4ZUSA

Crystal structure of equine mhc i(eqca-n*00602) in complexed with equine infectious anaemia virus (eiav) derived peptide rev-qw11
Total Genus 71
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
71
sequence length
274
structure length
274
Chain Sequence
GSHSMRYFYTAVSRPGRGEPRFIAVGYVDDTQFVRFDSDAASPRMEPRAPWVEQEGPEYWERETRNMKEATQNFRVGLNTLHGYYNQSEAGSHTLQRMYGCDVGPDGRLLRGYRQDAYDGADYIALNEDLRSWTAADAAAQITRRKREEAGEAEQCRNYLEGTCVEWLLRYLENGNETLQRADAPKTHVTHHPISDHEVTLRCWALGFYPEEISLSWQRDGEDVTQDTEFVETRPAGDRTFQKWAAVVVPSGEEQRYTCHVQHEGLAEPVTLRW
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural Illumination of Equine MHC Class I Molecules Highlights Unconventional Epitope Presentation Manner That Is Evolved in Equine Leukocyte Antigen Alleles
pubmed doi rcsb
source organism Equus caballus
molecule tags Immune system
molecule keywords Classical MHC class I antigen
total genus 71
structure length 274
sequence length 274
ec nomenclature
pdb deposition date 2015-05-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00129 MHC_I Class I Histocompatibility antigen, domains alpha 1 and 2
A PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4zusA02
3.30.500.10 Alpha Beta 2-Layer Sandwich Murine Class I Major Histocompatibility Complex, H2-DB; Chain A, domain 1 MHC class I-like antigen recognition-like 4zusA01
4Z7OE 1NUNB 5EA0H 3RKPA 4YPGB 2WBWB 3CVHB 3NOIA 1HYSC 4FXGB 3IDMA 2AEQL 1S7WB 1DQDH 4RZCB 4OF0A 4NPYB 3QULA 4ETQB 1FN4A 4NCC2 4JJ5B 5DMYA 5BOZG 3KLAA 1LK3H 4L3ED 4J6RH 1RJLA 3B9EA 2X4SB 1IAIM 3N1MC 1VACB 3X13B 4YH6A 2WBJD 2NY0B 5DD0L 2E9IA 4U1LA 2EYRB 2J88H 3DO7A 2R0WH 2VLJD 3QUMB 1T2QL 1CTOA 1KELL 2UY7A 1MCPL 4PJCB 4RGOH 1I1RA 4DGYL 1Q9LB 1EH9A 2VH5H 1SMAA 2XKNB 5IMKB 1I1CA 4GW1B 4G6AD 1HSAB 2FECI 2EO9A 5EORL 4OCXH 5IVOA 5M7QA 1F3DH 5HGBA 2YD5A 4XNZC 3KPOA 1QSEA 3DI3B 4LL9A 3U4BL 3TYFA 5GHWH 5HDQH 4BFIA 2D03H 5FO8A 2XG4A 3OJDA 4I0PA 1B0RA 4PV9B 4DKAA 5GRUH 3WD5H 1BPVA 4JGMA 2R69L 3RBSA 3GUTA 2D3VA 4NDMA 5CEZE 3IXAA 4NZRH 3LRSA 1MJUL 3LIZH 2XWBB 2BJML 4L3EA 4M1DH 3CDGB 4ZUWB 4DAGL 5C0FA 1ZLSL 1PEZA 3FQXB 3S4SB 5JW5A 3OJDB 2NY2B 3HNTH 1EXUB 3LS4H 4ZUUA 4ZO9A 5EZOL 5T3ZD 4FFVD 4RMQA 4CVWA 4PYGA 1NBVH 3H9SD 3P11L 1IFHL 4NSKB 5C0GB 3V0VB 3GMQB 2JJSC 4YLQT 4DGVL 1VA9A 1JTTA 2XA3A 2V2XB 1Q9LA 3VCLA 2A77H 5IW1B 4KJYA 4QRSB 1GGIH 4R0LC 4WW2C 4Z8FH 4G6FB 5D7JD 1R6VA 7FABH 4CU6A 4F37F 2BOCA 5FGSA 4KPHH 3P4MA 2F58L 3EJYD 5CEZH 3I3BA 4PJDE 5GGVY 4H26B 4HIXL 1YQ2A 2PXYC 4O2EB 5DVOA 4YC2B 2NZIA 2Y23A 4GG6B 3O4OC 4GKNA 3OKNB 2XWTA 1F6LL 2XZQH 7CGTA 2AI0H 4GQ9H 2F74B 4ODTH 5DJYA 2EO1A 3IYLW 2UVFA 2OMNA 3MMEB 3LDBC 5BV7H 3SDAD 3SCMC 4JVWA 3MACH 5I18H 4OT1L 2DM4A 2NR6C 3TBTA 1B0GB 1F3JB 1SBBA 3TC9A 1KCVH 4HWBH 8FABA 5D8JL 3UJJH 1QKZL 3OG4B 5C08B 3X13A 4HWEH 3QXUA 2Z31D 2VDMH 1U8PB 3PP4L 5C7XH 2D03L 1KYOJ 5F8RC 4XPHH 1FL5A 5EG6C 2DQIL 2BVEA 4JO2L 2WP3O 1C7TA 5AZ2L 4F80A 1A6UL 4U1IA 1TQBB 4KMTH 3ULSB 4OM0L 5DD1L 4P9MH 3VWKA 3KYMB 2QSTA 2D4FA 2B2XH 3EUUA 2H8PA 4J3XA 4QYOB 3C9NB 1PBYA 1SJVA 3BH9A 3QUZD 5EOTB 3GMQA 5BRZB 1OTSD 4GMTL 2NX5A 3PGFL 1MWAA 4TYUA 1A2YA 2UWEF 4JO1L 3KLHD 4OJFH 4ENED 5ITFB 5D2LF 1VFBA 2XZAL 1YDPA 1NSNH 3KJ4B 3VD5A 1W2KT 1OSPH 4PJDA 2VXSL 3UJTH 4GOSA 4UUJA 1DBBH 12E8L 5A2FA 4NQSA 4NWTH 4OZFA 3ARTA 1BQLL 5DURB 2PO6A 3O4LE 4DEPC 5JMOC 3Q1SL 1U8IB 2B1HH 3ZL4H 2H2SC 5E2TH 3SO3B 1FNSL 3BZDA 5D96C 4LHJB 1JWSB 1BEYH 1NMCB 2PO6B 3GKWH 4X7TA 2WLZA 3LHPL 3TBSB 1I8MA 3D0LA 5D1QC 5HHNB 3IJHB 5E2VH 4JQVA 1CLZL 1YMMB 3ZKMC 4XAKE 3RGVA 4ERSL 3DOSA 2X41A 2Q8BL 1GAFH 5A16A 3RQ3A 4KK8C 1TZIB 2IANA 4NKDB 3SDDA 2GSGA 5JIKA 2H8PB 3GBLA 1NMAH 5F88A 3U0WH 2QKIA 4BUGA 2VDLL 4LSPL 4JPWH 1G6VK 1MWAB 1OAXH 5DMIH 4LEXH 3FHAA 1QZ1A 1JPFA 1UT9A 2MFNA 4F7MB 4JN2B 1A3LL 5F3BA 5LQBL 4YK4C 2NNAB 4BZ2H 3Q5OA 3MLSH 1TTUA 4A6YL 4ZXBA 5DJCB 5HHME 2MSPA 3LB6D 2DWEB 5DHXB 4IMKA 2E5EA 5HI3C 1EFXA 4F7PA 3MV9D 1QEWA 3QUZC 4F7MA 4Q2ZB 2X6MA 3HB3D 3EO1B 5DWUL 1CXFA 3CFKA 4NQEB 3MRDA 4JRYA 5GJTL 3VGGA 3BRDA 3QXTA 3TH4T 4M3JA 5EU5B 1YN7B 2G60L 3K81A 1UYWL 1OPGL 5DRNB 1QYGH 1OP5H 4KTEH 4CN4A 4GRWE 1NUGA 5FIEA 1P53A 4Y2OA 4XBPB 1CZ8L 5GGUB 3VFNA 1A47A 4MCYA 3TZVB 4JREB 4Z7WE 2H3NA 4M9OA 4X80L 1WSST 3T8XB 3EYVB 3EYOA 4ODBD 2MQ0A 2W9DL 4J3UA 5D5MA 5E1AB 3HFML 4HKXB 1MH5A 4NHCL 3WN5B 4GMSH 3AREC 3F58L 4PRIB 3MLYH 1K6QL 1RZJH 3MRQA 2AV1B 3VWJA 2QLVB 3GIZL 2YRZA 2CRMA 4J12A 4IRJD 4LPVA 1AQDB 1EEYB 2IALA 4J2XA 3U46A 3Q6FB 4LSRH 4F57L 3KYOB 3HZYB 4OZ4B 1NANH 5MP6L 4AH2B 1QFUH 2H32H 5GGSB 5IMOB 5ITBH 1FFRA 1TZGL 4P5TB 5FYJL 1OY3B 4H20L 1G7QA 3T0VA 3LPWA 3L3OB 2OTWB 3JV6A 5HHMA 5E08H 4MS8D 4AG4H 3OKLB 5IMMA 3ZDXF 4M1CD 4XPBH 5HHOD 4KU1A 5B21A 1E4XH 3DV4A 3QG6A 4NQDD 3Q3GA 1MAJA 5I76A 1G7QB 5HI4D 4G42A 3VFTA 1S5HB 4U0RC 3TA3D 4OI8A 1MRDH 2FJGB 4HG4K 2R1WA 3QXDB 4R4ND 4RFNB 3HI1B 1NDMB 5BQ7A 3FQNB 4ZTOH 3MNVA 3QULB 2W07A 1JCKA 2CD0A 2RAMA 1N4XH 5EBMB 5T1DH 4WUUD 2EZ0C 5MEPB 1VGEL 2VN7A 1N3NB 4ZFZB 32C2B 4MNHA 2CLZA 3CZFB 4HFUL 3O2DA 4WW1A 3U7YL 4F8TA 4GRLA 3V7AG 5HVFB 5E2WL 4PDCE 1D5ZA 5D5MB 2CIKB 4POZC 5DRXB 4MWFB 1KB9K 1F3DJ 5IB2B 2XPGA 5BS0B 3A0OA 4OIAA 1XCQA 3BDYL 4DFHA 3C6SA 5I0ZA 3TPUE 4EI6B 1RSFA 3MZTA 4MA7H 2NYYD 1EDQA 1FRGH 1WWCA 2W65B 4KUCD 4NPYA 4QWWD 4L3AA 5B38A 1D5IL 5MHSD 2HTLD 4MQ7B 5CILH 4BQ6A 1J88A 3INUH 3QO1B 1IEAB 4NCDA 4EI6A 1KC5L 1U8HB 4ELMB 3QUKA 1IM9D 4NNYB 1FVCA 2Y1VA 1NMAL 2RGSA 4O2FA 5F7LB 5J4MA 4NKMB 1A7RL 5C92A 4ZPVB 1XF3A 2VLJB 2G5RA 3FQWA 3NCJH 3O3EB 2UZIL 4PJHB 2YOCA 1C16B 1NL0H 4ESKA 5KBNC 4JG0H 4UQ3A 4FQJH 4GKSA 1N64H 2FR4B 1XGPB 4NFBA 4AENB 3B2UC 3F62A 1LQVA 2DTMH 1GJIA 3WNOA 5I8EA 3KJ4C 3AY4C 4GKSB 1LK3L 2Z91B 3QDJD 3MNVB 1B0RB 5CBEA 1V8HA 5CAYB 5A2KH 3KXFB 2EDHA 4PYHA 5FOJA 3KXFD 3GSXB 3IXTB 2Z91A 1LEGB 2FSEB 4EJ1C 4D8PB 4R3SA 4KPHL 5AZEL 5GIRA 3IDGB 5HYQA 5EOCJ 4KZDH 4KHTH 2WUCL 1VADB 4I3SH 5I1KH 4WNQA 4JB9H 3H7BA 3QXAA 4WFGD 2XV6B 3JTCA 1RAMA 5KG9B 1S7QB 1A6WH 2WWKO 2NXYD 5ILTL 1KB5H 2P8LA 2DLFL 2A0LC 3QDGA 2AJVH 3G5VB 1D6VL 2CDGA 1ORSB 3KNBB 3WFCH 5GZOC 1WCBB 3MLZL 3VXNA 2R4RL 4MA1C 3FT2B 3RVVD 1IGCH 1CLYL 5FHAL 3AS3A 4X0KB 3VFSB 3QAZB 1DQLH 1MPAL 4F3FB 4LOUC 4PJ9B 4XI5C 4U2YA 3DVFA 3U4AA 4OZHA 1U93A 1I7UA 3HI6L 5BVJA 2VABB 3EJZD 4P2RA 5JHDE 4CDGC 4X7FC 5SWZE 3LDBB 5BVPH 2I60H 3C5SB 5F96H 2HFFA 4KHXH 5JMRA 4U1NA 3NCEB 4U3CA 2KUTA 3QHTC 3AUVA 2NY3C 4G7YL 3VA2C 4K94L 2DMKA 3HE7C 1JHTB 2VNCA 1X4ZA 3EJZC 3CDFA 2XPGB 1TQCB 4Z9KB 1FZOB 1C12A 1N26A 4OLWH 5GXBB 3KPQB 5EUOA 3H9HB 1EEZA 1JRHH 3MRMA 5F1IB 3VXPA 3EIFA 1RZFH 2IPUG 4ZFGH 4JAMB 4MDJB 1L7TH 1D9KD 5GS0C 4H26A 4UZGA 2EH7H 3RVXC 1NC4B 2V5RA 5A3ID 1F13A 4U6YA 2O5ZL 1KV3A 2AXGA 3O3UN 3QDGB 3FFDA 4JE4B 2AJZB 3NVQA 4UDUB 5JXEA 2FX8L 5IQ9B 2E8ZA 4L1HA 4X7SH 3VXSA 2ZG1A 4Z0XA 1KCLA 5LJYH 4QRUB 4FZ8H 4QHLB 4S2SB 1TETH 3VGAC 1NCCH 1NAKL 3IDGA 5EU3A 1Z9MA 3SDCB 1R24B 4YE4H 3SE8L 2E7CA 5BVJB 3MO1A 4X4MA 1MCJA 1KNOA 1QUNA 5IEHB 1BAFH 3GM0A 5BJTA 1IAOB 4C83A 2HN7A 3AVEA 1NEZA 3V8OA 4KHTL 5F89B 4TVPE 1WCBA 4BZ1L 4MNGA 4GMSL 4LHQB 4PP1D 2ZCKL 3BOVA 4FFWC 5AD0B 3HAEA 1I8LC 1QFWL 4KDTA 1P84K 3DUUB 1JPTH 3RDTD 2QQKL 4QRPA 4NQCB 5F88B 1AGDB 3MLZH 4P3DA 4YXKL 4ZUSB 4D0DA 5DUBB 3GJFK 2E6QA 1E28A 3OAYH 3C6LC 1EMTH 1NLDH 5KSVA 3EYUH 1T7XA 2QHRH 1HNFA 3ARQA 1OW0A 5MENB 1E28B 4YGAB 4YEFA 2GYSA 2YPLD 5MENE 1BD2D 1FGVL 3LN5A 4M6MH 5CUSH 1F58H 5JZ7D 3DVGB 1CFTB 1D5BB 1RUQH 5TF1H 4WUKL 1JN6B 1WC7B 1OD9A 1SBSH 4JO4L 4QWWC 2DQUL 1F11A 2YN5A 3ZDYE 2AQ1A 3X14A 4UUJB 3WKML 1WFOA 4HWZB 4XTRD 2FGZA 3G04A 1FV1A 2NY5C 3S4SG 3F6LA 2CXGA 5J12B 5E8NA 3PWVA 2P48B 4BKLA 4E42B 5D7LB 5C0RH 3B3IA 3L3HA 1NFDE 5EO0A 4I0PC 5GS3A 2VZTA 4G8GA 3V5DA 3L5XH 1IM3B 2HWZH 3T0DA 1U36A 3RPKA 2GAZA 5JXAL 4FNLL 5C08A 3OKMA 5AAWA 4UT6H 5D70L 5FA4B 1MQKH 4I0PD 1T1WB 1X5GA 3BN9C 4XPFL 5EO0B 3HPJA 1HH9B 3MGOB 4OKVA 3UMTA 3WUWG 4ODUA 4K7PH 4JKLA 4JFOA 3EYQC 4FA8A 3O81A 2WUCH 5E5UB 1G7PB 1MHCA 5FAAA 5I17A 4S1SL 4QRPE 1K6QH 1RZJL 4H1LH 3GMNB 3LB6C 1MCRA 1S9WB 3S98A 5CD5C 1HHKB 1P9MC 3QH3B 3TLRA 1RUAL 4HJJL 4NJ9H 1U8NB 2QBWA 3RPIB 5KOMC 3WFCL 4JGUA 3WIIH 8FABB 2Q7YA 1WQVT 3RVTC 4PBVC 3X11B 5T1LA 1IAKA 4U1KB 3W39A 1FV1B 2B20A 3U1SL 2AW2A 3RWIB 3DVIA 1AP2B 2P5EB 5MENA 1CVRA 5ID0B 4EZMA 4P3WA 1BZ9A 1IGFH 3UPCA 4JVUA 5IVXF 3G6AB 5D7JA 1MHEB 2OR9H 3GJFB 5AEAA 3JTSB 5HHOB 2VC2L 2A6KB 5GSRB 5F7NC 2UZIH 3S7GA 4P46B 3RVVC 1S5IL 1BGXL 4HC1H 1H15A 2ADFL 2F54A 5JPNA 3ARUA 1K2DB 3DV6B 1AXSB 3V79C 2I07A 1BIIA 3OB8A 3BE1L 4G8GE 2HVJA 3QFDA 5ITFA 3QPXH 4OQTH 2JIXB 5E4IA 4NN6C 1JGEA 2GJJA 4J23A 4ORGB 3BAEH 2PTTA 3VXUB 3MXWL 3VG0L 5FGCB 5EUKB 3HAEG 1NKRA 2W9EH 4Q6IC 1U9KA 2BY0A 1NAKH 5L2JB 5D8JH 3HR5A 2X40A 3DXAD 3IKCB 3IAGC 4BH8A 4WVRA 5E9DB 1LO4L 2ZUUA 3O6FB 4F57H 4DKEL 2A2QT 1YC8A 4YDKH 1UH2A 2UY6A 1FRGL 2DKMA 3PWLA 1V3MA 4XPHL 5E1AA 3LZFL 5DT1L 2FRGP 4IIQA 4Y4KB 4CVZA 4LGRB 3C2AH 3OB0K 1NCDH 2Q8AH 1FVDB 4V3EB 5LGKA 2A74A 4WV1A 3OTTA 4GAYB 4QOKE 5DUML 3IT8D 3RUGE 4XMPL 3TT1H 4GXVH 1CXKA 3M07A 2Z31C 3ERYA 1MNUH 2HKFH 4PJEE 4ZAKA 4ZFFB 4XCFL 5GQBA 5DRNA 3S9DB 3U7AA 4JHWH 3TJHC 3FN9A 25C8H 4TSBL 4LF3B 3DHMA 4ELME 4NO5A 4YEEA 2C4XA 2EECA 1JNNH 1U3YA 5ALCH 5E5RB 4XWGL 1QO3B 4DJMA 1AGCB 1ZANL 1L7TL 3HNTL 4M4RA 1C08B 5JO5A 2EDOA 4IJ3C 1HI6B 5CJXC 2ESVA 2BY2A 4Q6IB 4Y5VA 4AK1A 4HS6A 4K3GA 1AKJA 2DQTL 3CX5J 1KPVB 5JUEL 2ZUYA 4WHCA 3VFGL 3MRKB 1WV7T 4OLEA 1XEDA 1UZ8B 1QA9A 5IM7A 3OHXA 2CK0H 2ZOKB 4YHLH 3BGFB 4HIJA 4XBGB 2IPKA 1EK3A 1RZGA 3DSFH 4KI5F 4TVPH 2ZJSH 2JCCF 3GMPB 1LDPH 3PV7A 3MRFA 3MYJA 4YBHA 5EBLB 1AO7E 3O6KH 4JKWA 1JGVL 1IM9A 2LTQB 2EDNA 1MREL 3RNQB 4XPFH 1FZMB 1MY5A 5D7IB 5FYLL 2Q3AA 5LAXA 3MLWH 2EYSB 1BWWA 1MCPH 4PJFA 4RGOL 1YEIL 4H0GA 2BSRB 3A6BL 1Y18B 4UT7H 5D96B 1FFNA 4ZUTA 3MRNB 3REWA 2V7HA 3RVUD 9CGTA 4RCAA 1JI1A 3RI5F 2PYED 5JHLL 3TT1L 2Z92A 1UB5B 5HYSB 5DEFB 3LKRA 1G7LB 3LPGA 2RR3A 3QG7L 4HK3J 2HKFL 5CBEB 4NKIL 3VFPA 1MY7A 4IOSD 5DD5H 1OL0A 4FXGA 2DKSA 1OPGH 1U8LA 3QIBA 3SGJA 3AXLB 4R6UA 4XC1L 4Q0XH 4QXGL 2ADJA 5FB8B 4GBXC 2P5WD 4D9RD 1XCQB 3EFFB 1FBIL 1NFIB 3WEXB 4YFLI 4JFHE 4OFKA 2GHWB 2V5MA 3B83A 5EU4B 1BWMA 2AK4D 4Z7VB 2H3NB 3DX7B 2XFXA 5F72S 3M8OL 4RAHA 4OD3H 4YHMH 2PXYD 1A5FL 2OXGA 3BYTA 1Z9SA 4NQDA 4XH2B 2WP3T 4ETQA 2R15A 1AO7A 1R5WB 1NC2D 4I4WA 1R3HB 4H88H 1U93B 3PWPB 1DL7L 1LWRA 1H5BA 4HIIA 3G9AB 1BQHA 3K2UL 1J8HB 4N0FB 2CGRH 5FYKH 1INEL 1G7IA 2W0FA 4PJFE 2VQ1B 5LBSL 2BOBB 3PUCA 4OZHF 5EBMA 1KPRB 1B6UA 2XN9D 1OWRM 3BHBA 1WUNT 2V9TA 4G9FA 5TE7L 1IGTA 1EJ6A 4MS8C 3S4SA 4IMKC 3T3MF 3DBXA 4HWUA 3DROA 4YC2C 3QUYD 3AREB 1E4KA 4J7RA 5DVNA 5CP3H 4WJ5B 1JTOA 5CD3A 3UPRA 1T1ZB 5CKGA 3B9KC 1IGYB 2YXMA 4WNQB 1Z6JT 2H2PC 3HI1A 2AEPH 2VLJA 4JREC 1XGTA 2K1MA 5KVFH 5DJDB 1KT2B 2J5LC 2XTLA 3VXUD 3KYKL 2QSCL 5EU3B 2FX8H 4K7FA 4AENA 4XMKH 2EE3A 5DUBA 2ZG3A 3GBML 2EEAA 1A14L 1OAKL 3RUGF 2CLVA 3HC3L 1HHJB 2YMXL 1FVEA 4NQDE 1BJ8A 3UDWA 2D7MA 3TNNB 4LVOC 1KPRA 3KPRA 4F2MB 2Y5TA 1IQDB 4HSQA 1X5KA 1X5HA 5JXAH 2J8OA 1E6OH 1BD2B 1RIHH 4MXQD 4L29B 1ZVSA 2YPVH 3WNKA 3RDTA 3CFBA 1WITA 2AQ3A 3N06B 3AAZB 3AS2A 1JHTA 5D72H 3PQYE 2AI0L 4RBPK 3PL6D 2XKNA 2WBJB 1FYTE 1T21B 2GTZA 1XR9A 4U7KA 1N8ZA 4N8CL 4Y16A 3BWAB 1GRWA 5KS9B 1C7SA 3FFDB 2IADA 3IU4L 2IPTH 1X9QA 3V95A 4DUWA 3ARPA 2CR3A 1N2RA 5FECB 3BPNC 1N8ZB 3FTGB 3HC0B 5CUSL 3QNYA 2JJWA 1VGKA 4G3YH 4FZEH 3KXFE 1PZ5B 3O3AB 3QEGH 1TJIH 2DJ4A 3LV3B 3I9GH 4U1HB 4GXUN 5CMAA 5C0DB 1A1MB 2X7LA 3UBXI 3M1BA 3TV3L 5FM8A 5ACZA 3VRJB 3WFDL 1M4KA 4I9WD 4PV8B 4R9HA 1NMBL 4TNWK 5IR1A 2H6PB 4HHAB 2FSEA 3TFKA 3CFBB 3FT4B 5IF0A 4GO6B 3OKDB 4OLYH 4AL8L 2CLVB 2HVJB 3BD3A 5IT2L 3KPRE 5D7LD 3PWPE 3ARVA 2G5BA 2K7PA 2OL3L 2YD6A 3KYNB 3PDOB 5ADOL 4HWZA 3QDHA 4NN5B 1RIUL 2BNRA 2XWBA 4ZUWA 1FFOA 5EUOE 5J9PA 5HGAB 3PP3H 3SGKC 4PRPD 5HPMA 5SWZD 5E6IA 3MJ8A 4EIGB 3MFFB 3MV7A 1INDH 4HXAH 1TDQA 2ZUTA 4ZNEE 1RU9L 4G8FA 5F7EH 4X4YA 4OCLC 3D85A 4NSKA 5F1KC 3BN3B 2Q76A 3WS6A 1ZVHA 3ZE0E 2ORBL 3IRZA 1CICC 1GAFL 3C9NA 5LG1A 1F2XK 5MEND 5ACZB 3HC4H 5DVMA 5LKNA 3W9EA 3CZJA 3OXSA 5HVGB 2XQYG 4IRSD 2FX9H 3QYCA 3EYUL 5DI8B 2CK2A 2EKSB 4K2UH 1ED3A 1EAPA 4OLZL 4M7LT 1LE9A 3DTXA 5GGRA 4FQIH 4JPWL 1ZSDA 3SPVA 3KLSA 2MKWA 1H3VA 1DBKH 5CFHA 4GRMB 1ZE3C 3FO0H 4CADA 1OTUD 4HZAA 4UV7L 3K0WA 4WDIA 1YEDB 2FBJL 4X4XB 1CN4A 5GS1B 1V5JA 2DM2A 4XP5H 2OK0H 1JWMA 1OAYL 5IIEA 4JN2A 3CFCL 5T3ZH 3KS0J 1CR9H 1UWGH 4JY6B 4HUXB 3BI9X 4Z7WB 3QUZA 1BM3L 2IAMA 1JWMB 1I7TB 5I8KL 2LVEA 3W5MA 4Y2DC 4RQQB 1NMBH 4HF5L 3RY4A 1JFQH 3CFEA 1CG9B 5DQ9A 3UCRA 3MMEA 2ENYA 2PN5A 5I73B 1NGPL 3T0EC 5KJRL 2BSSA 3N1QC 5DDHA 4NC2B 4M62L 1QACA 3GSRB 3BH8B 3O9WA 4IOFC 5IB5B 2O26U 5J06A 2W0KA 2C5DC 4LNRB 1I8MB 3RKDD 1W0WA 5IB1A 4FFWD 1BVLA 1DEEA 3D87B 3L3IA 3RDTC 1LD9A 1A1OB 5EORH 1WBYA 1KCRL 1UB6B 4JG1L 3VGFA 5C70A 4CGTA 1WTLA 5JR1H 3CX5K 3QDJB 3MA7B 3SDAA 3ZT6A 1NEZG 3IFNL 5F7KC 4QNPF 3HRZB 1QNZL 4JY5L 1PLGH 3D39D 3NA4A 4B0MM 1M1SA 1I8KB 3QQ4A 4OZIF 1BHGA 3NFSH 3SPVB 4U3XA 3BH9B 1IAIL 5BRZA 4MB3A 1YUHA 3H3BC 3LN9A 1GZPA 5B39A 2HLFC 4RRPA 1JZ4A 5KVGL 4A2LA 4NZTL 1S7UB 1EX0A 4X8JA 4MA3B 4W70A 2NY0C 3G6AA 4G6FD 5D7JB 3PXHA 1MIEL 2C3VB 1NGYA 3EYSH 3QEGL 5LAXB 1M71A 3RWGB 1KGCE 2ZZUT 1WWBX 4B5EA 3VFVB 3LKOB 2X4RA 3P0YL 1RY7B 2DQDH 4JHZA 2DMBA 4JJHA 2IFFH 4NO5B 5EFIA 1KOAA 4JM2D 4YJZL 3ZT5A 2P8PA 5FF6B 1DQQA 4LRIA 5JA9A 1KSRA 4N9GA 4NKQB 4PJ7A 3BDXA 2BHYA 2CO7B 1JWUB 1A0QH 1ZA6B 4KXZI 3HZMA 4DGIL 1YQVH 2QR0A 3I3EA 2F54E 5HBBA 3U30C 5I19H 2R0ZH 3EYOB 1D5MB 4JM4H 5DR5L 2ICWB 3RTQB 3U2SA 4N5EA 1J86A 2R4SL 3QH3A 3HNVL 2JCCA 3JWDC 1J1PL 1Q9OB 3MLWL 4NFDA 2Y07L 4HS8L 2W0FB 4P5TD 3QUZB 2ADJB 3BKYH 5BRZD 1KB9J 1H0DA 3FOMB 4S1DC 3QO1A 3TO4A 1BIHA 1MFBH 4LLYA 1Y6MR 5D7KE 2FH6A 3HZVB 1RURL 4XVSL 4URTB 3N1FC 1DN0A 3VRLE 4NQDB 3SDXE 3FOMA 2AEWA 3O4LA 3W5NA 1RIVH 3JZ7A 5E00A 5I8CA 5BCAA 4FQ1L 4X6CA 1F6AA 3DYPA 1U42A 5C09E 3O6FD 4G3YL 4PP2A 4ZODA 3FB5B 4Z7UA 2V7NB 1AH1A 4JFZL 5TE6H 1PSKH 1A6PA 3O6LL 1YEGL 4MVBA 2ERJB 5ALBL 4NM8H 4OBRA 1I8IA 2A6JA 3I2CL 3ECBB 1KEML 3UTOA 3QFJB 1HIML 4JFFE 4QOKA 1Z9LA 4XMKL 1W72L 5K33A 3MXWH 4NQED 1A14H 1JPGB 2ICWJ 3T0ED 3BESR 1F42A 2E9BA 4O58H 2VDOL 1AXSA 4EN3C 5CD3B 2GI7A 3G5YA 3KDMA 3MRNA 3OHXB 1TCRB 2EC9U 3VD3A 5FM4A 2L0DA 3MACL 3TZVD 5ISZB 2OLDA 3LN4B 5INDA 4OB5L 2HMID 1SYVB 4N1CA 3QZWB 1YECH 2XNAB 1UQSA 4M62H 1Z9OA 3MZGB 5HYQB 5KSBF 4Y2DD 5ETUB 4CW1B 1QSED 2X2YA 4LCYB 3HUJA 2O61A 1WWAX 3OAUL 2ID5A 1F45A 5ICZA 2OJEA 2F53A 2UYLA 3B9DA 2CUHA 4OFYD 1AHWA 4BA8A 5I1JL 1KN2H 3FCTB 5HYJE 1OD7A 2Q87A 4BSWB 3U0TA 3TCLB 3VRIA 5FGBA 1DZBA 3OWEA 1BFTA 1U8HA 1VENA 3CFDA 4JRXA 4M1GH 3RL2B 2IGFH 3BRFA 3DIFB 4WWKB 2J4WL 4U1HA 3HMWL 4XPGH 4FQ1H 5IB2A 4UV7H 4QRQB 4NQTA 2EYRA 1RK1A 2AXGB 2VLKB 1OARL 4RMRA 1AGFA 2FJHA 1QBLH 3IDXL 3DIFA 3O6LH 4K94C 3CFCH 4YHPB 1QSVA 2R9HD 1Y6KR 1IZJA 3MJ9L 1FZOA 1JI2A 4S10A 3V9FA 3ARGD 1AD9A 3RWDA 4ONFL 4X98B 3WO4C 4OTXH 4S1RL 3UTSA 3HG1B 2K3TA 4M5ZH 2A83A 4CRPA 1SVZA 3MV8A 4M48L 1WISA 4NYLB 3GSWB 2R1WB 3NH7L 1JRHI 1F8TH 3UAJD 5DSCA 4WI3A 4Y4FA 4M8QA 2EDBA 1JZ2A 4K3DH 4MJ5B 1LEIA 3RWJB 3JUZA 3UZVB 2VZVA 5FYKE 1DLHB 1EGJA 3FQNA 5ICXA 1WT5A 1DE4A 2W0LA 2BP3A 4NQCA 1IKNA 2DQFB 3VXNB 1RJZB 4JDTH 5GS0D 3V6ZB 3MROA 5C09B 2F53E 5DR5H 2NW2A 2YWZA 4LDEB 5D1QA 1D5IH 3GSQA 3UTZB 4GJTB 4MAYC 5HGDB 2X5PA 1DBML 4NBXB 5F89A 1VFUA 3OXSB 2FZ3A 3BKML 5HYJA 4GAJH 4U1SA 4PJAF 1A1NA 1S78D 4RGND 3MRBB 4CMMA 3BFOA 1UJ3B 3I50L 4M7KL 4MLIA 5IW3A 1GHFL 2VTFA 1BF8A 3VWJD 5AWNL 1I1AA 3QEUA 4QHLA 5SWZB 5MHSE 1U58B 3VG9B 4HJGA 4W4OC 3O8XA 4MXQA 4LDOB 1U3ZA 1FYHB 4QRRB 2O5YL 4JHWL 3UJIH 3RWJA 1JHLH 4GW5B 1OGAA 3CVIL 4U6YB 5E99H 4H1LA 2NZ9D 5C0BD 3GBMH 3KPLB 5JW3L 1ZGLB 4N1EA 4PJ8A 1IGTB 3Q5TA 1BFSA 4UOW0 3OSKA 4QF1B 1RJLB 2H41A 4PUBL 2OZ4H 4N0YL 4L8DB 4NJAL 3IFLL 3UTSB 3W9DA 4RMUA 3VI4F 2LU3A 4Y88A 3IDJA 2NY4C 4WI5A 4AQ1B 1Q0XH 1I1YB 4OTXL 3HC0A 5EWIL 4FTVE 4S11A 2ADIA 2GJ6E 2HTLC 3QI9D 5SX4H 2ZPKL 1AGFB 1A9EB 3VG9C 4Z8FL 4ZS7H 1ZLUH 1HHKA 7FABL 4WO4A 3ARXA 3H42H 4L29A 4BSJA 5D7KD 4NWTL 4XP1H 2OI9C 3F7PC 5AYUH 4FFYL 1FH5H 3V6FB 2G2RA 4QNPE 2O5XH 4B50A 3TNNA 2WV3A 5CBAB 1BQHG 3GKWL 3VXUE 4IS6B 5C0AD 2CLRA 1XF2B 1FAIH 2L4OA 3VXTB 2Y36L 5K9KA 5F96L 4G6JL 2BRRL 5LGJA 3TBWA 5T33L 3QIWC 3C8HA 4Q6YA 1CE6B 4YIQA 2EYTB 2FIKB 1MRCH 4R90L 4HIEB 2IAND 4PPTA 1ZXQA 1BREA 4E0RB 5DJYB 4LAQL 4QHUA 2AGJL 1SJEA 2VDLH 4KGJA 4NZRL 4JDVA 1P7QA 3LS5L 3T3ME 3VDCA 1NC2A 1DP0A 3U7WL 3ESVF 4PY7B 3QHZL 2NQCA 1YMMD 2YD4A 4PJCF 1T1ZA 4H1LB 2ZUQC 1EAJA 1P4LB 3DMMC 1JHKH 3OB0H 3G5VA 5B3JE 3TBVB 3KAAA 5ANMA 1L7IH 4A2MA 4ZYKA 5FFLA 4OZHE 3W0WE 3KWWB 4OFDA 1QPPA 1TXKA 4OZFG 4N9OB 4P9ML 4NKDA 3U9PH 4MQTB 1T5XA 1M7XA 5C0GA 1ZT4A 5JIIA 3GSVA 4AEEA 4LCWA 4JGJA 1FFPB 1T89C 1B9ZA 4WU7A 1T5XB 3IAPA 3RZCD 1YEHH 4Q9BA 5ESAA 2IPUK 2VDKL 3LY6A 4QRPB 4WI7A 1KCRH 2NR6D 3CMGA 1UWXH 3QIUC 4C56E 2CUIA 4TNWF 2FHFA 4L3EB 3CC5A 1YPZA 3BZ4A 2PYEA 4KFZC 2FJFA 2HG5B 3IF1B 4OFPA 2IG2H 3CVHL 4PJIA 5FA3A 3ZDZE 2BSSB 4ZFOB 3EHBD 2G5BB 5BV7L 3PXJA 3VXSE 2X9XA 3OAUH 1UVQA 2R2CA 3BPCA 2YKLH 5DT1H 3SDDD 2HT4D 4L4VD 4PGEB 4TULH 1CLZH 1PGRB 5KVEH 3NCFB 3WHE1 4Y16B 4HIEA 5E00B 1KLGB 1E4KC 1E6JH 4X4ME 4F9PA 2PETA 3L5HA 1YEIH 3EZ8A 4U1NB 5E95B 2HVKA 1NCNA 4TTDD 3IU3A 4XCCH 1OTTC 5E94A 1WBXB 1MWAL 4KMLB 1U8KB 3UTTD 4MNGE 4P4KA 4RGMB 4NM8L 1VGKB 4J3OC 2JELL 4YDIH 4XC3L 2VXTH 4F7PB 3E2HB 5IVZB 3H3PL 3L1OL 1ZA6A 3S37H 1GPOL 5ICYB 3BGMA 2A6DB 2FB4H 4PP1C 5BMFH 2C1OA 5K59E 4X6BA 1A3QA 2AXJA 4OCWL 2KQNA 5F3BB 4ODHH 5GJSH 5TGBA 2QADB 1G1YA 4J6RL 4CMHB 1INDL 4O58L 1ES0A 1KG0A 5IROC 4MDIB 3G5YB 4X6DE 2HKHL 1V7ML 3HMXA 5JDSB 4GAYA 2GFBB 1R5VB 1BX2B 4FFEX 4KKLD 4ZDHA 5GRZA 3CLFL 4QHNA 3WS3B 5TDNA 3ILPA 1BF2A 4LHUG 5DMJB 5L2KA 5CGMA 1JWUA 3LVEA 5TE4H 4WGWB 4J4PD 4RWYL 1ED3B 3LH2L 4X7TB 2B4CH 5KSAB 1KLFA 1X3DA 5MI0B 4GAGL 1XF4B 4JFXA 3HR6A 1QRND 5KSAA 5FYLE 3CXHJ 5D2LB 1B88A 2AKRB 1V3KA 4WU7B 5EOCL 2VWEC 4TNVK 4G9DB 5EO1B 5KSVB 2BSTA 4XGZB 1NCUA 4PY8J 4KI1A 2H26A 1J10A 1TITA 3DECA 5KVEL 1WZ1L 2GCYA 3CDCA 5TE7H 4PJEF 3CLEL 5DHVH 4YHIB 4JEGB 1RZGB 1TTGA 3QDJA 1QD0A 3VD9A 3KS0H 3MLTB 1IKFL 4TSAH 2CH8A 5JO5B 4AT6B 2EXYD 1A4JA 1T7YA 1EO5A 4XC1H 4ZS6D 5I1EL 3D3VD 2ESVB 2IWGA 5KTEH 2Z93A 5C6TL 5L7XL 3O2WL 4R7DB 2YRLA 5D6DA 3OGCB 3DETC 1S7WA 3G6JE 3MUGB 4N90E 1ZHLA 2BMKB 2BVPA 5T1KD 4DGIH 4HIXH 4NYLA 2CJUL 3O4LB 1MLCA 1IEAA 2MKLC 5DLMH 4NO2A 5D2NB 2J6EH 3E6HB 3WLBB 4NKOB 4LASH 1EHNA 3MC0A 1SM3H 1JPTL 3WJLC 4N5UA 2F9BT 2DAVA 4ODVH 2X4OB 4Y5YC 4UBDC 2PTTB 4ONOA 1RUAH 4MAYD 3SQOH 1KCGC 2XZCL 1FNEB 2OQJA 2RQ8A 3HPLB 2MWCA 3MLTA 4YDLC 1L6ZA 3RWCB 4FMKA 3HHRB 3MOBH 3ZT7A 4YHZL 1K8IA 3DGGB 5BS0D 1GC1L 4DZBA 1F4HA 3SJVB 4PG9A 1J8HE 1KN4L 3GGWA 1NJ9A 5H2BA 5DJDA 1LE5A 5I8OL 1AHWB 1I8KA 1CLOL 2HAZA 3ARGC 2D31B 3TBSA 2PR4L 5CIPA 4RA3A 2MQCA 1Q9WB 5IJKA 3SY0A 4DW2L 4N5EC 1HIMH 4YR6B 5E2JA 2W1NA 1G6RB 3FO0L 4Z0BL 4EUPA 4OI7A 3OKYA 1UQSB 3QG6B 4PJGF 3QDAA 1XT5A 5SX4I 5JOPE 4FNLH 2A73B 2B5IC 3I02A 4O5LH 1NPUA 4L5FL 4Y5XA 3QRFM 2X44D 1N64L 2VXSH 4HH9B 4IMLB 2BVOB 5ISZE 5DK2B 4GBXA 1MFCL 3FRUB 3IDIB 1RPQA 3EOAB 5GGSA 5IMOA 4V3DB 4OB5H 1MJ8L 1Q0YL 1BQHB 5I74C 3WIHL 4OIIL 5C9KA 1E6OL 1LGVA 4NJ9L 3UPRB 3NA9H 1KFAH 3OQ3B 3K2MC 1NCAH 1LDSA 3ULVH 1CICD 1F4WH 5KW9L 2NY6D 5T5FH 4JB9L 2IJ0C 4MDJA 2FJHB 1RI8A 2O5XL 2ZNWA 3QUXD 3VGBA 1A6WL 4X6FA 1PDKA 2FL5A 2R0LL 5DJXA 3MOQA 2BVYA 2N7AA 5JZ7C 2XTJC 2ZCLL 3T3PF 5DMIL 2BC4B 4M93B 5MI0C 1PQZB 1VACA 4DTGH 4ZAKD 4PJ5A 1MCWW 2CMRL 2R4RH 4JZJC 1J18A 2C7UB 4LRIC 3MV8B 4MA8L 4R96A 5L6YH 3CSYB 4I3RL 2QQKH 4O51B 3VRJA 25C8L 3NGBC 2VDRL 1G0DA 4MQ7A 1YMHA 1RQ5A 3QI9B 4WW2F 3IDMB 3HG1D 1B4JH 3TNMA 1MLBB 3CK0H 1HYSD 3K4AA 2YA0A 4P5MA 5D1ZC 5HHPB 4XWGH 2X70A 5I1IL 4N8PA 3GMMA 4F3FA 1ZANH 2YRPA 3QR2A 3ARDD 4JAMA 4GMTH 1EFQA 2AERT 2FWOB 3SDCC 3MV9A 4FQJL 4E41A 1MEXH 4Y5VC 4YX2H 3VJ6B 4IDLA 1A9EA 4K9EH 4U05A 4PLOB 5BO1H 1CFVH 2VZ3A 1A5FH 3RJDA 3KR3H 1F3RB 5ISZA 4WTWA 2WMPA 5JIHA 5ADPL 1CZ8H 2OL3H 1U8LB 5B22A 4F2MA 5CJXA 2ZPKH 4WTZG 2A6IA 3DWTA 4TVPL 3PGCB 4ZMAT 4MXVF 2DMCA 2EDYA 1WFUA 2MNUA 5J1TC 1UJ3A 4FXKA 2PCPA 3W9DB 3BDBA 2ZKHH 3N9GH 3MGAA 1FH5L 2ZOLB 4NRYA 4R97C 2DRUA 4PRBB 2DD8H 4NGHH 1KTDB 1RHHB 1YQVL 3ETBF 5F1NA 5JPMA 5HPMB 1Q94B 2GITB 3BKMH 3CSBA 4MQXC 2EEBA 3V6ZA 2JK5B 3W82A 1SYVA 2YC1A 3IS0X 2EKJA 1MI5E 2GJ6B 1G7JA 1QQDB 4OBSA 3OKDA 4CVXA 1KIRA 3CDYA 3BP7B 3O11A 3FONA 2XTJE 4HIHB 1FQ9C 3RWFA 3UPAA 5GHWL 43C9A 4W6XB 2UUDH 3N0PB 4L1DA 4JFQA 4M9PA 2PUQT 3FB8B 1KPUB 1ZT1A 3EYFA 5FGCE 3P0GB 5EO9B 3PGDA 1T1WA 4R2GB 5CJOL 3UTZA 3PGCA 4E41E 2EEDA 5EOTA 1RMFL 5CEYB 4UB0H 3UROR 2NY0D 3X3FL 2DQGH 1S8DA 3PL6B 5CLTA 3DURA 3V6FA 1RZFL 1OSPL 3FB7A 1NFKA 2WNGA 3MRHB 4TUKH 2VC2H 4PS4H 1IGIH 4MHHI 1U8QA 3ARFD 3HTLX 3IJSA 3WFHB 5GRXG 3HS0A 4FQQB 4Q9RL 1WFTA 2DQUH 3P4LA 5FGBC 3Q1SH 1F90H 3OAZK 2APWA 3VW3H 2PNDA 3FTGA 3WUWA 1DUZB 5BO1L 1IC5L 3FB7B 3WUZA 1GZQA 3B8SA 5JW4N 3NACH 1DVFD 1URLA 5IGXL 4DZ8B 2NTFA 3R8BB 3S36H 2R23A 1XIWD 1VFAA 4UAOC 1W0VA 5CZXD 3AY4A 2KDGA 4XB7A 3UTQB 3S88H 3MGTA 1NCTA 3MRJB 1XGYL 4JDZB 5FCUL 4NOBA 5K93A 1MCHA 1HQRB 4PG2C 3T4AA 1BJ1H 3QEQB 2VO5A 3TIDB 5BXFA 5CHNB 1FJ1B 5JHDA 5EZLB 2GUOB 2VLRB 3GSOB 2ZUVA 1MQKL 1NGQL 2VB5A 4NP4L 1U8JA 5K59F 1FG2B 2BNUA 3QUML 4AJ0A 3DXAA 4NT6B 4HGMA 3QJHB 3BKYL 4RISH 3FN3A 5I9QB 4M00A 15C8H 1J1OH 1JYNA 3HAEB 1A6VH 3EOBB 4IOFD 5HY9B 1EMTL 2BNQD 1MF2H 4EI5A 1ZT4B 2MPAL 4Y4HB 5ID1A 3CFJA 4KUZH 3BZEB 4CMMB 1KPUA 5DEGB 2BY3A 3RZCA 5L6YL 5IB3A 3V4PL 1IMHC 1YNTB 2KH2B 5DXWA 1X4XA 1JMXA 3ULUC 4Y4HA 3BZEA 3MPCA 4QTIH 4I1NB 3TBYB 1RUQL 2APBA 4EOWH 3LQAH 3BEWA 3VFUB 1C5DA 2NLJA 3I85A 5IBUB 5AUMB 1XMWA 4Y4KD 3SDAC 3HC3H 2JF1A 3BUYA 2X7LB 2VDPH 5IHZA 1NFDB 4ZQKB 2P1YA 4XAWH 3LPFA 5C0FB 3TPUA 1HOCA 1R5IA 4KQ3L 4EQ2A 4RMSA 3NABL 3OR7B 2EDJA 1MFDL 4DVBB 2FEEL 2EDKA 1KUMA 1HSBA 4OV5A 5J13B 5EUOB 1KB5L 4LLMA 5DFVD 4WI6A 4RWYH 4HUVA 2R0ZL 4JM4L 1CE1H 4EBQL 5F7FA 2DB8A 4HUXA 2LU4A 5F3HA 4XCNA 3HLAB 3P40A 3WLWD 4K9EC 3ZL4L 4PJCA 5IOPA 3JWNC 4WU5B 4TN9A 5FUCC 4XBEL 2Y6SC 1EO7A 2QV2A 5DJCA 4FQIL 5D71L 3FB5A 4Z7UB 2A1WL 5E1HB 3BPCB 3MOBL 4N5ED 4O2EA 3WFEL 4APQA 2Q3ZA 5D2NC 3SEPA 3S35X 3FFCB 4MD5B 4HK0A 3U9UB 1KJ2A 5GRUL 2PYEE 1O7VA 4PGCB 3WD5L 4K94H 4PJIE 5C8JB 1JZ8A 3V8CA 1F97A 1YPZB 1MCLA 1AGEB 2PR4H 1I7TA 5MEOA 4GFTB 3T2QA 4N0UB 3OKMB 3ARED 3RFZC 1GPOH 1KBGH 3REVB 5EU7C 3VFUA 1CBVL 2DL9A 4KAQL 3TO2A 4KROD 4PY8I 2YD7A 3QDGE 2XI9A 3DO3A 3VDBA 2Y4SA 2P7TA 3HZKA 3VXQB 1DANU 4AT6A 4DVBA 1NGZA 4K23H 3TM6A 5AZEH 4N9GB 4PJ7B 4YE4L 3QIBC 3VWJB 2V7HB 2FNBA 5J9PB 3CC5B 5D72L 3D25B 2YK1H 2A9MH 4JM2C 1ZKAA 3HE7A 3EW3B 1K3ZA 4YBQC 3SGEI 5CEZL 4JFYB 5F6HI 5EUKA 4QHNB 2IH1B 5IUSA 2AJVL 3KDMB 1F02I 1PD6A 5J56B 5LXGH 2ZCKH 3BEVA 4S1DD 2XZQL 4EXKA 3DX9A 1NLBH 3OPZH 3VFWB 3DMMA 2EDTA 4V1DA 3HC4L 2IH1A 3VFOA 2XQYK 3ZHKA 1OF2B 3W2DL 1S7RA 4LRNH 3D5OF 3OGOE 4R2GD 1XF4A 1B4RA 1K2DA 3MTRA 1TVBB 2VDQH 1HH6B 4JLRA 1I3VA 5K9QI 3MRPA 4X9HA 1UB6A 3JXAA 3V7AE 4JKPL 4MXWL 4X6CB 4XBPA 1LEKA 5K9QG 4KJPC 1ZS8B 2DTML 1FZJA 4L4TE 2H9GB 4OV6F 3H9YA 1JRHL 1FCGA 4WWKA 3SDCD 5E8DL 1P4IL 2OTUB 3TO4B 5D7SL 4ISVA 1A1OA 2KZWA 3IDXH 3QQ9D 4NO0A 4BK4A 2PW2A 1I3UA 3PHOA 1T66D 2X4NB 1V3JA 2E6PA 5CZKA 3T77A 1CDGA 3PHOB 1WAAE 5SWSD 4FZ8L 5DEFA 5ICYA 4I3SL 3PE9A 4ISVB 2CR6A 3C6SB 2NX5D 3MOAH 5F9JB 3CPLA 3NZ8B 4X6DB 1N6UA 1FL6A 1NBZB 4M43H 1J0IA 1N59B 1TVBA 2F15A 2J8UB 2V17L 5GRVL 5I73C 1MFDH 4ODVL 2E7MA 4IHOA 4M5YL 4R4BA 2DD8L 4NGHL 3HE6D 3ES6B 3OKKA 3IETB 3O6FA 4UTAH 3VWKC 4MQXD 4N8VA 4F9PC 3FRUA 4HDIA 3IDIA 4JZOA 4RNRB 1BVKB 2YPLB 2Z31A 4P59L 2AJUL 1T6VN 4G9DA 3CNKA 4KJYB 5HHNA 1DL7H 3EYQD 3SGDH 5DJ0A 4PR5A 4OI9A 4Z95H 3D25A 1VEPA 3HMXL 4O02H 1L8JA 3QCTL 4DZBB 1HHIA 4OLUL 3TFKC 1BP3B 1S9VA 4RAUA 3STZB 5DJ0B 4MNQD 4P9HC 2R1YA 3SCMD 1FNEA 2OQJB 3ZTNH 1Z5LA 2Q86B 1C5CH 4R3SB 3O41A 5TDOB 3ZTJG 3X3GL 3ULUL 3WNNA 4C54A 3H9SE 3TT3H 3UJIL 3P11H 1KCSL 5H37H 4PRID 2ZUXA 4DGVH 2V2TA 4RMTA 1XF5A 4XCEA 1OTTD 4HPOH 3BP6A 4FQXD 4P5MB 2AEQH 3SKJH 4RFOH 1CL7H 1XGRB 4LEOB 1F90L 4JFDE 3ILQD 3IRPX 1FL5B 2VMFA 1Q0YH 3WN5A 4R96B 1QYGL 2X4OA 4JFDD 3T0WA 2YS4A 2AXFA 4KVCL 3LEYH 2CDFA 2XFXB 3D3VE 5ICXB 4K23L 2VLKA 2O93L 1J8HD 5ADOH 1YEEL 2ICWA 2Q20A 3RTQA 3U2SB 3HPJB 1N0LA 5DRXA 2HFGL 2J2ZA 4PRDA 5DHVB 3O0RH 4LNVA 2XOTA 4NZDA 4OAWA 4QT5A 3IFOA 4D9QD 5HJ3A 3DLQR 5CHNA 3VGHA 4LKCA 4P4KD 5DJ2A 1YNLL 3OXRA 4BYHA 5T1MA 1OGAD 2WQRA 3VXSB 1NGQH 1U2CA 4KI5D 5JOFB 2DOCA 5TE4L 5INCA 1ZT1B 3CU7A 1TFHA 5GS2D 4ALAH 2YPLE 2BDNL 1UENA 4HUMB 3TN0C 5IFHL 4GQPH 4BUHA 3M45A 4J3TA 3WIFB 1TNMA 3VFTB 5FYJH 4K3JH 3HN3A 3ZHDA 2EXWC 2AJ3B 3FRPG 1JWSA 5ALBH 2V2WA 1KTRL 4KMTL 4C4KT 1OOAA 3LRGA 2ZCHH 3VE0A 5SX5K 5HYJD 2B2XL 3ARYA 3QDMB 2YEZA 4N0CD 2VLKD 3OV6A 4KTDL 4XVTL 3TA3B 3CFDB 3KPSA 4LVNC 5DJ6A 5IJVA 5FO9B 1W72H 4G43A 3KPMA 5L0QC 4U6XB 5HHXL 5JPMB 3ULUD 5KANG 1G6RA 3KR3L 4PR5B 4KZEL 2VN4A 3JWOC 3TT3L 2WBJC 5JUEH 2OJEB 1T20B 1JPGA 1OAQH 3ARRA 1X6NA 3MA9L 1RJYB 5E9DD 5MEQB 4R7NA 3OJVC 1J0ZA 5FV1L 3NA9L 1BZ7B 2OSLA 4KJPD 4K3DL 3IVKB 2L7JA 3SDYL 3K1DA 5DURD 5E6ZA 1JGEB 4WEMB 1FVEB 4HS8H 1ND0B 1PJ9A 3LOWA 1S9KC 3EDEA 5L8JB 1TQCC 5DYOB 3H9ZA 3LKSA 3WSQH 1FORH 2NY3B 4WJ5A 3R06B 1SJEB 3QQ3B 1RURH 3QBTB 4G9FE 3KPOB 4GSDL 2BOBA 4DKEH 3L5WB 5F1NB 4KY1L 5D4QA 1A6AB 2N56A 4EXPX 4ELMA 3K1KC 1FLTX 3VXRA 5LGJB 1M7IB 3LCYA 1T1XA 2D9QB 5IQ9A 1CTNA 5FUOL 3KPMB 4G43B 3SQOL 3DUHA 1FJ1A 1B0GA 1F3JA 2P5EA 3WXVH 3VD7A 2EYTA 4BELD 3L3KB 1L4IA 3EDKA 1XIWB 4Z0XB 3MBXL 2HFFB 1A3LH 4WFEE 5DHYB 5DQ9B 5LQBH 1C8PA 2DQIH 1PQZA 1FGNH 1LK2A 1NBVL 3F7YB 4WO4B 3TVMC 4Y5XC 4EOWL 4U1JA 3B2UD 3QWQB 4PGZA 1P4IH 4AQOA 1FNLA 1IGIL 1U8MB 1RULH 2VOTA 3WFDH 3IDYC 1T22A 5H35B 1U8KA 3BZ4B 3BGAA 2M2DA 3NN8A 3OX8A 4NN7B 2IAMD 2EDXA 5M94B 2ADIB 3ULUH 3BKCH 4XP6L 3I6KA 5HHXH 4ZOEA 4WTXA 3S36L 2FHBA 4ZO6A 3P4NB 3MRLB 5KN5A 1NDGB 3S3PA 1HYRC 2UWEE 1OGTB 2A9ML 3H42L 4L8DA 3TCXA 3GKZA 4L8BA 1LNUA 2R9HC 5FYKL 2CGRL 3CFJB 4G8EA 4JQIH 4LBEB 4MD0B 1R0AH 4XMLL 4PJIB 5JIPA 3SO5A 2OJZL 1VFMA 3H6JA 5IKCA 1G9MC 4MJID 5CD5D 3NPSC 3S96B 3RNQA 1HZHH 2DQHH 2EKSA 3MBED 5E7BA 3HNVH 4PLKD 3SBWA 4Y19B 1BBDL 3FN0L 2C3HA 5MEQA 4K8RL 2XACC 5H37G 2IQ9H 3ULVL 3HRZA 1IRAY 4I2XB 1QP1A 3DXAB 4NT6A 5ITBL 4N90D 2C4FT 1KNOB 1OAXL 4LAQH 1DVFA 4LLQB 2D0HA 1A6UH 5L2KD 4H20H 2ED7A 2JLLA 1MVUA 4BQCA 4HJJH 1EVTC 1MQ8A 5HXMA 4GG6E 1JTPA 3MLSL 5EU7E 5J6HA 4MJ4A 4HCRH 3WE6B 3MQIA 4P4KC 5IBTH 3DXAE 4JCMA 4GBXD 5DA4A 3BJLA 4OIBA 1QLEH 3UC0L 4LSSH 4HKBA 4HHAA 4PGDA 2DICA 2XRAH 5I15L 3WUWB 3EO9L 1R3KB 4PJDF 1EEZB 5F1IA 4HS6B 5A2JH 2GJZB 4N8VG 4ZTPH 1HCVA 3MO1B 2X1QA 1BGXH 2HMIC 4IEFB 4HJ0D 4OF7A 3MRDB 4JRYB 4WI9A 1LDPL 3SKUD 1UM6H 3ILQC 3L3IB 4JDTL 1K4CB 5GGTH 1BEYL 3QRGH 3ULSA 1V7NL 1I9JH 3QUMA 4ZSOE 1T7ZA 2W9DH 5B8CC 2ZWLT 4LGPB 5DFTA 2IMMA 5BW7C 2UUDK 3W0WA 4LRNL 1J9CT 2W60A 3WL9A 1KTLB 5I19L 1DN2A 5FDWA 2VR5A 4C4KO 4O2CA 5FUZL 4Z7WF 3TVMD 3WDIA 3KPTA 4U6TA 2AJSL 5JDJA 4WU5A 5HDBE 1ADQA 1UH3A 4NC1C 4Y89A 3VCLB 4ALAL 1HHGB 4V1DD 5IEKA 1E27A 1Q9OA 1BQUA 4MGXA 3MUGA 5C0NC 3NFSL 3TBYA 5IVXB 4ODWA 1NGYB 1A8JH 5E8OA 3E0GA 3ROOB 5I1AB 3EJJX 2OP4L 2CMRH 4PJCE 3WJJC 3O3DB 4XMPH 1AO7D 1FBIH 4JG0L 2OTWA 4HKBB 4KAQH 4U4BA 1YUHB 5E9DA 1CYGA 3X3GH 4HH9A 1D9KC 1J87A 1YEGH 4LFHD 1S7RB 3O6FC 4YFLF 1BIIB 1QBLL 3WS3A 5TFSH 3CX2A 1BZ9B 5FKPA 1ZMYA 4M43L 2LAAA 3SDAB 5JNYA 3GSVB 1NANI 1YMMA 2YD2A 2NX5B 3B43A 5GGUA 1L0XA 4WHTA 3V0AC 2IF7A 3VFNB 3H2WA 1SJHA 1TVHB 3ECBA 2ESVD 3CH1B 1WJ3A 1LVEA 4XXCA 5F7WC 5FM5O 1BVLB 4EUPG 4G6ML 4M6OH 1WK0A 2VXVL 3RPIA 4Z5RB 2ICEB 4LSQL 2NY1C 2D7TL 3ARBA 4N68A 1Y0LA 3EO1A 3FRPA 4BJLA 3ULUF 5E7FA 3RWIA 3D69B 1P69B 1YJDL 2HJFA 4X9IA 2H2SD 3C08H 4DGYH 3UEZA 2FX9L 5KZCB 3HI6H 5F8QC 3UX9B 3BISA 2A0LD 5ELIA 1MFEH 1HZHL 4LKXB 1MI5B 3GGWB 4AYFA 5SV3A 1K4CA 3S3SA 1X5FA 4HPYH 3D18B 2H32A 4MJ2A 3QHZH 4XCCL 1YNKH 4Z76B 1NMCC 2PO6C 1ITBB 3PWPA 4ONHA 3QUYC 3FKUS 3VDAA 1JGUH 5L2KE 2J8UA 2RB8A 2QKIB 3DGCR 5CSGA 1MRDL 1V3LA 1H9VA 1OAYH 2UYLB 4HK0B 5F6IB 5IHUH 4I13B 1X5IA 3OF6D 3FO2A 5C0BE 4PRPB 4KJQD 3I6GA 3QIUB 5ACMA 2A74B 4WV1B 1TMCA 4ZD3L 5GS0H 2CDFB 3L6FA 2CRZA 1YYMH 2R56L 1Y18A 5DLML 2XA8H 2BRQA 1M6OB 3UO1H 4U6VL 4Y4HD 4D3CH 5L8LB 2XN9E 3T65B 1CFTA 1AXTH 4LSVL 2GJ6D 3BPOC 1G7LA 5EDXA 2NYYC 1IE5A 1A7NL 3VFSA 1Q0XL 3OMZA 3GMPA 1G7HA 5F7EL 5F7YC 4P59H 2X09A 5A1AA 1UKQA 1QBML 1TCRA 43CAA 2AK4E 3SJVA 5AG9A 2XNAA 5TQ0L 4FQXB 4I48A 1B0WA 5EFIB 3ARZA 1WBZA 1G7HB 3GHEL 4YXKH 1OCWL 2V2WB 4F58H 1Q9WA 4K2UL 4A6YB 1IGJA 3R8QA 3QJFB 4XZUA 1Q38A 1KLUA 1X4YA 4LLUA 3SGDI 1F6AB 4EUPB 1MUJA 2NMSA 1AJ7L 1AXIB 5DJ6B 3BMWA 1DBMH 4I5BB 5FHBH 1A7OH 2VXUH 1I75A 1QG3A 2X70B 2P49B 4F7CB 3GMLA 4XCFH 1SEBB 2PXYB 3R0NA 4Q6IA 3I50H 2E7LE 4PJ8C 5CJQL 1U8MA 2V9QA 4EDXA 6FABL 4Q2ZA 2QQLH 5I1EH 3AB0C 3MA9H 5A2IH 3AB0B 3OR6B 1IC1A 1YY8B 1H3WM 5F9WB 4LSUH 5DJAA 5C0RL 5L9DH 1WZLA 3V4UH 5INCB 1QR1A 1PFCA 5GS2H 3GZKA 2NW3A 1CGWA 5DJZA 1YY8A 2VIRA 1M6OA 5JORA 4H25A 4QXUH 1YEKL 1T21A 4UTAL 2XN9B 4JO3L 3PDDA 3SE8H 1PX3A 5L88L 3I84A 2DL2A 5JOPD 3VFRB 3TNMB 3WMSA 4KQ3H 2R4SH 4NKOA 5B38B 1A02N 3CVHA 5D1ZB 2ZSVA 4LSRL 4OZGF 4FQXC 2R39A 1RUML 3SDDB 3I6GB 3B8YA 2X1PA 1KGCD 3BKJL 2O61B 4S1SH 1GOGA 3MBEB 5EOCH 3AU1B 5E70A 3SQBA 1CE1L 4EBQH 4PRHB 4MWFA 4OD1H 3QFDB 4PJBE 1IC7L 1Q72L 5DI8A 5IBUG 2IFGA 2D0GA 2J6EA 2LVCA 2Y7QA 3PWUB 1QRKA 1XGQA 3MCG1 4F15B 3QUXA 1C5CL 4ELMF 3QZWG 1UA6H 4J8RB 1PG7H 1S7QA 1FAIL 4TULL 5HDLA 5BOPA 5I1IH 5T3ZL 3KJ6L 3V7MA 5EOQL 3RHWF 2DDQH 3TIEA 1S7UA 2B1AL 3O2VL 1JGDB 4OGXL 4NCC1 5T1DL 4EI5B 4NKIH 5C07E 4HC1L 3L5JA 2I27N 4MAUH 5H94A 3G6JB 3R1GH 1ULVA 4KKNA 1LHZA 1OAUH 2YPKB 3K3QA 5I15H 4HJGB 4JHAH 3FHQA 3MRRA 3JV5A 5FXCH 1BZQK 5JW3H 2HT3D 2W59A 3LQZB 5C1MB 4LCCC 2VXTL 2YPKA 2ESVE 2VDOH 1C5DB 2NLJB 3T8XA 1BD2E 5GJTH 4Z77B 3W81A 3VGEA 1QLFA 3PG2A 1WICA 2G60H 4U2ZA 4N0RA 4PY7A 2F58H 5T1KA 1IARB 4EKXA 4L4TB 5KZCD 1ZWIA 3QB7C 1RZKL 3U9PL 1UWXK 1I9JL 4ZPVA 1JUFA 3RWHB 5CMAB 1XCTA 1WBXA 4Q74A 1J5OH 2Z8RA 1UWEL 3QP3A 5JHDB 1K3IA 3MROB 5C09A 4Z7WA 1TZHB 5T5FL 1NC4A 3FN0H 3L9RB 2QHLA 4QYOA 1H0DB 5IMLB 5KS9F 3RU8L 4PJBA 3B9KA 3QJHA 1FSKB 1KJMA 4L8SA 1LNUB 5DHVA 2NXYC 2YA1A 1T03L 3MLYL 3VJ6A 2AJUH 3GMNA 3BQUB 1TJHL 3Q48A 3NCJL 5KVGH 1KJMB 1A7BA 1GZQB 1S9XA 2B4CL 1E27B 2BVQA 1QFHA 1U91A 4PRHE 2FD6H 3SE3A 2PYEB 5K9KB 4IRZH 1N0XH 3LV3A 1GH7A 2APXA 5CGYD 2HRLA 5I1GL 2CRIA 3VXRE 2APFA 1NDMA 2W60B 3WL9B 1H5BC 5FEBA 3C60A 4HIHA 2Q76B 3KNBA 4ONFH 4RDQF 2Y5TB 1VKXA 3D85B 4NQUA 3VMPA 4YHYC 4ZPTB 2I24N 2IBZX 1HOCB 1FFNB 1L7IL 1A0QL 5IWLA 3LQZA 3BN9D 1VFOA 2GJ6A 5ESAB 5GGTL 3NH7H 1AR1C 3DYMA 4MMXC 5LWYL 3OR7A 1ZSDB 1T3FA 4XCYA 4ZUVA 4MNGB 2YUXA 1SVCP 3O8XB 4UINH 4R7NB 3VXQA 1FP5A 3H7BB 3QXAB 4UTBH 4XNQB 3KPPB 2GCYB 2LQRA 4JPKH 1DR9A 4NBZB 5C0IA 3VXUA 3VFVA 4Y8DC 1CGUA 2YA2A 5FYLH 1H8SA 3QXWA 2V17H 3SKOB 2AJSH 2Z4QB 5C0IB 1KG0B 4MX7A 3MNWB 1IAKB 3W39B 4M8VA 1EIBA 3TVMB 4KJWC 1ZGLP 4RAVA 1U8IA 4NUJB 3L7EA 1MHHB 3V52H 5EBWB 5HGAA 5BS0E 1CICB 1LP9E 4YGVA 1P5UA 4JZJB 4PGCA 2D9CA 5C8JA 5HYIA 4LEXL 1CT8B 4JFDB 3BGFC 4GH7B 3CD4A 1ZLWH 2JKXA 4XNMA 1P7QB 2E27L 1DQJB 4N0UA 5ANME 4HIIB 4ODUB 3QG7H 1BMGA 3TYGH 1QLEL 3UC0H 3E3QE 5MEOB 3PV6A 1JHLL 1CI5A 2O5YH 2K7QA 3O3AA 4P9HH 5J11B 4PLJC 1WBYB 1JYVA 4JRYD 1IGML 3T4AB 6FABH 3D39E 4OGYL 5DFWH 2YSSA 2OZ4L 3M1BB 3O8XC 5GRWA 5DWUH 1NL0L 4NIKB 3U30B 2AJZA 4S1RH 1CD8A 2CPCA 3HS0B 4FQQA 1OGTA 5FDWB 2A6DA 3VFGH 1OAUL 1X5JA 1C5BL 3RNKA 4LHUB 2OI9B 5ESVB 1X5XA 3PWNA 2R2EB 3TWCL 3VXOB 3BRGC 4QXUL 1I9RL 2DWEA 3MUJA 1SEQL 1SY6A 3ROLA 3WV0A 3CFIC 3Q6GL 4MVBD 3DVNB 1F00I 4X9BA 5FV2A 4CN6A 3K2UH 3U6RA 4PLKC 4NNPL 3EOTL 1RUMH 3HB3C 4NHCH 3P30L 1QFWM 4OCNC 3HUJB 4JPKL 1Q8MA 4QY8A 1ZHLB 1HDMA 2MTPA 4P2RB 4HQQH 1XFPA 5EIVA 1IAII 2X05A 2P44B 3TJHD 4Y16C 1HHJA 4OD1L 5EIQA 4G8IA 4D0DB 4ZUSA 3EOYG 4Z7QE 4OGZA 2Y07H 2ORBH 2J4WH 4JFXB 5AYQA 2IH3A 4GW4B 4R26H 1JK8A 1E4WL 2EYSA 2WIMA 1H15B 2CKNA 3NIDE 5TJWK 5CZVL 1T2JA 4NM4H 2D7NA 5CSZA 2IH3B 4P2OD 5L2JA 5KSUB 3KG5A 1CU4L 2V9RA 3WXVL 5SWZA 1KBGL 3V2AR 1XF5B 4XCEB 4UI2A 3ROOA 1UXSA 4AY0A 4GRWB 5I1AA 4ZFOL 5EB9A 4OCRH 4Y5YB 4JY4B 4KUCF 5LVEA 4NQVA 5I8OH 4M7LH 4OGAC 1BECA 1K5NB 4RFEB 4XWOD 4I9WE 3WFBL 2A73A 1AKJB 1J8KA 2HLFD 3GI9H 1N4XL 5ECJE 5HSFA 2F8VA 4HV8A 4BSVB 1FL6B 3QI9C 4Y4FB 4YXLL 5C2UB 1JGVH 2WAHA 4M3KB 4H88L 5D1ZA 5DMKB 4X5LA 5DK0A 1IZKA 3E6HA 3VU2A 3WLBA 1UWEH 3IKKA 2YSSB 1QSZA 2PW2B 4X83A 1W72A 2HJKB 3BKJH 3QO0B 1P84J 4M61B 3OL2A 1J05A 5I6XC 4PRDB 4DCQB 2NW3B 3IU4H 3TJHA 1HXYB 3BP5A 2GQHA 1JL8A 1KTLA 3JVGC 1YNKL 4EN3A 5C0JB 1QO3A 4JY5H 3O2DH 4PG2A 1S78C 4ZNCD 3C5JB 1F2QA 3GFUA 5DO2D 3MLRL 1NC4D 2NXZC 1LO0H 2AABH 4F37K 5DD3L 3BE1H 4K8RD 3VFPB 2HRPL 4LCWE 1L0YA 4LLYB 5KSAC 1ACZA 3FJTA 3LRHA 4V1DE 2E9JA 1CBVH 5IBLD 4WUUA 4J3SA 3G6JA 1F58L 1JF1A 2GT9B 4YDVB 3ZKND 1DQQB 5GRVK 3ARDA 4NRXB 4G8GB 1BZ7A 2OSLB 1HKLH 5HVHC 2R1XB 4HMDA 5FYKD 4IRSB 1UEYA 3GMLB 2Z93B 4GRWH 3DV4B 4IDJH 1EJOH 3SCMB 3UZEA 4HT1L 5D6DC 1OB1A 5IT2H 3PWPD 2JB6B 3MRGB 1OM3H 3ZE2E 2G75B 2FJGA 3LAFA 3E6FA 4EDXB 3D2UB 4H1LG 1RZ7L 3K46A 4XHJD 2BOCB 1V7MH 5TQ2L 3QJFA 3GB7B 4XZUB 1G9ML 3CSGA 5EU6E 2NY2D 3E6FB 1YJDH 4PJFF 5F1SA 2HJLB 3NMEA 1JGDA 2JB6A 4PJXA 1KPVA 1VFBB 2ARJA 1OP9A 3ARFA 3EZJB 3RIAF 3UTTE 4M48H 1SJHB 3ZHLA 3OF6A 1NKOA 1OW0C 2DLFH 1MFEL 2GTWB 2P24B 5DD0H 3BEVB 1Q94A 3SBWC 3QUXB 3GSXA 2DS4A 4AM0A 4P0DA 5F9OL 1KCUH 4BQ9A 2J7LA 3NZHL 5KW9H 5J1AB 1T0PB 1NUDA 1DQLL 5DQJB 2IPTL 5CEXB 3HKFA 5E8EA 4Y5VB 3LSOB 2BXYA 3G5XA 4JPVH 4P46C 4JKPH 3QCTH 3LKPB 4N8VB 1PG7X 5DDHB 4XH2A 2PYFB 2CIIB 4K8RH 4PJ5D 4ZSOB 2ERJC 3CGTA 3QCVH 4FQLL 2X9WA 3SGJC 1E4XL 3T1FB 3SJVE 4FQ2H 4Q9CA 1N0XL 2R69H 3ZTNL 3GRWA 2E7LC 3FT4A 1LEIB 5CJQH 3PWJA 4WUUE 3F7VB 2P5WE 4D9RE 2VQ1A 1JVKA 4WUUB 2XICA 5J3HD 4JFHD 3ARBD 4OZGA 3OKKB 1HQRA 2DI9A 3OAYK 3KPSD 3C5SA 5IHLB 1BOGA 3CUPB 4FTVD 3U0TB 4K8RC 12E8H 5IBTL 3PWJB 1R5WA 4X6BB 1P6FA 1D5XA 2FEDD 1IT9L 3IFOB 4HT1H 4JR9H 2VIRB 3MRMB 1PYWB 1RV6X 3VXPB 1JIBA 2AJYL 3ULVE 3RVWD 2E7LA 3QPXL 4KQ4H 1DFBL 3G5XB 2CUMA 3UTTA 3V5HB 1SM3L 4LASL 1TQBC 5D7IE 5IESH 3NABH 5GPRA 3BDYH 5DHYA 2DWDA 3H9SA 1IBGH 3GK8H 3NACL 4YAQB 5HI5C 2JCCE 4POYA 5C6PB 2NCMA 2KL6A 2DKUA 2GK2A 3MR9B 4MA1B 3RGVB 4G80B 3O41B 5TDOA 4FFVC 1T1XB 4P4RB 5F6IC 4JCLA 3WJJA 1HWGB 4PRBA 3VXRB 4WI4A 3PWVB 4MJ6B 3O45A 1GC1H 4P4RA 2VUYA 3I3DA 1A7RH 4PRAA 3TBVA 3MRQB 1WCQA 2DLEA 3KPSB 3SE3C 4UDTA 4RIRB 3THML 4ACPA 2Q7NA 1BLNB 2B1AH 1UKTA 2GK0B 3O2VH 4X6CE 2EDQA 2YBRB 5TF0A 1I7ZA 4M6NH 4DW2H 3H3KA 4G9FB 1HILB 1MAKA 3OZ9L 4M6ML 1KJVA 2VDML 4Z0BH 5TF1L 2ATKB 3TO4D 3SKOA 3V4UL 1JYWA 4ODXB 2VAAB 3SE9H 4LCWB 1RK0A 3IVKA 3P9LB 3L3DA 5ERWA 4DQOL 5JQ6H 2FGWL 4LCWD 3UYPA 4KZEH 5CJ5A 2AGJH 1MFAL 4NRYB 3QQ9C 2EDLA 2HFTA 2NY1B 4JFFA 4XP4L 3BT2H 1XGUB 1CL7L 1VPOH 1RVFL 3TO4C 4AZ8A 1MCEA 2CLRB 1XF2A 2D7OA 5J8OA 4LNRA 4HFWB 4UNVA 1D6EB 1N5AB 1MFCH 1CE6A 3GJEB 1VB9A 4UTBL 2HWZL 1LD9B 3C09B 1U91B 3K8MA 2R0KL 1Q1JH 4GLRI 5CCKH 3VMOA 1CF8H 1OM3L 2VDPL 5DJZB 4JDVB 4JR9L 4PTTB 3DO7B 1ROWA 2IADB 4HKJB 1A64A 1QLRB 3MV9B 2HT3C 4D3CL 1I1FA 1IGCL 4RRPG 1GGTA 4OCSH 1NBQA 1X6LA 4XCNB 4Z95L 3VMNA 1JNHA 2ZSVB 1FE8L 1D5XB 3B2VH 3I6LD 3MGTB 1ZGLM 1WGOA 2AV7B 2VABA 4MXVE 1QBMH 3WNPA 5CBAA 3W11D 5FCSH 1E4XI 1UB5A 3DRQB 5C2BL 3JBG7 1S7VA 5GRJH 4RISL 3AM8C 1KN4H 4U7MA 1OCWH 1WZKA 3G9VA 3BVNA 1OSZB 4WFFD 4F9LA 4ZXBB 2XZZA 2BZDA 1B90A 4TQEH 1MHHA 2OZ4A 4QF1A 2MPAH 5DYOA 4PJBB 1A7OL 4QRTA 2YXFA 3QEUB 5B39B 2LTQC 4I18B 2FJFB 2HG5A 3VH8G 2XXMB 5EZOH 2AS5M 3TPUB 3MNZB 3DARA 4Y8AA 2IMNA 2X4UB 1MSPA 1MJ7L 1KXQE 4NZUH 4FQHB 4OSUH 2FIRT 3MSPA 1ZHBA 2GJZA 4I2XA 3GNMH 1YYLH 2P5EE 5B8CB 1MFNA 5CIPH 1KIPB 3T0EE 1K8DB 3SKMA 1QTYT 4HZLB 2J6EL 1OHQA 1A7PH 2APVA 2H26B 4FQHA 1CFQB 1FNAA 1R24A 1ZLUK 4DOHB 4YGVB 2SEBB 2P5ED 4CU7A 4NQXA 1P7QD 1R5IB 5JQHC 1G9MH 5IHZB 2EIDA 3GSUA 4ZXBC 4OIIH 1ORQA 1NEZB 4UT9H 4Y19A 3QCUL 3WLWC 1ZT7B 2EZ0D 4G8IB 3MRIA 1R0AL 4CNIB 4Z7VE 1WFNA 5HY9A 3T3PE 4DKFL 5E8OB 4U1LB 1I1AC 4GLRH 2BNRB 2HKHH 4OKDA 4HC1A 5E8PA 4D8PA 2GUOA 1DVFB 3P0VL 4LLQA 3QUXC 1A3RH 5IVZA 1GGCH 3H0TB 1A21A 1AGCA 3RA7H 2FIKA 4NWUL 5IB3B 3QNZB 4APQB 3C6LB 1LP9B 5EPMB 1HE7A 2E8YA 3KYOA 1AD0B 5I18L 4L8BB 1NGXA 5DZNA 5F7MC 3LEVL 1L9NA 2NY7H 4M1CC 4LIQL 4NM4L 1NCDL 2Q8AL 4NUGH 5IEKB 4MDIA 3C5JA 1FGVH 1FO0L 4RGMC 4MLSA 5D5ME 3MUY1 4KRPC 4X6EB 1NBYA 5IW6B 3BQUA 1IVLA 1T4KB 4PJ9D 3DUSB 3DVNA 5DGRA 5I1HH 1FIEA 1LMKA 2X89D 5CEZD 4OLYL 1ONQB 4IIQB 5EZLA 4IRSC 3BD4A 3ZKNC 1RULL 4TQEL 5DD1H 3SGEH 4HLZH 3DMMD 4OF6A 5K9OB 4PLJD 5DD6A 1ONQA 4YBLC 2GKIA 5FGRA 2KPNA 3I75B 3T0EA 2P8PB 3LKNB 2QJDA 5CWSB 1EJOL 4F33A 3PP3K 4FQPA 3TJEH 2VXQH 3S5LB 4NQVB 1IT9H 1ZHNB 1VPOL 3STLA 4AIZA 3EO0B 2ILLA 5BZDA 3AAZA 5MERA 5ETUA 1EERB 5F70A 1AI1L 2ARJB 3ARFB 2Z92B 3P30H 4OLVL 4R0LA 3U0PA 4BFGA 2VDNL 3VXMD 2NTSP 4RAUB 3MNWA 1F4YH 3HE7B 4PB0L 3U7YH 2V6HA 5C3TA 3QT2A 3IAQA 2YZ8A 4MAYB 5HD8C 3QUMH 3HE6C 5DA0B 4ZQKA 1EGJL 4NC1E 3W9EB 1C1EH 1LILA 3PQYA 2GSGB 1I7RA 4OCSL 4Z7OF 4KC3B 4JFPB 1KN2L 2Z4QA 3V0VA 1BX2A 1Z2KA 3LEVH 4MAYA 1M71B 3RWGA 1LO0L 4QXWA 2EE2A 4OZIB 2VDQL 1FYTB 4KUZL 2NY4D 4UAOB 4OCYH 3MRIB 5FHBL 2GW5A 3FMGH 3O3EA 3GO1H 5CSBA 4G59A 1FIGH 4XB8A 3WIHA 4TSCL 2KBGA 5IB1B 4I4WB 4QHKI 35C8L 3EYVA 1EEQA 4P5TC 4LFHG 2G2RB 3WO4B 1IC4H 1DCLA 4KTYA 4FHBD 4PRPA 3EO9H 3P9WB 1UZ6F 1G7IB 4JFEA 2OI9A 3VXSD 1JPST 1ZVYA 1GGIL 4XRCB 2A77L 4XAWL 1DN0B 2VITB 2VKWA 1CXEA 4PTUB 4HUNB 4PRNA 3WFHA 4KKBD 5JOFA 1A2YB 4PLNC 1PZUB 4XPTL 2DLTA 3WN5C 1JF1B 2GT9A 4JFED 4RSVA 4YDVA 1RD6A 2DIBA 4YWGH 4S2SA 4QRRE 5SX5H 3NCCB 3HG1A 1VEMA 4JO3H 4D9QE 3ZYZA 4LVNB 1W0VB 4KK8D 4QCIB 3B3IB 1NBZA 5CP7B 5D1XA 2WLYA 4ODSH 3I6LE 5HI5D 2MQ3A 3U83A 3P9MA 1WIPA 5HJ3B 4WTZA 5C07D 2R8SL 3HZMB 3QIWA 1YPZE 1HQ4A 4HUWB 4UIMA 3O4LD 5E5MB 4U0QB 3MV7E 1WF5A 3WSQL 4FRWA 1G7JB 1J05B 4L9LA 1CWVA 3C2SA 4KRPD 3WFEH 5GSVA 1O5DT 1GGUA 1CLYH 1TZIA 2IANB 5FHAH 1JGLH 3GRWL 3QSKB 4UU9B 3S8WA 1QFUL 2MOVA 4KVNH 4Y7MA 1AQKH 4H8WL 1OGAB 2HRPH 4OD2B 4X6DF 2AKRA 2ZCLH 5C08E 1FC1A 3NCYP 2Z8SA 5K9JL 1U6AL 3NTCL 2Y72A 4MA3A 4DTGL 4PJXB 5DEGA 4OCYL 1AQDA 5HDBF 3EKCA 5DUPL 1I1AB 4JFEE 4XPBL 2KKQA 3PHQB 4LHUD 3VA6A 2A6IB 3QQ3A 1DQMH 1CDYA 2D7PA 1J1XH 2B8OT 4K3HA 4KKCC 3BXNB 4LEOA 3TP4A 4FP8H 4P2CG 1IC4L 2DN7A 2ZOLA 3JTSA 5CS7A 5A16B 2AAVA 5E2UL 4P46D 3SKJL 1MUJB 1Z0NA 2GITA 1UEMA 3O2WH 3MR9A 2XTJD 1XGTB 2WK2A 1VDGA 4OUUA 3TA3A 2Y7QB 5DF0A 4UQ2B 3KYMA 1DBJH 1WBZB 2Y6SD 4G6KL 2IBZY 1QSEE 2YPVL 1MLBA 2ITDA 5LWYH 5LXGL 3BQUD 3CMOH 4NP4H 1YMHB 1PKQA 3L95A 1YY9D 4PRAB 2IG2L 3CVHH 5KSBB 1AI1H 1K8IB 2FWOA 3W2DH 4HKXA 4QT5B 5JA8B 1T0MB 1ACYH 3BSZH 3ZDZF 2R8SH 1U8NA 3RWEA 2R2BB 3RVUC 4MJIA 4PJXE 4M61A 3OAZH 4PFEA 2XN9A 2DBLL 3DX8A 3PL6A 1QOKA 2C7UA 4U49A 5CJ8A 4P49A 3ZZ1A 3UTTB 4JVPA 1UXWA 5JW4R 3SDXB 3ALXA 2ZP0T 5AAMA 4YHYB 4Q0XL 4QXGH 2V5SA 1QFPA 4RX4D 5EU6B 3FMGL 1U6AH 3NTCH 4UIKL 1N2RB 5TDPB 2FB4L 1NCWL 1I3RA 2KQMA 5B3JF 5D7LA 1Z3GL 2APTA 2V5TA 4L4JA 5J1SC 3Q5YA 2C3XA 4O9HH 2N4IA 4G6MH 1I1YA 4FN0A 3CXDH 1ETZB 2GEEA 1DFBH 3TCLA 3VRIB 2R29L 3P4OA 3GDBA 1RIUH 2GTWA 2P24A 2QADC 2X9YA 5IFJB 1JUFB 4YHIA 1A7NH 1FPTH 8CGTA 4OF5A 3L5XL 4YWGL 43C9B 5I1KL 3LZFH 3CCHB 2GK0A 5KANI 4YK4B 1A4JB 2EH8H 2GY5A 3AMKA 1ZEAL 5KSAD 1DSFL 5IKCB 2NY1D 4XNUH 3HCVA 4JQXC 5A2LH 1CDCA 1MCFA 5SV4A 1NFDA 1N7ML 1CXLA 3QDMA 5T33H 3RUGB 3FO1A 1XGYH 1OF2A 1C1EL 2CKBL 4XXCC 4XPGL 2HFEB 3QEQE 4PJAB 2C3WA 2JJTC 3RX7A 1RUKH 2C4FU 2R0LH 4YQXH 3DETD 1RFDH 1FO0B 4G8FB 4C56D 5DTFA 3BWUC 5IHUL 4X4ZA 1SY6L 4NZJA 5E08L 3BPLC 3RY6C 3VGAB 4ZS6C 1J8HA 1A7QH 3JWDH 3SDXA 3SO3C 3UTQA 4LF3A 4HG4J 1W0WB 2VL5B 3L3JA 3RIAK 3R1GL 2AV1A 2ED9A 5F97E 1MFAH 1MJUH 4Y2DB 4CN1A 3BT2L 3D48R 5HI3D 3FAXA 4LHUA 3VXOA 3AGVA 4U1JB 5C0DA 2AJYH 3F7VA 4I18C 1CQYA 3BZFA 2DM3A 4MQSB 3T77B 3IJSB 3V6OA 1AXTL 4LSVH 1K4DA 3D0VA 4BH7B 4E41B 4K71B 4DUVA 3FFCA 4MD5A 5IR1B 2COQA 4JM2B 5JLZA 1BOGB 3CUPA 3K80A 1ZHNA 1LO2L 1G7PA 1SJXA 1CFNA 3LQAL 4NNXB 4X6EA 3GIVA 2CJUH 3QIBB 4PJAE 2HH0H 3SKNB 2YUVA 6CGTA 1N5AA 3WYRA 1JNJA 1UXWB 5E03A 1YEEH 1OT2A 5J0BA 1AE6L 3FOLB 2WZPD 4MNQE 4PJ9A 3LN5B 2F53B 3SOBL 1I9IH 4WFGE 1A6AA 3DMMB 1S9XB 5C0AE 1I1FB 3BX7C 5IK3B 3MFGB 3O11B 1RHFA 3DTXB 3U4EB 1O0VA 4UMGA 1T4KA 1P6AB 1ZTXL 1DSFH 2OR7A 5HHVL 4TOYL 3BUYB 5E8NB 3HNSH 3V6BR 3WBDA 1BBDH 1JZ7A 1CGSH 2WM0A 1BFVL 4DK3A 3SE4C 5GGQL 2EDRA 3LEXA 2J3SA 3P3YA 3RVTD 4Q9QL 2SEBA 3FFCD 3C09C 4XVUD 3ME0A 5D7JC 4B53A 1UCBH 5IG7A 5JNYB 2E6JA 4XNXL 1DQJA 2ZCHL 4XC3H 3IS1X 1ZWIB 4M02A 4JRXE 1HHHA 1T1YA 3RWFB 5JHDD 5GIRB 4U1GB 1CXIA 5I16B 4W4NA 1U3JA 4M7JH 5CSZB 4P5KA 5BZWA 4Y4FD 1DDHB 3QPQC 5IWLC 4OD3L 1T3FB 2AABL 4GW1A 4LLWA 1HWHB 1I7RB 5J6HB 4MD0A 1FL3B 3QXVA 3E2HC 1NC2B 4WEBH 4H5SA 4R0LB 3ISWA 4L8CA 4BFIB 3D39B 4LLWB 3G08A 3S96A 2DQEH 1DLHA 5DFVC 4LP5A 4U33A 3C5ZD 4MCZA 1P4LA 4U1MA 1KT2A 1NDGA 2FATL 1CFQA 3C8DA 5HYFA 2ATPB 3BW9A 2WWMC 3AC0A 4R4FH 2NY4B 4QHMB 2XY2A 3RZWA 1AIFB 4MNQA 4QRUA 2XIDA 4HXAL 1II4E 5LBSH 3C6LD 4DOHE 4F33B 3A6OA 3ZKXB 1U2HA 1DBJL 1QFOA 4G6KH 2XA8L 3ZYOA 4JN1H 3UJTL 3O0RL 3MNZA 1D6VH 2H6PA 3LKQB 4KRLB 1GGCL 4QY8B 4Q97A 1VFAB 4NO2B 4HDIB 5LGHH 1T22B 2X4NA 3P2TA 5H35A 3S88L 3BGMB 5GRJL 3RGVC 4JDZA 2XZCH 3H9HA 1K4DB 4FFZH 4NQCE 4CUCA 5KSBE 5D1XD 4JRXD 3MRLA 5I9QC 4Y4HC 5KN5B 4Y19E 2QSVA 3BUTA 1BFOA 2EC9T 4GAJL 3P73B 5FYJU 35C8H 3E3QC 4LPUA 4Y19D 4QCIA 4YQXL 5IW6A 3WCYA 5K9JH 4PTUA 3HAEH 1YC7A 1QPXA 3C6LA 5EPMA 1QEWB 2EH7L 4X0KA 2UWEB 2WINA 4M6NL 3RNKB 3I2CH 2M26A 3V5DB 2EDWA 5EH1A 4CKVX 5I2IB 1QFWI 5FKPB 4L9DA 3VFMA 5EU4A 1QQDA 1XH3A 1OAQL 2FX7H 1Z3GH 2VDKH 3PQYB 1DJSA 1RZKH 2QR0B 5FM5M 4J1UA 4KKAD 5C6WH 1QSFD 2QQNH 5CZXC 3BIKA 1BJ1J 2DJSA 5FDYA 4P2QE 2JJTA 4OZIA 5DS8A 4P23B 1BAFL 3DYOA 2C9AA 4FOMA 1UYWH 4HZLA 3MCKA 4GAFB 4M4PA 1ODAA 3QEHB 1KFAL 4ODWB 4TUOA 4NN5C