 2ILLA 4IRJA 3HNVL 1KLFA 2I27N 1G9NL 1NUNB 4YLQT 4JKWA 1NBYA 5I66A 4D3CH 1A0QH 1QTYT 1T83A 1MWAL 4P5MB 5IHBA 4NHUB 1MCKA 4GW1A 5EC1A 4KPHL 3VFNB 4IRJD 1HCFX 5DT1L 4QRUA 4MMXC 5DJCB 2D3VA 2FD6H 4L29B 4R90L 3CSYA 2GFBB 2ZUWA 1MELA 3PWPE 3ZKXB 5I19L 1NKOA 1CDHA 3IAQA 4I18B 2ZG2A 1GIGH 1TZGL 5HHNB 1HQ4A 2VDRH 1ZLWK 3SKNB 2EDEA 4P4KB 4BSWA 1SBBA 2A0LC 5EIIB 4G42B 3T0EB 4HUXA 3IETB 4HGWA 3LHPH 4HKJA 5I76A 2BVTA 1DLFH 3D2UD 2XN9E 2FHFA 1NEZA 3X14B 4DN4H 5JOPE 3MRMB 3RVUD 2IBBA 3T2PA 1UM6L 2P8MA 1CICA 1ZANH 3L7EA 4MA8H 5D72L 1DBAH 3MLZL 1BD2E 3EHBC 3MLXL 4IMLB 3CXDH 3FRUA 3ZTNH 4JFEA 5CZKA 3ULVE 3VFPB 5FYJE 2QR0B 4IRSD 1WBZA 3GM0A 1QG3A 5LKNA 2FYYB 1UM4H 1R24B 1KEML 4M6MH 2RGSA 4U6HA 2EZ0C 3KPSE 3RTQC 1XF5B 4DUXA 4APQB 3G6AB 4F15C 1E4KC 2X4UA 1I8IA 1EEQA 4L9LB 4JVWA 1XZ0B 4ZUVA 1LK3H 4U1SA 2BSSA 1HEZA 2BY3A 5E08L 2PCPB 43C9B 2J5LB 1KJ2H 1KT2A 3VXPA 2AV1A 4BELD 1JGVH 4QOKB 3S35L 5I71B 3DX9A 1W2KT 2DMBA 1G7HB 1JPST 5HHOE 2JLLA 3MQIA 1C16B 2CRYA 3HZMA 4M6NL 4GKNA 1OP3H 1S9VB 3DSFL 4O00A 1LO0L 2QTEA 3ARQA 2V2WB 2QQNH 4NRYB 3N06B 3M07A 5HDBF 2J1KA 2BHUA 4P23C 4F37F 1JYVA 2DQFB 4GBXB 2NW2A 5KANG 4WI2A 4MXQA 1I1YB 3TIEA 3VXTB 3LIZL 2NY2C 4TSBH 2F74B 2Y72A 1GPOH 3P0VH 3MUY1 3HA0A 3SDCB 3R8BB 1XAUA 5E6IC 5SV4A 2FLRT 5D5MF 3MGOA 1TCMA 3LKSA 1LDPH 5KAQF 2EDLA 3D25B 3T0ED 1I7UB 2HFEA 3VD3A 3U83A 1H8NA 3O0RH 1VKXB 5JW3L 5EOQH 4NNYA 3V6OE 2X41A 5FYKE 3REWB 3N1GC 5HYQA 1A1MB 4PRIB 5AG8A 1KBGL 3SPVB 2ZCKL 4AEIL 2YOCA 2P43B 3L3GB 5ETUA 3TV3H 3KPRE 4U1GC 2R69H 5H94A 5L2JB 4TNVF 3LKRA 5EZOH 3C8KA 3O9WC 3MOAH 1VCAA 2X09A 5D72H 3UTOA 3T8XB 3QFDB 4UV7H 2OSLB 5C0DB 5EU4B 2B0SL 4JQVC 3HC3H 1YQVH 4OKVA 5GISL 3OAYH 5HI3C 1JVKA 4JHAH 3M45A 3IGAA 2CMRL 2X4OB 3J7HA 2CUHA 5HHPB 5FAAA 5L6YL 4HD9A 4MJ2A 4PJFE 3EYOA 3QB7C 2FSEB 1B0RB 3WSQH 1VFBA 1KG0B 4Z5RA 4X4ME 3C6SA 5JQHC 2OS7A 1CE6A 1CLYL 3M8OL 3FMGL 3RIAK 1D7FA 2JCCA 3FFCA 3QHZL 4RX4D 5E1AB 5E08H 1XGQA 3O41B 2E7HA 3HNTH 3L1OH 4ZAKB 1MAKA 2ICES 3BP7B 1QSEA 4JO1L 1B4JH 2FEEL 2VLME 2PNDA 1HIMH 1A0QL 4K7PL 1M05B 4HCRA 4AZ8A 2CGRH 2NY2B 4F7EA 3DSFH 5FYLL 3UTTE 3S4SG 1MCNA 1OOAA 2IC2A 4GG6E 3MUJA 2DKUA 1RZKH 1ZTXH 1E4XI 1E0OB 3T2NH 3UEZA 2BSRB 4X7CC 5C09A 1WTGT 1PSKL 1N8ZA 4UQ3A 5KSAC 4YO0A 3G5XA 4FZ8L 3TIDA 5F7WC 1YEFL 4OGYL 3I85A 3EYQC 2R56H 3WNLA 2WWKT 3QNYB 4JFFE 1U8MB 1Z0MA 4OV5A 3QDGA 4Z77B 4OM1H 1A6VH 4EDWH 1TVDA 2PKDA 3FOLA 5HD8D 1GC1L 1IGML 1F6FB 2FX7H 1E27B 1HNFA 3BZFA 5C0IB 4J23A 3TA3C 1DBBL 4K3EH 2ADIA 4M9OA 4NJ9L 5IQ7L 1VERA 4P57A 3ARBB 1G7PB 4L8BA 2X4QA 4WCYL 1AXTL 2FWOB 3AFLA 3GHBL 4FQ2L 4IOFC 5EBLB 4YDVA 1XIWD 1MVUB 3MLXH 3FFCD 1T5WA 4RX4A 1ONQA 4OF6A 2NY1B 4KJPD 4OGZA 2DDQL 4WEUD 5IEKA 4KTDL 1PG7X 2AXGA 4G6JL 2W0KA 1A6AA 1OTSD 4CMHC 1WZ1L 5A2FA 2FEDD 3CX5J 1Z9SA 3LMJH 3U7WL 2YXFA 1RIVH 3C8DA 3P4MA 4PJ9B 3FT3A 4WFHD 1QSFA 4XCFL 1ZGLM 2B8OT 1JHTB 3FO0H 4HWZA 5D93C 5ID1B 1FZOA 4G9FD 1TPXC 4I1NB 2VMFA 1YEDB 1DQQB 2EYRB 5GRJL 1H0DA 3LN4B 3FAWA 4NYLB 4YBQC 1RJZA 5DF0A 3VWJC 1QO3A 4H25A 5D4QA 1UB6B 2UWEF 4Z7WE 1XH3B 1JCKA 3VXUB 3B9AA 3PWLB 1X5IA 4MA7H 1MFDH 3K2MC 3PWJA 4NFBA 3ULVD 2VZSA 4OLUL 1OPGL 3WXVH 5BO1H 1QLRA 1QZ1A 1CTNA 2VUOA 1C16A 3HZMB 4DN3L 5K59E 2R56L 4Z9KB 3V4VH 3TA3B 2AXHA 3AU1A 3WS3A 1FNFA 2R2HA 1FPTL 5EU5B 3OR7B 3H3BC 2P5EE 4UOJA 2B5IB 2H6PA 3MRFB 3O8XC 5BS0E 5D2LF 4NQXB 5IEHA 3A6CH 3EO0A 5IIEA 1QSEE 2D4DA 3PQYD 4HF5H 4Q9QL 4J3TA 2BVEA 3QEHB 1UXSA 1QRND 8FABA 1N6QH 1EGJH 1UA6L 1FSKC 4X6DA 1MFAH 4HUVA 4IOFD 4RZCA 2V9TA 4JY4B 3BH9B 1ODAA 3HNSL 4HLJA 4P4RA 3C60D 4LCIL 5SX4H 1YJDH 1U8NB 4JFFA 4PGDA 3M17B 1V05A 4HQQL 1UWEH 5JLZA 4P2RA 5D93B 4HMCA 4QHKI 4G6JH 3B5TA 3RBSA 3ILPB 3L5WB 4ZOEA 2XYCA 4ONHA 1ZSDA 3NH7H 3GJFA 4E41E 4HUXB 2V17L 3THML 3ES6B 2P7TA 4W68A 3PDGA 4ORGA 3O9WA 1WITA 3T0EE 2ESVE 2PXYA 5TE4H 2O5YH 2DLFL 2EE9A 1IAKA 3BMWA 5ESQB 2VXVH 4WW2B 1K6QL 4Z7VB 2BOBB 2H9GA 3GSNB 4ODTH 2D7TH 3QDJB 1IAMA 1SVZA 5CBEB 4I0PB 4MAYD 5EO0B 2P5WE 1FG2B 2DKSA 1FH5H 5IMLB 1MCJA 2YEZA 5T1KB 5IFJA 1S7TA 3MRLB 2XRAL 4AM0A 2M1KA 2I9TA 1P9MA 4XPHL 4X0KA 4YHOH 3EYVA 4P2QB 4NWTH 3WLBA 4OLUH 4NZUL 1I1AA 5BO1L 1PAMA 3WNKA 4F7CA 4X6CF 3G6JB 2WIMA 5EDXA 1IE5A 4N90D 1LILA 3BP4A 4DGVL 2XWBB 1GZQB 3PE9A 4LCCC 2BK8A 2A83B 3UX9B 1VGEH 4BK4A 1OM3L 3MOQA 3D2UA 3O6ML 1YUHB 4GS7B 3CFIC 4K94L 2XACC 2P49B 3K2UH 4I2XA 1EUTA 2WBWB 3BAEH 4QRQA 1AGBB 1KCGC 1XMWA 4LLMB 1GHFH 3T0DA 4H26B 4YWGH 5E7FA 1D9KD 3HC4L 4TOYH 1JTOA 4F9LA 1MRCL 3RWFA 4OQTL 4RNRB 1MY7A 1PG7W 1RUAL 1DQLH 3WHE1 5C09B 4GG8A 2B1HL 3BFOA 2OQJB 1UG9A 3ARXA 4NOFA 5GS1A 3HUJF 3GI8H 4G7VH 2CLZA 4P99A 3KDMA 2G9HA 1U8KA 5FCUH 3SJVB 2NNAA 2GT9A 4KK6C 1HXMB 3PIQA 4RRPG 3JTSA 4XP9L 5A2KH 3NIFE 1XZ0A 4E42B 5L0QC 1QSEB 3GSNA 4XVJL 1OAUL 1YMMD 2PYEE 3HMWL 3ZYIA 3T0XA 3BUTA 1M6OA 4ZD3L 5T1MA 2R0ZL 5I73B 5I9QB 2GY7B 3RRQA 2CJUL 4Z5RB 4X4YB 5D2NE 1FLRH 1KCRH 2V7NB 3TCLB 3EYOB 4PB9L 4Y5VC 3ISWA 4M6OL 5JTWA 1LE9A 3DUUB 5FKPA 2D7TL 3TO2A 1FFRA 4M7KH 3RNQA 4NO5B 4Y4HC 3LKPA 3U0WH 4PREB 4AEEA 1C7SA 1U92A 1NFIB 2Q86B 3GKWL 2KQMA 2NTFB 5EU4A 1E4WL 4FMKA 1OW0A 3D0VA 3SKJL 1LO4H 3MMEB 4KTEL 4YGVA 3LY6A 4Z18A 4ZFFB 4PRDA 4LLDB 32C2A 4X6EB 1UVQB 1U93B 3PV6B 4N0UE 5GS2H 3B2VL 5DK0A 4XNMB 2NY7H 5JUEH 1A8JH 1G84A 3AAZA 1VGEL 1MQKL 3DPBA 1X5YA 3U4EB 2WUBL 3I84A 1LEKB 3WIHA 4MNGA 3PABA 3QCVH 1UVQA 1QLEL 1FHGA 4X6DF 5FM5M 1AIFA 3IU3B 5HDBE 1R5VA 2RCSL 2OL3H 4PJ7E 5IR1B 1XCTA 3BZEB 3E6FA 2R2HB 4JHWH 4ZFOL 4DGIL 5EC1B 4LCIH 9CGTA 2FZ3B 3WXWH 1I3UA 4PJHF 5D96B 5DT1H 1IGYA 3VGBA 4GMTL 3SDDC 1VACB 3TJHD 4QF1B 1N5YH 3KPQB 3NZHL 4K71B 3QCTH 1L0XA 4Y5XA 5C0AA 4WRLA 4NZTL 1OCWL 1FCGA 4HJJL 5MERA 3R06B 4QXGL 3VI4F 5DD1L 4WO4D 5FGRA 1HOCB 3TBVB 3IU4H 1RJYB 4RMVA 2QSCH 4O2FA 5DSCA 1AGCB 5E4EB 1EVTC 4GLRH 2PUQT 1NGQH 1B88A 1CGYA 1R3LB 1YY9C 5JORA 4KY1H 4X5WA 4ZD3H 4HIIB 2ZUXA 4O4YL 1G0DA 4WO4C 3TH3T 3U0PB 1XF5A 2CDFA 4PJXF 1XF4A 4NCDA 3FT3B 3GBNH 3GMPA 4V2BA 2Q20A 3IDNA 1AE6L 2FHCA 5C0NC 1FVEB 1CD1B 2QR0A 4QHKJ 2VR5A 5DTFA 3RWFB 4LAQL 1LEGB 3U7YH 4C4KT 4Y4FC 3WE6B 1TJIL 1WAAA 1HSAA 1XCQA 3BQUA 5J3HC 1PEZA 4Z78B 3RKDD 3MV7D 3P2TA 4YHNB 1G7PA 2Y4SA 2X2YA 4HC1H 2OLDA 1K4DB 4TRPL 1X5GA 5E8PB 3MV9B 4CU8A 2P8LB 3BP4B 4OUUA 4K94H 4QY8B 1WZKA 2Y06L 3ZKND 1MCRA 2CO7B 3N50A 3RGVA 2ADGB 5DHXB 5T5FH 1MLBB 5ACLA 2ATPA 1CGUA 1B0GB 4J8RB 1BEYL 1BFVH 4R4BA 4U33A 4OT1L 2DJ4A 1AR2A 2QQKL 4HEME 3DETC 2BP3A 4F80A 1P4BH 2P5WD 3GFUA 3SGJC 3H9SE 3QHFL 2JB6B 3TIDB 2FDBP 2VO5A 5EUKA 1QA9A 1G7QB 3DYMA 4WO4A 4QTHA 3QIUA 2AQ3A 1HH6A 2Y7QA 5AZEL 1X4YA 3QR2A 4TPRL 1JNLL 5M7QA 4K8RH 5SWZB 2WINA 5LGJB 3KYAA 1FG9C 4OUUB 1CT8B 4YXLH 3DRQA 5EN2A 5K9OB 4P23A 4N90E 2CR6A 4TUKH 4EXPX 3UXFA 3MV9E 2M8XA 1U8QB 2WLZA 5IMKA 1HYSC 3VRJA 2R69L 1WJ3A 3JSSA 3MZTA 3QUMH 4RIRA 4XWOD 4MXWH 3HG1E 1X7QB 3FFDB 3WBDA 1N7ML 2G2RB 4NJAL 2DQTL 3OKYA 3GSQB 4R2GB 1OHQA 1U8NA 2IBZY 3C09B 3QQ9C 3QXTA 4JN2A 3VXUD 1A3RL 4QRPB 5LCVH 4M1CC 4CRPA 5TE6H 3T0WA 1EMTH 3MJ9H 5E00A 5SWQA 1T83C 4LCYA 4Y5YB 3U9UA 5JXAL 4OD2A 1NGPL 5T5NG 3SPVA 2WANA 4BZ1L 2MCG1 2YD9A 4KJYB 2L7JA 1S9XA 4WUUE 4L4VA 5D1XB 4KKBC 1VENA 2J7LA 1RHHB 1UB5A 1I7UA 4N1HB 5GS1B 3UTZB 4D0DA 3WFEL 1KEGL 2DQHL 2NXZC 2NX5D 5DVOA 4PGJA 1IGIL 1L9MA 2F5AH 3L3OA 2CRIA 1LP9E 1LNUB 3PWVB 4EBQH 1Z9LA 3SO3B 2GITB 4YX2H 4G3YH 4F7PA 5I8OH 5EO1B 5I1DB 3TBWB 4LLUB 4LSVH 3HPJB 4JN1H 4I2XB 4QRQB 2CKBA 1XGRA 1IFHH 5FKAB 2EO1A 1A7NH 5I9QC 4NYLA 1XCTB 2CLVB 5CP7A 1H0DB 4JFDD 2ICWJ 5F1IA 3TN0A 4WU5B 4RMTA 1GZQA 5D7IF 3EJYD 1J05A 1RZ8B 2MFNA 4YDJA 1FNGB 4KY1L 4OFPA 4RGND 4EN3B 4TSAH 1EPFA 3K74B 4YH6A 2WWKO 3UC0H 2VDKH 3WO4B 4OAWA 2Z31B 4HF5L 2DI9A 4L9LA 2NY5C 1U9KA 2BY0A 2EC8A 1B2WH 3MRLA 4NC0B 4RDQF 1PZ5A 3VD7A 1VA9A 3MMEA 2EIDA 3D9AL 4P9HL 5KSBF 4E5XB 1Q0YH 3ZTNL 4KTDH 2OI9B 4HPYH 4P2QD 5I1LA 3K3QA 1OD9A 4PJFF 4U6XA 3W82A 1T21B 5FKPB 4W81A 1XF4B 3DUUA 4UU9A 2A73B 5D2NB 2F19L 5JIPA 1NCDH 3LOWA 1RY7B 4YHPA 4XNZB 2AJ3B 2BVUA 1RVFL 4UAOB 2XWTB 1Q72L 1AQDB 3IFNH 2WBJC 4PJAF 3OKKB 1D5IH 4HXBH 4M9PA 5IBLC 5CJXA 1Y18A 2XWTA 1MFBH 4P23B 4RBPH 3HMXA 2DLFH 4LARH 1EH9A 5DRZA 1T20B 5FYJL 4GSDH 4HIEB 1DJSA 3BKYH 1D3CA 4BYHA 5HHOD 4UTAL 2QQKH 1TVBA 5KVDH 2Y7QB 1TITA 4OD1L 4AQOA 1PZUB 4MQ7B 3VI3F 1XGYH 4W6YB 5FHBL 3KXFD 4HUVB 1FJ1A 3H0TA 1HHJA 2EYTA 4FTVD 1RU9H 3QIBB 4KUZH 3GHEL 4MSWA 4YFEA 5KSBB 1ORQA 2QJDA 5C0FA 1YMHA 1LE5B 5I66B 5EUOB 2NXZB 1UJ3C 4JPVH 2YPVH 3MBEA 1RUMH 2HFFB 1JGUL 1FFOA 1CGWA 1B0RA 5SX5H 3VFOA 1JPFA 3NABL 5ALBH 1K8DB 1MNUL 2XZQL 4K07A 5F1IB 3TN0B 3WNMA 2H3NB 2PXYC 5BZWA 4Y4FB 5D7IB 2CKNA 3C6LB 5AZ2L 5F6IB 2AJVH 4X8XA 4XI5D 3JWNC 1DQDL 3PWNA 1GH7A 2E6QA 5DRWA 1ULVA 3BQUB 2VLRE 3VXMB 3LCYA 2MCPL 3NFPB 3MX0A 4OF7A 4UIMA 3T8XA 3NPSC 4CMMA 4QKXB 1RUAH 3T1WA 3PJSA 1UWEL 5BXFB 2B0SH 3VFSB 4U6YB 4H1LA 1MI5D 3TT3L 3HNVH 1DLHA 1A4KB 3QDJA 1GGCH 5FYKL 4F8TA 3KWWB 3LS5H 4PRNB 4Z7NF 15C8L 1DTUA 1A6ZB 5DRNA 3WNNA 3FL7A 3UYRH 4L3EA 3P4MB 4PJ9A 3O9WB 5C08D 1NGYA 3F58H 4KPHH 2MOVA 2X1WL 3ES6A 3RI5F 4X5WB 2E6PA 1IQDA 1F4AA 2EKJA 2VH5L 1KIQB 3LQAH 4MD0A 4FN0A 1V3MA 3KPOA 2R23A 1AR1D 3KDMB 5KG9A 4OIIL 3LB6D 5CAYB 3B6SA 1H3GA 4HUKB 2YKLH 5FO9A 1C7TA 2I9LB 2UZIL 1JI1A 2HJKA 1OAKH 3ZYZA 3SQBA 3FT4B 5E8DH 1UC6A 5ACMA 2C9AA 4R26H 3LKNB 2BJMH 4OZFH 5LXGL 2VAAB 5D1XD 3VH8A 3CPLA 5ICXA 3S8WA 2DQIH 1I7ZA 3U4BL 5D7IA 1CDGA 1DQML 3VD5A 4X6FA 3DVIA 1ZVYA 2VZVA 2R39A 3C6LC 1LD9B 2W91A 1SJVA 5C08B 1AXIB 3CAFA 5SWZA 4CU6A 4AQ1B 2PYEB 1AXTH 1T4KB 3B9KD 32C2B 5F7NC 2DQJL 3EDEA 5TQ0L 5BRZA 2AXFB 3MRQB 4YGVB 2IANA 2JB6A 3V0AC 4EUPG 1ADQH 3I6KB 3BDYH 1X5KA 4GMTH 4NN7C 3V4UL 1FL6B 3ZE2E 1MEXH 1A14H 1BZ7A 1JHKL 1RJZB 1AKJB 4M8QA 5F6HJ 4OLVH 4L4JA 3TT3H 2E7LE 4FXGA 3BMVA 2ZZUT 3S96A 1FIGH 2ATPB 3OF6D 1CD8A 3P9MB 5CGMA 2ZCHH 3IU4L 3ZZ1A 4DZ8B 1T20A 4M8VA 4NSKB 1VFBB 2FL5A 4OFIA 4WFHE 1FZOB 1MCSA 2Q8AL 4EQ2A 3H3KA 1CGTA 1JHTA 1FLRL 4C56E 2BNUB 1AQDA 5TQ2H 3Q6GH 1N59B 1MCFA 1OTTD 1UXWB 3PWPB 5HBBA 1TETL 2EE6A 4WFFD 1HYRC 5ESAB 5F97E 2P5WB 1M71A 3WD5H 2PXYD 3S7GA 4J1UB 4MAYC 4PGZA 1LO4L 1OP5H 1YDPB 2ZUYA 5DJ8A 4UNVA 4KROC 4U3HA 1KPRB 4YBLC 4P2QE 4KK8C 2EKSB 4OB5L 1BECA 4YDVB 1F58L 2OTUA 4X8JB 5FUCC 3H3PL 3CU7A 1JBJA 1FPTH 4WGWB 4XZUB 4UI2A 2H6PB 3E8UL 5L0QB 1RJCA 2DWDB 1BVLB 1OW0C 3AS1A 4HS8H 3VFVA 1I7ZB 3DOSA 3EOBB 3CPLB 4HXAL 2F54B 3KPPB 1J05B 2DQUL 2VERN 4LSSL 3VFUB 2RHEA 5D6DC 5T3ZE 1BZ9A 4RA0C 3H2WA 4KKCD 5LBSH 3NCBB 2BNQA 1YJDL 3B6SB 5KW9L 1DVFD 1OAZL 4N5ED 2HKFH 4L8SB 3QHFH 1JMXA 4PJAE 3O8XB 5KANI 5FYKH 3LS5L 4YHZH 4YXKL 5EU6B 4PPTA 4CADB 1SJXA 1NMAH 4FQIH 5D2LE 3TCXA 3E3QA 3LD8C 2GI7A 3U0TA 2K7QA 1D5ZB 4GH7B 3QEQA 3RDTB 1CFTB 1P2CA 2DRUA 2BNRD 1A6ZA 4PV8A 3LHPL 5D5MB 3GUTA 4HIJB 1MCQA 5ISZE 1R24A 1U93A 3KJ6L 1AHWA 1JJUA 2VLJD 4HUMB 2AS5M 2IPTH 1KN4H 2ZSVB 3VXOB 3VFPA 2J8UF 1RIUL 3IGAB 1UM5L 2F53D 4N8VB 4R7DA 1DBAL 3QJHA 4FQXC 4M62H 3U7YL 2W9LA 4U0RB 2JCCE 3FFCE 2XRAH 4OF0A 4PJXE 3KPLB 1A3RH 4P46D 5ANME 1UM4L 3MFFB 2V2XB 2H3NA 3ZSSA 1ZEAL 4KKLD 1LP9A 4ZUUB 3FQRB 3WYRA 5GZNC 1RZ7H 2OM5A 3WLWD 4XBPA 3GGWB 1MHEB 5HVFB 1T1ZB 4P5TB 5EIQA 1LO3L 4YC2B 3C6LD 5FDYA 3TF7A 1VGKA 4JREB 5JOFA 1JFMA 1DR9A 4YPGB 1YMHB 3EO0B 5IIEB 4C54A 5C9KA 4IHOA 3O4OB 5T5FL 4NHCH 4WI9A 5IWLC 5DEGB 4F58L 2JB5L 1WZ1H 3SDCA 4POZD 5C7XL 2DQHH 2C1PB 2IBGA 3IVKB 3UTPE 2GIYA 5C71A 2QQNL 3SDXB 3RY4A 1DN2A 1AD0A 2HT3C 4ZUTB 1WF5A 3QNXB 3HRZA 4MDIB 2J4WH 4ESKA 1DQLL 2B1HH 5F1NA 1IEBA 5DK2B 4BH8A 2DMKA 4JHZA 4LLVA 4OLVL 1FFNB 2GHWB 4L8DB 1IARB 5GRJH 3MCKB 3P0VL 3DXAA 3GO1L 1AY1H 4PRAB 4PY7A 2VQTA 3EYSH 3MCLL 1T66C 1MLBA 4OSUL 5HHOB 2PCPA 4NQEE 4MNQB 5A40E 4OFYA 3ARZA 4NRXB 2YPKA 4MJIE 3WFDL 2FX8H 3O2DH 2HWZL 3SOBL 1I3RA 1EEZA 5DJ0A 4PGBA 2DB8A 5FGBC 2DWEB 3X3FL 1KN4L 3SDAC 1MFEH 3F7PC 1IM9D 1S7WA 2BNQE 1IMHC 3MOAL 5C09D 5I74B 5F7DB 2NMSA 1ES0A 4K7FB 5E2TH 4P46B 3GB7B 3WFBH 5E5UB 1ZA3B 1U8HB 5L2JA 2ICCA 3P9LB 1ORSB 5DTFB 1EDQA 2P8MB 4MZ2A 1I7RB 2CSPA 4JGMA 3BH8A 2Z31A 2X7LA 2BOBA 1NCDL 3V7AG 3Q3GB 1Q9OB 4ODUA 2Z8WC 3MJ7B 2RB8A 4ELME 2Z4QB 1O0VA 5HYJE 4P5KA 5C6TH 3U4AA 1C08A 2DAVA 3BZFB 3HHRB 4P4KA 1CFVL 1FO0H 4J2XA 3GJFK 4FQXD 1A7QH 2ESVD 1WFTA 5DSCB 1T80A 2ARWA 2RCSH 5DD6B 3WFZA 2D7QA 4LLUA 2CK0H 5EZLA 3U1SL 1S5IH 5I1HH 1L7IL 5E8NA 3DO7B 3M17A 1LNUA 1OAQL 2X9WA 3PWVA 1BGXH 1WAAE 4JN1L 1HKLH 1IC7H 3KPQA 3HAEH 1VACA 4D9RE 4K8RC 3DETD 2R4SL 4LDLB 2IAMA 3I2CH 4X4XA 3U6RB 4L4VB 2YPLD 5D1ZC 1FGVH 5CBAA 3QEHA 4MJ6B 3G04A 3TN0D 1T66D 2OR7A 3I3BA 3RVWC 4WTZG 3DMMD 3HZYA 2I26N 2JJVA 4K23L 4ZAKA 3DI3B 1XGQB 3O41A 2ZPKL 1YZZA 3MACH 1OY3B 3O2VL 4OLXH 4PJ8A 4URTB 3WKMH 2OK0H 3KYOA 5E24E 5CSZA 2OP4L 5EU5A 3C08H 4N8PA 5J57B 3JWOH 3RWDB 5ITBL 1IT9L 1SEQH 4XWGH 5IHZA 4OZ4B 5DJ2B 1U8JA 5EZOL 1RZJL 4GXUM 1DQJA 4X6EA 5C2UB 3E2HB 4JFZH 1P4LA 4UV7L 4IIQA 3HRPA 5I1GL 2XN9A 3QEGL 1MFCH 3ARDD 3VCLB 4J6RL 4XVUC 2FGWL 2OJZH 3EJZC 1BZQK 4Z7NE 1K5NA 1F11A 3QFDA 5A2LH 5E6YA 2UWEB 1UACH 1GZPA 3MGTB 1LO5A 4ZS6C 1AO7E 3RWEA 3FO0L 3ULSB 1YN7B 4EOWH 5LGJA 2FIRT 3MRBA 3REWA 5KS9A 4MA3A 1V3KA 3BE1H 3R0NA 2Y06H 3NAAH 4WWID 2GQHA 2GTWA 1BVKB 4OFKA 2C4FU 2BDNH 4NQCD 5GGTH 3QPXH 5ACZA 3QIUC 1KTRL 2GFBA 2Q7NA 3L3IB 5ISZD 1DLHB 4XPFL 5DLMH 5EZIH 4LIQH 4OLZL 3QUZD 1MY5A 1YNKH 2VISB 4M48L 1NAMB 4U31A 3VW3L 5T5NF 5F1SA 5TFSL 2AAVA 3UYOD 1JF1A 4Z7VF 1JWUA 5BQ7B 3MNVA 1EAPB 4Y16D 3V5HB 1UKTA 5IVXA 1RZFL 5DC0A 1LO2L 4G6MH 1BZ9B 5HGDA 3UBXB 4UMGA 1U8OA 3ARBA 1H3XA 5TPWH 3WDIA 4DTGL 3DHJA 4D0BB 2Y36L 2GJZA 5ITFA 1YN6B 5CD5C 4K7PX 4LLMA 1BAFL 2YA0A 3V8CA 4ZO9A 1FFOB 1GC1H 4XNZC 4EZMA 3MLSL 1KT2B 3VXPB 4AIOA 3A6CL 1HEZB 2DBLL 4S11A 5D7LB 4Z77A 3VXRA 1DL7H 2D7PA 3ZDZF 5BVJB 4QRRA 1UENA 3ZTJG 3CVHH 1KJ3H 4LHUD 3QH3B 5C0CB 1FAIL 4C83B 3BPNB 2BOCB 1UWXH 1OWWA 3HKFA 1MFEL 5CGTA 3O4LA 1OQOA 3OZ9H 3CZJA 1NEZG 2E7CA 4JFZL 1VDGA 2EKSA 2APWA 4P3CH 1PKQB 1N8ZB 2JE8A 4TUOA 2XA3A 5B22A 1ADQL 1BD2D 5F88B 3BUYB 3FCTB 3QP3A 1QLEH 2VQ1B 4AMKL 1MOEA 5I1IH 5I8KH 1ITBB 2NX5B 3ZKMD 3DXAE 1MAML 3GSXA 3NIFF 1I8MA 5CBEA 2ZOLA 2W92A 4YBLB 1EA9C 4DGIH 5EOCJ 2XY2A 4WW2A 1Q94A 2FJGB 4GQ9L 3T3MF 1S9WB 4AT6B 1KLUB 5FO7B 4AIXA 1KG0A 5DVKA 1VB9A 5DD5H 1XGTB 3GRWH 4UT9L 4MXVF 4J3OC 4PJGA 2F54D 2Z8VC 1X5XA 4Q9RL 1YMMA 3BGFB 4L5FL 2XWJB 1BQHB 4WJ5A 4ZFGL 4G6AC 2DN7A 4MS8D 3H7BA 1AKJA 2XKNB 1QHOA 2XA8H 4K2UH 4P2RB 1MIEL 1NDGB 2CDEB 5E5RB 3WL9A 4LASH 4DN3H 4QRUB 3KYMB 1PZ5B 5ERWB 3QWRA 1AIFB 3IU3A 1OGAD 1KELH 3BQUD 3KLAB 3C5ZC 5FUOL 1IQWL 4HW6A 1TNMA 5D9SB 3BT2H 3EOTL 5I0DA 4JCMA 3MRHB 4EN3A 3VG0H 4JQIL 3KPTA 4KDTA 2BVYA 1XEDA 4PJFA 5C08A 4PJCE 4NM4L 4TYUA 4HWUA 5D71L 4OTXL 4HWBL 4JQXC 5IB1A 4RAVB 4N9OB 4PRDB 4LOUC 1DEDA 4OLEA 1UCBL 3SGDH 3WIFB 3LB6C 4O2EA 3S36H 3KVQA 1U92B 3WV0A 3TIEB 4PGEA 4JRYE 1Q0YL 3GSWA 3PWJB 4NUGL 3SY0B 2EDYA 5IUSA 2YA1A 3VXQB 1ZOXA 1NCBH 1OL0A 5FHAL 2F8VA 1NMAL 4RQQB 3OAZK 5T1MB 5C6WH 2O61A 5H35B 3EYQD 2VN4A 4PBWD 2V9RA 4EOWL 1WIPA 3P73B 4GKOA 3P30H 4OD2B 3I6LE 4P23D 2X4UB 3BZ4B 3X11B 2FD6L 3JTSB 4HMDA 5JW4R 4M3KB 1N5AB 3DURA 6CGTA 1TETH 4JZJB 2AJZA 3V5KB 2I07A 4MD4A 1LEIA 4WV1B 4OLZH 4RFEB 2VZOA 5AZEH 1XF2A 5EA0L 5F21B 2VLMD 2D9QB 3GMNB 3FO2B 5BZDB 4KVCH 1BWWA 3SE8L 1NLBL 3GMLB 1BIIA 3BKJL 1INEH 2VDQL 3S5LB 5CP3A 4NN7B 3VXMA 2DLHA 4DN4L 1Q38A 4QOKD 1H8OA 1X3DA 1ZEAH 4FA8A 5HGAB 5JHLH 4L4TB 5FGCE 5KBNC 3QFJE 2FWOA 1RZGB 3WN5A 4CN4A 3EOTH 2EDTA 2IH3B 2VLRB 2R4RH 1OB1B 4LNRA 4M7LH 3VFOB 5ADOL 4RGMC 3JWDC 4P5TC 1DL7L 5FF6A 1JL8A 2DQUH 4LSSH 3AS0A 2XZQH 3BGMB 5HDOA 4PLKC 3HPLB 4QTHB 4TOYL 1OP3K 1U95A 1ZLSL 4JQVA 5TDOB 3U36A 3DV4B 1YEKL 3LEXB 2YEZB 5IFJB 2HKFL 3MLTB 1FG2A 1JPSL 2PO6A 3I3EA 3Q1SH 2J4WL 5J3HD 1RMFH 1SMOA 1P6AB 4KRNA 4J8RA 4FQIL 4Y19A 2A6IB 3UDWC 3GO1H 3IRZA 4UV4L 1NC2B 4M61B 4KDTC 1HI6A 3IYLW 5F7HA 4YHLH 3AS3A 3RZCB 3W9DB 4JPWH 2ZUTA 4YPJA 3NN8A 3TESA 4XCNB 3RIFF 4G3YL 5I8OL 3B9VA 2EIZB 3BO8B 4JY5H 4UOW1 4TSBL 1WWCA 3WEXB 4M6OH 3LQAL 3QA3B 2WK2A 2FSEA 4G7YL 2EDRA 3QEUA 2R2EA 1CF8H 2W0FA 1FN4A 3HZKB 4HK3N 3W2DL 5C8JB 2IMMA 2DD8H 3FONA 4XMPL 3NGBC 4ZODA 5JW3H 5F3HB 1S5HA 2A9NH 5IFHL 3O2WH 3O3AA 3WFBL 1IAIH 1ZHNB 1A64A 1ZLWH 3NVQA 1KELL 2FBJH 1RZ7L 3QIBD 1PJ9A 1UXSB 3T1FA 5J6HB 1PKOA 3TV3L 1PVHA 3QDJE 3BEWB 3DVNA 5ETUB 5SV3A 1OVZA 2O26U 5DI8B 5IT2H 2XZAL 3SO5A 3S5LA 2NY0C 1DFBH 4LSPH 4XB8A 1S7VA 3AU1B 3WS3B 3OF6A 1QRNB 5JW4N 1BBDL 2B1AH 1I8LC 5GISH 4XP4H 4F58H 1QSED 3PQYE 1OSPL 3R06A 3MGOB 2F19H 3WXWL 1ZLSH 3MJGX 3VXUA 5J1AA 2UV3A 4KXZI 3VFWA 3R1GL 1JK8B 4MYWB 1QO3B 2H26B 3VE0B 3RZCD 1OCWH 1NFDE 3P73A 4Z7UB 2K1MA 5IOPB 4Q97A 3RGVD 1Z5LA 3U46A 4Q7DA 5JNYB 4RA3A 4E9LA 5KVMC 3QT2A 1JFQH 1S9VA 4KI5C 4X99A 4OSUH 1TZGH 4PRHB 5H2BB 3ZE0E 1IILE 5HYFA 3QXDA 4E41D 5HYSG 2EH7H 2YRZA 2OK0L 5DYOA 3PV7A 3PL6A 5KSVA 4QLRA 3WUZA 2E9BA 5TQ2L 1T22B 4APQA 3GSUB 3QIUD 3SN6N 1N0LA 2VSDA 5I6XC 1FYTA 3PHQB 2HLAA 4OCNC 3DGGB 3WD5L 3CSBA 4FZEH 12E8H 4GBXD 4NP4L 4IOIA 2UYLB 5IQ9B 5FUZH 2MMXA 4FFWC 2VXUH 1YYMH 3AY4A 5FEBA 1AXSA 4LEOB 5MENA 4KU1A 3JTTB 3JXAA 1GAFL 1MIML 4NO0B 1G7JA 3RZWA 2WBJA 3TVMA 3ZL4H 3WS6C 1GL4B 2Z91A 4EUPH 1NDGA 3VDCA 1FO0L 2VR9A 4ERSH 4XVTL 4YBHA 1C1EL 3SCMA 1HHHA 4GOSA 4HWEH 4UDUB 3SKNA 4K3DL 3CMOL 2A6JA 5GGTL 4G8GB 5D8JH 1YNTB 4D8PA 2AQ2A 3VGFA 3QG7L 5T1LD 3HZKA 2CLZB 1HH6B 3FT2B 4NQDE 4FG6D 4XPGL 4WWKD 3CCHA 5I8EB 5LBSL 1IC7L 5TE7L 4GMSL 3F58L 4ZMAT 3P40A 1OAZH 4NRZA 3MRKB 4P46C 3OKMB 5HPMB 4H26A 1GJIA 4TTGA 1JWMB 5LG1A 2X05A 5SWZE 3JV0A 4MD5B 4XGZA 3LRSA 4N0FA 1J5OL 3LS4L 3PUCA 3O6KH 3CFDB 2YD3A 4RWYL 1TMCA 4HLZH 1BQLL 3QULB 5E2UH 5INDB 2VDMH 1XIWA 5F7EL 1H3WM 4ODXA 3MV9A 4YAQA 3JWOL 3T4YB 4P3DA 5ITBH 4MA7L 1YECH 4NKOB 2CD0A 4PTUA 1RZJH 1ZT7A 3MRGA 2H45A 4PV9A 3WHE0 1TXKA 4MXWL 1NCTA 1M7IA 3AB0B 4N0CC 1ETZA 3MREB 3BP6B 2ICEB 1JNHB 5FM4A 2D2OA 5CJXC 3W2DH 4XH2B 4ZOAA 2BCKB 5HHVH 4IEFB 1NKRA 5DJYB 2J12B 2F53E 4OZHE 1Q9KB 1YY8A 2BMKB 3D3VB 3DX6B 4MB4A 5E0QA 5FUZL 4JFPA 1CLZH 4AH2A 4MLIA 4OGAD 3HE7C 1RHFA 1EMTL 3L3GA 2H9GB 2X1QA 2E7MA 3VMNA 4AY0A 5I18L 1TLKA 2DLGA 3K0WA 4WDIB 4JFOB 3RWHA 3UTQB 2D7OA 2BERA 3OQ3B 4N9GB 3MNVB 3TNMB 1U8LA 4HBCL 3TPKA 4EI5B 1J0YA 1RUPL 2JCCF 1A5FH 4AG4H 5CEXA 1N6VA 3EJYC 2QQLH 3HNTL 5KVGL 1IC4H 4I5BB 3QJFB 2ED7A 1B4JL 3QPQD 1NBQA 2KDGA 2NZ9C 4B0MM 5HGHA 2L0DA 4N0UA 3UMTA 4UTAH 5CKGA 4J3SA 4G6KL 4PJHA 3UTPD 4XRCB 5IJVA 5A2JH 4UQ2A 2FATH 2YWYA 3ULUC 2QADC 3NOIA 1A7NL 3LZFH 4RZCB 1F90L 4BQ8A 2JJTA 2FZ3A 5K59F 4YFLF 3BZDA 3HI5H 1HHIB 4HEPG 2VLKA 43C9A 5IBLD 3Q6FB 1IZKA 3GMOB 1DBJH 2OXGA 2WBJB 5T3XE 1K5NB 3F62A 3BGAA 3QDJD 2P8PB 1QR1A 3MRFA 3GMMB 3LH2H 4PJBE 3RVTC 1EFXA 5I74C 4X9BA 1RJLB 5I1CH 3K8LA 1KC5L 1KJ3L 5DHYB 1MRDH 1K4CA 2UYLA 4KROB 1TTFA 2HWZH 3T08A 4YHML 4KKAD 3SOBH 4LHUA 3D9AH 4NQCA 5AAWA 3H3PH 4MB3A 1MREL 5I30H 4UTBL 4NO2B 2BC4A 1A6TB 3QQ4B 2R1WA 4NQTA 1YYML 4HS8L 5IB1B 3EYFB 5JW5B 1L6XA 3PL6B 1DBKH 3OKDB 4ZPVA 1QD0A 1CLZL 1KJMB 4MDJA 2DYPD 1UGNA 1HHIA 1JPGA 4Z7WF 4CU7A 4H8WL 4LPTA 5D96C 4L1DA 3G9VA 1RUQH 4RWHA 4Z7UF 1T6WA 5F9JA 4I18A 3KYMA 1OF2A 2EXWC 2DYPA 4JR9L 1Y0LA 2D31B 5HYJD 5DJDB 3MRJA 2VKWA 4PRPB 3MUHL 1T0MB 3L6FB 1G1YA 4WU7B 4YR6A 2JIXB 3QDMB 4JKLA 3H7BB 4OD1H 3E3QE 1YNLL 4NFDA 1OLZA 3PGDA 4I5BA 1MIEH 1XGUB 3CVHB 2CK2A 5C1MB 4NHUA 1NAKH 1BMGA 1NLBH 1NCCH 2FECL 3DVGA 4OZIE 3U82B 1T5WB 4Y19D 3MJ9A 5EU6E 4MAYA 3H9SD 3CFEA 3QUYC 5GRYA 2WLYA 1D6EB 1KBGH 3PWUB 5D7JA 5D2LB 1F90H 2Q3ZA 1A7OH 2FJGA 1KJ2B 4IRJB 3V4VL 4MMZC 2CLRB 2PTTB 3OKLA 2NXYD 3N0PB 1RK1A 5BOZG 5C0IA 4ODSL 1I7RA 1E27A 3UZVB 4PJEB 3HR5A 2VDML 3B4NA 3KPMA 4JZOB 2V5MA 3D6GA 4B50A 1F02I 1I4FA 3NABH 4R96B 1NGWA 1BQHG 2Q3AA 4FNLH 2BCKA 3AB0C 1UCBH 1T03H 3ARPA 5DURB 2IADA 1ZHLA 3DNKA 4L8CA 1C12B 5AAMA 1X5LA 4IOSD 2APBA 3KPSB 1ITCA 5HHMD 3VWJA 1F3JB 4MS8A 3HG1D 2JIXD 3QDMD 3WCYA 5DRXA 4J6RH 1S9YB 4PRPD 5IB2A 3EFFA 3RUGB 4IRZL 1SY6H 4U1IB 5DJAB 3GMQB 3O4OC 4FFYL 2AP2A 4YNYA 1RIHH 3QIBC 3P77B 2QEJA 1T6VN 4LSUL 4WI8A 3BYTA 4LQFL 3ARDB 5BOPA 2J8HA 4ZFZB 4LSQL 5C0EB 3TYGH 4BH8B 1TQBB 4BFEA 4LPVA 5HJ3B 3FO1B 3ARBD 5EB9A 5I8EA 3NZHH 2PW2B 5T33H 3V6OC 1KFAH 3CDYA 3ZYOA 4P2RD 4YEEA 2LU7A 3NIGF 2Z35B 3K1DA 3UAJC 2X4OA 2E27L 5AEAA 4OM0H 4PG2A 3F5WA 4RGOH 3I6GB 5L8KB 1BF8A 2N7BA 4N5EA 2JIXA 3QDMA 2WQ8A 3FB8A 1DSFL 4HZLA 4M5YH 1A6WL 3MNWB 3FQNA 5KS9B 1QPXA 1JUFB 1N4XL 4OBRA 4BZ2L 4JY4A 3V7AE 3N9GH 4M6AA 5DS8B 3QSKB 3D1MC 2VABA 3BWUC 5JHDE 3JTTA 4DTGH 3WN5B 1JPGB 2VLKE 4JG1H 3EIFA 4OCYH 1JHLH 5IEHB 4LSPL 4I77L 1X44A 4FFZH 4JJHA 3BVNB 5C0BE 4M1GH 4LFHD 1A1OA 1CE1H 3WO3B 1MUJA 2LU4A 5E94B 3CH1B 3SE3C 1FQ9C 3MNZA 4GRLB 1KSRA 4JB9L 5C0JB 2H8PB 4ZSOA 4JDTH 3V5KA 1A14L 4XVSH 5EFIA 3D87B 4XBEH 4GLRI 4GKNB 4LSDA 5IM7A 4Z7WA 1NANI 1W72B 4JPIB 3DX7B 4JANB 4Z95L 3ZKXC 1CQYA 1J8HE 3BESR 3GMQA 3NFNA 5GRZA 3AGVA 3IJHB 4L3CA 5DEFA 3ZHLA 1W0VA 3EFFB 5A43C 1L7IH 2IAMB 3C60B 1ZWIB 1LMKA 4ZAKD 3TO4C 1P4BL 4G80A 1IM9B 4JFXB 4BFIA 2CJUH 3WXVL 1DUYB 4OJFH 4XRCA 4L3EE 4OBSA 3GRWL 4UT9H 1NSNL 2HT4C 2R4SH 1T1WA 1QFWM 4U6HB 4HH9A 5EZLB 1P7QB 5KTEL 4L8CB 1S7RA 3CH1A 3OGCB 4K3GA 2H1PH 4CVUA 1XT5A 3LKQB 3SDDD 1HK6A 5I1EH 1E6OH 1CQKA 4IMLA 5EBWB 1AJ7H 4PJEA 4BQCA 4Y2OA 1KULA 4P5KB 1ND0B 4BZ2H 5CWSA 1SJHA 5MP6L 1P84K 3IXAA 1GAFH 2E7LA 4X9GA 5HI4D 4U6VL 4JFOA 4R4ND 1MCHA 1UFUA 3E3QC 5I76B 1LO3H 2VABB 5DJ8B 2NZ9D 4WHTB 2MQCA 4PP8C 1JHLL 1ORSA 4OCXH 4OTXH 2BMKA 1N2RA 2YRLA 5DJYA 2A9MH 4LCWB 5ESAA 2JB5H 1X6LA 1UACL 3O3EA 3VA2C 5GXBB 4ZTPH 4XC3H 3H9HA 4FQXA 2CRZA 3OKNB 5KSBE 3CUPA 1BLNB 1LK3L 1F5WA 2JK5A 4JDTL 4M1CD 1UCTA 1IM9A 2P5EA 5EG6C 4OGAC 1NBYB 1EFQA 1FFPA 2D7MA 1QBAA 5EU6D 3NCYS 2QADD 1IGJB 3PHOB 1SYVA 1Q9WA 4ZPVB 3ILQC 5IKCB 3ZE0F 1UKSA 1T1YA 4MB5A 3HMXH 1EGJA 3QQ4A 5HGBA 4KHTL 1KB9K 5C08E 2EC9U 2XFXA 3I6LD 5IVXF 3FCTA 2HT2D 3BN3B 3X17A 3M1BB 1BJ8A 1NSNH 3AXLA 3O9WD 3X3FH 4M62L 1T1XB 3QDGD 2R0LH 1IC5H 3QUXD 5CCKH 2BNRB 3HLAB 2H2SD 4FZEL 2R1XA 4ALAH 4DGYH 4CKVX 1JV5A 4I9WE 4UDUA 4QT5B 1R3HB 4JM2B 3WHXB 1M1SA 5HHME 5DJZB 1QR1B 3MLSH 5D6DA 1ZKAA 4HUUB 3K81A 4I8DA 2UZYB 3Q6FA 1MCCA 3RKPA 4KKLC 1AGEB 1T7VA 1B2WL 4LAJH 2NXYC 4S1DC 2VAAA 3NPSB 4NC2B 3LD8B 3F65A 4UQ2B 4NGHL 1G6VK 1G6RH 4BUHA 5D2LA 1F4WL 3MNWA 1BM3H 4QO1A 5B39B 1A5FL 3B5GA 3LEVL 1EAPA 3N85L 3HN3A 1ZA6A 5C6PB 2X89A 1RVFH 4ZDHA 2FX9H 4OT1H 5FO8A 3LKQA 5GGSB 1Q72H 1QSZA 4AEHL 3FMGH 2IMNA 5JMOC 2NPLX 4M7JH 3VFMA 3RVXC 1JE6A 3FQXB 5F9JB 3IDXL 4Z7OF 1OGAA 3GSVB 4CGTA 3O6KL 3V95A 2CXGA 5FYLH 1LO5B 3DMMC 2PR4H 4J3VA 5HD8C 4NUJB 3U0WL 4ZUWA 4CADA 2YUZA 1ZTXL 5GRXG 4YHKH 2ICWA 4K2UL 1YECL 3AVEA 3NCJL 1ZHKA 1KIPA 4TUJB 3MRPA 5F7KC 4YHMH 3MREA 3VCLA 4LMQE 5FIEA 3IFPA 1B3JA 4HV8A 3KPSA 3KJ4C 2B39A 2YPLA 3MV8D 2P46B 1MJUL 1IC5L 3AXLB 3VDBA 4ZPTB 5FFLA 5E8OB 4NT6B 2HFFA 1AH1A 3N1FC 2A9NL 5KN5B 5D71H 4Y8DC 1TMCB 1TQCB 4RISH 1Q1JL 4XHJC 2B7DT 1AKJD 5CD5D 1BQUA 3MV8A 2I5YH 2W07A 1P69B 3HZYB 4CMHB 3UTSB 4Y16A 2EYTB 1NEZB 3X14A 4OCLC 4X8JA 4F15B 2QKIB 1HHKB 5I17A 3PDOA 1IC4L 2IPKB 3K4DA 3V5DB 1BD2B 5CJ8A 4H88L 5F70A 3LVEA 1JF6A 1BBJB 1UQSB 3QUXB 5HHMA 3OR6B 4JJ5B 3U1SH 1ADQA 1QVOB 3B3IB 3I9GL 3VXRD 4YDIL 4PRBB 5T3ZD 3R1GH 5CIPB 1S7SA 4APQD 1MCOH 4NBYB 1LQVA 5IFAL 1CFQA 5J8OA 4U05A 1OAXL 4MA1B 4LEXH 5JXEA 1FBIL 4J4PC 6FABH 3CFJB 4N9GA 3IDYB 3GM8A 1KTDB 5HJ3A 1AXSB 4TNWK 5EA0H 4MVBD 2VC2L 4HHAB 1N0XH 5MEOA 5IB3A 1RZJC 5I1CL 5GS2D 3GNMH 5F96H 3V7MA 1TFHA 5IG7B 5CEZD 4CDHA 1PLGH 4FQCH 1MRDL 2BNRE 4HIHA 3FO9B 3SGKC 1TJIH 2NYYD 5F7FA 3GB7A 1TCRA 4UT7L 2VLJE 3LV3A 2P47B 2VE6B 5FYLE 3VGAC 1FRGH 4YDLB 1G7IB 4ELKB 12E8L 3TF7C 4JGJA 1DUYA 4XAWL 4I48B 3V0WL 3FTGB 5H2BA 3ZTJH 4BFIB 4Q9QH 4KK9C 3IDGB 1G9NH 3ECBB 4YDKH 2GJZB 1JZ3A 1LP9F 4MNQA 1RI8A 3KNBA 4EUPB 1NUFA 4R2GD 5I8CB 3SQOH 1V8HA 5IOPA 4HWBA 5FKAA 4HH8A 1AR1C 3QWRD 5E8EB 1FFQA 3TJEL 3DHMA 3QCUH 5FV1L 4F3FB 4MD5A 4XGZB 4M1DH 4CN6A 4YXHL 1RV6X 3OPZH 4NQEA 3R8QA 4X80H 5EZIL 2YC1B 1M7DA 4K3DH 3V9FA 4GRLA 5CZVL 4LCUA 4PJ8C 2LABA 1BVKA 4MA1C 3I50H 3ULUH 4MA3B 3PGDB 4I0PC 4JZJA 1CXIA 3FB5A 5FHBH 3BVNA 4HJ0C 3ZE2F 3OJDA 3QIWD 4M7JL 4ZXBD 3STZB 1IQDB 4LCYB 4Y5YA 3U9UB 1EERB 2ZWLT 3D0LB 2YS4A 5I1KH 3RUGF 2HN7A 2Z91B 2D31A 3CFCH 4MLSA 1EHLH 4LPUA 1JNJA 2GJ6E 4ODSH 4LDEB 2XXCB 2YBRB 3NACL 4NJAH 1FH5L 1BF2A 4PJAB 4JQIH 4QT5A 1N0XL 2F53B 4FXKA 4NQED 3FQNB 1CLOL 1EXUB 5SWSE 4GG6B 1QFHA 4GRLD 3QI9D 2ZUQB 3TJHC 1JNHA 2WSKA 3RWDA 3PHQA 2EC9T 3RAJL 2ESVB 3HUJA 4AENA 2MCPH 5JZ7C 4Z8FH 2BNQD 2Z35A 5HHVL 4JB9H 4XCNA 5JQ6L 3DGCR 4A6YA 3RZCA 3DRQB 5EN2B 4ODXB 4X9IA 4RISL 5F89B 4QRSA 3MBEB 4X7FC 5CILL 5D7JD 2DIJA 2O5ZL 1KTDA 5FB8B 3D39D 1DVFB 2C1OA 2VR4A 4XCEA 3V6FA 1KTLB 1QA9B 4NKMB 3ZKQD 2AJXL 5DR5L 3OG4B 4JKPH 3QIBA 3H9HB 2QHRH 4UB0L 3TN0C 1J1PL 3B9EA 3QUXC 4HGMA 1L0YA 5M95B 4QXUH 1GPOL 2HTKD 2EDDA 2FJHA 1YEIH 1Q0XL 4WIQA 3STZA 1GGBH 5J1AB 2Y1VA 1HHGA 3Q48A 4PJHB 5DO2C 2FB4H 2H1PL 2DLIA 2KL6A 3F7YA 3MZGB 2DIBA 2LVCA 1MWAB 4GAFB 2P5ED 1KGCD 1FZJB 5FDWB 4P4KC 4LCUB 1AGDA 1JGLL 3RWIB 2VDKL 1M7DB 3IDYC 4KI5E 4LEXL 5AD0B 3DTXB 1S7VB 1WEJH 4BSVB 3X13B 5L7XH 4D9RD 4KUCD 5D7KE 3HR5B 3KPMB 2X7LB 3VWKC 1EEUA 1WT5A 3BH8B 1XIWC 4WENB 4U6VH 1HSAB 3RVWD 4QXWA 4LEOA 4NM4H 1U6AH 2FH6A 4HCRL 2EDJA 1V7NL 3KR3L 1X5ZA 4FFZL 5DUPL 3SKMB 3SDAA 5CD3B 2XIDA 1Z3GL 1RFDL 1FYTB 4WI6A 1YA5A 5I75B 3NZ8B 3OXSB 1ZMYA 1W0WA 5HYJA 4ZTPL 4NKQB 4TUJA 4NRXA 43CAA 5F6HI 2NW3B 1F13A 2YUXA 5C0ND 1VHPA 4XVTH 1MFBL 1TIUA 1PW3A 3P4LA 1W72A 4P5TD 4D2NA 5IM7B 3B9KA 3QG7H 5D1QC 5FECB 4YHLL 4LU5H