3MRDA

Crystal structure of mhc class i hla-a2 molecule complexed with hcmv pp65-495-503 nonapeptide v6g variant
Total Genus 79
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
79
sequence length
274
structure length
274
Chain Sequence
GSHSMRYFFTSVSRPGRGEPRFIAVGYVDDTQFVRFDSDAASQRMEPRAPWIEQEGPEYWDGETRKVKAHSQTHRVDLGTLRGYYNQSEAGSHTVQRMYGCDVGSDWRFLRGYHQYAYDGKDYIALKEDLRSWTAADMAAQTTKHKWEAAHVAEQLRAYLEGTCVEWLRRYLENGKETLQRTDAPKTHMTHHAVSDHEATLRCWALSFYPAEITLTWQRDGEDQTQDTELVETRPAGDGTFQKWVAVVVPSGQEQRYTCHVQHEGLPKPLTLRW
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HLA class I histocompatibility antigen, A-2 alpha chain
publication title Analysis of Relationships between Peptide/MHC Structural Features and Naive T Cell Frequency in Humans.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
total genus 79
structure length 274
sequence length 274
ec nomenclature
pdb deposition date 2010-04-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00129 MHC_I Class I Histocompatibility antigen, domains alpha 1 and 2
A PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3mrdA02
3.30.500.10 Alpha Beta 2-Layer Sandwich Murine Class I Major Histocompatibility Complex, H2-DB; Chain A, domain 1 MHC class I-like antigen recognition-like 3mrdA01
4PJGE 4ENED 3LEXA 5MI0C 1MCEA 3WXVH 1KCRL 1ZHBA 4JHZA 1VPOL 4ZSOA 1YEFH 1I7ZB 3GSWA 2YUWA 5FYLH 4AIZA 2AXHA 4HX1A 2GJ6A 2IBBA 4N0UE 4NRYA 4LCWA 4RAUA 2ZG2A 4ODTH 3EHBD 3MJ8B 1F45A 1CDIA 4PJ5B 3EO9H 5DVNA 1BD2A 1Z9MA 2EKSB 4YX2H 1MAML 1KN2L 4K23H 5DK0B 4GBXC 1KLFA 3BYTA 2PYEE 4H25B 3BPNC 3TA3C 3E2HB 4IRZL 4CVXA 2JJVA 2Y7QB 4XAWH 2VUOA 3QWQB 4YFLF 4NFDA 5IJVB 3ARDB 1JGUH 3VXUA 4OZIA 4LIQH 2YMXH 3B3IA 1B6UA 4P2OD 4JFXB 3VRLE 1YYML 1OPGL 1IM9A 4DGVL 5IHUH 1HHGB 4QHKI 1RZGB 3WJJA 3RWGB 4ZS7L 3OAUL 5I73C 4NO5B 1DANU 4LCCC 3E6FB 5BMFH 3DNKA 4MQXC 4Y4KB 1JE6A 3U30C 4QF1A 1Z0MA 1OW0A 5AZEL 2ARWA 4YEFA 3UDWC 3D18A 4RFEB 1S8DB 3PIQA 3QHFH 1T6VN 3MYJA 4ZFFB 3IDNA 4P59L 1LO3H 5TQ2H 1ZT7A 4OD1H 1N59B 3N06B 5C07B 2CXKA 2ESVE 3TBWB 1F58H 1C12A 4EUPB 2EICA 2Q6WA 1KF9B 1EFQA 3IJSA 5EU6B 4B0MM 5DD5H 3PDDA 6FABL 1BBJA 2VDML 4P9MH 3KPSA 1NPUA 4E5XB 4NNPH 1VACB 4RAVA 4Y5VB 5CEXA 4RX4A 2R29H 3T0BA 3GSOA 4KTEH 4F9LC 2JELL 3DXAD 3VXPB 4OFYD 4Z5RA 2D7QA 5A2LH 1OTSC 1CGTA 4MAYB 4XPBL 3WD5H 4KHXL 1ZWIA 4LCIL 3AU1A 4YH6A 2DF3A 4JO2L 2YHGA 1I7RB 2C5DC 4MXQC 3SPVB 1RJLB 1KG0A 1LE9B 2OI9C 3QQ4A 2C3XA 4LP5A 3BESR 2ICWB 1MRDH 4R97C 3T8XB 3VFMB 5EU7C 3PJSA 5IG7A 2FBOJ 2BNRD 3IFNH 3WNOA 3QWRA 3DTXB 4HWUA 4QY8B 2NX5D 5EZIH 3UBXB 2ZOLB 3MXVL 4O9HL 1IC7L 3G08A 3ILQD 3NCYS 1QBLL 4M02A 3FO1A 4Y4HB 3QNZA 3IXAA 4PRHA 4QHMB 1TTFA 1CLZH 3TNNA 4QO1A 3GMNB 1G7HB 2CO6B 5K9OB 4ZTPL 4MA8L 1P1ZB 1K8DB 1WC7B 1WVZA 3KPQB 4LASH 3OXRA 3MA7A 5D5MA 1RZ8A 1ONQB 3K2MC 3LZFL 5IB5A 1KIPB 3HCVA 3BH8A 4AL8L 4HPYH 1OGAD 5GJSL 5ALCL 5EA0H 3K4AA 4F37F 2G5RA 1OHQA 4N9OB 25C8L 3CMGA 2R4SH 5KW9L 1U8OB 3MGOB 4Y1AB 2V7NB 1IAOA 3HZYB 5BV7C 4NKOB 2QQNH 3C8DA 5KS9B 2G9HB 4IRJA 5TH2A 5E08L 2VZ1A 5HI5C 4G7YH 4LF3B 4EQ2A 2FIKA 4QNPF 3O8XC 3QXDA 2C3HA 2GAZA 5D2NA 5IB4B 4ZAKD 3O4LE 5IVXE 1P7HL 3KLHD 1AGEA 1CF8L 3PQYD 2QHRL 1DL7H 5DJYB 5FYKE 1JIBA 1PX4A 3V5DB 1GZQA 4HAGA 4I0KA 4YHKL 5B4MC 3SE8H 1NLBH 1PJ9A 1XR8B 2A38A 4Z7OE 3MUGA 4F7CA 4KK6C 3IDYC 4HIXL 4QXWA 3GNMH 1MFAL 3HRZA 4DKFL 1W72H 1QRND 3K4DA 4ORGA 5GHWH 5CZVH 5LVEA 1KJMA 1DUZA 4I77H 4LSQH 5IMLB 4X80L 5JMOC 4KJQD 2DLFL 5I8OH 4IIQA 5E9DA 1A4KB 3QUXD 5CSGA 4PJFA 3E8UL 5T3XL 1IGIH 3KPPA 4WCYH 2A74A 1NCUA 4HLJA 2JJWA 3ES6A 4MCYA 1LDPL 1MFDH 4UB0H 2D0FA 4NQUA 4Z0BH 5ESAB 4LSPL 2E3VA 3I6LD 4ZUSA 2WQ8A 3V6OA 4P46B 3KLSA 4RNRB 2N56A 2AXGB 4HMDA 5I1HH 4NQCE 3VFSA 4XC3L 3QIBB 4JFDD 2OM5A 1QPXA 2FZ3A 3TN0D 2ZKHH 4AEEA 5DD6A 4MLIA 2VMFA 2R2EB 4Y5XC 5CLTA 4APQB 2QADB 1OP5K 2DLIA 3QIUC 1JTOA 5IB3B 2JB5H 4XMPL 2PTUA 4D8PB 3OAZK 3MRPB 1KACB 1MCOL 5KVGL 4LPWA 3VWKC 2VISA 4WO4C 4WW2A 1CE6A 1FIEA 4KKBC 5EOTB 1F4XL 2GHWB 3FOLB 4HKXB 2YC1B 5CEYA 1QLRB 4M5YH 2VXSH 2MHAA 3W2DH 1PG7X 3T4YA 5D72L 5JR1L 3MNVA 3H9HA 1FAKT 2R23A 2BVOA 2P8LB 4JO4L 3AY4C 1QSFD 5JW5A 4Y19B 1QLFA 1VCAA 4JG0L 4XVJH 1MHHB 1ZHLB 5DHVH 2GCYB 1X5ZA 4GW4A 3T0DA 4O58L 3V4UL 1F8TH 3PWNB 1MCPH 4MXVF 1D6EA 1ZA3A 4P99A 2HRPH 2HJKA 5FYJD 3CXHJ 2CD0A 2XTJE 5I1CH 3S37H 3GMMA 4NQDB 4BSWA 1XF1A 2P5WE 3QYCA 5CBEB 3MREA 4HK0B 4KV5E 3IDJA 3DO3A 1AGFB 1WT5C 5FUOL 1AJ7L 3AGVA 1HXMB 1WWAX 1IAIH 1WEJH 2EIDA 2NW3A 3WIHL 3AM8A 2VZSA 1GIGL 2XZAL 5DHYB 4K7PH 2Y06L 3OKKA 4S1SH 4DK6A 5MEPA 4OZHF 3GI9H 1EHLL 2LU4A 2PUQT 1N6UA 1G0DA 3LVEA 4PRIE 3WL9A 3ARPA 3OHXA 4MQ7B 1HDMB 1NCTA 4RAHA 3G04A 4JGUA 2VKWA 5FO7B 1CXIA 1ZT4B 5F1KC 3BPNB 2Y4SA 1RY7B 4U2ZA 1MVUA 3MLSH 4OLUL 3W82A 4FOMA 5D7SH 2HT4C 3STZA 3DVGB 3B5TA 3L5HA 2W65B 2CRYA 4PJCB 4HUXA 4PRPE 1II4E 3Q1SH 2H41A 1VDGA 2B1AL 2DICA 3QUMB 3H0TA 4H8WH 3VGAC 1X5KA 5LGHH 4U6HA 1H5BC 4Q58C 3BAEL 2DM3A 2Y9RT 5EOCH 1YPZF 4V1DA 3RA7H 4LLYB 5DMJB 5D7LB 4KK8D 4LCCB 2FYYA 3BVNA 4UINH 4M6NH 1JZ3A 1SQ2N 2Y1VA 5D1QA 4KUCD 1J86A 5TF1H 2AK4B 1RURH 3IFPB 3ZE2F 3KWWB 1YMMB 4TVPE 1NC4D 4OUUA 3QZWG 1IGCL 3HB3D 4J6RL 4LLUB 2XIDA 1BIIB 1L6ZA 1RD6A 2OL3H 5F9WC 5E8OB 5DJ8B 4Y5YC 4PJXF 1WTLA 4OGYL 1BEYL 4B7IA 4DN3L 4R4BA 2FJFB 3P9MA 3UTTB 1U93B 4N1HB 1K4CB 3NIFF 1KCRH 4NGHL 4YHPB 1VPOH 3Q3GB 3V9FA 4M4PA 5DXWA 1N8ZB 3VFGL 3QRFM 1UKQA 2XRAL 1CI5A 3O3DA 2Y5TA 3RWIA 3HC4H 1KV3A 4JDTH 2IG2L 4POYA 5A2IH 4G6AD 5DSCB 1UXWB 2XWJB 4JRYA 3WFZA 1WBYB 1MAMH 1JCKA 1DJSA 1Q72H 4G9DB 1DLFH 4F57H 2RFXB 3UTQA 1X5GA 4IRZH 2R0ZL 1DVFA 3V7MA 1KIQB 1AO7B 5E4EB 3U79A 4XCEA 3ZHLA 5JW4R 5A3ID 2XN9A 2ZPKL 5FK9A 1T20B 3FT2A 3L5XH 2R9HD 3ZKMC 5GS0L 4ODWB 1IAII 1P2CA 3MRHA 1YYMH 5DUBB 2D0GA 1OPGH 1LGVA 4WNQB 4DGVH 4M6AA 4R97B 3P0VL 2OLDA 3HZKA 4XPTL 5DWUL 5FF6A 1U8QB 2AKRB 4L3ED 3S97C 1GHFL 3WIIH 1H8OA 5I19H 2KUTA 1JZ4A 3U2SB 3CMOL 2AEIT 4RDQF 3TPUE 5GSVB 5DJXB 1T0NA 1XR9B 4LDLB 2DWDB 4GRLC 4U1MB 4ODUB 2M2DA 4U3CA 4Y16D 5AZEH 5KSAB 3FFCE 4JY4A 4O4YH 3G6AB 1FDLL 2VXTL 4P59H 1NAMB 3L95B 3UXFA 3IETA 1MFEL 3CFCH 1FAIL 1H15A 3SE9L 1GGTA 4YK4B 3F58L 1IQDA 2DQGL 4GJTB 2DQCL 1KLGA 4KH2A 4TSCL 3BUTA 1RZIA 4M1GH 3SJVD 1YN7A 1T89C 3PL6A 4JM2A 1FE8H 1ZSDB 4WENB 2LV4A 5TFSL 5IBTH 1IZKA 5BZDA 3HE6B 2JELH 5D2LE 5BV7B 4JANB 3PWJA 4XBPB 1V7NH 3O9WD 4XPBH 1VHPA 3UO1H 4KHXH 3MRBA 3CFKA 3HLAA 4GKSB 3WDHA 1WBXB 3MRGB 1F00I 1B3JA 1ED3A 2WBJC 1P9MA 3QG7L 1I4FA 2MPAL 1QLEH 5FM8A 4PBXA 1P6FA 2GJ6D 4LCWD 4ZFOB 1TTUA 3FFDA 1U92A 3VXME 1MWAA 4Z7WB 3VMNA 1BD2D 2ZSWA 4G9FA 4ZS6D 4GXVL 2J8UB 1XGTA 3GI8L 1CD1B 2ATPB 3MA9L 4GKNA 1PAMA 1BMGA 2APVA 1R3JB 1XGPA 4Z78A 4ZUTB 1VESA 5DEZA 4QHUB 4EI6A 5A16A 1JHKH 2VH5L 5IEKA 3VXUD 4L1HA 4DVRL 3SCMD 1J8HB 4Z76B 3PWVB 3RUGF 3CPLA 4MA8H 1IM9D 4XC1L 1MPAL 1ZGLB 3LZFH 5JO5B 2PO6A 2ZCLL 4S1DD 5GJSH 3ROLB 1MQKL 3UAJC 1XIWC 4RCAA 3FB8A 5ALCH 8FABB 2LQRA 1AFVL 4YR6B 1TVBA 25C8H 3QPXL 3HC0A 4PJ7A 2XA3A 5KW9H 4X6DB 4EXKA 5GISL 4X4YA 1F3JA 5F9JA 2AAVA 5DS8A 3UROR 4JFQA 5J89A 2GFBB 4GRMA 1S7XA 1AKJA 3VGDA 4ZMAT 5E08H 1TZHA 3WLBA 3QIUB 3GM8A 1RK1A 4X6FA 3ARBB 4HGWB 2NY7L 4JGMA 2V5SA 1J5OL 5C0AE 3RKDD 4NNYA 4OF6A 3O3AA 4LU5L 2DIAA 2AQ2A 1A14H 3OMZA 2EDEA 2AABH 1FC2D 4RFNC 2F8XC 4WHTA 2E8YA 4WO4B 3N85L 3VWJA 3AREB 4HXBL 5LJYH 4KKLC 4F7PA 3AUVA 2DMKA 2YD6A 2VAAA 1QSEE 2OR7A 4U1NA 5F7HA 5HYQA 2IANB 2R1YB 2AP2A 3KPSD 3S6CA 5E2VL 5DC9B 4KZEL 4HIXH 1MFAH 4DKFH 4HJJH 4X6BA 5ESQB 4Y88A 3NMEA 2VLKE 4JY6A 4RX4D 1R5VB 1U6AL 4PJIB 2CR3A 2GQHA 2X89A 5ANMB 4X80H 3EDKA 3LN5B 3OKMB 4C56B 5FHAL 3HG1B 4KHTH 2DLFH 3TBYB 1CTOA 4UUJB 4GQ9L 2SEBB 5DGQA 4HUKB 1DQJB 3QHZH 5T3XH 2RR3A 2HA1A 5GGSY 4X5XB 5EORL 2DI7A 3N1GC 5ISZB 1B9ZA 1LDPH 2QV2A 3MRDB 5C0BE 3C8KB 3CC5B 3S96A 4LSPH 3W39B 5IB2A 5J6HB 4RIRB 1BLNB 3K80A 4OT1L 1KB5A 2OZ4L 1MCDA 3MV8E 4W68A 1DDHB 1T5WA 2ZOKB 2R2HB 3QWRD 3MSPA 4OZGF 1MAJA 3BJLA 1IGTB 5E2JA 2J12B 4NSKA 2XFXB 5CBAA 4BA8A 1NFIA 3DI2B 3GSXB 2H2SC 4MXWH 2GTWB 4ZPVB 4KMLB 4PRHD 1MNUH 1Q0XL 4N90E 5HYFA 5ICYB 5HHMD 3D0VB 4E41B 1CXEA 1NCNA 3GHBL 3EYOB 3ARRA 4FFVC 2ZUWA 5DURD 4XMPH 4L1DA 3M17B 1WSST 3IDMA 3PWPB 8CGTA 1MCOH 5HVHC 2EC9T 5KVGH 1S7WB 2Z31B 3LN9A 3RHWF 1ZS8A 4FQLL 5D70L 1LK3L 1U95A 4LCUA 2AJYL 2QHLA 1NDMB 2VQTA 3BP6B 3MV7E 1EBAA 4L4TB 2X4SB 3IVKB 1PDKA 4M4RA 3K8KA 1INEL 3P73B 1EERB 1RIHH 5JR1H 4W81A 1NCAL 4JO4H 4IRJD 4O2CB 5JXEC 5KVEH 4JZJA 2GY7B 4JG0H 2NY5L 3WKNA 3U4EB 5EZJA 1ZV5A 3V4UH 1HXYA 4XBGA 2F53B 3OKOB 2DTSA 4HFUL 4OGXL 2JLLA 4R7NB 2X1XR 5J9PB 1S9XB 4BQ6A 4P3DA 3X11A 3HFML 5GS1C 4LLDB 4LLQB 4P23A 2BMKA 3HUJB 2D7NA 5FM5O 4TNWF 4YDKL 5F9WB 3ULUD 4JB9L 4P4KA 2PF6A 4NWTL 4DZ8B 3B9KA 1RVFL 4X7TB 3JWOL 2NXZC 4OZFB 2D7TL 1GRWA 3WIHH 5F3HB 1CGWA 3QEUA 1XCTB 2XZAH 5E9DD 4X8JB 1ZLWK 4XNQB 1AQDA 2ATKB 1JTTA 3CNKA 5DUPL 4MJ5B 1EHLH 4XGZA 3I50H 1QFWL 2H6PB 4KRPD 2YD3A 4E42B 3WN5C 4GS7B 2FR4A 3O6FA 3O3BB 5KJRH 1RMFL 2X9XA 4H88L 1WJ3A 2HLFC 4MNGB 4G6ML 3QFDA 1O7SA 4ZUUA 1NGQL 1Q9KA 4RA3A 4HWBA 4Z7UA 2DIJA 4LLWA 3UYRH 5E8EA 1NUNB 4OF3A 1JI1A 1DQQA 4PGEB 2B1AH 5I1DA 2X1OA 2O5ZL 1V3LA 4MJ2A 3L9RB 2X2YA 3BAEH 1AQKH 1D5MB 1U8HB 1QEWB 4ONFL 1KT2A 2OR8A 2UWEF 5FKAA 3RY6A 2VYRE 2YXFA 3VRIA 2EH8L 4GRLB 3D39B 3KPRA 5GSRA 1WCBB 1OAYH 1UJ3B 4I9WE 5HDBF 2WNGA 3GSVB 1A6UL 3LH2L 4R26H 4QHNB 5I66A 3G6JA 3VFOB 4C58B 4JQXA 5TF0A 4HDIB 1TLKA 1KB5L 2Z4QA 1FL6B 3QDJA 3TIDB 5IMMA 2CR6A 1E6JL 2ADGB 2F5AL 5LGKA 3QO0B 4XRCA 2V9QA 4OGYH 4Z8FL 1BEYH 4AH2B 4DN3H 5T3ZE 5D1ZC 2GSGB 2HJFA 4IDJL 3TH4T 4OQTA 4NGHH 3ZTJG 2A6IB 2PTTB 4L3CA 3VFGH 3VFVA 5EN2B 4PGJA 3RL1B 1HILA 3RWJA 2XRAH 4DTGH 5INDB 4QNPE 1VKXB 1NCBL 5D1XB 3ARTA 4JVUA 2IG2H 1BQUA 6CGTA 3LDBC 1JL8A 2YBRA 4MD0B 4GOSA 4YC2B 3ABZA 1XGYL 3DX7A 2GYSA 2P1YA 2B0SL 3U6RA 5DMIH 2R0ZH 2XXCB 1LD9A 1YNTA 4FQ1H 5SWSE 5IR1B 5FHBL 1GPOL 3EO0B 3KNBA 1X5LA 1ZVYA 4PJHF 5IBLD 4HUWA 1OARH 2ZPKH 1NUDA 1KULA 1HYRC 3HHRB 2WBJB 5GS0H 4FZEH 2WINA 5C0RH 1FC1A 1Y6KR 1UEYA 4XPTH 3G9AB 3DBXB 4J3UA 5E5MA 4HKBB 2CO7B 2X4OB 3OX8A 1AXSB 4QRSA 3CMOH 1YN6B 2G60L 1A3LL 3GMRB 3I6KB 5DJAB 4KFZC 2VDKL 1JHTA 2KKQA 1FVDB 3OJDA 4D0CB 1JRHL 1HH6A 4KI1A 3NIGE 5HHQB 3QEQA 2WWMC 1AI1H 1FDLH 2VXTH 5F7DB 3H6JA 4HIHB 2DM7A 4R7DB 4OLZL 1J8KA 1LK2B 1N7ML 4JGJA 1NGZA 4OI8A 4LCYB 4HBQA 5CJXC 1XGUB 3DMMC 3BWAB 1KJ2B 4J1UB 4LDOB 4GRWH 3VGGA 4PJHB 5B38G 3GJEB 2B4CC 2DQCH 4WGVB 3QJFB 4DN4L 3F7YA 5IUSA 4TSCH 4V1DD 4NKDB 2NY2C 3FB6A 1XF5B 4ONGL 1UEMA 3CXHK 1UACL 4Y4FC 5TFSH 2W0KA 3V4VL 2HFTA 4PG2A 4ERSH 5GRXG 1K4DA 3FRPG 5JDSB 3IDGA 2DWEB 1BHGA 3UPRA 4D9QE 4MB3A 5GRUH 1BX2A 5HHXL 1HQ4A 1WFNA 4PJDB 4AENA 2FL5B 4P2CG 1T0MB 1G7IA 2EXYD 4KK9D 4R9HA 4P57B 4HWBL 4OM1H 5C6WH 4RFOL 2HKHL 4YHLL 1QD0A 4Q6YA 2MWCA 3QG7H 3K1DA 1I7ZA 2MPAH 2YD9A 1MLBB 3F12B 3O2WL 4FG6D 3KLDA 2EDXA 3L5WA 4NHCL 1TQCC 3MJ8A 4F9PA 1IKFH 4PJ5A 4MXVE 3EYSL 2EKSA 4GXVH 3RDTC 3GI8H 5I1EL 4JVPA 2BRRL 5I1LB 5DK0A 2DYPB 4H25A 1P5UA 3E2HA 2OMNA 1DVFD 4BJLA 4KPHL 2Y7QA 1CD8A 3BH9B 2D9QB 2VR5A 5IJVA 3ARDA 2JJUA 5I8EB 2VH5H 3JV4B 2XN9D 4DVRH 2HT3D 1H3TA 4HCRH 1MHCB 4JFXA 5F3BB 3THML 2B39A 3KJ6H 4XC1H 2J88L 1HHGA 1L7IL 1MPAH 1RZGA 2R2CA 3RWGA 5I18L 2CUHA 3KYKH 2ZCLH 4NO5A 1MQKH 2OJEB 1DBKL 4OZHE 5LWYL 1AFVH 3T09A 3GJFB 4UQ2B 3E6FA 5BS0E 1IT9L 4Y4KA 5GISH 5AG9A 4ZYKB 4LL9A 3BX7C 4X5LA 3TBTB 4RFEA 1CDBA 1S8DA 4ZFFA 3K3QA 4MYWB 5DK2B 5GGRB 4DGIL 2NY7H 3QQ3B 4LU5H 2VRAA 1N59A 3LY6A 3NFSH 5C07A 5CJOH 3TBWA 1YEEL 4L4VB 1WF5A 1NUFA 2ARJB 4EUPA 2LABA 1I8LA 4YHOL 5JA8B 5EU6A 3BKMH 2X4PB 5AYQA 2E7CA 4F7TB 1KPRB 5E2VH 1YPZE 4OGAC 3NVQA 4E5XA 3PL6D 4JM2D 1VACA 4Y5VA 3WFHB 3OV6A 4GKZB 2K9UA 3FT4B 3VXPA 2J1KA 3QRGL 2DQJL 4POUB 2ICES 3ZE2E 4OCLC 4MAYA 5FHAH 4QOKB 4X0KB 1H3PL 5CZKA 1I7RA 2UUDK 5FKPB 2BOCB 3SPVA 1RJLA 3LIZH 3WS6C 2IQ9H 4PJXE 5EORH 4WFHD 3UYOD 1LE9A 1C5CL 1EH9A 3NIFE 3ISWA 5GS1B 1U8IB 2ICWA 1CLCA 4OT1H 2OZ4H 3T8XA 3VFMA 1JZ2A 3DURB 4MJIE 4POZC 3DTXA 4QY8A 1RIUL 1S78D 3UBXA 4G9FD 2ZOLA 1Z6JT 3BZ4B 3DGGB 2EDFA 3S37X 1JPTL 4YGVB 4WUUB 4Y4HA 5GRYA 4QHMA 1Q0XH 4QGTA 4UT6L 2DI9A 4UDUB 3P4MB 2FB4L 2BC4B 2IFGA 1KCUL 4HPOH 1XT5A 3LQMA 5IFAH 1G7HA 3HNTL 4P48A 5K9OA 1HE7A 1P1ZA 2IQAB 4IOSD 1K8DA 5DRNB 1WC7A 4RISH 3KPQA 3AAZB 4ONOA 1L7TL 4FQLH 5D70H 1LK3H 5HVFB 1ONQA 4K7PX 5FCSH 1KIPA 1YEDB 2PO6D 1U2HA 3U4BL 3DHJA 4NIKB 2C3GA 3BN9D 4CL7A 4GG8B 1NCWL 1U8OA 3MGOA 1PKQE 5T1DL 4Y1AA 2V7NA 3HZYA 4ZOEA 1P7KB 4NKOA 4R2GD 1N5AB 1JFQL 5L88L 5KS9A 1OAKL 1NCAH 2G9HA 3QNXB 5EPMB 2NY5H 4GAGH 4LF3A 3TZVC 4MJ4A 5F9DC 2EE9A 3TO4D 5T5NG 5IB4A 3MLWL 4HFUH 3WNMA 3CDYA 4MNQB 2GJZB 4L8CB 3MRIB 4MS8C 2ZWLT 3S36H 3VWJD 5DJYA 5BJTB 2YPLE 4FFWC 5F7NC 3V5DA 2Z91B 3HFMH 3LPGA 3BIAX 1WZ1L 5F7EL 1KNOB 1XR8A 1CGUA 1IKNA 1A9BB 2BSSB 4UIKH 3ZTJH 4NOBA 4RA0C 2Q8AL 4YDKH 1UQSB 4AIOA 1PZUB 5GGVY 1RVFH 5I17B 1G7MB 5D1ZB 2X89D 1GCFA 4ELKB 5IMLA 2D7TH 5F6HI 3BRDA 2X10A 4BZ2L 4I3RH 5ALBH 1HINL 3GBML 4GW1B 5JIKA 3PGFL 2HN7B 5HDOA 1QOKA 1A4KA 2MKWA 3PP3H 4P9HL 4XWOC 5DUPH 1DBJH 1ACYL 1B90A 1YDPB 4TUKL 1X5HA 3O6LL 5ESAA 2ICEB 3QDGE 1Z0NA 4KXZH 4H88H 2E6PA 4P46A 3RIAF 5DFVC 4G6MH 2WIIB 2AXGA 4RNRA 4FQXC 3HNVL 3B9VA 1NGQH 5DMKB 1YEIL 4Q9RL 3QIBA 3UPCA 1R5IB 5I0ZA 2VITB 2Z93B 1JF6A 1FNHA 1AY1L 2O5ZH 1YEJL 4DAGL 2R2EA 4APQA 3RIFK 3BT2H 3ARFB 4JHWH 3CAFA 5EO9A 4Z6AT 5IB3A 4ONFH 4FQCL 4D8PA 3I3EA 5T33L 3MRPA 4CVWA 1FFQA 1EO8L 1YUHB 4YIQB 1IC1A 3RUGE 1A6UH 4ZO8A 5EOTA 3LD8C 1SEBB 3P30H 4Z0XB 3FOLA 4HKXA 3MLYH 2YC1A 4IOFD 1QLRA 1EJOH 2X1PA 2GW5A 2VR9A 4XCCH 1ZLVH 4K71C 2QQLL 5D7IB 1G6RH 4AEIL 4Z8FH 3G6DL 4UTBL 5AG8A 5KZCB 2P8LA 4IDJH 4XP5L 5T1LB 2M8XA 4Y19A 2XNAB 3QUYC 3RQ3A 1DUYB 2ADIA 1MHHA 1AHWC 1ZHLA 3HAEG 1T22B 2GCYA 3HMXA 3ZDXF 4YDLC 4NFCA 1NCBH 3I2CL 5E03A 1EEQA 2NY2B 3GSUB 3PWNA 1QSZA 1J1OL 1I1CA 3VH8B 1E27B 3SDAC 1I1AC 1XGYH 1EZVY 3QDME 1I1FB 2VLJE 2B0SH 5F1NB 3S88L 2MTPA 3LKPB 3UJJH 5CBEA 4HK0A 4B7LA 3KS0H 5FHBH 3RWHB 4EDXB 1GPOH 4P4KD 1AGFA 4QHLB 4ZG1A 2Q7YB 3B9KD 5C09B 5DA4A 4U05A 2YPVH 4K3JL 1HXMA 1KYOK 3C5JB 4I3SL 4MHHG 5GRJH 5B3JF 4B50A 3VFWB 4WI9A 3FB5B 3P11L 5DHYA 4P2QB 3VXRE 1TQCB 1QFWI 1A3LH 2W0LA 4N8VB 3RDTB 3CZJA 4MQ7A 1HDMA 1EMTH 1E4JA 2NR6C 2VDKH 3C9NB 3EJZC 5FO7A 3BPLB 3O6FD 3MLRL 1ZT4A 4KXZI 2XWTB 4GG6F 3C08H 4BUHA 2W60B 4U49A 5DFTA 3DVGA 4PYGA 4OZGE 2W65A 3W11C 4PJCA 4OLZH 1N7MH 3QUMA 2E7LA 5ACZB 3HE7B 5HY9B 4I0CC 2EDWA 1Y0LB 5IKCB 4DN4H 3JSSA 5CHNB 4CU6A 3TF7C 1TPXC 4LLYA 5D7LA 3OKNB 4LCCA 3ZHDA 2EE2A 4ONGH 3TFKC 4D9LH 1UACH 1U8JB 3KPRD 3V4VH 5CD3B 2XTLA 2VC2H 2AK4A 3IFPA 3UDWA 5IWLA 1A3QA 3KWWA 1YMMA 3UJTH 5IFHL 3B2VL 2Y72A 2EZ0C 1WWCA 5HHXH 3FHAA 3MBEB 2IBZY 2YRZA 2X7LB 3QDJD 2E6JA 1BIIA 4LLUA 1B4JH 1DQLL 5E8OA 5DJ8A 3BIKB 1ZAGA 5GGQH 5FDWB 4JFHD 4MA3B 2FJFA 3MNWB 2EC9U 1U93A 2HKHH 3DVNB 4YHLH 3UTTA 1K4CA 2C7UB 4YHPA 3Q3GA 1N8ZA 2OR9L 1PFCA 1OAXL 1CE1L 4NHCH 3MODL 3GSNL 1PY9A 1GGYA 5DSCA 1UXWA 2XWJA 2QSCH 1WBYA 3FQUB 3RX8A 5I1EH 2HH0L 3TC9A 4G43B 2R0KL 4G9DA 2RFXA 3N9GL 4F33B 1KIQA 5LXGL 1AO7A 2VLRE 4C59B 2VQ1B 1G9EA 4U7SA 1MJUL 5IP4A 1W72B 1VADB 3QDHA 1JGDB 5ITBH 4G8GE 1T20A 4TNVK 4ODWA 1LO5B 4D9RD 1SEQL 3VFPB 2WV3A 4I2XE 2QLVB 3AMKA 5DUBA 5C2BL 1NANH 4WNQA 2J88H 3SKUD 4PV8B 1ADQA 5I18H 1AGCB 1U8QA 2AKRA 2YD5A 4ZXBC 3U2SA 2VZ3A 2FO1A 3ZSSA 3HMXL 5GSVA 5LWYH 3JXAA 4BQ8A 5DJXA 3EZ8A 1XR9A 3LS4L 2DWDA 2VXQL 2VDOL 1IT9H 4U1MA 4ODUA 5MHSE 2I07B 4RGND 5KSAA 1JRHI 2EH7L 4HS8L 5HVWA 3V95A 4PDCE 3M8OL 3QEQD 3G6AA 5HYJB 4DW2L 2DQEH 4S0UC 1NAMA 5IM7B 3L95A 1JZ6A 3QXTA 5DT1H 1YEEH 3PABB 3TYFB 5LCVH 3CH1B 2ZCKH 5DD1L 4YHOH 5IOPB 4ZO7A 2Y25A 5HXMA 5I16B 3KVQA 4AT6B 2FX9L 1KC5L 2UWEE 2A0LC 1ZSDA 5L6YL 2Z92B 3VXSE 2CMRL 2AV7B 3HE6A 4BKLB 4JANA 3QRGH 4XBPA 4O02L 4OTXL 4ZUWA 1I8KB 3UCRA 3RPIB 3TZVB 1VB9A 3O3EB 1FHGA 1H3PH 4GKSA 1FORL 1N0XH 2QSTA 4KC3B 4NJ9L 1EA9C 4EI5B 1WBXA 1A02N 4JN2B 3MRGA 1W0VB 4RMUA 5C0AD 1C5CH 4NP4H 3DUHA 3QUML 4NCC2 4ZFOA 1FV1B 3DYMA 1QSED 4KGJA 4TUJB 4PJ5D 4Z7WA 1KUMA 1SBSL 2J8UA 1CD1A 2ATPA 1L9NA 3WFCL 4QXUL 2LAAA 5F21B 2X9YA 2C3VB 5CEZL 4P49A 4JO3L 2AJ3B 1WCQA 4KDWA 1R3JA 1N4XL 4ZUTA 4RMQA 4FTVB 4NC1E 4H0GA 4BZ1L 2UY6A 1HOCB 4J23A 4QHUA 1KCUH 4GH7B 1QHPA 4PJHE 1J8HA 4YHZH 4Z76A 1HYSD 3PWVA 3TT3L 4FQHB 4XNUL 1ZANL 3B8YA 1NANI 3U7YL 1ZGLA 3F6LA 4JRWA 5JO5A 1WLHA 4KMQA 3ROLA 5TQ0H 3U4BH 3PHSA 8FABA 5F96L 5ABDE 4YR6A 5MENE 1NCWH 4X6DA 4Y4KD 5F7MC 1Y6NR 1DEDA 2YA0A 4HIIB 3TNMB 2FD6L 3EFDL 5F1IB 2VB5A 1JFQH 2APXA 1OAKH 3QSKB 5DC4B 2GFBA 3LSOB 2YN5A 5JHDB 1A7OL 5HHPB 3QIUA 4NN6C 3T0XA 3ARBA 1RU9H 4HGWA 2HP4A 3WLWC 1NEZG 2W59A 2Y07L 4KI5C 1MCBA 5C07D 2H1PH 4GXUM 5CJ5A 3FO0L 4WFFE 2DJ4A 4WO4A 1PYWB 3AREA 5EWIL 5EU6D 1WZ1H 5F7EH 4OLEA 2IANA 3K1KC 4DJMA 2DQDH 2R1YA 1HQRB 2V2XB 5HHOB 5ESQA 1MCFA 2Q8AH 3HAEH 1OP5H 1R5VA 4LHUG 4PJIA 4KUCF 4WJ5B 2ZUYA 3NCCB 3ZDZF 5ANMA 1ZMYA 1RHHB 4LBEB 3LN5A 4BZ2H 3OKMA 4C56A 4MAYD 3HG1A 1BREA 4AG4L 3TBYA 3DGCR 2BNUB 2G5BB 3PGFH 1D9KC 2WMPA 4UUJA 4YDLB 2X4QB 2YD1A 2SEBA 4P9HH 1DQJA 2OL3B 2OQJB 2VO5A 3PV7A 4K3EH 2HAZA 3WNNA 4X5XA 4OZ4B 1NAML 1EIBA 5ISZA 5CCKH 3MRDA 3C8KA 3CC5A 1HIML 2B5IB 3B6SB 3W39A 3KPLB 5J6HA 4RIRA 1BLNA 2AJXL 3G5YB 1DDHA 5JOFB 3HNVH 1AD0B 2ZOKA 2R2HA 1YEHL 1YEIH 1IFHL 1WT5A 1IGTA 1NH6A 3BGMB 1T83C 2VN7A 2NY0C 2EIZB 4GAFB 2XFXA 4PJEB 4KUZL 1D7FA 3GSXA 1YEJH 5BV7L 2GTWA 4Y4HD 4ZPVA 1VEPA 4DAGH 1MCCA 1RPQA 5ICYA 5L7XH 5ICXB 3D0VA 4E41A 3EYOA 4BFGA 3DETC 1PG7W 3M17A 5T33H 2E7HA 3PWPA 5F1OB 3EJYC 3JUYA 4LNRB 3BDXA 4F80A 1S7WA 2Z31A 4NC1C 5C0DB 1U3ZA 4OV5B 4M93B 3SDCD 4D94A 2CRMA 2M1KA 1NDMA 1YY9D 3BP6A 2JKXA 4L4TA 1NL0H 2X4SA 3IVKA 1WQVT 4UT9L 2P5EB 5IHBA 4NQEE 3P73A 4YO0B 3CSPA 4Y1AD 1OP9A 3C60C 1NC2B 3GRWL 3G6DH 1UWGL 4L8SC 2H3NB 4O2CA 4WUKH 4YHYC 1IBGH 3MV9E 5AAMA 4MA7L 2JJTC 1UH4A 3H8NA 4ODVL 3U4EA 1TPXB 5JW4N 4BK4A 3DSFH 3I2CH 5DF0A 2F53A 3OKOA 5B22A 2DKMA 1J1OH 1NAKL 1Z3GH 4R7NA 5K59E 4K7FB 2DB8A 5J9PA 3TV3H 1S9XA 4S1QH 4M8VA 2WLZA 4LLDA 3VXNB 4LLQA 3HUJA 4OF8A 3S88H 1CICC 4M7KL 3WJLC 4UILL 1IAIM 1KTRL 3ALWA 1X4YA 4ZNEE 1F11B 4DZ8A 4X7TA 4K3JH 4OZFA 4I3SH 4W6WB 2RJMA 4XPFL 3JBG7 5FOBB 5F3HA 4KMTL 1XCTA 2AQ1A 5T3ZD 3P9LB 4X8JA 4XNQA 4YGAB 5DUML 2ATKA 5C0CB 4MJ5A 2XKUA 4HG4J 4HC1L 2H6PA 1MCRA 4HK3J 4E42A 1OSPH 5F97E 3BZEB 4R3SB 3O3BA 4IOIB 1AE6L 1M71B 2F54B 4P46D 4MNGA 4MHHI 1R3LB 4XH2B 4LLMB 1S5IL 5EIVA 4RBPK 4X4ME 4JFFB 5JIHA 2EDKA 1DE4B 4R4ND 3QIBD 3NCYP 4DGYL 4PGEA 2Q8BL 5CKGA 3L9RA 4U1LB 4APQD 1D5MA 3K7UA 2QADD 4Y2OA 5TPWL 1U8HA 1QEWA 4ZXBB 4OUOA 3RX7A 1J12A 4OZIF 1NLDL 1MOEA 1QBML 4GRLA 3D39A 4PBWD 1WCBA 1UJ3A 5E2UH 5CGYC 1V05A 1CFNB 2ZP0T 3TCXA 4U0RC 3GSVA 5DD3L 4QHNA 3VW3L 1NCCH 5IFHH 3VFOA 3B2VH 3OXSB 5GRZA 4OLVL 1QUNA 4JRXB 4JQIH 1MRCL 4DFHA 4HDIA 1CDJA 1PLGL 2NY3C 1FL6A 4OB5L 3TIDA 3UTPD 1BGXL 2ADGA 4ZFGL 3QO0A 1DQLH 4AH2A 3T0EB 2V2TB 3UTSE 2GSGA 5E99H 3UBXI 5CZXD 1RULH 4Y19D 2A6IA 3D3VE 3D85B 2YD8A 2PTTA 2Z35B 5EN2A 3RL1A 3MFFB 2R69H 5INDA 1VKXA 5D1XA 1OAXH 1T89A 1L6XA 1CE1H 3SY0B 4NHUE 4LQFH 3GSNH 4XZUB 4J7RA 4MD0A 2VAJA 3WO3B 5F7UA 4X9BA 4HS6B 4MMZC 4Y89A 2V2WB 4U6TA 2YWZA 5DMGD 1TJHH 4WY7L 5EC2B 5I1KL 3MQIA 5C1MB 5IR1A 4D9QD 1MJUH 3EO0A 2J2ZA 1QZ1A 3NCJL 1FIGL 4JKPH 1T1XB 3L7EB 2WY3A 4HLZG 2WBJA 1A4JB 4OLYL 5C2BH 4GFTB 3M07A 4HIJB 3S3SA 1JNLL 3UZVB 3DBXA 5JOPE 5BOZG 4HKBA 5C0NC 2X4OA 1AXSA 1MFCL 1Z9SA 1YN6A 5GGTA 3GMRA 4U2YA 3I6KA 1LNUB 2VXQH 5DJAA 3J7HA 5D7JC 3D5OF 5D9SB 1FVDA 4D0CA 4YZFF 2HT2C 4YBQC 3MR9B 3C2SA 5F7LB 3GUTB 5HHQA 4HS8H 3M8OH 5F7DA 5SX4H 4DW2H 15C8L 4HIHA 1SMOA 4R7DA 3CH8A 1LK2A 3ESVF 4LCYA 2ZUQC 1XGUA 3BWAA 3O6KL 4J1UA 2CRZA 4O5LL 1C1EL 5DD1H 3PE9A 5AYUL 1F5WA 1V8HA 3GJEA 4PJHA 2NY1C 3QJFA 3U36B 1ODAA 3REWB 4R4FL 4NM4L 4NKDA 1KC5H 5D7LD 1XF5A 3LKNB 3WSQL 4Z7NF 4LSVL 1KJ3L 4MQXD 5JDSA 2DWEA 3GM0A 2AK4D 5D5MF 1YMMD 4O02H 4LEOB 4OTXH 4FQPA 3I6GB 1H8NA 4PJDA 2FL5A 4S11A 1T0MA 2BP3A 1FORH 1OQOA 2L0DA 2VXVH 1K6QH 4P57A 1PQZB 3MLXL 5DYOB 3UTTD 1K3IA 4LAQL 4LRIA 1MLBA 3F12A 1JHLL 2X44D 3ZDXE 3QG6B 3VE0B 4MX7B 3LHPL 3QZWB 3VGFA 3MOBL 5C71A 4NCC1 2ZSVB 1SBSH 5I1LA 4GMSL 4YHIB 2DYPA 1OTSD 3IDUA 4NUGH 5CEZH 2BDNL 5GGVH 1D9KB 2H2PC 1AO7D 3WKML 3BH9A 3ULUF 4BZ1H 2O26U 5ELIA 1UGNA 1NGWB 5DEFB 3ZLQC 4OFIA 5I8EA 1IC5L 3JV4A 3DXAE 4XNZC 4CMHC 1MHCA 4CU8A 2CLRB 1FZMB 5F3BA 3V79C 3TT3H 3NABL 5B3JE 3IAQA 3QFJB 1ZANH 3DX6B 3FQWB 4PLKC 2E27L 1ZTXL 4F15C 4PJFF 2OJEA 5F96H 4F8TA 3GJFA 4UQ2A 1GGUA 2EKJA 2EIEA 4UBDD 2NY0B 2FSEB 5KSAD 4ZYKA 2ZCHL 3TBTA 4DKDC 3WS3B 4UV4L 1A7OH 4ENEC 4GG6E 1C08B 4JFZL 1DN0B 3GSQB 5GGRA 5DK2A 4YXKL 2O5XH 2D31B 5SX4I 2H26B 2NX5E 3QQ3A 4UNTA 3R06B 4L4VA 4TVPL 3FO0H 2ARJA 3C09C 2X4PA 2CGRL 1OF2B 1UB5B 4F7TA 1KPRA 3RU8L 5MERB 5CD5D 2HFFB 3WFHA 5IFJB 2V5TA 2G2RB 4GKZA 3FT4A 3C60B 4WW2F 3HE6D 1TTGA 4GQPH 4ZDHB 1QFUH 4YHYB 5JXEA 1KXVC 3IT8D 4D3CL 2GTZB 1WTGT 4P2OC 1OGAE 1S7TB 4QOKA 4JLRB 3KXFB 3OKYA 4X0KA 4UOW0 1WZLA 5D96B 5FKPA 2BOCA 2ITDB 3MRCB 4X7SL 4YEEA 2P44B 4CNIB 3QI9C 5GS1A 1U8IA 1KJ2L 3ZT6A 3RHWK 1U3HC 3DURA 4Z7VF 1VFBB 5EUOB 1Q1JH 1YEHH 1IFHH 3PQYE 2CK0H 2WUBL 3BZ4A 1E28B 3DGGA 1J0JA 2UZYB 2R1WB 1GAFL 2ZZUT 5EULV 4YGVA 4WUUA 4AJ0A 3MCLL 4K07A 4L5FH 3ULVD 4UDUA 5TDNB 3P4MA 1QRNE 2BC4A 3U1SH 4MVBA 4U4BA 1J8HD 1Z9LA 4WEMB 2IQAA 5DRNA 3B4NA 3AAZA 4Y8DC 5B39G 1F6LL 1TCRB 1YEDA 2YZ1A 3LAFA 3K0WA 4UT9H 5FM4A 1LILA 1ZKAA 4IM8A 4GG8A 5E2WL 1ZLWH 2Z8VC 3QHTC 4PTTB 2EDLA 3GRWH 1P7KA 1N5AA 3I6LE 4Z7VB 1VFMA 2D7MA 2GSIB 1QNZL 3QNXA 5K9QG 3PNWB 5EPMA 3BJ91 1A7NL 1IARB 2I9LB 4ODVH 3ARBD 2NY6D 2DS4A 5MEQB 2HVJB 4JFDE 4F7EB 3VXQB 2LTQC 4MNQA 3CCHB 1NAKH 2GJZA 4ORZC 4L8CA 3MRIA 4WO4D 5BW7C 3ARED 5BJTA 1J1PL 4CMMB 4GRWB 3W0WB 3BE1L 1SYSB 2Z91A 4GLRI 2YD4A 3CVIH 1KELL 4P5KB 2ED9A 1KNOA 2IAND 4Z7QF 4KROB 1A9BA 3MRQB 2BSSA 2CKBL 4M7KH 2CDEB 4UILH 1UQSA 4TSAL 1HHHB 5ENWB 3FAWA 2B2XL 3ZKNC 5I17A 1G7MA 5D1ZA 5FECB 2E5EA 4ELKA 2MOVA 1FVCB 2V7HB 1BF8A 4NYLB 4CKVX 5DFWH 4KMTH 4C56D 3HG1D 4GW1A 3VMPA 3PP4L 4I18C 2HN7A 3FOMB 4WWID 4WU7B 4HC1H 1YDPA 4UDTB 5ISZD 1QSFE 3OGCB 4AK1A 3ZSTA 1UM6L 1VEMA 2ICEA 5DTFB 4U3XA 3K2UL 3BP7B 4HLZH 1AE6H 1P4IL 2F74B 3FO2B 2WIIA 2YUZA 3ULSB 2PR4L 5H2BB 1S5IH 3L7FB 5J13B 5DMKA 4R90L 1YEGL 1ZEAH 1SJHB 3BEWB 5FYJE 2CLZB 1R5IA 4OAWB 5DA0B 2VITA 2Z93A 4DGYH 2Q8BH 5CP3H 4ZAKC 3S34L 5DQJB 4EQ3A 4C4KO 3KLHC 3VI4E 1EVUA 4DOHB 3ARFA 4NO0B 5TPWH 5JQ6L 4E41D 3VFTB 1OGTB 3BPCB 1BP3B 5J11C 3S4SG 1NLDH 1FN4B 1QBMH 2Z31D 3CFJB 5KAQG 1YUHA 3EBAA 3VD5A 4YIQA 1UYWH 1RZJC 2HKFH 3FQXB 3VW3H 5TDOB 1SEBA 4RQQB 4Z77B 4Z0XA 4OLVH 4L4TD 4DCQB 1MRCH 2HT4D 3MLUL 3QA3B 4OB5H 4YE4L 5BVPL 3OQ3B 2AEWA 4HWNA 4XP4H 5D7IA 4HS3B 5FYKH 3QUXC 3NA4A 1FNEB 5CJXA 2ZUQB 2OJZL 4U1IB 4D2NA 1C5DB 5T1LA 3RGVC 4F2MB 2XNAA 2YKLL 1DUYA 3REVB 2Z8RA 4RMTA 3CK0L 1T22A 4EBQL 3SQOH 1MCWW 3GSUA 2F53D 3L1OL 1SY6L 4HBCL 4WTZG 4X83A 1K2DB 1E27A 3VH8A 3CZFB 3OG6B 1CFTB 3TP4A 2XY1A 5CP7B 4XWGH 1I1FA 1QR1B 3HZVB 5F1NA 3LKPA 4WY7H 5I1KH 3V5HB 4UU9B 1MELA 4NN5C 1IEHA 3RWHA 4EDXA 3DYPA 4QHLA 4BFIB 4LGRB 2Q7YA 5C09A 4FP8L 2CJUH 5C9JB 3ZDZE 3C5JA 3CLEL 4TOYL 1YA5A 1MIEH 3MV11 3VFWA 1JNLH 3FB5A 2HWZL 3SKNB 4P2QA 4FZ8L 1YNLH 2P4AB 35C8H 3KDMB 5HD8C 2NY4D 1MFCH 5GZOD 3MFGB 4N8VA 3RDTA 4PYHA 1WWBX 3C9NA 4Z9KB 3OF6A 1V7ML 2XWTA 3BKCL 2W60A 1EEZB 2FDBP 2IWGA 4PJBF 2V9TA 4TTDD 5F6IB 2EDBA 3RVWD 1EGJL 4DKAA 2P24B 4M7LL 5CJQL 2UVFA 4CU7A 5IQ7L 1FGNL 2X70B 1DBBL 2AGJH 2W0PA 3EO1B 5JXAH 4FABL 2VLRD 4XNZB 1CGYA 4CMHB 3RVVD 3O6KH 4AQ1B 1MCLA 5IVZB 2Q7NA 5ACZA 1C1EH 3SO5A 3HE7A 5HY9A 1FG2B 1Y0LA 5IKCA 3C5SB 5CHNA 5HYEA 4KQ3L 4R4FH 4XB8A 1I1RA 3OKNA 3U0PB 5EIQA 5DJZB 4PJ8B 5EBMB 1X4ZA 1U8JA 2DMBA 3D39D 1WIUA 1KJ3H 4GRLD 1F90L 4G8EB 5CD3A 1H3GA 1I3VA 3WHE1 3A6CL 4PJ9B 4X6CB 5KSBF 5IROC 2AS5M 5E7BA 4L3EE 4V2CB 3MBEA 2X7LA 4Q9BA 1IL1B 4ODTL 1FNGB 3BIKA 3E0GA 4PJBB 2YN3A 3MPCA 5FDWA 3H42L 5JQHC 2VZUA 2AERT 4MA3A 3MNWA 5FM5M 4NCDA 5KBNC 3DVNA 3EO9L 2C7UA 1WWWX 3C09B 5C0CE 4K23L 1IAMA 4HG4K 1JHLH 1H3VA 1KBGH 5D1XD 3L3KB 4WHCA 1KJVB 4Q6IC 4N0CA 4XAWL 3LHPH 3CVHL 2D2OA 1I8MB 3FQUA 4U1KB 3ZKSD 4G43A 1MCNA 4HMEA 1X7QB 4F33A 3MX0A 2BDNH 5DRXB 5D8JL 1S9KC 2V9RA 1K9TA 3SJVE 3HI1B 2Q3ZA 2HLAB 5IHUL 2VQ1A 4WHDA 1EEYB 1W72A 1VADA 5KSBB 3WS6A 1JGDA 1IC5H 3PHOB 2AEQH 1NUGA 2WBJD 1LO5A 4KK8C 3VFPA 2ZUXA 3BMWA 3NABH 5BMFL 3QI9B 3JV5A 3LS5H 3IJYB 4PV8A 1ZTXH 1MCKA 3AVEA 1MEXH 1AGCA 4C57C 2B4CL 1U3HB 5IVOA 4N5UA 1KPVB 3E6HB 3HB3C 3PG2A 1LO3L 1HI6B 3T3PF 2XY2A 3QUZD 4ZSOE 4V3EB 2I07A 5J6GB 3LV3B 3CD4A 2J5LB 2IH1B 3SDXB 3I85A 2GJ6E 4KQ4L 5C08B 4LCWE 3CU1A 4UQ3B 4HGKC 2WM0A 5HYJA 5IM7A 4JQVC 1BD2E 5FIEA 1T03L 1DSFH 3PABA 4P4RB 4TVPH 4NNPL 3CH1A 3S98A 3TYFA 3MLPA 4WW1B 4RRPA 4G6AC 2E9IA 5IOPA 4M9PA 2CGRH 5I16A 1OD7A 3NOIA 3UAJD 4AT6A 4N0YL 5M7QA 1UWXH 3VXUE 4OZIE 3H9ZA 2Z92A 1YQVH 2EDDA 1A7PL 5JA9A 3VDCA 2AV7A 4BKLA 5A3IC 3HI5H 4D3CH 1FBIL 1I8KA 5ECJE 3MRFB 3RPIA 2V17H 3TZVA 1F4AA 3H9SB 3O0RL 3O3EA 4IRSC 2EYTB 4NRXB 4QXGL 1MRDL 5B38B 3CX2A 3QH3B 1VEOA 2QQQA 2LTQB 4JPVH 4ZOAA 4JN2A 3IFNL 4EI5A 3TJHA 4OM0H 1G7LB 4X7SH 1G6RB 2BNRB 1W0VA 4MS8A 3TGXA 3BISA 3FB7B 1KJ2H 5DHVA 4Y16C 1GL4B 1FV1A 5L2KB 5EC1B 4TUJA 2IAMB 5CGMA 5JW4Q 2MCG1 3L3OB 2WUBH 4PP1C 5L9DL 2NTFB 5FCUH 5E5RB 4GMTL 2DYPD 2C3VA 1O5DT 4OJFH 2AJ3A 2DKUA 3KPSE 1T7VA 4OCRH 4LASL 3MCLH 5C86A 3OWEA 4FTVA 1HOCA 2VDPL 2JK5B 3BWUC 3SBWC 4HPYL 1PVHA 2GITB 1XCQB 3T1FB 5H94B 3ARGB 4TSBL 1D5XB 3U7AA 4OFKA 1JGEB 4FQHA 3OB8A 2P43B 3NCBB 3L3DB 5C0EB 2FWOB 3ZE0F 2NNAB 2C4XA 5JMRA 3RWDB 3NZ8B 3EDEA 3T0AA 3O9WC 4OCXL 2G75B 3IYLW 1R3HB 1EFXB 1FNAA 1I8IB 5E24E 3OSKA 4NJAH 4HIIA 5DQ9B 3TNMA 5F1IA 4YZFE 1BJMA 5JHDA 3LSOA 4L8BB 5HHPA 3QCUL 1A6PA 3SE8L 1A1OB 5ETUB 2V6HA 4PV9B 1J9CT 3PUCA 4O2FB 4BQCA 5J11B 3CDCA 3GNML 4L4VD 1W72L 1SM3L 1PYWA 4OBSA 1J1PH 4P2RB 3BE1H 4TRPL 1T0PB 1AD9B 4PRHE 5FGBC 3JV6B 1IQWH 4LSQL 1LO0L 1HQRA 2CKBH 2V2XA 5K9QI 4PRNB 5HHOA 4TSAH 4DKEL 1SMAA 5E8PB 5AD0B 2EEAA 4PR5B 3ESUF 3PGCB 1IGIL 4WCYL 4WJ5A 5IB1B 2Y36H 3G6JF 1RHHA 5JXED 5D5ME 4ZO9A 3RGVB 3V0VB 3SCMC 4U1HB 4UB0L 3F6IA 4QOKD 1CLOH 3PP4H 4U6YB 2BNUA 1A21A 2G5BA 1EEUA 1MFNA 1IRAY 2X4QA 1WFTA 3QEHB 2E6QA 4CJ1A 1OTTC 2OL3A 3O41B 4S1DC 4OZ4A 4GSDH 4U7KA 3BHBB 1TQBC 5LGJB 4IS6B 4EN3B 3B6SA 5FA3B 3KPLA 3MLTB 1GSMA 4YDIL 3G5YA 5J4MA 1OW0C 2A6JB 4PJAB 3ZL4H 4JKMA 5JOFA 1AD0A 3BUYB 2PR4H 1QACA 4QT5B 4NN5B 4R90H 4CW1B 4Y8AA 5ERWB 1YEGH 1INDL 3BGMA 3SE4C 2EIZA 2XT1B 3RKDC 3QWOB 3Q48A 2YA2A 4NO2B 4PJEA 4UMGA 3L3GB 3S34H 5SWZB 5E1HB 1CXHA 4WUUD 3PP3K 5ICXA 3F7VB 3ULUE 2A83B 4LSDA 4MVBD 4LNRA 5GRVK 2VXSL 1H8SA 5C0DA 1ZK9A 3VI3F 1KEGL 3UC0H 4OV5A 2F15A 5E9DE 1E4WL 4JPWL 4JDVB 43CAB 4PJFE 4KDVA 4AYFA 1JZ8A 2GT9B 2P5EA 1BPVA 3MLUH 3FN0L 4YE4H 1MY7A 3SHSA 4YO0A 1A47A 5EUKB 4ISVB 1MCPL 1NC2A 4XP6H 5DR5L 1YJDC 2H3NA 1BVZA 5FUCC 3V6OE 1JV5B 2YKLH 5I1CL 5DLML 2JCCB 3KPNB 1VFAB 1MHEB 4EBQH 1LQSR 2RIKA 4MNQD 1SY6H 4K7FA 4X9FA 1F4WL 4RGOL 3ZHKA 3VXNA 4FN0A 3EDFA 4KJPC 3P4NB 1G0YR 5JZ7D 1CFVL 1ZLVK 1R24B 3V6BR 1F11A 4FP8H 2C1OB 4GAYB 5D1ZD 4I4WB 4P5MB 1TMCB 1FZOB 2CLVA 5FOBA 4QCIB 3TH3T 3P77B 4X4XB 1RUPL 1G0XA 2NZ9D 3P9LA 4FZ8H 2XG4A 3T2QA 4WWKB 5C0CA 2ZUSA 1PW3A 1ZOXA 3MRLB 1X6LA 4JR9H 4HSQA 5MEOB 5KVFL 1QKZL 4R3SA 3BZEA 4U6VL 3TBVB 1W0YT 2EEBA 4LKCB 4IOIA 1CZ8L 5GPRA 2F54A 1M71A 5FYLD 5LGHL 1R3LA 2IFFL 3HKFA 4XH2A 4LLMA 1CBVL 1OAZL 1GOHA 1EGJH 4JFFA 3DECA 1DE4A 5IQ7H 1FGNH 1DBBH 4JFYB 2HTKD 3RA7L 5H35B 3OZ9L 5D2NC 1DLHB 4M3KB 2VABB 1MI5B 4M6NL 4UINL 5HDLA 1WBZB 1JUFB 3ARFD 4PLJD 4QRRB 2VE6B 3OJVC 4ZXBA 4JPKL 3ILPB 4LLAA 3E3QC 1UADC 2R8SL 3H7BB 2OL3L 1F90H 5T1KB 3VMOA 1AR1D 1CFNA 3T2OA 3ULUC 4F7MB 2BFVH 2EYSB 3QO1B 3VD4A 3OXSA 2BVQB 1P4BL 4LKXB 3STBA 4JRXA 4CVZB 5D7KD 1LP9B 1MREL 4IIQC 3HC4L 3KPMB 3NTCH 4JDTL 3T0EA 3H42H 5FB8B 3SGKC 5KZCD 2V2TA 4K94C 4KRPC 4YDJB 3D85A 4ALAL 4MGXA 2Z35A 5DI8B 1Q72L 1DLFL 3MFFA 4F57L 4OQ1A 2NY2D 3CJJA 5C0GB 2QR0B 4XZUA 3CVHH 4Q97A 1FNSL 4BFEA 1Q9LB 4U1GB 1T7WA 3RTQC 1IGFH 1MH5B 3L5XL 4HS6A 5SWQB 2O5YH 2V2WA 5D8JH 3T2PA 4IRSB 4V1DE 5EC2A 4Z7QE 4J4PD 5C70A 2XICA 4Q2ZB 3HAEB 3B5GA 3WIIL 5I19L 5C09D 5H37G 1T1XA 3L7EA 2UV3A 1IILE 1A4JA 3FTGB 4HIJA 2PCPB 4P2QD 4LVNC 2MMXA 3BD3A 1NFDB 4QRPB 2B4CH 4KKCC 4O4YL 2WBWB 3X3FL 1LNUA 3BIBX 3RDTD 3G5XB 3MO1B 3PWLB 5D9SA 4OKVB 1QHOA 3AS1A 3CFCL 3OF6D 1TITA 4YFLI 1JGVH 2BXYA 3MR9A 4KQ4H 1B0WA 3GUTA 4RMWA 3BKYL 4G8IB 2JIXB 5HPOA 3BP5B 4M1GL 1A6VL 4JRYE 4TVSa 1T03H 5F89B 3CFIC 1FE8L 5DGRA 4LHQB 5IBTL 3HE7D 3R0NA 4LVEA 4V2BA 1N2RB 4IMLB 3U36A 1V7NL 3REWA 3H3PL 3P4OB 4YPGB 4N0YH 3UO1L 3O9WB 5E6YA 2N1KA 2NXYB 3LKNA 3T4AB 5FGCE 2XN9E 5T3ZH 4ZD3H 5J7CC 3OR7B 5EDXA 4F3FB 1A7PH 3BEVB 1R6VA 5IBLC 4LEOA 1FBIH 3GHEH 3I6GA 4H5SB 5E1AB 2BY2A 3O0RH 3MBED 4KWUA 1QLEL 1SYVB 4HQQL 4QXGH 2B20A 2OYPA 2F5BL 1YQ2A 3EYQD 1PQZA 1CN4A 5KS9F 2OXGA 5DYOA 3VXTB 3MRKB 5GGRY 3IU3B 1CR9L 4I0PD 1FCGA 4GAJL 2W91A 2IPKB 3QG6A 4OGAD 3VE0A 4MX7A 1XH3B 3MBXL 3M45A 4N0CD 2AEPH 3QZWA 4YFEA 1U8PB 5CGTA 4RMRA 3MTRA 2ZSVA 4BH8B 5L9DH 5LQBH 1CGSL 1JHKL 1TXKA 4YHIA 1U0QA 4GMTH 3WNLA 1IAKB 5TE7H 3SCMB 4ELMF 2FHFA 1PX3A 5IHLB 4JFEB 1D9KA 2VDPH 3BRFA 1NGWA 5DEFA 4EVNB 4NNXB 1LMKA 1BAFH 4TSBH 2ICCA 2X05A 2CLRA 1FZMA 1TQBB 1WIPA 2IF7A 3LPFA 2FBJL 3WIHA 3QFJA 3GSRB 4JDZB 3DX6A 3FQWA 2A9NH 1RI8A 3ARXA 5GS2H 4C55A 5SX5H 4QRTB 12E8L 4NZTL 4OCXH 1O0VA 4WFHE 4EOWH 1MJ8L 2UVEA 4LVHC 3BYYA 2FSEA 1A14L 4O2EB 2AABL 1S5HB 1N64H 4KK9C 1BOGB 3WS3A 3SKOB 3QCUH 1C08A 4PJBE 1DN0A 3GSQA 3ELAT 1QSVA 2BNQB 3IJSB 4NKIH 5HYJD 2D31A 5J0BA 3QQ9D 4G9FE 4ELMB 3SGJA 3R06A 4FG6C 5ADOL 4RGMC 4HJJL 4JG1L 1SM3H 2DI8A 1NBVH 2D7OA 4EDWH 3FQTB 4X7EC 4TRPH 3Q5YA 3WDIA 3TVMC 1OF2A 4YWGH 4KJYB 1ZE3C 1UB5A 4N1CA 2X1WL 3P0YH 1LO0H 1JPSL 5MERA 4KHTL 2BVYA 2HFFA 3U83A 1DVFC 4DKEH 5IFJA 1UG9A 2G2RA 3C60A 3QHZL 4ZDHA 2EDJA 4G3YL 2GTZA 1AGDA 2HT3C 2APBA 5KSBE 1S7TA 4JLRA 3KXFA 4OD2B 1XGQB 4PJ7E 2ITDA 4FFZL 4EI5D 3MRCA 3TJHD 1J0ZA 3KR3L 4MS8D 1RUML 5I8KL 4CNIA 4XI5D 1NSNH 4PY7B 1EUUA 4YDIH 2XV6B 1DBAL 2FRGP 3I3BA 5SV3A 3VGEA 4HHAB 4MXWL 3WJLA 1MNUL 4ONHB 3LEYH 1E0OB 1PSKL 1VFBA 5EUOA 3GSNB 5HHMB 2I5YL 1INDH 3Q6GH 1HHJB 4FFEX 1T3FB 1E28A 1H0DB 1BQLL 2DTMH 1WAAF 2R1WA 4FXGB 2NTSP 1RUAL 5E56A 3GEWB 3GK8H 4FTVD 5TDNA 2MNUA 4XNYL 3U48A 1KCSL 3SKMB 1CIDA 5FXCH 4JM2C 1RIHL 1KEGH 3KGRA 1R3KB 1Q94B 2DIBA 1TCRA 5KVEL 1E4WH 2XPGB 4JPWH 1TVHB 2WUCH 3C5ZD 4K2UL 3BP4B 3FN0H 3NIDF 1GH7A 3T3PE 4PTTA 3H9SE 3T0WA 2Y5EA 5DR5H 4Z7VA 5JHDD 5KN5B 2P8MB 2VDNH 2GSIA 3PNWA 4DVBB 5DLMH 1FRGL 2I9LA 1S9VB 1P9MC 4DK3A 2VWEE 4M62H 3AB0B 4PJCF 5MEQA 2F8VA 1CDCA 2HVJA 3VGHA 4F7EA 3BZFB 3VXQA 3EKCA 3CCHA 1D5ZB 4RBPH 3SE3A 1F4WH 4RGOH 4CMMA 5E5UB 3MNZB 2E7BA 5DJDB 3W0WA 1SYSA 1S78C 3HNSH 1U8LB 5MI0B 4P5KA 3PXJA 3TCLB 3MRQA 2CDEA 5HHOD 1CFVH 1CK0H 2AVGA 3N0PB 1HHHA 3JZ7A 5ENWA 5F88B 1NEZB 5FECA 3I50L 5FV2A 4Z18A 1FVCA 2V7HA 4NYLA 1XF3B 4GBXB 2EECA 1RUPH 2BXZA 5KJRL 3FOMA 2FO4B 1NBQA 3TA3B 4CBPA 2ZNWA 4YHNB 4G6FB 4WU7A 2RQ8A 4PY8J 1EV2E 1RUKH 3SGEH 4UDTA 3OGCA 1FH5L 5KVFH 1QKZH 3RTQB 3UYRL 4LHUB 4U6VH 1JTPA 5DTFA 4ZTOH 5H37H 1CZ8H 3QT2A 3BP7A 3IGAB 2F74A 3QAZC 1VGKB 1M6OB 3FO2A 2IFFH 3ULSA 4R2GC 5K9JL 5H2BA 1OAZH 3L7FA 1CBVH 2VOTA 1AQKL 4X5WB 1YC7A 3BEWA 1SJHA 5I73B 5IHZB 1HNFA 2CLZA 4OAWA 3TO4C 3OZ9H 2W1NA 1ZXQA 3L3IB 2IMMA 5DQJA 1OAYL 4H0IA 3U30B 1B4RA 5CKAA 3R0MA 3VWJC 4NO0A 4R26L 4XMLH 3TWCH 3ZO0A 3VFTA 1OGTA 3BPCA 2OX5A 5IQ9B 4JPKH 1Z5LB 1KCKA 2R8SH 1R3IH 4HCRA 3CFJA 4IHOB 1XGRB 2VLLB 5HYSG 4N0RA 5JNYB 3FQXA 5TDOA 1I3GL 1FSKC 1IEAB 4RQQA 4Z77A 2HYMA 3ZE0E 1P4BH 4XTRD 4DCQA 5DD0L 4I5BB 1IGML 3O2VL 1XEDA 2P5ED 3QA3A 1MREH 4DTGL 2E9JA 4YHMH 3W11D 3BD5A 4HS3A 5MP6L 1ZVHA 1FNEA 1NC2D 4X7CC 4U1IA 5GQBA 3G5ZB 1C5DA 4F2MA 4ALAH 3REVA 4KKAD 3RWCB 5INCB 1JK8B 3HPLB 2WLYA 2ID5A 5DMIL 4Z7UE 4BELD 4FQ1L 2XTJC 1K2DA 1FNSH 2ENYA 3QBTB 4HUMB 4G59A 2VWEC 3CZFA 1CFTA 1OARL 5CP7A 3V2AR 1QR1A 3HZVA 2FHCA 3S3PA 3VRLF 2FECI 2OI9B 4FZEL 5C0RL 1CTNA 2LVCA 3IKKA 3V5HA 1N6QL 1JMXA 1Q9OB 4UU9A 3DUUB 1AXIB 4PJGB 4BFIA 3KPRE 1RZKC 3UEZA 3X13B 4A2MA 5C9JA 3G6JE 3MC0A 4L3AA 4HV8B 1JYXA 5C6PB 4N0UB 2R2BB 2XKNB 4UZGA 1F97A 3KYMB 3SKNA 3QDJE 1GOFA 2A6DB 3KDMA 3WDJA 5C0CD 1EHAA 1MVUB 4KKNA 2D4DA 3KPOB 3X3FH 3SGEI 1AI1L 4JFHE 4XMKH 5CIPH 2PYEB 1M4KA 5CAYB 3JUZA 4MWFB 4EIGB 4H20H 5I74C 3QIWC 2F54D 4M1DL 2OZ4A 1EEZA 3GDBA 5FDYA 1FCCA 5JDJA 3BKYH 2P24A 4JZJC 4JFFD 4Z7WF 2X70A 4YBLC 2J8UF 3TEUA 3EO1A 1A6VH 1WFOA 3RI5K 2VZTA 2BY0A 5E7FA 4XCFL 5IVZA 4ERSL 5C0IB 1FG2A 4OCYL 3ULVF 3C5SA 5KVDH 5DEGB 3H3PH 1ROWA 2VTFA 1KTDB 5GRUL 4ZXBD 1HCFX 3O3UN 4CN6A 3VDBA 3W81A 5IT2L 3U0PA 5DJZA 4PJ8A 1I9IL 5EBMA 3O8XB 4LVHB 3LRGA 4G8EA 1PGRB 3VG9C 4D9RE 2MQCA 2AXFB 4P4KC 5DO2C 3VI3E 4E0RB 4OM1L 5L0QC 4PJ9A 5C0FB 3B9KC 4X6CA 3ARUA 4JRXD 2C1PB 3V4PH 1A6AB 2ESVB 4HQQH 4QTIH 4X6DF 4JO1L 1IL1A 2IALB 1FNGA 3IDYB 2F5BH 4PJBA 3T0ED 4WFGD 4K3DH 1IKFL 2VSDA 4RGNE 4LVOC 3KYAA 3TT1L 2AJVL 1UM5H 3ZKXC 3D85D 2VDRL 4PRDB 3TVMB 1CR9H 2FGWL 3QEQE 4GAJH 3O6FC 4NQSB 3L3KA 4EXPX 2ITCB 1KJVA 3MBXH 2ENSA 1I8MA 1A7BA 1A1MB 4DQOH 1CGSH 4U1KA 1U3JA 2NZIA 3MROB 4LFHD 2P47B 2X42A 4L8DB 1X7QA 4HCRL 4HZLB 1FNLA 5DRXA 4HFWB 3KJ6L 3HI1A 1WIOA 2HLAA 3K81A 1I9RL 1EEYA 4PJIF 3KYKL 5KSBA 4G80B 1CCZA 3PHOA 2FBJH 3QI9A 4NQXB 3IJYA 4PPTA 3O11B 1QO3B 1U3HA 4Y5XB 1KPVA 12E8H 3AS2A 3E6HA 5T3XD 4NZTH 4RWYL 4DZBB 1M7IB 2GI7A 1HI6A 1MJ8H 1UC6A 2BHZA 4W6XB 3NFSL 5CJOL 1BFSA 5J6GA 3LV3A 4LSRH 3VWKB 1FZJB 2IH1A 1JNHB 3SDXA 5C08A 2HTLD 4OCNC 4UQ3A 5I1GL 3BKML 4PJ5E 4YXHH 1XMWA 1F42A 5ADOH 1E4XL 4P4RA 1HHKB 1NGPH 4FFYH 4JG1H 4WW1A 1H3WM 4XAKD 1YECH 4OF0A 4B5EA 4DEPC 4CJ0A 4WFED 5I2IB 1I85A 1JPSH 3HR5B 1UM4L 5LG1A 4OBRA 5IVNA 1FFPB 1U9KA 4KJWC 3LIZL 4S1RL 5JPMB 2IQ9L 5J3HD 4G3YH 4K7PY 1HEZB 3MRFA 3H9SA 4M5ZL 5KSVB 4OCWH 2EYTA 4NRXA 4FQIH 3O4LB 5IVXB 5B38A 5JORB 1ITCA 3QH3A 5ADPH 4FFZH 1WUNT 1EHXA 1G7LA 1G6RA 1A3RL 2BNRA 3KR3H 1RUMH 5I8KH 3FB7A 5TE6H 3VFUB 4H26B 4KRNA 3CFDB 3FRPA 3FT3B 1DBAH 1OAUH 4RWHA 4F58H 5DZNA 5I8CB 4R8WH 4M1CD 1U8KB 3INUL 4X9IA 5C07E 5L2KA 5EC1A 1PSKH 2IAMA 3MLZH 1SJEB 2I5YH 3L3OA 3OAYH 3BO8B 2NTFA 4HPOL 4PRAB 1BQLH 5IFAL 5EU6E 5I76B 4WTWA 3HUJF 1L8JA 2W0FB 1RUAH 4RISL 1D9KD 2YPKB 2JK5A 4XNYH 4LPVA 4HKZB 2GITA 4YXLL 1XCQA 2GUOB 3T1FA 5H94A 3QXWA 3ARGA 3MJ7B 1KCSH 1FL5B 1VENA 1CFBA 1D5XA 1JGEA 4JN1L 2YOCA 5C0EA 3L3DA 3QFJD 2R15A 4KZDL 1NCDL 5L8KB 2FWOA 4NQCB 3VGAB 3QAZB 2NNAA 2I9TA 5C2UB 1H5BB 3ALXA 4QWWD 3RWDA 3NZ8A 4K2UH 1SBBA 4GAGL 1X5AA 2G75A 1N6VA 4M7LT 1R3HA 1EFXA 2NY0D 3TO4B 1I8IA 4ZOCA 5DQDL 5DQ9A 2XZCH 3RNKB 3TJEH 3S36L 4L8BA 1P84J 1JF1B 1FRGH 1JYNA 1A1OA 5ETUA 4PV9A 4O2FA 4UIKL 1KXQE 5ITFB 4OFDA 2W9EL 4Y5YB 4F9PC 4P2RA 5M94B 1AD9A 3JV6A 5E0QA 1JP5A 5J12C 1J88A 3T1WA 4I3RL 2EXWD 5ALBL 3WEXB 4PRNA 3E2HC 1T5XB 3GKZA 2EDQA 4P2YA 5DJ2B 5E8PA 5AD0A 3C60D 4PR5A 3PGCA 4K8RH 5IB1A 1DBJL 1FQ9C 4NUJB 2BX5A 4MZ2A 1V3MA 5GRVL 4BH7B 5AWNL 3V0VA 3RGVA 3ETBF 4U1HA 5E8DH 3ERYA 3D25B 3VFNB 3KXFD 4HF5H 4U6YA 4YQXH 3QEHA 1AGBB 2ZG3A 3MOQA 5DHXB 3O41A 3QCTH 4Y1AE 2XTJB 4FQ2L 3B9EA 4R96B 1A7QH 3NAAH 3BHBA 5KS9E 5LGJA 4IS6A 1FH5H 3Q2CA 4EN3A 1SJVA 3MRJB 2P5WB 5FA3A 1H9VA 3MLTA 3DJ9A 4Y4KC 3RL2B 2A6JA 4PJAA 2J6EH 1OT1A 3BUYA 5K9JH 4QT5A 3BT2L 4JHWL 2OXHA 4CW1A 5ERWA 1HSBB 2ICWJ 1OOAA 3QWOA 4NO2A 3L3GA 5DJ0B 5SWZA 5C6TH 3TM6A 4YFDB 3F7VA 2DQUL 4PRIB 1UZ6F 3P30L 3MLYL 2A83A 2YR3A 5CILL 1EJOL 4XCCL 4DUXA 1KGCD 5GS0D 3VG0L 4J8RB 3C6SB 1G6RL 3K8LA 1A6ZB 3PHQB 3QIWB 1I3GH 4CUCA 3A6OA 1BBDH 4JDVA 5DD0H 3U4AA 43CAA 5E2TH 4PRPB 2X4NB 1IGMH 3O2VH 2GT9A 3G9VA 4MAYC 4OCSL 5EUKA 5MP6H 4ISVA 2F8OA 4X9HA 3GMPB 3JWDH 5FO9B 1FFRA 1RAMA 1JV5A 2WWKT 2IC2A 3HZMB 3BMVA 2JCCA 3UMTA 3KPNA 1VFAA 5GRWA 1MHEA 3X14B 1Q0YL 5B39B 4J2XA 3UJJL 3VG9B 3C87A 3P9WB 3D87B 3ZDYF 3W0WD 3S3JA 5L0QB 2YPVL 1UVQB 5GRJL 4KROD 3P4NA 1N6QH 2AJZB 4Y4HC 1R24A 5E6IC 4Q0XL 3RVTC 4GAYA 2C1OA 1TJGL 4I4WA 4P5MA 1TMCA 1YEKL 1FZOA 4XPAH 4QCIA 3ZKXB 3P77A 4X4XA 1EMTL 4PJDF 3EYUH 2FIRT 5CWSB 2P42B 5E94B 3UTPE 4G8FB 3SDCC 4WWKA 3C08L 1IE5A 1YY9C 3JTSB 3MRLA 1ETZB 1G84A 5MEOA 2ZG1A 4Y19E 3TBVA 4ODHH 4LKCA 1QBBA 2Q1EA 4OF5A 3QCVL 4M1DH 1RZJL 5IESL 3MUHL 5DJCB 1KCVL 4QYOB 3DVFA 4X7DC 2DKSA 4JFYA 3FN9A 2XOTA 1XIWB 2KZ1B 5H35A 1MAKA 4D9LL 3WFBL 4NWUH 1DLHA 2VABA 1MI5A 1CYGA 4XCFH 3QPQC 2D0HA 2LVEA 4NQDE 4WDIB 1WBZA 5D1QD 3S35L 1DEEB 1JUFA 2VC2L 4OCYH 3RZWA 4NO0D 3BZDA 3TPUB 3UJTL 4QRRA 2VE6A 1T2XA 1B0GB 1VGEL 1OY3B 4FMFA 3ILPA 1YY8B 5IT2H 1MRFL 1I9IH 3H7BA 1B4JL 3LEVL 5T1KA 4H1LG 3EJJX 4F7MA 3FFCB 4RFNB 5D6DA 5GGQL 4NZUL 1Y18B 2B1HL 2EYSA 4W4OC 4Q9QL 2A2QT 3QO1A 5F7FA 2BVQA 4LKXA 2CIIB 4CVZA 4XVUD 1LP9A 2ADFL 3MRNB 3NIDE 3PGDB 4JO1H 1X4XA 4N5EA 3KPMA 1NGYB 2D4FA 3DARA 5FB8A 1LE5B 3KYNB 1FPTL 1XF2B 1DTUA 3S4SB 2R0WL 3TT1H 2AJVH 2QSCL 4YDJA 4JRYD 2BSED 2VDRH 1W8OA 5DI8A 2V5RA 4DEPB 1YYLH 2J7LA 1UJTA 2FGWH 3IS1X 2X4RB 4PJCE 4MD5B 4L4JA 5D2LB 5C0GA 2QR0A 4I13B 2E7LE 1Q9LA 5J56B 5EIIB 2PXYC 4N68A 3R1GL 4R4NC 3NACL 5ITBL 3LB6D 3RVXD 1MH5A 5SWQA 2VLMD 3V7AE 4IRSA 5IK3B 5D7LE 1FFOB 2CKBB 4K3HA 1I9RH 4APQC 4Q2ZA 3HAEA 1A64A 3O6ML 2BVTA 1BQSA 3BKJH 4EEEA 2AK4E 2QBWA 2Y23A 2EE3A 1YMME 3IRZA 5IV2B 3FTGA 4NQVB 1RUQH 2ED8A 3IFOB 4YPJA 3VXMB 2N7AA 2PCPA 4EJ1C 2VNCA 5FYJL 1NFDA 4QRPA 4RWYH 3BQUC 2DQEL 4N9GB 2E7MA 3G5XA 3MO1A 3UTTE 3PWLA 4OKVA 1FGVL 1BQHG 5DT1L 5HVHB 5LCVL 1BECA 4J12A 2ZCKL 4HUVB 1ORQB 2H2PD 5I1GH 4G8IA 4JM4H 2V5MA 1A7RH 2CH8A 4OKDA 3SBWA 2JIXA 3BP5A 1TETH 4LSTL 4KDTC 4U0QB 2BVPB 5F89A 4EIZC 1QFPA 3WV0A 1E4XH 1NBZB 4HMCA 3T77B 1A5FL 1N2RA 4IMLA 1AO7E 2W9LA 4G6KH 5CLWA 3STLB 3P4OA 4YPGA 1S9WB 3VFRB 4ZQKB 1LDSA 3O9WA 4QRUB 1QA9B 1L0YA 4NZJA 1UM4H 4WI6A 3T4AA 2MCPH 1CIUA 4PJ8D 3OR7A 4OD3L 2VSCA 1D5BB 3R4DA 1N0XL 4F3FA 3O2DL 3BEVA 1EUTA 3F7RA 1FO0L 4NM8H 4S1RH 3A6BH 4PJ9D 1CVRA 5EU7E 5C0AB 4H5SA 5E1AA 1BJ8A 1T66C 4NP4L 4M5ZH 3EDJA 3DRQB 3PDGA 4WHYG 1SYVA 1WK0A 1KENH 2FEEL 1GGIL 1RSFA 3V5KB 2IBGA 3BDBA 3L5WB 1A3RH 4PGZA 5DRWB 1QSEB 4L9DA 3VXTA 4FRWA 3MRKA 1A2YB 4TUOB 5FGBA 4N8CL 5E8NB 2NXZB 3IU3A 3T2NL 5J12B 5C7XH 4M43L 2IPKA 2VLKB 4XPHL 2R4RH 3FRUB 1UWXK 2HMID 1IMHC 5GGUB 3KAAA 1XH3A 3INUH 3MMEB 1MIMH 1U8PA 4BH8A 3TIEB 1M7XA 1EXUB 3GMNA 5DVKA 1IAKA 2GJJA 3WN5B 3SCMA 4YHZL 1IGJB 2E7LC 2XQBH 4JFEA 4WV1C 2DMCA 5I1IL 3WUZA 2XQYG 1GYAA 4FNLH 3DROB 5F7KC 1N5YH 4EVNA 4NNXA 5C0BB 5TQ0L 4PIRF 4YXLH 4RMSA 2IGFL 1DFBH 4JN1H 3MV8B 1S7SB 3QI9D 3GSRA 4JDZA 4KZDH 1NCDH 4WI4A 4QRTA 1CGVA 5IWLC 1AKJD 1U3HD 1JWUB 3GMLB 3RY4A 1YMHB 1RU9L 4TNVF 3SE4A 1DQDH 2ZUUA 3Q6FB 3D69B 4LQ1A 2DQIH 4FMKA 4O2EA 2H1PL 5DQDH 1S5HA 5HI4D 1BOGA 3B2UD 5JIIA 3SKOA 5C08D 3SEPA 4I8DA 1HWHB 1L0QA 4AEHH 2BNQA 3VXOB 2DQDL 4Z7WE 4HWEH 2XZQL 4ELMA 2EDTA 2J8UE 5E00B 1E4XI 2RBLA 5F71A 3HI6H 3BRGC 2W9EH 3GIVB 3MV7B 3FQTA 5EOQL 2PW1B 2ORBL 5D6CB 3WUWG 3ULVE 4KJYA 3CDFA 2ADJB 1Q8MA 1B88A 1J8HE 5F44A 5E4EC 4K3EL 3IDXH 3LDBB 2VL5B 5AWNH 5CCKL 3RBGA 1QFHA 4XB7A 5F8RC 3H9SD 1DBMH 4OD2A 3EYFB 1XGQA 5D7IF 4X6DE 2LAGB 4FQ2H 3IJHB 4BFBD 4PY7A 4MJ6B 4UBDC 1HHIB 1S7UB 5GZND 4HHAA 5KSAC 1EK3A 4Y0GA 4ONHA 4PLNC 5L2KD 5L7XL 1CGXA 4HIEB 2IAMD 3GSNA 5E6IB 5HHMA 1XAUA 3CVHB 1HHJA 1HK6A 1T3FA 3ZKND 1H0DA 2QTEA 4HJ0D 1MHPL 1K85A 2IANE 4FXGA 1X5JA 4YK4C 4WI7A 3SDCB 2DQUH 3S5LG 4KK5C 1NL0L 2EO1A 2W9DL 4PJIE 5CILH 2RAMA 3ARGD 4NPYB 4M3JA 3SKMA 5ANME 5CD5C 3MRRB 3VG0H 4N1EA 4C56E 4JFOB 3HG1E 1R3KA 2P7TB 1Q94A 3DMMB 3HE6C 4WUKL 1IBGL 2XPGA 1TVHA 1UFUA 3WCYA 1BVKB 1I1YB 3BP4A 4UNVA 3X3GL 5ISZE 4OCSH 3WE6B 1EFXD 3DIFB 3DSFL 5DVLA 4Y4FB 4M6OH 1Z3GL 5KN5A 2P8MA 1NGXB 3TV3L 1G9MH 4H1LH 4S1QL 4DVBA 4XXCC 1BWWA 1S9VA 1WAAA 1HZHL 1F4YL 1Q0YH 3OB0H 3F8UB 4NQDA 4P23D 3E3QA 1QRKA 3BZFA 1VA9A 1D5ZA 4MDIB 4Q74A 4MCZB 4CN1A 3MNZA 4JY5L 4P2RD 5DJDA 1V3KA 3RZCC 4BSJA 4S2SB 5IEHB 2P46B 2F19L 1U8LA 2E9WA 2A6KB 4E41E 2YUVA 1HSAB 1R0AL 3TCLA 3OGOE 5JLZB 1VFUA 3HMWH 3PWPE 2GY5A 1B0RB 3TBSB 3KJ4C 3ULVC 4Q0XH 4Y7MA 1RIVL 5F88A 1NEZA 3SGKA 1TJGH 4U1JB 1YEKH 3ZTNH 3RGVD 2W07A 1XF3A 2X5PA 4L4TE 1OSPL 4GBXA 3MLVL 4QRQB 2FO4A 2N7BA 5DVOA 3TA3A 4YHNA 3NIGF 5HGHB 1D5IH 2YD7A 3LQAH 3UP1A 2P49B 2UYLB 1WITA 2PXYB 3IFLL 5GIRB 3RVUD 4D0DB 3RTQA 4EN3D 4LHUA 1F4HA 4AY0A 1U8NB 2GK0B 2N4IA 1JPGB 2ERJC 1G7PB 3N1PC 5SWSB 1L9MA 3IGAA 3QCVH 1VGKA 1M6OA 1RZJH 5IESH 1J7VR 2F53E 1KIRB 3WXWL 4X5WA 1P69B 3ARVA 2NYYD 1GC1H 1KCVH 3ECBB 5EO9B 5IHZA 3EFFB 5FA4B 3ARBC 3LKRB 1CDYA 2CSPA 1UB6B 2NQCA 2NY6C 3GKWL 2D03L 1QR4A 3WFBH 1P84K 3L3IA 3ARYA 5SWZD 2EIBA 5E2UL 3HUJE 4GKOA 1YJDL 3S35H 3AREC 2JF1A 4LP4A 1NCCL 3AC0A 1T2QH 1S3KL 4EKXA 5IQ9A 5HD8D 1VGEH 4JQIL 4P3CL 2BSRB 1J0HA 1RFDH 1Z5LA 3BQUB 1MRFH 3MGAA 3DWTA 1K5NB 3LEVH 4JE4B 3QUKB 3NH7L 4IHOA 4LFHG 1H3UA 1P7QB 1XGRA 2WQRA 2VLLA 2X40A 4IMKC 4NZUH 2B1HH 5D4QA 5JNYA 5J1SC 4Q9QH 1IEAA 5E99L 1RULL 1JYVA 2ZUTA 4I5BA 2F58L 2WSKA 3DUSB 2ADFH 2ADIB 1OT2A 2FATL 2R69L 4HWZB 1NFKA 2KPNA 4WI3A 4LQFL 5HJ3B 1FPTH 3G5ZA 4MAUL 2R0WH 4F9LA 4MNGE 4K9EH 3RWCA 5INCA 5I1AB 1JK8A 4LSSL 4PGCB 5IW6B 3HPLA 1UZ8B 1OTUC 1TJHL 2Y6SD 1DQML 3WNPA 1JPST 1U8MB 4WHYH 4MXQA 1LEKB 1GGBL 2CDFB 4HH8A 3AS0A 3R1GH 3NACH 4JKPL 2DD8H 1EAPB 5ILTH 4P5TC 2OI9A 3OR6B 1G1YA 1Q9OA 1BWMA 3DUUA 1P6AB 4PJGA 3OKEB 3D39E 3O6MH 3RRQA 4YNYB 9CGTA 3X13A 1OVZA 5BVJB 2K7QA 4HV8A 1WGOA 4N0UA 1LEGB 2R2BA 2XKNA 2Z31C 3KYMA 4IBLT 2A6DA 5FYJH 4WWKD 3F7QA 5GS3A 4NZRH 1M7DB 3KPOA 2PYEA 4KVNH 4A6YH 1FGVH 4LOUC 1S9YB 4MWFA 2QKIB 1T21B 3P40A 2W38A 1UKSA 3ULUL 4G6JH 2Q87A 1C8PA 4WV1B 3DO7B 3PDOB 1KB9J 2E9BA 3RKPA 4LSTH 2R1XB 4KAQL 2H8PB 1MI5D 3QISA 1A5FH 5C0IA 4K94L 5EBGA 5HDBE 3KHOA 4OZHB 3EIFA 4QRRD 5DDHB 5DEGA 1KTDA 1TJIL 2GEEA 3MJ9H 4I48B 1UZ6E 1LO4L 5BS0B 4Y2DC 5EZLB 4C83B 4OD3H 3O8XA 2IMNA 5LAXB 3V8CA 5T1KD 1CDUA 3O2DH 2VXVL 1K6QL 2AXFA 1JGLH 1FO0H 4E0RA 3B9DA 5C0FA 4J3XA 2C1PA 3ZYJA 1T1WB