4ZUSA

Crystal structure of equine mhc i(eqca-n*00602) in complexed with equine infectious anaemia virus (eiav) derived peptide rev-qw11
Total Genus 71
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
71
sequence length
274
structure length
274
Chain Sequence
b'GSHSMRYFYTAVSRPGRGEPRFIAVGYVDDTQFVRFDSDAASPRMEPRAPWVEQEGPEYWERETRNMKEATQNFRVGLNTLHGYYNQSEAGSHTLQRMYGCDVGPDGRLLRGYRQDAYDGADYIALNEDLRSWTAADAAAQITRRKREEAGEAEQCRNYLEGTCVEWLLRYLENGNETLQRADAPKTHVTHHPISDHEVTLRCWALGFYPEEISLSWQRDGEDVTQDTEFVETRPAGDRTFQKWAAVVVPSGEEQRYTCHVQHEGLAEPVTLRW'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Classical MHC class I antigen
publication title Structural Illumination of Equine MHC Class I Molecules Highlights Unconventional Epitope Presentation Manner That Is Evolved in Equine Leukocyte Antigen Alleles
pubmed doi rcsb
source organism Equus caballus
molecule tags Immune system
total genus 71
structure length 274
sequence length 274
ec nomenclature
pdb deposition date 2015-05-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00129 MHC_I Class I Histocompatibility antigen, domains alpha 1 and 2
A PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4zusA02
3.30.500.10 Alpha Beta 2-Layer Sandwich Murine Class I Major Histocompatibility Complex, H2-DB; Chain A, domain 1 MHC class I-like antigen recognition-like 4zusA01
4HGWA 2MHAB 2X4OA 1I3GH 4WHDA 1U8MB 4ODUB 3QCTL 1VPOH 2YPKB 1HDMA 4CVXB 3ETBF 3O45B 4GSDL 1UFUA 4M43H 4OFVA 3KPPA 1BZ9B 2HKHH 2NY2B 4PP1C 4OZ4B 1VFAB 1G6RA 1OGAD 1MJJB 3KVQA 5T1LB 3I6GA 3O6FB 5IMKA 4OJFH 2YK1H 2YKLH 1KEML 1J9CT 4MA7H 5EO0B 1BX2B 4MWFB 1FNEB 1AD9B 1F45A 2HT4C 4JFDE 4NC0B 2VQTA 4NQEA 1QSVA 3STLA 3KWWB 5DYOA 4X4ZA 4LPTA 1ZVSB 5DK0B 4XP6H 4PJIE 5DVKA 4IHOA 2NYYD 3PF2A 1PLGH 3FB7B 4LP5A 1RZIB 5J12C 3PG2A 3EJYD 4OZFG 2HJKB 4WI7A 1DBAH 2P8LB 5D71L 1CGUA 3FZUD 4JFEE 3QZWG 5J6GA 4Y1AE 3QXWA 3D3VB 3QFDA 5DQ9A 3HI6H 2BJML 5GGSA 1MI5A 1J0HA 5FYLD 3M45A 5L0QC 4OI7A 2ED9A 1CTOA 4Y89A 4Y16A 1OP3K 3WIHA 2VLKB 3K80A 3V2AR 2OJEB 3CFKB 2DQGL 4ZO9A 1OAUL 3LHPL 1YN6B 1UKQA 4NQED 3CDGA 2PR4H 4PJGB 2A6IA 5F7WC 3C60B 4GAGH 1AD0A 4H1LB 1IC4L 4P2CG 4R4BB 4NN7C 4LSTH 4OFKA 3F5WB 3R1GH 3MRPB 3WFHA 1KXQE 3NCCB 5EZIH 1OT2A 1AQKH 3OPZH 3C5ZC 4J8RB 4JJ5B 4X5LA 5IBLC 1DCLA 4RISL 5FB8A 4ZSOA 4Z7OF 4Z7VE 4NWTL 1TQBB 2MTPA 3O3AB 5K59E 2IAMB 4NJAL 4RWYL 2CXGA 4HS3A 4QWWC 4X7SL 1RHHA 4BSWB 3TNMA 3CFJB 3HCVB 4RMQA 4G7YH 5D1ZC 4Y16D 3SY0A 5CEYA 2OLDA 1FE8L 1HKFA 1N0LA 3CLFH 3R4DA 1ZGLA 1T03L 2JE8A 3DV6A 1IKFL 3T2QA 1CE1H 4P23A 2W60B 4U1HA 1EO5A 3VXNB 5FKAA 2VDML 3MGOA 4G42B 4TQEH 3IJHB 3S35X 1JTPA 3K2UH 2NR6D 1EO8L 4BH7A 4O5LL 2BNQD 1Q9KB 4C59B 3ALWA 2BVEA 1RIUH 2XRAH 2DICA 1DBML 3SQOH 3D2UA 4HH9B 3NIDF 1EGJA 3MRBB 4PJ9D 3T3PE 2HH0L 1SJXA 3IFNH 1K9TA 1FZMB 2YUZA 4N0YH 5KVGH 2BVQB 2R2EB 1QR1A 4FTVE 3WKNA 1U0QA 4F33B 1SEBB 3V5DB 1OM3H 4EDXA 4NNPL 5C2UB 3QWOB 4U31A 1RIVL 4HIHA 2WBWB 3FFDB 5FA4A 4LVOC 3FT3A 1VFBB 5A2JH 1CICB 1EIBA 5EO1A 3SE8L 4QY8A 3LOWA 3OQ3B 3C6SA 4ZFGH 3DMMA 4L8SA 5D1XD 2RJMA 3GHBL 3VW3L 1Z0MA 1NC2D 3KLDA 3OJDA 4M7LH 3N1PC 2EECA 4W4NA 4F2MB 1IGCL 4NHUE 1RZKC 3BZDA 4X80H 2FR4A 3MYJB 4WJ5A 3OGOE 4RFEB 4FXKB 4BQ9A 5GGTH 4O51B 2C4FU 3G6JE 5IV2B 5E4EC 1Q1JH 1SEQL 1JPGB 3RGVA 1V3LA 4PJDB 4YC2C 2IPKA 1ZVYA 5TDPA 4F7CA 1UH3A 5TGBB 4LPXA 3NIGF 3FN3A 5IMOA 3S3JA 4PJXA 1RJLA 4U6VH 5HGDB 1TETL 2AQ2A 4NNXB 1OAKH 3O9WA 4HUUB 3NTCL 3UAJD 1ETZA 1RZ7L 1QBMH 4DOHE 4OIIH 4P99A 1U6AH 5TE6L 1TJIH 5M94B 4F9LA 3DMMD 4N8CH 3ULVE 3RNKB 4XP1H 1X5FA 3U0TB 1G7JB 2ARWA 3BRFA 1VA9A 1ZOXA 3ESVF 1D6EB 5IJVA 2D31A 1K8DB 5EOQL 1G7PA 4F15C 4YNYA 3IFOA 1IGIH 3L95B 1IGJA 3G5XB 1OVZA 3HB3D 4ZNEE 1JWSB 4Z0XB 5GS0H 3OB0K 4KGLA 1WWAX 2FECL 3MUGA 3EOBB 3RVWC 1ZSDB 3O9WD 1IM3B 5JMOC 1QBLL 3CCHA 5DD1L 3BP4B 1DVFB 4LHUG 1S9YA 3OV6A 4CJ0A 5LQBL 1D9KA 3VI3E 4QRSA 4D9RD 3U9UA 3NBNA 3IT8D 3VXQB 4QRRB 5C7XL 3B9KC 4MMZC 3BKYH 3MRNA 1BZQK 3KS0J 2DKSA 4WUUB 5F93C 4JPIA 1AI1L 4XPBH 3WFBL 2J12B 2VDQH 2PXYA 3MROB 5DRNA 3AU1A 3MOBL 4X4XA 4Y8AA 1KLUB 5C0EB 2J4WL 2DBLH 4R4FH 1X44A 2CLVB 3PHOA 1NCWH 5J1TC 4X83A 3SDDB 3LS5L 3I50L 1RZFL 1RUAH 2I5YL 1C16A 4OGYL 4PJBF 4LRNL 5C9JA 3CSYB 1Q9OA 2P5EA 2IPUG 4LAQH 1YUHB 5DRWB 4YHNB 3AS3A 3DV4A 4CDHA 1ROWA 1QP1A 5BJTA 2OP4H 3ARGB 4NQDD 3TWCL 5IB4B 5DQDH 2ITDA 5IHZB 1J0ZA 1I8LA 2Y06L 4YLQT 1D5ZB 4XVJH 1I3RB 1DQDH 3QQ4A 2WBJD 3LQAL 4ORZC 4ZAKC 1SVCP 4YGVB 1FIEA 4LF3B 5DRZB 2DTSA 4KUCD 5K93A 2X40A 2Y72A 3L9RB 5GIRB 1MCBA 1XGYH 4PGZA 4Z95L 4ZG1A 2Q76A 4XXCC 5LVEA 3EFDL 1D5IL 1U8NB 4MZ3A 1UENA 5C09D 1NCTA 1E28B 1IAII 2Y9RT 1KIUA 4HFWB 1S9WA 2JB5L 3ZDXF 2UVFA 4FZEL 2W9EL 3AM8A 5E99H 2P5ED 3WFDL 1DBJH 4WU7B 1I9IL 1QSFE 3VWKB 1B4JH 5JA9A 1UZ8B 1SJHA 1RFDH 2P45B 3CC5A 5HGBB 3MLYL 1C5CH 4PJCA 5ADPH 3KPMA 5K9QI 4OCSH 4MB4A 3O2VL 4KRPD 4PY7A 4QT5B 3ZYJA 5E7BA 4MD4B 2CLRA 2BOBA 1UJ3A 1JGDA 1HE7A 3BSZL 1J12A 1O5DT 1NJ9A 1D5MA 2MPAH 1U3HB 1FZJB 4CN1A 5IWLC 1YZZA 3MA9L 3WUWG 1LNUA 5DJ6B 5CP7B 1A6TB 1NGPL 2DWEA 5E24E 4PTUB 1LGVA 5D1QC 5IEKB 2ZCHL 4LCUB 3NCMA 4Y4KD 4UBDC 1LD9A 1AFVL 3MOQA 4DK6A 3TVMA 1XIWB 3IDGA 4NQVA 1HQRA 4WHTB 3DVNB 2A6JB 5KSAB 4M3KB 4LVNB 4ZTPL 2AABL 4OUOA 1KYOJ 2BRQA 1NH6A 4P2RD 4G8IA 2L7UA 5F1IB 4MXQA 4KQ3L 4RSVA 1NLDL 1CD1B 3STBA 5DJZB 1FZOB 1DTUA 4W6YB 1DUYB 4WRLA 2V5RA 1MH5B 3AAZB 5EC2A 2JIXB 5KSBF 4FOMA 2XWTA 3LMJH 4HFUH 4EQ3A 1OF2A 3NIFF 4NN6C 1X9QA 1HK6A 3BWUC 3RVTD 3PWNB 4HC1H 1JFQH 4OLXH 3WS3A 5E8PA 4LP4A 4N9OB 3SDCC 3QUZC 2H3NB 2GYSA 2HFGH 3ILPA 4M6MH 2GUOB 3TVMD 4WTWA 3DX9B 1BEYH 3BISA 3R06B 3V4PH 5EZOL 2Y36L 1NMAL 2HLFD 1KOAA 4P2QD 1ZHLB 3K46A 3TFKA 1IAIH 3CFDA 5CWSB 2V7HB 3BPCB 1EPFA 2IQ9H 1A3LL 4TNVK 2XY2A 4RGMC 1UQSB 1BWMA 5JW3H 3H0TB 4JHWH 3WN5B 3DHJA 5I75B 5SWZE 4QHMB 1C8PA 4ZMAT 3FN0H 1OPGL 4DKEH 5HGAB 3O6FD 4Z8FL 4X7TB 3AMKA 3GSWB 4I1NB 4ONGH 3K0WA 2Z8WC 1C5BL 3MXWL 1UT9A 3KXFA 1FL6A 3F58L 1WBZB 2EDQA 3UJTL 3NGBC 3VFWA 4U7SA 5I1HL 1Z5LB 2W65A 3ARBC 4FXLA 2R0WH 2E9JA 3EYSH 4MAUL 3MTRA 3EOAA 4HQQL 4LSUL 5IW3A 3QIWA 3HPLB 4OFPA 3W0WD 1HQ4A 5F9OL 3ARYA 1R3LB 3GJEB 3IS1X 3LEYH 4LDOB 3HC0A 4LBEB 5C0IB 3VXSB 3MJGX 5DRXB 3HUJE 3CMOL 1F6FB 4MDJA 3VFUB 3QDJA 3TBVB 1MCEA 4L4TE 2CKBL 2A74A 3P0YL 4M1GL 2HMID 3AS1A 1TZIA 3F7QA 5I16B 3U9PH 2OCFD 3KLHD 3M1BB 4NO5A 5KVFL 2VLKD 4ODHL 3DVGA 2G75B 4IRSB 1G6RH 1MELA 4FQJL 3RTQA 2PYEA 1T1XB 3IGAB 1DLFH 3MLWH 4R8WH 1K85A 1VB9A 2OI9C 4RX4A 4XVUC 2CK0L 1QFUH 1SVZA 5CHNA 5JW4Q 4LKXA 5HI4C 2NX5E 4C4KT 2DAVA 1F4YH 1TZGL 1Q38A 1BQLL 3TPUA 4J23A 5T3ZE 2ZSVA 1V7NL 3GO1H 4S0TD 4QNPE 3EJZC 2IALA 1R3KA 3RWIA 3PWPE 1T6WA 2A6KA 2X4QB 3N9GH 1S8DA 5I15L 5GS2D 2IAMD 5CLTA 4MNQA 3QWQB 2ADGA 3T0VA 3JWDL 2VSDA 5HI3C 1AP2B 1MCRA 3T0XA 3W11C 2K7QA 3P4NB 4NGHH 3KLAB 1WZLA 2E8YA 5C70A 4WGWB 5F3BA 4Y2DB 3CFCL 4U1KB 5FYJL 2EH8L 3RTQD 2R56H 1QNZL 1UJTA 2PYED 5ESQB 3VJ6A 2XKNA 3WIHH 5A1AA 1HSAB 2W92A 5MEOA 4JY4B 1JCKA 3KDMA 4ALAL 1DQJA 1HZHL 1UWXK 5ID0A 3HPJA 2ENYA 2X4SB 3QULA 1HHHA 2NZ9C 4XNQB 4HEME 5MP6L 4IOIB 3MRRA 2AEPH 1WUNT 5BOZG 2H2SD 3QEHA 4QGTA 4Z0BH 2QKIB 5JIHA 1F6AB 4R6UA 3IF1B 3ZKNC 3FAXA 4WEBH 4RGOL 5GSRB 3DURA 2IQAB 4D0CA 4MNQD 4KHXL 4LDLB 4MA1C 1A9BB 1OTTC 1ACYL 1ONQB 4C54A 4KV5F 3MLUL 1A3RH 5IP4A 4FMKA 1YA5A 4NZUH 1A2YB 1U93A 3H7BB 4JY6B 2CDGB 5CINL 2FEEI 2PKDA 4M7ZB 3QUKA 4CVUA 4HEPG 1UYWL 1YEKL 4JCMA 5IESH 3BZFB 5DVNA 4LVHB 5EO9A 5IR1B 5EU6B 2FGWH 3RDTA 3S7GA 1MIEH 3FQNB 3V5KB 4L3AA 4Y19E 2Q8AH 3FRUB 1X5GA 2DQCH 5IUSA 5HPMA 4NRYA 2YRZA 4U1JA 4K3JH 5K33A 4OUUA 4JO4H 1HN1A 3RZCA 2C3GA 4P9ML 3BEVA 4YX2H 1ZEAH 1RULL 2X4TA 4G5ZH 2X9YA 1S7SB 1EGJH 1KN4H 3V6ZB 1GIGH 1JTTA 1JPSL 5I8KH 2RCSL 1KJ2A 4MA8H 1E6JH 1T5XB 1RZGB 3QEQA 4LCWE 3L3IA 1T7WA 1MFAH 3HHRB 5LJYH 1BECA 2ZCKH 4Z76B 4OQ1A 4WNQA 3QJHB 3D0LB 5F44A 1J0YA 3VXPB 3QNXA 4NKOB 4PJAF 1MCWW 1KENH 3H3BC 4I77H 2ZUWA 4GAFB 2FWOA 1AR1C 4GBXA 4FFVC 2A83B 4DTGH 4JB9L 1XH3B 2PNDA 4QXWA 2DKMA 4NQDE 4XNUH 1T83A 3F12A 2I24N 1G1YA 4ZUVA 1YJDH 4YDJA 3RZCD 2F19L 5GGUB 3GSNA 3HC4H 2VQ1A 1CFNA 2F53B 3V0WH 1P53A 2GJ6A 2FBJH 4HAGA 1DBBH 1LK3L 2J8UE 1X5HA 5HY9A 3KAAA 2ZP0T 1MREH 2ESVA 4WI8A 4AMKH 3RWDA 3NCYP 3S36X 5FUCE 4RNRA 3QFDB 5DQ9B 3IDNB 1FGNL 1F90L 2VDKL 2XFXB 2BDNH 4OF8A 4ELMA 4D8PA 1YEFH 5C2BL 1BOGB 4P2OD 3TT1H 4NT6B 1ZHKB 2B5IB 3QWRA 5LGHH 1A6UH 4X6CE 4ZO8A 3UZQA 5KVMC 5DK2A 3LKRA 4LCIH 3T4YB 4PRHA 3RU8H 5KBNC 3PP3H 4DN4H 2AJVL 2Z4QB 2V7NB 3SDDD 1AD0B 3X3FH 2VZOA 1U8IA 1KV3A 7FABH 4XZUA 1QHPA 2J6EA 4FFZL 4X0KA 2Q7YA 4XAWH 4NRXA 5I1KL 1S5HA 3MREB 4JKWA 5T1KB 3DBXB 3NFNB 2GJ6D 3QEGH 3TLRA 4DN3L 4PJ8C 3VGBA 2OXHA 4MD0A 3T3MF 5DS8B 5KSBB 2AJSH 2BSRA 4NQCE 4ZODA 3ARGD 5ECJE 4XP4L 4PS4H 4HS3B 4OI9A 2E9WA 1PY4A 3RKDC 3V52L 3IU3A 4Y5YB 3T09A 4PJ5E 1SBSH 5I17A 3UC0H 1RURH 3CX5J 3C5SA 1N3NB 4DGVL 2P5WA 4UMGA 3QWRD 4AT6A 5IMMB 2OSLA 3OX8A 4ONHB 1CFQB 3VGAC 5MHSE 1YNTA 4K8RL 3BOVA 2X4RA 4P23B 4PRHD 4U1HB 4BFIA 5AG8A 3ULUL 3L1OH 1HYRC 5I1AA 3BO8B 3HZYA 3H3PL 4N5ED 1A0QL 2UWEA 4NQXA 1YMMA 1U3ZA 3VXRA 1I1RA 5IGXL 1JYNA 2LQRA 2D3VA 4L5FH 4RIRB 3FOMA 4L8DB 4XBEH 4LVEA 4WWKB 3HE6D 4H0IA 4HIEA 3U30C 1A1NA 1GOGA 1BM3L 3VFPA 3D2UB 1TVHA 5DF0A 4U1IA 1N6QH 3C8KA 4GG8A 3OG4B 4H1LG 2DQHH 2ATPB 4ZD3L 1SYVA 2G2RB 3O6LL 3U83A 1S9VA 1HHGB 3HA0A 1CT8A 2W0FB 2ZJSH 3WNPA 3U46B 4HIHB 2JB6A 1U42A 1PYWA 5GRJL 5AG9A 1IZKA 2O5YL 2YBRA 4OAWB 1XEDA 1MJ8H 1YPZE 3EBAA 4OKVB 3UO1H 3C6SB 4ENEC 4WEMB 4P5TB 1LO3L 2EDXA 3PGFL 2FD6L 3SCMC 1INQB 4FG6D 3HZKB 1CD8A 3BW9A 3VXRD 3NABL 5HHMB 1FVCB 4UUJA 1JNHB 3OXRB 4OFIA 3MMEA 1PZUB 3T0AA 3BDYH 3V6OA 2NXYB 3ZTJG 1T1YA 1JWUB 1J8HA 3TCXA 3TH3T 3VD9A 3UPRA 1H3VA 2YWYA 4WHCA 1LE5B 2IBZY 4WO4B 1S7VA 3ET9F 5GGRA 5KSAD 3SKOA 4DFIA 3ZDZE 2H32H 3CK0H 1RJLB 5J6HA 5CGYC 2P48B 2FX9H 1DQLH 2UUDK 4IMLB 4R4ND 1EHLH 4HS8H 1GPOH 1U8PB 1I3UA 2VISA 4NZRH 1EK3A 1X5LA 1NCBH 3MLVH 4AEIL 2XPGA 5D6DA 3MGTB 4TULL 1BJ1H 2R0LL 4Y88A 4WW2F 3JV6A 3W2DL 4Q2ZB 3ZT6A 4H88L 5E00B 4YHZL 1S7TA 2ZOKA 5DD5L 2VXQH 3WS6A 1G9NH 1FL3A 3GMLA 1MFCH 3DIFA 2AI0L 3LZFH 4GQ9H 3WNKA 4HF5L 4MYWB 1C1EH 3D3VE 4A2LA 1R3HA 4JFXB 3ARDC 5CUSL 3F6IA 1J8HD 1NL0L 2P8PB 3H6JA 5EPMA 2RB8A 1KN2H 1JGVH 4YNYB 5FECB 1JZ6A 2RAMA 1IGJB 2QLVB 3BUYB 3BHBA 43C9B 2X1PA 3MUGB 1PDKA 5FKPB 4HUNB 4KJQC 1EEZA 1J1PL 3QIUC 2CUMA 5DUML 5E9DB 5DT1L 2MOVA 3RIAF 3MRJA 2PTVA 3WDJA 5DJDA 5HYJA 4PJGE 3CCHB 3D18B 1UWGL 3GI8H 1DVFC 3L7FA 43CAB 3CSPA 4YJZL 3UTSA 1FYTB 4H26A 1KCUH 3CXDL 3EFFB 3QUYB 5FYJU 4AL8H 3ZHKA 1RUQH 2VITA 1UWEH 3MRNB 1YYMH 3BIKB 4QYOB 2XZQH 1JWMA 1MHEA 1I1AA 4KMTL 2V2WA 3ULSB 2PXYB 3VD3A 1QBAA 3MQIA 4X5WB 3T0BA 1QYGH 3JTTA 4OBSA 5D7LA 4PB0H 2FRGP 2EDKA 4YDIL 1AGFA 2EDEA 4PJHA 1T1ZA 5E2TL 3FFCA 3QCVL 3QCTH 3GBMH 1IZJA 4HJGA 4YHYC 2WWKT 5HGGS 5FO8A 5BMFL 3MOAL 4FQQA 3T4AA 1G7IA 3G08B 1OP9A 4MS8D 3UYRL 4HULB 1V7ML 3NMEA 4I48A 3UTSD 2D0GA 1LDSA 4XI5C 5IVXF 3DSFL 4X9BA 2ATKA 2EH7H 2D03H 5GRZA 3O3UN 2ZUXA 3CFBB 3W81A 4JDZA 5DFVD 4PJEA 4GRLA 4ODVL 2NY5L 4EBQL 3IFLH 3L5JA 5KSUA 4RAVA 5KVEL 3KNBA 5HI5C 2NNAB 3SO3B 3G9VA 4F7PA 5F8RC 1IARB 4ZXBB 3DETC 1EFXB 1R5WB 3MRMA 3B2VL 4BUHA 3QH3A 1WIOA 2SEBB 2W1NA 2V5MA 3VGFA 5E2UL 1RZJH 1P4IH 4Q9BA 1X3DA 3VFNA 4UTBL 4PJAB 4X6DB 4OD1L 3VWKC 2H32B 1TTUA 5HXMA 3MXVL 5DHVA 5GS2H 4R7DB 2NY4B 4HXAL 3HG1A 2DQGH 1F00I 1BGXL 1Z3GL 1OAUH 3KPMB 3LHPH 4JFOA 5CSZB 3OAZH 4MX7A 4I0PA 4PRPA 1VESA 4MAYB 5EZLA 3DUSB 3TN0A 3O6KL 5E6ZA 2H1PH 3QDGA 4B50A 1UJ3B 1EAPB 1IC4H 3TBWA 4PJDE 1NJ9B 2NXZC 1G7QA 1U3HC 4HCRL 4M7KL 2EDFA 2LU4A 3ZHDA 1UKTA 5A40E 1C08B 4UNTA 1X6LA 3OJ2C 5I76B 3WV0A 3MZGB 4FXGB 5IBTH 4CMMB 2D7PA 4PGEA 4JVPA 3NPZB 4NWTH 3CIQA 4QRPA 4KDTC 1ZLSL 4P48A 4UU9A 1S7WB 4ELMF 1IBGL 2OM5A 4QXUL 1K5NA 1CVSC 5GS0C 4OV5A 1FV1B 4M9OA 1XIWC 3FCTB 1KCSL 1QSEE 2Y5TA 4JQIL 2A2QT 5DEFA 1FE8H 5I19H 3EYQD 5H2BB 4APQC 1IKFH 3SDAC 2P47B 2VL4A 4PRPD 4G8IB 1JI2A 4S1QH 2VDMH 4JLRB 5SWSA 1J10A 4DVRL 3FONA 5F96H 1KNOB 1JGUL 1EO8H 3RVVC 4O4YH 4PLNC 4ORGB 4OZHA 3JTCA 3BPOC 4HWEL 1ZA3B 4QKXB 5C0GA 2VE6A 1QKZL 1IAMA 4P4RB 3S96B 2R29L 5E6ID 2F15A 5EC2B 3QDMA 4YR6A 2VLLB 4J7RA 1OW0C 5CGTA 2I9TA 5IEHA 1DBMH 4KJYA 5IROA 3O3BA 3KPNB 1FO0A 2HH0H 4Z7WA 4IEFB 4G6JL 1TQCB 2Z35A 2E6PA 3BESR 4QRRE 3S37X 2F54D 1N5YL 4NNPH 1RIVH 3RPIA 3FQUA 4KROB 3D85A 4YBLB 4WUUE 5C0CD 4U6HB 3SE8H 4U1NB 1DQMH 2EKSA 2CIIA 1CDIA 3S5LB 3BX7C 3D39B 4JAMA 3KPRE 2UWEF 2YHGA 4POZC 3U7WH 1CGXA 1M1SA 4X8JA 4YHPB 2R1YA 2L0DA 3C8DA 3RVXC 3HZVB 3MUJA 4J4PD 3KXFB 1SEQH 5GZOD 3E3QC 4XC1H 4N1EA 4MJ5B 3SOBL 2C3VA 1W0VA 4MNGB 2DRUA 4EI6A 1JMXA 1C5DB 3LKSA 3B2UD 3QI9B 3BGAA 1CDHA 5IW6A 4Z7QF 3EOAB 2AJXH 5L2JA 2MKLC 1T3FA 4NO2B 1AC6A 5IF0A 3S8WA 3HC0B 5F70A 3LQZB 4FQPA 1CFVL 5TE6H 3Q48A 4ONOA 3QDJB 4AYFA 4TPRH 4E41A 5DLML 3O8XC 2BRRH 1KJ2H 1TZIB 1QLEL 4O2EA 4PBWD 4HG4K 1T20A 4QXTA 4H5SB 1H0DB 1ORSB 2HRPL 5EOCL 5EOQH 4LLWB 9CGTA 3L7EA 4IRSC 4LPVA 1MAML 5CKAA 5MENB 5BS0E 1OLLA 4P2YA 5CD3A 3MRLB 4M1CC 4XT1C 2BNRD 2ADFL 3MV9A 5E0QA 4LSSH 2J3SA 1QRNA 4BFEA 3TPUB 3LEXB 3U2SB 1BVKB 5J1AB 3TT3L 1IQDB 5JLZA 3QUML 5HYFA 4WW2B 1R5VB 1EJOL 5DD1H 1KB5L 3KPLB 5SX5H 3MYZA 2IALB 2Q86A 5ACZB 1FYHB 3BYTA 1YYLH 3GSNH 4OCXL 3P4OA 1NUDA 2BOCB 2ADGB 3UZEA 2F8OA 5DJ8A 5ABDE 2EXYD 3P4MB 1AI1H 4FFYL 5FM5M 1INDH 4YHOL 3RZWA 2DD8L 2YC1B 4YBQC 2GEEA 4L8CA 4LNRA 3BD3A 1VFOA 2R4RL 4NKDA 3SGDI 3P77B 3LS5H 3I50H 5T3XE 1H15B 1AJ7H 3I75B 2I5YH 4LQFL 1WT5C 2F74B 3FMGL 4OGYH 3MV9D 4NBXB 4LRNH 5FGSA 3X12B 1EFQA 1QRND 1WZMA 1KPRA 4NP4L 4ZFOL 3FO9A 3MR9A 3DROA 3LB6C 4LCCC 3RFZC 3H9SD 4XBPB 5FHAH 5DTFA 5DMKA 1I7UB 5IKCB 4FP8L 4WWKD 4PGJA 2Z31B 4D0CB 3RQ3A 3BXNB 4M7JL 1LVEA 4Z7OE 5CZXD 4HKBA 1FGVL 1H3PL 1TVBB 5A2IH 3U0WL 1PY9A 2WIIA 5J3HD 4Z95H 5K9KB 5A3IC 4PGCB 4Q58C 3EFDH 1D5IH 1K4DB 3D1MC 3AB0B 4KPHH 1SJEA 5E8OB 2DMBA 3VDBA 1NCCL 4YO0A 4PJHF 4BZ1H 3GMNA 4LU5L 4S1DC 3I9GH 3VXTB 3L5WB 1AGCA 2JB5H 1FP5A 2VL5B 5CBEA 5F6IC 2W9EH 4J3OC 2DQJL 3KYNA 3ROLA 3CZFA 1EXUA 5EIQA 3OXSA 5KAQG 1XR9B 4XNYH 1LO2H 2K3TA 1RZ8B 5IVXB 3IDYB 5ILTL 5T5NF 2NY6B 4PRNA 3MLYH 2CPCA 4EUPH 3EDDA 4U1JB 2EEBA 1FNSL 5T3ZL 4X99B 3NOIA 3DX7A 2DTML 3MA7B 3NIDE 1INEH 2NYYC 3REWB 1UACL 4AJ0A 5I1LB 3RX5A 5A2LH 3EJYC 4M6OH 3O81A 5HHOD 2C7UA 5GGVH 3H2WA 4UT7L 2NMSA 5FCUH 3B8YA 1NGPH 1PW3A 3UPAA 4AG4L 3QEQB 4F9PA 2VUOA 2WLYA 1TTGA 3TIDA 4EEEA 4LSDA 5CBAB 4RMSA 2ZCHH 5CEZE 3S88L 3WLBB 3CH1B 3D69A 2FSEB 3LD8B 3VXSE 4ZUSB 2ZNWA 1YMHA 1LWRA 4P3CL 1T66C 1XF2B 1AH1A 5I1CL 1CLCA 2BXYA 4C55A 3PGDA 1B9ZA 3GHEL 3SGDH 1ZKAA 4HDIA 3UTPE 3CU1A 3WFCL 3QPXL 4DKFL 3GDBA 4ZTPH 2V9TA 5EN2A 2Z9TA 5EZJB 3RY4A 2LTQB 5HDLA 2LE9A 1CDUA 3H9HA 2PO6B 4KQ3H 3AY4A 1NLDH 3WXVH 3VFTB 1VSCA 3TNNA 3NIGE 4LRIA 4YXKL 2APBA 3BYYA 4LLDA 2HG5B 5F9WC 2BY3A 3KHQA 4WFGD 2ESVB 1VADA 2QL1A 4EJ1C 4NCDA 3OKDB 1RSFA 3SE4A 4O58L 1F3DJ 2CDEA 3BZ4B 4D8PB 4PG9B 4K7PY 5D93C 1T7YA 4Y16C 5D2LA 3V7MA 1S7UA 2DQUH 4JG1L 2WBKA 3EYFB 1V3MA 3PV6A 4IJ3B 1LP9F 1JUFB 4OB5L 3E6FB 5IFHL 1EVUA 5EOCJ 1S7RB 1AO7E 2AJZA 4HPYH 2Q7YB 2AW2A 4G80B 1MLCA 4NRXB 3LAFA 1T1WA 5DURB 4CL7A 2NR6C 2FJGB 4NNYB 4KMLB 2PN5A 4PV9B 4ERSH 4HJ0D 3NCFB 2OXGA 1OOAA 1OPGH 1B88A 3ZKQD 3KJ6L 2BZDA 3VXUB 3RHWF 3TIEA 1C5BH 1M6OB 3K4DA 3MXWH 2R69H 2YUWA 1ITBB 1CE6A 3STZA 2W0KA 2EDNA 4I9WE 4QOKE 3EO0A 4NYLB 3VE0A 3E6HB 4UIKH 1KPUB 1JJUA 1U91B 2BNUA 3VCLB 3PP4L 2IAND 1IEBA 4AQ1B 1QVOA 1BQUA 1XFPA 4C56A 4F8TA 3P73B 2J5LB 4HQQH 3OKNA 1YNTB 3AS0A 5F9OH 4BFIB 4PFEA 1MAKA 4MMXC 4P23C 4YK4B 4J12A 5ESAB 1A7RH 4GG6F 2F5BL 5DMIL 3IVKA 5HVHB 4ZXBD 5IFJA 4P9HH 1PEWA 4M9PA 4DFHA 4EUPB 1XCTA 3MLXL 3P0YH 4M1GH 1S9XA 1S7QB 4PJBE 1LQVA 3RWCB 3FOMB 3NA9L 2B8OT 2CRYA 3SKUD 2YD1A 5TJWK 4FMFA 5KVFH 4ODHH 2GTWB 1HXMB 4FQJH 25C8L 1UXWA 2BVYA 1BQHA 3MCKB 5EU6E 4FQXB 4NPYA 3ARQA 4EKXA 5C0ND 2ZZUT 4G43B 4GMSH 4MAYD 3GUTA 3UZVB 3KYKL 3ARVA 4G6ML 4XWGL 1KUMA 4LOUD 4V1DA 1URLA 4RAUA 1UB6A 1O7VA 2NY0D 3GSOA 1ZLUH 3O3DA 2OMNA 3DMMC 4L8SC 4P5TC 2V2XB 4C57C 1AGEA 4PRBA 4DVBB 4JRXB 4JFZL 2PYFA 5KSVB 3JWDH 1T6VN 5C0JA 3GBNL 3MMEB 2YA0A 2VDOL 4F7MA 1DEDA 1A1MA 1P2CB 1Y18A 3X17A 2JTDA 35C8H 3UPRB 4X6FB 1YJDC 2P7TA 3CFCH 1VKXA 4K23L 3RGVC 5FYJH 2EH8H 1S7VB 3QNZA 1QNZH 2ED7A 4WO4C 5GGRB 2OR9H 2MNUA 3FOLB 3HNVH 4Y4FB 3SE9L 1F4XH 3FT2B 1Q0YL 3QO1A 5DHVH 4J3UA 4AIZA 3CUPA 5ISZB 3BAEL 3O9WC 1D7FA 4I0CC 3K2MC 3UTOA 3CVHA 5MP6H 1FG9C 2VO5A 3VWJA 1HHKB 5DJXB 1HCVA 1M71A 2QQLL 1RK0A 3FO2A 3HE7A 4QHKJ 1T4KB 3GSUA 4F9LC 2F53E 3L3KA 3V4UH 1KTDA 4KRLB 3X3GL 4N90D 1S7TB 2RR3A 3F7VA 5I1EL 3FO1B 2ILLA 3WHXA 2FL5B 1CF8L 1IM9A 3CD4A 3ULUF 1R3HB 2GK0B 1MRDL 3B9DA 1MI5E 4CW1A 1KCGC 4PGDB 3S97C 5CINH 2EEAA 4R96A 5EOTA 2FLRT 4K7FB 5GRUL 3GK8H 3PP3K 1YEKH 4M6NH 3FB8A 5D7IA 3DLQR 5A16A 1I9RL 1MCIA 4UT9H 3V5HB 2OBGA 3QIBA 3HI5L 3L7FB 2DWDA 3LS4L 4XHQA 1E0OB 4KI1A 3KYMB 1D9KC 1XZ0A 1TCRA 2XWBA 5AYUL 5T1DL 2ZSWA 4X6BB 3QO0A 2VITB 5A2FA 4Q6YA 3B9EA 4ZSOE 1MLBB 3MRIB 5KSBE 1NFKA 1JWMB 1MHEB 2EEDA 2X7LB 1I1AB 3NIFE 4P9MH 1J87A 4PRAB 3QI9D 2MQCA 2PXYC 5D7LB 3ARUA 1EVTC 1G1CA 1GGTA 4PTTB 1XGUA 2CKBB 1FZKB 1JPSH 2B4CH 4BKLB 1ZLVH 2RCSH 5JW5B 4Y5VA 2R9HD 1BFTA 3GMRA 4JQXA 1A1OA 1OTSD 4JO3H 5F7YC 4NDMA 4XPTL 4Y5XA 3QIBD 1MRCL 4WIQA 4I48B 1CLOL 5BZWB 4JKKA 2YWZA 5I71B 3DXAB 1A47A 1I8LC 2A0LC 4MZ2A 1GOFA 3FO0L 4G8GB 1ZAGA 4DGIH 2OR7A 1GZQA 2D7QA 2X1WL 4JDZB 5DJAB 4XMLH 5C3TA 2F19H 4GRLB 4J1UB 4NQTA 4IRZH 3EOYG 3KNBB 2X70A 5C9KA 1DL7H 4KK9D 4F7PB 4RFNB 5LGJB 1A7PL 4XPAL 3LEVH 3PL6B 2YMXL 2DLGA 4R2GD 2X44D 1QFHA 2VXSL 3U36A 4PREB 4JFHD 1OTUD 5FYKL 5HYSB 3G9AB 3QH3B 3ZYOA 1FGNH 2VDKH 3KPSB 1AKJB 3AM8C 3MBEA 2UZIL 2ICWJ 3ZZ1A 4ZDHA 4P46A 3KLSA 4PGBB 5D7SH 2RGSA 5HHVL 4JM2A 3WEXB 4YFEA 1J0IA 4HX1A 2VDPL 5HHME 4WCYL 1ZA6A 4MX7B 4I0PB 5HD8D 4U1GB 5JOPD 4UILL 5FOBA 3F65A 5B3JF 3DGCR 4LSRL 3W9DA 4N9GA 1UJ3C 4FFZH 4MHHG 3BT2H 5J1SC 5I1KH 4WI4A 3A0OA 5I1DA 5EBLA 1QLRA 1G9NC 2H45A 4DN3H 3G6AA 2E8ZA 4XVSL 3HRZA 1NGZB 2CJUL 1QPPA 1T5WA 3DTXA 5LG1A 4R0LB 3UTQB 4XP4H 3HR5B 4QEGA 1JNLL 2AXFA 1FNGA 1N0XH 3V52H 1NMCB 1IJ9A 3DX8B 3MBED 5MERB 4DGVH 1I1YA 3W39B 3EYOB 3SJVB 2Y5TB 1TENA 2ERJB 3WNLA 3ZYZA 1LP9B 1QA9B 2DI8A 4AQOA 3BP5A 2HLFC 3QXDA 4LLQA 4KVNL 5BW7A 4K8RH 1K2DA 1IAIM 3QBTB 3GNML 4P4KA 4NBZB 4MXQC 4MLIA 2P44B 3H3PH 4WUKH 4PJ7A 3SKJH 1EX0A 4LL9A 5C71A 4DAGH 2ITCA 4XX1G 3MRKB 1CTNA 3OGCA 3S3SA 1BFOB 2CR6A 5HHNB 1LHZA 4YR6B 5E9DE 5CJXA 1BM3H 3KYAA 5C0AA 5EU5B 3BGMB 4B41A 3BZEB 2V2TA 1ZT1B 1M05B 5IK3A 2P42B 3ME0A 1FYTE 1VPOL 3P30L 3IXTB 4M43L 1P84J 3K74B 1B6UA 2G5RA 1FVDB 3MLPA 1HILB 3GSRB 2HKHL 1JTOA 4KROC 4KV5E 4L8BA 5GRJH 4UDUA 3MCLH 5C6WH 5JHDA 4GG6B 2O5YH 4P3DA 3IXAB 3TFKC 2M2DA 2EKSB 4LLVB 4P4KD 3C09B 4E5XB 2VLJA 8FABA 1LO3H 3N1FC 3PGFH 2FD6H 4M62H 1NEZB 4KC3B 4OCMC 1G7HA 5I1GH 2IC2A 4Z9KB 4OLEA 1VENA 3NABH 5C8JB 1L0XA 2NTFA 3RWEB 4IRJB 4KJPC 3KLHC 2PF6A 5FF6B 2R0ZH 4K3EL 5FV2A 3IRPX 4OD2A 3I3DA 1KJMB 2YD3A 2IFFH 1GRWA 1W0VB 2EC9T 4EI6B 1I7ZA 3FKUS 5JORA 2B2XL 2I60L 3LKSB 4UINL 5AZ2L 1DBAL 2PO6D 3JBG7 3N1MC 4I2XB 5IB1A 3TO2A 4FN0A 3MRFB 5IW6B 5J06A 5T33L 5L8KB 2HT2D 5BV7L 5L2JB 4AEIH 3HI6L 3QIWC 4JRYB 4XNMB 1RZJC 4NHCL 4TULH 5JUEH 2QSCH 4TSAH 5JHDD 3Q5TA 4WW1A 2VLJD 4YHZH 4E41B 1N2RA 2X41A 4IDLA 2VMFA 1RUKH 2XNAB 5JPNB 3MV8A 3DVIA 4HF5H 4JZJB 4GAGL 5CFHA 3QPQC 3EO1A 5CUSH 3RWGA 1ZT7A 1NL0H 4LSTL 3RTQC 1RVFL 1ZWIA 3O11B 3MNZB 4PJAE 1KGCD 5EZIL 3AXLA 5ITFA 2MKWA 4U0QB 3OPZL 3VG0L 3PDGA 3S5LG 5K9OA 3GGWB 4QTHB 3W5MA 1J1PH 5EUOB 4WEUD 5DUMH 1QQDA 2WINA 2YD9A 5HHXL 4EI5B 3B9VA 4PP2A 2H2SC 4RMVA 2WSKA 1NUNB 3IJSA 3VXUD 2EYRB 3P4OB 2IWGA 1WTLA 4FQHA 3V7AG 4BSVA 4CVZA 1ORQA 2C3XA 1CE1L 1XF3A 4KMTH 1T7VA 1FFOA 1FH5H 1PG7X 2NW2A 2VQUA 4OM1L 3SGJA 1S78D 3TBTB 2IADA 4JFDB 5E2TH 3QCVH 4HT1H 3QJFA 1L9NA 2DBJA 5BMFH 5KJRH 4BQBA 3MOAH 5D72L 1KG0A 2C3WA 4KK8D 5HYQA 5CJQL 5D7IF 5JIIA 3UYRH 2WUBL 2ORBL 2ZUQC 5DTFB 3L3JA 4OM0H 3I6KA 4ZYKA 3QFJA 4N0YL 3PABB 3UTTA 2XN9A 3PV7A 4JFEB 1OM3L 3T3ME 3IJYA 3RIAK 4Y1AB 4LSPH 2UY6A 2DN7A 5EUKB 1KCVL 2PW2B 5E7FA 4DK3A 4ZFGL 2K9UA 2AEWA 4ODVH 2NY5H 4EBQH 2WY3A 1XF4B 2VYRE 3IU4L 5JZ7C 4KKCC 3DX6A 5F7DB 5EU4A 2GJZB 3AB0C 5I30H 1CI5A 1XGTB 3FTGA 3LKOA 4TUOB 2H9GA 3ZLQC 5B39A 5GGTL 3B2VH 2YXFA 1D5XA 3MRCA 3OF6A 1Q1JL 4HV8A 2E5EA 2XOTA 3LRSA 4UTBH 5FUOH 1Z6JT 3AREA 4NJ9L 4OD1H 3D39E 2NCMA 3RDTC 2DL2A 3IDYC 2X9WA 3MXVH 4HWBL 3QFJD 3UTTD 4U6VL 3BP7B 2NY6C 4P0DA 3QNYB 4HXAH 4YE4L 1BGXH 1Z3GH 5I73C 1OAKL 3OKMB 5D2NA 5JMRA 4Z7VB 1SMAA 4L4VA 1J0JA 3OAYH 1KYOK 5CAYB 2EDOA 5ACLA 3RJDA 3O6KH 3VRIB 3RZCC 1BMGA 3KXFE 2FH8A 3LKQA 1JHTB 1N26A 1TJIL 1K3IA 5ISZD 1FCGA 1FC1A 4MNGE 2IH3A 4XP1L 2A38A 4BZ2L 4X7EC 4WDIA 1PEZA 3RNQA 2EIEA 2FIKB 1T22B 1RU9L 1Z9MA 4MQ7B 3HMWH 3OF6D 1ZLSH 4QLRA 3OKKA 3VA2C 3MSPA 1IGIL 3L3OA 5TDNA 5GS0L 2F9BT 3LD8C 3QQNA 4R26L 3WKMH 1T0NB 3ARED 3VGGA 1I8MB 3QDJE 3O4LA 5JTWA 1PKOA 1BQSA 1WWCA 4JQIH 4JM2F 3WD5L 4GBXC 2DQFA 5ICYA 4L3EA 5C0BA 4XCYA 4L4VD 3PUCA 2NY1B 1T83C 1M7DB 2LTQC 5D8JH 4O2CA 3NN8B 1W72L 3FQXA 1SYSA 1F13A 5MENE 4OTXH 1BZ7A 1JGUH 2AK4A 1I8KB 4Y8DC 5GS1A 4IIQA 2BMKB 4OCYH 4LNVA 4HWEH 1D6VH 2FZ3A 1HINH 1Q9WA 1QKZH 3HLAB 4S2SA 2R29H 4IOSD 4WFFD 3TPUE 4XPBL 2H26B 5H94A 5SX5K 1X5XA 2Z0BA 2CDEB 4UQ2B 3CVHH 4KJWC 3JUZA 4G9FA 2DBLL 5HSFA 4R4FL 3WBDA 3IYLW 3D25B 1NCWL 1A4JA 4G6JH 5IB5A 1U8HB 3O3EA 3MRHA 3V0VB 2MJWA 3O4LD 2VLMD 2EYSA 1N5YH 5DO2D 3PV6B 1NFDA 1BBJA 1FFNA 1I9JH 4L3ED 4I4WB 2P1YA 1UEMA 3O41A 5T1MB 2FJHA 5DJ2A 1OHQA 3CU7A 1PG7L 1Q94A 4ACPA 1ITCA 4PJ7F 3V6BR 3FQWA 1LO0L 2R2CA 5DQDL 4NKMA 4AZ8A 3OKOA 4JREC 2AK4D 5FK9A 3BKJL 2IMMA 1J05A 4XVJL 3WO4B 3TJHA 1DQDL 3QXTA 4X7DC 3NH7H 3PDDA 4KK5D 5KOMC 5BRZA 5J11C 1XGYL 5D96C 3FB6B 4LSVL 4ZPTA 1YEGH 4MD5A 4G9FD 5J12B 3W9EB 4YHIA 1U2CA 4NRZB 1P7QA 3SDXA 3G5VA 1TITA 3T0EA 1CDCA 1AXSA 5E95B 4DZ8A 5JW4M 2JK5A 2AEQL 2YUVA 5DJ0B 3VFGL 2YEZA 5E99L 4YK4C 4PV8A 4D9QD 1DBJL 5HDQH 5L0QB 1CFVH 5KS9F 4QXGH 2NPLX 4Q6IA 2R39A 1RFDL 1NANI 5I1JL 5CIPA 3KPSD 5FDWA 1S9XB 2NW3B 3L5HA 3HRPA 3P2TA 4HS6A 3IFPA 2P4AB 2EZ0D 5EOCH 4UZGA 2BVPB 3PWLA 4K3HA 4S10A 2OTWA 4FQCH 4WTZA 3C5ZB 5IVXE 4FQXC 5MEPA 1VGKA 2KZ1B 4FFWD 3OKEB 5HJ3B 1IGMH 4V1DB 5KANG 3LKPB 4J3VA 4K2UL 2GSGA 3LSOA 4D0DA 2NLJA 4PJFF 1KB5H 1WFNA 4QHKI 2AV1B 3BJ91 5HGHA 2IPTL 1T04B 1PKQB 4R3SB 4M03A 1NGWA 4W6WB 5D1ZB 3DYOA 1PQZB 4PR5A 3Q5OA 4MJIA 1UVQA 4TSCL 1CFSA 1BIIB 5C0JB 2AQ3A 3MO1A 1DEEA 1IQWH 4OI8A 3KR3H 3QEQE 2P7TB 5GGRY 5CSGA 1RK1A 4G8EB 3SJVD 2K7PA 1WFOA 1FG2B 4HKXA 2VAAA 1WGOA 2AGJL 1E27A 4ZPVB 4Y4FC 1FNAA 3QSKB 4LQFH 4HKJA 1N5AB 4J6RH 4D9LH 3CUPB 4U4BA 2GTZB 2Z92A 3M07A 1R3JA 2HFFB 3QP3A 3VXMB 5IB3A 1JGLL 3UBXG 4NP4H 2WQ8A 1FJ1A 3MLTB 1DLHB 5D6DC 1OQOA 3RKPA 5KZCD 5L2KD 4OFYA 4HGMA 5BXFB 4OLXL 1FN4A 4XPGL 3HE7B 4FP8H 4MNHB 2I07A 3DUUA 5EIIA 1I8IA 3L3KB 5KW9H 2DLTA 5HDOA 1HNFA 2HFGL 1FVEA 4MJID 3V4PL 3F7VB 5DJCA 3WS6C 5INCA 2ARJA 1JMZA 2ESVE 1FGVH 3SKMA 1H3PH 5B22A 3NCBB 1S5IH 4KDVA 2FHFA 1IAIL 1KIQA 3IETA 2GIYA 4ELME 5I1IH 1QSFB 2YRPA 3MFFB 4UDTB 5L9DH 5EFIB 2E3VA 4GQPH 4P5MA 1NCCH 2E7MA 3GMQA 3EW3B 3S37H 1NANH 4L4JA 3FB8B 2Z93A 4ONGL 1NCNA 3PNWA 5A16B 4JQVA 5E4EB 5KN5B 1XF5B 3OR6A 3GB7A 1RY7B 5EORL 2H8PB 5B8CA 2Y25A 2YXMA 4OLWL 3QEUA 4GOSA 1I85A 2VABB 4RRPG 3REVA 1S7XB 3IRZA 1KIRB 5T5FL 5H37H 2Q6WA 1I1AC 4JCLA 4TSBL 1FPTH 2NTSP 1IAKA 4RGNC 5BVJB 4P9HC 3V6FA 2XZZA 1VFMA 5J57B 4OSUL 4JRYD 4XMKH 2P5WE 1I7RB 4UT7H 5GSVB 1KTLA 4KK6D 5I0ZA 4OZGF 3DI3B 4AG4H 2ICWI 3GIZH 5JXEA 1A6AA 3A6CL 3QAZC 2HT3D 3HMXL 2Y1VA 4K94H 4Z5RB 1OSPL 3MLWL 5CZKA 1TJGL 1TZHB 2UWEE 2ZUVA 3P9MA 1J7VR 1YMME 4KWUA 2YD5A 2APFA 1ZTXL 4KRNA 4NOFA 5GRYA 1F4YL 4FA8A 4FABH 1NC4B 3PWUA 3HAEB 3QPXH 3QUMB 4WI5A 2ZKHL 4YIQB 1KB5B 4AM0A 3GO1L 3CPLA 2FJFB 2VIRA 4QHLA 3IAGC 2GY7B 1EO7A 1OAZH 4GRLC 4PJIA 1T89A 1VCAA 2HVJA 4EI5D 5LWYL 3B9KB 3BH8B 3JWDC 4Z7QE 1JF1A 3U36B 2R1WB 2Y7QB 2FO4B 1ZLUK 1EMTL 4U33A 4X98A 4UAOC 1R0AL 2X4UB 5D7KE 1B0RA 5JXED 2R56L 4P46B 2VLRA 1NAMA 3CX5K 4TRPH 1CBVL 3WIHL 2CMRL 4JG1H 4ODWA 2HLAA 4XNZC 4KKBD 4JRXE 2APWA 3UEZA 1BD2A 4N0CD 4I0PC 4ZFOB 4OB5H 5IFHH 4U1GC 3T77A 3MV7A 3TN0C 4JFDD 3F7YA 3CAFA 5GGQL 3CH8A 2XKSA 1LEGA 2I27N 4Z0BL 2VXVL 1HOCA 3QUXA 4LMQI 1MOEA 5I18H 5I1DB 2PCPA 3KJ6H 4OQTA 1BAFH 3GJFA 4LCYB 3HRZB 5DA0B 2B7DT 3DTXB 2CUIA 5I2IB 5J13B 4O2FB 3VMPA 1FNGB 4I18A 4JFED 5F6HJ 4XBGA 5IVNA 1QTYT 4L3CA 4Y1AD 4L4TB 1ED3A 5ACMA 2WK2A 3X14A 3PQYA 4MSWB 2QJDA 3PP4H 5FGRA 5AWNH 1RI8A 1ULVA 3TA3A 4XH2A 4ZOAA 1RJZA 1MCOL 1YECH 3BD5A 2CIKB 3BWAA 5HYSG 3FT4B 4KRMB 2F5BH 1ND0B 4PJ7B 5DMIH 3T2PA 5C6TL 3LN9A 4I13B 3NCEB 5JR1L 4HWBA 2WWKO 4NFCA 2DJSA 1JN6A 1JL8A 5IM7B 3MLXH 3QUXD 3B83A 5EBMA 1P4BH 4QRTA 1HHJB 4JO4L 2R23B 3H9ZA 1GC1L 4O00A 1YY8B 1ZEAL 3M17A 5HYJE 2N7BA 4G5ZL 5IROC 2V2TB 1N59A 25C8H 5F1NA 3IKCA 3PWPB 1AGBB 1GIGL 2B4CC 2HJFA 5I8KL 2WZPD 1NSNL 2DYPA 3ARPA 4QHNA 4MA8L 4OZFA 4Y4HA 3RHWK 4N0UB 5D1QB 3L3HA 4FTVA 3QZWA 4XWGH 1RUMH 4AH2B 2ZCKL 2ZOLA 3QA3A 3JTSA 5KS9B 4EDWH 5C1MB 4RGNE 3C09C 4JPWL 5D7LE 4NO0B 3PWJA 5BQ7A 4AEFA 3MNWB 2A9NL 1ZLVK 1AQDB 5C0DB 1LEIA 4I77L 4PJHE 2NY7L 3FFCE 5DC9B 1OGTA 4JFZH 4DTGL 5FO9A 2VDOH 3OL2A 1H5BA 1YEDB 4OCLC 4NHUA 2LAAA 3AUVA 1JZ8A 5E8EB 1YJDL 1A5FH 4M02A 1IT9L 4K23H 1QR4A 4WTZG 1J5OL 32C2A 2AAVA 5FM5O 1F11A 2WLZA 2PTTA 5JORB 1Q0YH 1IGYA 1AGDB 4JZNA 1DBBL 4YAQA 3DXAE 2DYPD 2APVA 1CDJA 2ICEB 4AMKL 4G8GE 4Y4HD 4PJFB 4FTVD 2BDNL 1YEFL 3WFZA 3TT1L 2QQLH 2C1OA 5J89A 3QUZB 5F9JA 4CNIA 3X3GH 2P49B 4JFFB 1P7KB 4MVBA 4S1SL 1A6ZA 4LCIL 2I26N 5F3HB 3MJ9A 3X3FL 4AEEA 4RGMB 7FABL 3HI1A 4XAWL 5FYJE 3TZVA 3RL2B 1T2QH 5BZDB 1ZWIB 4HUXB 4PP1D 5ENWA 1B0GA 2HFEA 4X6EA 5ITFB 3V4VH 3HZMB 2IFGA 1IGTA 4AIOA 1NEZG 3HG1E 1FL5B 4PRDA 3MUZ1 3WO3B 3RX8A 1I9RH 3BGFC 1I3VA 5TH2A 5K9JL 3QDGE 3NGBB 3LS4H 4GKZA 3G5ZA 1SBSL 5I8EA 3ARBB 1RURL 1KJ3L 5T1DH 5IVZA 1MFNA 4OIAA 4MLSA 5I8CA 5D9SA 2VR5A 4U2ZA 1WBYB 5DMYA 1K3ZA 1QO3A 3ULVD 4K8RC 4QRUA 3GMMB 4JPKH 1MCWM 3L5IA 4QRPE 1TMCA 3X13A 2Q3ZA 1CIDA 2ICWB 5IOPA 2AXHA 1BJMA 3TZVD 1RMFL 3RWJA 1O0VA 4Q9CA 1JNJA 3WIFA 4L5FL 4NN5B 1Z9SA 4X5XB 1LP9E 5ESVB 5DGRA 4CRPA 2Z8VC 4PRIA 4NM8L 2GAZA 4ZFFB 5DUBA 1MHHA 5SWSE 5GPRA 4XPTH 1JP5A 4GRWH 5D7JA 2BVTA 2DQHL 4NC1C 4WVRA 1MRCH 2OI9B 1CLOH 2AJ3A 2IG2L 4UOW1 1QLFA 2J8UB 2XN9B 3O6ML 2JF1A 4N1HB 1R5IA 3QHFH 4JN2B 1MJ7L 4HUWB 2MSPA 5KG9B 3NZ8B 4LDEB 1T0MB 5LAXA 4M48H 3QDME 1QG3A 1Y0LA 3G5YB 3UO1L 1CD0A 1U92B 2BSSA 3QDAA 4HBQA 4QWWD 1NDGA 1A7PH 4XPAH 2YMXH 4OZGB 5EC1B 1B90A 3P9WB 2E9BA 4HV8B 4GO6B 4EXKA 4XXDB 1A7QL 4GG6E 2CDFA 3U4EB 3LRSB 2UZIH 2YPLB 2DIJA 2IGFL 4L9LA 4N0FA 5HHVH 1MHCA 3SO5A 4F80A 3CK0L 5E08L 1MF2L 4HXBL 4OCRH 1DQLL 3EGSB 1GPOL 1W8NA 1HSBA 2QHRL 1HHIA 5DJYA 5INDA 3GM0A 1N64L 1CL7L 3AFLA 3EDJA 4LSRH 4EN3A 3LV3A 2DI9A 4LHUA 3QG7H 4MA3A 1LEKA 4G7VH 4P59H 5F21B 1IL1B 1A7NH 3BN9C 2VXQL 1G9NL 4WDIB 4MA1B 3RNQB 1MFCL 3O2DA 3LZFL 2O5ZH 4I2XE 4KUZL 2CJUH 3SKNA 1C1EL 1F3JA 3B3IA 4F9PC 4ZOBA 1NGYB 1KN2L 5DI8A 3VI4F 2DMKA 5TDNB 3AROA 2D9QB 2D0FA 4M8VA 3RAJL 3VFVB 4GKNA 4E41E 4YBHA 4JZOA 4CAGA 1QSFD 3BQUB 2DQFB 3VFSA 1XGRA 1JV5A 3C9NA 1OGAA 3L6FA 1YC8A 4KVNH 2JJSA 2VJXA 3GI8L 3GNMH 1IILE 2X1XR 4MJ6A 3AY4C 4EN3D 3WFEL 1MPAL 2XQBL 4LLYB 2WQRA 4UOW0 1TFHA 4LHUD 4LRIC 2QV2A 1YNLH 4HJ0C 4AL8L 5TF0A 2QQQA 4P49A 1U8KA 2Z91A 3OKYA 1YYML 2IBZX 4OLYL 3QRGH 3LKNA 4Q74A 5CJOH 3SE4C 4HJJH 4LLMB 4MCZB 3GMPA 5KTEH 4GUPA 2J7LA 2G9HB 4I8DA 4PB0L 5FCSH 3MRDB 3BH9B 3PGCB 1JPFB 1E4XL 5F7UA 2APTA 3TM6A 3GBML 4ETQB 2BXZA 3P30H 1J0KA 3JWNC 3OZ9H 3GKZA 4NUJB 4WU5B 3PXJA 1MCSA 4UV4H 3B9AA 2OZ4A 4V2BA 3IDIA 3ULUE 3N85L 1EAJA 2QR0B 3HMXA 4YZFF 3O41B 5DJ2B 4E0RB 1Q94B 4CMHC 2V5SA 1QOKA 4YQXH 1KPVA 4PG2A 2RBLA 3MV11 5FK9B 1R24B 5TF1L 1QFWM 3WO4C 1UA6H 2EH7L 2D03L 1U9KA 5SWZA 1UH4A 4Z7UA 4UIMA 5DEGA 2D4DA 1EZVY 4K3EH 4LASL 1OB1A 4HZLA 2DB8A 3QG6B 1Z9OA 4JDVB 2HA1A 2NY5C 3IFLL 3RVWD 4MDIB 4ZS6C 1CGSH 4NC1E 4YHIB 4HKZA 2B2XH 2I60H 4UINH 3KPOA 5AZ2H 3WUWA 2EE3A 5JNYA 2XTJB 5T33H 4FZ8L 4LOUC 4JGUA 2BCKA 5BV7H 3LPGA 4XPFL 5TE7L 1CG9A 1RZJL 4NHCH 1P4IL 5E6YA 3T65B 3B9KD 3PHQB 4ZAKA 4X4MA 1F42A 1AIFB 3TF7A 4ZQKA 3U6RA 1IAOA 2BC4A 2LV4A 3HC3H 3HUJA 1JGEA 4XXCA 3MNVA 4P57B 2BFVH 3RL1A 5SWZD 2BSTB 1OCWL 2H1PL 3P11H 1K6QH 3G04A 1NCDL 2COQA 4M61A 2O61B 1RVFH 3R8QA 1BREA 5FDYA 1ODAA 2FYYA 3RIFF 3VG0H 3DUHA 2BNQA 4PJ8B 1ZS8B 1ZHNA 4JR9H 5IBTL 5JPMB 5H35A 3OAYK 2W0PA 1XT5A 4NBYB 5HHXH 3GSQA 2NX5A 4PJ9A 4RQQA 4PLKD 2QEJA 5JO5A 4NO3B 4ZAKD 5DR5L 5CD5D 3PDOB 2X4NB 2E6QA 5AEAA 3DGGA 3D6GA 5I19L 4U6XB 2RFXA 5JDSA 4WV1A 4LEOB 4PLOB 3VGAB 2YSSB 4L4TD 2ICES 4S1QL 4NCC1 5D1XA 4DCQA 1NC2A 5F96L 4K55A 4HKXB 4OM1H 4XCNA 5D6CB 1OAQL 2FH6A 4O4YL 3LN5A 1NAMH 3TJEL 4XCEB 5M95B 4HIXH 5E8DL 5IQ9A 3EYUL 5D72H 3U30B 1BP3B 5F97E 2ZCLH 4GT7A 1XF1A 4EIGB 5B3JE 2EC9U 5EBWB 5CJQH 1BJ1J 3JV4B 1UEYA 4ZUWA 2WUBH 2ORBH 2NX5D 3VWJC 3WSQL 2X10A 1U8OB 1FAIH 5ITBL 4TUJB 4OLUL 5T3ZD 3HE7C 2X4PA 2I07B 1I8IB 4M8QB 1FVEB 3LN4B 5EULV 3IAPA 3C6LA 3P40A 2M26A 5DJCB 4U1MB 5FA3A 3PWPD 4OQTH 5EBGA 3U7AA 3GJFH 1KCVH 1WZ1L 1DQML 2PTUA 3C5JA 4JO2L 2ID5A 1FORL 2AV7A 2CLZA 3FQRA 3SCMB 4YFLF 1H3XA 5ERWA 3ECBB 3IU4H 4OIBA 3U7WL 3S4SB 1IEAA 3IDXL 3KYOB 1CFTA 4P5MB 1TNNA 3IDMA 5F89A 4UBDD 5IG7A 5HHPB 4TTDC 4NO0D 3PNWB 3N1QC 1OTSC 1CDBA 1A4KA 3GB7B 4XC1L 5L88H 1NBYA 1FRGH 3QIBC 4NJ9H 1EA9C 3MJ7B 1FFQA 3F62A 2GITB 4ISVA 4KTEH 2F5AL 4HWBH 5CILH 5TQ2L 4YE4H 2Y4SA 5EU3A 3L3DA 4TUKL 5BV7B 1AE6H 3C6LD 4UQ3A 2AJXL 4Y19A 4ZUTA 1FC2D 2BVOA 4NM4L 2Q8BH 4MCYB 2PW1A 3A6BH 3UDWA 3U0PB 1X7QA 4CUCA 4KI5F 5EH1A 1T21A 2ADJB 2AP2A 1BVZA 4TPRL 3GI9L 1QSEB 2BRRL 2EYTB 5DDHB 5DHYB 1KJ2L 4BZ2H 4Y5VC 1U95B 4L29B 4C56E 3VFRA 3SDCD 3LH2H 4YFLI 1RU9H 3ARDB 3QUZD 4JQXC 2OTUA 3DO7A 1FAKT 4ELKA 4BZYA 2EIZA 5F1OB 1XR8B 5JOFA 4Y5XC 4R26H 4LK4A 3QXAA 2CRZA 4U6YA 1E4WL 2ZWLT 4LSSL 2EDDA 2YRLA 3QIUB 3WD5H 4KZDL 3D0VB 1VACA 4PLJD 1P4LA 1LQSR 3FB5A 1D3CA 4TVPH 4Y19D 3FQTB 4PB9L 3CPLB 1W0WB 4EVNA 1W72H 4NQDA 1YYLL 3Q3GB 3GSNL 1FSKC 1WBXB 2GFBB 3IDUA 1MCNA 1U8QA 4HIJA 4WFEE 4D0BB 3FHQA 2WBJA 1UB5B 4XC3L 2Y5EA 1HCFX 2EDJA 2H6PB 1INDL 5F6HI 4V1DE 2DM2A 3RWFB 1XCQB 4LKCB 3P0GB 3T2OA 3KPRB 2Y23A 4P46C 4LCWD 5C09A 1PKQE 1FFPA 1QUNA 4NZTL 4YHYB 1AJ7L 4GH7B 4JM2C 4PUBL 2XZAL 3JUYA 1F4WL 1QFOA 1JRHI 5HDBF 4JANB 3ULVH 3UJIL 6CGTA 4X6CA 4WHYG 3MJ9H 5FHAL 2HN7A 4DZBA 3S35L 2J6EL 1PG7H 3QR2A 4UNUA 1LO0H 2EC8A 4LLUB 4DGYL 4I3SH 3BKJH 3MJ8B 2PCPB 5F7EH 2FX8L 3JWOL 4DW2H 1QEWB 2G5BB 4YPJA 2QSQA 3VXME 4XVUD 5J13C 1IMHC 4U0RB 1ZT4A 3HAEG 5D5MA 1G7LA 4NQCA 1YN7B 4LSVH 1EV2E 4L3CB 4KPHL 5B38B 4S1RL 5DSCB 3X11B 4BZ1L 3E2HA 1MUJA 1KJVA 3EJZD 4PJ5A 3I9GL 5E8NA 3VFOB 5E1AB 2AEQH 4TNWF 5BW7C 4MQSB 4JPVH 3VFGH 1UXSB 4Y4KA 2X1OA 5IIEA 4AENB 4XNYL 1LO2L 1PZ5A 5HI3D 5BS0B 2OJZH 1BVLA 4HK0A 2UY7A 2CUHA 3ZKSD 5I1JH 1XGQA 4Z7NF 1JYVA 1KIPA 1PFCA 4EZMA 3TO4B 4P2RA 1S3KH 5D7IE 1L7TH 2X5PA 4Z7UF 2EXWC 3RWHA 5E5MA 5CJXC 1INEL 3VRJA 1NFIA 2NXZB 4NQCD 3CGTA 3UP1A 4M6OL 1NBVH 2NZ9D 4LARL 5CEXB 1K8IA 5GGVL 5FCUL 1U8LB 3TBYB 4HLZG 1PBYA 4GW4A 2HT2C 3H8NA 1T80A 3ARFA 2QTEA 4PJ5D 4LGSB 1GCFA 3ZKND 1OSZA 4K2UH 4CU7A 5LGKA 3CDCA 2ZOLB 4K94C 3DPBA 3LRGA 4BH8A 3BVNB 1UM5H 2IPTH 5CMAB 1OTTD 5MHSD 2VZSA 4TSCH 3ES6A 3P9LB 5C07B 1DN0B 3RUGA 1JK8B 4P2QA 4APQB 1SBBA 3OJMB 1H5BB 3SDAB 4G6KL 4F3FB 4RMTA 2GT9B 1OT1A 4ODUA 1OARL 3TBSB 2YPKA 4WFHE 4UB0H 4CVXA 4OZIA 1CIUA 3O45A 1W72B 2R0KH 1JRHH 3WXVL 1BZ9A 5DQJA 4YHKL 1HH9B 1VFAA 1L7IH 1R6VA 1F11B 2AGJH 2N56A 4KY1L 3BEWB 3BPOB 3O6FA 2P24B 1MNUL 3GSVA 5EO0A 1BX2A 4MWFA 2HP4A 1FNEA 5DD0H 1AD9A 1JGLH 2HFTA 2IH1B 3ARFD 3KJ4B 3UYOD 2WAHA 3KWWA 1EDQA 3PE9A 4XPGH 1ZVSA 5DK0A 4RA0C 2C1OB 4KGJA 2DQUL 4L1DA 4OFDA 1HKLL 3QQ9C 1A6ZB 2L7JA 5TDOB 3PIQB 3FB7A 3W0WA 3O2DH 4JHAL 5CKGA 2HJKA 2X1QA 3MBXH 4DKAA 5HVWA 4HPYL 5FV1L 1WC7B 3D3VA 2NY2D 3NCJH 2R2HB 4Z18A 4ERSL 1IGTB 1P1ZB 3CJJA 1TLKA 5T1LD 2BY1A 4JVUA 2VLKA 1J86A 2KDGA 1E4KA 3BE1H 2OJEA 3CFKA 2R69L 5EORH 1F58L 1A3QA 1AR1D 3PJSA 4GAYB 4FFVD 3IAQA 2QBWA 4W81A 3ROOB 2VC2H 4UIKL 3G5ZB 4FHBD 3C60A 4H1LA 4OLWH 4RAHA 5D9SB 4HHAB 3JXAA 4P5KB 1IGFH 3F5WA 3MRPA 3T04D 1QO3B 4KKAC 3VRLF 5AD0B 4JJ5A 4J8RA 1W0YT 5T5FH 4H25B 1DQQB 4TSBH 2AERT 1A7RL 1BHGA 5IOPB 3SGJC 3O3AA 4P9HL 2IAMA 3D3VD 3O8XB 4OSUH 5F9DC 5F7LB 1VGEL 3C8HA 1FDLH 1QFWL 3C2AH 3HCVA 1HEZB 4NN5C 4K7PX 1KT2B 3C2SA 4YDVB 4PRIB 4GKSB 1JIBA 1OAXL 1M7IB 5F72S 5FYLH 3A6CH 1MHHB 5C08B 3HMXH 3GZKA 1OSPH 4PJ7E 1NLBH 1TJGH 4U1SA 3VXNA 4IS6B 4O9HL 3ORJA 1QLFB 4G42A 4GMSL 4HUVB 3C60D 3TCLB 1ZTXH 3MCG1 3IJHA 4N8VB 4PJXF 4RZCB 5ANMB 1YEHH 1RIHL 4XHJC 1WQVT 2ZKHH 1MIML 3UMTA 4G9DB 5C0AE 1Q9KA 2X89D 1KCKA 2R2BB 4F58H 4HH9A 3HS0B 3VH8B 3MRBA 5LWYH 3RKDD 4OF3A 4OT1H 3ZL4H 3DVFA 4AK1A 4N0UE 3BDXA 2BVQA 1EMTH 4PD4J 4F33A 1AO7B 35C8L 1SEBA 3GMOB 3V5DA 1R0AH 1NGXB 3OAUL 1LDPH 3QWOA 5KS9E 2HVKB 3FFDA 2OR9L 3AREC 4V2CB 1VFBA 1I7TA 2XTLA 1CICA 3HNVL 1F4XL 4K71C 5I74B 1CBVH 2CMRH 2JCCA 3HKFA 1ZV5A 1A14H 5D2NC 1HHIB 3EYVB 3TV3H 4LAJH 4OCWL 4LCCB 3D5OF 4G6FB 4QOKB 3MRQA 3MYJA 4RFEA 4FXKA 5GGQH 3AVEA 4HIIB 3RGHA 3EUUA 4O51A 5IV2A 2VXVH 2RIKA 3BRGC 3V4UL 2OMBA 4PJDA 2WIMA 1JYWA 1IRAY 1MEXH 5ICZB 5TGBA 2OTPA 3SKNB 2BY2A 5HGDA 4PJFE 4KUCF 2GCYB 4HW6A 1P9MC 1KACB 4HUUA 1DANT 5DI8B 2NY3B 4E42B 1BWWA 2E7LA 4QHUB 3CFEB 4H8WH 4NIKB 2A6DB 4GKNB 1CICD 1XAUA 4PJBB 1NCUA 1P84K 2IMNA 4JFFE 4JFYB 4ENED 3GK8L 2X09A 3UJJH 4M6NL 4M93C 3BQUC 3L3GA 2J88L 3L6FB 5IT2L 3RNKA 1MCOH 5F6IB 3MV8E 1L8JA 3U0TA 3WJJC 4UT9L 3OR7B 4BJLA 4IDJL 5C6TH 4C83B 5MEQB 5JR1H 1K8DA 1YDPA 2A73B 3SPVB 5J8OA 5GS1C 4IIQC 1GJIA 2VUYA 4GAJL 3L95A 3G5XA 1D5BB 3KG5A 1F02I 1YQVL 1JWSA 4Z0XA 3GEWB 3Q0HA 2Q1EA 3UCRA 3EOBA 1GC1H 5CGYD 1DDHB 3DRQA 2WP3O 5GRXG 1ZSDA 1FO0L 5D5MF 3BJLA 1IM3A 2B4CL 4HGWB 2X4OB 4X4YA 1NSNH 2PETA 3BP4A 1DVFA 1KB9K 3LDBB 1HDMB 4RBPH 3JZ7A 4XB7A 1UM4H 3KPPB 5E1HB 3UYPA 4M5ZL 5TPWH 3IDIB 1G6RB 3VXQA 4JO3L 4P2OA 3I6GB 5IMKB 1QSED 4WUUA 4JPWH 1OD9A 1KPVB 2A9NH 4XRCA 2DLFL 4XNXL 3MROA 2LU7A 4GXUM 1DSFH 1CDYA 1KLUA 2NY7H 5C0EA 4NQEB 3STLB 4PJCF 5DYOB 4W70A 3TJHC 3SDDA 4KTYA 1MCPH 4DGIL 4BQ8A 4IHOB 4XMLL 1OB1B 1IT9H 1J5OH 4HMEA 4IRZL 3QIUD 3LRHA 3CSYA 5CZVL 1DL7L 1YUHA 4YHNA 5DRWA 5ADOL 5F9WB 5ALCH 2VZVA 3LEVL 2D7NA 2XN9E 3T0EC 2BX5A 4FFWC 1DVFD 2VDNL 5BO1H 3ARGA 2XTJC 5J6GB 1H8SA 5IB4A 5IHZA 1D5ZA 3IDJA 5GGSB 1MI5B 5EIVA 1I3RA 5D93B 4QRRD 5D7SL 1G84A 1NEUA 4Y16B 4YGVA 2YD6A 2X6MA 4WUUD 1MSPA 5IMLA 4Q6IC 1REIA 3L9RA 4LHJB 4ZQKB 5GIRA 3U6RB 4S1SH 3MNVB 4OZGE 1U8NA 3RUGF 4CN6A 3RL1B 3KPRD 3CDGB 4UTAH 5EA0L 1YY9D 2A6IB 2ZPKL 4MJ2A 4N5EA 1E28A 4CBPA 4OZIF 3BT2L 4L9DA 2YPLE 5FGBC 3WFHB 1DZBA 3ZYIA 3MRGA 4WU7A 3VWKA 5FB8B 3HE6A 1CL7I 2Q3AA 1UZ8A 4ZSOB 3LIZH 4LMQE 5D2NE 5J9PA 3DHMA 3SQBA 3UTZA 5AAWA 5HGBA 4XI5D 5E2WH 4PJ9B 5K9JH 1RHHB 1N0XL 5GJSL 5BVPL 3TNMB 4MD4A 1KJ3H 3SY0B 5CEYB 1WCBA 3ZE0F 2J1KA 1ZGLB 2RFXB 1U3HA 3DV6B 4V3EB 5HI5D 1FZJA 4KQ4L 1CYGA 4FQ2H 4WY7H 5DJ6A 5FKAB 5CP7A 1A6TA 2VZTA 3MGOB 4BQ6A 3CDFA 4JM4L 4WUKL 7CGTA 3SKJL 3DETD 1ZHBA 1RMFH 2APXA 5IEKA 1J8KA 4Z77A 4LCUA 4BH7B 4DAGL 4MQXC 15C8H 3LCYA 5BS0D 4R90L 3VWKD 5C0BE 4NM8H 4WHTA 3DVNA 5ID1A 5JIPA 1R3IL 4Z6AT 2A6JA 5FO7A 5KSAA 4YH6A 1MQKL 4JN1L 4G3YH 2A77H 2X4PB 3VGDA 1KLGA 2IG2H 5F1IA 1QR1B 1YEIL 3O6MH 3IKKA 4K3DL 4JKPH 1CD1A 1MJ7H 4EDXB 4XTRC 1CVRA 2LABA 5IBUB 5FA4B 1U3HD 3FT3B 3MCLL 1FZOA 5EO1B 4QY8B 1E4XI 2W9DH 1DUYA 3DMMB 3I6LE 4L8SB 3AAZA 2JIXA 4M62L 2R8SH 1UM6L 3OJDB 5I1GL 1UADC 4KK6C 4W4OA 4N5UA 3PWNA 4U7MA 5F89B 1JZ7A 2FR4B 4WJ5B 5B3NA 2P46B 2R0ZL 1MQ8A 1A4KB 4JQVC 1XIWD 5T3XD 4MXWL 2HT3C 3DX9A 1A7QH 3R06A 3RGVB 2IPKB 5B8CC 4F7CB 5TDPB 2IFFL 2IGFH 1ZHLA 4K07A 2FX7H 3FRPG 5CWSA 2V7HA 3BPCA 5IMOB 4PJXB 2CGRH 3ZDYF 4RDQG 5E08H 1MF2H 1UQSA 4HXBH 2CXKA 1I85C 3L3DB 3H0TA 3O9WB 3UX9B 3WN5A 3WUZA 1ETZB 2QHRH 4UQ3B 5BV7C 4QHMA 2JJWA 1MHPH 1EJ6A 2BVOB 1N64H 1CL7H 5JUEL 2QSCL 4TSAL 5BRZE 3ALXA 2HTLD 4X7TA 3GSWA 5F7FA 3RA7L 4CN4A 2JIXD 1WBZA 3T0EE 1RUKL 4HUKB 4KUZH 1Z5LA 2XTJE 5FYKE 3U1SH 3VFRB 2J8HA 3S36L 5IJVB 2D31B 4I3GA 1LMKA 2VRAA 1G7PB 2MFNA 5JXEC 1JHLL 3IFOB 3U7YL 3RAJH 3GJEA 4KFZC 3BMVA 2VZ3A 4LBEA 3VXSA 5C0IA 5DRXA 2JCCF 3VFUA 3TBVA 4MS8A 4POZD 1P4LB 3R8BB 3DOSA 4LLAA 4H0GA 1HNGA 1S9YB 4EVNB 2FB4L 3WFEH 1MPAH 1D9KB 2XQBH 3M1BA 4I3RH 3OKLA 4QRSB 1T89C 1CK0L 2G75A 3U9UB 1A8JH 4NUGH 1T1XA 3IGAA 3Q1SH 4JPIB 2MWCA 4OLYH 2WV3A 2YN3A 1ERNA 5DRNB 1UG9A 3AU1B 4X4XB 1FH5L 5IW1A 3FHAA 3ZKXC 3PHOB 1FNLA 1E4XH 1MRFH 1BFVL 3MGAA 2YZ1A 5CEZD 1C16B 2B1HL 4HT1L 5KJRL 3N06B 3VXSD 5C9JB 1Q9OB 2P5EB 3N85H 2UV3A 3O8XD 1WITA 3DV4B 1AP2A 1KCLA 5BJTB 4OM0L 3UTPD 3P4NA 3KLAA 1CGTA 1EBPA 2ITDB 4Y2DA 3QUXC 4U1KA 3RY6C 5TF1H 5JHLH 4KRPB 4IRSD 1KC5L 2QQKH 4LSPL 5ESQA 3QQ4B 1Y6KR 1MCQA 4M1CD 4JY4A 5FXCH 2GI7A 4LASH 4U0RC 1IC7H 2DLEA 2Q76B 2EDWA 1L6XA 4I18C 2X4SA 1E6OL 4OF5A 1E4JA 3P3YA 4ODTH 4XNQA 5I30L 4IOIA 2JJVA 4HC1A 4HGKC 1GH7A 2E9IA 4H1LH 1GAFH 3E2HB 1MUJB 1KJVB 4I0KA 1S9WB 3GJFK 4FZ8H 3TA3C 2QKIA 1NDMA 4Y2OA 2X2YA 4XPFH 5TE7H 2XKUA 5GSRA 4Y4KB 2IQAA 2WWMC 3KHOA 5TFSH 1PZ5B 1A9BA 1W8OA 5FUOL 4ZS7L 4U3CA 1ONQA 2WW8A 1SJHB 4HK0B 2FEDC 1WAAA 3CC5B 5HYIA 1AO7D 4PJCB 4Y2DD 3EO9H 1XGQB 2XT1B 2W0LA 1A2YA 3H7BA 4YBQD 4JY6A 4PY7B 3TO4C 2CDGA 3WE6A 1OCWH 2CLRB 2BOBB 1JGDB 5IQ7L 1BOYA 1NCDH 1N6VA 3ZTJH 3OSKA 1D5MB 4MXVF 1T2XA 2QADC 3BZFA 3VDCA 1U3YA 4Q9RH 1LNUB 5EU6A 1X4XA 4G6FD 3DNKA 4I9WD 4QOKD 2DWEB 5E6IA 4GW4B 1KBGL 1MCHA 1J88A 3FQNA 2BK8A 5ICXA 3V5KA 1OSZB 4RA3A 3FRUA 3HMWL 5GRWA 1LD9B 1J11A 4J2XA 3WKML 3TVMB 1H3WM 3IDGB 5DR5H 4NQVB 5GJTH 3U82B 4GFTB 1U58A 2F54A 3HN3A 1HQRB 1S7SA 2MCPL 3RUGB 5A3ID 2FATH 5B38G 3V6ZA 5C0CA 3ABZA 3QT2A 1H5BC 5D8JL 4OZIB 1T5XA 5I0DA 4S1DD 5DQJB 4HPOL 1KEGL 1RZGA 4OTXL 1OAQH 4LIQH 4KTDL 4Z76A 5F7HA 3QJHA 4OCYL 3D0LA 3TJEH 1D6VL 3VXPA 2VDRL 1HINL 4Z78A 3GSVB 4NKOA 5EU6D 1N7MH 5E8DH 3EYUH 4J4PA 3BKCL 3GSXA 2XWTB 1OF2B 3L5XL 3CVHL 5GISL 4EQ2A 3KJ4C 1CXKA 2A83A 3WSQH 3WS3B 2UUDH 5E8PB 1XH3A 4NWUL 3RIFK 5ITBH 4OLUH 5B4MC 1AY1H 4JJHA 3ILPB 5GGUA 4MVBC 1KXTB 3W0WB 1CLYH 2XZCH 3ULVC 2F53A 5ALBL 1MFEL 1L0YA 1I9JL 4ONFL 1QFPA 4NCC2 1WZ1H 3CFDB 2JJUA 4JKMA 3VI4E 4JO2H 1FORH 4KU1A 3NFSH 2EDYA 3VD4A 3TZVC 1HWHB 2VLRE 3G6DH 3IDNA 3C08L 3LPWA 2XFXA 2DF3A 3HFMH 4YDLB 1BOGA 1GSMA 3IDXH 4RCAA 4XCCH 1NCAH 3VG9B 4NT6A 1ZHKA 3NH7L 1BD2E 1T66D 5EB9A 1FL6B 3RPKA 3MV7E 3PJSB 3T4YA 3EHBD 1CFBA 3VFWB 1YEGL 1GGIH 5DFWH 2Z4QA 2V7NA 2BNRA 1DE4A 2W65B 2F5AH 1IKNA 5JOEA 1WF5A 5TQ2H 2QQNL 4TUKH 4D3CL 3MREA 3WYRA 2CK2A 3QIWB 4GJTB 1HQ4B 3CNKA 1MCCA 2F53D 5T1KA 3DBXA 3NFNA 4NM4H 1X5JA 4XAKE 5HDQL 5DS8A 5KSBA 2CD0A 4JDTL 4QXGL 1HYSD 4MDJB 3B4NA 4QTIL 1KFAL 3ZHLA 3GI9H 12E8H 2A74B 4G6AC 3PQYE 1MI5D 4Y5YA 2ZUYA 2VH5H 3DECA 4YWGL 1N3NA 2XXMB 4NO5B 3DVGB 4YZFE 3RTQB 3VXOA 5H8DA 5IMMA 2PYEB 4ONHA 1CFQA 4ZO6A 1VERA 4FQCL 1RHFA 5D7JC 4U1SB 5CHNB 3BO8A 1A6WL 1E4WH 4LKXB 4LFHD 3HR6A 2KKQA 5CCKH 4KZDH 1IGML 2FDBP 1HH6A 3H9SA 1K4CA 3S34L 4JY5H 2ZSVB 4KI5C 4PB9H 5T1KD 4XP5L 4RIRA 1FNFA 3MLZL 4L8DA 1R3KB 4WWKA 2ZG3A 3RWIB 2A6KB 1S8DB 4MNQB 3RVUD 2CO6B 2MCG1 5DMJB 2ATPA 4G59A 1IQWL 2G2RA 4XC3H 3KR3L 5IHUL 3EOTL 1HHGA 5F3BB 2W0FA 5F71A 4XB8A 3U46A 1CXEA 4LPUA 4K9EL 5GRVL 5LBSL 3F8UB 1I7TB 4L9LC 4TN9A 3VJ6B 4B7IA 2XKNB 4P23D 4NZTH 4OAWA 5I74C 4OKVA 2JCCB 5MEOB 3KDMB 4PUBH 1DQJB 2XZAH 4J6RL 4P5TA 4D9LL 5ID0B 1INQA 1F4WH 5C07E 3HPJB 1ADQA 3HZKA 3QULB 3UJIH 1HHHB 2X9XA 2XA8L 4TVPE 2ZUQB 1FVCA 5HHMA 1JNHA 3OXRA 3MRRB 3MRQB 2EE6A 4EN3C 4HWUA 1RPQA 3QEHB 2J6EH 3S35H 4U3XA 2FHBA 1GHFL 1JWUA 4DGYH 2XIDA 5KW9L 1LE5A 3D2UD 3DURB 4WO4A 1N4XH 2FX8H 3JWOH 3CXHJ 1PJ9A 2AJYL 3FN9A 2EO1A 4N8VG 1S5IL 2AK1H 3UPCA 4FFEX 4IMLA 5I1IL 1U8PA 2RQ8A 4N0RA 2NY3C 4U05A 1U93B 3J8F7 5HHOA 3TEUA 3O0RH 3MGTA 5IJKA 5HTSA 1UCTA 4S1RH 1AHWA 5L9DL 3SGEI 3QQ3A 3QUKB 3O2WL 3IS0X 4Q2ZA 3S37L 4F37F 3VH8G 3L3GB 4P5TD 4DKDC 1QSZA 5E00A 3MPCA 2JJSC 3BKMH 1KELH 5SV4A 5EO9B 5HHMD 1M4KA 1Q0XL 3QB7C 3RDTB 3P0VL 5KAQF 2VAJA 1YDPB 2NXYD 2WMPA 4JFXA 5DGQA 2P8PA 5FECA 5I73B 1G9MH 3RGVD 5FM4A 4UI2A 5HPMB 4NRYB 3BUYA 4WO4D 43C9A 1UKSA 4OUUB 2EO9A 3RZCB 5T3XH 5FKPA 3BEVB 1FHGA 4NFBA 2IPUK 1FPTL 4YXLH 3E3QE 2X4TB 3DRQB 5JW4N 5E9DA 3J7HA 3CVIL 4PJEF 1VFUA 2DDQL 3WLWD 4X4YB 3D18A 4LARH 4XMKL 1KJ2B 4KKNA 3FZUC 5L7XH 3LDBC 43CAA 3F7RA 1FYTA 1CGVA 3EFFA 3L3IB 3QUYA 3GIZL 4P2OB 4WNQB 4K94L 5BCAA 3QNXB 3BIKA 4QYOA 1QFWI 4XRCB 3ULSA 4PG2C 1WICA 4X5WA 1WAAF 2FWOB 3WIIL 4GBXB 4TNWK 4FABL 5F7KC 4G6KH 5F1SA 1OARH 3F12B 4PRIE 4ZUVB 4YDJB 1BFSA 5K9QG 5DZOA 3GSNB 5C08E 1OAZL 2AVGA 2VQ1B 1CFNB 4YHKH 1YEJL 3G08A 5E9DD 2GJ6B 4KY1H 3DRTA 3MACL 3SBWA 1MNUH 5F88A 5HY9B 1GGBL 5ANME 3ZE1F 3RWDB 1D9KD 4RNRB 5GGSY 5I6XC 1FYTD 3IDJB 4ELMB 3QUYD 4PLKC 4KI5E 3K8KA 1MFBH 3A67L 1NBZA 3CFBA 5DK3A 5CD5C 2IANA 5IMLB 4TRPL 3TF7C 3WDHA 2PXYD 4DQOL 1HKLH 1KLFA 1LE9A 1ZXQA 5DK2B 3LKRB 4PRHB 1F8TL 2NNAA 4TYUA 3SGEH 1G7MA 1TIUA 2IEPA 4JHAH 4JFPA 4I5BA 1Z2KA 5GQBA 1U8IB 4XZUB 4ZXBA 4X0KB 1NPUA 1EFXA 4S0SD 1R5WA 4JO1L 1S5HB 2SEBA 4CVWA 2CRIA 4JREB 1IFHH 2DLIA 2KUTA 2DQDL 5I18L 3OHXA 1YC7A 5CEZH 3MRGB 2OQJA 4PJAA 4OZHF 2OL3L 4W6XB 4X6DA 3HE6B 4MD0B 3LPFA 4U7KA 1BAFL 2ZUTA 2H32A 5J9PB 2BSRB 3UTZB 4NOBA 4R7DA 3Q6FA 5J11B 1C7SA 3RX7A 4PJ9C 2A0LD 1F58H 5D96B 5CSZA 2AXJA 3IU3B 5J4MA 3WDIA 5AUMA 4MAYA 3DUSA 5I17B 4L1HA 3C5SB 4H8WC 4Z7WF 2P5WB 1EAPA 4AT6B 1WCBB 5AWNL 1Q9LA 1MWAL 2OSLB 3OX8B 1J1OH 4WV1C 1YECL 2VXTL 2X4RB 1C08A 2E27H 5I76A 5I1AB 3HZYB 4FXGA 4CMMA 2HTKD 5D1XC 3BPNB 1ZHBB 2UWEB 4NQXB 1EFXD 1I1FA 1YMMB 3VXRB 4Z77B 1VGEH 1S7WA 4HWZA 1QFWH 3T1FA 1FIGH 5HDBE 3WNMA 1P4BL 1FV1A 2YA2A 4HIEB 2R15A 1A1NB 1OGAE 3VFPB 3AS2A 1OAXH 1GC1C 3FCTA 4XVTH 1TVHB 5ID1B 3JV0A 4U1IB 2NY4D 5FO7B 3C8KB 5H2BA 2WM0A 4F57H 4GG8B 4U49A 4LFHG 1V3KA 5CJ5A 1SYVB 1KLGB 4O9HH 3SE3A 3QHZH 1S9VB 4JLRA 1JYXA 1CT8B 3UAJC 1RIHH 1KNOA 3C6LC