3MRDA

Crystal structure of mhc class i hla-a2 molecule complexed with hcmv pp65-495-503 nonapeptide v6g variant
Total Genus 79
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
79
sequence length
274
structure length
274
Chain Sequence
GSHSMRYFFTSVSRPGRGEPRFIAVGYVDDTQFVRFDSDAASQRMEPRAPWIEQEGPEYWDGETRKVKAHSQTHRVDLGTLRGYYNQSEAGSHTVQRMYGCDVGSDWRFLRGYHQYAYDGKDYIALKEDLRSWTAADMAAQTTKHKWEAAHVAEQLRAYLEGTCVEWLRRYLENGKETLQRTDAPKTHMTHHAVSDHEATLRCWALSFYPAEITLTWQRDGEDQTQDTELVETRPAGDGTFQKWVAVVVPSGQEQRYTCHVQHEGLPKPLTLRW
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Analysis of Relationships between Peptide/MHC Structural Features and Naive T Cell Frequency in Humans.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
molecule keywords HLA class I histocompatibility antigen, A-2 alpha chain
total genus 79
structure length 274
sequence length 274
ec nomenclature
pdb deposition date 2010-04-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00129 MHC_I Class I Histocompatibility antigen, domains alpha 1 and 2
A PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3mrdA02
3.30.500.10 Alpha Beta 2-Layer Sandwich Murine Class I Major Histocompatibility Complex, H2-DB; Chain A, domain 1 MHC class I-like antigen recognition-like 3mrdA01
1IGIL 2N7AA 4NNXA 2GJJA 2K9UA 3D85D 1A7NH 1ZT7A 4CDGC 4JCMA 5D93C 4FXGA 3BT2L 5E8NB 3CAFA 1BPVA 4DGYL 2YPVL 1T7ZA 4MYWB 4GBXD 1GGCL 3UYRH 1QBLH 1CVRA 4MA1C 4YHYC 4PJGA 3AS0A 5EN2A 5L2KD 3WFHA 2ICEB 1AKJB 4XI5D 5GXBB 2PR4L 2DQFA 1MUJB 4NZTH 3O4OC 1FVEB 2R2BA 1BX2B 3QRFM 5KVFH 3RBSA 1TJIL 4X99B 4MCYA 5D6DC 1R3IL 5BZWA 3O6FB 4QXGL 1SVZA 2Y7QA 1KOAA 3EYFA 4H1LH 1B90A 3SO5A 3P0VH 5DMKA 1TVHB 4MSWA 4K8RC 1MLBB 3D39D 5HHOB 2EXWC 1Y18B 3KYMB 1XH3B 3G6AA 4X8JA 4C56A 4CW1B 1MCJA 4JFDA 5DXWA 1FNSH 1AD0A 5CWSA 3ROOA 2MCPL 5I71C 2XZAL 3OMZA 3TPUB 2FL5B 3OAYK 4PUBH 5IFJA 4W81A 4C83B 5J1SC 4P2OA 3PJSA 4Z7UF 5C0CA 3VGDA 2QQLH 1MCOL 5GGVH 8FABB 1X5KA 2CKBA 1CL7L 4QWWD 3C09B 4UILL 1LK3H 1BQLH 5D5MB 2GCYB 1N4XH 5CJ8A 4ACPA 2PTTB 2X40A 4HKXB 4KPHL 1S7UA 4OGZA 3BP5B 3OKEA 3NFPB 5IBUB 4DKDC 2WWKT 1Z5LB 4RISL 2XIDA 3O2DA 3MRBA 1MSPA 3KPSE 3T4YA 3DRTB 1FIEA 3TBSA 3DJ9A 3ALWA 1CDHA 1KEGH 2DM2A 3V8CA 4OLYL 3NZHL 3U82B 1ZWIA 2ERJC 4EEEA 3VXNB 4M1GL 2Y36L 4OD1L 5AZ2H 1JI2A 1ZVYA 3FQWB 4HBCL 4NFDA 5FB8A 2F8XC 4YH6A 4PJXF 3TZVA 1R3LA 1U36A 4N8CL 2OXHA 3K2MC 3K2UH 3T2PA 4F58H 2NR6C 1QPXA 4OLZL 2AERT 3MLXH 4PRDA 2VABA 1SJEA 2DQEL 1M6OA 1I3VA 5JA8B 5B38B 2J8OA 4NO3A 1NFIA 3ARTA 1OL0A 3MRHA 3TWCL 2FSEA 4M1GH 1D5BB 4PB0H 1DE4B 4K3JH 5DLML 4OZ4B 4OLZH 1J8HA 4MNGA 1INQA 5D7JB 1LE9B 5F1SA 3H9SE 3UTSD 1CGWA 1KELL 5SWZD 2A83B 3FRPA 4HHAB 4DVBB 5MEPA 1RJCA 4LLDB 1C1EH 1VKXB 3BW9B 1YEEH 1RMFH 4YWGL 1R0AH 4J23A 3LKRB 3DLQR 3IYLW 2R69H 5KTEH 2WUCL 1JMZA 3PWJB 3SDYL 5CGTA 4JFXB 3TGXA 4X80H 3QNXA 4FTVD 3U4EA 4AIXA 5TQ2H 4QCIA 3PWPE 3WDJA 4FQXB 4PJCA 4DN3H 5EU6A 1UM4H 4AEHH 4NO2B 1JGLH 4U05A 4QRQA 5HYSB 3WDIA 3MGOA 4F3FB 3O6KH 1YMMD 1YEFH 4XBPA 1AO7A 3VE0A 4QHMB 5BZDB 3LN4B 5DJ2B 3SJVA 2EDDA 2DQJL 4JZOB 1N0XH 5FYKL 4OFIA 1OT2A 1MFCL 3NTCL 4QXWA 4LMQE 3OHXB 4EBQH 4F37K 5J1AB 2FHCA 1O7SA 3SDAD 2ZUQB 5GHWL 4BH8A 1ZHKA 1BZ7B 2MPAH 5F9WB 3PDGA 1WIPA 3EJZC 1IEAB 4K3EL 3CH1A 3GMQA 5IHUL 4P2QD 4YE4H 3R8BB 4L8DB 3S3JA 4ETYA 2CUMA 1T2QH 4ELMF 3QAZC 2OBGA 2O5ZH 2QSQA 4JFEE 4P5MA 3O0RH 4UAOB 3E8UH 1AGFB 2DLFH 5JO5A 1EBAA 2Z0BA 3NTCH 2W65B 1H3WM 4QRRE 1NCAH 1T89A 4R0LA 5D7LD 1UKTA 1TQCB 3NH7L 5I8EA 3MGAA 5MP6L 2KDGA 4JFFB 3MRGB 3WS6C 5B39B 5H2BA 3KPSB 4AM0A 3S3SA 4HJ0C 2FECL 4H1LA 4PJ9D 1KIUA 1KLGA 1RZKC 1JMXA 3C8DA 3HCVA 4P23A 2OQJA 1HEZB 2D31A 4L3ED 1CXIA 3DYMA 4WV1C 3UTPE 4XWOC 1P9MA 1JPFA 4MJIA 3BX7C 5D71L 1MIML 4G6KH 3NH7H 4FQCH 4MQTB 5E2WL 2X4NA 3WHE1 1RZ7H 2EECA 5IJKA 2Q1EA 4YX2H 1W0VB 5HVGB 3FB6B 3OKOB 1BF2A 1WFTA 5D6CB 5CGMA 3CFEB 1BP3B 2DYPD 4RGNE 1QNZH 1F5WA 4NOBA 5EO9B 1A02N 3QUKB 5DJ8A 1FE8H 3VRLE 5GGSA 2ORBL 4OZFB 1PSKL 1IAOA 5SWSE 4NO2A 3TN0D 3CXDL 4FQXA 3M8OL 3RWGA 1FSKC 4JJ5A 2XQBH 4WFED 2A9MH 5HY9A 1XGQB 1RZ8B 3X3GL 5T3ZE 4N0YL 2WLZA 2X4OB 4YLQT 3LKRA 4WFGD 5EFIB 1U58B 5EU7C 4LLYB 4JFDD 4GG6B 4JM2A 2IQ9H 1VKXA 4LLDA 3FT2B 1H8OA 2AJXH 3AS2A 4KDVA 4HS8H 1Z3GL 4GG8A 4PRPA 2VDLL 5E99L 3TT3H 4POUB 3FFDA 4IDJL 3ZTJG 4P3DA 3N9GH 1NFIB 4NO3B 5TE4H 4Z7OE 3RUGE 4Y1AD 4U1MA 1CL7I 4Z8FL 2DJUA 3LKSA 3DNKA 3SQOL 2DBLH 4RZCA 1JGVL 5EOTA 5I9QB 1FLRL 4M6OL 1R3LB 1HHHB 2IQAA 3O2WL 1HSBA 3KJ6L 4HH8A 4DEPB 4EBQL 5C0ND 4ZFOA 4LLWA 3VXQA 1UZ8B 4I4WA 1TDQA 3FT4A 4Q6YA 3UDWA 1Q0YL 4H25A 1R5IA 4UU9B 5B22A 4Y5VA 2XWBA 1F3DH 4PJHF 3O45B 4D9LL 5MI0C 4AENB 4QRPE 4YC2C 3OKMB 3DGGA 1JPTL 4DKAA 1WZ1H 2R0WL 3PHQB 3ZDYE 4MAYD 4KV5E 3EZ8A 3U2SA 1HSAA 4NC2B 5TJWK 3GSRA 5F8QC 5DEZA 3TBYA 5IOPA 3EO1A 4OCRL 2CIKA 2R0WH 4I0PD 5FYKU 5HJ3B 4X9IA 1T1YA 3F7YA 4HKXA 1FIGH 4LEXL 3NBNA 4V3EB 3H42L 1WBYA 1G7LA 2H1PH 4XWOD 4CVXB 4AYFA 4LSTH 5E6ZA 1I7ZA 3K0WA 3O6LH 5GRUH 4WY7L 3LPGA 3VFVB 1FV1B 1SM3H 2RCSH 2EDJA 4X6CA 4IHOB 3IB4A 2ADJA 2F74A 4E41B 8CGTA 5C0CB 4JY4B 3PJSB 3BGMA 5DA0B 5J11C 3FJTA 2D7TH 3EW3B 3GMRA 2R9HD 5I17B 5D7LB 4ZUSB 5EUOB 1I75A 2XQYK 4JG1L 3O3EB 4QNPF 1I9JL 1XH3A 2EDKA 1M7DA 5KZCB 1FQ9C 3TPKA 1PKOA 4XPGH 4GRWB 4TULL 5FUOH 5C9JB 1SM3L 4JG1H 3DX6A 3EOAB 4ENED 3ZDXE 3C2SA 5C09B 2P48B 2FEEI 3K74B 2XZZA 3T2NL 1YJDL 2R1WB 2X1OA 1WBZA 5GS0D 2RIKA 2VXSH 3BH8A 2A6KB 3TO4C 4W4OC 1WZLA 3MNZA 1NC2D 5JXEA 5IFHL 1V3KA 1WITA 4PJ8C 5CLTA 4CBPA 2C3WA 2AJSH 1OTTD 2XTJE 3QIWD 4R96B 4PYHA 3RNKA 4BSVB 1RJZB 2HJFB 3IFOB 5GJTH 4MQSB 5DWUH 5IIEB 1T3FB 4POYA 4GG6F 1OW0C 1FNEA 3ZKSD 1FNLA 4MX7A 4O00A 1WT5A 1JPSH 4PRHA 1A0QH 2B4CC 4YXLH 2QHRL 1INEL 4CMMA 4YNYA 4TRPH 4NO0D 3JUYA 4QRUB 1S7VA 4R2GC 4Y4FA 1NAML 2F53E 3RPIA 3PABA 1EHNA 4IMLB 3N1FC 4YDJA 3MREA 1A6UL 2F8VA 1X5YA 2V7NB 4YJZL 1XF4B 4UIMA 1I4FB 1IC7H 3OKNA 4LF3A 4M6OH 4P46A 4WTZA 3HS0B 4H8WC 4HQQH 4GKSB 1X3DA 1CGUA 1M7XA 1RUKL 4C54A 3NFSL 4FQJH 3NCEB 1MY7A 1Q72H 3CZJA 4KAQH 4LVNB 4MX7B 3OAZK 1FNEB 1OM3H 2VZUA 5IESL 1CLZL 4K07A 4DZBB 1OF2B 5MENB 4X6DB 5HYEA 4JZJC 1KTLB 2GT9B 1RJZA 3IFOA 1T66D 3L1OL 4G7VL 3V7AG 4GRMB 4D9LH 5GS0C 1T6VN 1HQRB 1Q72L 2WIIB 4WENB 1MVUB 2Q7NA 4G5ZH 4OFDA 1C1EL 3ZE1E 1HCFX 1YA5A 2HTKD 3EO9H 1GZQA 1L7IH 1IT9H 4LNRB 3W81A 2VSDA 1OLZA 5D96B 2XN9A 3CSYA 5CP7A 4HH9B 1LVEA 1IC5H 1V7ML 1WBZB 3IJYA 2X89A 4DN4L 4NJAL 4LU5L 4OZGF 3BEWA 2IFFH 4JKLA 4N68A 3U0PB 1Q9KB 4MA8L 3DX6B 3EOAA 1RUAL 5C0RL 3D39B 5HHOD 1V5JA 4GAYB 2AK4D 4GXVH 1DCLA 5F9WC 4LSTL 1R5VB 2QSCL 3I2CL 5J9PB 4F57H 3MRFB 3TNMB 1DN0A 5IW3A 5ALCH 2DQJH 2JJWA 2ZUQC 5AYUL 3KPSD 4OTXL 1QSEB 1G9MC 5ICYB 1HYSC 2B0SH 5H37G 3L6FB 4KKAC 5BO1H 1NANH 2XRAH 4LEOA 3IKCB 4F7CA 1MJ8H 4JRWA 4NM4H 2J5LB 1P6AB 3BGMB 1D9KD 3MR9A 2F74B 4X7FC 2JF1A 5C0DA 3TIEA 1FV1A 3BMWA 5A1AA 5ESAB 4FQ1H 4PRPD 3GNMH 1D5IH 5D7IF 5E5MB 3HAEH 5ACMA 3D18B 5GRVL 4CVXA 4P48A 2XTLA 5K59F 5FUOL 5GGRB 3VFGL 4XAWL 3C60A 2VLME 3GHEL 3ZYIA 3VWJD 1NPUA 2I9TA 3IXTA 1CICD 3PGFH 3GNML 1GH7A 3TV3H 4WW2A 1MCSA 3C5ZD 3IU4H 1NFDA 3K4ZA 3VG0L 3HKFA 4JY6B 1VA9A 5D8JH 2NYYD 2YPVH 1G7IB 3X12B 3SCMB 5BVPL 1D5XB 3QPXL 3PHQA 4M9PA 3RVTC 4OM1L 1JF1A 3ARUA 4GSDH 5KVEL 3EHBD 2HVJB 4NQXB 1LO3L 4E5XA 1UB5B 5D1QA 4IRSD 4Y5VB 5EZOL 1H3PH 2JK5B 3SCMA 2FBJL 3QYCA 4BSJA 4L29A 3Q5OA 1G7QB 1YPZA 2FX7H 3IVKA 4PRHE 3RGVA 1A6TA 4HEPG 1FRGL 1CWVA 2B20A 5JA9A 1YEEL 2VZOA 4I3GA 5FV1L 1CG9B 1GSMA 4N90D 1AE6L 3PNWA 4XI5C 3P30L 5EA0L 4M7JH 4KHTL 1AHWC 5F7DA 3LKSB 4U33A 4MAUL 1P4LA 2FLRT 3STLB 4WI9A 1C5BL 3GO1H 2NW3A 3UAJC 2CO6B 5JHDA 4PJXB 5I75B 4LEOB 2XICA 4XC1L 4WWID 2Z92B 3DYOA 4BUGA 3HUJA 4PRPB 1UJTA 3AROA 5I1IH 4GAGL 3EHBC 3EO0B 4S11A 1F3DJ 4PGEA 5D2LE 4WI3A 4PTUA 3O6KL 3TPUE 4TSBL 4XXDB 1JRHI 1S9VB 1WWBX 4MDJA 3RL1A 1CYGA 4UOW0 2D4DA 3M07A 1RZ8A 3MJGX 4RISH 1GPOH 1QA9A 3RWGB 4HIXH 2GSGB 2I07B 5I1AB 3BISA 3OL2A 4YE4L 4KPHH 4NQCD 1VGEL 5CP7B 5FA4A 5DURD 4WO4A 3L3OA 4FFWD 4OCXH 1I3RB 4M6NH 1BVZA 1NCAL 5HPOA 2YOCA 1RULH 5D2NE 2XWJA 2BVQA 3FKUS 3ARFA 3K4DA 2RGSA 4K3DH 3MJ9L 5ANMB 5L7XL 5ALBL 4P46C 4MJIB 1YNKL 4MNHA 3DI2B 1EMTH 3NIDE 4I18B 1Z0NA 3CCHA 4Q9RH 2Z35A 4OZHF 4ZNEE 1TNMA 2C5DC 4LSSH 1A7QL 5F7EH 3O41B 2C3VB 2R1YA 3BP7B 3SDDB 1YYLH 4L9DA 5LBSH 3RTQB 4ZS7L 4HFWA 3O2DL 2V7NA 1ES0B 3MREB 1T83A 2LTQB 4WIQA 4AM0B 4WDIB 1IQWL 1XCQB 2E9WA 5EU5B 4YHZH 5JXAH 1QLRA 1YMME 3LEXA 2APFA 1A4KB 2B1AH 2QKIB 1PKQA 3MRGA 4QRUA 2NY5L 4PP8C 4P59L 1YJDC 3Q6GH 2UZXB 5I8EB 5GS0H 1EERB 3EYOA 2H41A 5DD6B 1J0JA 1P53A 1NBYB 1J5OH 4PTTB 1BHGA 3KNBA 5DLMH 1RMFL 5JO5B 3D9AH 4NN5B 3X11A 1OGAD 3DV6B 2ZCLL 4QXTA 3C2AL 1KXVC 5F21B 3EBAA 1XGYH 1R3HA 2ZP0T 1M71A 2VLLA 2V9TA 5J6GA 4JREB 1EFXA 1LDPL 1B9ZA 3I6KA 1AP2B 4MDIA 3OR7A 1CLYL 1ZHKB 2A0LD 3QQ3B 2X1QA 4N8PA 3HPLB 2BFVL 4M48H 5IEHA 2C4FT 4FMFA 2NLJB 4ZOBA 3OHXA 3LS5L 1C16B 2BSSB 3HRPA 3E3QE 3L3KA 1UXWA 2Q6WA 5C9JA 1WIOA 1P7QD 1LP9F 4FQ2H 4KROC 3ARGB 5HHPA 4XPAL 3CFIC 4XBPB 2OCFD 4MAUH 1KJMB 3ESVF 4BQ9A 1ZHNA 3PDDA 1KENL 3HMWL 3RY5A 1VEMA 3HG1E 1VFOA 3N1QC 2MPAL 4HGWB 2NXYC 4S0TD 5A43C 1MEXH 1SJHA 4ZUSA 5D7LA 5EBMA 2JLLA 2XI9A 1JGDA 1MF2L 5E6YA 2R0LH 5GHWH 4CADB 1CU4H 4U1JB 4ZUUB 4JY4A 5CIPH 1UG9A 4X6CB 4OCYL 2XTJD 1U8JA 1YECL 3BW9A 3MLVH 4RMUA 3QO1B 4YHPB 1L0YA 3AU1B 5D7JA 5LJYH 1INQB 2V9RA 4WFFD 1ZLUK 1OAKL 3GSUA 1WBYB 4XVSH 4I9WE 3QPQC 4M02A 2R8SH 2NY1D 3P40A 3PHOB 3C6LB 5T5FH 2CIKB 5TF1H 1OARH 5IOPB 3UZQA 1KTDA 3NIGE 2NX5A 1LO0H 5B38A 1A0QL 5DQDL 2IAMC 3G5YA 4M7LT 5DS8A 3ZE0F 4O4YL 4QY8A 4X6FB 4U1IA 5L0QC 3LN5B 2YKLL 5J12B 2DQDL 4HUMB 4JM2C 4OIIL 5IMMB 3DGGB 1MELA 1MFNA 3PP4L 1GCFA 5KSBB 5DC4B 2DB8A 1U8OB 1J05B 5C07D 1IL1A 1MRCL 4AL8H 1JHLL 3MLZL 1LK2B 2NY3B 1ROWA 5E8EA 5T5FL 2XFXB 4UBDD 4LLWB 1EMTL 5FXCH 1HSBB 1CFNA 1U8OA 4WI2A 1AY1L 4K71C 2W9EH 3VRLF 4Q6IC 5I1GH 3LN5A 4WO4C 1A7RH 3B3IB 3TBSB 5JLZB 3QQ4B 2K7PA 3BE1H 2R4RL 1KB5H 3N1PC 5HDLA 3RJQB 4GLRI 3T8XB 3WNPA 3OKEB 1S7UB 2NY2D 4P3DB 1TVBA 3C6LA 4U7SA 3ZT5A 3FFDB 4LOUC 3CZFA 5AUMA 1H8SA 1UENA 2R4SH 4WHTA 3T0XA 3UYOD 4EI5C 5ID1B 3OKLA 5BJTA 5D5MA 1EDQA 5CINL 2AK4E 3O11B 2UZIH 4KRNA 2CKBB 1U8JB 1RVFH 4ODWB 2APWA 5E9DD 5SX4I 3T04D 1U58A 3QCTL 3B9KD 3ZL4L 4XBGB 4E42B 1U41A 1RZKH 2VXSL 4U1JA 4CADA 1OVZA 1UB6A 4GFTB 1G6RH 3TPUA 1XGQA 1PZUB 2EC9T 4QTHB 1SJHB 4S1RH 4NRYB 5F7NC 1AD0B 4KQ3H 5BV7C 3BAEH 1KPVA 5EU3B 4JFDB 2V2XA 1B0WA 2JB5H 3BUYA 1WT5C 5GGSB 4MA7L 2EE2A 3DIFA 4B7LA 1NGQL 1JFQH 1IC1A 2AJVH 1V3MA 2LAAA 4P2RB 5C0FA 1DBBL 1CFVL 4GBXA 3CFEA 2E6JA 1A6VL 3HMXL 4IOIB 3O6FA 1FCGA 5TGBA 2WQ8A 1W0VA 1DQTA 1KJ3L 3VA2C 1GC1L 5JUEL 3TH2T 4CUCA 3IDJA 1BX2A 2M1KA 3DUUB 1JE6A 3MYJB 4Y4KB 1IJ9A 1MUJA 3QQ3A 2ICEA 3I6KB 2QHRH 4PJ7F 4XGZA 3E6FA 5GIRA 4AT6B 5TDPB 5J6GB 3ARFD 4HWBA 3HPJB 4WHYH 3MLUL 4A2LA 3DOSA 3ZO0A 3IFPA 1YECH 4FXGB 5C0BB 4OJFL 2Y6SC 1C08A 2HFFA 4NKDB 3GMLA 4BFEA 5HXMA 5B8CB 4PRAA 1IKNA 4GW4B 1KIRA 1TZIB 1T04A 1VPOH 4JFYB 1OARL 3HZKA 1WISA 1S7TB 1JN6B 1FNSL 5C0AA 4UNUA 4M03A 4UT9H 4IRSC 1XCQA 4C59B 4WDIA 5EU5A 1CD9B 4HC1L 3ABZA 1TZHB 3SDXE 3U0TA 4PJIB 4HFWB 2C3VA 2DQDH 2R1YB 1A7PH 1IM9B 3BP7A 4FTVA 4OIIH 4YK4C 4GKZA 4UDTA 4WY7H 3CH1B 3GMQB 4IM8A 5DMIL 1RK1A 3SO3C 32C2B 1K6QL 2RFXB 3R0MA 1I9JH 3RBGA 3WUZA 4BH8B 1QTYT 3HB3D 1E4WH 4HIIA 5FCSH 5GGRY 1YY8A 2VLJA 3U4BH 4O2FB 4WHCA 4KK6C 2XWJB 4PJ9C 5HBBA 1KXTB 1P4IH 5JOPE 3QNYA 3L7EA 4TUKL 4YDVB 5D1XB 4NT6A 3H0TB 4EVNB 3P3YA 4U2YA 1NCCH 2IH3A 5HYJB 1AD9A 2PYEE 2Y07H 5D6DA 1NCDH 1KB5L 2KQMA 1YEJH 4NHUB 2I24N 4HG4K 4YR6A 2NX5E 3QJFB 1KJ2A 3K2UL 1A1NA 2ZPKH 4Q2ZB 5F9OL 1Q94A 4YAQB 4LHUB 4M6NL 3ZYJA 4JFFD 3WFEL 5D7IE 5DUML 5FGBA 1S9XB 1ED3A 3OPZL 5E1HB 4MNGB 4DAGL 2J6EH 4NC1C 2OM5A 4Z7VF 5C6PB 2H3NA 1T7VA 3BZ4B 5JHDB 5IQ9A 2FSEB 3MA9L 3MRHB 4PD4K 3V6OA 1QPPA 3REVA 4P3WA 1EUUA 1OP3H 1OTUC 1NL0L 1GRWA 3L3GB 3QZWA 2ZOLA 35C8H 5D7JD 2I26N 2RHEA 4FXKA 5T3XH 4ODUB 4TUJA 4W70A 5IB2B 3T0EB 1ZVHA 4MS8A 2V5MA 4KJQC 5KVGH 4TTGA 5HI4D 2F5AL 2XTJC 2ZSWA 3IVKB 2NY1C 3CLFH 2A9NH 2W1NA 3GI9L 4NKOA 2UY7A 5CIPA 4F15C 1IAII 1GOFA 5FGCB 4R7DA 4JN1H 1P7QB 3R06B 4MMXC 2AXGB 5EA0H 5KW9L 1MFBL 3DRTA 4R2GD 2DTSA 5CFHA 3RIAK 4PREB 3T0EC 4ZTPL 4LCYB 5KBNC 4Y5VC 5ILTH 1PEWA 1W0YT 4ODBD 3IS0X 3FO0H 5D2LF 1CF8H 2DLIA 2GTZA 4PGZA 3BGFC 3ARXA 3D18A 2HWZL 3P0VL 4LKXB 4M7ZC 1G7PB 3WBDA 5DJCA 2ADIA 8FABA 1PY4A 3DYPA 2GAZA 5IFJB 3OKDA 1MWAL 1Q1JL 4LQ1A 3LH2H 4GQ9L 4YHMH 3MRMB 5EOCJ 1DQLL 1AO7D 1W72L 2V17H 4XP4L 3LHPH 4LGPB 1EO5A 1RFDL 2C1PA 3G6AB 4X8JB 4C56B 4CW1A 5CP3H 3TNMA 1MWAH 1Q1JH 4OIBA 4MSWB 3V5DB 5DMKB 5E1AB 1LK3L 1JZ5A 3V4UH 1FAIH 2BVTA 4FQ1L 3IFLL 5CCKL 2Y7QB 4G9DA 1RD6A 1MFEL 2FJHB 5BZWB 5D71H 1FL5A 1A7OH 3RZCB 3ZKXB 4KK9D 4IRJD 1XF5B 2WIMA 5IMOA 5FYJU 1BJMA 1YYLL 5TF1L 5IEKB 1U3ZA 4JO3H 4DKFL 4PJ9B 4QWWC 4PJGB 2DWDA 2W0KA 3EDFA 4LLQB 4YXKH 3MLYL 4RMQA 4LVHB 5IT2H 1A7OL 1HQRA 5HI4C 5E2VH 5CJXA 4HC1A 5HGHA 4ORGB 5E8NA 5LKNA 1RIHH 2AAVA 4UINL 4WGWB 5D7IB 3IFLH 3O2DH 2XNAB 4DZBA 5MENA 2VISB 4O2EB 5B38G 2CUHA 4C58B 5E8OA 4WUKH 3CU1A 5FIEA 2K7QA 4ZUWB 4ALAL 4LVOB 1EHLL 1IAIH 2V7HA 5FYJD 1MHCB 5GJSH 2YA1A 5EO1B 1KNOB 3NAAL 3Q6FA 4I77L 4XNXH 1SHMA 3VWKD 4NHUE 3STBA 3OKNB 4FQLH 4LF3B 5DHVB 3TYGH 4FOMA 3HZMB 4EOWL 2Z8WC 2F8OA 4ODVL 5KAQF 5E9DB 3C6SB 3LDBC 4NQCE 3SKNB 3PABB 3I3DA 1MVFA 5C08E 1PEZA 3G5ZA 5I1HH 3WNMA 4S1QL 3LQZB 5SWSA 3RI5K 1NLDH 4P2QB 2A6JB 2ZG2A 3IETB 3VFTA 1MCHA 3C8HA 3C5SA 5HHMA 4MNGE 3ZTJH 2BFVH 1I1FB 4LNVA 5T1KA 5I1HL 1NCWH 2HJFA 4BSVA 2PNDA 4NQTA 4JFOB 2HH0H 3KLHD 4GAGH 3CMOL 2VUYA 3ZDYF 3L9RB 4Y4KC 3E1F1 4PJDF 4M4RA 3VA6A 1CFTB 3VFMA 3H9SB 4NBZB 2EH8H 4GMSL 1HOCB 1T22A 1TQBC 2A6KA 5IMKA 4JRYD 5HVHB 2ICES 5H94B 3AGVA 2H32B 1QRNE 2YZ1A 4PJAE 5IVZA 1YN6A 3SCMD 3K8MA 3OQ3B 3QA3B 3X13A 5E8DH 3C5JB 4P2RE 2ICWJ 1G84A 3IDMB 3MODL 4HK0A 2BNUB 2ESVE 3O3EA 4KMTH 2EH8L 2VZSA 2BVYA 4CMHB 1GGYA 3OKKB 5SWZB 5F88A 4FS0A 2B4CH 2W92A 4QRTB 4ZODA 3I85A 3MOBH 1L9MA 2X6MA 5TE4L 2OZ4L 4I0PB 4HIEB 4Y19D 2KPNA 2VR9A 2IWGA 4IHOA 2UV3A 3LD8C 4LK4A 3O4LA 3VFVA 4P5KA 3T0AA 3MLZH 3SJVD 5HGGS 2R0ZL 1JRHH 5DFTA 4GRLC 4XNYH 2X4RA 2XWTA 4KKCC 3JWDC 1VFAA 3MRQA 1DQDL 1E4XL 1JZ6A 4DTGH 1BGXH 3GMOA 3GUTB 4ODXA 4Q6IB 4XNYL 3VXOB 3MRKA 2ZCKH 3CPLA 1OP3K 1FORH 4QOKB 2ATPA 4RIRB 4Y19E 4Z95L 3TZVC 3UX9B 1SBBA 1U93A 1MCPH 1SJXA 2AJUL 5EU6E 1B0GB 1HKFA 4WI5A 4WO4D 1YQ2A 3BWUC 3NCBB 2IG2L 1EEZA 3DX8A 4YDLB 1GGBH 4NJ9L 3VGFA 5F3HA 2EICA 4I4WB 5T5NF 3SKOB 1QUNA 4FTVE 3RVVC 5E08L 2H8PA 4P9HL 2BC4A 2CLZA 2OP4H 1YY9D 1TZGH 4TPRH 1ZGLM 4TUOB 1ZE3C 4KVCL 1GYAA 5GJTL 5E6IA 3KPNB 5E2TH 2DQIL 4JQXC 3RTQD 1LNUA 3QG6B 1FE8L 4TUKH 1JZ8A 3EJZD 3QEHB 4PJ8D 3NIDF 3FFCE 3AUVA 5D1ZA 2ZG3A 4MJID 4XWGH 1MCWM 4IEFB 1XGPB 3KXFA 3OG6B 4YPJA 4BFIA 3KYOA 3DSNA 4NO0A 4GG8B 4RRPG 4S1RL 2X9YA 1J1XH 1IC7L 5EU6D 4JM2B 2BOCB 5D70H 2XKUA 3QUMB 3MV8D 1BBJB 3QR2A 5J1TC 3WMSA 3SOBL 4BZYA 1CDYA 3B6SB 4NDMA 1PG7W 2XACC 1AJ7L 3QNZA 3S5LG 3WFEH 2KUTA 3I3EA 3V9FA 1CCZA 3VDBA 4JJ5B 3ULVC 4XWGL 4OM0H 3O81A 1YUHA 3I6LE 1F4XH 4UB0L 3BD5A 3SE8L 5ICZA 1KB9K 4ZNCD 5I73B 3MA7A 1F90L 5C07E 3UROR 1UWGL 3OZ9H 1P7KA 2G9HB 1JGEB 1VADB 3DO3A 4PJHA 1QFUH 3O2VH 1E4KA 2X2YA 4R90L 5L6YL 4NYLB 1FHGA 3IDYB 3OKOA 3FB6A 2XA8L 4PR5B 3V5HB 1N8ZA 4DVRL 3MLUH 5CD3A 5ADPH 3ULUH 3LQAL 1JPSL 2ED7A 3OZ9L 5LGJA 1P2CB 3I02A 3EDDA 2D31B 1FH5L 3CFCH 1LD9B 3OF6D 4LSQL 2AXFB 4QHLA 4OCWH 4XP1L 5TDOB 5CEZH 4M5ZL 1MWAA 5HI5C 2AK4A 3ZSSA 3KJ4C 4YEEA 5ALCL 2VH5L 5E70A 1EEYB 2YHGA 1CDUA 4ETQA 2XA8H 3N06B 1JWUA 4NP4H 3HI5L 4DKEH 5DRXA 4HBQA 3WXWL 1UXSA 1MJUH 2VL5A 3H9YA 3DURB 4Z9KB 4MB5A 43C9B 3GSNB 2VQUA 5CINH 1UJ3C 4LPTA 1I8MB 4RNRB 4V2CB 5AD0A 1CGXA 3RTQC 4NFBA 4G8FA 3SDDC 3EJYC 2MQ3A 2BSTB 1KCLA 1KC5H 3SDAB 3QUXC 1P5VA 1PD6A 4OI9A 2NX5D 1ZT4A 3VFGH 4NQSA 1T1ZA 5DEFB 3UJTH 3H9HB 1BD2B 4JZNB 2XA3A 2P8MA 4NO5A 3V52L 1T6WA 4NJAH 1G6RB 5E24E 2VLKE 5F9OH 3WIFA 3WLBA 1IGML 4YHLH 3L3IB 5FK9A 3HC3L 3QULA 1IGJA 1NGPL 2HA1A 4GXVL 3OJDA 4RFOH 4KTEH 3V2AR 1ERNA 5T1LD 1EXUB 2EE6A 4JZOA 1I1RA 4L4VB 2XN9E 4DCQA 1P5UA 2ZUYA 4OD2A 3CFBA 4QHMA 4N1EA 4UTBL 3VFOA 4YHIA 3EZJB 3TJHD 1QSVA 1KGCE 1YDPA 2H26B 1REIA 3DBXA 2PCPA 4OV5A 3B2UC 4L8BA 2WY3A 1ZVSB 4WW1B 4I3RL 4JO1H 2LVCA 4BUHA 4KDTA 3WHXB 5MEOA 1LGVA 2BY3A 2EDOA 1I85C 3C60D 3FO1B 1YY9C 3F58L 3E6HA 4MNQB 1YPZF 1AH1A 1FYTD 1UVQB 1YEHL 5T3XL 3SOBH 1LE5A 3FQTB 2PW1A 4MD0B 3KPMA 1ETZB 3MV9E 1UWEH 5ETUB 2R9HC 1QFWM 3BQUC 4MB3A 2L0DA 3PWVA 2BNRD 4IOFD 3U83A 3IAGC 3TBTA 3S5LB 4LRIA 4TSCH 5JW4M 1XCTA 1WC7A 4APQC 5I76A 5CZXD 3TESA 5FO9A 1OQOA 1URLA 4N0CA 4UV4L 3GMNB 3T65A 5DYOB 5DHXB 1LQVA 3OAUH 4U1GB 5CBEA 5JW4N 4F33A 3CFJA 4PUBL 4Z7WB 3RGVD 4HZAA 4LSVL 2ZG1A 5IQ7L 3F12A 5HPMA 1P1ZA 2EYTA 4NQCA 2F54A 3ULVH 4NKMB 1L0XA 4BJLA 2XQYG 1VSCA 1ZWIB 2VN4A 2NTFA 3GRWH 4Z7NE 1T1XA 2DYPB 1TNNA 2DQUL 3MFGB 2AJ3B 1U6AH 4WUUE 4A2MA 2VH5H 5D4QA 4UT6H 4Y88A 4XTRC 5DSCA 5JHDD 3QRGH 1GC1C 1K4DB 3MRBB 4OSUL 2J8UB 1Z5LA 4Q9RL 3ES6B 2CLRB 4H1LG 4I48B 4L8SC 1QRNB 4PJAB 5HHQB 3DWTA 5FDWB 3QDMA 2D7NA 4JR9L 3FN0H 4XNZB 4MXQA 1KFAH 5EZLA 4U1SA 4LCWE 4Y8AA 2PYEB 4ZFGL 4PRID 2HJKB 4Z77B 3MUHL 1RFDH 4XCFH 1WAAE 1NEZB 4PJ8A 1CXLA 4G6JL 3JWNC 4XBEH 3UC0H 5DJDA 1FFOB 3ZYOA 4QEGA 5FM8A 3SCMC 4NRZB 4C83A 4I3SH 5FOJA 3WIHL 2Z31C 4HXBL 1JUFA 3T3ME 4RFNB 3M1BA 5DUBA 4L3EE 5L9DH 4HJ0D 3U30C 1ONQB 3W0WB 4YBLC 4TVPE 4G6JH 2CRIA 2X89D 1T89C 2ZNWA 1INDL 1RU9H 2A73A 2NXZD 2PW2B 2VLRD 4P9ML 1N3NB 5GS0L 3TF7C 3KYAA 4EUPB 4G80B 4E0RA 5HHOA 1J0KA 4KI5C 2ITCA 1Q9LA 5ERWB 3O8XD 4K94L 5I1CL 3F7PC 3NA4A 5IR1A 2V5TA 3NGBC 5L2KB 2HRPL 4UMGA 1C5CH 4YUEH 4BZ2H 3RQ3A 2P7TB 3SDCD 1G7MA 1OAYH 4LLUB 3TH3T 4BZ1H 1GZPA 3WFHB 2Z4QB 4Y4HA 5H35B 3W39A 1MREH 4F9PA 4OUUA 2EYRB 4KU1A 4ZPTA 3MGTB 1R24A 5DD5L 1G1CA 4FQLL 1VERA 1PFCA 3DETD 1ZSDA 4Z95H 2YK1H 1OAYL 4U3XA 1FL6A 1AXSA 3QXDA 2E27L 3AMLA 4P23C 4RRPA 4L3CB 4MHHI 2Q76B 4PGCB 4JDTL 3TCLA 3B8YA 4U31A 5ISZA 4U6VH 2BVOB 3WFZA 1UM4L 2C3XA 4AEHL 2C1OA 3ZKQD 1R5WA 1QBBA 4MJ2A 2C7UB 5FO8A 4ZS6C 5JXEC 4N9OB 1F11B 4LIQL 4R7NB 1Y0LB 4TSCL 3VH8G 2X4UB 3S3PA 3EOTH 2YSSB 2WUBL 1FGVL 2GITB 5EIVA 4JKPH 3WUWG 2IQ9L 1N0XL 5FYKH 4Y5YB 1AGEA 2HFEA 5D1QD 5DJXA 2HN7A 4RGMB 1D6EA 4KHTH 3T0VA 4JO4L 4YK4B 5T1DL 5TFSL 3F7QA 5F7LB 4FQHA 1P6FA 1EEUA 3D2UB 3H7BA 3S35L 3Q3GB 4JPWH 4RFEA 2AEWA 3VD5A 3QHFH 3RA7L 2V17L 1M7IB 1Y6KR 1CFQA 3L7FB 4TYUA 3UPCA 4F9LA 1IM3B 1JNJA 4XNUL 3TO4B 2AK1H 2B4CL 3IU3A 3WNNA 1WAAA 1F3JB 1IVLA 3AB0B 3VXME 4UT6L 3S88H 2QHLA 4O5LH 5IK3B 3LVEA 1QSFA 4V1DE 1OB1A 4DWHA 1Q38A 2AKRB 3OBAA 1X7QB 4R4NC 5FCUL 4JLRB 5ITBL 2IPKA 3PWLA 5EO0A 4ENEC 4X4YA 5KSAD 3PUCA 2OJZL 1ZAGA 3QHFL 1BLNB 4JRXE 3OB0K 3VRJB 2OTUA 5E94A 4WU5A 5CMAB 1W72A 1KYOJ 1OP5K 5HGAB 4NQEE 5FCUH 5IT2L 4J6RL 1TJGL 2E6QA 4ELKB 1CTNA 1HQ4A 3CSGA 1U8PA 3W9EA 3MMEB 3UPAA 2DMCA 3EYVA 1IGFL 4FZ8L 3OR6B 1WUNT 4CN4A 3MLTA 5I18H 3O8XC 4PJBA 3RP1A 1X5GA 3IDYC 5F72S 4N1CA 1A7QH 2PYFB 1IKNC 3ARWA 4AIZA 5FUCE 4JPIA 1VFMA 4Y5XB 2AABH 2FIKB 1SYSA 3BP6A 4UZGA 1EHAA 4PG2A 4X7SL 1ZXQA 3TBWA 4EI5B 1V05A 2DM7A 3MCLH 1YEDB 3BEVA 3TBVA 3MZGB 4K23L 2YRPA 3QIWC 1NC4D 1OCWL 4LLVA 4LHQB 1GOGA 4ESKA 3DETC 4QOKD 4ZFOL 4YIQA 5DEGB 4ZFFB 1EVUA 1EH9A 3WKML 4GUPA 3ARBD 1QR4A 3JTTB 3QEGL 1QFPA 1KIQB 1SBSL 5C09E 4BSWB 5A3ID 3GJFB 2ZOKA 1XGTA 4JN2A 1AGDA 3K8KA 4OF5A 2OK0L 4NM8H 4Z7OF 1ZHBA 5DDHA 1OCWH 1JV5A 2MSPA 4Z0XB 4OGYH 2NY3C 5MERB 2VYRE 1F4HA 4YHNB 3UTPD 4YHOL 1ITCA 1ZT1A 4UTAL 1BECA 3SKUD 5KN5B 1FGNH 4JB9H 5J12C 3CX2A 2J7LA 3P0YH 5T3ZD 3DMMC 2P8PB 1T20A 2IAMB 3FB7B 4JPVH 3RGVC 5KVFL 1MJ7L 2UYLB 2Y06L 1E6OH 4BSWA 3GSOB 2J2ZA 3ZHKA 1FC2D 4UT9L 1J8HE 4HJGA 4KTDL 1RUML 4OCMC 3ULSA 1X5LA 5K33A 4TRPL 4QHUA 4I0PC 3LCYA 1JJUA 5ACLA 2SEBB 1CLCA 1BF8A 2YPLA 5INDB 4JFED 4U1KA 1MI5A 2IALB 5BCAA 5JORA 3AAZB 3NCJL 3ARQA 1IC4H 2XKSA 3RKPA 1UM6L 1YEDA 4JFPA 3F58H 3BRDA 3RWIA 3OX8B 2R1XA 2FHBA 3HNVL 3SE4A 3ILQC 3UJJH 3QO0B 2VLRA 1ZK9A 4OCWL 4XP1H 5CEZL 2A2QT 3C60C 4FQJL 4IJ3C 3DUSB 1JWMA 2WBJB 5A2LH 3BPNC 3SGJA 1RIVL 5EC1B 4K3HA 2VZ3A 3MC0A 4PJDE 1N4XL 3SPVA 2JJTC 3IDNB 4OKVA 3LAFA 5C0JB 2V2TA 3HFML 1TQBB 3HE6D 5HYFA 1BVLA 1AHWA 1U8PB 1HQ4B 3W9EB 1ZOXA 1XIWD 2ESVB 3CDFA 5FF6A 4ONHA 2VDPL 4WU5B 1KEMH 4JHAL 4HW6A 4PP1C 2D03H 2I9LB 2XKNB 2APBA 3VXSB 4PFEA 4XX1E 4QOKE 4G6FD 4XPFH 2FEDD 1X4XA 4OF3A 1YNTB 1YJDH 3BIBX 3VXUE 2X4PB 1RJLB 1RZJL 3HUJE 4Y4KD 1OY3B 5IK3A 4JHBA 4P5TB 5CEZD 2OTWB 3W11C 1FO0H 4L5FH 1F00I 1IEBA 4Y2DB 3TO4A 4HCRA 1IM3A 1EFXD 4Y16A 2GSIA 5FGBC 4DGVH 5E8PB 3QAZB 4KK5C 1QFHA 3LOWA 5K59E 4FQQB 4PGDA 1E4XI 4J1UB 3GHBL 3KYKL 4GRWH 4BM7A 4TTDD 1VGKB 1AJ7H 3RNQA 5B3JF 1OGAE 4FABH 5I1DA 3GSQB 1PX3A 2Y07L 2HFEB 5T1MB 3I50L 1IZJA 1CLOH 1FYTB 3VG9C 4YZFE 2I60H 4RGOH 4FZEH 3T08A 1KB9J 1HHKB 3U4AA 2QQKL 2XV6B 2WINB 3FQNB 3CXDH 3D6GA 3FB8B 4KJWC 2VDOL 4K3JL 1OAQH 3AS1A 3LKQA 1HWHB 2I60L 2X1PA 4PGCA 2VXQH 1KELH 3CFKA 3I6GA 2EDWA 2GTWA 3TYFA 3VCLB 3IDIA 3QDJE 2Z9TA 2UVFA 5HD8C 4OZGE 2ESVD 3BWAA 4PY8I 1AXSB 1XF1A 5IGXL 5C9KA 3K81A 4GXUM 3MGTA 1F4YH 3LRSA 1N5YL 2O5XH 1FRGH 3ALXA 3NGBB 3ZDZE 4OZIB 1B4JH 2PTUA 1YYMH 4H0GA 3TFKC 5AG9A 4WEMB 4CVWA 4NSKB 3OXSB 1CD1B 4HXAH 3FQUB 2EDXA 1FNFA 2P7TA 1ORSB 3FTGA 5I1LA 1N5YH 1JGVH 4FRWA 1A6PA 4NNYB 3TM6A 3S37L 2X4TA 4UILH 3NN8A 2BDNH 2R2HA 3GJFK 5L2KA 3L5WB 5EU4B 4LRIC 3L3JA 2QTEA 4OF0A 1L7TH 1QLFA 3V95A 2B5IB 3HAEG 5C7XL 1KC5L 2X4QB 3S35X 3P4LA 1ACYL 1UZ6E 2HT4D 3BGFB 4P0DA 3UPRB 1MNUL 2F9BT 3VXMB 1CXEA 4JY5H 1MCKA 4JDZB 4ONFL 1NC2B 3EOBA 5I66A 2A6DA 3MROB 1I9IL 4OLXH 1CK0H 3VXUA 1JUFB 1NGXA 1T2QL 43CAB 4B50A 2DIJA 5D7JC 4NRZA 4LGSB 1AI1H 3RHWK 1FFOA 1OAZL 2CXKA 1U8KB 3UBXG 4F2MB 1FFRA 2P47B 3RKDD 3BH9B 1ND0A 5K93A 3DO7A 1K5NB 1LDSA 4K7FA 1VACB 3D3VA 4U1LB 5T3XD 5SWQB 1DBJL 2P5WB 4UQ2B 3B5TA 3M17A 3MXWL 3SDXF 5ADOH 3G9AB 1DLFL 2A74A 2G5BB 1XFPA 2EDRA 2YRZA 2NY1B 3DX9A 3BKML 1RUPH 4LKCB 1KYOK 5HHXL 1RULL 1DQJB 3V6ZB 1N6QH 4JFFE 2JTDA 5DSCB 1T5WA 4L5FL 5F7MC 2G5BA 2GIYA 2VZTA 3CDGB 2XPGB 2VE6B 5GGUA 5L9DL 1U91A 1MCNA 1IBGL 2CGRH 1P1ZB 1DVFA 4GS7C 3MRNB 3MJ9A 4F15B 2IANE 1I7RB 5FYJH 5ECJE 5KJRL 2NR6D 3O6ML 4MVBA 4RAHA 2A6DB 5DYOA 3GMNA 3T65B 3CH8A 5JNYA 4M8VA 2WM0A 1ZLSH 3VXMA 1J5OL 3CIQA 1YN7A 3T3PF 5JHLL 5JPNB 2GYSA 1ZS8B 2J5LC 5JQ6L 1QLFB 4IRZH 4UV7L 4M6ML 4NZRH 5EU4A 3GSWA 4OF6A 1ETZA 4NUGL 4LMQI 3WNKA 5C0NC 3FQTA 2P4AB 4NNYA 3KPOA 4OLEA 4S1DD 1ORSA 3CMOH 3FTGB 4MNQA 2GJ6E 1N0LA 3CUPB 4MZ3A 3WFDL 3GFUA 1TETH 1KCVH 2VIRB 3KPRA 3V7MA 4Z7NF 1FN4B 1ADQH 3VFPA 2DBLL 3WHXA 5MEOB 1Z9LA 3FQRB 4Z7WE 4WU7B 2VZ1A 4JM4L 3MUGB 1B4RA 4ZS6D 3QRGL 1DBAL 1U0QA 4M1DL 3NCYS 3WEXB 3DBXB 4OV5B 4F37F 1YDPB 5EULV 5KVDL 1R3JB 5A16A 1VGEH 5HHOE 4YGVA 4F7TB 4RMWA 3KPRE 4OFYA 1RAMA 3TYFB 4F9LC 2GTWB 1XIWB 3CFBB 3EYQC 4X4ME 2CK0H 2X4SB 4HIXL 4M00A 2AQ1A 1N59A 2WWKO 3P4MB 2LU4A 1L7TL 2DQHL 4FQPA 2YC1B 2OX5A 4X80L 4ZSOA 2EDEA 3FB8A 4J4PA 3F7VB 1CGSL 2GFBA 3MBED 4PP1D 3PWUA 1Z6JT 1HHKA 2BERA 4I3SL 2HLAA 2EC8A 1YC7A 5C0EB 4PP2B 3UBXI 4NO5B 1NEZG 5ITBH 4DTGL 5F6HJ 3PG2A 4ZOEA 3ZSTA 3RL2A 5I1DB 4WI4A 5GSRA 3N1GC 4GQ9H 4JZJA 3S88L 5I30L 4PP2A 3KPLA 4NPYB 1TPXC 2Y5TB 4J1UA 1A9EA 4HAFA 3GSVA 4GLRH 3W11D 3BHBB 2ICCA 4G8FB 5DFVD 4QRPA 4JJHA 1I8MA 4NN6B 3KS0J 3W0WE 4HSQA 1EK3A 4Y2DA 3QXAB 4IBLT 5CCKH 5DRXB 3MBEC 4HGKC 4KMTL 3JV0A 3QB7C 4GBXC 1R3JA 1H3VA 4XPTL 3U7WL 1RJLA 4WVRA 4EQ2A 3LEYL 4HEME 4ONGL 5I2IA 4EUPH 3IXAA 1MFDH 2V6HA 3RJDA 1P2CA 2ESVA 4MD4A 3FAXA 3LEYH 2X44D 3QCVL 1FFPB 3BIAX 5EBGA 2AEIT 4N0UA 3DECA 1IFHL 4OKDA 2HFGL 5C0GA 3EFFA 2FCBA 1LEIB 4JCLA 4X6EB 2FLBT 1F6LL 2EYSB 4JFHE 4PG9A 3ME0A 2O5YH 2WUBH 4R0LC 3MA7B 1F02I 2JE8A 3J7HA 1J1PL 4D0DB 5ABDE 1FZMB 1NGYB 2AEPL 4P2QE 1F6AA 3SHSA 3C9NA 2JJSC 1IFHH 1N6VA 3ARBB 3QUZB 1BJ8A 1MEXL 2ZUVA 3PL6B 2C4FU 2NY3D 1YEKH 2R1XB 3QWOA 4NHCL 4XNXL 3QXWA 4HKJA 2OJEA 1PG7H 5CBAB 1I1AA 3HI6H 5FHBL 1M05A 2BRRL 4J3WA 5E4IA 2IALA 5C09D 4JB9L 2LQRA 3X3GH 4NM8L 3WXVH 4FQXD 2CMRH 1UQSB 5FM5M 4JG0L 1XZ0A 4MCZA 5CZXC 4HJGB 2FDBP 1CICB 1UCTA 3KYOB 5GSVB 1S7RB 1R3KA 3RA7H 4Q9CA 4LP4A 1ZEAH 1Z3GH 2VXVH 4WTXA 5DC0A 4DK3A 1P4BL 2UYLA 3GJEA 4NHCH 3P9WB 1NMAH 3LZFL 5A2IH 4LSUL 1U8MB 2IAMA 3LKPA 4G42A 1GGTA 1DZBA 4O2CA 3CSBA 2HH0L 4OCSH 4OZGA 4E9LA 2KQNA 2D2OA 1A14L 1FJ1B 3QIBA 1RQ5A 1PZ5A 4XC3L 1T7XA 3CFDA 1QHPA 3FHQA 4U1LA 1N64L 3RWHB 5IB5A 1JV5B 4Z0XA 3QWRA 3L1OH 1CE6A 3U7YL 2AVGA 1U8KA 3ROLA 1S7XA 5JZ7D 4DN4H 3MOAH 3W9DA 2J4WL 1KBGH 3QCUL 3RVUD 3ILPA 2WK2A 5I9QC 5I66B 1AQDB 4JFZL 4L3EA 1CGYA 4N0CD 5F8RC 4YPGA 2A38A 1QG3A 2P8LA 4EN3C 2NY0C 3G5XA 4Q6IA 5C8JA 1S7WB 4HC1H 1B6UA 4LLVB 3TCXA 1WSST 1N7ML 2VDKL 3GMOB 4MVBD 5F97E 3L3JB 2Q8AL 2EIBA 5J89A 3SDXA 1A7PL 2VL4A 5EH1A 3SGEI 3JWOC 5FUZH 2X4RB 2XWTB 4NKIH 4OCRH 2FO4B 3QHTC 4RSVA 1SYSB 4F7PA 3FAWA 4P5KB 5DD1H 3FQUA 1Q8MA 4AIZB 5IFAL 5BO1L 1MCEA 4Z76A 4YQXH 4KTEL 3MFFA 2JJUA 2CRZA 5CSZA 1T1WA 3NACH 5CAYB 4OZIA 4OCNC 4J3OC 4JGJA 2M8XA 4QRTA 3OR6A 4G3YL 4YFLI 4C4KT 1CI5A 2GJ6A 4XVTL 3MMEA 4U3HA 2BHZA 3BWAB 4PJCE 3BMVA 2VERN 4Y19B 1SEQL 5D8JL 4LDOB 2QR0B 3EKCA 3I6GB 2AJUH 3CFKB 1QEWA 5IBUG 2OTUB 1S9YB 3VRJA 3BAEL 3X13B 3QA3A 4BQ6A 3TT1H 3IU4L 4L1DA 1INEH 1QKZH 3RHWF 3FOMB 3PV6B 1JFQL 3FQNA 5E5UB 2R29H 3SGDH 4L4TB 4M61B 5L8LB 4LRNH 2FATL 2DLGA 4X5LA 1U8LA 2ZJSH 1T22B 1FYTA 4KGJA 4Y7MA 3SBWC 1A3QA 1CQYA 1F3JA 5EC2B 1CFTA 3VFMB 3L9RA 4J4PD 3RNQB 1AE6H 5IFHH 1CFQB 1TFHA 3HZVA 2MHAA 1JPGA 4HX1B 2UWEF 3LDBB 1F2QA 1C5DB 4FQQA 3WSQL 4KVNH 3V6OC 2BCKB 1U8IB 1GGCH 3UYRL 4Z7VA 5E6ID 3UJJL 3QT2A 4HGMA 4X83A 5TPWH 3P9MA 2OI9C 5AWNH 1JGUH 3BDXA 1I3GL 4PJCF 7CGTA 1KB5B 4HWUA 3SKNA 1KN4L 1TJIH 3GRWL 4NFCA 3FOMA 5IJKC 4R97B 3RGHA 4ZFZB 1R5WB 3LV3A 2I9LA 2BNQB 4XPBL 1HNGA 4OGXH 1MHCA 4LU5H 4LPWA 4KKBD 1K6QH 3VWJB 1FBIL 3NCCB 5FOBA 5FKAB 3OJMB 4HWBL 4Y19A 3NFSH 2VISA 3JZ7A 3QQ9C 4O2EA 4NQDD 3BD3A 4NZRL 2CKBL 4NCC2 5AWNL 1F58L 4P46D 1QFWH 1BVLB 3S97C 3MRJB 1QBAA 3L5XL 2QQQA 4FQXC 2UVEA 1U3YA 2DQTL 2IADB 4OI7A 3AY4A 2E7CA 4MMZC 4PJEB 5J13B 2EH7L 3GKWH 4M8QA 3IT8D 2YA2A 1T1WB 4PJ9A 4LLUA 2V5YA 3B5HA 3U4BL 4M5ZH 3S36L 4LLAA 4XCFL 4PRIA 3V5KB 4PJBE 1NGZB 1AIFB 1CGVA 1TTGA 4XVUC 1BFOB 3RZCA 2VLRB 1UKQA 4PJFE 5DJAB 3JV5A 1FL5B 5FYKD 2YEZB 3BFOA 2CKBH 3SDXB 3WNOA 4W4NA 1LHZA 4OLVL 1IGYB 4U6HB 3PWPD 2DM4A 4U1KB 5INDA 1FPTH 4G80A 3G5XB 1WWCA 1B0RA 5E95B 1HIML 4UNVA 4M7ZB 1TMCA 1KSRA 1AQDA 1I85A 2ADGB 1MAML 2QADC 1RI8A 3ILPB 5T3ZH 2DLFL 4X98A 3OKDB 3E0GA 5IMLB 4XMLH 3DI3B 5DUPH 3ZKNC 1KJVB 2VXTH 4CAGA 3QDJA 3ARDB 4OQTL 4Z7VE 3WO4B 5DJYA 4Z77A 1EUTA 3HC3H 4OAWB 5E6IC 4WNQA 4ZUTA 4YGAB 4NQEA 5CHNB 1DBMH 5FGRA 2YMXL 3TT1L 4XVUD 3RX8A 4KJPD 3V52H 3A6BH 5HHQA 3ILQD 4MJ4A 3RWCA 1HZHL 3JWDH 5BOZG 2J8UA 5E2VL 4O2CB 3O9WA 2OSLA 1CVSC 2JKXA 3CVHA 2ERJB 3TJEL 3ZL4H 4L3AA 4ISVB 2PO6C 2ZOKB 4JN2B 1QBML 4FFZH 4J3SA 1R3KB 4YWGH 1KF9B 1AXTL 5GSVA 4LPCA 1WVZA 5M95B 1RZ7L 4NRXA 2NTFB 1XZ0B 4MCZB 3LIZH 1LEKB 4KZDH 1JBJA 4NQCB 1UQSA 5TH2A 1AO7E 1K8IB 5IVXB 1AFVL 3LB6C 2NY6B 2GJZB 1R0AL 3WIIH 2FZ3A 1YEHH 2OJEB 2QEJA 4Z0BH 3CFJB 2AI0H 2C9AA 1WZKA 3T0EA 4D94A 3VFWA 1U95B 1UZ6F 3ARFC 1JGUL 3FONA 4GT7A 4XH2A 2OR9H 3OAZH 5FO9B 3C09C 25C8H 3WDHA 1WC7B 4O51A 3H3PL 3CXHJ 3QZWB 5IV2A 3EGSA 4JPIB 3P30H 3P0GB 3IF1B 3WV0A 1G1YA 3ULUC 1LO2L 2H9GB 1T21B 2F53B 4P2OD 4XPBH 4X6EA 3W5MA 4NQDB 4XPHH 3HNSH 3KPMB 25C8L 2YN3A 2HVKB 3FFCD 4XB7A 2PW1B 4H88L 1UYWL 3F6LA 4XP9L 4M7JL 4PLJD 1HKLL 2ILLA 4JQXA 1QSFD 2WWMC 2IGFH 3RAJL 5I0DA 5BQ7B 2IANA 2AK1L 2EZ0D 2IMNA 4Q97A 4UV4H 1GGUA 5L7XH 4ZAKC 4JQVC 1A6WH 3OAUL 4LBEB 3QIUC 2BRRH 4W6YB 4LASL 4WW1A 1J12A 2BNRA 2Y72A 5E94B 4LSVH 1EGJH 1LO0L 1L6ZA 2ARJQ 5T1LB 4L8BB 4AL8L 1CXKA 1FLRH 4NHUA 1BQHA 3O4OB 4LASH 3IRZA 2IH3B 5KSAC 4LCIH 1IQDA 4L4VA 2L4OA 4NT6B 3WJJA 3GK8L 3QNYB 4P5TC 3OJDB 4QRPB 1JHKL 4ZQKB 3L7FA 1H9VA 2P5EB 4GW1B 2GI7A 4WEBH 3R4DA 5EG6C 4RWYH 3WLBB 1YY8B 5K9QI 4R4BB 3BZEB 4I13B 5J0BA 4EZMA 1RZFL 1CL7H 1FZOA 1MLCB 2RFXA 4I0CC 3GKZA 4ALAH 4JZJB 3QUXD 4HLZG 2R0ZH 32C2A 3GGWB 5EU7E 1ZMYA 1DUZA 5DEFA 3SGKC 5DUPL 4FTVB 3TYGL 1NC4A 4ZXBC 1QNZL 4H20H 2HLAB 4RX4D 4PJIA 1BFVL 2YD6A 1HILA 4R4FH 4AG4L 3K3QA 4KUCF 2VDNL 1JN6A 2C1OB 3NFNB 2BVOA 4K94H 1TZIA 1KIRB 2VL5B 4H20L 1UXSB 1TJGH 2OK0H 2UUDH 1YNLH 4LHUD 4L3CA 1XIWA 1JWUB 5LXGH 1DQQA 1OHQA 2WUCH 5CEXA 4YGVB 3RDTC 2HFFB 5BRZE 1EEYA 1QO3B 1RZGB 2KKQA 5F96L 4HDIA 4XP5H 1KCUL 4PBXA 5IVNA 3GRWA 1MWAB 5TDOA 3BKYH 3MUGA 3T4AB 1EAJA 4Y4HB 5H35A 1KPUA 1GZPB 5KS9E 4OQTA 3VFPB 4M9OA 4U49A 1A6ZA 3VGAC 4YHOH 3GBNH 2JCCF 1VB9A 4GJTB 5CILL 3UTTA 3BO8B 2CR3A 5KVDH 1SMAA 5F89A 5IG7A 1WWWX 3TVMC 1G7JB 5DT1H 5HHME 1JGEA 4HUUA 1P7KB 1RZJC 2G9HA 1MJ7H 1Q9LB 3F8UB 4HMDA 5C0FB 5EOQL 3WJLA 1IGIH 5J56B 2VXVL 3DIFB 1ZTXH 1YN7B 3TFKD 4QHKJ 2VJXA 1N3NA 3MOQA 4LIQH 2JB6A 1UJ3A 2CMRL 4P4KB 5J4MA 5GS2D 2R0KH 4QTHA 4U6VL 1UEYA 3M1BB 3OGCA 5BS0E 4DOHE 5I30H 4PIRF 2NXZC 4XAKD 1MFAL 3BZDA 4XBGA 4E42A 3QUYB 3CGTA 3QUMA 5J11B 3IJHA 4ZDHA 4ODWA 5DRZA 3EFDH 4H8WH 1ZLWH 4Y1AE 3PQYD 1PY9A 4WWKC 1LO4H 4FFWC 4NO0B 4HT1H 3KPRD 1OTUD 2IBBA 2HYMA 3QDMD 1IKFL 2VLKA 3QP3A 2CDGA 3QDMB 4K8RD 1JF5A 4YDKH 4QXUL 1CDIA 5D2NB 5E2JA 3WFBH 1G0XA 1E6OL 1DQJA 1K4DA 1RK0B 5ADPL 1NBVL 5CJOH 2NY4B 2ZZUT 2A74B 4TUOA 4QTIL 4F8QA 5LGHH 3UO1L 5EIIA 4M43L 2P5WA 4J2XA 4RMSA 1U3HD 3WFBL 5J3HD 1X5FA 3Q5TA 1VACA 1A9BA 1W8OA 5MI0B 4MB4A 2X1XR 1JP5A 3KAAA 3L3DB 1K2DB 3F12B 1EEZB 4JVPA 4FZ8H 1IGFH 1E28B 1J05A 4L9LB 1B0GA 43CAA 1U8HB 5CBEB 1TLKA 4MS8C 3SN6N 5L2JB 1NC2A 3EOBB 2BHUA 3MUY1 3BDYH 4QY8B 1AY1H 1QYGH 2OP4L 3BPLC 4LPXA 2WANA 1XR9A 1KULA 3CC5A 1TZGL 4PBVC 1UFUA 5D1ZC 4IRSA 2G60L 3ESUF 5E2TL 4OZHA 3I50H 5F3BB 2FEDC 3QI9A 3PHOA 4GKNA 3VI4F 2X4TB 1GL4B 4YZFF 5JTWA 3SE4C 4HKZB 3DVFA 4K23H 1NH6A 2AJSL 5HDBF 4JHWL 1ZLVK 3E2HB 1OD9A 1OAQL 1DR9A 3C6LD 3N85H 1I7TA 4KRPC 3QEGH 4IIQA 2QQKH 1YZZA 2EC9U 3OKYA 3FRUA 3SE3A 5GRWA 3HI1A 5EBMB 3RUGB 1HI6B 3OKKA 4RGNB 2PCPB 4HGWA 4OF8A 1H5BB 5I8OL 3KJ6H 2W38A 2Q8BH 3VFOB 3VCLA 3IDMA 4RGMC 2NY2C 3ARGA 4KVNL 2VLMD 1WCBB 5IM7B 3DSFH 2NZ9D 4K3GA 4Y5YC 5D1XD 1YPZE 3QPXH 4KC3B 1EFQA 4EIZC 1T7YA 1JNNH 5IVZB 3B83A 4LFHG 2UWEE 3R8QA 1RHHB 2DIAA 2O5XL 4XC3H 2PXYD 5IKCA 3SDCB 5IEHB 3AREC 5I1JL 1CQKA 3HPLA 3DSFL 3OR7B 5T1MA 2AJYL 4OI8A 5EBLA 5FV2A 5DFWH 1I1YB 1NSNL 3HLAB 3D25A 3W2DH 4G8IB 1T1ZB 1IGCL 2BSRA 3TVMD 4Y1AB 1I1AD 4ONFH 1N7MH 3GEWB 3FO0L 3U36A 3KS0H 5DK0B 3V0WH 4P4KC 1ACYH 2EO1A 43C9A 3DURA 5F9AC 3WO3B 1KGCD 5IGXH 3F5WB 3LEXB 2VQ1A 1QLRB 1AQKH 2HP4A 5D9SA 1PW3A 4DW2L 3UP1A 1RJYB 2X4PA 4JM2D 2ZUSA 3D0VA 4UI2A 2EE9A 3SDDA 3O41A 2D4FA 4FHBD 3VXSA 5I1IL 3D0LB 2AXFA 4QHLB 4KQ4H 5IFAH 4XP4H 1JK8B 2ITDA 2YUZA 2V7HB 4PJFA 2VZVA 2Z35B 4U3CA 4PJ5B 5IBTH 4K9EH 5CJ5A 3RWFB 3P9LB 3QFJD 1NMCB 3E3QC 1EPFA 3IFNH 3I9GH 1OP9A 4YBLB 4JDVB 4ORGA 3VMPA 3ARFB 2V2TB 3QEQE 4R6UA 1FCCA 2ICWA 3HE7B 2Z31B 1CDGA 2B2XH 2DWDB 4LLQA 3DX7A 3MV7B 5MP6H 3V4PH 3L3OB 4YFDB 2HKFH 1I8LA 1DEEB 4MHHG 4FFEX 5FA4B 3MA9H 1OWWA 3B9VA 1JWMB 2WBJA 3D2UD 5IMOB 4OB5H 1OQXA 2FJFA 4HUXB 1YUHB 1RZJH 4C56D 2IH1B 2GSGA 3VI3F 2YA0A 1G6VK 3QNZB 1LQSR 1FO0L 4PS4H 3B6SA 1BQSA 4UQ3B 5E1AA 2EE3A 1BBJA 2ZUWA 4YXLL 4LCUB 5JORB 1MI5B 4PTUB 3KYNA 3A6BL 4JVUA 2N1KA 2YWZA 1NUDA 1H3PL 5EZJB 4QHUB 3AXLA 1Q9OB 4Y2DD 2YPKB 2Z92A 5BW7A 3O3DB 3P77B 1XGPA 3G04A 3GSOA 1WAAF 2BXZA 4HCRH 1FVCB 1PVHA 3B9AA 1A4JA 1CFSA 3STLA 1XF2A 4XVJL 4OLYH 5E0QA 2B7DT 1LNUB 4OZFH 1YC8A 3U9UA 3U1SL 4JO2L 3RY6C 2NW2B 5C2BL 3TO4D 3G6JE 2IFGA 5IW6A 1BJ1J 4U1GC 2E7LE 2BK8A 2GTZB 2CGRL 1U9KA 4X8XA 4G6ML 5MERA 5C08B 2ZUXA 5IQ7H 3ULVD 2EXWD 1IAMA 4K7PL 2N56A 2GUOA 1G7QA 1YPZB 3OWEA 4L29B 1ZHBB 4YO0B 5DDHB 2DLTA 1W8NA 1I9RL 2YUVA 5I0ZA 2LAGB 4LSPL 3QIUB 1MCQA 1P69B 1L6XA 3RWJB 1WV7T 4DGYH 5L8KB 5KSVB 4MWFA 3B9EA 2EH7H 1UB5A 4HWZB 3STZA 1KIQA 2DTML 2XN9D 3CDYA 4N0RA 1U93B 2VXQL 4TSBH 4PJEF 2DN7A 1JF1B 4RIRA 3JTTA 2CLVB 3FMGL 5CIPB 2D0GA 3MV9B 3PL6D 3U48A 4NKOB 4JY6A 3MV9D 3GI8L 2EIDA 2AEQL 1NFDB 5DVOA 3SDYH 2ZSWB 4PJEE 1OGTB 5MEQA 2CKNA 4FN0A 3O3BA 3TBVB 4OIAA 5ILTL 1X5HA 3QG7H 3JXAA 4XCYB 1X5XA 4KI5F 1A2YA 4DW2H 4GW5B 4X6DF 3HC4L 4Y5XA 4G9FB 3ARPA 3C8KA 3TIEB 2BY1A 3P2TA 1CLZH 4JPWL 2X5PA 4NQVA 3U6RA 3LKNA 4QRPD 4PJBB 3MZTA 3N50A 4Q9QH 5K9JH 3VFNA 2C3GA 3OSKA 4F7CB 1V7NH 3MLTB 4KKLD 4PJIE 12E8L 4G7YH 5B4MD 3PP3H 1GIGL 5ICYA 2PUQT 4PV9B 3PDOA 2AS5M 1L7IL 1QFWI 2J88H 3BDBA 4ELKA 2CK0L 3VJ6B 4YAQA 2PO6B 3QEQB 1Z2KA 5J9PA 3PWNB 1OT1A 4RWYL 4NP4L 4WUUD 5D96C 3RVVD 1W72B 5CGYC 2CJUL 3VWKB 4GAYA 1KJ2B 3O3AB 1BLNA 3EAKA 1T2JA 3ZKND 1Q9KA 2HKFL 1NLBH 3BEWB 1IAIL 1CDCA 5JOEA 1YN6B 4X9FA 2BY0A 2IG2H 5TE7L 3O6FC 5IBLD 1IQWH 5JXAL 1EHXA 3RWEA 5HYJA 4MD5B 1QSFB 3ARGD 2XN9B 1HOCA 1CD8A 3CSYB 5C2UB 3O0RL 1KCSH 1GZQB 4H26B 3ZT6A 2X09A 3MRRA 4PY8J 4U1HB 1H5BC 5D1XA 4IS6A 2Y6SD 3DXAD 2D0FA 5TDNB 1V8HA 3C5ZB 3PGDA 2XOTA 3WD5L 5IP4A 1WEJH 4IOFC 2VLJB 1TJHL 3S37X 1KCKA 1JFMA 3NZ8B 3HAEA 3KJ4B 1NGPH 3VFTB 3SGKA 1IMHC 5FYLD 1HCVA 1BOGA 4RAUB 4P57A 3LQZA 4AK1A 4F58L 4GKZB 3SGEH 2CIIB 4Y5YA 4FQ2L 3GSXA 4UIMB 2AI0L 1TZHA 4X7TB 2X4UA 1H0DB 1Y0LA 1FVDA 2X70B 3RPIB 1MIMH 2C7UA 4G6KL 3QZWG 5FO8B 5CS7A 5INCB 5EO1A 3HZKB 5BV7H 5DR5L 3UMTA 5JQ6H 4CMMB 3TCLB 3SGJC 4PRHB 4ZUWA 3KHOA 4PRAB 5B8CA 4LSDA 2V2WB 1T3FA 1C08B 4MXVE 5EWIH 3FL7A 1CBVH 1S78C 2VDRL 3S4SA 2MNUA 4P49A 4R96A 2EYRA 4ZPTB 3HPJA 1E27A 4OUUB 5T1DH 5TFSH 4IMKC 4HPYL 2A1WH 2GY7B 3UTSE 3BPCA 3QJHB 1WFOA 2AEPH 1NLDL 3JTSB 3TIDB 3ZYZA 4MJ5B 1QVOA 4KDTC 1NEUA 1NAMH 4GXUN 5EWIL 1H3XA 4XP6L 4S2SB 4QGYA 4UTAH 2NQCA 4AH2B 2DWEA 4UOJA 1A14H 3BP4B 2MFNA 2VITA 5DFVC 15C8H 2EDNA 2J4WH 3QUXA 5HHVH 1RIUH 5C09A 5BOPA 2EKJA 4NZUL 4RA3A 5MHSE 4EQ3A 4G9DB 2VLJD 2Y1VA 2DS4A 4NUJB 4LSSL 4XCNA 2A73B 1BWWA 3N9GL 1FG9C 5EDXA 3EDKA 2YKLH 2VUOA 2VDKH 4O9HH 2FB4H 3W0WA 5I17A 2ZCKL 1R6VA 4Q7DA 4EN3A 1RZFH 1QSFE 1BFVH 3G5VB 2O5ZL 1QOKA 5LGHL 2NY2B 2F19H 2HTKC 3E8UL 3LSOB 3KPQA 4AQOA 5DJCB 3T77A 4RQQB 3U9PH 3MSPA 4KRLB 2HJKA 2VAAA 3ETBF 2LU7A 5BJTB 1ITBB 1HHIA 3UCRA 4HF5L 5HJ3A 2JCCE 3VW3L 4KRPB 2JIXD 3TBYB 2OZ4H 1DQDH 3BKCL 4XPGL 4WI6A 4JRXB 4XCEA 4X7SH 2GJ6D 4YFEA 5B39G 1HDMB 5JLZA 2PTVA 3UTTD 4P3CL 4AENA 2D3VA 3QH3A 1T1XB 4J7RA 4NM4L 1MFDL 2AQ2A 1HN1A 2EYTB 4LEXH 4KQ4L 5HPMB 3LD8B 4RFOL 4JRYE 1LO5A 3QSKB 1HHHA 1LMKA 2IQAB 4NJ9H 5CSBA 4OLUH 5KSBA 5HSFA 1FZKB 1MCRA 1T5XA 3JV6A 4K2UL 4PJHE 4ODUA 4M3JA 1ZHLB 3WL9B 4JAMB 5KANG 4Z78B 3L3HA 3G5YB 5DO2C 5FYKE 4JPKL 3TBTB 3S8WA 4NCDA 1CTOA 2A9ML 4BZ1L 2HMIC 3K1DA 1T2XA 4H5SA 2NY0B 2VLKD 2NNAB 1MCDA 4F7MA 1KCRL 2LFGA 3VXPA 1FSKB 4HLJA 1LE5B 1ED3B 4DFIA 5C08D 1WWAX 5DVKA 3FT2A 1CZ8L 1ZANL 4J12A 4LHUA 4TSAH 2IPUG 5F1OB 4LLYA 3H3KA 1DBKL 5BXFA 5BS0B 5EFIA 3SE3C 5DD0H 4KXZH 1A1NB 3GZKA 2ZSVB 4KI5D 1JGDB 2EZ0C 2UZYB 3BZFB 4KH2A 4YR6B 2DD8L 1P4BH 4PBWD 3SQOH 1IAOB 1ZHNB 2DJSA 4G5ZL 1DSFH 4YHIB 5DJ8B 4M43H 4WRLA 7FABL 1UXWB 2Q6WB 4YDVA 5C0IB 3UYPA 1FDLH 4A6YB 3TP4A 1W2KT 1NJ9B 3U1SH 3L3IA 4DUVA 1RUAH 4QF1A 1G6RA 3G6DL 4HIIB 1OAXL 2DQGL 1RZIB 1HWGB 3GMMB 1A1MA 3BIKA 4HV8B 1SY6L 3AM8A 3TFKA 1F90H 5T33L 3HFMH 3HN3A 2DICA 3RWDB 1KCGC 4M6AA 2B1HL 1NQBA 1M71B 2BP3A 2VLLB 5AG8A 2CXGA 4N5UA 3QEUB 3U0TB 3DV6A 2BSTA 2D0HA 1I3UA 3D39E 3ZKMC 1KEML 4JHAH 3VGAB 4XNQB 3ULUD 5AD0B 2PO6D 3QEQD 1FFNA 3S9DB 1S7TA 4JFFA 1DL7H 4JY5L 1QYGL 3EYOB 3GSNA 3WCYA 1T04B 4GW4A 1JNLL 3KR3H 2ZKHL 4R0LB 1QSEE 1A4KA 2MKLC 4GAJH 3S36X 4NKDA 2JJTA 4UTBH 3QDJD 3I9GL 5E56A 2E9IA 5C0BA 5C0RH 3RTQA 1N5AB 4PPTA 1AC0A 3B2VL 3PXHA 1FYHB 5TDPA 3RWDA 1IEAA 4XGZB 1JZ3A 2MCG1 3VRIA 2CSPA 3S96B 4Z18A 3CCHB 3BYYA 3I02B 3QISA 4MNHB 4NC1E 1T0PB 5EPMB 5FYLH 3DUUA 1NFDF 1D5ZA 4IRJA 5HGBA 2P5WD 5ID0A 5J06A 4JRYB 3T1FA 1A5FH 5GRVK 4MA3B 1U8NA 1F6FB 1QHOA 4NYLA 3UJTL 4GBXB 1QR1B 1U3JA 1VADA 4P2RA 2OS7A 4BQCA 4PG2C 4LARH 2AJZB 4XTRD 3OGOE 3BESR 3BUYB 5ICZB 5HYSA 4YXKL 2V2XB 4GRLD 4NN6C 4LFHD 2CH8A 1BAFH 3CVHL 3GBMH 4WCYH 4KZDL 3MRIA 3RX5A 3BZFA 4S0SD 1PQZA 3MNWA 3L5JA 1UB6B 4OQ1A 1TPXB 4BFGA 1S9VA 4MDJB 5BS0A 3SEPA 4LSRL 2AJYH 4RMRA 3EO0A 1ZKAA 4QXGH 5MEPB 3VH8A 5KW9H 1OTSD 1FGVH 2MOVA 4WFHE 5ID1A 4L8CB 3WD5H 4JN1L 1J0YA 3J8F7 3VXPB 4BFIB 4F7MB 2NYYC 4APQB 5C0CD 4PJFF 4APQD 2EDFA 1I8IB 3WE6A 3V0VA 1ZGLB 4GMTL 3FMGH 1LO3H 1X5JA 2FYYB 3TH4T 5AEAA 3QG6A 2BDNL 4F7EB 3B3IA 1WK0A 2XTJB 3HNTH 5I15H 1XIWC 3WL9A 1YEGL 5CUSL 5DVNA 4CNIB 7FABH 3INUL 1T5XB 1FZKA 3B4NA 3BRGC 2R0LL 5FB8B 5L8JB 1HINH 4CGTA 2XZAH 1BIIB 1MFCH 5F3HB 4OZIE 5E8EB 2QQLL 1MRFH 3DX8B 2B5IC 3HC4H 4KKAD 1PKQE 5I8CB 2B2XL 3MBXL 3QIBC 1JYNA 3WS3B 3IGAB 5K9QG 1PLGL 2M2DA 2OL3H 3MXVH 4ZD3L 4U1IB 3VWJC 4X6FA 3CPLB 1D5XA 1LO2H 5IB4B 3VXOA 3FQXA 1ZV5A 1F4AA 4ODXB 4P9MH 3WJLC 3NFPA 5EIQA 4R97C 4AEEA 3VFSA 2I9TB 5MEND 3L5HA 3EDJA 1RUQL 2LVEA 3A67H 3QDHA 4HULB 2PTTA 1NAKH 4GH7B 5DRNA 4HWNA 2VAAB 3O4LD 3ISWA 5IVXF 4PB9H 4CU7A 4MQXD 5C0DB 1CE1L 3DV4A 3P4NB 3M45A 4LHJB 4ELME 5KJRH 4XRCA 3QFJE 5GRJH 2ZCLH 5SWZA 3NCYP 3LPWA 2ZCHL 4L4VD 4PY7B 2J8UF 1UH3A 2N4IA 4N8CH 2ZNXA 2P44B 1YQVL 3ARDC 4HK0B 4NUJA 1U2CA 4M7LH 1MLBA 5IHLB 2VO5A 3T0DA 3MRDA 3ZKMD 3ZZ1A 5T3XE 5HHPB 4FXLA 5D2LA 5IB1A 2G75A 3CX5J 3EYFB 3PWPA 5I74B 3MV7D 1WGOA 5C6TL 4ODSL 3HMXA 1OAUL 3ZHLA 5JMOC 1C16A 4X9HA 4R9HA 3MQIA 2NLJA 3IJYB 5C86A 4KROD 2HKHH 4G8EA 5ICXA 4HG4J 3CVHH 3GBML 4S2SA 1J0IA 3QCTH 3JV4A 4M7KH 1J8KA 2DQFB 5GS3A 3FB5A 1QVOB 4WHDA 4MJ5A 1AP2A 4JM4H 4MDIB 3DHJA 2BVPA 4Y2DC 4PJ5D 1XAUA 2XXMB 3T2OA 4LSRH 1HZHH 4PV8B 3S4SB 5JIHA 1JWSB 1Q0XL 3TNNB 1OF2A 5HGDA 5DMJB 4XMKL 3KNBB 3DVGB 2G2RB 4PTTA 1NGQH 1OPGL 5DD6A 3WIHA 3GI8H 4P2QA 3MLXL 5DTFB 2DOCA 4HFUL 5SWSB 3QDGE 4G8GA 1H0DA 3K1KC 1FNGA 2AV1B 4YHML 3MLRH 4PLKC 3QBTB 3C6SA 4OLUL 2YR3A 2IMMA 3MODH 4YDJB 1FNGB 2AV1A 3HZMA 4IMLA 5MHSD 4JFQA 4GO6B 3TA3A 3Q6FB 2CIIA 1KNOA 1S7VB 5E8DL 1YMHB 3PGCA 5L88H 1UA6L 2PETA 5DTFA 2GEEA 2MQ0A 3IDXH 4HIHA 1IGTB 2FNBA 4KJYB 2EDYA 2R69L 5E8OB 5ACZA 1WCQA 5HGDB 1EBPA 2XNAA 5ANMA 1T83C 4HPOL 2E7LA 5D7IA 2CJUH 4P23D 5HGHB 1UA6H 1VCAA 5TDNA 1RIUL 1JRHL 3DVNB 1ZANH 5CEYB 1I3RA 5F9DC 4JQIL 3MXVL 4MJIE 1CF8L 4ZD3H 3B5GA 4NWUL 1KG0B 1MHEA 3FT3B 3BH8B 5H37H 5KVMC 1G9ML 4CN6A 2HWZH 1IAKA 1KTRL 3QIUD 1A7RL 1UGNA 4H0HB 4ZYKB 1A6AA 3OF6A 3O3AA 1PX4A 1QSZA 4O02L 1MHPL 3TVMA 5J8OA 1WEJL 4TQEL 1IM9D 4XXDA 1AI1L 2DKUA 1S7QA 3V5DA 4L4TD 3PWNA 2H1PL 5BMFH 1M7DB 4K3EH 3F62A 4ONOA 4ZO8A 2C1PB 4D0CA 2DQCH 3PF2A 5EUOA 4XMPH 4P2OC 3GMRB 1DBJH 1KTKE 3MRMA 4M93B 4PJXA 4XRCB 1NKRA 1SQ2N 5D7LE 4NQVB 3P4NA 4WW2C 3SGDI 3IDUA 1P4LB 2L7UA 1G7PA 4YHZL 2HFGH 3MRPB 5F7DB 2OL3A 4HBCH 1H8NA 3PNWB 4XCYA 4MAYB 3QUZC 2F15A 3RVXC 4HUVB 1LP9A 1OGTA 4MA7H 1MCCA 5MEQB 3VFSB 1T03L 2ZPKL 3GSRB 1HSAB 4JEGB 5E99H 1AXIB 1FGNL 3FQXB 2Q8BL 4P4RA 5IB4A 5EBWB 4HUWB 4JG0H 5DQ9B 3EJJX 2JK5A 4X6CF 5B3JE 2HLFC 2CLVA 3C6LC 2AXGA 4UT7H 1SEQH 3OKMA 3IGAA 2YD3A 3WFCL 4NQXA 2HVJA 1U3HB 3CD4A 3P11H 5CJQL 1RVFL 5I8CA 3NABH 1R5IB 4UU9A 1UADC 3NAAH 4HUWA 5DQ9A 2YD9A 3HE7D 3QI9D 4LVEA 4KTDH 3FT4B 4YO0A 1UZ8A 3VXQB 3IXTB 3MPCA 3E2HC 1LP9B 3H9ZA 4HUVA 4X7CC 1F4YL 4RBPK 1UWGH 3C60B 1HH9A 4MAYA 4U0RC 2WBKA 4TUJB 1DDHB 1KENH 3HMWH 4UB0H 3VGGA 4F7EA 4BKLA 2ZOLB 5ESAA 2FYYA 5DMYA 1CFVH 2ZUUA 1ZGLA 3ARGC 3REVB 1A4JB 2YUWA 1I8IA 3WE6B 1AGCB 3KLHC 1Q0YH 3QUYD 3X3FL 3P77A 1MCIA 3RIFF 1ZTXL 2BXYA 4JFZH 3MV8E 3AXLB 4KMQA 4L9LC 1OAKH 3VXRE 1KLUA 1WLHA 2M26A 2X4OA 1AQKL 3VXSD 3U9PL 2Y06H 3V8OA 4OJFH 4YDIL 3MRIB 1CICC 3JBG7 1NBZB 4NN5C 1BD2D 4BELD 4QXUH 1KG0A 3FT3A 2AJZA 4DUXA 1SY6H 4TNVK 2VOTA 3B9KC 5EO9A 5CEYA 3DX7B 3MV7A 4V1DB 5F6IC 2WIIA 2ICWB 2Z31A 4GRMA 5KSBE 1DANT 5TE6H 1GGIL 3PL6C 3MJ8A 5FM5O 5CKGA 4X6DA 1A1OB 1K4CB 4JRYA 1F42A 5IB3B 2DQCL 5ID0B 5HGBB 5AYUH 4KJYA 1B2WH 3RWFA 4HIHB 4JHZA 4PJ5A 3QQNA 4KKNA 1JK8A 2ITDB 3PGCB 3AFLA 2VKWA 4P23B 3HCVB 1TENA 2E7HA 4KK9C 3K7UA 4P46B 1TCRA 3HUJF 4JFQB 4EIGB 1XF4A 4H1LB 4UNTA 2EIEA 3HR6A 2JJVA 5GISL 1A5FL 1CDJA 4YNYB 1WJ3A 3KG5A 1T0NB 2Z8SA 4EJ1C 4UDUB 1DFBL 1FFNB 2E3VA 5LVEA 3Q1SH 4XNQA 4NOFA 5IIEA 1AGFA 3TNNA 4D9RE 3KGRA 1JWSA 1V3JA 3JVGA 4PV8A 3LRHA 5BVPH 1NANI 4L8DA 5LWYH 3QDAA 3TJHC 4AT6A 1EIBA 2BVPB 4GS7B 3MJ7B 3LMJL 1QLEH 2CUIA 4MXWH 3FB5B 4I77H 5HYJD 4ERSH 3PE9A 2JELH 5IWLA 1YYML 3N0PB 4OD3L 3SDCA 4G8EB 4KWUA 5ICXB 2NZIA 1DFBH 5D72H 2RBLA 3N85L 4ZPVB 5I6XB 2BVEA 1NJ9A 1TCMA 1BM3L 2YPLD 5IM7A 3T0WA 2BOBA 5C0IA 2ADFH 5DJ2A 3LN4A 1UWXH 4HS6A 1AO7B 3VE0B 2HFTA 4FNLL 5T5NG 3MGOB 4XXCC 1KPVB 5EU3A 1NCWL 4PY7A 2D9QB 4B53A 1O0VA 4NRYA 2GHWB 5HYQB 1HI6A 3RUGA 4IRJC 1VDGA 4UIKH 3CLFL 4JKKA 4ZXBB 2E27H 5C0BE 1I9IH 4E41A 2ADJB 4PLOB 4L1HA 1DEDA 1J9CT 3EO9L 3NPSB 4PRPE 1JIBA 4KJQD 1OAZH 1I7ZB 2F5AH 5DK2B 2CQVA 4KXZI 1XR8B 5DRNB 1J8HB 1G7LB 3V0WL 4WHTB 3INUH 4GKNB 3GI9H 3C87A 3QI9B 4X6DE 1PG7X 5AUMB 1DE4A 2NNAA 2WZPD 5F3BA 3HTLX 1D9KA 1TVBB 2H2PC 3RKDC 4XZUB 1N64H 1XR9B 2BNQE 1FPTL 2FX8H 4PJXE 4JAMA 1MFEH 3RAJH 5TF0A 1EZVX 3CVIH 5L2JA 3JV6B 3VI4E 4P2RD 2L7JA 1E28A 1CFNB 1A47A 1LO5B 5TE7H 2HAZA 1FH5H 2NY5C 1S9WB 2XRAL 2DDQL 3FQWA 5JR1H 2HJLB 4H25B 2XFXA 1GAFH 2RCSL 3JWOL 2HJLA 1ULVA 1BIIA 4ZFOB 5IUSA 3WIHH 3CJJA 1D5IL 3TEUA 3QH3B 4Z7UE 2AGJL 4P9HC 5FUZL 2VLRE 5GPRA 4CNIA 1NCCL 3MLSL 1WFNA 4DQOL 2PXYC 5EOTB 4FG6C 1NCDL 4V3DB 3MXWH 5ADOL 3EYUL 1RK0A 5DS8B 1C5CL 3UZEA 3WJJC 5K9JL 4JRXA 2NX5B 4OB5L 1ZLSL 3V0VB 4XZUA 3BP5A 4NWUH 3MV7E 2XT1B 1GAFL 2CDGB 1NMBH 2BY2A 3ARRA 1HNFA 4APQA 2K3TA 5ANME 5C1MB 1CIDA 2ARJA 3D48R 1A3LL 5HD8D 4L8CA 3GSUB 4J3VA 1AR2A 4YUEL 1XR8A 2YS4A 5ISZD 4CN1A 2O5YL 4G9FD 1OAUH 1NUFA 4RFNC 3QO1A 3T77B 2DI9A 5DRZB 4DQOH 4L4VE 3SE9L 3D9AL 3QUYA 2X7LA 4LHUG 4AJ0A 1S5HB 3LIZL 1KN2H 5I1EL 5HY9B 4B41A 3BT2H 5HYQA 2DAVA 5FGCE 1DVFD 5CWSB 3ROOB 1IBGH 1HHGA 5CD5C 5GZND 1KLFA 1KJMA 4PYGA 4LVNC 3MRCB 3T0BA 1NCNA 2QV2A 4GMTH 4HS6B 2WWMD 5FFLA 4QHKI 4U7KA 5HHNB 2BOBB 3L3KB 5IG7B 3HNTL 3UTTB 4HFUH 4MA3A 2F54D 1LP9E