4ZUSA

Crystal structure of equine mhc i(eqca-n*00602) in complexed with equine infectious anaemia virus (eiav) derived peptide rev-qw11
Total Genus 71
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
71
sequence length
274
structure length
274
Chain Sequence
GSHSMRYFYTAVSRPGRGEPRFIAVGYVDDTQFVRFDSDAASPRMEPRAPWVEQEGPEYWERETRNMKEATQNFRVGLNTLHGYYNQSEAGSHTLQRMYGCDVGPDGRLLRGYRQDAYDGADYIALNEDLRSWTAADAAAQITRRKREEAGEAEQCRNYLEGTCVEWLLRYLENGNETLQRADAPKTHVTHHPISDHEVTLRCWALGFYPEEISLSWQRDGEDVTQDTEFVETRPAGDRTFQKWAAVVVPSGEEQRYTCHVQHEGLAEPVTLRW
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Classical MHC class I antigen
publication title Structural Illumination of Equine MHC Class I Molecules Highlights Unconventional Epitope Presentation Manner That Is Evolved in Equine Leukocyte Antigen Alleles
pubmed doi rcsb
source organism Equus caballus
molecule tags Immune system
total genus 71
structure length 274
sequence length 274
ec nomenclature
pdb deposition date 2015-05-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00129 MHC_I Class I Histocompatibility antigen, domains alpha 1 and 2
A PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4zusA02
3.30.500.10 Alpha Beta 2-Layer Sandwich Murine Class I Major Histocompatibility Complex, H2-DB; Chain A, domain 1 MHC class I-like antigen recognition-like 4zusA01
5FA3B 5AWNH 1QVOA 4MA8H 3X3FL 9CGTA 1FGNH 1MLBB 3KPSD 3FB8A 3HI6H 4UQ3B 1EHAA 4FQCL 4LSUL 4J2XA 2XWJA 1OF2B 1DQJB 4DQOH 1LK2A 4LSSL 4L4VB 4WW2C 2PO6A 3QQ3A 1YQ2A 1KSRA 4OFPA 4FQXA 4PJDE 4JFFA 1CD9B 4AZ8A 2IADA 4PLKC 4CNIB 2R0WL 3CCHA 1CDJA 4PJEB 2Q7NA 5D7JB 5L6YH 1J1XH 4HLZH 2MQCA 3BP6B 2LE9A 1IEBB 2FX8H 2H9GB 4K71B 1QA9A 3GNMH 4TPRL 4Y5YB 3WO4C 3OKMA 3TBSA 1BM3H 4JZOB 3QIBA 2IAMA 5E6IA 1TITA 5I1EH 3QIWC 4YHZH 2P5EE 2CGRL 1GPOL 5CINH 5EBWA 3ELAT 5BS0E 4TTDD 5ILTH 4HCRA 3X3GL 4X98B 3C9NB 4BSJA 4FNLH 4MXWL 1B4RA 4PRNA 1A6TA 1OAKH 1PG7W 1S9YA 3SKUD 4IHOA 2FATH 1KB9J 1NCDH 3CH1B 3TFKD 3WNMA 3VGGA 1DQML 1SY6H 2ICCA 1UEYA 3I75A 2HT3D 1QNZH 5ENWB 1T1YB 1F6FB 1YEJL 3TIEB 2EDOA 4YHOL 4PRHA 4Z7WA 4PREA 5DO2D 4O2EA 3RA7H 1EEYB 5FGCB 4PRDA 4NC1C 3CSGA 4U2YA 1WSST 1AP2A 3MNZB 5ADOH 5J56B 2YUZA 2EIEA 5E56A 1IAKA 1RZJH 3SGEH 1ZGLM 4X6DF 4XCFL 3T4AA 1N26A 1ORQA 4X8JA 3VG0L 5I75B 4NT6A 1DFBH 3KPMB 3G5YB 2EKSA 3G6JF 3QA3A 4CN4A 2VSDA 1GIGH 2X7LA 3H9HA 3HNTH 2ATKA 1LP9A 3FFDA 5DJYA 3RUGB 5FA4A 4X4YA 3TF7A 3IFLL 3V5HA 5IWLA 4JRXA 5C9KA 2IFFL 1HOCB 3MLSH 1NL0H 1U8MA 1U8IB 3JTCA 3SN6N 2BOCA 4JFXA 1K3ZA 1EXUA 3QZWG 1IL1A 3WHXB 1I3RB 5CSGA 4YZFF 4KQ3L 4G42B 1T1XA 2EE3A 1QSEA 4WEUD 3SE4C 4D2NA 5A2JH 1I1YA 5ITFA 1GAFL 4NSKB 3L7FB 2VLRE 3KPNA 1P2CA 1UADC 5DZLA 3AU1B 3T09A 3OB8A 5C09E 4FZ8H 4PRAB 2VL4A 3WEXB 2ZSWA 2FJGB 2RBLA 3VRLF 4Y5XA 5EU4B 1PEZA 2Z31A 4U1HA 4MQ7B 2W9DL 4R90L 3NABL 1NCWH 4ZYKA 8FABB 5E7BA 4G6FD 4HC1H 1QHOA 1QSFD 4HK0A 5FV1L 5BV7B 3P4NA 3MUGB 2JIXB 3O9WD 3EOAB 3JV6A 4JKWA 1KCVL 4LARH 3PQYE 2EC8A 4QRPA 1FCCA 5HHQB 4FFZH 3ERYA 4EZMA 4KAQH 3OAUL 3FO2B 1QFWL 4OCXL 3RVXC 4UU9B 2QSQA 3X12A 1EAPB 2HFGL 1RURL 4UT9H 5F7UA 2EDXA 5TE7H 1KBGH 1PVHA 1BEYH 3FQUA 4ZFOB 4MNHB 3ZE2F 5FCUH 2BNUB 1X4ZA 4MA7L 4HWEH 4JFQB 1A6UH 4P2OC 4YLQT 5SX5K 2BJMH 3QUMH 5HDBF 2AEQL 5ITBL 3KNBB 3RX7A 5KAQF 3GI9H 1MH5A 2LAAA 4L4TA 1S7XA 1D5IH 5JQHC 5TQ2H 1KJ2A 3ZDZF 3GGWB 1TFHA 4YR6B 1I8KB 4IMLB 1RUQH 3GSNL 4HAGA 4XBGA 1UA6L 4AG4L 3JBG7 3QXUA 3NCFB 1S7UB 5TFSH 4OIBA 4Y1AB 2ZUQB 4YBHA 1BJ1H 1RUAL 4PGJA 5E00B 1U8HB 5D7KE 4YE4H 2IH3A 2UVFA 4NO3B 3DX6B 3P9MA 1KGCE 3H9SE 2VLJE 1TNMA 3H42L 3BP4A 1U41A 4Z7VE 1EHNA 3WIFA 4YHPA 3IFOA 1YYLH 3CFIC 4NJ9H 4M8VA 2YUWA 3P11H 1ZLVK 3OHXB 1I7UB 1YUHA 1I9JL 2AABL 5AYUH 1Z9SA 4LHUB 5C0CD 5CP7B 2HRPL 1G6RA 4JB9L 4JZNB 1HKLL 4S2SA 3G5VB 4XAKE 1ITBB 1DQDH 5I74B 2LVCA 3FQRA 4KKCD 1ND0A 1RZGA 4GQ9H 2FYYB 1KXQE 5C0AB 5LBSH 2FSEA 2BFVH 4PY8J 3QDHA 2FX9L 2X1PA 5HHNA 4GH7B 2X4TA 3M1BB 3EO9H 1EGJL 5EO9A 1AI1H 4P9MH 1B9ZA 3H3BC 4JY4B 4LVHB 3V5KA 5A43C 4XMKL 3W82A 4FMKA 4U1MB 3P0YH 4QF1B 4NWTL 5FF6A 1WFOA 3CSPA 3B9KC 5TF1H 3D69A 3SGJC 1T1ZA 4RZCA 2ICWI 3DTXB 1CGXA 1NGWB 1CFSB 4I3SL 4RISL 2ADGA 4ZD3L 5JW4R 2NXYC 3UYOD 2B0SL 1MCEA 4FQHA 3T3PF 2VDPH 4JPKL 1NUFA 1VACB 3LHPH 1BFOB 1UM6H 5T3XH 1IGIL 3QI9A 3BZFB 1NBZB 1JPFA 1UXSA 1YMHA 2CD0A 5C2UB 2X4QA 4Y4HD 1RJCA 4LNRB 4FQ2H 3F7YB 2E7LA 5IUSA 2ICES 1I9RL 5AZ2H 3ARBB 2CSPA 4G7VL 1IJ9A 1QKZL 3ZKND 4WI7A 2K3TA 3EW3B 4KJYB 2ADJB 3KPLB 4HWBA 2D9CA 5E8EB 1AKJB 5HI5C 3UAJD 4QCIB 2OTPA 3BT2L 2JCCA 5GGQH 4S1SH 2OP4H 3GMQA 3WS6C 5D1ZB 2QSCL 1EJOH 1AXTH 3UTSE 2R1WA 2V7HB 5T3ZL 5T1KB 3FRPA 5J11C 4XT1C 4DN4L 5D1QA 2MCPH 1Q1JL 2I5YH 3MACL 3HAEG 5B3JF 4O9HL 4MAYD 1WVZA 4MD5A 3WFDH 2SEBA 2ZCHL 1OAXL 5E5MB 5B38G 5KS9B 5KSBF 3F58L 2Y5EA 4NOFA 5IFJA 1A9EA 5H37H 4YNYA 4WGVB 1DSFL 1VEOA 3SDYH 1TVBA 1BFSA 4L9LA 1CLYH 2C1OA 4IOFC 3MTRA 3GMNA 1JHTA 4JM2D 4GAJH 3D2UD 4CBPA 3DMMC 5FGBC 5DMYA 4WY7L 3VFPA 5FM4A 3CIQA 2L7UA 1ZHBB 5I6XC 2I60H 3I02A 2NY4D 1L0XA 3A6BL 1MFCH 4HQQH 1MJ7L 1J0HA 1LK3H 1FYHB 4U49A 3IDNA 2XN9A 2FB4H 4U1GC 4KI5D 1OLLA 2VRAA 5JW3H 1MLBA 3GSNB 3C6LC 3F8UB 3K74B 3H3PL 2EEAA 5CZVL 3RZCD 5HJ3B 5LVEA 1A7PL 5IFHH 5J8OA 1FL3B 5C07A 4FFEX 4F2MA 4KROC 5J7CC 2E7MA 1OF2A 2V5TA 1CQKA 2YD9A 3WFZA 4L4VA 1ZGLP 5DVOA 1FDLL 3RWDA 2ORBH 1DBAH 3RWHB 4RNRB 1O0VA 2VDNL 1F2XK 4NNYA 3TBWB 2CJUH 1MUJA 4CNIA 1UWGH 4JO4H 2D7QA 3QDGD 5CBAB 1IQDB 1AY1L 1RAMA 4F57L 3BP6A 4Y5YA 1WIOA 2UVEA 3W39A 3WS3A 1J5OH 4X6DB 4GUPB 3WD5L 3QQ9C 1BX2B 4JZOA 3NCYP 4JFFE 3MV9E 2H32B 4KPHH 1CZ8H 1QRNB 3U2SB 1XF2A 3GJFH 2B2XL 4XCNB 2DQIL 5ANME 3ZYZA 3RI5F 4QXTB 1NC4D 4NDMA 3DSNA 5CIPB 2WNGA 5E2WL 3LKSB 4HUUB 2VLMD 1EO5A 5DD1L 3BFOA 5IBUB 3SJVA 1CICC 2GQHA 5JMRA 1F5WA 3H3KA 4PJGF 1NJ9A 1MCOL 2WINB 4GRMB 5JPNB 5AWNL 4MA8L 4Z7OF 4PJ8D 5ID0B 3CH1A 1BOGB 1P7KA 1CIUA 4PP1D 2BY2A 5DJ0B 1K2DB 3QFJE 4CDHA 1FBIH 4YIQB 2EXWD 2P5WA 4C4KT 1T1YA 4AIXA 4I2XB 1PW3A 5IM7A 3E2HA 4IEFB 5CGYC 3CFJB 3S37H 2KUTA 2GY5A 4DQOL 1UYWH 1MFEH 3MNZA 1IKNC 5K9QG 1MJJB 2J6EA 1WEJH 2EZ0D 2NCMA 3ROLB 3PJSA 3S4SB 4NQCE 5BOPA 5D1XD 4PJFE 4WW2F 3BRFA 5GGSY 5C0FB 5L6YL 4ISVB 3OR6A 4YHLH 5EU5B 5D6CB 2BMKB 3IF1B 2FX8L 4PRPD 3GNML 4ZS7H 3S5LB 5ISZB 3GMRA 2BNQA 2Z91A 4D94A 3IJHA 4ZOBA 5CEZE 5I1EL 1HOCA 3PL6A 4YHZL 4I8DA 3HLAB 3VXMA 4RGMB 1ZGLB 5CINL 3MR9B 4HDIA 5ILTL 1FNEA 4NQTA 5DJ6A 1WBZA 4NQDA 3T77A 4OFIA 2VUOA 4YQXH 3W0WB 3WHXA 5E8PA 3BQUC 3L3IB 1H5BA 4JGJA 1JZ2A 5KVGL 1TVHA 2C3VB 2I9TB 5DJZB 3MGOA 3DX7A 1JYNA 4PV9B 1OAKL 4WO4C 2WIIB 2FATL 1NCDL 1B0GB 1C12B 3NFSH 4U1JB 4IRJC 3WEXA 4Y5VB 2FJGA 4JREB 1Q9OB 4M8QA 1QNZL 3KYKH 4OFYD 3HMWH 5ICZA 1Z0MA 4GXUM 1PGRB 3RA7L 3K8KA 4PLOB 3AY4C 2EDDA 4IMKA 4XNZC 4WTZA 2DAVA 1I1AD 3OKOB 2YPLD 3CLEH 4I77H 4NQEA 1RZJL 4RCAA 1NLDH 1MHEA 1FC1A 1DFBL 5TQ0H 2Q8AH 3MLYH 1AR2A 3H8NA 1X5KA 3PWVA 1GIGL 3TH3T 1HHJA 4EQ3A 1DE4B 3CUPB 1PLGH 1OB1A 3ARDB 5IROC 1MHCB 4C56A 2X70A 5I1LB 2NY6B 2YPKB 3MLSL 1NL0L 3L1OH 1HXMB 3IRPX 1A4JB 5GGSB 3V0VA 1XIWC 5HYIA 4EDWH 3HUJB 1MRFH 4X6FA 3QBTB 2NNAA 3HZYA 3KNBA 3VA6A 5CEXB 5BJTA 3MRNB 4I9WE 5ICXA 4W6XB 3GGWA 1MCWM 1NMCB 2APVA 4G5ZH 5E7FA 1SYSB 2VDKL 4FZ8L 2F58L 4RAHA 3VGEA 1T03H 2ZKHH 3C5ZB 5KVDH 4N90E 3RWGA 1AGEA 4L4TE 4LPWA 1YEHH 2VZUA 1NCWL 3DBXA 4HC1L 3SDDC 4OFDA 3EO0B 3MRDB 5CUSL 4NO3A 4FOMA 4JKKA 5HVFB 4GBXA 5EULV 2VKXA 2IJ0C 4OF0A 1P4BL 5J1AB 4LARL 2VXTH 3EZ8A 1BF8A 2XG5A 2R4SH 4FFZL 4KAQL 4G6AC 4IRSC 4BZ2H 4HIIB 5CZXD 1OP3H 3KPRA 1VA9A 3FO1A 4YDVB 3DJ9A 4N1EA 1I7UA 3T2PA 1GGIH 2XPGB 1A6ZB 3ARWA 1E0OB 4QYOA 4UT9L 4XCEB 5TE7L 1KBGL 1BEYL 2H26A 3H7BB 5FCUL 3KR3H 3FQNA 1P84J 4G9FA 4HWEL 1X7QA 4A6YA 1U2HA 4ZAKC 1A6UL 2Z8VC 5ESQB 3RTQD 4BQBA 1PD6A 2FYYA 4Z8FH 1OSPH 2IALA 2HKHH 3QUML 4X5XA 1XEDA 3M1BA 1HNGA 5TQ2L 3VW3H 4WFFD 2EYTB 1RUQL 1T83A 4QHMA 4QF1A 2DI8A 3G9VA 4BA8A 2F74A 5TFSL 5HI3C 1ZHLB 4XPTH 3VXNB 1CFSA 1KPUB 1CLOL 1LDSA 3PIQA 3EHBC 4M1CD 5DZOA 5IVXF 4LLYB 3OJDA 1OHQA 3O11A 1RZIB 1T80A 2J2ZA 3CD4A 3WJLC 1G7JA 4ZODA 2XZCH 1NDMB 1NBZA 4M9OA 4O5LH 5E2VH 1KIPA 2J12B 5DA0B 2ZJSH 5DJDB 3P11L 4Y4KA 1U9KA 2VL5B 1OD9A 4RDQF 1QZ1A 5AYUL 1JF5A 5H94A 3F7YA 1UZ6E 3GI8L 5TDPB 3W5MA 3PWPE 2NY1C 1BLNB 5J12B 2DL9A 3GEWB 1VDGA 5T1MA 4Z7NF 2RQ8A 5BW7A 5IMOB 3A6OA 2B20A 3FFCB 3FO9B 3RGHA 1DQDL 4RGND 3CFKB 5DI8A 4GQ9L 1HHKB 4DZ8A 3QCTL 1U3HC 1QEWB 3T1FB 2ADJA 3KPLA 2UWEA 3L7EA 4E41D 1KG0B 4D0CA 5D8JH 3EO9L 4YWGL 5FM5O 1AI1L 1Z0NA 1BREA 5GRXG 4M62H 4HGMA 2ZZUT 2V7HA 2E7CA 2G60H 5T1KA 5TF1L 2RHEA 4QWWC 1G1CA 1Q38A 3PGFH 1FFRA 3BDYH 1IBGH 5F9JA 5B39A 1J8HE 5E5UB 1U93B 3LVEA 2J3SA 1AR1D 4RA0C 5E5MA 2AJUH 2FWOA 3CK0H 3FOLB 2VDPL 3IAGC 3OSKA 1HYSD 1ZWIB 3LHPL 4XHQA 5T3XL 3ARGD 3OF6D 4OFVA 1KIUA 3TO2A 3CXHJ 1T0MB 4PD4K 1LGVA 3GBLA 2P4AB 3ULVD 2FR4A 4FQ2L 3ULSA 3ZDYF 1KYOJ 3Q1SH 3KWWB 4DUVA 1ZHBA 3LKPB 5KTEH 3JV4B 1OAYH 5IT2L 3S3PA 1UCTA 3MLVH 1PKQB 4HUWA 1A3LH 3TJEH 4NO0B 3GHEH 4Y4FD 1JZ6A 3IETB 5GZOD 3UJIH 4GKNB 3VWKA 3U83A 3TBYA 3P4MA 1U42A 4ORGA 4PJGB 3FHQA 4S1SL 5GGQL 2OP4L 4FTVD 2FEDD 1IM9A 1UACL 5DJAB 4OCWH 3C09B 1AXTL 3RVTC 1JPSH 3MLRH 1HEZA 3SKNB 3KG5A 1PZ5A 3RWHA 2BSTB 4Z6AT 2MCPL 1U6AH 4X5WB 4AMKH 2BCKB 2I5YL 3DIFA 3TBWA 3MUY1 4NQSA 4OQTH 2Z93B 2BHZA 2ZG3A 4WI4A 1JZ4A 5IJKA 2GTZA 3OV6A 5EC2B 5CBAA 1YNKH 1SJXA 1OW0A 5EBMA 1ETZB 3SDYL 4X6DA 4GUPA 5HHMA 1BX2A 1CLYL 1AHWA 4NC2B 4TSCL 4WW2B 3G6JA 5EORH 2FJFB 4GAJL 3NGBC 4PJEE 3KXFD 4MDJA 1QQDB 4O58H 2I60L 4UQ2B 3T3MF 5A16B 4P9HC 1MFCL 3QUMB 5LJYH 2DLGA 2ARJB 2HJKA 1LEGB 3VJ6A 1LK3L 3B8YA 3WO4B 1IEAA 3H0TA 3QH3B 2FB4L 3DURA 3FQWA 3LRSB 1EGJA 3SDXB 3AS3A 1UFUA 4GRMA 5JPNA 3FRPG 5EWIL 5JW3L 3B9DA 1HHHB 3PP4H 4WUKH 1BOGA 2CIKB 4E5XB 1NGXB 3QIWB 1K2DA 3TO4A 3BYYA 3GB7A 2V2WB 4PY8I 3HMXL 4OIIH 4YIQA 1RULH 4I2XA 5D5MA 3QUZA 1T20A 4IIQC 1X5ZA 1OD7A 3CFJA 5B8CC 1XGYH 3ARED 3F7RA 4W4OC 1R0AH 2WIMA 3TT3H 2ZPKH 1VFOA 1DBAL 2XYCA 3AAZA 4OZFA 3RKPA 4WI6A 4F7PB 5F3HA 4QRQB 5I1GL 4FQLH 2BZDA 2HH0H 2ARJQ 3EOTH 1IGFH 3ZKQD 4P57A 2CJUL 3PABA 1UWGL 1TJHH 4JO4L 5FGCE 3BP5A 1BWWA 2I27N 1CN4A 1QLEH 4OGZA 4ENED 1J5OL 2IF7A 4BK4A 2R2EA 5DRWB 4KPHL 1CZ8L 1TQBC 4MMZC 1U8QB 2V2XB 2VISA 5H2BB 3MGTB 3E6FB 2XZAL 2DBLH 5IB2B 2AK4D 2HVJB 3RUGE 3W0WA 3RGVD 5JDSB 4OD2A 2VXUH 5DRXA 4KRMB 4PJHF 4PV9A 2HLFD 5FUZL 1XCTB 5IF0B 2WIIA 4MA3A 4P48A 3P9WB 2BOBB 1LE9B 1GYAA 4U1JA 1KC5H 1FBIL 3BDBA 1DJSA 2IFGA 4QNPE 1BZ7B 4DKAA 2DN7A 2CIIB 3ZYOA 2B1HL 3RX5A 1MFEL 4NKMB 1ZANH 1UH4A 4OT1H 4GS7C 2EDLA 1WEJL 3ZT7A 4P4KA 1FJ1A 4AEIL 1JGVH 3OB0K 4P46C 2AJYH 2EO1A 2FBJH 1RMFH 4D8PB 5HHXH 1CD0A 1JNHA 1ADQH 4JQXA 1FL5B 3IDIA 1HHGB 1F11B 1KFAH 5ALCH 4YHLL 4HW6A 5IW6A 4JO2H 4UDTB 5IMKB 3GSQB 4ZS7L 1DE4A 3CUPA 1MHCA 2F54B 1YN6A 1GGBH 5I1LA 5KZCD 1P53A 2VN4A 5BMFH 2IPKA 2YR3A 3BPLC 1R5VB 3STZB 1CGWA 1FNLA 5EPMB 4JEGB 2CLVB 3MRCA 5JZ7C 4YQXL 1EFXD 2KDGA 4KJWD 5CSZB 1ZVSA 4DVRH 2NY2C 1C1EL 4R7NB 4NKDB 2PTTA 1KIRB 3TN0A 5FFLA 1U8KA 5FDYA 5IFAH 4EI5C 1LO0H 3NIFE 3LKOB 3NFSL 3FRUB 4G80A 2VB5A 3WLWC 3MC0A 1F3DH 3T0EC 2Z4QB 1EZVX 3KYKL 3ZKXB 3HMWL 2NX5D 3BO8B 2BHUA 4P2OB 2HT4C 1T4KB 4P9HH 4YDJB 2J8HA 5EIVA 4YXKH 3VXRB 3CLEL 4I77L 1FO0A 1R3LB 3HC3L 3FKUS 4R96B 1NLDL 4Y1AE 1KJ3H 4MNGB 2A9ML 2IBZY 3BIBX 5IVXB 5TQ0L 3BIAX 2Q8AL 3MLYL 4HIIA 1TZGH 3MNWA 5E95B 2Z8SA 2VAJA 3CC5A 3WIHH 2C7UA 2YUVA 2IPTL 1PLGL 2XQBH 1A6ZA 5ADPL 4HS3A 4XCEA 3RDTB 3LCYA 3CFBB 1H3PL 4PG2A 1GCFA 2V17H 1OARH 5HYQB 1CE6A 1HZHH 2BHYA 4MDIB 3WKMH 4Y2DD 4K3DL 3ZE1F 4EDWL 1MRFL 5IJVB 2X89A 4XP4L 3SE8H 3FAWA 2W0KA 4WTZG 5KBNC 4P5TD 4D3CL 4G5ZL 3DO7B 5F96L 4PJCE 4S1RH 1T03L 1KB5A 4HV8B 5KVDL 2XFXA 3MBXH 1VKXB 3IFNH 5C0AE 3SBWA 3DOSA 4ZS6D 2R23A 2DQDH 3RPIB 3RY6A 1YEHL 2L7JA 4FXLA 5DHYA 4OTXH 1OOAA 4ELKB 1MRDH 1A4KB 4Y2OA 4DGVL 4JFPA 5EG6C 5FM5M 3MRQA 3QT2A 5I2IB 2VXTL 1FN4B 2APTA 2Z8RA 2R4SL 4X6CB 1A5FH 2GFBA 3B9KB 2WMPA 4G3YH 2BNRB 2EKJA 5KSBA 5JOEA 1JGUH 3ARFD 1X5IA 1L0YA 3VFSA 2OJZH 2IQ9H 5FGRA 1JGLH 1E6JL 4AY0A 2NXYB 5TDPA 1GGIL 3SDAC 4X9FA 1BLNA 2LVEA 3WNLA 2GHWB 4B41A 1JE6A 3FFCA 4G9DA 4CRPA 3KR3L 5LGKA 4H5SB 4N0CC 1U95A 5F7YC 1YQVH 1HHKA 1OSPL 3SCMD 1MNUH 4JAMB 3RY4A 2HKHL 3V5DB 1SY6A 2HFEB 4MWFB 4ZO7A 5HPMB 1KCRL 3L5JA 1CFVH 3NZ8A 4XP5L 3VW3L 1G7PB 5DJCB 2XACC 1DLHA 2DLFH 2VTFA 3MJ9A 4KK8C 2RFXB 3VMNA 4D0DA 4JFOB 3DX9A 4YFLI 3BZ4A 4XPTL 4NM8H 4N8VB 1NC2D 4U6XA 2JE8A 3P0GB 3BH9A 4PGDA 2VH5H 3GSXB 2D03H 3FOLA 3BH8A 1BVKB 1BIIA 1MF2H 1KF9B 4N0UA 4X7TA 4XP9H 5HYSB 4L3EB 5C0JA 2XZCL 3PP3H 4LVEA 1T66C 5FHBH 4NFBA 4O5LL 4AEFA 5E2VL 2QHRH 4K7FA 1T0MA 3F7VA 5I8EB 5JHDA 3OTTA 5KS9E 3NIDE 1GOFA 1OM3H 1WJ3A 1CWVA 2M26A 4YBLC 5SWZD 3LKPA 3S37X 3O41B 1YEFH 3JV4A 3IDGA 1HCFX 1H3XA 4FA8A 4NO0A 1U8LB 1IAOA 3H7LA 3QEQD 1YDPB 1JTTA 3K8LA 4LGPB 3DMMB 4OD1L 5D8JL 3FTGA 1VCAA 5GJTL 3BYTA 4PJGA 4CVXB 5I6XB 3B5GA 2XRAH 2BSSB 4LCYB 1UJ3C 4M62L 3MROA 3WLBA 4E42B 2NLJB 4HJJH 4JGMA 3SKNA 5ERWB 1RY7B 4U1GB 4XI5C 3PGFL 2PYFB 1JPGB 3PV7A 1IBGL 3C6LB 2WY3A 4OF3A 1CGUA 4TOYH 2AJUL 1I7TB 3V4VH 4AENA 5EH1A 4OGAD 3CK0L 4MQTB 3I6GA 5DDHA 5GS1C 3MGAA 5F6IC 5BOZG 4KDTA 2FJFA 3OAZK 4XPFH 3BGFC 4CKVX 3D6GA 1A3QA 2C1PB 4MAYA 2A6JA 2ZUWA 3Q1SL 3MZGB 1QQDA 3OKDB 4OBSA 2X05A 3MV11 4X6DE 4UQ2A 3AB0C 1OAYL 4RAUA 3O6LL 5EUKB 3DSFH 1QRNE 1A3LL 3QH3A 2ERJC 3GHEL 1S5HA 3LRSA 5FEBA 4BFIB 4A2MA 4P5MA 2XTJB 4QHLB 3UJIL 4E5XA 2CIKA 1NGXA 2VDOH 4WHCA 5GS2D 3OKNB 3VCLB 3UZEA 2EDWA 3RIFK 4MJIA 5C8JB 1I1FA 1UXWA 3NCYS 4PJHB 3QIUD 1N5AA 4ZNEA 4WW1B 5SWSB 4OCWL 4X7SH 1JPSL 1LO4H 1NAMH 2EDQA 1L7TH 1U6AL 4AMKL 4CL7A 2WK2A 1MI5D 3THMH 4X99A 3QQ4B 2ESVB 5HGAB 1YNKL 2J8UF 4FXGB 1LE5A 4ZO9A 3VXUB 1HSBA 3VD5A 2GYSA 1FVCA 3GRWA 1AD9B 4QRUA 3OGOE 4ETQB 1RVFH 4M03A 3QDJB 1NBYB 5EORL 3VFMB 3UTOA 4JFDD 1OQOA 1U8JA 3AC0A 3E6FA 2MHAB 5F88A 3QB7C 4NWUH 5IMMB 1HYRC 3W11C 2V9RA 2HJLA 1OTUC 3HZVB 4O58L 4PGCB 4PBWD 4KKAC 2WLYA 5ISZE 1Z9MA 3EYQC 2C4FU 3MBED 4JDVB 1R3HB 3Q5YA 3BESR 4KWUA 1EHLH 3D39B 5B4MC 1MIMH 3C6SA 3O6MH 2VIRA 5LXGH 4WUKL 1VADA 2N56A 2YA2A 3W0WE 4OIIL 1T3FA 4I0PD 2GJZA 3U4BH 2XXMB 3IRZA 3ZE2E 3QEHA 2CIIA 4KXZI 2DQJH 3BKYH 2DQUH 4NHCH 3MLUH 3BQUB 3F65A 1XGYL 1FG9C 1BGXH 4NKMA 1R0AL 3T2OA 2Y7QA 1NDGB 3TT3L 3F12B 2D7PA 5HDBE 5L8LB 3CVHL 3VWJD 4FQLL 2HH0L 2XWTB 3EOTL 4WO4B 5T3ZE 3IYLW 2DIBA 2MFNA 1DL7H 3S36H 4I18C 4IRJB 3ZDZE 1TJHL 4LPXA 4URTB 4TVSa 3MV8B 5MEPB 1HHGA 4I4WA 5DD6B 5T1DH 2VO5A 4BQ8A 4L3CA 4UDTA 1BVLA 1WZLA 5TDOB 1BD2A 1ZVHA 4XNZB 5FO9B 5LGJA 1UQSB 5LQBH 2H2SC 5D9SB 1WGOA 2ITCA 4BYHA 1RQ5A 4F9PA 1XGUA 1R5VA 3STZA 3QUXC 3B6SB 2EO9A 2H3NB 2QQLH 4MJ4A 4D9QE 3VXTB 2VXUL 1IC5H 3INUH 4R7NA 5IVNA 4NKDA 1KIRA 4OZFG 5LKNA 5DEZA 1QSZA 5IR1A 3NA9H 4RBPH 3G04B 5JA8B 4CADA 3FRUA 1IGCH 1KC5L 1OVZA 1ONQB 2OR9H 4PJBF 5SV3A 3CMOH 2XKNB 3HUJE 1IAIH 4M1DH 2GI7A 2HG5B 1XIWB 1ZA3A 1S78D 1T7ZA 4G8FA 1T4KA 5C08D 5BO1H 1I7ZB 5D6DC 1KELL 1ZANL 3CFEB 4U1IB 4OT1L 1YPZB 4N68A 2IBBA 1JGVL 1T22A 1HQ4B 2AJYL 2FBJL 1RMFL 5IVXA 3BHBB 1TXKA 1ADQL 1UENA 5FHAH 1KFAL 5ALCL 1VFBB 5ACLA 2VLKB 4JO2L 1M6OB 1I1AA 3SDDB 3TLRA 1Z9OA 4FQJL 4N0FB 3TNNB 2AI0L 4BSWB 4LSRH 4NO5A 3N1FC 5BMFL 1FIEA 5HYQA 1FYTA 4E0RB 1OCWH 3SKOB 1A2YA 1WQVT 4IRSB 3MV7D 4NKOB 2FECI 3VXSD 1KLUB 5D7LB 1EDQA 1ZEAH 3FQXA 5HGHA 4KJQD 3ABZA 5EO0A 1LO0L 4OZ4B 1VKXA 5JA9A 1JTPA 3DXAD 4IDLA 4LHJB 3QJHA 3V6FB 1E4JA 2XY2A 3U6RB 5DD3H 5GRVL 3FOMA 5DYOB 5CLWA 1U8OA 1S7RB 4P2QD 4S1DC 5ID1B 4MB4A 4OZGF 2DQGH 1KJ3L 2FHBA 3TH4T 3ULUE 3UTPD 3HE7D 2NXZC 3B9KA 3MODH 4M7KH 3SGJA 3GJFA 2E27H 5IKCB 4GW4B 3WIHL 2YKLH 4JKPL 4LL9A 4D0BA 2XQBL 3V9FA 3GSOB 4ODXA 1LNUB 3N06B 3O8XD 1NH6A 1ZT4B 3UEZA 1FFQA 1K5NB 2NTSP 3SQBA 2V17L 1YEKH 2QSVA 4H5SA 5TH2B 1HZHL 3WKML 1M71B 1U8PB 2A1WH 1A6PA 3KPPB 4JAMA 1J8KA 2HFEA 4H1LH 4MWFA 3SE8L 1EH9A 3N9GL 4N0RA 3MRBB 5I17B 1TJGH 3FFCE 2GK0A 1Y0LA 4L29A 4KTEH 2NY1B 1JZ8A 4UT7H 1DVFA 4S1RL 1K8DA 2DYPA 2QBWA 3MBXL 5I30H 2P5ED 3IFNL 4KUCD 4J3WA 3CVHB 4HKBB 1VHPA 4OTXL 1U3HB 1MRDL 1WWBX 1U92B 3TVMD 4KDWA 5DS8A 3EFFB 3FHAA 4HXAH 4S11A 1CFNB 1L8JA 3ZHDA 4IBLT 4UTAH 3GSXA 5GZNC 4NN6C 1NFIA 5GZOC 2PNDA 5ESAB 5KSAD 4YJZL 1A5FL 1JYWA 1EX0A 4OUUA 3GSRB 4FXKA 1JHLL 3VU2A 2BY3A 1MY5A 1XGPA 4G3YL 3BKCH 3P4LA 5EC1A 1JGUL 4Z77B 1MSPA 4OZIF 5JW5B 4PPTA 1JGLL 5GRUH 1FFPB 4MD0B 4WUUB 3DVNB 3R8QA 3O41A 1A6WH 3T2NH 3WUWB 1JHKH 2HT2D 1N7MH 3CSYB 1CT8B 2DDQL 4LOUD 4MJ5B 2A77L 1YQVL 4PS4H 1XGTB 4LSTH 3S34H 2CMRH 2WV3A 1MNUL 2DBJA 1CDHA 1ZLUH 4HBCH 3VMPA 1W72H 1G9ML 1FG2B 5FGBA 3OJVC 1PKQE 5CILH 4AH2B 4CVXA 4ZUSA 4LCYA 1NFDE 1KCKA 2XIDA 4E42A 2YWYA 4L9DA 5ERWA 1MJ8H 4X6BB 2PYFA 1JPGA 2A6IB 1MY7A 4AJ0A 4QOKE 4NM8L 5IGXH 5FECB 4KQ4H 4Z7OE 3FQTB 4H20H 2ATPA 4MS8D 4NKIH 5BRZB 3UPRB 2D03L 5JUEH 2VLRD 2FLRT 1P7QB 3UBXG 2D31B 3VFNA 1MF2L 4OJFH 3L3GB 4XP9L 2J8OA 5FHBL 2QHRL 4KRPC 5IBLC 4ZXBA 5JDJA 4M7LT 4QRRB 5DUPH 3LDBC 4U6HB 4ZOEA 1F2QA 4EKXA 3DROB 1YEFL 4MNQB 1AGFA 2Z92B 5HVWA 2FGWH 4ACPA 3HNSL 3ARGA 3OF6A 3PQYD 3UZVB 4YEEA 1NCBH 5GSVB 5HHPB 4HF5H 3TCXA 1I8MA 4LLMB 3L5XH 3NGBB 4KTDH 2VXSH 1KENH 1ZLWK 1GGCH 4FG6D 3BIKA 1XR9A 3OBAA 4WW1A 4PLJD 4RRPA 3SDXE 1CVSC 3MOBH 1CICA 3SGDI 2KBGA 3AGVA 2RGSA 4PJIB 5BZDB 4S0TD 5E99H 4JFHE 2IG2L 1JWUA 1KLFA 2AJ3A 3CDGB 4GKSB 4GMSH 2EYSB 3I6LE 2E5EA 4JJ5B 4DJMA 1HI6B 4FTVA 2EICA 3V4VL 1G7HA 4WWKC 1SBSH 5DSCB 4IIQB 5B8CB 2VDLH 2BX5A 1A7RL 4MB3A 3PWLB 4GAGH 1T5WB 3ULVH 1IKNA 4IOIA 4DGIH 1PY9A 2VOTA 3C5SB 2VITB 3VFVB 5IMMA 4KHTH 1LEIA 1H9VA 2YPVH 4PGCA 1KGCD 4NC1E 3H9SD 1MLCB 4JPWH 4Y16D 3DSFL 1CI5A 4JDVA 1U0QA 4XBPB 1G7QB 1R3IH 3BVNA 1VERA 2W38A 1A9BA 2NR6C 3MLTB 1N8ZB 1TQBB 2VDOL 2C26A 4HZLB 4NRYA 4PGEA 1RJYB 5CD5C 1CCZA 4G7YL 5CEYB 1FNFA 1KCUL 4G6FB 3UXFA 3ILQC 4K2UH 3ZLQC 2F5AL 4TNVK 4P2RD 4X7SL 4MB5A 7FABH 3O9WB 5DHVH 3NBNA 2P8LA 1LO4L 1NAML 3SEPA 2O61B 4JFYB 4PJ7B 2GAZA 4WO4A 1O5DT 2MTPA 5E1AB 1RJZB 4X7FC 2HJFA 4HGWB 5I8OH 4YPGB 3MV8A 2Z9TA 1U2CA 4LCCC 3AREA 1SYVB 4X4ME 5TDOA 2K7PA 1WUNT 4G8IB 3AY4A 1J87A 1RVFL 4WHTA 1QLFA 5T3XE 2GW5A 5D9SA 1G0DA 5DQDH 4GS7B 5GRYA 2VDMH 2NYYD 5DEGA 4P46B 4NWUL 1FV1A 2OSLA 3B6SA 4K23H 4XTRC 2AKRA 3HCVB 1IGMH 1M7IB 3VRJB 2F54E 1KCLA 2D7MA 5B3NA 2HN7B 4BUGA 5IROA 1MIML 3N1MC 3O6ML 5LXGL 3MRHA 4L1HA 4WEBH 3G04A 4ONFH 4P23D 1VB9A 3BPLB 2XKNA 3U4BL 2R8SH 1JF1B 2VLLB 2XA3A 3RGVA 2DQJL 2DQUL 2R2HA 4FQQB 3MLUL 4NHCL 5DFTA 2X4RB 1OP5K 3ZE0E 3OXRB 1BGXL 2OBGA 2PXYA 2FH8A 3BGAA 1MQKH 4QT5B 4LSVL 4XPGL 3WFHB 1B0RB 4L5FH 4EI5B 4GQPH 1S9XA 5J57B 1DL7L 1H0DB 3S36L 4GT7A 4BZ1H 3T0EB 2OZ4H 4J8RA 5CEZH 3VXRE 4OZGB 1FC2D 2V5RA 3HZMA 1S7QA 3HE6D 3UTSD 5CJ8A 4APQD 2CRZA 5DURB 4MNGE 5LQBL 2P45B 1N4XH 5IVXE 4JVWA 5I15L 3TZVD 5E9DA 4NQVA 1RJLA 4J4PD 4Q6IA 4EVNB 4HUXA 4X0KA 3NTCH 1JRHI 2QADC 2QQLL 3EO1A 2YD3A 4CN6A 4MSWB 4G6MH 1IC5L 5KSUB 2CPCA 3INUL 2GJ6D 4XHJD 3KPTA 4NBYB 1KLUA 5D7LA 1KJVB 3DI2B 3DI3B 5I18L 3B2VH 1QFPA 3NA9L 3RRQA 4J3OC 3RVWC 4X7DC 4U6TA 1IGCL 2OR9L 3JZ7A 4GG6B 3CMOL 4WJ5A 1AC6A 4M1DL 1MVFA 4MX7B 3CXDL 4ZAKA 2VN7A 1AIFB 3ESVF 3S88L 4LLVB 5BO1L 4OQTA 3U6RA 2BVYA 3C8DA 1LHZA 1H3TA 5JXED 1BQSA 1JZ5A 3QSKB 5DYOA 3EYFA 5CFHA 1JGEA 4AEHH 3WFBH 1W0VB 4JRYB 3B9EA 3FB6B 4C4KO 4Z76B 2NX5A 3D0LA 3V6ZA 5IKCA 1C8PA 3CZFA 3D87B 4EOWH 2VR9A 2R9HD 4LEOB 4EQ2A 1YN7B 4WNQA 3WL9A 4HIHB 4H25A 4Q9CA 4LSRL 1LNUA 1AD0B 4X6CE 4UMGA 1H8NA 1ZT4A 5EA0H 4OZIB 3WIIL 2BNRE 4LGRB 1OCWL 1PKOA 4HEME 3RKDC 4ZFZB 4RA3A 3A6CL 1F4XL 1FZKA 3DX8B 4YHIB 2AJXL 3ROOA 3X17A 1SQ2N 1REIA 5DZNA 4JHAH 2PO6D 1Q9WB 1OT2A 1T04B 43CAA 5I17A 2D7OA 2YA0A 1P1ZA 1BBDH 1A0QH 1VGKA 1ZEAL 3C5JB 5EBLB 1SJEB 4JFFD 3MV9D 4U6YB 1LO5A 2E8YA 2BDNH 3FCTA 1CD8A 2X5PA 4Y2DA 3QPQC 4GRLD 1NAMB 2OI9A 4PP2B 4WI5A 1R24A 3I6KB 3QG6B 4L8DB 4TQEH 2LU4A 2EE9A 3ZTJH 1U3HA 1E28A 3QIBD 2IAMD 3PHQB 5E6ID 1RUPH 1F42A 2W60B 3VRIA 4NOBA 4EUPH 5IVZB 4PLNC 4UIKH 3B9VA 3KYMB 3GSRA 3X14A 3KYOB 3MODL 4M7KL 2E27L 3OJMB 3QJFB 2YKLL 3QWOB 1FFPA 2NY4B 4MD0A 3O3AA 4WUUA 4OZHB 4M5ZH 1HWHB 3U0PB 3HB3C 2F53B 4L3EE 3V8OA 4RIRA 1T7VA 4F7TA 3KDMB 1YEKL 4POZD 2YD1A 2A1WL 5IHZB 3LS5H 1SMAA 1IGYB 3RZCB 4Z7UE 5J6GA 3LSOB 5D2LB 4YXHH 1J86A 1FG2A 4RFNC 3L5WB 4HXBH 1OGAA 1TJGL 1R3JB 4AH2A 4ZPVB 1W0WB 4KTEL 4YBLB 1WCBA 3EYSH 4NUJB 4BSVB 1XR8B 1TMCB 4K8RD 1EV2E 5D7JC 2X4NB 1R5IA 5I30L 1U91A 4K55A 1OAQH 1EA9C 2R1XB 3IXTB 3QDGB 1ZVYA 3VD9A 2V9TA 1J12A 4ORZC 2IGFH 4JRXD 4ZTOL 4HMDA 3NFNA 4HXAL 1B6DA 4UTAL 3BAEL 1P7QA 1P84K 1T0NA 2D31A 5DJ2A 1NANI 5BS0B 3MLWH 5L2JA 3LPGA 1KEGL 2J8UA 5HY9B 1NC4B 2E9WA 4QRRA 5GRUL 4U6HA 4UV7H 2ADFH 1SBBA 1A6WL 3T2NL 4MNQA 2W59A 5CMAB 4MHHI 1JHKL 5FGSA 4WFGD 3GJEA 4GG8B 1CL7H 4PJ8B 4XBEL 5ETUB 2Z31D 4KDVA 5F6IB 4PS4L 5HHPA 4LSTL 1OSZA 5FOBA 2CMRL 5JIPA 1IGTB 3DUSA 3BGFB 4LRIC 5J3HD 1UM4H 1NGZA 2YBRB 3LS4H 4WHDA 5IEKB 5DFVD 3AB0B 3AS2A 4QRPD 1LO2H 1DQQB 4QKXB 2X1XR 4JKMA 2XTJE 1PEWA 5FO7B 4Y19E 2JJSC 2AJZB 2ERJB 1F97A 1BJ1J 1E27A 4HK3N 4X7CC 1HSAB 1S7VB 4YBQD 4ZFFB 3CDGA 4PJHE 5IGXL 4Z0XB 5JO5B 4KQ4L 2EYSA 5SWSE 1LD9A 1G7MA 2UYLB 5JUEL 4LP5A 2NY0C 3CNKA 5KN5A 4IIQA 5CWSB 4OJFL 3OKKA 1WIPA 5B8CA 2GUOB 3WMSA 1FZOA 1NBQA 2Y6SD 3NAAH 4W4OA 5DTFB 5F6HI 4ZSOE 1INDH 1I9EA 3QO1A 3VFWB 4OLUL 3PDDA 1I85A 1VFAB 4GFTB 5A2FA 4L4TD 2ESVE 5DUPL 3P73B 3HN3A 3VFVA 1RV6X 3VXUE 4P4RB 4XX1E 1PBYA 1UWEL 1MCLA 4ODWB 5E8DH 4NBZB 3TA3C 2FGWL 3QDJE 4KVNH 5C09B 3BWUC 1QRKA 2CLZA 4JGUA 4QLRA 4KZEH 1NCBL 3RVVD 5HI4C 1X5XA 3MLTA 5C0BA 4HF5L 5F7EH 1EEUA 1N8ZA 2DQTL 2N7AA 3HPJA 4PY7A 3O3BA 1AGBB 4XC1H 4L8CB 2YZ1A 2VXSL 1KENL 1RJYA 3G6AA 4TULH 4PJFF 1S7SB 5A2LH 1GGCL 3PNWB 3QXTA 3D39E 3CXHK 4XXDB 3MOBL 1TZHB 3A67H 4PJBA 4J6RH 3T4YB 3MMEB 4JQIH 1BQHA 1B0WA 5E99L 3U30B 1WWWX 3QXAB 5JR1H 1KYOK 2VXVH 5JOPE 1AO7A 4AT6B 4G8EB 4GMSL 4QHNA 4YPGA 3QIUA 1KPVA 1V7MH 3TNMB 4ZQKA 3SDCC 4NKQB 2ZOKB 1Z3GL 5IIEA 2XV6B 3D0VA 3Q6FB 4QHKI 2VDLL 2Z0BA 4G8IA 4GAGL 3ULVL 5F9AC 1QFWI 4FFWC 4DGIL 1FZJB 5KVFH 1BHGA 3MV8E 3V52L 5LWYH 3QHTC 1MCDA 2Q76A 3IJSB 4KHTL 5C0ND 4I18B 2AV7A 2YPVL 1N2RB 3QNXA 1WISA 4H1LB 4JPWL 1WK0A 3O6FC 3JWDC 2W92A 5BVJB 2HN7A 4O00A 1R3IL 4LKXB 4TSAH 4XWGH 3C60D 1GZPA 4R9HA 1TCRB 4WDIA 3TPUB 1JWSA 4LLUB 2QEJA 3LPFA 3PWPD 5E8OB 3M17A 3MBEA 7FABL 3QI9D 1LQSR 1WZ1H 4P59H 3ZE1E 5IB5A 4LPTA 4O2CB 1JWMA 5DK0A 2FL5B 4EI5A 4HIEB 4I0PA 4DK6A 5I8OL 3QDMA 3T0EA 3CGTA 2Y23A 1CYGA 4JY5L 3V7MA 4PRIB 1G7IB 5DUBA 2YK1H 4TNWF 1YPZE 4BH7A 4ELMF 4OZGA 2DQCH 4LPUA 5D2NB 4OF8A 1KTDB 3IFPA 1IARB 1XMWA 4G8GA 3OKEA 2VDML 3I3BA 1U58B 2FZ3B 4LCUA 5L8JB 4DOHB 5L2KA 2VLKE 3MRLA 4PJAB 4K23L 3R0MA 1IGML 2IEPA 2XY1A 5DRZA 1DN2A 2P8MB 3TJHA 5I1KH 4MSWA 4M48H 1OT1A 3GMOA 1GL4B 4PG9B 1KLGB 2QKIA 3F5WA 5D1QD 1Y18B 3HE7C 1ZS8B 4PGBA 4ZDHA 1NAKH 4ONFL 5LCVL 3DRQA 3QULA 4Z7QF 1O7SA 1Z2KA 5CCKH 4KJPD 4MX7A 5EU3A 4LQFH 2R8SL 3R06A 4LLVA 1HILA 4Q97A 5D7LE 3MOAH 4M6OH 5GGRA 3AM8C 2Y72A 3QRFM 3KYAA 2XKUA 2OR8A 4XAWH 3HC4H 2IWGA 3DETC 4R2GC 5M7QA 4BZ1L 1DUZB 1D5MB 2OZ4L 43C9B 3QXDB 1DQTA 4XVTH 4JANB 1W8OA 1YEEH 4LEOA 2XN9D 1KEMH 3WN5C 3AMKA 2G5BB 4M4RA 4HIHA 3ISWA 5DLMH 1NCCL 2YWZA 2O5XH 3BD4A 1ZHKA 4JFZH 4RMSA 4BQ6A 5C0IA 3VFTB 4OZIA 4KY1H 5C07D 1QBMH 1MHHB 1V7NH 1P4LB 3NTCL 4YHIA 3DX8A 5AG8A 4E41B 3N1PC 4U33A 4L4VD 1Q9WA 1YY8B 4G6ML 4R4NC 3X3FH 4JQVC 2X4PB 5FKPB 3SDAA 4HWNA 1A7BA 1AGCA 3OGCB 1SJEA 1YNTB 4MVBC 3LN5A 3ME0A 1NAMA 2RAMA 5I1AB 2XI9A 3PDOA 1URLA 4LKCA 4U31A 2IPUK 1UZ6F 3JWDH 3O3DB 2OMNA 3J7HA 2W60A 3KLDA 2J5LC 5IVZA 4HIXL 4LOUC 3WFBL 1WT5C 2R0WH 2IQAB 1WFUA 4MJ6B 1UVQA 2P8PB 3GSUB 3DXAA 1QR4A 4I13B 3NCEB 1DDHA 3KYOA 3LKQB 1UKTA 2BSRB 3SJVD 3REWB 4PP8C 4EOWL 2ICWB 3QJFA 3BW9A 4X9HA 4AK1A 4LPVA 2X4UB 3U1SH 2LFGA 4DVBA 1JZ3A 4V1DB 4XVSL 3P3YA 4HS8H 1GPOH 3DV4B 4K3HA 4C83B 2APXA 2VJXA 1S8DA 4Y4FB 2ICEB 5ACZB 1LQVA 1UB6B 2P5WD 5FUOL 2HKFH 4U3HA 2YRZA 1C7TA 1DEDA 4UDUB 2D4DA 3LSOA 3I85A 4OLXH 4NYLA 5I0DA 1BBDL 1TIUA 3WYRA 4ZPVA 5EU7E 5I66A 3O8XA 1CVRA 4NUJA 2BDNL 2X4NA 4NO2B 3BN3B 5DHVB 4F8QA 5TPWH 4TQEL 3WXWL 4QRTA 1ACYH 1YY9D 5K9OB 1RUPL 3PL6D 1JF6A 3VXMD 5KW9H 4BUHA 2A2QT 5ANMB 3BSZH 1UJ3A 2ZCLL 5BS0A 2XQYK 3DVGA 3L3KA 1XGRA 3E3QE 2OTUA 2W65B 5HY9A 1D6EB 3VXPB 3IFLH 3EJZD 2M8XA 5MERA 3NVQA 5BRZE 3RVUC 2NY3C 3GIVB 4U1KB 1QLRA 2N4IA 5I8CB 4OAWB 4XRCB 4M5ZL 1DBKH 4WU7B 5CMAA 3MJ8A 3P9LB 5CBEB 3BWAA 5GS1A 4GG8A 3QFJB 3MRIB 2LU3A 2P47B 2XNAB 3LS5L 4QRRE 3C2SA 1F6AB 2CRMA 5DK2B 3RWFA 4N5EC 4KRPB 1GAFH 2DTML 3FONA 4YXHL 4MNQE 3LDBB 5HD8D 1MPAL 2JIXD 3LV3B 3BXNB 2EC9T 1GSMA 3EYSL 4JZJC 1DQQA 4Q6YA 3WFCL 4NQCB 4LASH 1DQLH 2W9DH 5JPMB 1LILA 4HS6A 5MI0B 1OAQL 3DRTB 1S7VA 4PJEF 5EOCH 3EOBB 3FT3B 4BJLA 1N59B 2H2PD 4IM8A 2V7NA 2IGFL 4RGMC 5GGTH 1B6UA 3ARTA 4PJIE 4D9RE 2GUOA 4DUXA 1Q0XL 1J0IA 1YECH 5C92A 1BWMA 1JPTH 3MLWL 3LEXB 2VC2H 1B4JL 2P24A 3VFUB 4C58B 2HVKB 2G9HB 4CJ1A 1ZA6B 2N1KA 1QFOA 2W1NA 3IKCB 4UV7L 4ZUTA 1WBYA 2ADFL 4ODWA 4LP4A 2VLRA 4Y5VC 4OIAA 4WWKB 5C09A 3MCKB 3DYPA 3V6BR 5I16B 2AEQH 5BVPH 2XWBA 1NEZG 4IS6A 4L8CA 5E03A 3SE3C 3BEWA 4CVWA 3ARXA 3RWCB 5FO8A 1UM4L 4KI1A 3UPCA 4JR9H 3LS4L 1S7SA 3Q5TA 1P5UA 4YC2B 4PJ9A 4HHAA 4UNVA 1UA6H 3B3IA 1SVCP 1KTKE 3LRGA 1LO2L 4I48B 3TBVB 3LB6C 2YD6A 3R4DA 1RPQA 4XXDA 4PDCE 5T1LB 3IJYB 5DHXB 3MMEA 3KPRD 4RQQA 2NYYC 3QXAA 5IQ7L 4Z5RA 2Q6WB 3T0XA 5FDWB 4AT6A 1QD0A 2NY6C 4CU8A 4HEPG 3ARSA 4LHUD 4NNXB 2VQUA 2YN5A 1TNNA 1FNSH 3MLZH 3TEUA 1NKOA 3SGEI 4KK6C 2NTFA 3W9EB 1BFTA 5JOFB 4PJ7E 1T2QH 3NAAL 2H8PA 1INDL 3OL2A 3WUZA 4HG4J 4O4YH 4XCYB 4U6VH 3U7YH 1ZLSL 2H32H 2HRPH 2VQ1B 3EJYD 3O45B 4ELMB 4I18A 4HBQA 3BP7B 1HKLH 1WCQA 3C5ZC 2YEZB 5E8DL 1T89A 3MYJB 5HXMA 4KVNL 4LCCB 5L88H 4KZEL 2MKLC 5FOJA 3KYNB 1JGDB 4IOSD 5CKGA 2ZOLB 5F7EL 1SJHB 4OFKA 2OXGA 3CX5J 3HG1B 1A22B 5GIRB 4YHYB 5GRJL 4LLUA 3QUXA 1NBVH 3H9SA 2VLJA 3B2UC 4RFOH 1IE5A 3LEVL 4Y16A 2X42A 5F93C 1K8IB 5BZWB 4J3SA 5F70A 3A67L 4J6RL 4NRXB 4KK9C 4I3SH 4JQIL 4O2CA 4J4PC 4EUPB 4ZD3H 5JR1L 5BQ7B 1B90A 3KLAA 3O2DH 2CDGB 4HIEA 4Q2ZB 3FZUD 1AH1A 2Z8WC 3WNPA 3C8KB 1V7ML 3T04D 3ARBD 3L6FB 5D93B 3VE0B 5EZJB 1OWRM 5DEFB 1JK8B 4MCZA 2LAGB 3BRGC 3DHMA 1FRGH 5D6DA 3X13B 2EDYA 3NIFF 3T0EE 3GKWH 5KVFL 5LWYL 2FZ3A 4P2YA 3HC0B 2JTDA 1WV7T 2HMID 2Y5TB 1RIVH 5C0CE 2HTKC 1HH9A 4UBDD 5FUCC 3MXVH 4EN3C 1YEDB 2VE6B 1W72A 5T1KD 3ULUC 2IMMA 2R0ZH 5EZLB 1KLGA 3STLA 4TSAL 3ES6A 5EUOF 1BQHG 3OXSB 5FYJD 4UAOC 2X41A 1SEQH 4FQIH 1VGEH 3MRJA 4KRNA 3BN9C 1ZKAA 5AAMA 2QSCH 2ZUYA 1TPXB 1WWAX 4ZUWB 2QADB 2DLIA 3QNYB 4YX2H 5DJ8B 4DN3H 3HAEH 1WZ1L 2VERN 4P59L 4Z9KB 1Q1JH 3EIFA 4HH9B 2EXYD 5C9JB 2FCBA 4P23A 3PF2A 4GG6E 1ZT7B 3PWUB 1IRAY 1HDMA 1OQXA 1OAXH 1A8JH 3F58H 1ZV5A 1DSFH 43C9A 4M6ML 2A0LD 5E70A 4WFED 2DTSA 4JANA 4FQXC 2BVEA 3SY0B 2DQCL 3FO0H 1EEQA 3OAYK 5I1IL 4JRYE 5HDQL 4XNMA 2Y36H 3VWKD 3WV0A 4PJCF 4WEMB 5HGBB 2OL3A 3SCMB 1NEZB 1P4LA 2H45A 2K1MA 2OQJA 3MRMB 3OKLB 1I1CA 4HUMB 4HJGB 4U2ZA 1YY8A 3K0WA 4M48L 3HE6A 3UTSA 4OZIE 3QRGL 2X4PA 3N1GC 1RZ8A 4AIZB 3DVIA 4ZTPH 3HTLX 1S5IH 1PG7H 2AV1B 5CCKL 2Q1EA 1AQKH 1U3ZA 1NC2B 1FDLH 4ZUVA 3MOAL 3NCMA 4M6OL 2YXMA 1OTSD 5C70A 4XB8A 2X44D 3PV6B 4P3CH 3ESUF 5JHLH 1EO8H 4KKLC 1GZQA 3UP1A 2P8PA 3GSUA 1A3RH 1KIQA 3BMWA 1R3KB 1X5FA 2PW1B 4JO3L 5F89A 4JO1H 4JFEB 2W0FA 4HT1H 4XVTL 3ARPA 1YEEL 1KEML 3Q3GB 2X4UA 5DLML 4V1DA 2A9NH 4JFZL 3DV4A 3MRKB 4HX1A 2ADIA 3ALPA 2ICEA 3GSVA 4KY1L 5ACZA 4PRBB 2NZ9D 3MREB 4BQ9A 1XF5B 3QEQB 4NQXB 4XVUC 1QBML 1EMTL 4OI7A 5DC9B 3QUZD 5MEQB 5AYQA 1N5YL 3TYFA 3UTTB 2X10A 4OZHE 2LQRA 2F53E 4XVJH 4MXQC 4KI5E 4YHMH 4A2LA 4M6AA 4XNQB 1KULA 4GXVL 2JB6B 4HULB 5K9JH 4K9EC 5C0GB 4O02H 5D2LE 4AYFA 5IMLA 5KS9F 4HJ0C 3NIDF 1XF3A 5C71A 2YOCA 3WKNA 3EGSB 3JWDL 4RFNB 3ULUH 1E6OH 4WENB 3RNKB 3RFZC 1ITCA 3MV9A 4Y5XC 5IB1B 1P7HL 4LVNC 1L4IA 1V05A 2AXGB 5GSRA 5ANMA 4GRLA 3PHSA 3RQ3A 5D7IB 4R6UA 5FV2A 3QDGE 3W0WD 2D3VA 5EOTA 2W65A 1R6VA 4YAQB 1HN1A 3VXPA 1BIHA 4JRWA 1CDGA 4YK4B 2APFA 3U1SL 4U1NB 5I8CA 4XRCA 1A1OA 1H3GA 4HS8L 4JVPA 2BVTA 1NUNB 1CGVA 3WE6B 3BD5A 5T3ZD 3QFJA 3O4LB 4R4BB 2VNCA 2HKFL 2AEIT 2E8ZA 5HYFA 3LN4A 1HH6A 5KVGH 4XMPH 1BBJB 5DXWA 4YHKL 3EYOA 4OLXL 5DMGC 3IAQA 3R1GH 3BXNA 1K4CA 2VZSA 2Y6SC 4P4KD 2GSIA 5EIQA 3T65B 3IU3A 1A6AA 3MA7A 1MAML 4NQCA 1F3JB 4EXKA 3ZO0A 5TPWL 4PJFA 5JPMA 1Q9KB 3QUYC 5KSVB 1D6VH 3DRTA 1ACYL 5FB8B 3ZYIA 5GS0D 3ZKSD 4D9QD 3FT3A 3QEGH 1FZMB 4OUOA 3ZT6A 2E6PA 2B7DT 2YD2A 4KC3B 5KW9L 5GGRY 1EEZB 4R0LB 3BSZL 1PY4A 4JFDB 4M5YL 1Y6KR 3PWNB 5DQJA 3JSSA 2HVKA 3B8SA 4PRPE 2BVPA 3IKCA 3TN0D 1QR1B 1D5BB 3MJ6A 3EAKA 1DBKL 1T21B 2QJDA 5AAWA 4TUOA 4WWKA 2DRUA 1FL6B 4KV5E 4MD4B 2NY0B 4HKXA 5DA4A 1K9TA 1S7WA 2ZUVA 2WWMC 5MENB 1MCJA 1B88A 4PB9L 3IDXH 4XWOD 5CHNA 3L3HB 3AVEA 4BM7A 1OPGH 2GEEA 2VDKH 2F58H 3MRFB 5J6HB 3WBDA 4I48A 2VKWA 2P43B 3TA3B 4MLSA 5J1SC 4LASL 5T1LA 1DQLL 4F37F 4OKVB 3MV01 2WZPD 4WHYG 5CUSH 4ODUA 1EVUA 3O0RH 5EOCL 4KK5C 2Q6WA 3WO3B 5FDWA 1MCCA 5DGQA 3VH8A 4MA1B 5FM8A 4Q9QH 1P4BH 3IGAB 3LD8C 2EDTA 5GGTL 3QEUB 5E94B 1D9KC 3S8WA 3BKMH 3RHWF 4LLDB 1U8NB 4WI8A 1YECL 1JPTL 5DFWH 2VC2L 4K9EH 1GRWA 2X89D 1EIBA 3CPLB 3DYOA 2VQ1A 4KH2A 1A21A 1CTOA 3BP7A 2JJVA 2AW2A 3MYJA 1GOHA 4R26L 3ZKXC 3SDCB 3PHOB 4LCCA 12E8L 2Q7YB 3DLQR 3WSQH 1XZ0B 2R1YA 4NPYB 3JVGC 2F19L 1JGDA 4G59A 1F45A 2H6PA 5BVPL 2AERT 1JMXA 5E2UH 4NZUL 1S7TB 2EDHA 4JR9L 5EN2A 3MO1A 1IGJB 4JN1L 4LF3A 5E6YA 4UT6L 5EUOB 2YSSB 1CS6A 5BZWA 2UUDK 3O6FB 4NRXA 3WDIA 4KTYA 1QO3A 1CLOH 5JORB 3TPUE 4GAYB 5BQ7A 2CDGA 4Q2ZA 4V2CB 3RDTC 4O2FB 4L8SC 2DJUA 5GGVL 2K7QA 5INCA 4FFYH 1FNSL 3MLZL 1V8HA 2CKBA 3FFCD 3VE0A 5D1QC 1NGPH 4OF6A 2FO4B 5DEFA 3ECBB 1T2QL 3D85B 4DTGL 1X6NA 2WAHA 5AD0B 2ZUUA 3BPOC 4O4YL 4KJPC 3GI8H 4PJ5B 4U6VL 3U7YL 1RZFL 5F97E 4PRIE 3HC0A 1BJMA 3HUJF 2DL2A 2Y5TA 4LBEB 1XF4B 3QG7H 3QUKB 4LAQH 5D2NE 3MLXL 1D5ZB 1OTTD 3L3JB 3TIDA 2VE6A 3VXSB 5L88L 4NZTH 1HK6A 4PYGA 4PJCB 4U7KA 2WBJC 5EZLA 2R39A 4CDGC 3QCTH 1DBBH 3SGKA 3WNKA 3OXSA 2YA1A 4W68A 4DOHE 3IXAA 1G9EA 4YWGH 4PJAE 2AJSL 3MCG1 3OR7B 5KVEH 4OCSL 1UM5H 1JCKA 3RJQB 5LAXA 1NBVL 1S9VB 3L3OB 4WFFE 4ZPTB 4RFOL 2A74B 2DWDB 5DJ8A 3NH7H 1OGTB 5FK9B 5EO1A 3EZJB 3TCLB 4P2QB 3CFDB 3GMPB 4HH9A 5C9JA 3C60A 5JHDD 1ZT7A 3HE7B 3PWUA 3SE9H 3O2DL 2HLAB 1G6RH 1C16A 4LLQB 4CVZA 3HPLA 1YA5A 1MQ8A 3PWPA 3MRGB 5IB4A 5DMKB 3MRRA 4DGYL 4NO0D 1M1SA 1ZHNA 5F1IB 1NLBH 4FFVC 1FRGL 3HZKA 4PBXA 4BELD 3SKMB 3QZWB 1F00I 1K4DB 3GKWL 2WM0A 4EXPX 1MCQA 4JCMA 5IW1B 1KCGC 3H9ZA 4R2GB 5IT2H 1KT2B 1RIVL 2BVQB 5MP6H 2ID5A 4OI8A 3MXVL 3OKLA 4GW1A 4HJGA 3MUZ1 3QFDB 4RFEA 1RSFA 3WN5B 4F33A 2R0ZL 4RGNE 2I07A 5GGVY 3ARQA 4I5BB 1CD1B 4NGHH 1UKQA 1CU4H 1SEQL 4FQIL 1J8HA 3ULUF 1VGEL 4E41E 2CK0H 1UACH 4PR5A 3U48A 1CFTA 4ODVH 2C3HA 4YX2L 2QV2A 4PBVC 4DN3L 2BXYA 3C08H 3WFEL 3KJ6L 5HYJB 1LMKA 4N9GB 5IHLB 3PV6A 1KJMB 3E2HC 4PLKD 3BEVA 3DHJA 1MVUA 3SPVB 4M61A 3BUYA 3EFDH 5SWQB 2FJHA 2DQEH 1FP5A 1KTRL 4TSCH 4WV1C 3M8OL 3FO0L 4XZUB 1IFHH 3NFPB 2Y36L 4HWBH 2Q86B 3QIWD 2J5LB 4LGSB 3ULVE 4MJID 3SO3C 3V0WH 2JJWA 4H26A 4W70A 4NQXA 3BGMB 1IC1A 1I9IH 2PCPB 3I6LD 3HA0A 3ZKMC 4RAVA 4V1DE 1T5XA 2YC1A 5FA3A 5EWIH 2C5DC 3FL7A 4NIKB 4XH2B 4NZDA 4TRPH 1FAKT 1PQZB 4UQ3A 1RHHB 3HMXH 2JB6A 3CU7A 4ZTPL 2A6KB 3WHE1 4DFHA 5F3BB 1H5BC 2MKWA 1NMAH 1S5IL 3UO1H 1PG7L 3F62A 1X5HA 1DQJA 1AQKL 3GO1H 1S9KC 2XOTA 3P77B 1A7OH 3K8MA 5I1GH 1WC7B 5IB1A 3U9UB 1Z9LA 3DGGB 4P3CL 5JQ6H 5JHLL 4PJEA 1EO8L 5D7JA 2EDEA 1A3RL 4IMKC 4BH8B 1IEBA 2G2RB 2H9GA 4JO1L 3V79C 4HT1L 5HD8C 4YAQA 5I19H 1QHPA 1G6VK 1BZQK 2XTJC 2H1PH 2EH8H 4S10A 3VFOB 3QQNA 2A9NL 3U9PH 2XZAH 4F7EB 4OGYH 3PDGA 2OYPA 1NFDF 3P2TA 4ZFGH 4X98A 3C9NA 1HIMH 4OI9A 1K3IA 5EIIB 3KS0H 3PXJA 2G5RA 5FUZH 4MCYB 4XVJL 1R5WB 2NY3B 2APBA 4YHML 1XF1A 4RMQA 2IH1B 4ODSL 5T3XD 5ENWA 3TP4A 1FNHA 1F3JA 3ARUA 5K9JL 3TIEA 2B1HH 3VXOB 2YXFA 3BPCB 3PGDB 4JPIB 4O02L 5D72H 1EEYA 5KSVA 4KKBC 1BD2D 4P2CG 2CUIA 2DWEB 3LQZB 2R56H 1DBMH 1GVIA 3IDJB 4LRIA 1FZMA 5C0RH 3F6IA 3S96B 5HGGS 3REVB 4P5KB 4YDIH 4LCWB 2PR4H 3ULUL 1E6OL 4AEIH 1G9NL 5C2BH 3EDJA 3U0WH 3KPMA 3G5YA 4JZJB 1LEKB 3PWNA 4LDEB 1HKFA 2JJSA 1WBXB 3RVXD 1FNGB 3TYGH 4GBXC 3RUGA 5A1AA 1GH7A 1NSNH 3ZSSA 1MHPH 4MQXC 5IW3A 4PTTB 1ZTXH 4Z78B 5ALBH 1U8IA 1T21A 2RB8A 3SDXF 3K4AA 3T0VA 5EOQL 3WCYA 1I3RA 3CVIH 1CLZL 1S3KL 2WSKA 4P2OD 4G42A 5MENA 1G7LB 3W81A 4R97B 1C1EH 4TUJB 2HRLA 4XMPL 2JB5L 1H3VA 4NSKA 3L7FA 2J6EH 2OJEB 5TGBB 3G5XB 3AU1A 1WZMA 1AQDB 5IQ9B 3R1GL 4P2RB 4PRAA 1VEMA 3TA3A 4F7MA 5EU4A 5DQ9B 3HAEB 4MQ7A 4PFEA 8FABA 1FFNB 3RIAF 5B38B 1D6VL 4U7MA 3D9AH 3D48R 3N85L 1T83C 3FAXA 2YN3A 4UTBL 5JXAL 3QEGL 1JYVA 1I8IB 3VFRB 3MUGA 2JIXA 5FCSH 3RL1B 3EOAA 5ELIA 3HC3H 3WDHA 4DZBB 5HHQA 2A9MH 1FYTD 2AXFB 3FO2A 4X9BA 3OAYH 1U8NA 2QL1A 1IC4H 3M45A 5AUMB 4TUKL 2CLRB 4UU9A 3RI5K 1IQWH 2IPTH 2J1KA 3IVKB 5ADPH 1EAPA 5KJRH 3ET9F 2YS4A 1H3PH 1J0ZA 4ZFOA 4MNHA 2BNUA 3Q5OA 3IU4H 2KQMA 3QWRA 5I76B 4Y4KC 4JFQA 4K3DH 1T1WB 5F44A 3D3VB 5C7XH 3NCCB 5FYJU 1WWCA 4ELME 4XNXL 4XP4H 1ZE3C 3IDXL 1D5XB 2X4SB 3JV5A 2GTWB 4YR6A 1I8KA 4IMLA 4D3CH 1OPGL 5F96H 2V2TB 1IGJA 1NGYB 5JMOC 3V7AG 5EUOA 5SX4H 2A83B 1S7UA 1J18A 4Y1AA 3O6FA 3B9KD 2BNRD 4EDXB 2P7TB 3HG1E 3FN9A 5E00A 1U8HA 1HHIB 3DX6A 3KPOB 3O0RL 3MXWL 2NXYD 4O2FA 4QXUL 4DGVH 2DKMA 3ZTNH 4Q9QL 5CZKA 4QHUB 1FVEB 3W9DB 3GMLB 4Z7QE 3QWQB 4U0QB 3BKML 2P46B 2MNUA 3ZHKA 5T5NG 3TZVB 1T7YA 1PFCA 3OHXA 4K9EL 5AZEH 1E6JH 1PG7X 4PJ5A 4AIOA 4ZNCD 4LHUA 3QNZB 4X4XB 5CP7A 4JZNA 4HFUH 2IC2A 1WITA 4OCMC 4ZUUB 1DN0B 3G5VA 1V3LA 1DVFD 2GJ6B 3GSWB 2DYPD 4JN2B 5TJWK 3ZE0F 2HFFB 3WSQL 4PJCA 1QUNA 1BZ9B 5C0AA 5TE6L 2KQNA 5MHSE 1KCRH 5E2UL 1AGDB 4M6NH 4XP5H 2EYRB 1ZXQA 3H6JA 5CP3H 5HI5D 2BK8A 3VH8G 4JY4A 1S9VA 4ZPTA 5DC4B 4U1MA 2DWDA 2BC4B 2CK2A 2VAAB 1OGTA 4EN3B 1IMHC 3VWKC 3TCLA 2JELH 1ZOXA 3DTXA 4HKJB 1NGWA 3RJDA 2IPUG 3I2CL 3JTTB 2YD4A 4UAOB 5HVHC 2ARWA 2QR0B 4ALAH 2L4OA 1MAKA 2RCSH 5CSBA 1UJTA 4WTWA 2A6DB 4QTHB 1BFVH 4FFYL 3JWOL 4O51B 1VACA 2JCCF 3HKFA 4A6YH 1BFOA 4F7MB 5IHBA 1NGPL 1QVOB 3BZFA 1BQUA 2WUCH 2HTLD 4UNTA 3FB8B 1QFUL 4JM4H 5IJKC 2WQ8A 4IOFD 5IVOA 1OWWA 4LNRA 3QZWA 1K4DA 3ZL4H 2XZQH 5JW4N 5IW1A 2XWJB 1Y6NR 1LK2B 1AHWC 3ARBA 1KV3A 3QG7L 2V5SA 1KT2A 4LAQL 2BVQA 2PO6B 5CJXC 5HHVH 1M4KA 1I3UA 5A3IC 4NZTL 4FQXB 3LPWA 1DBBL 2IADB 4KJYA 3CCHB 5C3LD 1CD1A 5E8EA 1AKJA 4OD1H 4QCIA 5GJTH 2J88H 1JI1A 1FLRH 2R2CA 5KVEL 1UM5L 1M7XA 1QA9B 3OKMB 1PSKH 3TBSB 5D1ZA 4KROD 4K7PY 4CMMB 2ZSVB 3NH7L 2OMBA 5E6IB 5IBTL 1MJUH 3EKCA 3TO4C 4KVCH 5HYJA 5EBWB 5C6TH 4JQVA 3K2MC 4ZXBD 1CBVH 3G6DH 2DKUA 4X6CF 3DGCR 3UDWC 3SE9L 1J0JA 4MVBA 3QUZC 1G6RL 1XCQB 1OAZH 5KS9A 3KGRA 1WTGT 3SPVA 4GMTH 5EU7C 1IEHA 2XQYG 4PRNB 1A6TB 4IHOB 1P5VA 3QQ9D 4Q9BA 4Z0BL 4F80A 3KLHD 1NLBL 3I75B 4NN7B 2CO6B 1C5CH 4U3CA 4XNYH 3VGFA 1WT5A 4JFEE 4L1DA 4PRHB 4PREB 4Z7WB 1F58H 3KJ4C 4O2EB 3U0TB 4YGAB 4PRDB 3BGMA 4DKFH 4XGZB 3O6LH 1A7NH 5MP6L 1AP2B 1UB5B 4V3DB 5F7MC 4EBQH 4WU5B 1CICD 1IAKB 2R15A 4FQ1H 3J8F7 4BFBD 1F4HA 1NFDB 3GSNA 5FYJH 3T4AB 1ORQB 3GZKA 2LU7A 4X8JB 3S3SA 4NT6B 3E3QC 1PQZA 4F3FB 1RHHA 3QA3B 3QEQE 4NGHL 4NNPL 4JDTH 5HJ3A 4QOKB 1CU4L 1FL3A 2ESVD 2OTWB 2X7LB 3H9HB 5DJXB 1LP9B 5F9OL 2CK0L 5DJYB 3UTTE 1Q94B 4QGTA 5F9WB 5CGYD 1MELA 4ODVL 3V5HB 4POYA 3C08L 4RNRA 3QDJD 4LFHD 4TTDC 2X1QA 5HYEA 2BOCB 3L95B 2Q3AA 4JFXB 3MNVB 1YEGH 1IL1B 3GIZL 1IQDA 2E9BA 3GBNH 2GY7B 2VZTA 1QSEB 4BH8A 4YFDB 3EFDL 1HE7A 1P4IH 5ITFB 2OM5A 2DQEL 4WVRA 3TFKC 4Z7UF 3HS0B 1P2CB 2H32A 2B5IB 1QRNA 3K4DA 3U2SA 2LABA 1IFHL 5F21B 2HT3C 4J3XA 2ZSWB 4HWBL 4XCNA 5J4MA 4JQXC 4L8BB 4DW2H 4Y5XB 5D7IE 5MEOB 4LVNB 2NZIA 4QXTA 4M7LL 5DO2C 3CX2A 2PF6A 4U1HB 3V0WL 5CIPA 3GDBA 5SX5H 3LKSA 3JV0A 4HUUA 1I9IL 2EIBA 2GSGB 4HIJB 3BQUD 3BE1H 4LAJH 3P4NB 2GK2A 3QPXH 4DKEH 2WINA 3MQIA 4LSPH 5CJQH 3NPSC 3VGDA 5ID0A 4YUEH 4TRPL 2QHLA 4WO4D 5DJ0A 3FB7B 1YMMB 3KLSA 3O4LE 4IRJD 2AEPH 1NMAL 3UO1L 3MV8D 4FHBD 3EJJX 3LAFA 3BPCA 1PZUB 4JPIA 3O4OB 4IJ3C 3X12B 2APWA 2DWEA 3GO1L 3LQZA 4OM1H 3IDJA 1JTOA 1A7OL 1QYGH 3GJFK 1NCAH 1MJJA 3CVHH 3S96A 4HUVB 5J0BA 3ROLA 3S4SA 1WF5A 5C0FA 5JQ6L 4JZJA 4I0CC 1LEKA 4ISVA 4EI6B 5EU5A 1MCKA 5D6CA 4P99A 3MFGB 2DD8L 1ZLVH 1MH5B 2BMKA 3IF1A 3QUYB 5I8KH 4KMTL 3S5LA 2YUXA 5ISZA 5I19L 2ZG1A 3WHE0 1RIUH 3FJTA 4XBGB 2H1PL 4MQSB 2EH8L 1F4AA 3HLAA 2IMNA 1NCNA 1ZGLA 3U9PL 3MR9A 4JFDE 4MMXC 2E7HA 4OGYL 3K46A 4ZFGL 1XIWD 1HIML 3L3IA 1N6VA 2IH3B 1DCLA 3O9WC 2C3VA 4N5UA 2I9TA 4OZFH 5DJZA 2AP2A 2PXYD 3CLFH 3B5HA 4OV5B 3G5XA 1I3VA 5KANI 1E4XH 5IEHB 1B0GA 3Q48A 1C12A 4YHPB 5IQ9A 4MZ3A 4Y5VA 3S97C 1Q9OA 1GGTA 5CGMA 5MENE 3GUTB 4M3KB 1YUHB 1FFNA 5D72L 5B38A 2BVOB 1KELH 1G6RB 3SDDD 4HAFA 2R56L 1DBML 3OKOA 1I8IA 3SE3A 5C0RL 2JF1A 4S2SB 4YDIL 1CGSH 2PR4L 3B83A 4KRLB 2WLZA 3GMMB 5C2BL 3U0WL 5E9DD 4DZBA 1E4KC 1ND0B 1RZGB 4H8WL 1QBBA 2FSEB 1MCNA 3VD3A 4G6AD 1G9MC 5HHNB 2CLRA 2X4TB 3N0PB 3TYGL 5EO9B 4FQJH 1TDQA 3ARDA 1NSNL 3V5KB 2AI0H 5D7LD 1MHPL 2YPKA 1BQLL 1ZTXL 5FF6B 3LD8B 5ALBL 1HXMA 1A4JA 1W2KT 5GGSA 1T1ZB 4RZCB 1D9KB 1MCHA 1T1WA 5BCAA 3CVIL 1I75A 5FXCH 5GS3A 4ZAKD 3HUJA 4LEXL 1ERNA 5CEXA 3V2AR 3TC9A 2PN5A 4TVPD 3MRNA 1DZBA 2GTWA 2J6EL 3CDFA 1N0XH 1B2WH 1LO3L 1SYSA 2EC9U 3QI9B 3C5ZA 1JPFB 1YMHB 4UOW1 1YNLH 2X4QB 3M07A 4E9LA 5HI3D 4YDKL 3EO0A 3MRDA 3D9AL 3P30H 3KPOA 5E6ZA 1J05B 5HVGB 5EUOE 5J1AA 4LQ1A 4KKCC 4XPAH 1A14H 2Y07L 2R69H 2O5YL 5DF0A 2VABB 1IC4L 4YDVA 5L7XH 2D0FA 2IANB 1I8LA 4JKPH 1IQWL 2JCCB 4EIGB 2K9UA 2XPGA 1OY3B 3GMQB 3OG6B 4X4XA 5KJRL 4L8SB 3C8HA 3H7BA 5J9PB 2AEWA 2NY1D 2R1WB 3IU4L 2O5ZH 2DLHA 1FSKC 4CVUA 5D1QB 1Q72H 5ESQA 1RU9L 4JG1H 5C7XL 3VI3F 2EDKA 4PJ5E 3BMVA 4MD5B 5BV7L 2SEBB 1U3HD 3MV7E 3N9GH 3BPOB 5IB3B 5IFJB 1A9EB 1FO0H 3U82B 2EYTA 1RZKL 1TVBB 2L0DA 3VXSE 3O3UN 1UG9A 2C1OB 4MGXA 3GMNB 2OXHA 1YPZF 4Y4HC 1JHTB 4EN3A 1ZHLA 4QWWD 1JNJA 1EFQA 1IAII 2WBJB 3VXNA 1KPUA 5F7FA 1BF2A 1J0KA 1T0PB 2O26U 3OZ9L 4LLYA 3I02B 4WUUD 3ZTNL 3S35H 5DWUH 1RZIA 4GAFB 4LIQH 3ZKNC 3IDNB 2XN9B 4G43B 4P2QE 4WFHD 4RMVA 1QOKA 1JHLH 1NDMA 5A2KH 3UTPE 3UAJC 5DJDA 5TE4H 2DICA 1L9NA 2VL5A 5I73C 5AZEL 5C07B 3NA4A 2Z35B 1CE1L 4F2MB 1JNLH 5F7WC 5IV2B 1OGAD 1GGUA 1JIBA 5IMOA 4HFUL 1KB5H 3FO9A 3RWDB 4KDTC 5J06A 2DDQH 2GT9B 3CFKA 2A77H 4LCIH 4NNYB 3C2AH 3LY6A 4MAYC 5E4EC 4NUGH 1MUJB 1QEWA 1H15B 3T1FA 1G9MH 1KG0A 4FRWA 2FIRT 4M6NL 3P4OB 1WIUA 3WS3B 3W39B 5BRZD 1P7QD 4JM2C 4CMMA 1CGYA 1CG9B 3MYZA 3WJJA 2ZSVA 1XF2B 2EIZB 4HG4K 3RVTD 2JELL 1JFQH 4DEPC 4MHHG 2NY4C 2DIJA 4NDMB 4QRRD 1HXYB 1U93A 1XCQA 4ALAL 3SJVB 4LHUG 2RCSL 4KI5C 1BFVL 2IBZX 4MNQD 1TTUA 1ZWIA 1NJ9B 4A6YL 1IC7H 4OLYH 5HYJE 1H8SA 2WUCL 4GLRH 1X4XA 1J9CT 1P7KB 2ZNWA 4JM4L 4X9GA 3RZCC 3CX5K 4HFWB 2P5WB 3ARYA 3HI5H 4R7DB 3ZL4L 5IM7B 2XZQL 3E2HB 2R4RH 3KWWA 4Z7UB 3U0TA 1J1OH 4XGZA 1X5LA 1PKQA 1UB5A 3HNSH 3MJ9H 5HHVL 1JN6B 4WU5A 3IETA 4WV1B 1NFDA 3PJSB 4D9RD 3CH8A 2V5YA 1DTUA 4GKNA 4I1NB 5M95B 3BPNB 4F3FA 2C4XA 4ZO8A 3E0GA 3OR6B 4QOKA 4ODTH 3UJJH 2J88L 5A40E 1FLRL 3HHRB 3SO3B 2OTWA 5DJXA 3OG4B 1PSKL 1Q94A 2WQRA 5DJAA 3GMRB 2BNQB 2Z91B 4HC1A 4J7RA 3IJHB 4YFEA 4HGKC 3PL6B 1MJUL 2BSTA 3VXMB 4KVCL 4XC3H 3EYVB 4X5WA 2IG2H 4HDIB 2BCKA 5C6TL 4MXQA 1CBVL 1MEXH 3G6DL 3L95A 3ZYJA 2Z93A 3MNVA 1FNEB 1P6AB 5DJ6B 1WBZB 4NQDB 3T77B 5EC2A 1OAZL 5E8PB 1H5BB 4OLZH 4Y88A 4GMTL 1TVHB 4GW5B 1ETZA 3Q2CA 2FIKB 3MGOB 4PJ8C 3DX7B 1A7RH 5D5MF 3DYMA 3HS0A 4PP1C 4NCC1 6FABL 4WW2A 3U4AA 1Z5LB 2D7TH 4W6YB 2EXWC 5C0BD 2C3XA 4U3XA 4L8BA 4M8QB 1C5CL 5MEOA 5ICZB 4XNYL 1F58L 5A16A 5I9QC 4DKFL 3QUMA 1A7NL 2GSGA 2ARJA 3OPZH 1LEGA 2HFTA 4HIJA 4P3WA 2EZ0C 4EBQL 1MCPH 2GIYA 4NQEB 3SDXA 4FQ1L 3GM0A 4F9PC 5D1XC 1MHEB 5FYJL 1HHHA 1LWRA 1P69B 4Y19B 3QIWA 3FB7A 1YMMA 5B39G 2V2WA 3UMTA 4JDTL 1LVEA 1AO7D 4G7YH 1YZZA 3OQ3B 1KCUH 2CR3A 3PWVB 1HHJB 2F5AH 5F7KC 2E9JA 1OB1B 1EO7A 2R0KH 4C56B 2X70B 4HSQA 4OF7A 1CR9L 3VGAC 4F7PA 4QRQA 3ZSTA 4HUVA 3T2QA 4ZSOB 1RFDL 3V0VB 2A73B 1YEGL 4P46D 4EI6A 4X6FB 3GBNL 1VENA 3HZYB 1V5JA 2NNAB 3VFGH 4N1HB 5BJTB 4J3TA 1P4IL 3OJ2C 2CRYA 3QUYA 5ICXB 4LCWE 1II4E 1N6QH 4UIMB 4M1GH 5DRWA 3EDKA 2KKQA 1U8QA 2V2XA 2QLVB 5H2BA 2XICA 3MGTA 4J3UA 1YC7A 4DW2L 3RWGB 5IB2A 4JLRB 1AGEB 2HVJA 3DBXB 1I1AC 4JHZA 5JDSA 5JZ7D 1PDKA 2UZIH 2MMXA 3BE1L 4GBXB 4OM0H 2NY2D 1MIEH 3QPXL 4DKEL 4NZJA 4LSPL 1XCTA 5CJQL 3U30C 5IF0A 4OV5A 2VMFA 4YUEL 5IEHA 2BOBA 4OCNC 1LE9A 2UZYB 4OCYH 4EI5D 3UJTL 35C8H 3KPRB 1BZ7A 3PUCA 4PJIF 3WLWD 2AEPL 5L9DH 3FO1B 3QDMD 2PTVA 3T0ED 3GUTA 1TTFA 1JJUA 1L6ZA 5FYLD 3GRWH 2HT4D 4C57C 1D3CA 4UILL 3SE4A 5LGHL 4QYOB 2BVOA 5GJSL 1C5BL 4OM1L 4X4MA 2F5BL 4LSVH 4NRZB 4P2RE 4MAUH 3WXVH 2H26B 1QYGL 1NCAL 4XPGH 4KMQA 5DURD 1J88A 3FQNB 4G8GD 4K3JL 4U1SB 3GMMA 3JTSB 4G9FB 1X7QB 4A6YB 4D8PA 5L2KD 2IALB 1FL5A 1F11A 1UH2A 4X5XB 5IBUG 2XTLA 3HNVH 1Q9LB 4KKNA 5IMKA 3GSQA 1LDPH 5I8KL 3TJHD 5D71L 3AS0A 1RIUL 1WFTA 2DJSA 3DARA 2F54A 1K85A 4QHMB 2WW8A 4J3VA 5I15H 2F74B 3KAAA 1UZ8B 4LSDA 1D9KA 4AEEA 5EPMA 2CLVA 3KPQB 4PJXF 3PIQB 5CSZA 4F7CB 3RWIB 3PGCB 4V3EB 1JZ7A 4EJ1C 3OJDB 3CLFL 3O11B 3UYRH 5I18H 1FCGA 4HPOH 4Y89A 1E4XL 1BMGA 3LKOA 5CZXC 1G7JB 4JRYD 1F90H 2Y25A 3D3VE 3S4SG 2Z4QA 1KIPB 3AUVA 4F58H 4PJ7F 3RAJH 3BO8A 3CXDH 4Y4KB 4P2OA 3S88H 3JVGA 2C9AA 5H94B 4YDJA 5F71A 5D2NC 3BDXA 1UCBL 3S5LG 1J05A 3VXRA 5T1MB 1DVFC 2O93L 1R3LA 1CGSL 4OCLC 4R96A 1OLZA 3RTQC 4MNGA 1IT9L 5DI8B 4DZ8B 2P44B 2VABA 2UWEB 2DI9A 2PYEB 3L7EB 4LRNL 4ZO6A 4D0CB 5EZIH 2IANA 1YJDC 2DF3A 4NP4L 1KB9K 3RDTA 3CFBA 4L8SA 3SDAD 5J9PA 3HR6A 3WIIH 1DP0A 1WFNA 4MDIA 5KAQG 3A6CH 4M1CC 5F9JB 1F4XH 5B39B 2AJXH 4N0CD 4Y8AA 1TETH 1FGVH 5GRVK 5IJVA 3HMXA 3E8UH 5HHOB 3RBSA 5IB3A 2FWOB 2PUQT 1QG3A 2LV4A 1E4WL 3OMZA 2GJ6E 1N0XL 1B2WL 3DO7A 2JK5B 2HTLC 5F7LB 3GHBH 4HV8A 3TO2B 2WBKA 1NKRA 1YNLL 3RPIA 3WNOA 5FYKD 2FR4B 3IB4A 4KK8D 2WBJA 3ULSB 5GS0L 4ELKA 3P30L 4WCYH 1A4KA 2DQFB 4RGNC 3MJGX 5FUCE 4HUWB 2F53D 5I2IA 3P0VL 4XPAL 1FN4A 4G43A 5F6HJ 1A14L 4X6CA 2R69L 1CTNA 4CMHC 2BNRA 3VWKB 1A7QH 1T66D 5L7XL 1ODAA 3TBYB 3P4MB 1ED3B 2GITB 1J0YA 3HRZB 4ORGB 2OCFD 2Z35A 4UOW0 1IM9B 2FNBA 4WRLA 5HVHB 5IV2A