4ZUSA

Crystal structure of equine mhc i(eqca-n*00602) in complexed with equine infectious anaemia virus (eiav) derived peptide rev-qw11
Total Genus 71
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
71
sequence length
274
structure length
274
Chain Sequence
GSHSMRYFYTAVSRPGRGEPRFIAVGYVDDTQFVRFDSDAASPRMEPRAPWVEQEGPEYWERETRNMKEATQNFRVGLNTLHGYYNQSEAGSHTLQRMYGCDVGPDGRLLRGYRQDAYDGADYIALNEDLRSWTAADAAAQITRRKREEAGEAEQCRNYLEGTCVEWLLRYLENGNETLQRADAPKTHVTHHPISDHEVTLRCWALGFYPEEISLSWQRDGEDVTQDTEFVETRPAGDRTFQKWAAVVVPSGEEQRYTCHVQHEGLAEPVTLRW
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system
molecule keywords Classical MHC class I antigen
publication title Structural Illumination of Equine MHC Class I Molecules Highlights Unconventional Epitope Presentation Manner That Is Evolved in Equine Leukocyte Antigen Alleles
pubmed doi rcsb
source organism Equus caballus
total genus 71
structure length 274
sequence length 274
ec nomenclature
pdb deposition date 2015-05-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00129 MHC_I Class I Histocompatibility antigen, domains alpha 1 and 2
A PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4zusA02
3.30.500.10 Alpha Beta 2-Layer Sandwich Murine Class I Major Histocompatibility Complex, H2-DB; Chain A, domain 1 MHC class I-like antigen recognition-like 4zusA01
4UNTA 4TVPE 1IAII 3IDYB 4HUWB 3CLFH 4J3TA 3VFOA 4YHKL 3G6JE 2QL1A 4RGOL 1BQLL 4JN1L 1AC6A 2AK1H 2WWMD 1INEL 4IS6A 4X7SL 3X12B 1C5CH 3RTQA 1MH5B 4LOUC 4C56B 4HUVB 4RMSA 1VFOA 5HGAB 4NRZB 4XPAH 4U1LB 4ZFOB 2B8OT 1MQ8A 2AJ3A 3FB8B 5E94A 9CGTA 4LEXL 2RCSL 3DRTA 3KDMB 3MXWH 5HGDB 3BWAA 4PJHE 3HZVB 3BEWB 4X7CC 3C2SA 3NZ8B 4Z78B 3A6CH 1LEIA 2DQTL 2XWBA 5HHXL 1IAMA 1B3JA 4HGWA 2H26A 2VLKB 3MNWA 1GL4B 4E41E 3P4MA 4IRJD 5EO1A 1GAFL 1KIPB 2AXHA 3KPMA 1GCFA 2B2XL 3TO4D 4OI7A 4PJ7E 1J5OH 2P4AB 5F7YC 2NY0D 3SDAD 3MRNB 3FOMB 3VD3A 4XBPA 4QRTB 2CK0H 3JWDL 3QAZB 1S7TA 4UQ2B 3ULUH 5HHMA 3QIUA 2GY5A 4YFDB 5BRZE 3QDJB 1CLCA 2DTML 5IK3B 1UACH 3KPNA 1KT2A 4NWTH 5LGHL 4JJHA 1S8DB 1KPVB 4I0KA 2DJSA 2HN7A 4K9EH 3MRFB 1K8DA 4MVBD 2BVEA 4U1GB 3VFSB 3FQWA 5CEXB 4HIJA 2HMID 5JNYB 2X4PB 4NNPL 3SO3B 4MQXD 1N26A 3QI9C 3HE7D 4XPHH 5FKPB 2OS7A 2HG5B 1SYSB 4I9WE 1E4XH 1BWMA 2DN7A 2X4RA 5DMGD 4G80B 4L8CA 2C3HA 4KDTC 3UBXB 1L7TH 4TPRH 2OYPA 3TT3H 2VLRD 1PYWA 1NMCB 4FQJH 1N4XH 3G6JA 3QCUL 4NP4L 3MBEC 4OUOA 4X7TA 2AXFB 4PRAB 3NCMA 4XXDB 4L5FL 3LB6D 1MY5A 3BKJL 4XXCC 3VFOB 3E2HB 4KZEH 3RL2A 2V9QA 1ZSDB 2HFEA 1IILE 4X7DC 1BZQK 4M1GH 3SDCC 4IS6B 4TNVK 1PZUB 4MA7L 4L8SB 4OF6A 3ZKMC 3D3VD 2GQHA 4M9OA 4PJHA 3UYRH 4HZAA 1FO0A 5E94B 4YHYC 3FQRA 1F4XL 3QXUA 1DR9A 2ERJC 4F37F 3DRTB 1D9KA 1JHTB 4TSBH 4M5YL 4U2ZA 4TVPH 1NKRA 4E41A 3C5ZD 5HVFB 2DQIL 2NR6C 3BPCA 3MJ9L 4LLWA 4YC2B 3EBAA 4HGWB 3VGEA 2H26B 4KPHL 4PJ7A 1AQKH 2VN4A 3OX8A 5J8OA 1IKNA 3QEQD 3K8MA 1HSBA 3UCRA 1MHPH 3LAFA 3O6FC 4ODWB 1ZXQA 5GZOC 1LO3L 5F6IC 1FL6B 2QQQA 5BRZA 4XC3L 4IM8A 1YEFL 2DDQL 5TPWL 4ETQB 4RGMC 1S7TB 4ZUWA 1FO0H 3KHOA 4U6XA 4F2MA 4TNWF 5HHMB 3QIUB 4YBHA 3W81A 3LS5L 4AJ0A 3UYOD 4HS3A 1FRGL 3KPNB 4MA3A 1LWRA 4ALAL 5H35B 5J6GB 2UZIH 1HQ4B 5ICYA 3ILQD 3BP4A 4QO1A 4JFPA 4KK8C 2YRZA 2F54D 3FQWB 1BFTA 3QJFA 4HIJB 3UJJL 2XZZA 5J11B 3Q6GL 1NBZA 3D69B 1WZ1L 4FZ8L 2RQ8A 5EBMA 5GRZA 1CL7H 4ONFH 5KJRL 4L8CB 1MCOH 3FMGH 4KGLA 4XBEL 3GDBA 3CXHJ 4R4BB 4WO4C 3G6JB 4DFHA 4X7TB 3V6ZA 1NAMB 2R2EA 4XVTL 5CEZL 4W6WB 3A6BL 3NGBB 4HX1A 5DJXA 3IFLL 4M62L 5LGJB 1BQHG 3JV6A 1OAQH 3L7FA 4OLUH 3GBNL 5D7SH 3GNML 3BD4A 1RUMH 4XPGH 1FFPB 4PV9A 1NGPL 4PJHB 2E9IA 1FO0B 1WTLA 4YXHL 2G75A 1G7HA 5DA0B 3GSOA 5I1GL 4KI1A 4HEME 1URLA 1Z9MA 1D9KB 4QRUB 4UV7L 5H8DA 1DBML 4OBSA 1OP5K 2RAMA 4E41B 3U0PA 1AGCA 4JHBA 3MRBA 3BPCB 4R96A 1UKTA 2OLDA 4LLWB 1A02N 3P0YL 4X9GA 1HH6B 1J87A 2Z4QA 4H25B 1K5NA 2AK4D 4OT1L 3SE3A 4TOYH 4S0SD 3OX8B 4WUKH 3VE0A 5EZJB 2CIIA 3HC0A 5C70A 3DMMC 1WGOA 1TMCA 4P46B 4Y5YC 2ADIA 2PNDA 1FBIL 4Z76A 4PFEA 5CHNB 2XTJD 5BW7C 4LDEB 4QRRE 4Y5VC 4S1QH 4F2MB 1XF1A 4IRSD 4J6RH 1ZA3A 2XQBH 5SX5H 1EHXA 4HS3B 5JTWA 1WC7A 5CINH 5E6IA 3DECA 3OR7A 3ARDD 1BQUA 3QFJD 1U6AH 4IMLA 5JUEH 5ICYB 4X4ME 4JFPB 2XXMB 2WUCL 3K74B 3SPVA 4ACPA 4GAGL 3QJFB 4LHQB 1MCSA 3U6RA 3WD5H 3MUHL 4M93B 5GZNC 4X8XA 1NBZB 5DQDH 2Z31D 4BM7A 4AZ8A 4BH7B 4KI5E 5I75C 3OAZK 5J13C 3NVQA 3OHXB 5IFAH 4HD9A 4ZS7H 3DOSA 3ET9F 5I1JH 3HHRB 4HPYL 4MCYA 2HFTA 5DJYA 4U31A 4HIXL 2OR9H 3OWEA 1OAYL 1YN6A 5I1EH 3WXVL 35C8H 3V6ZB 2R2EB 4DN4H 4D0BA 4DN3L 3RVVD 1KCVH 4HMCA 1PAMA 4XNXL 6FABL 5DJXB 4LHUG 4HEPG 4WHCA 3JV6B 1MCJA 3EDJA 4JKKA 3L7FB 3TIEB 5JMRA 5F71A 4EI5D 1X6LA 1FJ1A 5ITFB 1S5IH 1H5BC 3EJYC 1UWGL 4HH8A 1TZGH 4X6CB 5I17B 5C07E 1B9ZA 3DRQB 4PV9B 4R7DA 2AXGA 4WFEE 5IBUG 5DR5H 3CC5A 5I0ZA 4LVOB 4WEUD 2G75B 3G6JF 3QWRD 5EFIA 5ID1A 4NRYA 3GSOB 3ZKSD 1CXHA 4P9MH 1W0VA 1CFSA 4N0YH 4YR6B 5E9DD 4Q9RH 3BD3A 1DN2A 2VQUA 4OCSL 1BPVA 3U0PB 4JKLA 2AQ3A 4JM2B 4S10A 3MRBB 5D7JD 1PG7L 2Z4QB 2FO4B 1K5NB 2DI7A 3HN3A 4F80A 5CJOL 5F70A 3K8KA 3G5VA 1XGTA 2V5SA 1TXKA 3L95A 4QRRA 2EH8H 4PJHF 3T2NL 3KLHC 2YA1A 1RZKH 3NCJL 2ADIB 4MAYB 1T2XA 3L3GB 3I2CH 4Z76B 4FQCL 3VXMA 1XCQA 3V6BR 2BFVL 2FHFA 2OK0L 4NHUE 4N0CC 1YJDH 3LH2L 1GH7A 4X4MA 1OM3H 4JY5H 5KVMC 3LY6A 4S1RL 1H3XA 5E6IB 4PJ7F 5DD3H 2I27N 4I3RH 1TZIA 2DMKA 1S7XB 2EDDA 4IMLB 3RX5A 5L2JA 1OPGL 1CICA 3RGVC 5B4MC 4ZDHA 4FTVE 3SPVB 3U6RB 4PTUA 2E7HA 1FVEA 2YD8A 1QVOA 4G5ZH 2WANA 1QRND 5DEFA 4WW2C 1A0QL 1ADQL 3RIFF 3WN5A 4WWID 2EDEA 3P30H 5AD0B 2IWGA 3DUUA 5IROC 4MZ3A 1HNGA 5IBTL 3F7QA 4MCYB 4KK6C 5CJQL 2X4NA 1R3IH 2X4TB 3DHJA 3MODH 1BIIA 3WSQL 2Y36L 4D0BB 3IVKB 2E7LE 2NTSP 5CIPB 4KTYA 2FB4H 4RBPK 1R5WA 5C07A 3MRQA 3SCMA 3ZE0E 4B50A 1A2YA 3WXWL 1R3HA 3GJFK 4X9FA 1FFQA 5FUZL 4FQ2L 1CE6A 4BSWA 4PJ9A 4JGJA 3SOBL 1V3KA 1Z9LA 3CC5B 1GGUA 4JRXB 4BQ9A 4E0RA 4F15C 5EOCJ 4NRYB 3LRHA 2N1KA 1Q72H 4U1KA 3UTPE 1CFSB 5EH1A 4BZ2H 1LK3H 2BVQB 2CLVB 3P0GB 4BELD 3Q1SH 3VH8G 3TA3D 1J0KA 2BK8A 1M7DA 3MXVH 4HGKC 4ZXBC 4OTXL 4JDVA 5CZXC 3S3PA 3WS6C 1OGAD 5ECJE 4HC1L 3WNPA 5EU7E 4HUUA 4X6CF 2P1YA 3L95B 4QRRB 2PN5A 4NHUA 3QULA 5DEGA 5DJZB 3PG2A 5EOQH 1B90A 5CZVH 4S2SA 3VXMB 1XCQB 5ESAB 4PGCB 1OTTC 5JW4M 1A64A 1N6QL 1TPXB 4J7RA 2DBLH 1NANH 3O6KL 2MPAL 1UFUA 4G7VL 2WM0A 2OL3A 2W0FA 3GKWL 4K23H 1J8HE 4X6FA 5LAXA 4MS8A 2E8YA 4KGJA 1FNGA 3RVWD 1TZIB 3L5WA 2PO6A 1AHWC 3MRMA 4MYWB 1CICB 3P4LA 1FZMA 3CFJA 3LPFA 3A0OA 4QHLA 4L3EB 4L9LB 2OSLA 2XWJA 1K4CA 3MC0A 4PIRF 5DEFB 4M7KL 1VA9A 3DBXA 1J1XL 3WN5B 4KHTH 5DJAB 2CJUH 3FT3A 1X44A 4YWGH 2DQGH 5TE7L 3DUUB 2E7LA 4JQIH 5KVEH 4JRYE 2X4NB 1BIIB 3B2UD 2LTQC 1LNUA 3T4YA 4KKCD 3ZHKA 3MLXH 5A1AA 2DD8L 1R5WB 1DUZA 2OL3H 1A2YB 4P4KC 1R3HB 1FGNH 2MWCA 4NHCL 4JPVH 1XR8B 2EYTB 1AP2A 2ZG3A 1ZHKA 3I84A 1JIBA 3MLZH 4EN3D 1R6VA 4OLXH 1EGJL 3LOWA 4M1DH 1CE6B 1T22B 2R0WL 5FCUL 1G7JA 2VLMD 4JZJA 3IDUA 3QWQB 4S1SL 4AENA 4BSWB 1BF8A 1JTOA 1RUPL 2O5XL 3P4OA 4J3OC 2EYSA 3VMPA 4E0RB 5D1QC 3IKCB 4HJJL 1BZ7B 1TJGH 5B22A 4J4PC 1FYHB 4PR5A 5I76B 4U1KB 5GRJH 1XF5A 2X6MA 1A6AA 2DTSA 2R69L 2YK1L 1DEEA 4GBXD 1AGBA 4HWEL 4J3WA 4KJWD 3ULVC 1RIUH 3BHBA 4P23D 3KYNA 3TBTB 1AR1C 3LD8C 5DD0L 1F4YL 2A9NL 4I0PA 4JDVB 2YUZA 3PWVA 2YN3A 3CIQA 1FZOB 3OKMB 4GW4A 3MLSL 4LSRH 5T33H 3BZEA 1VGEL 2PXYC 1HXMA 5FO7A 4NHUB 3QULB 3ZTNH 4X5WB 4HWNA 3G9AB 4IHOA 5C0NC 4GRLC 1IGCH 3KXFE 1CLZL 1NKOA 3WO4C 1J8HA 3QWOB 5L9DL 5D6CA 1UJ3A 1F90H 4ODXA 4U3CA 3QUXD 4KKNA 2P5ED 4HIHA 2OL3B 2W0FB 4NZRH 1T0MA 4FQXA 2QSCH 3EO9H 5LAXB 5LGKA 4P2QB 1OAUL 3L5WB 2PO6B 3RZCC 4OGZA 3E6HA 4MJIB 5DHYA 1LDPL 3NCYS 1CQYA 5FKAA 1FZMB 1IGTA 4E42A 1DBAL 4ENED 4QHLB 4M9PA 3EJZD 1RK0A 2OSLB 1K4CB 2VKXA 4JRYA 5D93B 1HDMB 2EIZA 3K2UH 4JY4B 1DQQA 3DBXB 3GFUA 3FT3B 4K2UH 3OZ9H 5E4EC 2VE6A 1YYML 2BXYA 2PTVA 4LCCC 3UZEA 1SY6L 1WV7T 4N68A 5L8JB 2H6PA 3DIFA 4UAOC 1LNUB 2H32A 2XG5A 2VDQH 4N5EA 5HVGB 3MRPA 5J3HC 1H9VA 4F9LA 2EIEA 4NN7B 2YC1A 2AJYH 1LP9B 5C9JA 5T3XH 1U91A 5E00B 3HZMA 5BV7L 2YD9A 1D5MB 4XCYA 3NABL 1AE6H 1C1EL 1DVFB 5IB3A 4JFYA 1IBGH 5C0DA 4Z7VB 5EPMB 4DGYL 4GKNA 4WNQA 1AR2A 2G2RB 1G7JB 4JZJB 5JR1L 4MCZA 4M7LT 2XFXA 2CDGA 3P4OB 5EC1A 4XP1L 1MFCH 3WKNA 4DZ8A 5HY9A 2YMXH 3QIWA 4AEIL 3H9ZA 2JIXA 4CKVX 1CCZA 3QNXB 4PR5B 2GUOA 5GJTL 1XF5B 3GMMA 3HMWH 1KULA 3BYYA 4EBQH 1DEEB 5EO0A 2EKSB 2D7QA 3BHBB 5AZ2L 1KIQA 5GRUH 4P5TA 4OJFH 4I0PB 4ZAKC 3PWVB 1LQSR 3MV8D 1H8OA 1PEWA 4GW4B 4L8DA 5AYUH 4OKDA 2DQJL 1R24B 3TNNA 3KXFA 3BZEB 3OXSA 3GSNB 3SDDC 3A6OA 1HXMB 4AEFA 2J4WH 4LU5L 5E2VH 1AO7D 4QHNA 1EO7A 1JNLH 4WUUD 3SJVE 4IHOB 2VISA 2ZUUA 4PGBA 5DRNA 1GIGL 4PJAB 4RRPG 3EZJB 3NPZB 4Y4KD 5T3ZL 5ABDE 1N64H 1NC4A 1ONQA 1KB5L 3S88H 4ODXB 3EOTH 2XKNA 3T8XB 4PY8J 1UA6L 1A6VH 4HIHB 4ZOCA 4XI5D 5GSRA 3O4OB 5J9PA 4HQQH 3MRCA 1G6RA 4ELKA 3E6HB 4ODUA 5IJKC 1QLRB 2EE9A 4FFEX 1IGTB 3L6FA 4E42B 3UX9B 1MF2L 1RK0B 5J6HA 1VPOH 2EIZB 2ZCLH 1DQQB 1JHKH 1PSKL 3PUCA 1UH2A 4LMQE 3E0GA 3ZHLA 1I7ZA 1PQZA 2VE6B 3IJYB 1NSNH 3EUUA 4ZPTB 3VFNA 1W72A 3H42L 2H6PB 5CEZD 3FQUA 3O9WC 3SQOH 3V4PH 1CR9L 4KDVA 1CDJA 2Z35B 5DLML 3MRPB 4WV1C 4NQDD 5CLWA 5FM4A 2YC1B 3UZQA 5C9JB 1EJOL 1NBVH 5K9JH 3AAZA 1U91B 3EJJX 4D2NA 3S34H 1WWCA 3OKKA 4D9RE 2HTKC 2K7QA 1MNUH 1F3DH 1U8QB 4JQXA 5IB3B 4MNHB 4JFDD 3QHFL 4LLQA 5FA4A 4XMKH 4YHZH 5C0DB 2R8SL 4GKNB 1KPRA 4WNQB 5AZEL 1RZJC 4MCZB 4QCIB 4R0LA 2C4XA 3PGFL 5CP3A 4DZ8B 2FECI 1KACB 4LSQH 2KL6A 4MD5A 5HY9B 1JNJA 3P9LA 5EBGA 1TVDA 3KLAA 2EDRA 1YEHL 2CR6A 5J1AA 4DUWA 3U30B 3TT1L 3CH1B 4Y1AE 1JFQL 4G7YL 1W72H 5EO0B 5CS7A 3E3QE 5F8QC 1CTNA 2HH0H 4WTWA 1KIQB 4P5TB 3IB4A 2XYCA 5F9AC 4KKLC 2JELH 2UY6A 4V2CB 1LO4L 1NCBL 2ATPA 4KKAD 4Z7VF 5CD5C 3SJVA 2APWA 4L8DB 4YFLF 3CVHA 3KXFB 4M6ML 3OXSB 1JPST 5C0CB 4K8RL 4XWOD 3W9DB 1PLGL 3NZHH 5GRXG 3ZL4L 1EXUB 3TZVD 4U6HA 4HMEA 4Y4HD 5F72S 4I3SL 1DDHB 4QHNB 3GSVB 3SGEH 2VISB 5CFHA 4PGBB 4IJ3B 4FMFA 2Z91A 3PDGA 5CP3H 5F44A 1NC4B 3MV01 4XBGA 1LO2H 5GS1B 1U3JA 5E8EB 4R90H 3HCVB 5F3BA 3IDXH 1DFBL 1NAKL 1BQHA 3EOBA 4UBDD 4XHJC 4HJGB 3RGHA 3AREB 2A9ML 3VFUA 4V1DD 4H88H 1D6EB 5JLZA 4X80H 2B1HH 1YEGL 5J6HB 2NY4D 2VDRH 3KPQA 4P0DA 2NY6B 3RKDC 3CVHH 1KG0A 1I7ZB 1PQZB 3OJDB 4PJAF 5FHAH 3K1DA 3TBVB 4FFVD 3VFNB 1KN2L 4U6YA 1W72B 4XPTH 1YNKL 3GMLA 2R56H 2W0KA 4RMRA 2XZAH 5J57B 2VSCA 1U3HA 4CN1A 4G6MH 1DLFH 1GPOH 1JHLL 4DJMA 2R2HA 3AAZB 3HE6D 2ITCB 4QHUA 3LKRB 2WW8A 5L88L 3OKKB 3OQ3B 1KXVC 5E0QA 5IOPA 1VACA 2BSTA 3V0AC 3VWJA 2EC9T 4BYHA 5FA4B 5CILL 4QTIL 1X5YA 4Y88A 1KPRB 2IQ9H 1IEHA 4Z7OE 5F1OB 4RGOH 2CMRH 2UZYB 2LU4A 4Y1AA 3U9PL 2P48B 1T3FA 3E3QA 1HEZA 2N7AA 5L0QB 2MTPA 2VWEE 5IW1A 1A14H 1MI5E 2EEDA 4OZ4B 1I9IH 1AFVL 4CU8A 4UMGA 3WFBL 1ITBB 3PP3K 4UIKH 1JN6A 1GGCL 5AWNH 1ND0A 4APQA 2ATPB 3OAUL 1RZFH 5HI3C 5I8OH 3U9UB 3AUVA 3C60C 4PUBL 2DQTH 1NLDL 4JFHD 4U6HB 1FIGL 5J4MA 1JTTA 3HUJE 2DQUH 4RMWA 5DYOA 1PEZA 5ALCH 3FONB 4GG6B 2Z91B 3CDCA 4XBGB 5HD8C 2AJVL 2CR3A 1F6AA 5F3BB 3QEGH 4G9FB 1R5IA 3G08A 4LARL 1S9VA 2R29L 4ODBD 5HHVL 1BQHB 2VDNL 4XP5L 5T1DL 2IFFH 4MA8L 2NXYD 3FOLA 2DOCA 1NJ9B 4O00A 1M7IA 3RI5K 5FK9A 4XP9L 3L5IA 1X5GA 2XPGA 1XH3A 5DJ6A 1W2KT 4Y16D 3V95A 1A3QA 1KG0B 2WAHA 1RK1B 5HPMA 1LMKA 2V7HA 4JY6A 5E2WL 5LXGH 3GHBL 1D6VL 1U9KA 5C7XL 2NZ9D 4U6YB 3RDTB 2R4SL 3UBXI 4WDIA 1QHOA 1A7RH 5JOPD 5SX4H 2HVJA 1U3HB 3NBNA 4PGEA 1L8JA 5EUOE 1YY9C 4XT1C 3TYGL 5D1ZA 2OZ4A 4KVCH 4QHUB 3L3DA 5DWUL 4HDIB 4K7FB 4XNQA 5F7HA 5IOPB 3RWEA 5IM7A 4Q7DA 3WMSA 2V9RA 5I71B 1KCUH 5E99L 3K0WA 1MI5A 4DKFH 1A5FL 4Y1AB 3AS1A 3DGCR 1I1AD 1OB1A 5EORL 3F12A 4D9LL 2I9LB 2Q8BH 4C54A 1HEZB 4FFWD 5TQ0L 1WBYA 5IW1B 4O58L 5L6YH 5JQ6L 3WFDH 2A6KA 4NIKB 5D8JL 3BPLB 1T0NB 3JWOC 1HHIA 3PHOB 5C0AB 2QTEA 4XVSL 2Q1EA 2P47B 1JN6B 4M5YH 3AM8C 1X6NA 1ND0B 5DMJB 2BVPA 3ARFC 4AH2A 2OZ4H 3HUJA 5DMKB 4F8TA 4IBLT 3M17A 4G9DA 3FFCE 4LP4A 5EOTA 3SDYL 1E4XI 1A3LL 2YD1A 3B8SA 4GKZA 3ALPA 1JGLH 5DYOB 4Q97A 4IDJL 4O2CA 4HH9A 1HHGA 2VAJA 4LFHG 4FQ1L 2A74A 4I8DA 4NGHL 4F7PA 4JO1H 4Q6IA 1S5HA 1CLYL 2NYYD 1F6AB 1WJ3A 3MFFB 1IRAY 4OQ1A 2DDQH 1N5YH 2ZUTA 1C5BL 3BH8A 4DW2H 2ADFL 2KZ1B 3G08B 4MSWA 1S9VB 4JFQA 4LHUB 3BIBX 2P5WA 3UROR 4R97C 1BD2E 1MCQA 1AC0A 2GJZB 3PGDA 1JVKA 4LIQL 3PWPE 2VC2H 3VRLF 3E8UH 1YMMA 1S3KL 1MREL 5FK9B 1QUNA 3HG1D 5DK2A 4GW1A 1MRDL 2XPGB 4LOUD 3IU4L 2YD2A 5DJ6B 5IBUB 4KMTL 3RY6C 1XGRB 2Q86A 3N9GH 3FT4A 3ARGC 4LBEA 4X4XA 2KPNA 3INUH 4XPBL 4GG6F 4JY6B 3ARBC 5HHOE 5EUOA 3L9RA 2PR4L 1BBDL 2YOCA 1F11A 2NY7L 2VDOH 2XZCH 4WDIB 3VH8A 2EZ0C 4OAWB 1G7PB 3GBML 2GITA 1QSEE 4PGEB 2LV4A 2PKDA 1OP3H 4ELME 2EO9A 1Q94A 1GOGA 3L3DB 5LCVH 4XNQB 1MCFA 1ITCA 1C8PA 1B4JH 3RWEB 2WUBH 1JZ8A 5CUSL 3A6BH 1KCRL 3RWIA 4UQ3A 2W59A 1MI5B 4WIQA 3BOVA 2BY1A 5CBAA 5KSAA 3LIZL 3VJ6A 2GFBA 1T2QL 1B4RA 5F9DC 3F12B 3CFEA 5F6HJ 4QRQA 4NC1C 5IW3A 4HWBL 4PTTB 1WBYB 3RIAK 2F8XC 4OCXL 15C8H 5JW4Q 1QFWH 4ZFGL 3DV6A 1F8TH 2P8PB 1VENA 4HKZA 4PGZA 3EO0B 3WHXA 4C59B 4JO3H 1YNLL 2VIRA 1HHIB 3DVGA 2EXYD 4IIQA 3BT2L 3FFCA 2BVPB 4GXUM 5D7IB 1DBMH 4AH2B 1XR9B 2R1YA 2YPVL 2A6DA 1ZOXA 4TQEH 3ZO0A 3M17B 5INDA 3QI9D 5ETUB 4G9DB 5GXBB 1JP5A 1MFEH 2YSSA 1BVLA 1CL7I 5ISZD 1NPUA 4GKZB 4XTRC 3P9WB 4O2CB 4HH9B 1FORH 1HHGB 3S4SG 4CJ1A 5IQ7H 1U92A 3HI6L 2A74B 1BD2A 2Q6WB 4WFFE 4Q6IB 3CDFA 3MBED 3PWPA 2OX5A 1J0ZA 5IKCA 1QO3A 5C0BE 1IGFH 3BH8B 2MCPH 4MSWB 5IBLC 3LQAC 2ESVB 3HFML 2P5WB 1BECA 2Q7YA 5EDXA 4G43B 3WE6A 1MVFA 3PGDB 5AG9A 2NXZB 1JF1A 3C09C 1MIMH 3O6MH 4PLKC 1ULVA 1YMMB 2D3VA 3B83A 3VXNB 3SDCD 1QSVA 1UGNA 5HHOA 3R0NA 4PB0H 1SMOA 5IG7A 4OFDA 3FB7A 5J06A 2Q86B 4O2FA 4NSKA 1QSEA 5DDHA 3PIQA 5HHPA 4ELMA 3F8UB 1MLCA 1IZJA 1M1SA 3L3JA 1F11B 3VH8B 3DX6A 3O45A 5BXFA 3L3KA 1E0OB 2GITB 4E5XA 3L5HA 3RTQC 2UUDK 5T1KB 4PY8I 2NR6D 1NCNA 1H3TA 1HZHL 1DQLL 5TGBA 4OLZL 4NO5B 5JZ7C 3ULUC 1KJ3L 3TVMA 2C4FT 4LRNL 5JHDE 5IHBA 1KTRL 1P4IH 3RWIB 4UQ3B 3O6FD 2FX9H 3RWCB 2V5YA 4JKWA 3FN3A 5GZOD 4K9EC 1DBKL 2GJ6D 3X14B 3LRGA 3VJ6B 3CFEB 1H3WM 4JFEE 2NY3C 3IXTA 4QHKJ 3CFIC 4NOBA 1IC5L 4CVWA 3KPSD 4JREB 1E6JL 5D1XA 1Y6NR 5DJDA 3MACH 3DV6B 1FDLL 3K4ZA 4N9GA 4HKZB 4UIMB 2BX5A 1CFVL 3WHXB 3MJ7A 2X44D 5EN2A 3D18B 4Z7OF 2AABL 4ETYA 3DVGB 5DFTA 4TRPH 4U49A 3N1FC 4IIQB 5I74B 4BK4A 5I1KL 3JWNC 3LHPH 4ZTOL 3PGCA 2R1YB 3DTXB 1VEOA 4R7NB 1QG3A 2A0LC 4XRCB 1PG7H 2CDEA 3QIUC 4M7LH 2OQJB 2YSSB 1FGVH 4KJQC 3CLEL 4AMKL 5C0BA 4R9HA 4KXZH 3UTSE 1MCWM 1UM6L 2K9UA 5IB4A 1U92B 5EWIL 1WIOA 4WO4D 1BD2B 3NCJH 1Q1JH 3W5NA 3PWPB 2VAAA 1QO3B 5J11C 2EXWD 3MSPA 4UT7L 1S7VB 2CUMA 3CCHA 3TPUB 2BFVH 5D7IF 4P4RA 3C87A 4FP8L 3WL9A 3VRIB 2Q7YB 3WE6B 5HYIA 4S1RH 4PG2A 4MXQA 4P9HC 3QCTH 3QUYA 5INCA 3CFCL 1UM5H 1KLUB 3D9AL 3T1WA 1AGDA 4ONGL 4YBLC 4O2FB 1QSEB 1NCDL 1RUQL 2AVGA 3GGWB 4HXAL 3PIQB 5DDHB 5HHPB 3NGBC 5KVFH 2NX5B 1TIUA 4NM8L 1MLCB 2VXTH 2FX7L 3DX6B 1ZGLP 5TJWK 4NQVB 3L3KB 1I1FB 4PRDA 2WY3A 3MA9H 1MRCH 2VLRE 4WHTA 4TUJB 3VCLA 5IBTH 4M7ZB 1HHHB 5J12B 5JW4N 3VFRA 5JHDA 1CS6A 1TCRA 2IAND 5TGBB 4AIXA 5I1HH 5GQBA 2WBWB 5FV1L 5C0FB 3TVMB 4JFEA 8FABA 2QBWA 2JCCE 4KQ3L 1EEQA 1H3PL 4C4KO 4ZFFA 1NGXA 4P48A 3IXTB 5D96C 2EH7L 3CU1A 2ICWA 2M26A 3GSQA 2EC9U 3BISA 3DLQR 2X9XA 4BZ1L 1CBVH 5D1XB 1IKNC 5DJDB 4J2XA 5LKNA 4N9GB 3V2AR 4KUZH 5C2BL 3MJ8B 4Z7UE 3MJ7B 5EN2B 5KOMC 5H94A 2OJZH 5BOPA 2EICA 4QXTA 4D0CA 4WEBL 2XY2A 3PGCB 4RISL 4N8PA 1TQBC 4CDGC 5GZND 5K9KB 3UTSA 2Y23A 4LCWE 1V3MA 2CDEB 1NBQA 4L4JA 2XTLA 1KNOA 5KSVA 4OZHE 5CGYC 2Y5TA 1C5DA 5A16A 1CFNA 2HKFH 4XMPH 3F58H 4C83A 5IB4B 1WUNT 2JKXA 1JGUL 4K94H 3SBWA 2VAAB 3QDGB 5DUMH 2CKBA 3SE4A 2PCPA 3D39B 3CCHB 4H8WC 4P4RB 4CRPA 3WL9B 5K59E 5E08L 2VXSH 3FN0L 5F1NA 1LDSA 3HE7A 1JPSH 4BUHA 1P6AB 5JA8B 1P84J 3I6LE 3QUYB 3EJYD 4P57A 4D3CL 4L3AA 4NKDB 4OF5A 4YDKL 1AGDB 4PB9H 3MRRB 1NGYA 2VLRA 4LLMB 3LKOA 3UTQB 4ZTPH 2QSVA 3HPLA 4PRDB 3BN3B 4OQTL 4PRNA 2J88L 2DF3A 4WHTB 4MQTB 4WTZA 3QDMD 5SWZD 4KHXL 4N0UE 3RX7A 2JCCA 2BNUA 4J8RA 5JHDB 3I6KB 1EFXD 3NPSC 4GXVH 2JF1A 2CKBH 3O6LL 4O4YH 4PJXE 3OKEA 5K9QG 1L9NA 1MFDH 3OKDA 4JFEB 1UCBH 2H41A 2R4RH 2PW2B 2Z9TA 3FQXA 5CMAA 4ZFFB 3BYTA 5GS3A 1MJUL 3CFKA 3P3YA 4NHCH 3OKLB 1PBYA 1OQXA 4Z7UA 1FCCA 1GGBH 4Y19E 1EHLH 4F7EA 3SE3C 3GSQB 5D70L 5CKGA 1NANI 3G5XB 4N0CD 3Q6FA 4LSTH 3S36X 1E4WH 3L5JA 1DQMH 4OUUA 5H94B 4LCWA 4Y89A 4MXVE 4QXTB 4D0CB 4IMKA 4IRJB 4OZHA 3T2QA 3VD9A 3RGVD 5B4MD 5T3ZE 4NPYA 3B5GA 1LVEA 2CRYA 3TO4B 4XNYH 2JTDA 5TE4H 5I1DA 3TLRA 1AIFB 2ZCKL 2NY0B 5DD0H 3SDAB 3OAZH 5KSVB 1RULL 5SV4A 2I9TB 1W8OA 4JG1H 5E6IC 2FJFA 4YDVB 5C2UB 1C5DB 5A16B 3MLSH 1CFNB 2FEEL 1AD9A 4M8QB 4KK6D 5DVLA 5E95B 5C0JA 1FNLA 2FBJL 3ILPB 1I1RA 2UZXB 4Z0XA 1SY6A 3V9FA 5T5FH 4BA8A 1T03L 2GKIA 5IVXB 1F13A 3VWKC 4TNVF 4PJFE 3OXRA 2PCPB 4NN5B 1LQVA 2BJMH 3BKCH 5F1NB 3MREB 3O81A 4JHWH 4GRWH 3HE7B 3QFJE 3VMNA 3VG0L 5CCKH 2WINA 1OTUC 4NWUH 4WVRA 3RL1A 4OM0H 4ODTL 4WU7A 3U1SH 1F4WH 5BVPH 3Q5YA 1DBBH 4LRIA 5C0RH 1NGYB 2VLRB 4DK6A 4NNXB 4RFNC 1INQB 1YYLH 4N0UA 5DXWA 3FO0H 1JV5A 5ESQA 5MEND 2YA2A 1FPTH 3HPLB 2DQEL 4PJXA 1YYMH 4PRHE 2DLFL 2L7UA 2HT3C 1HOCA 1ETZA 3C6LA 5C1MB 1SY6H 1FG9C 5GGQL 1LGVA 2JCCB 1ZLUK 2DIBA 4L4VD 4ZXBD 1IMHC 2BRRL 5CZXD 1QA9A 3CSGA 4C57C 4YHNA 2CO6B 1YJDC 5C09D 5MEPB 3TEUA 2BNQE 3D3VB 4Y19A 2J8UE 2CLRB 3FQXB 2OBGA 2P7TA 3DVNB 4HWUA 2BZDA 1T83C 3BZFB 3U46A 3RUGE 1KN4L 3BP7B 4LVHB 4F7EB 1BFSA 5D7LD 1OTTD 2OMNA 3BSZH 1CLOL 2YPLD 4UDUA 4XP1H 1YEDA 1L9MA 1WZLA 1WFTA 1KB5A 2FLBT 3GJFA 4W6XB 4GRWB 4AL8L 4OZHB 1NEUA 2YUVA 2MFNA 3SN6N 5DT1L 4XCFH 4YEEA 2X2YA 3D0VA 1TPXC 5D2NB 3X3FH 4LQFH 3O2WH 5FYKL 4MA1C 3MMEB 3EO1A 5KZCD 2FJFB 4UOW1 5GS2H 4PJFA 3I50H 4KI5C 2G60L 1FLRH 5F6HI 5C0JB 5KSBE 4LU5H 5HDQL 1VADA 4WI7A 4YX2H 3LB6C 2B7DT 2GY7B 2C7UB 3QFJA 4Y2DA 4RBPH 3WN5C 5T3ZH 1QSFD 1T66C 3V4VH 1LO5A 1YNTA 1BP3B 2F54B 3GJFH 5CAYB 3CSPA 2EDWA 4NUJA 3PDDA 4P4KD 3MR9A 1KOAA 2W9DH 5TFSH 1N2RA 3GO1L 4OLVH 3P9MA 1MJ8H 4ZFOL 3QPXH 4F57H 2AI0H 4WU7B 4JO2L 4PRHA 4HUMB 5D1QD 1RZIA 4N0UB 4PP1C 3HNSH 5ESQB 4J4PD 3SCMC 5HYJD 3H2WA 1UYWL 2IPTH 2W92A 5IVXF 4PJXB 5F9JB 1S7WA 3ULVD 1ETZB 3C6LB 2BNQA 1FL3A 3CNKA 2BHUA 2J8UA 4L4TE 4PJ9C 2XKUA 4ODVH 3NA9H 3RNKA 3U4EA 1AR1D 4AM0B 4ZYKA 4M6AA 4LSSL 3ABZA 3R1GH 4I48A 5DLMH 3P11H 4RAUA 3RUGA 2E27L 43C9A 3T0AA 1KC5L 1JWMA 1AI1H 5I18L 2WBJA 2PXYD 2OI9A 2P7TB 1EZVX 1Z0NA 3FRPG 4K7PL 1OTSC 5GRVK 1V7ML 2W65B 1EBPA 5C0ND 4GRLD 4NO0A 5SV3A 3HRZB 3T09A 4MD4A 3CLFL 1TVHA 2Q76B 4NCC2 2C4FU 5EU6D 5JW3L 4MQSB 1HIMH 4UDUB 5F7DA 3WFCH 1Y18A 2AK1L 1YEDB 2JCCF 5D7JA 4JQVA 4H5SA 1C5CL 4RMQA 2AJZB 3I3DA 1BM3L 3WEXA 3GJFB 2AJXH 4EJ1C 5EIIA 3RZCD 1TTUA 4G7YH 4XPAL 1XIWA 4Q9CA 4MAUH 1HH9A 4KTDL 5C8JA 2HFFA 3VFMA 4C58B 2IADB 3MXWL 3NN8B 5C08E 3TN0A 1I75A 5BOZG 2CLZA 4G8GD 2RHEA 4TVSa 5KSBA 2CIKA 3A6CL 3BW9A 2G9HA 3IDNA 5B38A 4PRIE 3T1FB 2PO6C 4PJFB 4IRSB 1ORSA 2Q87A 1R3LA 2ARJB 3GI9H 3VI4E 3QUZA 4RFEB 1ZLVK 1OGTA 1MFAH 4NJ9H 1IM9D 3WFEH 1VADB 4Q0XH 3V0VA 5J3HD 4Z9KB 4GRWF 1J1OH 3QFJB 1S7SB 3C5JB 2E5EA 4OZHF 4DKAA 2BNRD 2XOTA 3GMRB 4R26H 1LO5B 1YNTB 1J5OL 1UENA 4PV8B 3SEPA 4OZGE 2LABA 2CK0L 1F42A 1U8OA 4LSVH 1N2RB 3PWNA 3TF7A 2V2WA 4FS0A 1NAKH 3ULUL 1MWAA 4DFIA 4EZMA 4KUCF 1RMFH 1UACL 2I26N 4P3DB 4GG8A 4NWTL 1TENA 4Z18A 3VXUE 5K59F 4QRSA 5BZDA 4K9EL 1YEGH 4L4TA 3ZT6A 1VKXB 2X1PA 5FO8A 4XHQA 1UZ6E 1EO5A 3UPCA 4N90E 1S7WB 2W0LA 2BNQB 5C9KA 1A21A 4XPHL 2J8UB 4TSCH 3RNKB 3KAAA 4ZYKB 3JXAA 1D5IH 4ZAKD 4EI5B 1FZJA 4Z7QE 1ZV5A 3B4NA 4I48B 4RAUB 1D5BA 4DQOH 1L7TL 4TPRL 1JHLH 1JWMB 3TT3L 1FSKB 2QHRL 4NRXB 1DCLA 4FQJL 1N4XL 2WBJB 3SDDD 4F58H 3KPRD 5L88H 3SGEI 5EU7C 1YEKH 4JZOB 2VDMH 1MWAH 1P6FA 1LD9B 4BK5A 4NO0B 4XNMA 4S0TD 4FA8A 5CILH 1TVHB 4PJXF 2P45B 2R1XB 5F1IB 4KZEL 3RBSA 4JFOA 1N0XH 5F7DB 3U9PH 5I66A 4M1GL 5D7JB 4X6BB 1YZZA 3ARDC 2I07A 3BPNB 4LPXA 3VG9C 2FDBP 5CGTA 3WEXB 3KLSA 5C08A 5IHLB 1ZGLA 4OLEA 2ARJQ 1SQ2N 5CBEA 4HIIB 3LKSA 4JHZA 5EIIB 3KPOB 4P2RE 2GIYA 3UYRL 1XIWB 3WFBH 1HH9B 2B39A 1UJ3C 4PRIA 1EHAA 5IVOA 1G9NH 3DWTA 4TSBL 3QXAA 4TVPL 4NQED 4FQQA 3ZMRA 5GGTA 5KSBB 4FQXC 1OHQA 3O3EA 2A6IA 3IDNB 1ZT1A 1DSFH 4MXVF 3VXRE 1NLDH 1ORSB 1Z9OA 1R3LB 3VXPB 1AQKL 1OGTB 3O9WD 5ENWA 2RBLA 3PHQA 3V8CA 3FT2B 4L29A 4U05A 4ZUSA 5JXEC 4OZGA 1MHPL 3BRDA 3LN5A 3UMTA 4OZFA 2KUTA 5E5UB 1PX3A 3QRGH 5JIPA 4LMQI 1HXYA 2A1WH 1L7IL 2HTKD 4JB9H 1QRNB 3VXUA 1U8OB 1J0HA 1QLEH 1FO0L 5SWQA 5J89A 2VDNH 1MWAB 1NLBH 3HPJA 4PRPD 1OAZH 1K6QL 4F9LC 2UVFA 4PJFF 2I25N 5KVDH 1AXSA 4GG8B 4RA3A 3SGDH 3G6DH 5GGTH 4ZMAT 4L4TB 2UZIL 3PJSA 5D71H 5DJ2A 2E9JA 1AD0A 3O2DA 4BH8A 1T1XA 5FO8B 12E8H 3M07A 4HSQA 4UTBH 3SQBA 3RY5A 4NQCD 3LKNA 3BWUC 3TV3H 5B39G 4UT6L 3FCTA 3BQUA 3FJTA 1CL7L 3HC4H 3QIWC 4P2YA 4ONFL 1D5BB 1MCOL 2H2PC 3FMGL 3FO9B 4OZFH 1Q0XH 5TQ2H 4Z6AT 5CD5D 1OY3B 5ESVB 3RWDA 4HK0A 3SE9H 1Y0LB 4FNLH 4N0FA 1A3RH 3LS4H 3PQYD 3TJEH 4FQLL 3S4SB 1A6ZA 4XNMB 2N56A 5DRXA 3WIIH 2DQFA 3JUZA 1I9RH 4JFOB 43CAA 1OAQL 4P2RA 1XGPA 2J8UF 4OLUL 5EORH 5I66B 2VKWA 3O2DH 5D7SL 4D9QE 5C08B 1OGAB 4XPGL 4OLYH 5EB9A 4XHJD 5CBEB 3LKSB 1RD6A 3F5WA 4CJ0A 4DUXA 3WHE1 5CKAA 4RGNC 5DQJA 3VXRA 1HN1A 2OCFD 4U3XA 3B3IA 5AG8A 2AV1B 3QXAB 4JANA 3RKDD 3OJ2C 4FQQB 4E9LA 3D2UA 1JZ6A 1ZT1B 3GKZA 1N3NA 5TF0A 4ZO9A 4N1HB 3EYVB 3MV7D 1OOAA 3TPKA 4PREA 1NCCH 4W4NA 5ENWB 3PHQB 4WUKL 3UTTD 1A3LH 4ZUSB 3NCCB 4GMSH 1NMBH 2YRLA 1KJ2A 1YEEH 5DJ0A 1CWVA 1JZ3A 3WNMA 4MDIB 2W1NA 3LN5B 1XAUA 5B8CA 3TH2T 1WBZA 1HXYB 1NC2D 2F74A 3RHWF 2D7OA 3VXUB 3TYFA 4KWUA 4Y0GA 4WI8A 5KSBF 2ZG1A 4OCLC 4S1QL 5SWQB 3TIDB 4J6RL 5KG9A 3HPJB 2XQBL 4PBWD 5CINL 1RUKH 2Y72A 4L1HA 4ODSH 32C2A 1U6AL 3UPRA 3PJSB 5JUEL 1KTKE 1AD0B 1WVZA 4KMTH 4BH8B 4JQXC 1T1XB 3S98A 4XPBH 3WD5L 1P2CB 4EQ3A 2FNBA 2OM5A 4JN2A 3LKNB 3R8BB 1JJUA 4R0LC 5F1SA 1KJ2H 5GGSB 5IFAL 5F9OH 4ZS7L 3FCTB 3BQUB 2W60B 5MHSE 1I8IB 4EN3B 5HI3D 1MSPA 3RWDB 4KRNA 4HK0B 5GISH 1BGXH 2OR9L 3WV0A 1Z6JT 4N0FB 4GMTH 3WKMH 5I1EL 4NCC1 2HRLA 3DX8A 5GGRY 4MNQD 1A6ZB 1KCVL 4PJ5D 5DRXB 3FQTA 2DQFB 4YIQA 2F19H 3BE1H 5FM5O 4U1SB 43CAB 1RIVH 1T2QH 1S5IL 3EYSH 1T6VN 3MUGA 5E2TH 2BDNH 1TZGL 3H6JA 1T2JA 1Q8MA 2Z92A 4FZEH 5FM8A 3VXSE 2XRAH 4KKBC 3FAWA 5DQJB 5LWYL 1I8MA 2BSSB 4LGSB 4N0YL 1S78C 4ZO6A 3B3IB 3BT2H 2DYPA 3VGGA 4Q9RL 2CGRH 5DRWA 2A73A 2WLZA 3SDXE 4Y4KA 1KCKA 4MD0B 5JXAH 1N3NB 5I2IA 3FO2A 4BFIA 4I1NB 2XZQH 2J3SA 1OAKH 3QUXB 2P5EB 4PREB 4KKCC 5EU3B 5A2LH 3RRQA 2D0GA 1H0DA 5FECB 1H3UA 1KJ2B 4FRWA 5DJ0B 2EH8L 4X99B 3B5HA 1YY9D 1NQBA 3HI6H 1RZKL 4CU6A 2X70B 5B8CB 1T20A 1WBZB 3I2CL 5EA0H 3RVTC 4Z7NE 3K80A 1CE1H 3AU1A 5C6TL 2D31A 3FHAA 4Z7WE 5JA9A 4U1NA 1YJDL 1OM3L 1MJ7H 4JY5L 3MLTA 5ADOH 2VERN 4ZG1A 3KG5A 5E1AB 4K07A 3EHBC 3U83A 2Y07H 32C2B 3UPRB 1W0YT 2IBGA 3OR6A 5E6YA 3GSXA 3O8XA 3BMVA 2V2XB 4XZUB 1E27B 3VWJC 3O3BA 3I02B 5ANMB 3PDOB 4G5ZL 1G0YR 1JBJA 4JN2B 4CVZA 1I3RB 3STZB 3B9KD 3PP3H 3MA7B 5JPNA 3P77B 4I77H 3P30L 1QBLH 4LSPH 3E3QC 1OLZA 3ARFD 4PYHA 2YD6A 4JFXA 3HS0A 1VGKA 2EDQA 3BPOB 1R3IL 3MODL 5FAAA 3MNVA 4JPIA 1QZ1A 4LEOA 4CAGA 4PJIE 2UVEA 3O3UN 4P2OA 3BPLC 3DX8B 3CJJA 3MV9E 2IBBA 2NLJB 2FB4L 1J7VR 5JHLL 1CD9B 4NYLA 4YIQB 2LE9A 5IJVB 4APQC 1KYOJ 3MV11 1PW3A 3U4BH 2IFGA 1KJMA 4AEEA 4DVBA 4G6JH 5I1IH 1UWEH 1YPZB 1XGYH 1E6JH 5KW9L 2Z92B 2YD7A 1N6UA 3KYOB 1U42A 5DHXB 1J11A 3SDXA 4DCQA 2CPCA 1CFVH 1DUYB 3VXQA 5HDBE 1Q72L 4L8BA 4Y4HA 1GOHA 4BZ2L 5HVHB 1LK3L 1AO7B 3CXHK 2XA3A 4WUUB 3Q1SL 1ACYH 5DRWB 1G9MH 3QH3A 1JK8A 4F9PA 4Y4KB 1NFKA 1A1OA 3MXVL 3ARGD 3L3OB 1HINH 3ARBD 3FO2B 1JGEB 3RPIA 3T4AA 4LNRA 4JGMA 3RKPA 4N8VG 1QACA 1H0DB 3P4NA 2W07A 4M03A 4AMKH 1J10A 3JTTA 1JZ4A 2HFGL 5KS9B 4XC1H 3GRWA 4Z7WA 2BY0A 4ISVA 4AIOA 5JPMB 4HKJA 4A6YA 1EAPA 5A3IC 3ALWA 1Q9WA 3K8LA 5EOQL 4UT7H 2AERT 1SJXA 2WQRA 3QXVA 4DAGH 4U1NB 2DBLL 1EO8L 3AMLA 1CDBA 1T5WB 4K23L 3AB0C 4D8PA 3DNKA 5IESH 4WWKA 4TULH 2C1OA 5D1ZC 3BXNA 1Q9OA 4JCLA 4NQDB 4JZNA 3GSXB 3O8XB 3WUZA 2EO1A 4X0KB 3HE6A 1CDIA 2X1WL 3KVQA 4RX4D 4OCNC 1ZT7A 5DD6B 3GSRA 4CVZB 4EIZC 4KHTL 2CJUL 5JPNB 5IIEA 1RPQA 4PJIA 2ZUYA 4YWGL 2DQGL 4JFDB 2FO1A 3GRWH 3MV9A 2BSRB 4JQIL 5A2JH 3HS0B 4A6YH 4G6FD 3EIFA 4LCIH 4LEOB 2IH1A 4P2OB 1U8MB 3MLXL 3IT8D 4X4YA 3DO7A 4HUNB 4XTRD 1EA9C 4WFGD 3PWLA 4NYLB 4UINH 3X17A 1BOYA 2OL3L 1B6UA 1FGNL 1KJMB 4EI6A 4UZGA 5DO2C 3MLZL 4LLDA 2EH7H 4OLXL 3MNZA 4DVBB 4M1DL 5IBLD 4RFOH 4U1HA 2DM3A 2SEBA 5JIHA 2C5DC 3DXAE 5FOBA 1NH6A 1RSFA 4P5MA 3ORJA 1CTOA 3VFGH 5HGGS 3SDXB 4RCAA 4LLVB 4PLKD 1TJGL 4LHJB 3VXQB 5C0IA 4Y4HB 5GRJL 5DFVC 3LQZA 1FFNA 3F7YA 2WWKT 3EDKA 3IETB 2PTTB 4P3WA 1RIUL 5AAMA 4HWZA 2IMMA 1F58H 3T4AB 4LNRB 4XPFH 5MERA 2H45A 2ICEA 2Q7NA 4B41A 4CL7A 4B7LA 4MLIA 1IL1B 1UXSA 1YPZF 4LSRL 2Y6SC 3RTQD 3VXOA 1GVIA 5T33L 3MLRH 2ZZUT 4Z7WB 4V1DB 3BIKA 5F97E 3ZTNL 2DLEA 4A6YB 4ORZC 5JZ7D 3ULUD 3RPKA 1EAPB 2XN9E 3HZKA 1IGCL 2NY4B 2H8PA 4DGVH 2VXQH 1P1ZA 2FYYA 4XP4H 1ZS8B 4WCYH 1F90L 5E08H 4OCRH 5IT2H 1TTFA 5DTFA 3O41A 2YS4A 1EUTA 1CGTA 2XY1A 4BSVB 1FZKB 1UQSA 2QSCL 3D0LA 3EO9L 1TNMA 2NY3D 3R06B 4D8PB 4WWKB 2C1OB 2MJWA 3K81A 1Q9OB 3NTCH 4JZNB 1UH4A 2X7LA 5JDSA 4AK1A 5KS9F 3HE6B 1CZ8H 1ZT7B 3K2UL 3GSRB 4OV5B 2FH8A 2H9GA 2DMBA 3CPLA 5KSAC 4K2UL 3OZ9L 5IIEB 2O5ZH 1ZHLA 4PJIB 3GSNL 4U0RB 3MV9B 4JDZA 4URTB 1GGTA 3R4DA 1XGUA 3MLYH 3BDXA 2A0LD 5HHMD 2B4CH 3QIUD 2R9HC 2VDQL 2IH1B 3IAPA 3JTCA 4GT7A 4KJQD 2HYMA 2AJYL 3DO7B 3GI8H 5K93A 2CO7B 2O5YH 3KS0H 4IIQC 5FA3B 5T3XL 2AS5M 3NACH 1MUJB 1H3GA 2VB5A 4GUPB 3DXAA 2ICWI 4Z8FH 2Y4SA 4RMUA 2NY5H 5I6XC 3ZE1E 1IBGL 2MQCA 4UBDC 3RI5F 1F45A 1MCNA 4U1HB 2SEBB 5D70H 1ZKAA 5FOBB 4P5MB 1MFCL 1EERB 4OKVB 1F02I 1UWXK 3H9SE 4K3EL 2YMXL 2A83A 3H0TA 2APBA 4PJ8C 4HS8H 5E7FA 3LQZB 3REVA 3HMWL 4EBQL 1NGZA 5MEOA 3I3EA 1IGMH 5DMIH 4HWZB 1JZ5A 4C56E 2IAMA 5GRUL 5BQ7B 2MOVA 3T0EE 4U3HA 5MERB 2ICEB 1ZGLM 1KB9J 3CFDA 5AYUL 3BI9X 2UUDH 2XN9A 4JM4L 3VXOB 4YXKH 2LVCA 2NXYB 3M45A 3EOAB 3SDXF 2VZUA 2J4WL 3QO0A 5E2VL 3G9VA 5J7CC 1R0AH 1JNLL 1KPUA 4V2BA 3HZKB 4HCRA 1P1ZB 2FYYB 4NZUH 5ACZB 3RZWA 4G42A 1N64L 4P5KB 1MCPH 3EOTL 3T0WA 4E41D 3O41B 5GGRA 3ZT7A 1A6VL 1P5VA 1UVQA 4XNUH 3AS3A 1N6VA 7FABH 1UQSB 3D0LB 3OF6A 4HQQL 1U95A 5AUMA 3TVMC 4Z7NF 1UB5A 2X7LB 1A7NH 3ZKXC 4Z7WF 1VPOL 3MRJA 2ZCLL 1JHKL 4PJDE 2H9GB 3CPLB 2NMSA 5BRZD 3QDJE 1ZHLB 1WFOA 2BXZA 5IQ9B 4JDZB 1NSNL 2F53E 1W0WA 1BEYH 2L7JA 1XGUB 1BF2A 3EFFA 5D1XC 1BVZA 1WFUA 1I1AB 4HCRH 5E8OA 3SQOL 2BRRH 3V4PL 4S11A 5CGYD 3CX2A 3MGTA 3NIDF 1NBVL 3VGBA 5K9JL 2RGSA 3ZYIA 1MPAH 3S34L 3DXAB 4I9WD 3HLAB 2RB8A 4YDLC 1MNUL 1RI8A 3EYFA 3ERYA 3H9SA 4HJ0D 4M7JH 4XMKL 4YHZL 5I1AA 4HUWA 4PLNC 4PJIF 3IJSB 4X4ZA 3ZZ1A 2X4QA 4QGYA 5SWSE 4GO6B 1E4KA 5GIRA 1X4YA 2DM7A 3QG6A 2DQDH 4RWHA 1MH5A 3B6SB 2A83B 3H0TB 4C56A 4Y16C 3GK8H 1FAIH 3T0EA 3REVB 1OT1A 3JV4B 4AL8H 1W72L 3JVGA 5LG1A 5MEOB 4U1LA 1ZT4B 2HH0L 1OT2A 2IAMB 3KDMA 4YK4B 1QTYT 5HGDA 3MLUH 2JELL 4PG2C 3MCLH 4NC2B 3BIAX 4FQIH 1UT9A 25C8H 5HDBF 3CGTA 2XN9B 5MEQA 5B39A 1JRHH 3QO0B 3QXWA 4YXLH 1K9TA 1G7LB 2YZ1A 1KIPA 4X8JB 3EGSB 4NFCA 2YBRB 3RIAF 1LO2L 3MUZ1 3TO2B 4WHYH 5DVOA 4R90L 3DARA 3IDXL 3THMH 2OTUA 3GO1H 4NBYB 4PS4H 4UQ2A 4CMHC 5ICZB 4PJDA 1TQCC 1U95B 3QDJA 5JORA 3PL6C 5AUMB 5CJ5A 5IK3A 4H88L 3H3BC 3V5DA 4XX1E 1S8DA 2F53A 1EZVY 2AQ1A 4V3EB 4NDMB 2VDRL 2EEBA 3KPTA 1U41A 1FH5H 4KVNH 2BVOB 5FHAL 2PYFB 4L9DA 4K94C 1FQ9C 3O6FA 2M1KA 4XPTL 5FKPA 1SYSA 2R56L 5E8OB 2XZAL 1XF4A 5HYQA 4EOWL 2P43B 5HSFA 4G6ML 5E6ID 2D03H 1CT8A 1DLFL 1GPOL 1UJTA 5HHQB 1AGFA 1O5DT 3H8NA 1AXIB 2NYYC 5SWSA 4PRAA 3EYFB 4KV5E 4XXDA 1DZBA 3EFDH 3H9SB 5K33A 5I1AB 1JZ2A 3VWKD 1TJHH 2IQ9L 1HKLH 4YDIH 1DE4B 3E2HA 2X4QB 3Q48A 4PJGB 5JW3H 2CMRL 1ZSDA 4ODHH 1R3KA 3BEVB 5GIRB 3QG6B 3QI9B 1BM3H 4L8SA 4X83A 1A14L 1MHCB 4DKDC 1OTUD 1UZ8A 5ISZB 3T0EB 1I9IL 3SBWC 4NKQB 4BQ6A 2DL9A 3SE4C 1KGCD 4KTDH 4WO4A 3H7BA 1FN4A 4UIKL 1JHTA 3MBEB 5AWNL 4UTAH 2IG2H 4LK4A 1RZFL 5I8OL 3ZDXF 1K8IA 5MEQB 2HT3D 2VABB 4JFZH 5B39B 2LU3A 3TCLA 1K4DA 3SDCB 2HKHH 2DQUL 2YKLH 5ALCL 2YHGA 4ODWA 4TTGA 4FOMA 5IB5B 1FL6A 3QEGL 2ERJB 2OTUB 4ETQA 2IC2A 3VU2A 4RAHA 1MOEA 5E8NA 2IFFL 4PJDB 5DVKA 4EXKA 5JORB 1OW0A 5JQHC 3V5DB 1BJMA 4GS7B 2F53B 1EUUA 2EXYC 5H35A 4WI6A 5J6GA 5JW4R 1HQ4A 1IVLA 5F96L 2FX8H 1S9WA 5LXGL 1A6TA 5DEZA 4X5XB 3O6FB 3CMOH 3DMMA 3D69A 1HK6A 2V7NA 1JNHB 4Y5YA 5F6IB 1RUAH 1A7RL 1XF4B 3GJEB 4RNRA 3S35X 5HYQB 3S97C 1A7QH 3BESR 5A2FA 2B1AH 3MX0A 2QKIB 1CT8B 4JGUA 4RGMB 5BW7A 3KPSB 3S37X 2QHRH 1AGFB 4R4BA 4KI5D 4IMKC 4KVCL 3MLVH 3V4UH 5SWSB 1FNAA 3F7RA 3SY0A 1NAMA 1OQOA 1FYTD 1MIEH 1MLBA 3Q2CA 3EDDA 1KCUL 4BFEA 5LGJA 5CSGA 1T66D 4DKFL 1CXKA 3FZUC 4DVRH 4CU7A 3WIHA 3EW3B 1R3KB 2Q8BL 2RIKA 3BUYA 1IM3A 3SKJH 1UC6A 5L6YL 1UZ8B 3WFDL 1FFPA 4M6OH 2NZIA 3ARZA 4MHHI 1BFVH 3ZE1F 3T0BA 5FDYA 4WO4B 3H7BB 1FC1A 4X6CE 2DICA 1FN4B 4PP1D 4QRUA 4Y2OA 5C07D 3SCMD 5MI0C 2FHBA 2B5IB 5BV7C 2IALB 2OZ4L 2F8OA 5FFLA 2MNUA 2B20A 1K8IB 1ZTXH 2AEQH 1NAMH 3FB6A 2O26U 1ZLUH 1HH6A 3CZFA 4H25A 3IS1X 4PJ9D 3LDBC 3RU8H 3TCLB 1K4DB 3WJJA 3AMKA 2BRQA 1JGLL 5T5NF 1H5BA 3U4AA 5EZJA 4X7FC 3WIHH 3TJHC 4P46A 2APXA 3ZYZA 4CN6A 4JO1L 4ZD3L 5IHZA 3KJ4B 5EZLA 2AV7B 1RIHH 1OTSD 3C6LC 1N5YL 1L7IH 4DW2L 5CHNA 5DD5H 3KHQA 5E8NB 3QHTC 4PJEA 2Y25A 1K6QH 2JB5H 2IH3A 2VC2L 1FHGA 3E8UL 5MENE 2EDOA 4LLYB 4J3XA 1MEXH 2NPLX 1IJ9A 1CGYA 1KBGH 2BVUA 3I6GB 4NQUA 1S9WB 3AS2A 3N9GL 3MRLA 3INUL 3V7MA 1A6TB 3VDCA 3DMMB 2V7NB 2VDOL 4BH7A 2XZCL 4Y5YB 4OFYA 2VQ1B 3OHXA 3W9EA 2VLJE 4RNRB 4UT6H 5CJ8A 1DBJH 4FTVD 3S36H 3IRPX 2AJUH 4JKPL 4PJDF 3VI3E 1F3JB 2FGZA 4AYFA 2PO6D 3NCFB 4X98B 4N8VA 3AROA 1WTGT 3U79A 5LCVL 3SY0B 2B0SL 2EXWC 3D25A 4FQLH 1B4JL 3VFTA 2WUBL 4O9HH 5EU4A 1EIBA 5IP4A 5F7UA 1MLBB 2YPLE 5I19L 2R0LH 1G84A 2ZSWB 3TIEA 1J86A 3BUYB 3RVXC 3UEZA 5ITFA 1Q9LA 1IM3B 4BQBA 4D0DA 5DUPL 1CVSC 4N1CA 5I75B 4X6CA 5I17A 15C8L 5IHUL 5C86A 1QFWL 3DRQA 1GC1H 1J88A 5D9SA 1F8TL 1JNNL 4OIIL 1KFAH 4Y2DC 3SGDI 4CADA 4JO3L 1AJ7H 5C0GA 1HQRA 2X05A 4YR6A 4RMVA 3FHQA 4JJ5A 4Q9QH 4JRXE 4JM2A 4H0GA 2VSDA 4TQEL 4OSUH 3M8OH 3FB6B 3UTPD 3CZFB 2FO4A 1MFEL 3S5LG 2YD4A 5EC2A 1H5BB 4XAKE 1FORL 5IQ7L 4KK9C 2NCMA 5GJSH 4RMTA 1JYWA 4R4FH 2R0KH 5F9WC 4MAYA 5IHZB 3MOBH 3U7WH 3GMOA 5EZLB 4L1DA 3L3GA 1IGFL 5MENA 5BVJA 4L3CB 2MCPL 2CDFA 2FATL 4PJEB 4G8IA 2IH3B 3QDMB 1MIML 3O6ML 3VXME 2R2CA 2WBJC 4TUOB 2OI9C 1EFXB 4ZXBA 4N9OB 2LFGA 4PB0L 5E70A 1S7XA 1PKQB 2ZOKB 4K8RC 2VLJA 3MRLB 3SKUD 4XMLL 1I85A 4CNIB 4LPWA 3MYJB 2WBKA 1J8HD 1AGEA 2E7BA 3BFOA 3NFPB 1SMAA 4HV8A 3LVEA 5DS8B 3W9EB 3DSFH 5AD0A 3BAEH 5F7LB 1A47A 4FQXD 2MSPA 4L3EE 2AEWA 4U1JA 2JLLA 5D7LA 2X4TA 4AQOA 3HTLX 5DA4A 2YPLA 3QNYB 4N8VB 1G7IA 1ZLVH 1XIWC 3SKOB 1QFHA 3D25B 2E3VA 3IVKA 3VFTB 1AKJA 5JXED 5EU4B 5CIPA 4JRYD 3TN0C 5FHBH 1P4IL 2H1PH 2FX9L 5DI8A 5HPOA 1CU4H 4PP2A 4LASH 4I2XE 1Q9LB 4D0DB 4WW2B 2X09A 4EQ2A 3HRPA 5F7NC 3QUZC 4NUGL 1KCLA 4KV5F 4N5ED 3MACL 2Z93A 1I7TA 5D9SB 3QSKB 4JRXA 5IMOA 4YHPA 5DC0A 2ENSA 3IKKA 1EAJA 4CADB 1KCSH 3NMEA 5LWYH 4AT6A 2DWEA 2DI8A 4TRPL 5C0GB 4G8GE 3DSNA 1HQRB 1D5ZA 2BVQA 2CLVA 2J2ZA 3LHPL 4JJ5B 3PABA 3G5ZA 3VRJB 3TF7C 4KROC 4M7LL 2O61A 1LE5A 2JJSA 5CIPH 4OGXH 5BS0D 3U0WH 1MFNA 4DK3A 1N5AA 1FGVL 3WNOA 5EC2B 3QIWD 1Y6MR 2JIXD 2H2PD 2BOCA 4C55A 1Q1JL 4DEPC 4H20H 5DJZA 3GMOB 3NH7H 4F15B 5MENB 1WCBA 5BVJB 2X89A 5ESAA 2CDFB 4PGCA 5C6TH 1G9NC 4G8IB 3LSOA 3CX5J 3JZ7A 2AEPH 3HNVH 4NT6A 4ZXBB 3QCTL 1UM5L 1U93A 3WLWC 1K3ZA 2VLJB 2QJDA 4GSDH 2YA0A 3EYUH 1I8KB 5KVFL 3BO8B 4L3EA 4L9LA 4YQXH 1AGEB 3H9HA 1WISA 4RGND 4P2QE 2VXTL 3UDWA 4HV8B 5DJAA 4MJIE 1A22B 3KJ6H 3MA9L 2EDXA 1MRCL 5IGXH 4GRLA 2QADC 5CZKA 3I3BA 4U1JB 5D7LB 3TC9A 4PJEF 2EDHA 3JUYA 5EU6A 1KELH 4Y4FA 4HLZH 4FG6C 2YPLB 3CMGA 1ZHBB 5I1HL 1P7QA 1G7IB 5JW5B 4LGPB 1AKJB 4I2XA 3DHMA 2XA8H 3ULVH 5JHLH 2NY6D 2R15A 3RZCA 5DI8B 1F4HA 1U2CA 1ZANL 2JK5B 3ECBB 5DD1H 4XCNB 4OGAC 4PP2B 4B0MM 1XR8A 2EYTA 1OAXH 1LP9E 5FOJA 4DZBB 2ITDA 3T3PE 1T22A 4G8GA 5FDWA 1HSAA 1YUHB 3QBTB 1SJVA 1CBVL 5KW9H 5KZCB 4YPGA 2Z93B 1I7TB 4KUZL 3IKCA 4YHPB 5IMOB 4KU1A 2ZUQB 1BZ7A 4PBVC 4Z5RB 4Z7VE 4AT6B 2DWEB 5DSCA 2OJZL 3BP5A 4N8CH 2R1WA 4YHMH 2LTQB 5I76A 1UG9A 5FYJE 1DANT 4GRMA 4CBPA 1D5ZB 3IU3A 4WI2A 3HA0A 1BFOA 2K1MA 2R0ZL 3G5ZB 3PABB 4ZUVB 3H9YA 5E03A 3VGDA 4OB5H 1BMGA 3MUJA 5EZOH 1QSFB 1WF5A 3TBTA 1FIEA 5FYJU 3TBSA 2O61B 2WQ8A 4QNPE 1LE5B 4P4KB 7CGTA 1N5AB 5EUKB 2JJTA 4WW2F 1Z5LA 1FZOA 3OKMA 4UT9H 5K9QI 2HKFL 4XMPL 2FEDC 2HFGH 3F58L 4WFHD 1ZLSH 3GB7A 2VOTA 2VRAA 2BOCB 3IS0X 2QHLA 5J1TC 4X5WA 4K94L 5E5MA 1N0LA 5D1QB 1WCBB 5DUML 3K4DA 1A8JH 3QWOA 4OFVA 3TH3T 1A1MA 5F7EH 3CH8A 1INDH 2VO5A 2VXSL 1EO8H 5DK3A 3BQUC 4JM2F 3SJVD 5I9QC 3LSOB 1JTPA 3IGAB 3UXFA 1JPSL 1PY9A 4PJAE 1DQJA 4NT6B 3LD8B 4P2QA 1ORQB 4ZAKA 5TDOA 4I5BA 1U93B 1VESA 2QLVB 4MJIA 4PB9L 3B9DA 2AGJH 5T3XE 1QLFA 2IPKB 4KKBD 5IEKB 4PY7B 3BX7C 2PXYB 3H9HB 1HDMA 4ZTPL 4JY4A 1S78D 2APTA 3F7VB 3LPWA 1T1YA 4GRLB 2VDKH 3WO4B 3ARSA 1X9QA 2BVTA 3EOYG 5EU6B 2EIDA 1JWSA 3V6FB 4Y4FB 1Q9KA 1H3VA 1P7QB 4RQQA 4S1DC 4GXVL 1OVZA 2CKBL 4O4YL 1MFDL 3TGXA 3FL7A 5D5ME 3QO1A 1UCBL 1D5XB 4I2XB 1LP9A 2R4RL 1VFAA 5E00A 3RZCB 1A7OL 2FGWL 1D5MA 3UAJC 3EYOB 4JDTH 3VI3F 1OARL 3QEUA 1DVFA 5HYSA 3RY4A 4UOJA 1GGBL 2ITDB 3RVTD 4Z7VA 1EHLL 5EPMA 2VXUH 5D2LE 1KXQE 1CGSH 4G8GB 2G2RA 4YHIA 3DO3A 1CDCA 1HSAB 5FDWB 3G5YB 1MAMH 4YPGB 4D9RD 1N59B 1NDGB 4LSTL 3RWJA 2HT2C 1E4WL 4LCCB 3RHWK 1DQML 5DSCB 3BP5B 1UM4H 2DQCH 2R1WB 3EHBD 3QNXA 3E6FB 4UAOB 3UTZA 4GRMB 1IM9B 4HAFA 3IFOB 3IU3B 1BFOB 2EKSA 3VWJD 2V6HA 1OD9A 4XNYL 5TE4L 4O2EA 1OSZB 2IF7A 3TBSB 4HLJA 1HYRC 1MHEA 4JG1L 1Z5LB 4KRPB 2BCKB 2XWTB 4M3JA 2EDTA 1R24A 3C08H 3GSNA 1XMWA 1L0YA 3GB7B 3KPLA 4RDQG 3LV3A 3QPQC 5E5MB 1CGUA 5T5FL 4WTXA 1M7XA 5FYJH 5CJXA 5C0CE 5A43C 4PJAA 4UDTB 1A1MB 2V5MA 3C2AH 3KYMA 3S96A 4BJLA 2I60L 4APQD 5D7KD 4QXWA 3T8XA 4QY8B 2BJML 3BKCL 4JHWL 1I3GH 3BPOC 3FQNA 5CCKL 1A9EA 1DQJB 5GS0H 3GEWB 4NWUL 3VMOA 4ZAKB 5TDOB 4I5BB 3CUPB 4OM0L 3U1SL 1MCHA 1OF2B 1F4WL 3NIGF 2FIKA 2G5BA 5BVPL 1QLRA 5C92A 1DBBL 4ZOBA 3NFSH 5C0RL 1QLFB 2NNAB 1YC8A 4HPOH 1YYLL 3FO0L 1QD0A 1ODAA 3KYKH 1FPTL 3KPRB 3MRDB 3N1PC 1WBXB 1T1YB 3GSNH 2YWZA 4G8FA 3IJYA 2ZUXA 4ZPTA 5D5MA 5D4QA 1JWSB 1TLKA 2WNGA 1Q9KB 3ULVF 5LBSH 4RQQB 3MROB 5I73B 2Z35A 1NCUA 5FGCB 2C3VB 2NY1C 3QO1B 1A4JA 5HVHC 1VFAB 5D2LA 4FXLA 2UYLB 3U48A 5I1CL 3ARTA 3SGJA 4MZ2A 1U8QA 3QEUB 6CGTA 1RJLA 3J8F7 5E6ZA 5HYSB 4MNHA 3WJLA 5ILTH 4GAYA 5A3ID 5HXMA 4F7CB 4YHIB 4NQEB 1DQTA 1QKZH 4MMXC 3BSZL 3P2TA 4QCIA 1JUFB 2GTWA 5ALBH 3RWJB 3V79C 1F3RB 1YDPB 1T21A 4K3EH 3T08A 3AS0A 5D1ZD 2ZNWA 3UTZB 1NGQL 2FZ3B 1KLGB 5DHVB 3CH1A 2HJLB 1P7KA 4W81A 1X5KA 4XCFL 1KTLA 4O2EB 4Q9BA 3FRUB 3X3FL 1BJ8A 1SHMA 2HVKA 3O2WL 4LQFL 2OMBA 1MHEB 2VUYA 2DQHH 3HNTH 1GYAA 1MCWW 3S8WA 4JM4H 4YUEH 3W9DA 5C0CA 4OD3L 3I50L 2QV2A 4PRPB 1MVUA 1FLRL 3KPLB 1EXUA 3LV3B 1IGIH 3O8XC 4G6AC 1X5JA 3DV4A 1DDHA 3GSVA 5FYLE 4YX2L 3VRLE 4X5LA 3GMNA 4YDJA 3KYMB 3S96B 1CXIA 3V4VL 1N7MH 2GT9A 5GS1A 5E8EA 3HCVA 1SJHB 2YR3A 3FQNB 4NQCB 2W9DL 3MZTA 2IJ0C 1A9EB 5TFSL 4GG6E 5DO2D 1G9MC 4OLVL 1MJ8L 3NCBB 4OCMC 3N06B 3QPXL 4H26B 2AI0L 4F57L 4P2OC 4HJGA 3AREA 2FIKB 2G5BB 3C60A 4G9FE 4Y8DC 1D6EA 3HNSL 3OG4B 1FG2A 2L0DA 4K3HA 1YEJH 2IPTL 1GZQB 3PQYB 5DFVD 3HR6A 1JMZA 3OJDA 3ZDYF 4G8FB 3TBVA 5D5MB 3LN9A 4WU5A 4ODVL 3NA9L 1X7QB 3D85A 4POYA 5J0BA 3VGAC 3LKQB 2ZOLA 4DKEL 1HCFX 3R1GL 3CSYA 3P11L 1GGYA 3IF1A 1Q0YH 2FEEI 4EEEA 1A4JB 1AI1L 1DN0A 2Y6SD 5D2LB 3WDJA 2ITCA 1P84K 1FC2D 5KTEL 2F58H 3LKRA 4F9PC 2IBZY 2NW3B 1RJLB 2CRMA 1RJCA 4GAYB 3PV6A 4ZOEA 4OCWH 3HC3H 3QQ4B 3OAYK 3ESVF 4RSVA 5E8DH 5DURD 3DURA 1HIML 3WFCL 4EXPX 2GTWB 4M00A 1T21B 1T7VA 4XP6H 1QHPA 2V5TA 5FIEA 3IAQA 2AJXL 4OZ4A 3UTTB 2Q20A 1LP9F 1P7KB 3B9VA 3T3PF 1QFPA 4MAUL 1C12B 1KTLB 3MOAH 4FHBD 2E7CA 2HVKB 1PY4A 1NFIB 5FUOL 1NC2B 5KSAD 2CXGA 1R3JA 3U9UA 2XIDA 1II4E 4WWKC 3QZWG 1RURH 1MVUB 5C0AE 3GI9L 1MFAL 4M5ZH 2R9HD 1E6OH 4NJ9L 3DV4B 3GUTA 1GGIH 3WFEL 4Q0XL 3T3ME 2WMPA 1CF8L 2QQNL 3FONA 1J1OL 4QNPF 1BAFH 2P8MA 4GG6A 3GMNB 3WLBB 4YDJB 3UJTL 1A1NA 1BIHA 5CLTA 4R26L 2QQKH 3FFCD 2VZ3A 1RFDH 1SEQH 5TDPB 3UJIH 2GT9B 4PDCE 1CVRA 2ARWA 3OJVC 3RA7H 4G9FA 4LSVL 3W0WE 3MBXH 1DLHB 1JPGA 1KIRB 1ZWIB 4YE4H 1RMFL 1U8KA 2BERA 1A6WL 2QR0B 1H15A 1NJ9A 5H2BA 1E4JA 1KEMH 5HJ3B 3V7AG 2LAAA 3C60B 4WRLA 5I30L 5I8CA 5ITBH 5FYLH 1PDKA 1FG2B 2EE6A 4PJ8D 1LILA 4GAFB 4MNQB 3PWPD 1RK1A 3CK0L 4PJ5B 2ZJSH 4ZODA 3C6SB 4XVUC 2E6JA 4WU5B 4TSCL 1JGVH 1MFBL 2PTUA 3RDTA 3D85B 1D5IL 1I3VA 2ZOLB 4LSUL 4EOWH 3CSYB 3IF1B 1FNEB 4DQOL 4B5EA 5HHOD 1DN0B 2FRGP 2C9AA 4EVNA 1JRHI 2X4SB 3S5LA 4F58L 4HDIA 4K7FA 3QRFM 1HYSC 1YEKL 2VDML 1QSED 4YHOL 1B2WH 1MWAL 1V8HA 3PV6B 3DYPA 3DX7A 2G5RA 3V6OE 3QIBC 4WI5A 4ZSOE 5KANG 2F5AH 1N0XL 3DURB 5D5MF 1YN7A 1GHFH 3BVNA 2I9LA 4OF7A 1PD6A 4QRPE 4NOFA 1ROWA 2B4CC 3TVMD 1IC7H 5D2LF 2E6QA 1T0NA 5E8PA 2ADJA 1CD8A 2OJEB 4O51B 1G9NL 3PHOA 4OD1H 5C0AA 4XCEA 4NQTA 2CUIA 4CW1A 1DANU 1R3JB 4EUPG 2Y06H 4MJ5B 4JO4H 2VTFA 5DMKA 4MJ4A 1DSFL 5JDJA 2AJSH 3RAJL 2NY5C 3BRGC 5D1XD 3ZE2E 5D7IE 1OP3K 3GUTB 4R6UA 2MHAA 3CZJA 2HT4C 2P8MB 3W0WA 1A1NB 4HGMA 3ULSA 1DTUA 4JVPA 3B9EA 2M8XA 4G59A 3MFFA 3QRGL 1UKQA 2A1WL 1FV1B 4JB9L 5FV2A 1QLEL 4LHUA 4XNZC 3O0RH 1JPGB 1NLBL 1CK0H 1OAZL 2GJZA 4WFFD 4OZIE 4KZDH 2IPUK 1IT9H 1U8KB 5H2BB 1H15B 5KVDL 1UWXH 5C0BD 1MQKH 2IQAA 3G6DL 1B0RB 5GGTL 3WS3B 2ESVE 5I8CB 5M94B 2P5WE 3QFDB 5D71L 5F96H 1BJ1H 1U58A 1XGRA 1U8HB 12E8L 3PF2A 1YMME 4UTBL 1N8ZA 2V2TB 3ALXA 3TV3L 2X10A 4OAWA 1G7PA 4OD2B 3HC4L 1IAOA 5TQ2L 4Z77A 1Q0XL 4MXQD 4LKXB 4PGDA 3SE9L 3QUMB 3V6OA 4EVNB 3CXDH 4FNLL 1ZK9A 4ZSOA 5L7XH 2HRPH 4OBRA 1CXEA 3S5LB 4ONHA 4TTDC 1IQWH 4I18A 1A3RL 1CN4A 3LS4L 3TJEL 4W68A 3G04A 2IAMC 3DX7B 3ZLQC 4YK4C 3WIIL 4QRPA 5EOCH 1I9RL 2W0PA 1YN7B 1AXTH 3ARGB 1KEGH 3BVNB 3ARBB 4IOSD 3O2DL 1IEBA 4ZUTA 5FM5M 4PTTA 5JHDD 2EE2A 1V3LA 4OLYL 5FUCE 1JPFA 1Z3GH 4M3KB 3PL6D 2P8PA 4JFED 3EO0A 3K2MC 3VGFA 5E8PB 2ADJB 3MJ6A 3B9KC 2BHZA 2AAVA 4XCEB 3LQAH 4CW1B 5D7IA 1F6FB 4FN0A 1XR9A 2DBJA 1C7SA 1IC4H 4R2GC 3KYAA 3DGGA 2BHYA 4FXKB 4XGZA 2EEAA 5ETUA 1NCCL 5F7WC 1ZEAL 4MQ7B 4DWHA 1QYGH 5BMFH 2AKRA 3Q3GB 5KN5A 3V0WH 4GMSL 2MHAB 4OCYH 1NMBL 3BDYH 1YEEL 3TFKC 1LEGA 3W0WB 4F3FA 1NCWH 3ULSB 2Q6WA 4BZYA 4ZD3H 4OZIA 4AG4H 1J8KA 4MDJB 5IR1A 3UTSD 2ESVA 2CRZA 3BZ4B 3IJHA 4G43A 2D4FA 4YLQT 4G6FB 3VXNA 1KTDA 1RUKL 2IQAB 2ZUWA 3TPUE 3OMZA 4ODSL 4XAWH 3QCVH 2JB6A 1U58B 3CAFA 2LAGB 5EO9A 3ZTJG 3IDYC 4QKXB 5KVGH 1N8ZB 3ZYOA 2ZKHH 5CWSB 1B88A 4X9HA 2FCBA 1KJ2L 1E4KC 5F9OL 2WIMA 1RVFH 3VA6A 3GIVB 3IDMB 1IAOB 4Z77B 4WY7H 1NGWB 5T1KA 2NX5E 4JKPH 4O02H 5GISL 4PGDB 3T0EC 1BGXL 4ZSOB 4GMTL 4KJYA 3JVGC 4NBZB 4ONHB 3WKML 4NO5A 4I18B 1IGJA 3V5KB 1NFDE 2B0SH 3C09B 5GGVY 1H8SA 5ERWA 3T77A 5IB1A 3G04B 1QBML 4H0HB 2J7LA 4K71B 4FABH 1CFQA 4QRPB 5HHNA 2C1PB 5I19H 3RWCA 2F19L 3BE1L 3T0DA 3X14A 1RIVL 4Z95H 3EYSL 4UILH 5E2TL 1IEBB 2BDNL 3QNZA 5DUPH 4ZUTB 5HI4C 2E9WA 1JPFB 5IHUH 3HAEG 3BKYH 3OB0H 4FZEL 4GOSA 3RTQB 2XRAL 4UIMA 1JNNH 2GAZA 4OIIH 4OM1H 5FGRA 2J5LB 3D18A 1D3CA 2HAZA 1X5XA 3D48R 5T1LA 4QGTA 2AJ3B 2CGRL 1TITA 4DTGH 3OB8A 5F7KC 1F5WA 3QAZC 4CDHA 2YPKA 3DTXA 5JXAL 4R7NA 3U36A 3N85H 3DYOA 3DGGB 4XRCA 2XZQL 5L2KE 3BWAB 4UB0H 1OAKL 4XGZB 3U0TA 5DJ8A 2OQJA 4P9HH 4PLJC 5L8LB 3DI2B 3RWGA 4GS7C 3WDIA 1LEIB 4HULB 1NL0H 2AKRB 2NY3B 2XWBB 5KN5B 1LEGB 3B5TA 4LCWD 4F3FB 3MNWB 3P4MB 4U1GC 1HKFA 4OZIB 5EO1B 3AY4C 3KPMB 1CIUA 3SO3C 2PYEE 5EA0L 5IR1B 1S7VA 4OGYH 2FATH 1CE1L 3TPUA 3L5XH 1REIA 5AAWA 4MMZC 4WJ5A 3VRIA 2A38A 3IJHB 3T3MF 4XBPB 1MJ7L 3QDGE 1SJEA 5ADOL 3FZUD 4N0RA 4KUCD 1KTDB 1NMCC 4XCCH 3D39E 2Y07L 5TH2A 1KLUA 2JB6B 1KT2B 2HWZH 4F8QA 4XMLH 2HN7B 5EO9B 3GGWA 3VGHA 4RWYL 1K8DB 2D0FA 2F8VA 2NX5A 3E2HC 3I6LD 2PUQT 1M05A 4NQVA 4I77L 1I1FA 2ORBH 2NY2B 5E24E 1QBLL 4LSPL 4NQSA 4KQ4H 1NFDA 2DM4A 1A4KA 3ES6A 4L8SC 4TUJA 1WQVT 4P59H 1HHHA 2APVA 4KJYB 2X4RB 3EDEA 3BKML 1IGJB 5C0FA 5ERWB 3T77B 5IB1B 1PYWB 1TETH 1E28A 1CFQB 5HHNB 3PP4H 3TJHD 2B5IC 4YBLB 3VW3H 3W82A 2IGFH 1I3UA 3U4BL 1OLLA 4QLRA 3C6LD 4OLWL 1PG7W 4K3JH 3QNZB 4YC2C 2ED9A 4G6JL 3RL2B 5I1IL 4NUGH 1UWEL 2HFEB 1XGYL 3QDHA 5IV2A 1KGCE 4W4OA 2F5BH 4LAQH 4KTEH 2GAZB 3MJ8A 4D94A 3R8QA 4Y19D 4TSAH 4PD4J 2PF6A 1F3DJ 5L2KA 2Y7QA 3BUTA 3KJ4C 1U2HA 2QQLL 1WLHA 1ACYL 2MMXA 4H8WH 5GS2D 5T1LB 3FQRB 1ZAGA 1G9ML 2DLTA 2YPKB 2ZPKH 1CDYA 3MYZA 3U36B 1HINL 5K9KA 3PV7A 3QEHA 3U0TB 5HGBA 1OW0C 5DJ8B 3BGAA 4M6NH 3RWGB 5T3ZD 1JPTH 1T7YA 5K9OA 2V9TA 5D96B 2HTLC 2PYEA 3HZYA 3V52H 4IEFB 4PJ7B 3VXTA 4XC1L 4QXGH 1SBBA 2C26A 3QDAA 5D6DA 1HSBB 4O5LL 4OI9A 1LK2A 3CVIH 3QDGA 2Q3AA 4LCYA 4JG0L 1KCGC 4U7MA 3ZE2F 3ULUF 3JBG7 3D39A 4DAGL 5BRZB 1ED3A 3LZFH 3O3AA 1SM3H 4WJ5B 2EECA 4G3YH 1SJEB 1TQBB 4ZUWB 5IVXE 1X3DA 3RVXD 4U6XB 5IESL 4TULL 4MWFA 5TH2B 3BDBA 4NKDA 1J0IA 1IZKA 3MRRA 2P24A 2J6EA 1VSCA 4MA3B 4LLMA 3S6CA 4MJ6A 4Y2DD 2FD6L 3UTQA 4OZIF 3BP4B 4XB8A 3MJGX 1M05B 3H7LA 3LPGA 4NQSB 2QSTA 1NFDB 3GRWL 5FEBA 2YEZA 1WIPA 1A4KB 3ES6B 3VWKA 1IFHH 4A6YL 3DVFA 5EBMB 4LCIL 4POUB 2D7TH 3EZ8A 3I6KA 1FYTE 2VDPH 1CDUA 1QFOA 2YZ8A 4PRHD 3DX9A 3IDJA 1E28B 1D9KC 2WLYA 2PW2A 3MLWH 4UINL 5IFHH 4KK9D 2NTFA 1EVUA 1BREA 1ZANH 4OIAA 1V3JA 4LDLB 4RRPA 3OKLA 4HX1B 2BNQD 1CDGA 3D3VE 2J6EH 4RFOL 5DVMA 3WJJC 3G5XA 5IV2B 3NAAH 3VFGL 5ICXA 1QR1A 3OL2A 4KJPC 1Z2KA 2WBJD 4P46C 5L2KB 4LPTA 3NPSB 4JHAH 4KDWA 2Y7QB 4IRJA 5TF1H 4K8RD 2VH5H 5F1KC 4EKXA 1G7HB 2R0ZH 4QF1A 5IWLA 1EDQA 3T2OA 4NO0D 3TO4A 1MAJA 4LFHD 1F58L 3UC0H 3QEHB 1AIFA 4ONOA 4XPFL 1S9YA 4GRWE 1T83A 5HGBB 1JF5A 3SDAA 3QEQE 2I9TA 3V7AE 3LEYH 1AGCB 5K9OB 4YDVA 4R96B 2PYEB 3HZYB 3GIZL 5D2NE 4M8QA 3VXTB 3MLRL 3VE0B 3U7YL 2WV3A 3ILPA 4P3CH 4WEMB 1LK2B 2CIIB 1XIWD 1VB9A 4HJ0C 4M93C 3HC0B 4LCYB 1GC1C 5IVXA 5B21A 5AEAA 4DGVL 4KMQA 2VXQL 1TMCB 4XP4L 1NMAH 4MVBA 4WCYL 2A2QT 1ED3B 3TN0D 3O3AB 4OCRL 5IT2L 4ZS6C 5DZNA 3S35H 3MREA 3BH9A 5IFJA 4GLRH 1L0QA 1WWAX 1ZA3B 4MWFB 4TUKH 3S37H 3QUZD 2F54E 3NTCL 1WC7B 1QPXA 5LQBH 2P24B 1P7HL 3OR7B 4HG4J 4NNXA 4MJ6B 1CZ8L 1INQA 4KAQL 3IFNH