3MRDA

Crystal structure of mhc class i hla-a2 molecule complexed with hcmv pp65-495-503 nonapeptide v6g variant
Total Genus 79
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
79
sequence length
274
structure length
274
Chain Sequence
GSHSMRYFFTSVSRPGRGEPRFIAVGYVDDTQFVRFDSDAASQRMEPRAPWIEQEGPEYWDGETRKVKAHSQTHRVDLGTLRGYYNQSEAGSHTVQRMYGCDVGSDWRFLRGYHQYAYDGKDYIALKEDLRSWTAADMAAQTTKHKWEAAHVAEQLRAYLEGTCVEWLRRYLENGKETLQRTDAPKTHMTHHAVSDHEATLRCWALSFYPAEITLTWQRDGEDQTQDTELVETRPAGDGTFQKWVAVVVPSGQEQRYTCHVQHEGLPKPLTLRW
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system
molecule keywords HLA class I histocompatibility antigen, A-2 alpha chain
publication title Analysis of Relationships between Peptide/MHC Structural Features and Naive T Cell Frequency in Humans.
pubmed doi rcsb
source organism Homo sapiens
total genus 79
structure length 274
sequence length 274
ec nomenclature
pdb deposition date 2010-04-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00129 MHC_I Class I Histocompatibility antigen, domains alpha 1 and 2
A PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3mrdA02
3.30.500.10 Alpha Beta 2-Layer Sandwich Murine Class I Major Histocompatibility Complex, H2-DB; Chain A, domain 1 MHC class I-like antigen recognition-like 3mrdA01
4PGEB 1CFVL 1M05B 3O4OC 2ITDA 5D72H 3TT1L 1BBDL 3QP3A 2DM7A 2VXVL 1PKQE 1NEZB 4GS7C 1BD2D 2DWDB 1N64L 2APTA 5J7CC 2YHGA 3MRRA 4LARH 2I5YL 1UWEL 1YNTB 2NY5L 3VXRD 4JRYA 1A6TB 1D9KD 4M4RA 3LN5A 3ZT6A 3O9WB 5T5FL 4PJXB 1CDYA 1JGEA 1NGXA 4DTGL 1WT5A 1KJMB 3UROR 1MCBA 3GGWB 1MELA 1RULH 2O5YL 3HPJB 4V2BA 1YJDC 3TBTA 1FH5L 3RZWA 1YQVH 4OLXL 4MD4B 3NZHL 5FYKD 3SO3B 5E4EC 4F7MB 3L95A 3VU2A 3BJLA 3X11B 2A6KA 3ULVF 5DT1H 3TT3H 5F72S 3WE6A 5J06A 2P8LB 3L3OB 5CKAA 1HSAB 3OAYH 2BNRB 5K9JL 3O6FA 4LK4A 5TF0A 4LCIH 1IBGH 5E1AA 1F6AA 3ULVC 4PJXF 3RZCA 1MI5A 2V9QA 3HZYA 3K81A 3CZFA 5JHDE 3NOIA 3TBYA 4WO4D 1MCIA 2P49B 1JHLL 1F4XL 4QOKB 4MYWB 3PGCB 1EZVX 2AK1H 5IWLA 4XCNA 1A4JB 1HH6B 1KXQE 3O9WC 4AG4L 3EOBB 4NO2B 3B2UD 1UQSA 3OKEA 3PWPA 1K6QL 4LLYA 1XF5B 5JO5B 4HS3B 5IEHB 5ESAA 1T20B 1U2HA 2XOTA 1OAUH 3QNXA 1T2XA 5EUKA 4D9LH 1FNSH 2DTML 4OF3A 1P7KB 5F7EL 4O2EA 3ESVF 2XRAL 1SY6H 4LKXA 4N8CL 1BX2A 1U8HB 5I1DA 1I9JL 5DUBA 2VB5A 3SDYH 5J9PA 4HQQL 3KHOA 3SDXE 4BZ1H 1DL7H 4LLUA 2VN4A 4HEME 4M02A 2FEEI 1G6VK 4UQ2A 3W39B 3VXSD 3MOAH 2YPLE 4NDMA 5LWYH 2JELL 1UM5H 3IDXL 3DO3A 5JOPD 1I1AC 4JFXB 1QNZL 3O45A 3CUPA 4K94L 3UP1A 1SHMA 2YPKB 4ZUUA 3WL9B 4RQQB 5ENWA 2WBJB 5I18L 1X44A 3TVMA 4QTIL 1S7SB 3MGOB 5D1QD 1MCLA 4HMDA 2V7NB 1GZPB 1DQML 3KYOA 1HZHL 4Y1AA 5D7IA 4QNPE 4KJPD 5ID1A 5IM7A 4KGJA 2J8UA 1G84A 4WY7L 4Q6IA 5JPMB 1C5BH 3U7AA 3SJVE 4CW1A 3DPBA 1NJ9B 3B83A 4XNZC 2WBWB 4BH8B 2I9LA 2Q86B 3WXWH 4H5SB 3RVTD 3UTQA 2ENYA 4FQJH 1NEZG 5HHOD 1NKOA 5IV2B 1QRND 1J8KA 1CGVA 1I7UB 1QYGL 2FECL 2JIXA 1X5HA 1YUHA 3UPRB 4Y16A 4AL8H 4NQCB 1J05B 1NCUA 3U0WH 1FIEA 4NSKA 4P2QA 3UTSE 3RGVA 4CU7A 4KXZI 5HVHC 2VDOH 3VGDA 1VHPA 3R0NA 1QBAA 4AYFA 1J8HA 5E2UL 1U58B 3V52L 4L5FH 3MROB 5ELIA 4GMSL 4PTUA 1BEYH 3BZDA 3CXDL 2ZCHH 5J12C 3INUL 3GJFH 3OL2A 4D8PA 5T1MA 4ZOBA 1EAPA 4RGMB 1AHWB 3RWHA 5HDLA 4FQ2H 3T0WA 2CR3A 5DMGC 3GSWA 1WAAF 5DGRA 2P8PB 3DYOA 4CVWA 5CWSB 5J6HA 4WRLA 4RAUB 3C08H 4M1DL 1CGXA 3VWKA 3OJDB 5D7JA 1WIUA 4MA7H 5DDHB 1YJDH 1ZVYA 5ADOL 1A7OH 2AVGA 2R0ZH 2H8PA 3HC4H 3UBXI 5DSCB 4HCRA 4MQ7A 1P4LA 2B0SL 2GJJA 4YHZL 1BOGA 1XF4B 4PJGB 3QRFM 4Q58C 5GZOD 4UBDD 1CDCA 2AV1A 4R2GD 5CJQH 4LNVA 3D0LB 3RGHA 5HJ3B 3NZ8A 1FLRH 3C09B 5IT2H 5I8EA 3GHEL 2J6EL 3AC0A 1J12A 2BVPA 1BGXH 4JY4A 3ULVH 3SDDB 5GXBB 4UT7H 1W72A 4RGMC 3GRWL 2HJKB 1AGFB 1U8KB 2EYTA 1HXMA 3QIWD 1AHWC 4R8WL 3SPVA 2V17H 3PP3K 5DD5L 4OUUA 5TDOA 1FFOA 1PKOA 2FO4B 3DVGB 5BW7C 2EDYA 4E9LA 1RIUH 4PJGF 5DQJA 4JJ5B 3Q6GH 2HVJA 4YIQB 3RWGA 4JHAL 4J2XA 2EZ0D 1EO8L 5K9KA 3MRLB 2EO9A 2GT9A 4XRCB 4LPUA 5GGSA 3D85A 4LSRL 4NQXB 1X9QA 5CMAB 5D8JH 1FVEA 1YDPA 3QUML 3OKOA 4G6JL 4P57B 3V0VA 3MFFB 2DJUA 4Y4HA 3T0EE 1XGQA 1G9NH 2UVEA 5A1AA 3MBXL 5C0BE 5ISZB 2WWKO 4H8WC 2X4NA 4NT6B 5HDQL 5IG7B 1YQ2A 4ZUSA 3S97C 3RWEA 2AS5M 3BIKB 2DLFL 1T0NA 3V4UH 2OLDA 3QUZB 3QT2A 1U91B 4MNQE 1II4E 4P4RA 5BO1H 3PGDA 3DYPA 1S78C 1VKXA 1JBJA 4QRRE 4UI2A 2R2EB 4HUXA 5DFVD 5FYJH 3QISA 2XA8H 1JTOA 5HYSA 4K8RL 3DIFA 3U0TB 1RSFA 3KYKH 5EZOL 3WD5H 3KPRA 4OQTA 3CAFA 3K7UA 8FABA 5I75B 3BD5A 2V6HA 4YDVA 1P4BH 3V0AC 3O3BA 3BWAB 1FBIL 1R0AL 4X4XB 3ZE2E 3ORJA 3RA7L 5EU6B 2DIAA 3WDHA 3TIDB 3KPOA 1JF6A 1I8KA 3ARFD 3O4LE 3QIUC 4XAKD 5KVFL 1SYVB 4CN1A 4YDLC 2ZUTA 4F9PA 3W9DB 1G7QB 3GNMH 5T5NF 1M7IB 3HA0A 4JLRB 1ND0A 3ARXA 4BYHA 2HFGL 3HI1A 2DKUA 5CHNB 4FQLH 3L3IB 3F7VA 5T1DH 4ZTOL 2PCPA 3D9AH 3DX7B 1D5BA 4JN2A 4GBXD 5FYJU 3L6FB 3KYMB 3IJHA 1ADQH 1FCCA 1UZ8A 2ICEA 3IAGC 2OI9A 2CIIA 4Y19E 1N5YH 3C2SA 1IT9L 2DQUH 3QEQE 1CG9A 5IROA 1YEJH 4YHIA 5L7XL 2X4UB 5A2JH 1YYMH 3EO0A 1ZT7A 4WW2B 4PGDA 4UMGA 1Z0NA 4F33B 4DGVH 5HVGB 4F57H 3CVIL 4FQHA 1MPAL 1GC1L 1TTFA 4M1GL 5J3HD 1QSZA 3OXRB 4NP4L 3RBGA 4U6YA 2R2BB 4XNQA 3CD4A 4U1GC 2VLKB 3S3PA 1CFTA 4OFIA 3R8QA 1B4RA 4OLUL 1E4WL 4I3RL 4GUPA 4HKJA 4N0CA 3GMQB 3V6FB 1U42A 3JV5A 1RUAH 4ZPVA 3BPCA 2NMSA 2VDRH 1FVDA 1LK2A 3EJJX 3G6JE 5EWIL 5SV3A 1VADB 4ZO8A 3UJIH 4KMLB 1KUMA 4MSWB 1M71A 1IM9D 4WW2F 1INEH 2IBBA 1CICC 3LRSB 3UPCA 4OZHE 4XMLL 2NXYC 3FT3A 4L9DA 5K33A 1CGSL 1NKRA 3QUYD 3HTLX 4NQVB 4R4FH 3TWCH 3JTCA 4WUUE 3DVNA 2FJHB 4YDKH 3ERYA 4DKFL 5CP7B 5HGDB 3ZE1E 1G7LA 4WNQB 4MNGB 4L4TA 5K9OB 3L3JB 4DVRH 4LASL 5IF0B 3JWDH 2R4RL 3QUXC 2ITCB 3ARED 2VXSL 4OV5B 4G7YH 5E8PB 1QBMH 1QFWL 3K4ZA 5FM5O 4ZFFA 1OARH 2FL5A 4IRZL 1PKQA 4PJ9D 5GSVA 1KB5L 3LEVH 3VD7A 1DQTA 4KUZL 2A6IA 3O6MH 2EYSA 2N7BA 2Y07H 5D70L 5ITFB 1X5KA 5DK3A 4S0TD 2V2WB 5GISL 3I9GL 4YXLH 1QR1B 4Y5XB 3QFDA 3MXVL 4UDUB 1TJGH 4A6YL 1RMFH 5BRZD 3NABL 4TULL 3T0VA 2PTTA 5T5NG 3FB5B 1MRDL 4PS4H 2Z91A 1L7TH 4O5LL 2BVUA 1FNGA 3QDME 3MA7A 1A3LL 4OZGE 1RIVH 3WJLA 3RWJA 3MTRA 1OW0A 5IFJA 1NDMB 4EXPX 5HHVL 2Q1EA 2EDTA 4HFWA 4UUJB 2ADIB 4CU6A 3VMOA 5T33H 1PG7W 5JQ6L 2W9EH 3VG9B 1PZ5B 4H8WH 1TJHH 3BO8A 3QWRA 4KU1A 4M93C 1HHHB 2AEQH 5TDNB 4EI6A 3D39B 4O02L 3I6GB 4LPWA 5LGHL 4G6MH 2W60B 4U7MA 5C07E 5ESVB 1Q9OB 2H1PH 3U79A 1T80A 2E8YA 1G6RA 3BKML 3VG0H 2DQIL 4M6OL 5BS0D 1IAIL 3CXHK 4FP8H 3EGSB 5IFAL 1HILB 3QEGH 5HDOA 5D1QC 1OAKL 1JWUA 5FXCH 1P9MA 3S96A 3S4SB 3IFPA 3LS4H 2XFXA 4KWUA 4AH2B 2DQJH 1KCSH 1DQLH 3ARDB 5BZDB 4J3WA 1U8OB 4YO0B 4X5WA 5D6CB 4AENA 3VFWA 4YH6A 5L6YH 4HS6A 3SCMC 4DKEL 1MQ8A 5IBLD 5FKPA 4JQVC 2IGFL 5GS1C 3CH1B 1CLYL 2CDEA 3VG9C 5HGGS 12E8L 1R3HA 5I1HL 1RUML 1RJYA 2NXZC 4QY8B 2MMXA 5HHQA 5INCB 2MKWA 2DQHH 4Z95H 1QVOB 1RZGB 3SDXA 1NFIA 3ZKXC 1YEHH 2ZG1A 4Y2DC 3GKWH 3IFLL 1MSPA 1W0WB 2QL1A 2ZOLA 4Q0XL 1G7PB 3WIFA 1ZMYA 1LEKB 1T4KB 1S9XB 5IMKA 4QRTA 1MFNA 2AK4E 1ZSDA 5C0IB 4OD3L 2XZZA 3M1BA 3O3DB 4JFQA 4LFHG 3ARPA 4EVNA 1KENH 3WLWD 4BQ6A 5JUEH 4GOSA 5HY9A 1Z3GH 4JM4H 3QXWA 4HC1L 3RVXC 1GOHA 4C4KT 2ZCLH 2ZSWB 3O41B 4JB9H 4RX4D 3GMMB 5DVNA 3MV7E 5T1KA 7FABH 1IGIH 2DM4A 5C9KA 1QKZH 3T3PF 5FHAH 2YR3A 3OAUL 3EO9L 1MREL 1UVQB 3BP7B 2J5LB 4ERSH 2X44D 4NZTH 3DOSA 1D5IL 3FOMA 3R1GH 4HK3J 3D69A 4L3ED 5C6PB 2VZUA 1AXSB 1CDUA 3UTSA 4JO4H 3KJ4C 1GAFL 4ONHB 1AFVH 3RNKB 3BEWB 1KFAL 2XNAA 4BFBD 1NGPH 1U8JA 1OSPH 1N5AB 3QDJB 4RGND 5D1XB 1UH4A 3CK0H 1V05A 4YHML 1KEGL 3P0YL 4Z7WB 4RNRB 2D9CA 1TCMA 3PQYE 2OK0L 5F7UA 5IJKA 1J10A 2ZP0T 5LVEA 4R4NC 2H2SD 2WUCL 3CZJA 4LCWB 1F8TL 2Z93B 4OLVL 1U3HB 5E2JA 4UILL 1IQWH 2C3XA 4NNPH 2YBRB 3BD4A 1CFSB 1ZKAA 5CJ8A 5A2KH 4F7EB 1S7VA 3VRJA 2WP3T 5CZXD 5EU7C 3ZKMD 3LEYH 5FGCE 2XY1A 3KXFD 3OG4B 3ZKQD 3HUJE 4Z7WF 1HNGA 2Q6WB 4HWBL 5TH2A 4ETQB 4HGMA 3TJEH 1I3GH 2DJSA 3PWJB 1WF5A 3GMPB 4HDIA 4NC0B 1U8IA 2GJ6E 5F7DB 3VGEA 1J0IA 4BQ9A 1RV6X 3JWOH 1FN4B 5IJVB 1BP3B 3JTSA 3QFJB 4PJEB 3LH2L 1FP5A 1L9MA 5F88B 4GRWH 3UYRL 2XKNB 2EDBA 2EYRA 4P2RE 3L3GB 4L4VB 1GGCL 1JNHB 2IG2L 3TPKA 3B43A 5I1EL 4HUNB 1CIUA 1XIWA 1J1OL 3BVNB 3MLRL 3KLDA 4KQ3H 1SEBB 3SGEH 1FNAA 1U3HC 1S3KH 5E70A 1CLZL 2AGJH 2FGWL 3CSPA 4X7SH 5D71H 3TH4T 4MJ4A 4OKVB 4OCWL 4XP1L 5KSVA 5GRJL 4Q9QH 1LO5B 4D9QD 3OMZA 3ARFC 3IDYB 4OZFB 4PJEF 3UDWC 1UKTA 3IS1X 2HH0H 5IBTL 4I0PD 4EDWH 2DF3A 3VXUD 1RFDL 4U1SB 4OTXL 5FA4A 2DQEH 4MAYD 2ZZUT 1IAOB 1MJUL 4ONGL 4XPAL 2DQDH 1KT2A 4C56B 3WHXA 1NUDA 1KC5L 4X83A 3O6KH 3T0EA 4GQPH 3NFSH 4JPWH 2PW2A 5IUSA 5C0BA 4HBCH 3QCVH 2LVCA 3QDAA 4HUKB 1QFWI 1B88A 4R90L 1TCRA 3MRFB 2Y4SA 1FFPB 1BQHB 2NY0B 4KTEH 4MNQA 1H8OA 3TYGH 4LSUH 2X70B 3AXLB 3RWFA 1R5IB 5JW4M 1GZQB 4P2OC 4KRPD 2JKXA 2DYPB 1YMMD 3MZGB 5L9DH 2PW1A 1JPTH 2FIKA 4QRRA 1EPFA 4ZFOL 4JM2B 2E7CA 3ZTNH 4NJ9H 4X9GA 1L4IA 3IS0X 3SKOB 5IFHL 4PJFB 4AM0A 3WHE1 2NY1B 1JYVA 1OP9A 2FBOJ 4LCCA 1ACZA 3FB8B 3UAJD 4BZ2L 5MI0B 4TRPL 4GRLA 5KG9B 1OWWA 4M9PA 4Z7VB 3DRQB 3O4LA 4XBPB 5CJXC 1UEMA 5FIEA 3KS0J 3IXTA 1VENA 4R0LB 3UTTB 2ZPKH 3B6SB 1P53A 1KPVB 4Q9BA 1U8PA 1IGFL 4K3DH 1EX0A 3BDBA 3MR9A 4N5EA 4JANB 1EFXD 3BGFB 4X0KA 4D0CB 1G1YA 1IAII 1LO2L 4NOFA 4ODXA 4JM2F 5C0AE 2IPTH 4XP4L 3KPSE 1ONQB 4FQXB 4KJQC 5TQ2H 4PJFF 1KOAA 4JDVA 1FVCA 3SE8H 3DTXA 4L8SB 3BN9C 4OM1H 4Y19A 3MYJA 5FHBH 2DBLH 3QEQA 5EOCJ 4EN3A 4HGWB 3DI2B 3MRQA 1EEZB 4QRSA 5JMRA 1JYXA 2BNRD 4HJ0D 1NCTA 5GZND 3SKNB 5J13B 1ZA6B 5E5RB 5C0DA 2A73B 3C60A 4JO1H 5CZVH 5KSAC 1J1XL 3IYLW 4J23A 2VQ1A 4WEBL 4OT1L 1A6VH 4ONOA 4Z8FH 4R4BB 3QEHB 3Q6FB 1DR9A 4HWZA 1IKFL 5CILL 3KPLB 2AJSL 2AXFA 5FYJD 1J0ZA 3FOLB 1RIHH 4WHTA 3T3ME 4NUGH 1HSBB 1HEZB 4LVHB 3U30B 1GGBH 5E8EB 4XBEL 2I07B 4XWGH 3G6DL 1F00I 2X4QA 4EBQH 3UX9B 3AAZA 4OZHA 4E41E 4L8SC 3VFPA 4YX2H 2YZ1A 3DXAB 3HFML 3U36B 1JP5A 4RDQF 4LU5L 3KLHC 1S9WA 2CUIA 4WUUA 5JOFB 4L4JA 4OZFG 2C5DC 4PB0L 3WJJC 4JPKH 2AJZA 5C92A 3LSOB 3VFGL 1RK1A 1A7NL 1B9ZA 3RJQB 4ELMB 5GHWH 3EOYG 1IC4L 2AEWA 2EXYD 3RPIA 1F58H 1JWMB 1UYWH 4JFDB 1XT5A 5TE6H 3V5KB 5DEGA 2Z31B 5LAXA 3C6LA 1SM3H 2A83A 2X9XA 1YA5A 2WBJD 5SWQA 2FHFA 1KIPA 2XYCA 4APQD 1H3PH 3JUZA 1BQHG 3OSKA 1ZHLB 1PJ9A 4LVHC 4NFBA 1I8IB 3U30C 3S9DB 3CPLB 1WFUA 3O6LL 4K9EC 3MNVA 1XH3B 1LQSR 1UKQA 1ZA3B 2R0KH 3MV8E 4LSVH 4RFEB 4ELMF 2AJVL 5ITBL 3QDMA 1BWMA 4CU8A 4OZGA 4P5TA 2EC8A 2XQYK 4NRYB 1YNLH 5LGJB 3GHBL 3BYTA 1CCZA 3PWLB 1QA9B 3P4MB 2EEAA 4PRDA 1DEEB 4NGHH 5CD3A 2Y25A 5D2LB 5C0CE 4EIZC 2Q3AA 4TTDC 2WWMD 3HPLB 5CIPB 4ZNEE 1E4XL 5JHLH 1NQBA 5ERWB 3O8XA 1EEYA 4NQCD 1XGPA 3HE7A 5C07A 4F7TB 4Z77A 1CFQB 4W70A 2FR4B 1OCWH 2Q7YB 3OKNB 2DQTL 4MQSB 3H0TB 2G2RB 1T7YA 1OTUC 4X6BB 5JW4Q 5KZCB 5AZ2L 1UJ3B 4JFOA 5DXWA 4HMCA 4JDTH 2GFBB 4OZFH 2P24B 1BLNB 1FCGA 4B5EA 2R15A 2K9UA 5AWNL 4NQDB 5EO9B 3DLQR 5IR1A 2EDFA 5D2LF 1GGIH 4EI5C 4JFYA 1BVLA 3L7EB 5FCSH 1MCWM 1CU4H 4XXCA 4FQQA 3H42H 3FZUD 4L9LA 4A2LA 2HVKA 5LGKA 1SMAA 4I4WB 1R5VB 4RDQG 4ORGB 3P4NA 3BZEB 4I77L 1EVUA 2J6EA 1KGCE 2NY3B 1FSKC 3IF1B 2EE2A 2X89A 4GKNB 5IVNA 3GRWA 3LKSB 1X5ZA 1GHFH 1IM3A 4Z7OE 4FFEX 1OSZB 1S7RA 4UIMA 1H15B 5DHXB 1KCRH 3VRIB 4NN7B 4PJ8B 4M00A 2KKQA 4JPVL 4MVBD 2QQNH 5EO1B 5ETUA 1OGAE 4JFEE 5ICZA 2ITDB 2ZWLT 2NZ9D 1XFPA 2AK4A 3HS0A 3SDDD 4R97C 3U4EA 4KI1A 1K8IA 2FO1A 3FO9A 3CMOH 4QHNA 3QUMA 4V1DE 2H41A 4ENEC 3B9KA 3P4OA 2VC2H 4KK8D 4Z0XA 4BM7A 1FC2D 3TPUA 4NKMA 2OL3H 3MV7A 3WEXA 3VD9A 2BC4A 1QLEL 3HG1B 5FV1L 2DQCL 1JGEB 1NGXB 1XF2A 5F1NA 4YHLL 3EDDA 4I2XB 1DQJB 5EZJA 2RR3A 1ORSB 3TBTB 1TZHB 4QYOA 2DTSA 5AZEL 4M48L 4JFFA 1TLKA 1U93B 2EECA 3GSQB 1T03L 2A9NL 3L95B 2FZ3B 4NHUB 5FOJA 2LU4A 3T2PA 3CLEL 3C5JA 3DMMD 2VDNH 3WE6B 5ISZD 4H20L 4KROD 4JN1H 4WV1B 2IJ0C 4XP5L 3FRPG 3O6FB 5KANG 4S1SL 5E1AB 3QUZD 1F6AB 4F58L 3PQYA 4LSTH 1A7RH 4IJ3B 1E6JH 3HZYB 3CZFB 3L5XL 4PRBA 1KCKA 3UJJL 5I8CA 5ESQB 2HFFB 5HD8C 4XCNB 4YDIH 3LAFA 2EIEA 1NSNL 3FB6A 2R29L 4NQSA 3GSNL 5IB2B 1UQSB 3OKEB 3GSXB 4LLYB 1TVHA 1MIML 2C26A 1QD0A 2R0LL 1CE6A 2IQ9H 5FM5M 4NFCA 3QNXB 4J3TA 5EUKB 3FN9A 4C54A 3ARGB 3AU1A 4OGYL 5D2NE 4M7JH 3HUJA 2YUZA 4P5KA 3P30H 4LKXB 5GS0L 4JKMA 1BX2B 5I1DB 4MXQD 4UNUA 4YUEH 2GJ6A 4OCXH 4DEPB 1ZOXA 3T0AA 1KTLA 4UNVA 5E8OA 5J9PB 2X4TA 3O6FC 3DUHA 4DJMA 3FRUA 4Y7MA 3D1MC 4LLUB 4KY1H 5I66B 3T1FB 3BUTA 3RZCC 4IJ3C 4UQ2B 1DUYA 4S1DC 4PRHA 3K2UL 2QSCH 5L2JA 2ADFH 3MA9H 1MCPL 4JZJC 4QO1A 2V2XA 3O45B 4XP6L 3CUPB 1NCWL 2AXGB 4JG1H 4ZUUB 4P48A 5JDJA 4GW5A 4XVJL 1RUKH 3G5YB 4PRPA 4S1RL 5F44A 5I1IL 2MKLC 1G0XA 4MA1C 5DF0A 5JW3H 3H9ZA 1VFAA 3KYOB 3QPQD 4Y1AB 3ARBD 5ACZA 5IM7B 3E2HB 5H94A 4Q97A 2J8UB 4X7CC 1B0RA 4Q6IB 1DDHA 4NQTA 4CW1B 3PGFH 2VLRB 4PJCB 4DEPC 4IDJH 2VDKH 2I9LB 3OKYA 4XPBL 5CINH 5HI5D 3SQOH 2YPVL 2BY3A 2R2HB 3DUSA 3IU4H 2B5IC 5CIPH 5T3XH 3WXVL 2FCBA 2JIXB 3QB7C 3BKYL 4D9RE 2VXTH 2GTZA 4Y16B 2WY3A 1CL7H 2LV4A 1I9RL 5C3TA 1CDIA 4NSKB 5L0QC 1OP3K 3RGVB 3QULA 4J4PC 4RFOH 4MNHA 3UTZA 1E27A 1KB5A 3LHPL 3K3QA 4LFHD 3FN0H 1T6WA 2DBJA 2XKSA 3GIVA 2J8UF 4UB0H 1WWCA 4BUHA 1J8HB 3B8SA 1QR4A 3TVMC 5BMFL 4XZUB 5B8CA 4PJCF 3P11H 2RCSH 4A6YA 1ZHNB 1LK3L 1J11A 4Z18A 1MVFA 3RTQD 5EZLA 5T1MB 4KI5F 1DN2A 1WCBB 4Q6IC 1OAQL 4GAGL 5C6TL 1EH9A 3IJSA 2ZG3A 5DJDA 1R3KA 5EG6C 3RWHB 4IOIB 2O5XH 4K3JH 1Y18A 1VGEL 1MHCA 2HTLD 2EDHA 4GMTH 5E6ID 3VWJA 2YD7A 3JV6A 1WV7T 3KNBA 3ET9F 3NMEA 1E4XI 3OX8A 2QTEA 1IZKA 5F3HA 3VWKB 5E2TH 3DHJA 3N1PC 3HE6A 5EBWA 4KDWA 4U2ZA 5FUZL 3RGVC 1IFHL 3E3QE 4PP2A 2H8PB 3GMNA 2JLLA 3GM0A 4KK5D 4MQ7B 4QGYA 3KPSA 1BOGB 1NLDH 3FO0L 3L3DA 2AV1B 1JHKH 4HV8A 3B9DA 4R6UA 3HRZA 4HGKC 3VD4A 2DLIA 3RVWD 5I8EB 4RWYH 3BN3B 3QR2A 2BVPB 5DJZB 3OB0K 3TF7A 1FE8L 1W72B 5D1ZD 4HKBA 3TESA 1HXMB 4JHWH 3SPVB 2APBA 2UUDK 1JYWA 3RIFK 1JYNA 1P6AB 3V0WL 4YXKL 1R3LB 2AEIT 3MMEB 4FNLL 1FFOB 3V4PH 1HYSC 1Q9LA 3IDNB 1W0VA 1MCFA 4DGYH 5DQJB 1NFDE 2QSQA 3NA4A 1Q0YH 3T04D 5FB8A 3F7QA 3ARDD 4U7SA 3RWGB 5D7JC 4WTZA 1RURH 5K9KB 2LVEA 1PGRB 4U3HA 2BNUA 5GGSB 2J12B 3D85B 2Z9TA 4U0RB 5IQ7H 2XICA 1YDPB 1Q0XH 3OKOB 4MB5A 3C5SA 4QF1A 3V0VB 4E41A 3T0DA 2VZVA 3VFMA 4Y4HB 1XGQB 2C1PA 3QXDA 3WFCH 3NGBB 1OAXH 2AEPH 4ZAKB 5K9QG 2YC1A 2NZIA 1WFNA 2X4NB 3MSPA 5LG1A 3T2OA 2APFA 4ZUSB 2E9JA 1NAML 3BGAA 3FO2A 4ORZC 4P46A 1CZ8H 3RWEB 3TNMA 3W82A 2G9HA 1FL3A 1T0NB 4K7FA 2CK0L 2BOBA 4UV7H 4P4RB 1A9BA 2RFXA 5SX5K 4D94A 2W07A 4HC1A 1VKXB 1CLOL 3CSYA 3DNKA 3VXOA 4FG6C 4EKXA 2V2TA 4HIHB 3PXJA 5IHUH 4HUMB 4YFLF 5B4MD 1KLFA 5F7MC 4M1CD 4XXDA 4LSQL 2OS7A 3OKDA 2OP4L 1UB6A 3DIFB 8FABB 4DQOL 4YDVB 4U0RC 3VFUA 3O3BB 1G9MC 3NN8A 4LP4A 3SO5A 4MJIE 4W6YB 3MV8A 4Y4HC 1I8KB 3FTGA 4K7PL 3DURA 5E24E 1KBGH 4YBQD 3OAZK 5FYKL 4XGZA 1BECA 5IEKA 1T6VN 1MAMH 1ND0B 1EHNA 1AD9A 3HI1B 4LPXA 1MRFH 4N90D 5C0CA 2BRRL 3NIFF 3I6KB 3GBML 1D5BB 1MJ8H 4JN2B 4FFVD 5FOBA 4ZNEA 1F3JA 3EO1B 3UZQA 1UZ8B 1I8MA 2ICEB 4HULB 2OI9B 2CIIB 5C70A 4GAJL 1DSFH 4X8JA 1CG9B 4YHIB 1KXVC 3KS0H 1N7MH 3EO0B 3QDJD 4PGDB 2R0WH 5D1XD 5J6GB 4FQHB 1FNEA 3X14A 1MVUA 4GW1A 5C0EA 3SOBH 1FGVL 3FMGH 4HUUA 3QDHA 1CFTB 2EH7H 3T0XA 3SDAC 3V6OE 4HWBA 4LCWD 1CGYA 4HKJB 4HLJA 4CMHB 4F9PC 3TJHD 2XWTB 2XN9B 4LMQI 1HHKA 4MA8H 1FVDB 1LK2B 4ZYKA 4LVNC 1E28A 3VDAA 4N0FA 1YEKH 3U46A 1EBPA 4Y5VB 3RVUC 3WFEL 1WICA 3NAAH 1M71B 2AAVA 4KTDH 5I1LA 2D7OA 5DJ8A 2NW2A 1E4KA 1A6WH 3DMMC 3NACL 2OI9C 4WEMB 2N1KA 4NZUL 3BI9X 4ODVH 2MWCA 3BP5A 2VL5B 4OIIH 4P4KC 5IROC 2IALA 1CR9L 2YMXH 3AY4A 3T4YA 3QFJD 1G7LB 2AQ1A 4GH7B 4XX1G 1PYWA 5E2WH 3EZJB 1RUPL 4BA8A 1KYOJ 1RU9L 1A47A 4L4TB 2X4OB 3C5ZA 5TPWL 4L4VD 1OGAA 1X5YA 2CLRB 2AI0H 3SGKA 4JFEA 4AEIL 1TZGH 2R1YA 4QRPE 4K7PX 4LOUD 3KJ6H 4NM4H 4ZOCA 4ZFFB 2FL5B 1PKQB 1F3RB 1UJTA 3U9PH 3VA2C 3PF2A 4D3CH 1MHHB 3GK8H 2ILLA 5JLZA 4J1UB 2EYSB 2HLAA 4V1DA 1F45A 3UCRA 2MCPL 2YD3A 2K7PA 1NBZB 3EOTL 2G75A 3QFDB 1MQKH 3W0WE 4WFED 1Y0LB 2Z4QA 1NGYA 3DGGA 2PTTB 3UTPD 1YEDA 2Z91B 1ZV5A 2F53B 4I3SH 1FNGB 2X4RA 4HCRH 1NGWA 1ACYL 3QWOA 3EDFA 4MXWH 4IOSD 3RL1A 5I0DA 1NLBH 5HYSG 4C56D 4HFWB 3MJ7A 3D87B 5E1HB 4GXVL 3ZL4H 4YPGA 2AJUH 3MBEB 3OR7A 3MLYL 1MJ7L 3BO8B 1QOKA 5A43C 4HFUH 4NN6C 4EI6B 4ZFOA 5FECA 1ZAGA 3HNTH 3NFPA 1I3RA 3WV0A 1W72H 1JHTB 3UTOA 2DAVA 3H3PH 4DKAA 5C9JA 35C8H 1G6RB 5CUSH 2NY0D 4M3JA 3L5WA 2KQNA 3UC0L 3ABZA 3T77A 2DYPD 4LIQE 2B20A 3S96B 2OSLA 3D3VA 3QPQC 4QHMB 2XFXB 5SWSE 4TOYL 1I7ZB 4JM2D 3Q1SL 3CSGA 4QWWC 3WCYA 4D2NA 6FABL 3QO0A 3H9HA 1ZK9A 2NY1D 3LD8B 4IIQB 1WBYA 3VFWB 1G9MH 2VDQL 1KCVL 4F2MB 5HI5C 4HS6B 4XVSL 5TF1L 5FO7B 5D2NA 3O11A 4TVPH 4OCRH 3SDCA 3HI6H 4Z78B 2APWA 3MUY1 1R3HB 1L0YA 3UTTD 3VJ6B 2MHAA 2OJZH 3SGDI 5HHQB 4PP8C 2X6MA 3U6RA 1S7WA 1A2YB 3SDXB 1NFIB 3NCJL 4KK9D 1RZ7H 4FQXD 1OM3H 3BGMA 4ZO9A 1R5WB 4XCCL 1N8ZB 4WWKA 4KVCL 3SKMB 2ZOLB 1YEFH 4UV4H 1K4DA 4H25A 4MJ6B 4RSVA 3V7MA 4XWOD 2CRYA 5IMKB 1T1ZA 4QRTB 4OQTH 2JB6A 3U9UB 1ZSDB 4AMKL 2VITA 2IH1A 3S88L 3M1BB 3K4DA 4JFQB 5CZKA 5IHZA 2VYRE 2DI7A 5HY9B 3CLFL 1NDGA 2OYPA 2FEDC 3SDXF 3QNYA 3HC0A 5DURB 5E5MB 3CX5K 2EDWA 3HZMA 5T1KB 2YZ8A 1ZTXH 4FMFA 2EDQA 4W6XB 3WMSA 3CFBA 4M43L 1YC7A 2EO1A 3WFHB 1FAIH 4HX1A 1KJ3H 3BXNA 4X7TA 4AIZA 5JPNA 4GJTB 3FOMB 3P2TA 3LS5L 3C8KA 4KJYB 1T7WA 4H88L 1XEDA 3EUUA 3P9LA 2BX5A 1BD2E 3FL7A 4W4OA 4KVNL 3VXME 3C2AH 4P99A 2XNAB 3I50L 1DBBL 3LN4B 1G7JA 3OGOE 1N6VA 1DTUA 4XP9L 1FFNA 3P3YA 1VFBA 3QI9A 4JGJA 5FUOH 5D9SA 3VXRE 4HF5L 5EDXA 1JMXA 2Y06H 4X5LA 2EKJA 1VA9A 5EO0B 1YN6A 2C7UA 3FB7A 5MHSD 5IK3A 1LEIA 1MEXL 4E5XA 1OVZA 1GL4B 4KKBC 4LDEB 4TUKH 4JFDD 5CP3A 1A9EA 5BV7B 5KVGH 5FYKE 2Z31D 4KKAC 4BH7A 2CKNA 4OJFH 2WMPA 3EYVA 5EA0L 3MLXL 1U8QB 1T21B 2PN5A 4WFHD 1UACH 5DUMH 2EE3A 3K1KC 1S7VB 3VRJB 3F12A 1PG7L 3RWIA 4PRNA 3QQ9C 3UJTH 3E3QA 5TH2B 5HYJD 4NKDA 15C8H 3THML 4HDIB 1DFBL 4G6KL 4OLZH 3UZVB 4XVTH 3N0PB 1JN6A 4NKQB 1KCUL 1H3GA 1S7UB 1KTKE 3JTSB 3VW3L 5HTSA 2GY5A 3MO1B 1VPOH 1V3LA 2EYRB 2IAMC 5C2BH 1I8LC 3W81A 5IJKC 1OQOA 3RAJL 3IDMA 2F19L 2W0FA 1RAMA 1KEML 5D6DC 4NBZB 5MEQB 1XIWB 3GI9H 4HJGB 4BUGA 3CSBA 5KZCD 3MCG1 4F3FA 4BQ8A 5KSVB 5DLMH 1JGLH 3VGHA 1NFDA 4PLJD 2D03L 1AKJB 4NQDD 1JZ7A 4N0YL 3TV3H 4TPRL 1KPUA 4CVXA 1OAZH 3GSRB 5DZOA 4KZDH 3L9RA 5IW3A 1F4WH 2J7LA 1JUFA 3CC5A 3WHXB 3ULSB 5E56A 3T0EB 1RHHA 5TE4L 5JOPE 2PW2B 3CU1A 5IVZA 2Y36H 5C0BB 5ICYB 4HH9A 3TN0C 1H5BB 4KHXH 4MCZA 4RAHA 3P40A 1G6RH 5GPRA 5CBEB 2WWKT 3GSUA 1QFUL 1Z5LA 3UYPA 1TCRB 3MODH 4ZS7H 1XIWC 4W6WB 2HRPL 3RWFB 2NY4B 5C09B 1RVFL 3TZVB 2F54B 1L7IL 1BJ1H 2P8MB 4PJ8D 3L1OH 1D6EB 4Z5RA 4LHJB 1NCBL 2PW1B 2FIKB 4QRRB 4WDIB 1PG7X 4ZQKB 4QXTA 4CADA 4Z7QE 1EEUA 2PXYA 3PWUA 2BOCB 5HHOE 4AM0B 2CRZA 1AJ7L 1MFCL 1N6UA 4LCCB 3S36L 1L0QA 2G5RA 3IXAB 4X6CA 4MJIA 2NW3B 4UNTA 2F15A 3PJSA 3MZTA 4PRID 5I2IB 4U1IA 3IXTB 3MRGB 3HG1D 1FRGH 3MNWA 2Q8AL 3C6SA 4G6AC 1U8PB 4R7DB 5C0FA 2J4WH 3T65B 4YWGL 4AZ8A 4Z7NF 3MR9B 4LEOA 2VLJD 3DX6A 4X0KB 3Q3GB 5DWUH 5EZIH 4ODXB 3JV0A 4YR6A 5KN5A 4JDVB 1FVCB 3EAKA 3MLSL 1CK0H 3DTXB 3MRMB 2NY5C 4O4YH 4Y19B 4HUVA 5I74C 3MYJB 2HAZA 4M5ZH 4YDJA 3QEQB 4EN3B 1WIOA 1G7MB 5GGVL 3ZE2F 3MRQB 3GSNA 2G60L 4QRSB 5DD1L 1PW3A 3UYOD 1V5JA 2KDGA 4S11A 2A38A 5JDSA 5C0DB 1PBYA 4NQED 4B0MM 1X7QA 1QRKA 4GRLC 2WQ8A 2VQ1B 2FB4H 4MZ3A 3V6OA 5IMMA 4ZO6A 1JPGA 2HRLA 3SHSA 4HWZB 1J86A 5K59E 4OCSH 1RZ8A 1U8NB 3IAQA 4UT9H 4ZFGH 4J3SA 2A6JB 1N6QL 4JHZA 2NNAA 3B5HA 5AYUL 4KRLB 4PJHE 3ARGD 2X4QB 3G6AB 4Z0BH 3AAZB 3VFPB 4FABH 3WNNA 2NLJA 4V3EB 4DZ8B 1Y6NR 1DQQA 3HR5A 4WUUB 2OTPA 4MS8D 3X3FL 4N9GA 3RVVD 3PE9A 5AG9A 2BFVH 1RK1B 4YHNB 1T0MB 4F80A 3S36X 5F97E 2VUYA 2R1WB 2EKSA 3TT3L 3C60C 2Q8BH 3TCLA 3WS3A 5TGBA 4ZSOE 3O2WH 4QRPA 5DEFA 2BSTA 3PHSA 1D5ZA 5BV7H 2ICWJ 5D7KE 3ALPA 5DEGB 5DFTA 1HNFA 3C6LB 2A83B 1DQDH 2Y6SD 3QCTH 4X98A 1KIPB 2NY2B 1TMCA 2HTKD 5I71C 1L6XA 3TBWA 5BQ7A 2GW5A 3W0WA 2HFTA 32C2B 1A21A 1ZLVH 4PLOB 1KG0A 3MNVB 4YPJA 1A5FL 4K55A 3GFUA 3QDMB 3RIFF 4OZGB 3PHQB 4IDLA 4X99A 4XPGL 2HKFL 2YD9A 4K94C 2VLRD 3MJGX 1IEBA 4HIEA 4K23H 4ACPA 1WEJL 4KRMB 5ALBH 5ANME 4ZTPH 4GRMA 4PRDB 2CXKA 2ED7A 2R9HC 1K5NA 1RJLA 5CD3B 1XZ0A 4KI5D 1EJOH 9CGTA 3EJYC 4ZUVB 4IOFC 1C1EH 4Y16D 3O8XB 1EEYB 3HE7B 1MCRA 5C07B 4Z77B 3AS3A 1A14H 5BW7A 3WIIL 3GEWB 3BE1H 4QGTA 3QH3A 4OF8A 3C6LC 2QBWA 1DE4A 3TNNA 4G80A 4ZS6D 5DGQA 2NY2C 4OZGF 5LWYL 1FGNL 4KKCD 3WKNA 3ZYIA 3PDOA 4YQXH 5SWSA 5CJOL 1O5DT 3IT8D 2UY7A 2VXQL 3ME0A 5IR1B 4H26B 3ZYOA 4JFYB 4CDGC 1BVLB 4P5TC 2H2PD 3F62A 5CJ5A 4LRNL 1EUTA 1A7QL 4L9LB 1DLHA 1X6LA 1WVZA 4AEHH 2WLYA 3BUYA 2HVKB 5ICXA 25C8L 4ZOAA 3SY0A 3P4NB 2B4CH 1CFVH 3P77A 5B39A 4HSQA 1EIBA 2NQCA 3TT1H 1BBDH 3VWKD 4LGPB 1U8MA 2VXVH 1K85A 3HE7C 1EGJL 3WLBA 2DMCA 1P7QA 1N64H 5FO8A 4EZMA 1F4YH 3CDGA 1XGRA 3CCHA 3C87A 3FQTB 1S7RB 2I5YH 5HI3D 1NCDL 1T89A 1UWEH 2NY5H 3FT2B 2NY6B 3CFCL 4RBPK 5T5FH 1M6OA 4CVUA 3S35H 2I25N 4EEEA 1A0QH 4DTGH 4XC1H 5ETUB 1FG2B 1EMTL 2H26B 4NNXB 2O5YH 2BXYA 5ICZB 3BAEH 1Q8MA 2AK4B 3ULUD 3HS0B 2DKMA 2IPUG 3NZHH 3U4EB 3VCLA 4NO0A 5F7YC 5HXMA 4K3EL 3FO9B 5E2VL 3K8KA 4P5MA 43C9A 5L2KE 4TN9A 2XZAL 2VZ3A 3B9KB 1SMOA 4X80L 4DN3L 1WC7B 4ZFZB 4Z0XB 1VSCA 1MLCA 3TPUB 4NKMB 3QQ3A 3MV7B 5E95B 3WEXB 1YY9C 5IB5A 1OP3H 4JR9L 3PL6D 1XF2B 3PWNA 5F1NB 1NAMA 5F21B 1L8JA 1BFTA 5D7LE 4KDVA 1PX4A 4IRSC 5EZJB 3D85D 4QYOB 1JNLL 3U0PA 2XV6B 4JFFB 1JHLH 1F4XH 3WNOA 4Y4KC 2BHZA 1F5WA 3M8OH 3TBSA 5J1TC 1FPTL 3ZHLA 2GI7A 4AG4H 1BD2A 5CGMA 3VXMA 3C5JB 4TVPD 4ZAKD 1UWXK 1K6QH 2OJEA 2ORBL 2BJML 3VXRA 4TUOA 1D9KA 3AROA 2DTMH 4JY6A 4XPTL 1NGZB 5BRZE 3PQYB 4CNIB 1E0OB 4UINL 1FLRL 1TPXB 2XRAH 5I8CB 4N8CH 4KC3B 4YZFE 3G08A 1I9JH 3BEVA 5LXGL 4HLZG 1O7VA 3D25A 4NQSB 4HQQH 1BHGA 1IGJA 3QG7L 1KNOA 1TVHB 5E6ZA 3EHBC 4MXVF 4PLKD 2YUVA 1CE6B 2GTWA 1HKLL 2XKUA 2ZOKA 2XTJB 2JELH 1CDHA 3AU1B 3IDXH 5FGCB 1MIEH 4PLNC 3MRNA 3HUJB 4P5KB 3JTTB 4HS8L 4AEFA 5BS0E 3LKQA 2CDGA 1AGDB 2GJ6B 5I18H 1KTLB 4E0RA 3MV9D 4AIXA 4K8RC 2A6DA 5CEZL 4QTIH 3FRUB 1G9NL 1NAKL 1WJ3A 3O3AA 4K71C 5I76B 5DD3L 3TO4C 1DQMH 3RP1A 1HZHH 1K3ZA 1OOAA 2X1OA 4PRHB 2BP3A 4IMLA 1H9VA 3D0VB 5L2JB 3W11C 5ALCL 3VFOA 4XPFL 3GMLA 5KW9L 4ZUWB 3RQ3A 3BP4A 4PRPB 2JE8A 3WN5C 3H9SB 1AP2A 1SJHA 3R06A 5BO1L 5F9AC 1QYGH 2NX5D 3BIAX 1P5VA 3QUKA 5SWZD 4PY7A 3Q5TA 3ESUF 2GSGA 5FYJL 5ACZB 4WUKL 3E6FB 5H94B 3OF6D 3SGJC 1P1ZA 5EPMA 5DRXA 4ONFL 1QG3A 1KIRB 4N0CD 2YUWA 1NEUA 2XN9D 1D7FA 2VLLA 4GAFB 5GS2D 4I18B 2X10A 3DSNA 4J12A 4HLZH 3GSOA 3DUSB 2PO6B 5SX5H 2JJVA 5F9WB 4GMSH 3FAXA 4LCYB 2QV2A 1A3QA 3CXDH 4PV8A 4PY8I 1S9VA 4KKNA 3DARA 3MUJA 2A1WH 2I26N 3A6OA 5F6IB 1E27B 4B53A 1KB5B 3WFZA 1HH9A 5D1QA 5FO9B 1P4IL 4PY8J 1KCGC 4YXHL 3GIVB 5DJXA 3P9MA 1AE6L 5A2FA 4M1DH 1T7XA 2IQAA 4JPIB 5AD0A 5F6HJ 2DWEA 2K7QA 5FF6B 5ADOH 3KLAA 3OAZH 4R3SA 5C0GA 1UCTA 5HHOA 2C4XA 1T1XA 3EYQD 5GS1A 4YHZH 1KTRL 4M6NL 3VE0B 2VR9A 5DJDB 3T4AA 1J1PL 1Y18B 2W9LA 4C83A 4HG4K 3DV4B 5E7BA 1DLFH 4RIRB 4LEXL 3ILPA 2AQ2A 3QHZL 3EOAA 5F9WC 3GHEH 4NYLB 3OX8B 1LILA 4N0RA 3CU7A 4O51A 4RGNE 3L7FA 4MHHG 3HE6B 4Y2DA 2F53D 3GRWH 5EBWB 5CSZA 4YNYB 5F6IC 2UWEF 4PP2B 4R8WH 4L8CA 1GCFA 1C8PA 4P59H 2GUOB 4YC2C 1FZMA 4CUCA 5DO2C 2FX9H 3KPSB 5GSRA 2ICWB 2FX7L 3L3DB 4UU9A 4OQ1A 4HV8B 2CO6B 3MBED 3QSKB 3QWRD 1TTGA 4OSUL 5B8CC 3RDTC 4FMKA 4JHAH 3W2DL 4IMKA 3NPSC 4NJAL 3WDJA 2R39A 4LCUA 2NYYD 2VXUL 2UZIL 2Y6SC 3QUMH 4G6JH 3KXFE 3QQNA 2F74A 3JWDL 2DLGA 3MBXH 2KQMA 3VWJC 1Q9LB 1W0VB 5C6WH 2X09A 1YY8A 4NCDA 3WUWB 4I8DA 2D7PA 2DLFH 5C2UB 3B9AA 3NTCL 3KG5A 4YXLL 1E6OL 5JW4R 2BNUB 3N1GC 3F7YA 4PJHA 1W8OA 3C5SB 5LBSL 4QF1B 4E41B 4PS4L 1L7TL 4HWNA 3MJ9L 3QXDB 3QIWA 6CGTA 5I9QB 1MJJA 2YC1B 3W9EA 5BJTA 1BJ8A 3VGBA 3IETB 2B1HL 4OGZA 2W65B 3FO2B 1GGYA 3QDGD 1RHFA 1URLA 2ESVA 3TNMB 1U92B 3GB7A 3HCVA 3TBVA 1FL3B 2ERJC 1FBIH 4K7FB 4NPYB 1R0AH 4D9QE 2H45A 3RA7H 2BOBB 3DETC 1YEIL 4KK6C 5B3JF 5IB1B 4ZSOA 5I73C 2RFXB 5KVFH 4KKCC 4OZIE 3T3MF 3VXUE 1QFOA 2R4SL 4BSWB 5C86A 3CSYB 2H1PL 3H3KA 3VXOB 3TLRA 2V2TB 4H0GA 3H7LA 3VG0L 1G1CA 3OKDB 2HFGH 3VXPA 4OM0L 1UB6B 2DD8L 4ZTOH 3OKKA 3WO3B 1MH5A 1J0KA 4RRPA 3BPOB 4HJJL 3H8NA 4QHUA 4JVPA 3HRPA 4YHYC 1IT9H 3MV8B 1EA9C 2GK0A 1YC8A 2YRLA 1OT2A 3EYUL 3FTGB 4JRWA 5DURD 5L7XH 3KYNA 2X9WA 1IRAY 5T1KD 4Y89A 2EIZB 1UH3A 4PJ7E 3CVIH 4XNYH 4XGZB 1GC1H 5ANMA 4M1GH 4P46C 4RFNB 1JMZA 4NP4H 3O3EA 1UM4L 1UEYA 3DROB 4Q6YA 4PB9L 1AD9B 1DBJL 1Z2KA 4MDJB 5C0CB 1QEWA 3RX7A 4KH2A 3K2MC 4OLUH 1E4WH 4I3RH 3S37L 2DLEA 1C7SA 3NCFB 2DQHL 1MLBA 4Z95L 4U49A 4G8GB 2YEZA 4PBVC 3LKOA 1RUQL 3O0RL 5EWIH 4JVWA 5DK0A 3ARFA 4JG0L 4H1LA 1FNEB 3X14B 4GG6E 3LIZL 4PJXE 5C0EB 4XMLH 4HUUB 3AM8A 2XXMB 3BQUB 5DC9B 3GKZA 3PL6C 3RKDD 2D7QA 4DKFH 4GBXA 3ZMRA 3CH8A 1HHKB 3ILQD 4HUWB 1W0YT 5JUEL 4ZYKB 1E28B 1MFEH 1WZ1H 4N0FB 3U46B 2X1QA 3G04B 4LASH 2R4RH 3H3BC 5I1LB 4QXGH 1NCCL 3LKPA 2VXSH 5DJ8B 3HB3C 5ID0A 2CSPA 1QFWH 2BNRE 4L1DA 4IRZH 5FHAL 1KB5H 4P2OA 5DS8A 3VXQA 3MLVL 4KUZH 5J1AA 5FCUL 3BP5B 5D70H 2IALB 5GISH 3I9GH 1YNKL 4WTZG 3J8F7 1FL5B 4A6YH 4Q9RL 3BD3A 4TULH 1YEGL 5JORB 2E7BA 3OZ9L 4G8EA 2VE6A 3C5ZB 4O5LH 1A1MA 4JFEB 5E8DH 2R1YB 1NGPL 5FYJE 1A3LH 4U7KA 5F93C 2V9RA 1QPXA 5HHVH 1IM9A 3LQZA 4JQXA 3VGFA 2HLAB 5JQ6H 5IOPA 4V1DB 5L2KA 2DQGL 2XZCL 4TUJA 3MUHL 1DP0A 2G75B 1KN4H 4O02H 1ZGLA 1D5MA 2Z4QB 5FM4A 5LGHH 4LBEA 3S37X 1YEDB 1AKJD 1S8DA 3BZ4A 1KTDA 2FD6H 3BKMH 1F3DH 5D7LA 3VI4F 2X4RB 1NGWB 2DQIH 2AERT 3QWOB 4M6OH 1IAIH 1J0HA 5D7SL 5GJSL 3QAZB 5IFAH 4M7ZB 3RL1B 3V2AR 2HFEA 3AY4C 5ILTL 1MCSA 3MJ7B 3T0ED 4YPGB 4XCYA 3OR7B 4LHUD 5C0BD 4ZXBB 3GI8L 3ZE0F 1LNUB 4NZRL 4KKLD 3UMTA 1T83A 5F96L 4ZD3H 3HHRB 5I1CH 5C9JB 2EDDA 4DKEH 4UAOB 1TJIL 5JXED 2NR6D 3L5WB 2IGFH 2NY4D 3H6JA 5C09D 4P0DA 3T77B 3TZVD 3ZO0A 1UCBL 2F54D 1CLYH 2BVOA 3TEUA 1TIUA 4PV9B 5I1HH 4BFIA 1RUMH 3EJZD 5I30L 3RWDA 2OSLB 3D3VB 1GRWA 4KQ3L 1QFPA 3H9HB 1DANU 1X4ZA 4KRNA 4OLYL 4PGBA 4X7SL 1WBYB 3KDMA 4M7ZC 3IFLH 3L3KA 1CFNA 1J9CT 1DVFD 2GK2A 4Q9QL 1X5LA 3F5WA 2RJMA 5CBAB 1MHPL 4JO3L 4Q0XH 4S2SA 1WAAE 1A22B 1BF8A 3QXAA 5DYOA 3SDCB 5BS0A 4S10A 2MHAB 1AR1C 3MLUL 4OD3H 2FEEL 3U6RB 5I1KL 2AV7A 4N5ED 3N1MC 1S7WB 4FZEL 5F1KC 1BM3L 4DVBA 4WI4A 3QIBC 4CJ1A 4HBCL 4POZD 4HC1H 3QCVL 2P5ED 3QEQD 1K4DB 4H25B 4EN3D 5GGSY 4KTEL 3OAUH 1MREH 3EYQC 3IKKA 4PD4J 4EDXB 3S5LA 2JB6B 1JPST 2VITB 4NUJA 3BH9A 1RK0A 1D5IH 5FA3A 5L9DL 3TA3B 5IHZB 5ADPL 1NDGB 1VESA 3K1DA 5D2NC 2ED9A 3WO4B 2ZUVA 4YGVB 1GAFH 4DOHE 4YEFA 3HC0B 1KFAH 3SDCC 1RZJC 5C0ND 5F7NC 1JGVL 3DUUA 4PJGE 4WGVB 3CFBB 4BJLA 1KEGH 2H3NB 3W5MA 2EE6A 4HX1B 3BXNB 4X7TB 4NBXB 4AIZB 2GKIA 5JPNB 2I60L 2OK0H 3U4BH 1OY3B 5ACLA 2FLBT 2VQUA 3C8KB 3CFKA 4S1QL 3P9LB 2CH8A 1F8TH 4WWKC 3EYSL 3OGCA 4OLVH 5EBMA 3LDBC 4YFDB 1MFDH 4HT1H 4UILH 4FTVA 4WUUD 1QSFB 1G7JB 4PRAA 5JZ7D 5EOTB 2CO7B 1GIGL 1FFNB 5F9JA 5D9SB 1A1NA 2QADB 3NH7L 4RX4A 1YN6B 2C7UB 5FHBL 3FB7B 2BCKA 5IK3B 1Y6KR 1LEIB 4HWBH 3LKRB 4EQ3A 1CDGA 1CDBA 1A9EB 3SBWC 2HLFD 3LH2H 5CGYC 4PJDE 3EYVB 1A6VL 5ISZE 1T3FA 1GGCH 2IG2H 4N5UA 2JB5L 1U9KA 3IDGA 3RWIB 5I1EH 3MRIB 3D2UA 5DQ9B 3HNVL 1J1OH 3MLRH 3WNPA 1UM6L 2Y72A 1QSED 4P49A 4MB3A 4F15C 4NKDB 4XNXL 1QACA 4OFPA 3IJYA 1JN6B 1GGBL 1WSST 1BIIB 3QI9C 5A40E 3ETBF 4OCWH 2QSVA 4XP1H 5GRJH 5E7FA 3EFDL 1MHEA 3O4OB 4ZUTB 3HLAB 4LF3A 5GQBA 4GS7B 1V7NL 5IBTH 1KLGA 3O8XD 1IGYB 2FSEB 1RFDH 2Y5TA 3SKUD 2N56A 2HG5A 3S3JA 2W0FB 4ONGH 4U1LB 4XPAH 5TFSL 2F9BT 1Z9SA 5FEBA 1AO7D 2VAAA 5JW5A 1G7HA 3QEUA 4O9HL 1IQDB 1ZWIA 2G5BA 4G9FD 5GRUL 2WUBL 1VGKA 4UTBL 3GDBA 4F3FB 5EU5B 3MV11 2P46B 1XR9B 1NFDB 4R90H 5MP6H 4LLDA 4S0SD 4XNUL 3MLZL 4JFHD 1EGJA 3ARTA 2YD2A 1VEMA 3E3QC 4WU7A 1LD9A 1KPUB 1XGUA 4CVXB 3NIDE 2Q7NA 3L9RB 3KR3L 2DLHA 1JWSA 1JUFB 3CC5B 4KPHL 4JHBA 4PDCE 1I1YB 1Z9OA 1JGUL 1RHHB 1HCVA 2DMBA 5IVZB 1AIFB 4HH9B 3HN3A 1BBJA 4MCZB 3GSUB 4BZYA 1YZZA 3EBAA 3U7YL 1HXYA 1I85A 1NFDF 1P84J 4NRZA 4TRPH 1C5CH 3FQWB 5IMLA 5CCKL 2IADB 4U33A 4I0PA 2GCYB 1OHQA 2NY6D 3BDXA 3VXUA 3JWNC 2HP4A 4Z5RB 1QTYT 4I1NB 1DBKL 2L7JA 3KWWA 1IGFH 4QXTB 4CADB 3AGVA 3S34L 2P47B 3PWUB 2AK4D 2VIRB 2PTUA 4QRQB 1GH7A 2ZUQC 4XP4H 1ZXQA 5CSBA 3BHBA 2BMKB 5ECJE 3RU8L 4X6CB 4HWUA 3VD5A 4MJIB 3B9KD 1F97A 2WW8A 4PJ5E 3QZWA 3PJSB 1GGIL 4U1IB 4YGAB 1QHPA 3GBNL 3RIAK 1UWGL 5M95B 3MNWB 2HWZL 5HBBA 3SQBA 4PJ7A 3C6SB 3H42L 1LO3L 4LEOB 2XQBL 2YD6A 1IL1B 1J1XH 3TIEA 4JZJA 4R26L 3WSQL 1I1AB 4JFFD 4YR6B 4WEBH 4OT1H 1X6NA 5KN5B 5JA8B 4HAFA 4HUVB 2DWDA 5CILH 2ZUYA 3LQAL 2YKLH 4FQ1H 4X6CF 3SGEI 1GHFL 5D96C 2VUOA 3GSNB 2PXYC 1OPGH 1VACB 1YNTA 4UDTB 1JZ4A 3CX2A 5D5MA 2OXGA 4XMPL 4ZDHB 4U3XA 4XBEH 2O26U 5JDSB 4GG6A 4PJXA 1I1FB 2KPNA 1X7QB 4U1MA 2QR0A 1EV2E 4JRXB 4XNZB 4O2CA 1FZOB 1XGYH 3CIQA 1EFXA 3HPJA 5IMMB 4KJWC 3M17A 1JPGB 4PB0H 1UB5B 2HYMA 1HHIA 1R3IL 3VFGH 2P7TA 1RZ8B 1A7NH 4ODTL 1IC4H 2NNAB 1JFQL 4NN5C 1RI8A 4J4PA 4RBPH 5F70A 3CVHA 2XTJD 5DRZB 5HVHB 5MENE 3VGAC 2NLJB 4OKDA 1T66D 3MRDA 3HR5B 2UVFA 4WU5B 5FDWB 1LO4L 4N9GB 1T5XA 4MJ5A 2JTDA 1HH6A 5J12B 2BNQA 1A1OB 2KH2B 5ABDE 3O6LH 4NO2A 4BSVA 1ZVSB 2R23B 4YEEA 3TCLB 2AJVH 5TGBB 3WS3B 4QRPB 4PRHD 5CP3H 1OTSC 5ITBH 2BSTB 3V6OC 5IEHA 5AEAA 5GS0C 1P7KA 4PJBE 1BIHA 2AJXL 3KPMA 2ZNWA 1ZLWK 1UH2A 4PRPD 3U1SL 1Y6MR 2K3TA 3H9SD 1P2CB 5GRVL 3TBWB 3W0WB 3U2SA 5HI4C 1E4XH 4BELD 1KG0B 3KPQA 4U1KA 4U4BA 5DRWA 5DJ6A 2FHBA 5FK9B 2NPLX 4X99B 3LB6C 2CIKA 2BSRA 1W2KT 5AZ2H 2VWEE 3T3PE 2F58H 4NIKB 1KB9K 5IESL 4OZ4A 2H6PA 5LJYH 4GRMB 2A9ML 2PO6D 4XBGA 3CMGA 1RJLB 1XZ0B 1MFAL 1CD1B 2CJUL 1IAMA 5AWNH 1WITA 4YUEL 4I0CC 4OCXL 4NKOA 4APQA 2HMIC 1OTTD 1LE5A 2SEBA 1KPRA 2X2YA 1CT8A 1S7SA 4TNVK 2V7NA 4KY1L 3RBSA 1FJ1B 1DE4B 3V95A 4G80B 3IB4A 1MCEA 2GEEA 3N06B 4I77H 4FZ8L 2ADFL 3MA9L 5JIKA 3PDOB 5SWSB 2P44B 4JG1L 4H5SA 4FFYL 4PGCA 2OMNA 1RUKL 1IC5L 5IV2A 4N90E 1JPFA 2EXWC 4YAQB 4JPVH 5JW3L 1WBXA 2R1XB 1DBML 1BZ9A 3EW3B 3MLWL 4P3CL 1WAAA 5ICXB 5C0RH 3P77B 5B39B 5BVJA 5F1OB 4PP1D 4M7LT 1U8MB 5I17B 5JIIA 4IRJC 3HE6D 2VDKL 2PNDA 3ZKND 1P7QB 4H0IA 1U58A 5FO8B 4Z7WE 3SQOL 5KAQF 1H0DA 3CDGB 4XVUD 1XGRB 3CCHB 1EZVY 1LVEA 1DBAH 3KGRA 4UZGA 4GG8B 1M6OB 3OAYK 1QLEH 4OFYD 1NUGA 4FFWC 5GJTH 1FFRA 1ETZA 4YHLH 1BFVL 4U6XB 3QO1A 1UGNA 1XR8B 4QLRA 1HHJA 5GS3A 5BOZG 3X13A 1KIQB 5AZEH 3BT2H 5DMKA 3ARWA 4NO0B 3QIUB 1CBVL 1T03H 4YDLB 1RZFH 1ORQB 1CF8L 43C9B 2JK5B 2A74B 4ODSL 4HXAL 4X9IA 3MJ9A 5BXFA 1MLCB 3QQ3B 4H20H 5IB5B 1XF4A 4PJGA 4XP5H 2IBZY 2PKDA 2V5YA 2BVTA 3PWNB 3QFJE 1NAMB 1SVZA 1T1YA 4S1SH 4MQXC 4J3UA 4WTWA 4P23C 3L5XH 5D4QA 4JAMA 3U0PB 2VDML 4L4VE 1EDQA 2FX8L 3UJJH 2QQKL 1T89C 2VO5A 4E41D 5EN2A 5E2TL 2BHUA 3TBSB 4LSSH 2HJKA 3T08A 1BD2B 1U8KA 4XHJC 1T7ZA 1NSNH 3VXMB 4Y4FC 1A8JH 3GSNH 5D93C 5EORH 2OJEB 2LAGB 1MIMH 1NLDL 3DVGA 2R0LH 2HT3C 2XACC 1KELL 4TUOB 3VXRB 1TXKA 4KTYA 1D9KB 2YN5A 3CGTA 1WZLA 4U1GB 1JHKL 4WFEE 3SDAA 4Z7UA 1F2XK 4JY6B 3UEZA 4JJ5A 3F65A 4OGYH 1I1CA 1QBLH 1CXIA 2YD5A 2X7LA 4XT1C 5F1IA 5GS0H 3FHAA 5KTEL 2CKBL 3BSZL 4ODBD 2D9QB 3BEVB 4NQXA 5CMAA 3D25B 2BVQA 4FFZL 4C56E 2D0HA 4PJDA 3MFFA 4W81A 1IGJB 1CICB 2B2XL 3DMMA 3V4PL 2NXYB 2GTWB 4NT6A 4TSAL 3ELAT 5CD5D 5IG7A 4P4KA 1GVIA 2ZOKB 1Q0YL 3HMWL 2EDOA 1MCPH 1LEGA 4IHOA 3MRNB 5FGBC 3BIKA 2OMBA 4XP6H 1RURL 4A2MA 5E08H 1NCWH 5KAQG 5DHVA 5J11C 4S1RH 4E0RB 3U7WL 1TNNA 1Q0XL 1D9KC 3QUXB 2A6DB 1UENA 2D3VA 5C0CD 3QYCA 2I9TA 1OP5K 3GSVA 4PJFE 3U0TA 5HYEA 4KV5E 2ZJSH 1EO7A 3ARVA 2AABL 1YYLL 4LPCA 3GMLB 5B39G 3RPKA 3ZSTA 4G8GD 4XPBH 2YPVH 5E00A 5CKGA 4UV7L 3BP4B 5HHXL 1RQ5A 1AP2B 1SJHB 2XY2A 1S9YB 3WXVH 5IQ9B 4EOWL 4MXQA 1MCQA 3BKYH 1G7QA 2UZXB 2JCCE 1AXTH 3QUKB 5IHUL 3ZLQC 4DUXA 1I9RH 2GSGB 1MCOL 3WNKA 3BQUD 3LHPH 1P1ZB 2DN7A 5CHNA 5EPMB 1B2WL 5DRXB 5B3NA 4J6RL 3KYMA 3LZFL 4IS6A 4WO4C 3BFOA 4M93B 3OV6A 4GRWB 2AXJA 3G9AB 5BMFH 2AJ3A 2YWZA 4G42B 3GSOB 1LK3H 2DICA 3DSFL 4PJIE 3B2UC 4PV8B 5DUPL 2CQVA 2GAZA 1C5DA 5DJCA 1OAQH 4N1HB 4GAGH 5C6TH 4KUCF 1DANT 4CVZB 5D1QB 1OB1A 3A67L 1IVLA 2N7AA 3V4VL 2AJYL 3ARBA 1A64A 2GHWB 5DJAA 5DJXB 5F7KC 5T3ZD 3P9MB 2PTVA 1Q72L 3TO2A 5EU3B 1YPZE 5EUOE 1SJEA 2IQAB 3GMQA 3V6FA 1Q94A 3C5ZD 3N50A 5E4IA 2IANB 4GRWF 1H8NA 3PWVB 5FUZH 2HKHH 1IFHH 2VR5A 4OD1L 3SCMB 4R3SB 5C7XL 5C0GB 5HHOB 1T1XB 3MGAA 4LLVB 5GS1B 4MSWA 4N0UB 1NANH 3LRSA 2DKSA 3HC3L 2NXZB 4V1DD 3SOBL 4C83B 3FMGL 3UXFA 1Z9LA 1L0XA 2EE9A 4PJ5A 1V8HA 3ILPB 3EOAB 3RNQB 2F5AL 4TSBL 3T8XA 3ZKXB 4O51B 5HHPB 4WNQA 4XCEA 3L7FB 5EOCL 3DWTA 1FE8H 3T2NH 4Y2DB 5JHDA 5GGQH 3HNSL 5CSZB 5HHNB 1PQZB 2RGSA 1UKSA 2VR4A 4L8CB 2P1YA 1FDLL 4W68A 4FXGA 5K9OA 1FZMB 3L3JA 5MHSE 4Z7QF 4YXKH 1CN4A 4FNLH 5E9DB 2DJ4A 2E7LC 5F7HA 3RTQA 4KJPC 5I19L 3AFLA 5LCVL 2ATPA 4UU9B 1TFHA 3BX7C 4JFDE 2UZYB 3FONA 1A6WL 4TYUA 3A0OA 4ZXBD 4CL7A 4LNRA 4ODVL 4NOBA 5ITFA 5FUCE 1IC1A 2V2WA 2YMXL 3L5HA 4F37F 1QR1A 3GM8A 4Y5XA 3RVTC 5E6IA 1AQKL 3DVIA 4LCUB 4WFHE 1SBBA 1IEHA 1J7VR 1IAKB 2WK2A 5DQDL 5A16A 4J7RA 4YHKL 5TE7L 4NM4L 4FQCL 3PDGA 5HYJE 5MERB 5DTFB 5EC2B 3BMWA 3D3VD 3Q48A 3G5VA 4FA8A 1NAMH 4MD5A 4NKIL 1L6ZA 3QPXH 4UUJA 4D3CL 4R2GB 4GXUM 1V3KA 1NMAL 2A0LD 2CK0H 5E8NA 2YPLA 2XZQL 4P3DA 5TDNA 3F7YB 3I6GA 2EDRA 2Z35B 3A6CH 1QHOA 3KJ4B 4PJHB 1KULA 5MENA 1CLOH 3Q5OA 1NMCC 4HCRL 5D1ZA 4OIBA 4LSQH 3EGSA 2OP4H 4IMKC 5MEPA 4MJ2A 2WNGA 3VDCA 4JKKA 1K4CA 4BSJA 2YS4A 4HPOH 4DQOH 3OJMB 2ESVB 3S4SA 2D31A 3GB7B 3HCVB 4AH2A 2DDQL 3SJVA 1A4KA 4NQDE 5BZDA 4MCYA 3ULUL 4WGWB 4YO0A 2X40A 3MJ8A 4F7PA 1F13A 4OBRA 3RI5F 4R96A 4XPHH 3X12A 1Z0MA 4PJHF 4L8BB 4PJBA 5CUSL 4HHAB 5GZOC 4HPYL 3FFCD 4UBDC 4R2GC 3CH1A 4JKPL 1VFUA 3MRPB 3OKKB 1MH5B 1LE9A 3GBMH 3ECBA 3TA3D 3QHFL 3QG6A 5J89A 4QHUB 5I0ZA 1RZGA 2GK0B 2DS4A 2H9GA 2HT2D 3LRGA 3KYNB 3GUTB 3QIWC 3D48R 3QXTA 3ZKNC 2IAMA 1EHLL 4LPTA 1I8LA 1S7XA 1G7PA 4TVPL 4OBSA 1FGVH 4ZPTA 3FAWA 3OR6A 5EIVA 1LEKA 1S9XA 5D6DA 4D9RD 3ROLB 1C16A 3STZA 3FJTA 5EOQL 2EZ0C 5IGXH 1AGCA 4X7FC 5C0IA 4U1HA 1MLBB 5TQ0L 5J8OA 2FBJL 1JK8B 5A3ID 3JUYA 2LQRA 1QSFD 1OGTB 3MRJA 3LKOB 5DJ2A 4IEFB 3DO7B 5DK0B 2L7UA 3ARFB 3WFEH 2ZSWA 3AB0C 3O41A 2QADD 4PRIE 4H1LB 1BWWA 1TQCC 1RZIA 3HG1E 2ARJA 4LQFL 3OBAA 3NACH 1FYHB 2HJFB 3UBXA 3W5NA 4I2XE 4NZUH 1U2CA 2VLJE 4OQTL 1UVQA 3BP7A 2DM2A 4DN4H 1CR9H 3OPZH 4RZCB 4GBXB 2OR9H 4NHUE 3TN0A 1AXSA 3TFKD 1RUPH 1M1SA 5I15L 3O2VL 1RU9H 5TPWH 3BEWA 5DFVC 1N5AA 2E9IA 1CXHA 1ZTXL 5ID0B 4XTRD 1UA6L 2ED8A 1IGCL 1HDMA 4Z7WA 1P7HL 4P2OB 5DS8B 1IMHC 5J1AB 1KJ3L 1JV5A 4NQEE 2MCPH 1QSVA 2ZUWA 3D6GA 4JVUA 3GO1H 3BMVA 3IDUA 4M7KH 4DW2L 1PX3A 4OFDA 4EQ2A 3TJHA 2ADJA 4G8EB 2VE6B 1NUFA 3AM8C 4EJ1C 1BOYA 1ACYH 2NTSP 4NNYA 2IH3A 3ALXA 1DUZB 3HI5L 4JFZL 5DK2A 1KJ2L 5HHMB 2Y06L 1IGML 1IM9B 3LQZB 4GBXC 4GXVH 5EU4B 4N1EA 1DEDA 5IOPB 5L2KB 1NGQL 1MJ7H 4NCC1 4TUJB 2VKWA 5CD5C 4ETQA 3MQIA 3PWJA 4TUKL 4KZEL 1D5MB 4Q74A 1HINH 4MD0A 4NO5A 5I1GL 4LBEB 1QZ1A 1S8DB 3BZ4B 3QFJA 3UZEA 3MRHA 5F88A 5D7LB 4LDLB 5J3HC 3UC0H 4GSDH 1BQSA 4OV6F 2D0GA 3BESR 3BH8A 4L4VA 3AS0A 2OQJA 1JNHA 2NTFB 2HFEB 2WINA 2MCG1 3QXUA 2DB8A 3B5TA 4RRPG 4TOYH 1AGBB 3Q1SH 1SEBA 3C9NB 2D2OA 2BK8A 1NBVL 3BPLC 6FABH 3ULVD 1YECL 1N59A 5I16B 2Y7QA 1FZKB 1ZT1A 1U95A 5KSAB 4NM8L 3ZDYF 2CLVB 1BREA 2VDQH 4OKVA 2XPGB 4PG2C 1FV1A 1LO5A 4JQXC 4XVSH 1VPOL 2FATH 1VFMA 3O9WD 2BVOB 1S7TA 2OL3B 2J8UE 4F7CA 5KVEL 2C9AA 4BFIB 3VFSA 5GGTL 1BAFH 4YBLB 3QUYC 3RWDB 2XXCB 2VLRE 4PJCE 1XGTA 4C56A 1I9IL 1S5IH 3GI9L 5HYQA 5FGRA 4UQ3A 3OJVC 3NCJH 4KI5E 4PGBB 3KDMB 3L3KB 1SEQH 1CFNB 2P48B 1RZJL 1ZLUK 4XCCH 3AREC 5I1AA 4MJID 4Z7VF 4PJ9C 4H1LG 1BVKA 1QP1A 5H8DA 3QXAB 3TV3L 1ZS8A 3Q2CA 5T1LB 1T83C 1GZQA 1F4WL 2DYPA 4NFDA 2AV7B 5L8LB 4QOKD 3QXVA 4BQCA 2GY7B 3CLFH 4DVBB 1I1AD 5JW4N 1JNNL 4PJFA 2Q76A 3U82B 1B6UA 2J8HA 4YBLC 3G6JA 3MODL 3EIFA 5DRNB 4ZS7L 2O61B 4WI8A 3SEPA 4P9HC 5KG9A 2NY7L 5FAAA 3RHWK 3DRQA 4XBPA 4POYA 2W92A 5KSBB 3BH9B 1RK0B 5FA3B 3LS5H 2JCCA 3B6SA 4H88H 4JQIL 4JRXD 5F3BB 3B3IA 4JANA 4KVNH 1B0GB 4D0CA 1DBBH 3TYFA 4XP9H 1ONQA 1A7PL 4FHBD 4HF5H 2VRAA 4KHTL 1Q1JL 2W9DL 4GKSA 1QLFB 4PJAB 1CDJA 4E42A 3NIGF 1I4FA 4OCYL 1NL0L 4PJIA 4WI9A 5DR5L 1EEZA 1MEXH 5DD6A 3CFKB 3ULUE 2IF7A 5KSBF 1DCLA 3SKNA 2J4WL 4Y5YC 3V7AE 1FYTB 1QPPA 3F58L 4FTVB 4OF5A 5EZIL 5IBLC 2FLRT 5EA0H 3MLXH 1KACB 3KHQA 4PYHA 4PRAB 4H1LH 5F9JB 1CK0L 5FGSA 1A1NB 3RRQA 1YPZA 5EUOA 4EI5B 1PG7H 4DCQA 3QJHA 4LDOB 3MOQA 4PJAF 2CK2A 4BK4A 3IFNL 2OM5A 1MRCL 4XX1E 4UOJA 3THMH 1CD0A 1HEZA 1DFBH 4G6KH 3FO1B 3MGTA 4YFLI 1EFQA 5KJRH 1U3ZA 2ZCKL 5E8EA 4WFFD 3VW3H 3SE9L 4RWHA 5GRYA 4ESKA 3U36A 1FIGL 2LTQB 4TVPE 3H7BA 1FSKB 1T3FB 4UIKL 5JXAL 3CDFA 3RAJH 2RB8A 4UTAL 4OCSL 3WYRA 4YJZL 3D2UB 4ZFGL 1GYAA 3DX9A 3WLWC 3IJYB 5C1MB 2VZTA 2BRQA 3PUCA 1I7RA 1JWMA 4JFDA 3LRHA 5CSGA 4M61A 1YEEL 2D03H 4R97B 4HIXH 4PR5A 3NIFE 4N0YH 1J5OL 1KLGB 4TPRH 3MUGB 4DFIA 2MPAL 1BFSA 2HG5B 4KQ4L 3Q0HA 1KV3A 5JIPA 3CFJA 2VAAB 2VLME 4DAGL 5JW5B 1G7HB 3QEUB 4HIIA 3ARRA 1ZWIB 1ZA3A 2G5BB 2Q8BL 4ODHL 5TE4H 1VGKB 1PY9A 3I2CL 3ROOA 3V5DB 2LTQC 1JPSL 5HYJA 1ZT4A 2D7TL 4IRSA 5LGJA 3PHOB 3DBXB 3MV9E 4LLDB 1QFUH 4RGNC 2FJGA 2LU3A 2VAJA 4NC2B 4Y4KA 2X4SA 5JQHC 3ES6A 3QCTL 1DEEA 3ZHDA 4WU7B 1LD9B 1XGUB 2HRPH 1RVFH 3PABA 3HPLA 1L7IH 2F8OA 5ERWA 1I7TB 1CFQA 3IVKA 1NCBH 2H2SC 3H0TA 4KAQL 3OXSA 1WZMA 4CAGA 1RJCA 2PYEE 1AJ7H 1BBJB 1UJ3A 2B39A 3MRRB 1MFCH 2UYLA 1P7QD 1F4HA 4X7DC 3S36H 4D0DA 1BVZA 1HXYB 2NX5E 1S78D 4KMTL 1ZLWH 2P24A 4JRYB 4NRZB 5SWZE 1BLNA 3LN5B 5CZXC 3ZKMC 5IMLB 1H3VA 4UT6L 3ZHKA 4I0PB 4I5BA 3R8BB 1FL6A 3VFRA 1JZ6A 2WIIA 1BZ7A 1A14L 3F7PC 2EICA 2XN9E 3WS6C 2VNCA 4X7EC 1JRHL 4P2YA 4NC1E 2A6KB 3QIUD 3KLSA 3MLSH 3BHBB 2YK1L 5JMOC 1SVCP 2X4PA 3L3HA 1N3NA 2E27L 1MNUL 4GKNA 2J88H 3QZWB 5GGRA 4URTB 4NBYB 2YXMA 1OSZA 2G60H 4N8PA 1EXUA 5DD1H 3VRIA 3TO4A 4PJ7B 4PJ8A 3RZCB 2E8ZA 3LPFA 1MI5B 1INDH 4RGOL 3TBYB 3FQRA 1I85C 3TIEB 3DJ9A 4JZJB 2B4CL 4LVEA 2EDEA 4I0PC 2XWJA 5DMIH 4GW4A 2CKBA 3PWPB 1CD9B 4MAYC 3WN5A 1S9KC 2GITA 3VXMD 1F4YL 4NWUL 4YFEA 5ESAB 3QQ4A 1IEAA 3WDIA 5IHLB 4K9EH 1N6QH 4MA1B 4U6VL 2CUHA 5D5MB 5AYUH 1VERA 5EU6D 4PRIA 3QWQB 4O2EB 3SGJA 4GG6B 3HG1A 3A6BL 3S35L 4PJ7F 4JREC 4U1MB 1A0QL 1O0VA 3BWUC 4XC1L 5A2LH 3V9FA 2QR0B 4I2XA 5DUBB 2F53E 5HPOA 4O2CB 1DQJA 2VLJA 2W0LA 1EFXB 4MAUL 1K8DA 1ORSA 3BAEL 1TZHA 5JTWA 3M17B 3PP3H 4HZLA 5HYIA 2VDPL 3X3FH 1U93A 2B5IB 2IFFL 3GSQA 1HHIB 2P7TB 4KRPC 2FZ3A 4NHUA 4P2RA 1CICD 1MWAL 1WWWX 4ALAL 2NXYD 5L0QB 1R6VA 4NDMB 4DFHA 2HJLA 4WV1A 3CVHB 1PEZA 5D5MF 5HGBA 5E03A 4TQEH 2BY2A 5ENWB 4GG6F 4NQEA 1REIA 3MRDB 3UAJC 5KSUA 4Z76A 3TVMB 4TSCL 1T1WA 2RBLA 5ESQA 5FYLH 2HFFA 2RIKA 2VLKD 3QUXD 1T5XB 2DL9A 5D7IB 3M8OL 4MJ5B 5ID1B 1ES0A 2PYFA 3VRLF 2BNQB 4BSVB 5DZNA 5IB2A 1A5FH 2Y9RT 3GSXA 1BJ1J 5IBUB 4DUVA 3CFIC 4X4ME 4R7NA 4K2UL 4U6HA 4XPGH 2XG5A 2CRIA 4P2CG 2HKFH 5JNYA 3UTQB 3SO3C 4WI7A 2FYYA 3H2WA 1WEJH 1A6PA 3N1FC 3ARGA 1ZLSH 3KPMB 4XI5D 5IW6A 1YUHB 1GPOH 3IFOA 1G9NC 4KUCD 3U2SB 4P2QB 4MS8A 4HK3N 3KPQB 4HJ0C 5D7IF 4U1KB 3QDGE 5LKNA 5GZNC 3WIIH 5DRWB 5DJ6B 2IBZX 1MF2L 5I66A 2F5BL 3T1FA 2CIKB 1EAJA 2BSRB 4O00A 1H3XA 3V8CA 4G5ZL 3RDTA 2OBGA 1FZJA 4XC3L 1FGNH 3EDKA 4OZ4B 2H6PB 4PTUB 1MIEL 4XBGB 5CJOH 5K93A 5AAMA 3S35X 4D8PB 3MACH 2AXGA 1EAPB 4MLIA 3TH2T 4WI5A 2VXQH 5J1SC 1ITCA 3G5YA 3ARQA 4NKOB 4APQB 2P5WE 1LE5B 2SEBB 3OHXA 3QZWG 1KPRB 2DI9A 3GSWB 1CT8B 4LIQL 4LRNH 1ZANH 1A7QH 4G9DA 5J6HB 5DJ0A 3E2HA 25C8H 2ZUXA 1DN0A 5D7JB 2VERN 3GZKA 3DVFA 2BY0A 2VLRA 4PJCA 2IAND 4MMXC 1B6DA 1EGJH 5C0AA 3HR6A 1P4LB 3SCMD 3GBLA 2R2HA 1L9NA 4PGCB 3PP4L 3IAPA 4G7VL 1NCDH 1JPFB 3NZ8B 4L8DA 4XCFL 1A6UL 3REVA 2NXZD 1WBXB 3CFCH 2EXYC 1BZ9B 3D39D 1LDPL 2XA3A 1OP5H 2FGZA 4JY4B 1WISA 1EMTH 2F8VA 5BVJB 2EYTB 2WBJC 3B2VL 2ZG2A 4APQC 1UFUA 4Y2DD 3ARUA 4OUUB 4K3EH 5E2VH 5TDOB 1H0DB 2QHLA 4XZUA 3ZDXE 5JOEA 1ZHNA 3P0VH 2K1MA 3IU3A 5E9DD 1QUNA 2XZAH 4X80H 4DN3H 1IC7H 4WI2A 4OCMC 4FQIL 1UADC 2ZKHL 2AKRA 4L3AA 2HVJB 1WCBA 3OWEA 1H8SA 1JF5A 2A1WL 5JIHA 4JR9H 4IOIA 1ETZB 2GT9B 4OB5L 3QO1B 2Q3ZA 2FJFA 5DI8A 1HHJB 3BOVA 1FVEB 3I02A 1NCNA 1JNLH 3X13B 5BVPH 5DMKB 3RVXD 1N2RA 5GRVK 3MOBL 2WWMC 3D5OF 4QHLA 2Z0BA 1FPTH 1B4JL 3WUZA 2R69L 1NMBL 4DOHB 4M6AA 5BXFB 3MCKA 2ORBH 4P9ML 2BJMH 1G0YR 3X17A 5IBUG 3B5GA 3VH8A 1T1YB 4MDIA 5F8RC 4XPTH 5EFIA 1DLFL 3EFFA 3PGDB 4UINH 3OTTA 4JAMB 4G8FA 1P69B 1N4XL 4HUXB 4LGRB 5DJZA 5EN2B 3JWDC 5LXGH 1M7DA 5HYSB 3BDYL 1NH6A 5L8JB 4AT6A 5GRZA 1JRHI 3KPRB 3LKNA 4P59L 1MCCA 1J0YA 3QG7H 3MMEA 1R3LA 1SYSA 1NUNB 2FX9L 2ZNXA 3FZUC 4AY0A 3QJFA 2ESVD 3IDNA 1HKLH 4Z7UB 3SDAB 3KPOB 5HVWA 2FWOA 2FIRT 4R4ND 4RISH 4Y8DC 3S8WA 3PL6A 2X7LB 4HS8H 3I85A 5F1IB 4ETYA 4JO2L 2C3HA 5D7KD 3WBDA 4LVNB 4GAYA 5DFWH 2BVQB 2V7HA 1EERB 5KS9E 3F7VB 2PCPB 4PJDB 5CEZH 4MVBC 1NAKH 5DC0A 1WQVT 3IJHB 5DD3H 4NHCL 2LFGA 3DMMB 4ZAKA 3CVHH 4DK6A 3C09C 5KVDL 1J87A 1HN1A 4P3WA 4KROB 4P4KB 1IE5A 3EZ8A 2NZ9C 4LLWA 2VOTA 1LEGB 5ALCH 4IHOB 4XPFH 3SDDC 1ZT7B 2DIBA 4Z7UF 1VB9A 5KW9H 3UO1L 3O2DL 5C09E 2F54E 4GQ9L 5DHVB 4CKVX 4U6YB 3VFNA 4M7LL 4XNQB 4KK8C 3BKCL 4MMZC 4Z7NE 4HIHA 1VEPA 4PJDF 2E6QA 4GUPB 2I9TB 1Q38A 3GSVB 4WUKH 2DL2A 5C71A 1U3HD 5C08E 4ZPVB 3BPCB 4ONFH 4LMQE 4MWFA 3DI3B 5FV2A 2A77L 4V2CB 5J0BA 5E00B 2W1NA 1JCKA 1X5FA 1NC4A 1D6VL 4FN0A 3FT3B 2OXHA 4U1NA 4KROC 2VDLL 3GJEA 3MV9A 3DVNB 2DIJA 3JV4A 2OCFD 4ISVA 4GLRI 4EXKA 3QUZC 1P4IH 4YXHH 3I6KA 1G0DA 2QLVB 3EO1A 1AE6H 4IS6B 3CFEA 2P5EE 4NN6B 3BP6A 2AJ3B 5IKCA 3I3EA 3MCLL 5GSVB 1CTNA 2GAZB 4PREA 1C5DB 2PYEA 5DJCB 1I3VA 5J6GA 2A6IB 3HMXL 4XNYL 4G8IA 4LSDA 4M6NH 4P2OD 5I75C 2NX5A 1J1PH 1KJ2A 3MNZA 2YD8A 5E99L 5SWZA 2BDNL 5EBLA 1OB1B 2D7NA 3JVGC 3ARBB 4FRWA 5DJAB 3BW9A 4LEXH 3OF6A 3QHZH 1FNLA 4QTHA 1WTGT 3QRGH 3TO2B 3NIDF 4JCLA 4MXQC 1SJEB 1BQLH 1QFHA 4OF7A 2XWTA 2XN9A 3MA7B 1JTPA 1Q94B 3ZKSD 2VH5L 3RWJB 5IFJB 4Y5VA 5HHMD 1ZEAH 2FX7H 1RZKL 3MREA 2B1AL 1X5XA 1JF1A 5L2KD 1F6FB 1OAYH 4OSUH 4M8QA 5F7FA 4PJ5B 4DK3A 2VL5A 3W2DH 3K0WA 4HXBH 4NJAH 3RHWF 5LQBL 4WW2C 3WFBL 3T8XB 2CD0A 2BSED 4XCEB 3QIBA 1FC1A 5D7LD 4KJQD 2VXUH 2UZIH 5JHDB 1XCQA 1MFEL 1WZ1L 2VISA 4FXGB 2X4OA 3BN9D 1JWUB 2CLRA 3QBTB 3IFPB 4LLQA 3ARBC 3RTQB 2WSKA 4QXGL 2ATPB 1T2QL 3WKMH 1X5AA 3FONB 2WIMA 5GGTA 3T09A 1XCTA 1MHHA 4LNRB 4X5WB 4AENB 3ZYJA 3IDIA 1LP9E 4J1UA 5B38A 5CLWA 4RMUA 3NTCH 3HZKA 2VMFA 3EYFA 1NBZA 1E6OH 5KSAD