3TFKA

42f3-p4b10/h2-ld
Total Genus 52
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
52
sequence length
174
structure length
174
Chain Sequence
PHSMRYYETATSRRGLGEPRYTSVGYVDDKEFVRFDSDAENPRYEPQVPWMEQEGPEYWERITQVAKGQEQWFRVNLRTLLGYYNQSAGGTHTLQRMYGCDVGSDGRLLRGYEQFAYDGCDYIALNEDLRTWTAADMAAQITRRKWEQAGAAEYYRAYLEGECVEWLHRYLKNG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title T cell receptor signaling is limited by docking geometry to peptide-major histocompatibility complex.
pubmed doi rcsb
source organism Mus musculus
molecule tags Immune system
molecule keywords H2-Ld SBM2
total genus 52
structure length 174
sequence length 174
ec nomenclature
pdb deposition date 2011-08-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00129 MHC_I Class I Histocompatibility antigen, domains alpha 1 and 2
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.500.10 Alpha Beta 2-Layer Sandwich Murine Class I Major Histocompatibility Complex, H2-DB; Chain A, domain 1 MHC class I-like antigen recognition-like 3tfkA00
3MRRA 2AKRA 4L8SC 4U1NA 4NQEA 3FQUA 1WBZA 3UTSA 4NSKA 1ZS8A 5D7JC 1JF1A 2OI9A 3FQNA 1G6RH 4Y4FA 2VAAA 3KPPA 3V5KA 2BNRA 1BQHA 1G7QA 1T7WA 4G8IA 2J8UA 3RWFA 3SDDA 2MHAA 2VLLA 1K8DA 3BGMA 2FWOA 2YEZA 4NO0A 4O2EA 1MWAH 5DEGA 3UTTA 1KBGH 3MGOA 2GTZA 4G8GA 1AKJA 1OSZA 4HWZA 4PRHA 1QRNA 1XH3A 1ZT1A 2OL3H 3CZFA 1KPUA 4L8BA 5AD0A 5EU6A 4Z78A 1ED3A 3H9SA 4MVBA 1T0NA 5E6IC 4F7PA 3VFMA 2H26A 1ZSDA 5E8NA 1AGDA 3FTGA 4QRRA 5F1IA 4UQ3A 4PJ8A 3RL2A 4JFDA 4JQVA 3FT3A 4PGCA 3KPNA 2GJ6A 3OV6A 4I4WA 5C0BA 3P77A 5E8PA 4Y16A 3HLAA 3X14A 1ZHNA 4D0DA 1QQDA 1BZ9A 4X6CA 5DDHA 5SWQA 5D9SA 3MV7A 2HJLA 3G08A 4L9LC 3E2HA 1UXWA 4PRPA 1DUYA 3AM8A 4N0FA 1LQVA 1TVHA 1YDPA 3TBYA 2BVPA 4HKJA 3DX8A 3VJ6A 1T7XA 1G7PA 4Y4HA 1MHCA 3JTTA 5J1AA 4FTVA 3ARGA 5SWZA 3WUWA 5C0JA 3TO2A 2X4OA 3BUYA 3P4MA 1UXSA 4GKSA 4PJFA 5D2NA 1EFXA 5C0FA 4ZUWA 3GSWA 1W72A 1HHGA 1KPVA 3BO8A 4K7FA 3X12A 3O3BA 4WU5A 1N3NA 3BHBA 3DX6A 1P4LA 3ILQC 1C16A 2C7UA 1FZMA 2E7LE 3KPMA 1B0RA 4IRSA 4NQVA 4PJIA 3P73A 5B38A 3DXAA 4NO5A 5HHOA 3WL9A 5C0IA 5MEOA 4GUPA 3JTSA 1AGFA 1KTLA 2VLRA 4O2CA 5INDA 4V3DB 5INCA 5L2KA 2UWEA 5F7DA 2P5WA 3FRUA 3O8XA 4I48A 3H7BA 1AGBA 4L8DA 3REWA 5IB2A 3UPRA 1A9BA 3MRQA 1I7UA 4IHOA 1VADA 1OGAA 2A83A 2PO6A 3KPOA 4MX7A 5C09A 1JGDA 4NO2A 3LV3A 1T0MA 3VFTA 3ECBA 4JRXA 1ZVSA 3VXMA 1YN6A 1A1OA 4HUVA 4L4TA 1S7SA 3QI9A 1P1ZA 3TF7A 4WO4A 3C9NA 1ZAGA 4EUPA 5GSRA 3FOLA 4MJ6A 3M1BA 4WUUA 3HE7A 4JQXA 4MJIA 4Z76A 3L3JA 3SDCA 3VFRA 5GSVA 4G59A 1X7QA 5EU4A 1FFOA 1PQZA 1ZHLA 4U1JA 5HHQA 5D7LA 5ENWA 5E9DA 4NQCA 1LEGA 4PGDA 3U0PA 3TIEA 1I1YA 3PWUA 3VXSA 3BH9A 3ES6A 3BEWA 2BNQA 1S7WA 2FYYA 3D2UA 4IIQC 1S7QA 3ARFA 3KPSA 1CG9A 1W0WA 2BSTA 5MERA 1ZT4A 1HOCA 4PV8A 3OX8A 3BWAA 4E0RA 4ONOA 1S9YA 3MREA 2ZSWA 1XR8A 4N0CA 1ONQA 4LCYA 4HS3A 4JFOA 1AGEA 3DMMA 1B0GA 1GZQA 3BXNA 3BH8A 5EO0A 4G43A 2GUOA 1YPZA 4FFEX 4PV9A 5B39A 4MS8A 3QUKA 3FT4A 2ESVA 4CVZA 5BJTA 3B3IA 2AV1A 2CIKA 3FQRA 3V5DA 2F54A 3GMPA 2ZOLA 3BP4A 2ZOKA 5C0AA 3HUJA 1N59A 3SJVA 3DX7A 2X4RA 2AV7A 2BCKA 3BZFA 3MRDA 2VE6A 4PRAA 2YPKA 4PP8C 4PRNA 3QDGA 4MQ7A 3SPVA 3MA7A 5IVXA 3AREA 1SYVA 4MNQA 1RK1A 4HX1A 3VXRA 4GKNA 3CH1A 3X11A 3TO4A 4PJHA 4PGEA 3I6LD 3MRMA 2GAZA 4PRIA 3I6KA 1HYRC 3VFNA 1ZHBA 1HHJA 2Q7YA 1S9XA 4N0UA 3VRJA 3D3VA 4X6EA 3QZWA 4U1LA 3TA3A 5C0CA 3LN4A 5C07A 4F7TA 3KPLA 3VFWA 3T1FA 3MRBA 5F1NA 3GMMA 4G9DA 5ACZA 2V2XA 3I6GA 3KPRA 2CKBH 2AK4A 4QRSA 3VFOA 5IEKA 3AU1A 3KLAA 4F7MA 1I1FA 2XFXA 3IT8D 3L3DA 3SKOA 1GZPA 1CD1A 4WW2C 3RWDA 1JUFA 3QQ4A 2BVOA 5EO1A 1OF2A 1QR1A 5HGAA 3P9LA 3DBXA 1ZT7A 1TVBA 4HUWA 3TBVA 2PYEA 4PRDA 1K5NA 4PJCA 5FDWA 5F9JA 3ROLA 3RGVC 5E8OA 4LCCC 1ZHKA 3VXPA 5L2JA 3TBSA 5IM7A 1XR9A 4QRPA 3RWHA 3WLBA 5SWSA 3KYNA 1T22A 1BIIA 5IROA 3UTQA 1A1MA 3MYJA 1JPFA 1VACA 3QUXA 3MRGA 2BSRA 1T1ZA 1JE6A 3QFJA 1T20A 1M6OA 1E27A 3TIDA 4ELMA 2CLVA 3P4NA 2F74A 3GMOA 1RJZA 3QQ3A 5H94A 4EN3C 5J6HA 4CW1A 1I7TA 1NAMH 3L3KA 3V5HA 1WBYA 1LP9A 3OXSA 4NQDA 1T1YA 4EI5A 4QRTA 1JHTA 3HAEA 2VLJA 3PWNA 3CC5A 1YN7A 1OGTA 5FA3A 4O2FA 3RWJA 4NQXA 2HLAA 4ZUSA 2CLRA 4PJ5A 1DDHA 1SYSA 3VXUA 3ERYA 1FG2A 3MV8A 3W0WA 1L8JA 2BSSA 2GTWA 1S8DA 3BW9A 3KPQA 2WY3A 3RUGA 5JHDA 3H9HA 3UBXA 3VRIA 1HHIA 2HN7A 3RTQA 2X4TA 2AXGA 1JPGA 4N5EA 3BP7A 4CVXA 3ARBA 1EEYA 1AO7A 5EOTA 1DUZA 3SCMA 5C0EA 3QFDA 4QRUA 3DTXA 1EXUA 4Y4KA 4X6FA 1HHKA 3X13A 4U1KA 1I4FA 2CIIA 5C9JA 1T1XA 1LK2A 5D2LA 3BZEA 3HG1A 4PJ9A 1T80A 5EU3A 2H6PA 2JCCA 3TFKA 1T7YA 1KJ3H 5IEHA 1T21A 4HUUA 1KJMA 4JFFA 4MJ5A 5MEPA 3O4LA 3TJHA 3HE6A 4NT6A 3O3DA 1INQA 1MI5A 2FO4A 4JFQA 2VLKA 3S6CA 5HYJA 1NEZA 4L3CA 4S0UC 3IXAA 4NHUE 4Y2DA 3LN5A 3QUYA 3VFSA 2F53A 2FIKA 3P4OA 1JFMA 1AGCA 1S7TA 4ZUTA 1XZ0A 5MENA 1T1WA 3L3HA 4WU7A 5C08A 3TVMA 3GMQA 3QDMA 3GSUA 4L4VA 3LKOA 4PJXA 3M17A 2GT9A 3CPLA 2X4NA 3GSQA 3L3IA 3O3AA 1I7RA 3LKNA 4JFEA 4MNGA 5IB3A 4PJBA 3RZCA 5HHPA 3MRIA 3CDGA 5MEQA 3MRLA 3GMNA 4IRJA 5IB5A 2NW3A 3GMRA 1QVOA 1LD9A 1R3HA 4ZAKA 4PDCE 3MRFA 5HHNA 1FFPA 3HPJA 1DE4A 4G9FA 3VWKA 4LCWA 5D5MA 4L8CA 3JVGA 3E6FA 3E3QA 1EEZA 4UQ2A 4D0BA 1N2RA 3FFCA 3TBTA 4ZUUA 3WS6A 4V3EB 2AXFA 2XPGA 3FONA 3GSNH 3KYOA 1A6ZA 4HUXA 1S7RA 3O9WA 3ILPA 5C0GA 4PRBA 1UQSA 3MR9A 2BVQA 2NX5A 1FZKA 1FO0H 1FZJA 3LKRA 2P5EA 3MV9A 4F7EA 1BD2A 4L29A 4NNYA 5IB4A 1HSBA 2D31A 3O3EA 4PR5A 3PWLA 3RL1A 3QULA 3MRJA 5EU5A 1VGKA 5DEFA 1S9WA 3TPUE 1KPRA 3GSXA 2RFXA 3L9RA 5E00A 5FA4A 3RWGA 3T8XA 5BS0A 1NANH 3QUZA 1N5AA 4ZFZA 1QEWA 3FQXA 5C0DA 1TMCA 3ROOA 4U1MA 5ISZA 1S7UA 2X4PA 3MRNA 3VWJA 2X70A 2X4QA 3GIVA 3SDAA 3MRPA 3GSVA 5D7IA 3BVNA 1LEKA 4U6XA 3MGTA 5HHMA 3VXOA 3PABA 3CVHA 1A1NA 1E28A 3VFUA 1U58A 3RWIA 4QOKA 3SDXA 5HGBA 1HHHA 4N8VA 4E5XA 1Z5LA 3FT2A 1JGEA 1S7VA 3MRKA 4F7CA 4PJAA 3QDJA 1P7QA 3JTCA 1QO3A 4U1HA 3RWCA 3E6HA 2ZSVA 1M05A 2HJKA 5FKPA 4WDIA 1RJYA 3GMLA 4ZUVA 4LHUA 4L3EA 1FZOA 5EUOA 3KXFA 3LKQA 4G42A 2CLZA 3KWWA 4JRYA 4K71B 4HV8A 3ARDA 2V2WA 4QRQA 5EFIA 5BXFA 1W0VA 5HGDA 3MROA 4PJGA 3L3GA 3PWVA 3GSOA 4PGBA 4WJ5A 3PQYA 2GITA 2VABA 1KJ2H 1IM9A 3PWPA 4WWKC 1B3JA 1RK0A 4XXCA 4LNRA 1KCGC 3B6SA 4U1SA 3W39A 3WS3A 5IB1A 3NFNA 1IM3A 3LKSA 4X6DA 1FFNA 5HGHA 5BRZA 4MXQA 1QSEA 3FQTA 4NO3A 3HCVA 1S7XA 1CE6A 3C8KA 2DYPA 3CCHA 3VH8A 3D39A 3GSRA 1T7ZA 1QSFA 3FOMA 1KJVA 3SKMA 3MRHA 2X4SA 4PG9A 4PG2A 4U1IA 3TN0A 4APQA 5J6GA 4Z77A 3RWEA 3BEVA 4U6YA 3VXNA 4D0CA 1A9EA 3OXRA 3GJFA 3VFPA 1HSAA 4PJ7A 3LKPA 4NNXA 1MHEA 1WBXA 4PREA 1Q94A 3PWJA 1T7VA 3D18A 3P9MA 1QLFA 4JFPA 3VFVA 3VCLA 3FQWA 3QEQA 1LDPH 4PJEA 3TZVC 3MRCA 3D25A 2YPLA 2X4UA 1I1AA 3TBWA 4PJDA 2FZ3A
chains in the Genus database with same CATH superfamily
3MRRA 2AKRA 4L8SC 4U1NA 4NQEA 3FQUA 1WBZA 3UTSA 4NSKA 1ZS8A 5D7JC 1JF1A 2OI9A 3FQNA 1G6RH 4Y4FA 2VAAA 3KPPA 3V5KA 2BNRA 1BQHA 1G7QA 1T7WA 4G8IA 2J8UA 3RWFA 3SDDA 2MHAA 2VLLA 1K8DA 3BGMA 2FWOA 2YEZA 4NO0A 4O2EA 1MWAH 5DEGA 3UTTA 1KBGH 3MGOA 2GTZA 4G8GA 1AKJA 1OSZA 4HWZA 4PRHA 1QRNA 1XH3A 1ZT1A 2OL3H 3CZFA 1KPUA 4L8BA 5AD0A 5EU6A 4Z78A 1ED3A 3H9SA 4MVBA 1T0NA 5E6IC 4F7PA 3VFMA 2H26A 1ZSDA 5E8NA 1AGDA 3FTGA 4QRRA 5F1IA 4UQ3A 4PJ8A 3RL2A 4JFDA 4JQVA 3FT3A 4PGCA 3KPNA 2GJ6A 3OV6A 4I4WA 5C0BA 3P77A 5E8PA 4Y16A 3HLAA 3X14A 1ZHNA 4D0DA 1QQDA 1BZ9A 4X6CA 5DDHA 5SWQA 5D9SA 3MV7A 2HJLA 3G08A 4L9LC 3E2HA 1UXWA 4PRPA 1DUYA 3AM8A 4N0FA 1LQVA 1TVHA 1YDPA 3TBYA 2BVPA 2IA1A 4HKJA 3DX8A 3VJ6A 1T7XA 1G7PA 4Y4HA 1MHCA 3JTTA 5J1AA 4FTVA 3ARGA 5SWZA 3WUWA 5C0JA 3TO2A 2X4OA 3BUYA 3P4MA 1UXSA 4GKSA 4PJFA 5D2NA 1EFXA 5C0FA 4ZUWA 3GSWA 1W72A 1HHGA 1KPVA 3BO8A 4K7FA 3X12A 3O3BA 4WU5A 1N3NA 3BHBA 3DX6A 1P4LA 3ILQC 1C16A 2C7UA 1FZMA 2E7LE 3KPMA 1B0RA 4IRSA 4NQVA 4PJIA 3P73A 5B38A 3DXAA 4NO5A 5HHOA 3WL9A 5C0IA 5MEOA 4GUPA 3JTSA 1AGFA 1KTLA 2VLRA 4O2CA 5INDA 4V3DB 5INCA 5L2KA 2UWEA 5F7DA 2P5WA 3FRUA 3O8XA 4I48A 3H7BA 1AGBA 4L8DA 3REWA 5IB2A 3UPRA 1A9BA 3MRQA 1I7UA 4IHOA 1VADA 1OGAA 2A83A 2PO6A 3KPOA 4MX7A 5C09A 1JGDA 4NO2A 3LV3A 1T0MA 3VFTA 3ECBA 4JRXA 1ZVSA 3VXMA 1YN6A 1A1OA 4HUVA 4L4TA 1S7SA 3QI9A 1P1ZA 3TF7A 4WO4A 3C9NA 1ZAGA 4EUPA 5GSRA 3FOLA 4MJ6A 3M1BA 4WUUA 3HE7A 4JQXA 4MJIA 4BKWA 3L3JA 3SDCA 4Z76A 3VFRA 5GSVA 4G59A 1X7QA 5EU4A 1FFOA 1PQZA 1ZHLA 4U1JA 5HHQA 5D7LA 5ENWA 5E9DA 4NQCA 1LEGA 4PGDA 3U0PA 3TIEA 1I1YA 3PWUA 3VXSA 3BH9A 3ES6A 3BEWA 2BNQA 1S7WA 2FYYA 3D2UA 4IIQC 1S7QA 3ARFA 3KPSA 1CG9A 1W0WA 2BSTA 5MERA 1ZT4A 1HOCA 4PV8A 3OX8A 3BWAA 4E0RA 4ONOA 1S9YA 3MREA 2ZSWA 1XR8A 4N0CA 1ONQA 4LCYA 4HS3A 4JFOA 1AGEA 3DMMA 1B0GA 1GZQA 3BXNA 3BH8A 5EO0A 4G43A 2GUOA 1YPZA 4FFEX 4PV9A 5B39A 4MS8A 3QUKA 3FT4A 2ESVA 4CVZA 5BJTA 3B3IA 2AV1A 2CIKA 3FQRA 3V5DA 2F54A 3GMPA 2ZOLA 3BP4A 2ZOKA 5C0AA 3HUJA 1N59A 3SJVA 3DX7A 2X4RA 2AV7A 2BCKA 3BZFA 3MRDA 2VE6A 4PRAA 2YPKA 4PP8C 4PRNA 3QDGA 4MQ7A 3SPVA 3MA7A 5IVXA 3AREA 1SYVA 4MNQA 1RK1A 4HX1A 3VXRA 4GKNA 3CH1A 3X11A 3TO4A 4PJHA 4PGEA 3I6LD 3MRMA 2GAZA 4PRIA 3I6KA 1HYRC 3VFNA 1ZHBA 1HHJA 2Q7YA 1S9XA 4N0UA 3VRJA 3D3VA 4X6EA 3QZWA 4U1LA 3TA3A 5C0CA 3LN4A 5C07A 4F7TA 3KPLA 3VFWA 3T1FA 3MRBA 5F1NA 3GMMA 4G9DA 5ACZA 2V2XA 3I6GA 3KPRA 2CKBH 2AK4A 4QRSA 3VFOA 5IEKA 3AU1A 3KLAA 4F7MA 1I1FA 2XFXA 3IT8D 3L3DA 3SKOA 1GZPA 1CD1A 4WW2C 3RWDA 1JUFA 3QQ4A 2BVOA 5EO1A 1OF2A 1QR1A 5HGAA 3P9LA 3DBXA 1ZT7A 1TVBA 4HUWA 3TBVA 2PYEA 4PRDA 1K5NA 4PJCA 5FDWA 5F9JA 3ROLA 3RGVC 5E8OA 4LCCC 1ZHKA 3VXPA 5L2JA 3TBSA 5IM7A 1XR9A 4QRPA 3RWHA 3WLBA 5SWSA 3KYNA 1T22A 1BIIA 5IROA 3UTQA 1A1MA 3MYJA 1JPFA 1VACA 3QUXA 3MRGA 2BSRA 1T1ZA 1JE6A 3QFJA 1T20A 1M6OA 1E27A 3TIDA 4ELMA 2CLVA 3P4NA 2F74A 3GMOA 1RJZA 3QQ3A 5H94A 4EN3C 5J6HA 4CW1A 1I7TA 1NAMH 3L3KA 3V5HA 1WBYA 1LP9A 3OXSA 4NQDA 1T1YA 4EI5A 4QRTA 1JHTA 3HAEA 2VLJA 3PWNA 3CC5A 1YN7A 1OGTA 5FA3A 4O2FA 3RWJA 4NQXA 2HLAA 4ZUSA 2CLRA 4PJ5A 1DDHA 1SYSA 3VXUA 3ERYA 1FG2A 3MV8A 3W0WA 1L8JA 2BSSA 2GTWA 1S8DA 3BW9A 3KPQA 2WY3A 3RUGA 5JHDA 3H9HA 3UBXA 2O5NA 3VRIA 1HHIA 2HN7A 3RTQA 2X4TA 2AXGA 1JPGA 4N5EA 3BP7A 4CVXA 3ARBA 1EEYA 1AO7A 5EOTA 1DUZA 3SCMA 5C0EA 3QFDA 4QRUA 3DTXA 1EXUA 4Y4KA 4X6FA 1HHKA 3X13A 4U1KA 1I4FA 2CIIA 5C9JA 1T1XA 1LK2A 5D2LA 3BZEA 3HG1A 4PJ9A 1T80A 5EU3A 2H6PA 2JCCA 3TFKA 1T7YA 1KJ3H 5IEHA 1T21A 4HUUA 1KJMA 4JFFA 4MJ5A 5MEPA 3O4LA 3TJHA 3HE6A 4NT6A 3O3DA 1INQA 1MI5A 2FO4A 4JFQA 2VLKA 3S6CA 5HYJA 1NEZA 4L3CA 4S0UC 3IXAA 4NHUE 4Y2DA 3LN5A 3QUYA 3VFSA 2F53A 2FIKA 3P4OA 1JFMA 1AGCA 1S7TA 4ZUTA 1XZ0A 5MENA 1T1WA 3L3HA 4WU7A 5C08A 4JO8A 3TVMA 3GMQA 3QDMA 3GSUA 4L4VA 3LKOA 4PJXA 3M17A 2GT9A 3CPLA 2X4NA 3GSQA 3L3IA 3O3AA 1I7RA 3LKNA 4JFEA 4MNGA 5IB3A 4PJBA 3RZCA 5HHPA 3MRIA 3CDGA 5MEQA 3MRLA 3GMNA 4IRJA 5IB5A 2NW3A 3GMRA 1QVOA 1LD9A 1R3HA 4ZAKA 4PDCE 3MRFA 5HHNA 1FFPA 3HPJA 1DE4A 4G9FA 3VWKA 4LCWA 5D5MA 4L8CA 3JVGA 3E6FA 3E3QA 1EEZA 4UQ2A 4D0BA 1N2RA 3FFCA 3TBTA 4ZUUA 3WS6A 4V3EB 2AXFA 2XPGA 3FONA 3GSNH 3KYOA 1A6ZA 4HUXA 1S7RA 3O9WA 3ILPA 5C0GA 4PRBA 1UQSA 3MR9A 2BVQA 2NX5A 1FZKA 1FO0H 1FZJA 3LKRA 2P5EA 3MV9A 4F7EA 1BD2A 4L29A 4NNYA 5IB4A 2NYKA 1HSBA 2D31A 3O3EA 4PR5A 3PWLA 3RL1A 3QULA 3MRJA 5EU5A 1VGKA 5DEFA 1S9WA 3TPUE 1KPRA 3GSXA 2RFXA 3L9RA 5E00A 5FA4A 3RWGA 3T8XA 5BS0A 1NANH 3QUZA 1N5AA 4ZFZA 1QEWA 3FQXA 5C0DA 1TMCA 3ROOA 4U1MA 5ISZA 1S7UA 2X4PA 3MRNA 3VWJA 2X70A 2X4QA 3GIVA 3SDAA 3MRPA 3GSVA 5D7IA 3BVNA 1LEKA 4U6XA 3MGTA 5HHMA 3VXOA 3PABA 3CVHA 1A1NA 1E28A 3VFUA 1U58A 3RWIA 4QOKA 3SDXA 5HGBA 1HHHA 4N8VA 4E5XA 1Z5LA 3FT2A 1JGEA 1S7VA 3MRKA 4F7CA 4PJAA 3QDJA 1P7QA 3JTCA 1QO3A 4U1HA 3RWCA 3E6HA 2ZSVA 1M05A 2HJKA 5FKPA 4WDIA 1RJYA 3GMLA 4ZUVA 4LHUA 4L3EA 1FZOA 4G59C 5EUOA 3KXFA 3LKQA 4G42A 2CLZA 3KWWA 4JRYA 4K71B 4HV8A 3ARDA 2V2WA 4QRQA 5EFIA 5BXFA 1W0VA 5HGDA 3MROA 4PJGA 3L3GA 3PWVA 3GSOA 4PGBA 4WJ5A 3PQYA 2GITA 2VABA 1KJ2H 1IM9A 3PWPA 4WWKC 1B3JA 1RK0A 4XXCA 4LNRA 1KCGC 3B6SA 4U1SA 3W39A 3WS3A 5IB1A 3NFNA 1IM3A 3LKSA 4X6DA 1FFNA 5HGHA 5BRZA 4MXQA 1QSEA 3FQTA 4NO3A 3HCVA 1S7XA 1CE6A 3C8KA 2DYPA 3CCHA 3VH8A 3D39A 3GSRA 1T7ZA 1QSFA 3FOMA 1KJVA 3SKMA 3MRHA 2X4SA 4PG9A 4PG2A 4U1IA 3TN0A 4APQA 5J6GA 4Z77A 3RWEA 3BEVA 4U6YA 3VXNA 4D0CA 1A9EA 3OXRA 3GJFA 3VFPA 1HSAA 4PJ7A 3LKPA 4NNXA 1MHEA 1WBXA 4PREA 1Q94A 3PWJA 1T7VA 3D18A 3P9MA 1QLFA 4JFPA 3VFVA 3VCLA 3I0TA 3FQWA 3QEQA 1LDPH 4PJEA 3TZVC 3MRCA 3D25A 2YPLA 2X4UA 1I1AA 3TBWA 4PJDA 2FZ3A
chains in the Genus database with same CATH topology
3MRRA 2AKRA 4L8SC 4U1NA 4NQEA 3FQUA 1WBZA 3UTSA 4NSKA 1ZS8A 5D7JC 1JF1A 2OI9A 3FQNA 1G6RH 4Y4FA 2VAAA 3KPPA 3V5KA 2BNRA 1BQHA 1G7QA 1T7WA 4G8IA 2J8UA 3RWFA 3SDDA 2MHAA 2VLLA 1K8DA 3BGMA 2FWOA 2YEZA 4NO0A 4O2EA 1MWAH 5DEGA 3UTTA 1KBGH 3MGOA 2GTZA 4G8GA 1AKJA 1OSZA 4HWZA 4PRHA 1QRNA 1XH3A 1ZT1A 2OL3H 3CZFA 1KPUA 4L8BA 5AD0A 5EU6A 4Z78A 1ED3A 3H9SA 4MVBA 1T0NA 5E6IC 4F7PA 3VFMA 2H26A 1ZSDA 5E8NA 1AGDA 3FTGA 4QRRA 5F1IA 4UQ3A 4PJ8A 3RL2A 4JFDA 4JQVA 3FT3A 4PGCA 3KPNA 2GJ6A 3OV6A 4I4WA 5C0BA 3P77A 5E8PA 4Y16A 3HLAA 3X14A 1ZHNA 4D0DA 1QQDA 1BZ9A 4X6CA 5DDHA 5SWQA 5D9SA 3MV7A 2HJLA 3G08A 4L9LC 3E2HA 1UXWA 4PRPA 1DUYA 3AM8A 4N0FA 1LQVA 1TVHA 1YDPA 3TBYA 2BVPA 4HKJA 3DX8A 3VJ6A 1T7XA 1G7PA 4Y4HA 1MHCA 3JTTA 5J1AA 4FTVA 3ARGA 5SWZA 3WUWA 5C0JA 3TO2A 2X4OA 3BUYA 3P4MA 1UXSA 4GKSA 4PJFA 5D2NA 1EFXA 5C0FA 4ZUWA 3GSWA 1W72A 1HHGA 1KPVA 3BO8A 4K7FA 3X12A 3O3BA 4WU5A 1N3NA 3BHBA 3DX6A 1P4LA 3ILQC 1C16A 2C7UA 1FZMA 2E7LE 3KPMA 1B0RA 4IRSA 4NQVA 4PJIA 3P73A 5B38A 3DXAA 4NO5A 5HHOA 3WL9A 5C0IA 5MEOA 4GUPA 3JTSA 1AGFA 1KTLA 2VLRA 4O2CA 5INDA 4V3DB 5INCA 5L2KA 2UWEA 5F7DA 2P5WA 3FRUA 3O8XA 4I48A 3H7BA 1AGBA 4L8DA 3REWA 5IB2A 3UPRA 1A9BA 3MRQA 1I7UA 4IHOA 1VADA 1OGAA 2A83A 2PO6A 3KPOA 4MX7A 5C09A 1JGDA 4NO2A 3LV3A 1T0MA 3VFTA 3ECBA 4JRXA 1ZVSA 3VXMA 1YN6A 1A1OA 4HUVA 4L4TA 1S7SA 3QI9A 1P1ZA 3TF7A 4WO4A 3C9NA 1ZAGA 4EUPA 5GSRA 3FOLA 4MJ6A 3M1BA 4WUUA 3HE7A 4JQXA 4MJIA 4Z76A 3L3JA 3SDCA 3VFRA 5GSVA 4G59A 1X7QA 5EU4A 1FFOA 1PQZA 1ZHLA 4U1JA 5HHQA 5D7LA 5ENWA 5E9DA 4NQCA 1LEGA 4PGDA 3U0PA 3TIEA 1I1YA 3PWUA 3VXSA 3BH9A 3ES6A 3BEWA 2BNQA 1S7WA 2FYYA 3D2UA 4IIQC 1S7QA 3ARFA 3KPSA 1CG9A 1W0WA 2BSTA 5MERA 1ZT4A 1HOCA 4PV8A 3OX8A 3BWAA 4E0RA 4ONOA 1S9YA 3MREA 2ZSWA 1XR8A 4N0CA 1ONQA 4LCYA 4HS3A 4JFOA 1AGEA 3DMMA 1B0GA 1GZQA 3BXNA 3BH8A 5EO0A 4G43A 2GUOA 1YPZA 4FFEX 4PV9A 5B39A 4MS8A 3QUKA 3FT4A 2ESVA 4CVZA 5BJTA 3B3IA 2AV1A 2CIKA 3FQRA 3V5DA 2F54A 3GMPA 2ZOLA 3BP4A 2ZOKA 5C0AA 3HUJA 1N59A 3SJVA 3DX7A 2X4RA 2AV7A 2BCKA 3BZFA 3MRDA 2VE6A 4PRAA 2YPKA 4PP8C 4PRNA 3QDGA 4MQ7A 3SPVA 3MA7A 5IVXA 3AREA 1SYVA 4MNQA 1RK1A 4HX1A 3VXRA 4GKNA 3CH1A 3X11A 3TO4A 4PJHA 4PGEA 3I6LD 3MRMA 2GAZA 4PRIA 3I6KA 1HYRC 3VFNA 1ZHBA 1HHJA 2Q7YA 1S9XA 4N0UA 3VRJA 3D3VA 4X6EA 3QZWA 4U1LA 3TA3A 5C0CA 3LN4A 5C07A 4F7TA 3KPLA 3VFWA 3T1FA 3MRBA 5F1NA 3GMMA 4G9DA 5ACZA 2V2XA 3I6GA 3KPRA 2CKBH 2AK4A 4QRSA 3VFOA 5IEKA 3AU1A 3KLAA 4F7MA 1I1FA 2XFXA 3IT8D 3L3DA 3SKOA 1GZPA 1CD1A 4WW2C 3RWDA 1JUFA 3QQ4A 2BVOA 5EO1A 1OF2A 1QR1A 5HGAA 3P9LA 3DBXA 1ZT7A 1TVBA 4HUWA 3TBVA 2PYEA 4PRDA 1K5NA 4PJCA 5FDWA 5F9JA 3ROLA 3RGVC 5E8OA 4LCCC 1ZHKA 3VXPA 5L2JA 3TBSA 5IM7A 1XR9A 4QRPA 3RWHA 3WLBA 5SWSA 3KYNA 1T22A 1BIIA 5IROA 3UTQA 1A1MA 3MYJA 1JPFA 1VACA 3QUXA 3MRGA 2BSRA 1T1ZA 1JE6A 3QFJA 1T20A 1M6OA 1E27A 3TIDA 4ELMA 2CLVA 3P4NA 2F74A 3GMOA 1RJZA 3QQ3A 5H94A 4EN3C 5J6HA 4CW1A 1I7TA 1NAMH 3L3KA 3V5HA 1WBYA 1LP9A 3OXSA 4NQDA 1T1YA 4EI5A 4QRTA 1JHTA 3HAEA 2VLJA 3PWNA 3CC5A 1YN7A 1OGTA 5FA3A 4O2FA 3RWJA 4NQXA 2HLAA 4ZUSA 2CLRA 4PJ5A 1DDHA 1SYSA 3VXUA 3ERYA 1FG2A 3MV8A 3W0WA 1L8JA 2BSSA 2GTWA 1S8DA 3BW9A 3KPQA 2WY3A 3RUGA 5JHDA 3H9HA 3UBXA 3VRIA 1HHIA 2HN7A 3RTQA 2X4TA 2AXGA 1JPGA 4N5EA 3BP7A 4CVXA 3ARBA 1EEYA 1AO7A 5EOTA 1DUZA 3SCMA 5C0EA 3QFDA 4QRUA 3DTXA 1EXUA 4Y4KA 4X6FA 1HHKA 3X13A 4U1KA 1I4FA 2CIIA 5C9JA 1T1XA 1LK2A 5D2LA 3BZEA 3HG1A 4PJ9A 1T80A 5EU3A 2H6PA 2JCCA 3TFKA 1T7YA 1KJ3H 5IEHA 1T21A 4HUUA 1KJMA 4JFFA 4MJ5A 5MEPA 3O4LA 3TJHA 3HE6A 4NT6A 3O3DA 1INQA 1MI5A 2FO4A 4JFQA 2VLKA 3S6CA 5HYJA 1NEZA 4L3CA 4S0UC 3IXAA 4NHUE 4Y2DA 3LN5A 3QUYA 3VFSA 2F53A 2FIKA 3P4OA 1JFMA 1AGCA 1S7TA 4ZUTA 1XZ0A 5MENA 1T1WA 3L3HA 4WU7A 5C08A 3TVMA 3GMQA 3QDMA 3GSUA 4L4VA 3LKOA 4PJXA 3M17A 2GT9A 3CPLA 2X4NA 3GSQA 3L3IA 3O3AA 1I7RA 3LKNA 4JFEA 4MNGA 5IB3A 4PJBA 3RZCA 5HHPA 3MRIA 3CDGA 5MEQA 3MRLA 3GMNA 4IRJA 5IB5A 2NW3A 3GMRA 1QVOA 1LD9A 1R3HA 4ZAKA 4PDCE 3MRFA 5HHNA 1FFPA 3HPJA 1DE4A 4G9FA 3VWKA 4LCWA 5D5MA 4L8CA 3JVGA 3E6FA 3E3QA 1EEZA 4UQ2A 4D0BA 1N2RA 3FFCA 3TBTA 4ZUUA 3WS6A 4V3EB 2AXFA 2XPGA 3FONA 3GSNH 3KYOA 1A6ZA 4HUXA 1S7RA 3O9WA 3ILPA 5C0GA 4PRBA 1UQSA 3MR9A 2BVQA 2NX5A 1FZKA 1FO0H 1FZJA 3LKRA 2P5EA 3MV9A 4F7EA 1BD2A 4L29A 4NNYA 5IB4A 1HSBA 2D31A 3O3EA 4PR5A 3PWLA 3RL1A 3QULA 3MRJA 5EU5A 1VGKA 5DEFA 1S9WA 3TPUE 1KPRA 3GSXA 2RFXA 3L9RA 5E00A 5FA4A 3RWGA 3T8XA 5BS0A 1NANH 3QUZA 1N5AA 4ZFZA 1QEWA 3FQXA 5C0DA 1TMCA 3ROOA 4U1MA 5ISZA 1S7UA 2X4PA 3MRNA 3VWJA 2X70A 2X4QA 3GIVA 3SDAA 3MRPA 3GSVA 5D7IA 3BVNA 1LEKA 4U6XA 3MGTA 5HHMA 3VXOA 3PABA 3CVHA 1A1NA 1E28A 3VFUA 1U58A 3RWIA 4QOKA 3SDXA 5HGBA 1HHHA 4N8VA 4E5XA 1Z5LA 3FT2A 1JGEA 1S7VA 3MRKA 4F7CA 4PJAA 3QDJA 1P7QA 3JTCA 1QO3A 4U1HA 3RWCA 3E6HA 2ZSVA 1M05A 2HJKA 5FKPA 4WDIA 1RJYA 3GMLA 4ZUVA 4LHUA 4L3EA 1FZOA 5EUOA 3KXFA 3LKQA 4G42A 2CLZA 3KWWA 4JRYA 4K71B 4HV8A 3ARDA 2V2WA 4QRQA 5EFIA 5BXFA 1W0VA 5HGDA 3MROA 4PJGA 3L3GA 3PWVA 3GSOA 4PGBA 4WJ5A 3PQYA 2GITA 2VABA 1KJ2H 1IM9A 3PWPA 4WWKC 1B3JA 1RK0A 4XXCA 4LNRA 1KCGC 3B6SA 4U1SA 3W39A 3WS3A 5IB1A 3NFNA 1IM3A 3LKSA 4X6DA 1FFNA 5HGHA 5BRZA 4MXQA 1QSEA 3FQTA 4NO3A 3HCVA 1S7XA 1CE6A 3C8KA 2DYPA 3CCHA 3VH8A 3D39A 3GSRA 1T7ZA 1QSFA 3FOMA 1KJVA 3SKMA 3MRHA 2X4SA 4PG9A 4PG2A 4U1IA 3TN0A 4APQA 5J6GA 4Z77A 3RWEA 3BEVA 4U6YA 3VXNA 4D0CA 1A9EA 3OXRA 3GJFA 3VFPA 1HSAA 4PJ7A 3LKPA 4NNXA 1MHEA 1WBXA 4PREA 1Q94A 3PWJA 1T7VA 3D18A 3P9MA 1QLFA 4JFPA 3VFVA 3VCLA 3FQWA 3QEQA 1LDPH 4PJEA 3TZVC 3MRCA 3D25A 2YPLA 2X4UA 1I1AA 3TBWA 4PJDA 2FZ3A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3MRR A;  2AKR A;  4L8S C;  4U1N A;  4NQE A;  3FQU A;  1WBZ A;  3UTS A;  4NSK A;  1ZS8 A;  5D7J C;  1JF1 A;  2OI9 A;  3FQN A;  1G6R H;  4Y4F A;  2VAA A;  3KPP A;  3V5K A;  2BNR A;  1BQH A;  1G7Q A;  1T7W A;  4G8I A;  2J8U A;  3RWF A;  3SDD A;  2MHA A;  2VLL A;  1K8D A;  3BGM A;  2FWO A;  2YEZ A;  4NO0 A;  4O2E A;  1MWA H;  5DEG A;  3UTT A;  1KBG H;  3MGO A;  2GTZ A;  4G8G A;  1AKJ A;  1OSZ A;  4HWZ A;  4PRH A;  1QRN A;  1XH3 A;  1ZT1 A;  2OL3 H;  3CZF A;  1KPU A;  4L8B A;  5AD0 A;  5EU6 A;  4Z78 A;  1ED3 A;  3H9S A;  4MVB A;  1T0N A;  5E6I C;  4F7P A;  3VFM A;  2H26 A;  1ZSD A;  5E8N A;  1AGD A;  3FTG A;  4QRR A;  5F1I A;  4UQ3 A;  4PJ8 A;  3RL2 A;  4JFD A;  4JQV A;  3FT3 A;  4PGC A;  3KPN A;  2GJ6 A;  3OV6 A;  4I4W A;  5C0B A;  3P77 A;  5E8P A;  4Y16 A;  3HLA A;  3X14 A;  1ZHN A;  4D0D A;  1QQD A;  1BZ9 A;  4X6C A;  5DDH A;  5SWQ A;  5D9S A;  3MV7 A;  2HJL A;  3G08 A;  4L9L C;  3E2H A;  1UXW A;  4PRP A;  1DUY A;  3AM8 A;  4N0F A;  1LQV A;  1TVH A;  1YDP A;  3TBY A;  2BVP A;  4HKJ A;  3DX8 A;  3VJ6 A;  1T7X A;  1G7P A;  4Y4H A;  1MHC A;  3JTT A;  5J1A A;  4FTV A;  3ARG A;  5SWZ A;  3WUW A;  5C0J A;  3TO2 A;  2X4O A;  3BUY A;  3P4M A;  1UXS A;  4GKS A;  4PJF A;  5D2N A;  1EFX A;  5C0F A;  4ZUW A;  3GSW A;  1W72 A;  1HHG A;  1KPV A;  3BO8 A;  4K7F A;  3X12 A;  3O3B A;  4WU5 A;  1N3N A;  3BHB A;  3DX6 A;  1P4L A;  3ILQ C;  1C16 A;  2C7U A;  1FZM A;  2E7L E;  3KPM A;  1B0R A;  4IRS A;  4NQV A;  4PJI A;  3P73 A;  5B38 A;  3DXA A;  4NO5 A;  5HHO A;  3WL9 A;  5C0I A;  5MEO A;  4GUP A;  3JTS A;  1AGF A;  1KTL A;  2VLR A;  4O2C A;  5IND A;  4V3D B;  5INC A;  5L2K A;  2UWE A;  5F7D A;  2P5W A;  3FRU A;  3O8X A;  4I48 A;  3H7B A;  1AGB A;  4L8D A;  3REW A;  5IB2 A;  3UPR A;  1A9B A;  3MRQ A;  1I7U A;  4IHO A;  1VAD A;  1OGA A;  2A83 A;  2PO6 A;  3KPO A;  4MX7 A;  5C09 A;  1JGD A;  4NO2 A;  3LV3 A;  1T0M A;  3VFT A;  3ECB A;  4JRX A;  1ZVS A;  3VXM A;  1YN6 A;  1A1O A;  4HUV A;  4L4T A;  1S7S A;  3QI9 A;  1P1Z A;  3TF7 A;  4WO4 A;  3C9N A;  1ZAG A;  4EUP A;  5GSR A;  3FOL A;  4MJ6 A;  3M1B A;  4WUU A;  3HE7 A;  4JQX A;  4MJI A;  4Z76 A;  3L3J A;  3SDC A;  3VFR A;  5GSV A;  4G59 A;  1X7Q A;  5EU4 A;  1FFO A;  1PQZ A;  1ZHL A;  4U1J A;  5HHQ A;  5D7L A;  5ENW A;  5E9D A;  4NQC A;  1LEG A;  4PGD A;  3U0P A;  3TIE A;  1I1Y A;  3PWU A;  3VXS A;  3BH9 A;  3ES6 A;  3BEW A;  2BNQ A;  1S7W A;  2FYY A;  3D2U A;  4IIQ C;  1S7Q A;  3ARF A;  3KPS A;  1CG9 A;  1W0W A;  2BST A;  5MER A;  1ZT4 A;  1HOC A;  4PV8 A;  3OX8 A;  3BWA A;  4E0R A;  4ONO A;  1S9Y A;  3MRE A;  2ZSW A;  1XR8 A;  4N0C A;  1ONQ A;  4LCY A;  4HS3 A;  4JFO A;  1AGE A;  3DMM A;  1B0G A;  1GZQ A;  3BXN A;  3BH8 A;  5EO0 A;  4G43 A;  2GUO A;  1YPZ A;  4FFE X;  4PV9 A;  5B39 A;  4MS8 A;  3QUK A;  3FT4 A;  2ESV A;  4CVZ A;  5BJT A;  3B3I A;  2AV1 A;  2CIK A;  3FQR A;  3V5D A;  2F54 A;  3GMP A;  2ZOL A;  3BP4 A;  2ZOK A;  5C0A A;  3HUJ A;  1N59 A;  3SJV A;  3DX7 A;  2X4R A;  2AV7 A;  2BCK A;  3BZF A;  3MRD A;  2VE6 A;  4PRA A;  2YPK A;  4PP8 C;  4PRN A;  3QDG A;  4MQ7 A;  3SPV A;  3MA7 A;  5IVX A;  3ARE A;  1SYV A;  4MNQ A;  1RK1 A;  4HX1 A;  3VXR A;  4GKN A;  3CH1 A;  3X11 A;  3TO4 A;  4PJH A;  4PGE A;  3I6L D;  3MRM A;  2GAZ A;  4PRI A;  3I6K A;  1HYR C;  3VFN A;  1ZHB A;  1HHJ A;  2Q7Y A;  1S9X A;  4N0U A;  3VRJ A;  3D3V A;  4X6E A;  3QZW A;  4U1L A;  3TA3 A;  5C0C A;  3LN4 A;  5C07 A;  4F7T A;  3KPL A;  3VFW A;  3T1F A;  3MRB A;  5F1N A;  3GMM A;  4G9D A;  5ACZ A;  2V2X A;  3I6G A;  3KPR A;  2CKB H;  2AK4 A;  4QRS A;  3VFO A;  5IEK A;  3AU1 A;  3KLA A;  4F7M A;  1I1F A;  2XFX A;  3IT8 D;  3L3D A;  3SKO A;  1GZP A;  1CD1 A;  4WW2 C;  3RWD A;  1JUF A;  3QQ4 A;  2BVO A;  5EO1 A;  1OF2 A;  1QR1 A;  5HGA A;  3P9L A;  3DBX A;  1ZT7 A;  1TVB A;  4HUW A;  3TBV A;  2PYE A;  4PRD A;  1K5N A;  4PJC A;  5FDW A;  5F9J A;  3ROL A;  3RGV C;  5E8O A;  4LCC C;  1ZHK A;  3VXP A;  5L2J A;  3TBS A;  5IM7 A;  1XR9 A;  4QRP A;  3RWH A;  3WLB A;  5SWS A;  3KYN A;  1T22 A;  1BII A;  5IRO A;  3UTQ A;  1A1M A;  3MYJ A;  1JPF A;  1VAC A;  3QUX A;  3MRG A;  2BSR A;  1T1Z A;  1JE6 A;  3QFJ A;  1T20 A;  1M6O A;  1E27 A;  3TID A;  4ELM A;  2CLV A;  3P4N A;  2F74 A;  3GMO A;  1RJZ A;  3QQ3 A;  5H94 A;  4EN3 C;  5J6H A;  4CW1 A;  1I7T A;  1NAM H;  3L3K A;  3V5H A;  1WBY A;  1LP9 A;  3OXS A;  4NQD A;  1T1Y A;  4EI5 A;  4QRT A;  1JHT A;  3HAE A;  2VLJ A;  3PWN A;  3CC5 A;  1YN7 A;  1OGT A;  5FA3 A;  4O2F A;  3RWJ A;  4NQX A;  2HLA A;  4ZUS A;  2CLR A;  4PJ5 A;  1DDH A;  1SYS A;  3VXU A;  3ERY A;  1FG2 A;  3MV8 A;  3W0W A;  1L8J A;  2BSS A;  2GTW A;  1S8D A;  3BW9 A;  3KPQ A;  2WY3 A;  3RUG A;  5JHD A;  3H9H A;  3UBX A;  3VRI A;  1HHI A;  2HN7 A;  3RTQ A;  2X4T A;  2AXG A;  1JPG A;  4N5E A;  3BP7 A;  4CVX A;  3ARB A;  1EEY A;  1AO7 A;  5EOT A;  1DUZ A;  3SCM A;  5C0E A;  3QFD A;  4QRU A;  3DTX A;  1EXU A;  4Y4K A;  4X6F A;  1HHK A;  3X13 A;  4U1K A;  1I4F A;  2CII A;  5C9J A;  1T1X A;  1LK2 A;  5D2L A;  3BZE A;  3HG1 A;  4PJ9 A;  1T80 A;  5EU3 A;  2H6P A;  2JCC A;  3TFK A;  1T7Y A;  1KJ3 H;  5IEH A;  1T21 A;  4HUU A;  1KJM A;  4JFF A;  4MJ5 A;  5MEP A;  3O4L A;  3TJH A;  3HE6 A;  4NT6 A;  3O3D A;  1INQ A;  1MI5 A;  2FO4 A;  4JFQ A;  2VLK A;  3S6C A;  5HYJ A;  1NEZ A;  4L3C A;  4S0U C;  3IXA A;  4NHU E;  4Y2D A;  3LN5 A;  3QUY A;  3VFS A;  2F53 A;  2FIK A;  3P4O A;  1JFM A;  1AGC A;  1S7T A;  4ZUT A;  1XZ0 A;  5MEN A;  1T1W A;  3L3H A;  4WU7 A;  5C08 A;  3TVM A;  3GMQ A;  3QDM A;  3GSU A;  4L4V A;  3LKO A;  4PJX A;  3M17 A;  2GT9 A;  3CPL A;  2X4N A;  3GSQ A;  3L3I A;  3O3A A;  1I7R A;  3LKN A;  4JFE A;  4MNG A;  5IB3 A;  4PJB A;  3RZC A;  5HHP A;  3MRI A;  3CDG A;  5MEQ A;  3MRL A;  3GMN A;  4IRJ A;  5IB5 A;  2NW3 A;  3GMR A;  1QVO A;  1LD9 A;  1R3H A;  4ZAK A;  4PDC E;  3MRF A;  5HHN A;  1FFP A;  3HPJ A;  1DE4 A;  4G9F A;  3VWK A;  4LCW A;  5D5M A;  4L8C A;  3JVG A;  3E6F A;  3E3Q A;  1EEZ A;  4UQ2 A;  4D0B A;  1N2R A;  3FFC A;  3TBT A;  4ZUU A;  3WS6 A;  4V3E B;  2AXF A;  2XPG A;  3FON A;  3GSN H;  3KYO A;  1A6Z A;  4HUX A;  1S7R A;  3O9W A;  3ILP A;  5C0G A;  4PRB A;  1UQS A;  3MR9 A;  2BVQ A;  2NX5 A;  1FZK A;  1FO0 H;  1FZJ A;  3LKR A;  2P5E A;  3MV9 A;  4F7E A;  1BD2 A;  4L29 A;  4NNY A;  5IB4 A;  1HSB A;  2D31 A;  3O3E A;  4PR5 A;  3PWL A;  3RL1 A;  3QUL A;  3MRJ A;  5EU5 A;  1VGK A;  5DEF A;  1S9W A;  3TPU E;  1KPR A;  3GSX A;  2RFX A;  3L9R A;  5E00 A;  5FA4 A;  3RWG A;  3T8X A;  5BS0 A;  1NAN H;  3QUZ A;  1N5A A;  4ZFZ A;  1QEW A;  3FQX A;  5C0D A;  1TMC A;  3ROO A;  4U1M A;  5ISZ A;  1S7U A;  2X4P A;  3MRN A;  3VWJ A;  2X70 A;  2X4Q A;  3GIV A;  3SDA A;  3MRP A;  3GSV A;  5D7I A;  3BVN A;  1LEK A;  4U6X A;  3MGT A;  5HHM A;  3VXO A;  3PAB A;  3CVH A;  1A1N A;  1E28 A;  3VFU A;  1U58 A;  3RWI A;  4QOK A;  3SDX A;  5HGB A;  1HHH A;  4N8V A;  4E5X A;  1Z5L A;  3FT2 A;  1JGE A;  1S7V A;  3MRK A;  4F7C A;  4PJA A;  3QDJ A;  1P7Q A;  3JTC A;  1QO3 A;  4U1H A;  3RWC A;  3E6H A;  2ZSV A;  1M05 A;  2HJK A;  5FKP A;  4WDI A;  1RJY A;  3GML A;  4ZUV A;  4LHU A;  4L3E A;  1FZO A;  5EUO A;  3KXF A;  3LKQ A;  4G42 A;  2CLZ A;  3KWW A;  4JRY A;  4K71 B;  4HV8 A;  3ARD A;  2V2W A;  4QRQ A;  5EFI A;  5BXF A;  1W0V A;  5HGD A;  3MRO A;  4PJG A;  3L3G A;  3PWV A;  3GSO A;  4PGB A;  4WJ5 A;  3PQY A;  2GIT A;  2VAB A;  1KJ2 H;  1IM9 A;  3PWP A;  4WWK C;  1B3J A;  1RK0 A;  4XXC A;  4LNR A;  1KCG C;  3B6S A;  4U1S A;  3W39 A;  3WS3 A;  5IB1 A;  3NFN A;  1IM3 A;  3LKS A;  4X6D A;  1FFN A;  5HGH A;  5BRZ A;  4MXQ A;  1QSE A;  3FQT A;  4NO3 A;  3HCV A;  1S7X A;  1CE6 A;  3C8K A;  2DYP A;  3CCH A;  3VH8 A;  3D39 A;  3GSR A;  1T7Z A;  1QSF A;  3FOM A;  1KJV A;  3SKM A;  3MRH A;  2X4S A;  4PG9 A;  4PG2 A;  4U1I A;  3TN0 A;  4APQ A;  5J6G A;  4Z77 A;  3RWE A;  3BEV A;  4U6Y A;  3VXN A;  4D0C A;  1A9E A;  3OXR A;  3GJF A;  3VFP A;  1HSA A;  4PJ7 A;  3LKP A;  4NNX A;  1MHE A;  1WBX A;  4PRE A;  1Q94 A;  3PWJ A;  1T7V A;  3D18 A;  3P9M A;  1QLF A;  4JFP A;  3VFV A;  3VCL A;  3FQW A;  3QEQ A;  1LDP H;  4PJE A;  3TZV C;  3MRC A;  3D25 A;  2YPL A;  2X4U A;  1I1A A;  3TBW A;  4PJD A;  2FZ3 A; 
#chains in the Genus database with same CATH topology
 3MRR A;  2AKR A;  4L8S C;  4U1N A;  4NQE A;  3FQU A;  1WBZ A;  3UTS A;  4NSK A;  1ZS8 A;  5D7J C;  1JF1 A;  2OI9 A;  3FQN A;  1G6R H;  4Y4F A;  2VAA A;  3KPP A;  3V5K A;  2BNR A;  1BQH A;  1G7Q A;  1T7W A;  4G8I A;  2J8U A;  3RWF A;  3SDD A;  2MHA A;  2VLL A;  1K8D A;  3BGM A;  2FWO A;  2YEZ A;  4NO0 A;  4O2E A;  1MWA H;  5DEG A;  3UTT A;  1KBG H;  3MGO A;  2GTZ A;  4G8G A;  1AKJ A;  1OSZ A;  4HWZ A;  4PRH A;  1QRN A;  1XH3 A;  1ZT1 A;  2OL3 H;  3CZF A;  1KPU A;  4L8B A;  5AD0 A;  5EU6 A;  4Z78 A;  1ED3 A;  3H9S A;  4MVB A;  1T0N A;  5E6I C;  4F7P A;  3VFM A;  2H26 A;  1ZSD A;  5E8N A;  1AGD A;  3FTG A;  4QRR A;  5F1I A;  4UQ3 A;  4PJ8 A;  3RL2 A;  4JFD A;  4JQV A;  3FT3 A;  4PGC A;  3KPN A;  2GJ6 A;  3OV6 A;  4I4W A;  5C0B A;  3P77 A;  5E8P A;  4Y16 A;  3HLA A;  3X14 A;  1ZHN A;  4D0D A;  1QQD A;  1BZ9 A;  4X6C A;  5DDH A;  5SWQ A;  5D9S A;  3MV7 A;  2HJL A;  3G08 A;  4L9L C;  3E2H A;  1UXW A;  4PRP A;  1DUY A;  3AM8 A;  4N0F A;  1LQV A;  1TVH A;  1YDP A;  3TBY A;  2BVP A;  2IA1 A;  4HKJ A;  3DX8 A;  3VJ6 A;  1T7X A;  1G7P A;  4Y4H A;  1MHC A;  3JTT A;  5J1A A;  4FTV A;  3ARG A;  5SWZ A;  3WUW A;  5C0J A;  3TO2 A;  2X4O A;  3BUY A;  3P4M A;  1UXS A;  4GKS A;  4PJF A;  5D2N A;  1EFX A;  5C0F A;  4ZUW A;  3GSW A;  1W72 A;  1HHG A;  1KPV A;  3BO8 A;  4K7F A;  3X12 A;  3O3B A;  4WU5 A;  1N3N A;  3BHB A;  3DX6 A;  1P4L A;  3ILQ C;  1C16 A;  2C7U A;  1FZM A;  2E7L E;  3KPM A;  1B0R A;  4IRS A;  4NQV A;  4PJI A;  3P73 A;  5B38 A;  3DXA A;  4NO5 A;  5HHO A;  3WL9 A;  5C0I A;  5MEO A;  4GUP A;  3JTS A;  1AGF A;  1KTL A;  2VLR A;  4O2C A;  5IND A;  4V3D B;  5INC A;  5L2K A;  2UWE A;  5F7D A;  2P5W A;  3FRU A;  3O8X A;  4I48 A;  3H7B A;  1AGB A;  4L8D A;  3REW A;  5IB2 A;  3UPR A;  1A9B A;  3MRQ A;  1I7U A;  4IHO A;  1VAD A;  1OGA A;  2A83 A;  2PO6 A;  3KPO A;  4MX7 A;  5C09 A;  1JGD A;  4NO2 A;  3LV3 A;  1T0M A;  3VFT A;  3ECB A;  4JRX A;  1ZVS A;  3VXM A;  1YN6 A;  1A1O A;  4HUV A;  4L4T A;  1S7S A;  3QI9 A;  1P1Z A;  3TF7 A;  4WO4 A;  3C9N A;  1ZAG A;  4EUP A;  5GSR A;  3FOL A;  4MJ6 A;  3M1B A;  4WUU A;  3HE7 A;  4JQX A;  4MJI A;  4BKW A;  3L3J A;  3SDC A;  4Z76 A;  3VFR A;  5GSV A;  4G59 A;  1X7Q A;  5EU4 A;  1FFO A;  1PQZ A;  1ZHL A;  4U1J A;  5HHQ A;  5D7L A;  5ENW A;  5E9D A;  4NQC A;  1LEG A;  4PGD A;  3U0P A;  3TIE A;  1I1Y A;  3PWU A;  3VXS A;  3BH9 A;  3ES6 A;  3BEW A;  2BNQ A;  1S7W A;  2FYY A;  3D2U A;  4IIQ C;  1S7Q A;  3ARF A;  3KPS A;  1CG9 A;  1W0W A;  2BST A;  5MER A;  1ZT4 A;  1HOC A;  4PV8 A;  3OX8 A;  3BWA A;  4E0R A;  4ONO A;  1S9Y A;  3MRE A;  2ZSW A;  1XR8 A;  4N0C A;  1ONQ A;  4LCY A;  4HS3 A;  4JFO A;  1AGE A;  3DMM A;  1B0G A;  1GZQ A;  3BXN A;  3BH8 A;  5EO0 A;  4G43 A;  2GUO A;  1YPZ A;  4FFE X;  4PV9 A;  5B39 A;  4MS8 A;  3QUK A;  3FT4 A;  2ESV A;  4CVZ A;  5BJT A;  3B3I A;  2AV1 A;  2CIK A;  3FQR A;  3V5D A;  2F54 A;  3GMP A;  2ZOL A;  3BP4 A;  2ZOK A;  5C0A A;  3HUJ A;  1N59 A;  3SJV A;  3DX7 A;  2X4R A;  2AV7 A;  2BCK A;  3BZF A;  3MRD A;  2VE6 A;  4PRA A;  2YPK A;  4PP8 C;  4PRN A;  3QDG A;  4MQ7 A;  3SPV A;  3MA7 A;  5IVX A;  3ARE A;  1SYV A;  4MNQ A;  1RK1 A;  4HX1 A;  3VXR A;  4GKN A;  3CH1 A;  3X11 A;  3TO4 A;  4PJH A;  4PGE A;  3I6L D;  3MRM A;  2GAZ A;  4PRI A;  3I6K A;  1HYR C;  3VFN A;  1ZHB A;  1HHJ A;  2Q7Y A;  1S9X A;  4N0U A;  3VRJ A;  3D3V A;  4X6E A;  3QZW A;  4U1L A;  3TA3 A;  5C0C A;  3LN4 A;  5C07 A;  4F7T A;  3KPL A;  3VFW A;  3T1F A;  3MRB A;  5F1N A;  3GMM A;  4G9D A;  5ACZ A;  2V2X A;  3I6G A;  3KPR A;  2CKB H;  2AK4 A;  4QRS A;  3VFO A;  5IEK A;  3AU1 A;  3KLA A;  4F7M A;  1I1F A;  2XFX A;  3IT8 D;  3L3D A;  3SKO A;  1GZP A;  1CD1 A;  4WW2 C;  3RWD A;  1JUF A;  3QQ4 A;  2BVO A;  5EO1 A;  1OF2 A;  1QR1 A;  5HGA A;  3P9L A;  3DBX A;  1ZT7 A;  1TVB A;  4HUW A;  3TBV A;  2PYE A;  4PRD A;  1K5N A;  4PJC A;  5FDW A;  5F9J A;  3ROL A;  3RGV C;  5E8O A;  4LCC C;  1ZHK A;  3VXP A;  5L2J A;  3TBS A;  5IM7 A;  1XR9 A;  4QRP A;  3RWH A;  3WLB A;  5SWS A;  3KYN A;  1T22 A;  1BII A;  5IRO A;  3UTQ A;  1A1M A;  3MYJ A;  1JPF A;  1VAC A;  3QUX A;  3MRG A;  2BSR A;  1T1Z A;  1JE6 A;  3QFJ A;  1T20 A;  1M6O A;  1E27 A;  3TID A;  4ELM A;  2CLV A;  3P4N A;  2F74 A;  3GMO A;  1RJZ A;  3QQ3 A;  5H94 A;  4EN3 C;  5J6H A;  4CW1 A;  1I7T A;  1NAM H;  3L3K A;  3V5H A;  1WBY A;  1LP9 A;  3OXS A;  4NQD A;  1T1Y A;  4EI5 A;  4QRT A;  1JHT A;  3HAE A;  2VLJ A;  3PWN A;  3CC5 A;  1YN7 A;  1OGT A;  5FA3 A;  4O2F A;  3RWJ A;  4NQX A;  2HLA A;  4ZUS A;  2CLR A;  4PJ5 A;  1DDH A;  1SYS A;  3VXU A;  3ERY A;  1FG2 A;  3MV8 A;  3W0W A;  1L8J A;  2BSS A;  2GTW A;  1S8D A;  3BW9 A;  3KPQ A;  2WY3 A;  3RUG A;  5JHD A;  3H9H A;  3UBX A;  2O5N A;  3VRI A;  1HHI A;  2HN7 A;  3RTQ A;  2X4T A;  2AXG A;  1JPG A;  4N5E A;  3BP7 A;  4CVX A;  3ARB A;  1EEY A;  1AO7 A;  5EOT A;  1DUZ A;  3SCM A;  5C0E A;  3QFD A;  4QRU A;  3DTX A;  1EXU A;  4Y4K A;  4X6F A;  1HHK A;  3X13 A;  4U1K A;  1I4F A;  2CII A;  5C9J A;  1T1X A;  1LK2 A;  5D2L A;  3BZE A;  3HG1 A;  4PJ9 A;  1T80 A;  5EU3 A;  2H6P A;  2JCC A;  3TFK A;  1T7Y A;  1KJ3 H;  5IEH A;  1T21 A;  4HUU A;  1KJM A;  4JFF A;  4MJ5 A;  5MEP A;  3O4L A;  3TJH A;  3HE6 A;  4NT6 A;  3O3D A;  1INQ A;  1MI5 A;  2FO4 A;  4JFQ A;  2VLK A;  3S6C A;  5HYJ A;  1NEZ A;  4L3C A;  4S0U C;  3IXA A;  4NHU E;  4Y2D A;  3LN5 A;  3QUY A;  3VFS A;  2F53 A;  2FIK A;  3P4O A;  1JFM A;  1AGC A;  1S7T A;  4ZUT A;  1XZ0 A;  5MEN A;  1T1W A;  3L3H A;  4WU7 A;  5C08 A;  4JO8 A;  3TVM A;  3GMQ A;  3QDM A;  3GSU A;  4L4V A;  3LKO A;  4PJX A;  3M17 A;  2GT9 A;  3CPL A;  2X4N A;  3GSQ A;  3L3I A;  3O3A A;  1I7R A;  3LKN A;  4JFE A;  4MNG A;  5IB3 A;  4PJB A;  3RZC A;  5HHP A;  3MRI A;  3CDG A;  5MEQ A;  3MRL A;  3GMN A;  4IRJ A;  5IB5 A;  2NW3 A;  3GMR A;  1QVO A;  1LD9 A;  1R3H A;  4ZAK A;  4PDC E;  3MRF A;  5HHN A;  1FFP A;  3HPJ A;  1DE4 A;  4G9F A;  3VWK A;  4LCW A;  5D5M A;  4L8C A;  3JVG A;  3E6F A;  3E3Q A;  1EEZ A;  4UQ2 A;  4D0B A;  1N2R A;  3FFC A;  3TBT A;  4ZUU A;  3WS6 A;  4V3E B;  2AXF A;  2XPG A;  3FON A;  3GSN H;  3KYO A;  1A6Z A;  4HUX A;  1S7R A;  3O9W A;  3ILP A;  5C0G A;  4PRB A;  1UQS A;  3MR9 A;  2BVQ A;  2NX5 A;  1FZK A;  1FO0 H;  1FZJ A;  3LKR A;  2P5E A;  3MV9 A;  4F7E A;  1BD2 A;  4L29 A;  4NNY A;  5IB4 A;  2NYK A;  1HSB A;  2D31 A;  3O3E A;  4PR5 A;  3PWL A;  3RL1 A;  3QUL A;  3MRJ A;  5EU5 A;  1VGK A;  5DEF A;  1S9W A;  3TPU E;  1KPR A;  3GSX A;  2RFX A;  3L9R A;  5E00 A;  5FA4 A;  3RWG A;  3T8X A;  5BS0 A;  1NAN H;  3QUZ A;  1N5A A;  4ZFZ A;  1QEW A;  3FQX A;  5C0D A;  1TMC A;  3ROO A;  4U1M A;  5ISZ A;  1S7U A;  2X4P A;  3MRN A;  3VWJ A;  2X70 A;  2X4Q A;  3GIV A;  3SDA A;  3MRP A;  3GSV A;  5D7I A;  3BVN A;  1LEK A;  4U6X A;  3MGT A;  5HHM A;  3VXO A;  3PAB A;  3CVH A;  1A1N A;  1E28 A;  3VFU A;  1U58 A;  3RWI A;  4QOK A;  3SDX A;  5HGB A;  1HHH A;  4N8V A;  4E5X A;  1Z5L A;  3FT2 A;  1JGE A;  1S7V A;  3MRK A;  4F7C A;  4PJA A;  3QDJ A;  1P7Q A;  3JTC A;  1QO3 A;  4U1H A;  3RWC A;  3E6H A;  2ZSV A;  1M05 A;  2HJK A;  5FKP A;  4WDI A;  1RJY A;  3GML A;  4ZUV A;  4LHU A;  4L3E A;  1FZO A;  4G59 C;  5EUO A;  3KXF A;  3LKQ A;  4G42 A;  2CLZ A;  3KWW A;  4JRY A;  4K71 B;  4HV8 A;  3ARD A;  2V2W A;  4QRQ A;  5EFI A;  5BXF A;  1W0V A;  5HGD A;  3MRO A;  4PJG A;  3L3G A;  3PWV A;  3GSO A;  4PGB A;  4WJ5 A;  3PQY A;  2GIT A;  2VAB A;  1KJ2 H;  1IM9 A;  3PWP A;  4WWK C;  1B3J A;  1RK0 A;  4XXC A;  4LNR A;  1KCG C;  3B6S A;  4U1S A;  3W39 A;  3WS3 A;  5IB1 A;  3NFN A;  1IM3 A;  3LKS A;  4X6D A;  1FFN A;  5HGH A;  5BRZ A;  4MXQ A;  1QSE A;  3FQT A;  4NO3 A;  3HCV A;  1S7X A;  1CE6 A;  3C8K A;  2DYP A;  3CCH A;  3VH8 A;  3D39 A;  3GSR A;  1T7Z A;  1QSF A;  3FOM A;  1KJV A;  3SKM A;  3MRH A;  2X4S A;  4PG9 A;  4PG2 A;  4U1I A;  3TN0 A;  4APQ A;  5J6G A;  4Z77 A;  3RWE A;  3BEV A;  4U6Y A;  3VXN A;  4D0C A;  1A9E A;  3OXR A;  3GJF A;  3VFP A;  1HSA A;  4PJ7 A;  3LKP A;  4NNX A;  1MHE A;  1WBX A;  4PRE A;  1Q94 A;  3PWJ A;  1T7V A;  3D18 A;  3P9M A;  1QLF A;  4JFP A;  3VFV A;  3VCL A;  3I0T A;  3FQW A;  3QEQ A;  1LDP H;  4PJE A;  3TZV C;  3MRC A;  3D25 A;  2YPL A;  2X4U A;  1I1A A;  3TBW A;  4PJD A;  2FZ3 A; 
#chains in the Genus database with same CATH homology
 3MRR A;  2AKR A;  4L8S C;  4U1N A;  4NQE A;  3FQU A;  1WBZ A;  3UTS A;  4NSK A;  1ZS8 A;  5D7J C;  1JF1 A;  2OI9 A;  3FQN A;  1G6R H;  4Y4F A;  2VAA A;  3KPP A;  3V5K A;  2BNR A;  1BQH A;  1G7Q A;  1T7W A;  4G8I A;  2J8U A;  3RWF A;  3SDD A;  2MHA A;  2VLL A;  1K8D A;  3BGM A;  2FWO A;  2YEZ A;  4NO0 A;  4O2E A;  1MWA H;  5DEG A;  3UTT A;  1KBG H;  3MGO A;  2GTZ A;  4G8G A;  1AKJ A;  1OSZ A;  4HWZ A;  4PRH A;  1QRN A;  1XH3 A;  1ZT1 A;  2OL3 H;  3CZF A;  1KPU A;  4L8B A;  5AD0 A;  5EU6 A;  4Z78 A;  1ED3 A;  3H9S A;  4MVB A;  1T0N A;  5E6I C;  4F7P A;  3VFM A;  2H26 A;  1ZSD A;  5E8N A;  1AGD A;  3FTG A;  4QRR A;  5F1I A;  4UQ3 A;  4PJ8 A;  3RL2 A;  4JFD A;  4JQV A;  3FT3 A;  4PGC A;  3KPN A;  2GJ6 A;  3OV6 A;  4I4W A;  5C0B A;  3P77 A;  5E8P A;  4Y16 A;  3HLA A;  3X14 A;  1ZHN A;  4D0D A;  1QQD A;  1BZ9 A;  4X6C A;  5DDH A;  5SWQ A;  5D9S A;  3MV7 A;  2HJL A;  3G08 A;  4L9L C;  3E2H A;  1UXW A;  4PRP A;  1DUY A;  3AM8 A;  4N0F A;  1LQV A;  1TVH A;  1YDP A;  3TBY A;  2BVP A;  4HKJ A;  3DX8 A;  3VJ6 A;  1T7X A;  1G7P A;  4Y4H A;  1MHC A;  3JTT A;  5J1A A;  4FTV A;  3ARG A;  5SWZ A;  3WUW A;  5C0J A;  3TO2 A;  2X4O A;  3BUY A;  3P4M A;  1UXS A;  4GKS A;  4PJF A;  5D2N A;  1EFX A;  5C0F A;  4ZUW A;  3GSW A;  1W72 A;  1HHG A;  1KPV A;  3BO8 A;  4K7F A;  3X12 A;  3O3B A;  4WU5 A;  1N3N A;  3BHB A;  3DX6 A;  1P4L A;  3ILQ C;  1C16 A;  2C7U A;  1FZM A;  2E7L E;  3KPM A;  1B0R A;  4IRS A;  4NQV A;  4PJI A;  3P73 A;  5B38 A;  3DXA A;  4NO5 A;  5HHO A;  3WL9 A;  5C0I A;  5MEO A;  4GUP A;  3JTS A;  1AGF A;  1KTL A;  2VLR A;  4O2C A;  5IND A;  4V3D B;  5INC A;  5L2K A;  2UWE A;  5F7D A;  2P5W A;  3FRU A;  3O8X A;  4I48 A;  3H7B A;  1AGB A;  4L8D A;  3REW A;  5IB2 A;  3UPR A;  1A9B A;  3MRQ A;  1I7U A;  4IHO A;  1VAD A;  1OGA A;  2A83 A;  2PO6 A;  3KPO A;  4MX7 A;  5C09 A;  1JGD A;  4NO2 A;  3LV3 A;  1T0M A;  3VFT A;  3ECB A;  4JRX A;  1ZVS A;  3VXM A;  1YN6 A;  1A1O A;  4HUV A;  4L4T A;  1S7S A;  3QI9 A;  1P1Z A;  3TF7 A;  4WO4 A;  3C9N A;  1ZAG A;  4EUP A;  5GSR A;  3FOL A;  4MJ6 A;  3M1B A;  4WUU A;  3HE7 A;  4JQX A;  4MJI A;  4Z76 A;  3L3J A;  3SDC A;  3VFR A;  5GSV A;  4G59 A;  1X7Q A;  5EU4 A;  1FFO A;  1PQZ A;  1ZHL A;  4U1J A;  5HHQ A;  5D7L A;  5ENW A;  5E9D A;  4NQC A;  1LEG A;  4PGD A;  3U0P A;  3TIE A;  1I1Y A;  3PWU A;  3VXS A;  3BH9 A;  3ES6 A;  3BEW A;  2BNQ A;  1S7W A;  2FYY A;  3D2U A;  4IIQ C;  1S7Q A;  3ARF A;  3KPS A;  1CG9 A;  1W0W A;  2BST A;  5MER A;  1ZT4 A;  1HOC A;  4PV8 A;  3OX8 A;  3BWA A;  4E0R A;  4ONO A;  1S9Y A;  3MRE A;  2ZSW A;  1XR8 A;  4N0C A;  1ONQ A;  4LCY A;  4HS3 A;  4JFO A;  1AGE A;  3DMM A;  1B0G A;  1GZQ A;  3BXN A;  3BH8 A;  5EO0 A;  4G43 A;  2GUO A;  1YPZ A;  4FFE X;  4PV9 A;  5B39 A;  4MS8 A;  3QUK A;  3FT4 A;  2ESV A;  4CVZ A;  5BJT A;  3B3I A;  2AV1 A;  2CIK A;  3FQR A;  3V5D A;  2F54 A;  3GMP A;  2ZOL A;  3BP4 A;  2ZOK A;  5C0A A;  3HUJ A;  1N59 A;  3SJV A;  3DX7 A;  2X4R A;  2AV7 A;  2BCK A;  3BZF A;  3MRD A;  2VE6 A;  4PRA A;  2YPK A;  4PP8 C;  4PRN A;  3QDG A;  4MQ7 A;  3SPV A;  3MA7 A;  5IVX A;  3ARE A;  1SYV A;  4MNQ A;  1RK1 A;  4HX1 A;  3VXR A;  4GKN A;  3CH1 A;  3X11 A;  3TO4 A;  4PJH A;  4PGE A;  3I6L D;  3MRM A;  2GAZ A;  4PRI A;  3I6K A;  1HYR C;  3VFN A;  1ZHB A;  1HHJ A;  2Q7Y A;  1S9X A;  4N0U A;  3VRJ A;  3D3V A;  4X6E A;  3QZW A;  4U1L A;  3TA3 A;  5C0C A;  3LN4 A;  5C07 A;  4F7T A;  3KPL A;  3VFW A;  3T1F A;  3MRB A;  5F1N A;  3GMM A;  4G9D A;  5ACZ A;  2V2X A;  3I6G A;  3KPR A;  2CKB H;  2AK4 A;  4QRS A;  3VFO A;  5IEK A;  3AU1 A;  3KLA A;  4F7M A;  1I1F A;  2XFX A;  3IT8 D;  3L3D A;  3SKO A;  1GZP A;  1CD1 A;  4WW2 C;  3RWD A;  1JUF A;  3QQ4 A;  2BVO A;  5EO1 A;  1OF2 A;  1QR1 A;  5HGA A;  3P9L A;  3DBX A;  1ZT7 A;  1TVB A;  4HUW A;  3TBV A;  2PYE A;  4PRD A;  1K5N A;  4PJC A;  5FDW A;  5F9J A;  3ROL A;  3RGV C;  5E8O A;  4LCC C;  1ZHK A;  3VXP A;  5L2J A;  3TBS A;  5IM7 A;  1XR9 A;  4QRP A;  3RWH A;  3WLB A;  5SWS A;  3KYN A;  1T22 A;  1BII A;  5IRO A;  3UTQ A;  1A1M A;  3MYJ A;  1JPF A;  1VAC A;  3QUX A;  3MRG A;  2BSR A;  1T1Z A;  1JE6 A;  3QFJ A;  1T20 A;  1M6O A;  1E27 A;  3TID A;  4ELM A;  2CLV A;  3P4N A;  2F74 A;  3GMO A;  1RJZ A;  3QQ3 A;  5H94 A;  4EN3 C;  5J6H A;  4CW1 A;  1I7T A;  1NAM H;  3L3K A;  3V5H A;  1WBY A;  1LP9 A;  3OXS A;  4NQD A;  1T1Y A;  4EI5 A;  4QRT A;  1JHT A;  3HAE A;  2VLJ A;  3PWN A;  3CC5 A;  1YN7 A;  1OGT A;  5FA3 A;  4O2F A;  3RWJ A;  4NQX A;  2HLA A;  4ZUS A;  2CLR A;  4PJ5 A;  1DDH A;  1SYS A;  3VXU A;  3ERY A;  1FG2 A;  3MV8 A;  3W0W A;  1L8J A;  2BSS A;  2GTW A;  1S8D A;  3BW9 A;  3KPQ A;  2WY3 A;  3RUG A;  5JHD A;  3H9H A;  3UBX A;  3VRI A;  1HHI A;  2HN7 A;  3RTQ A;  2X4T A;  2AXG A;  1JPG A;  4N5E A;  3BP7 A;  4CVX A;  3ARB A;  1EEY A;  1AO7 A;  5EOT A;  1DUZ A;  3SCM A;  5C0E A;  3QFD A;  4QRU A;  3DTX A;  1EXU A;  4Y4K A;  4X6F A;  1HHK A;  3X13 A;  4U1K A;  1I4F A;  2CII A;  5C9J A;  1T1X A;  1LK2 A;  5D2L A;  3BZE A;  3HG1 A;  4PJ9 A;  1T80 A;  5EU3 A;  2H6P A;  2JCC A;  3TFK A;  1T7Y A;  1KJ3 H;  5IEH A;  1T21 A;  4HUU A;  1KJM A;  4JFF A;  4MJ5 A;  5MEP A;  3O4L A;  3TJH A;  3HE6 A;  4NT6 A;  3O3D A;  1INQ A;  1MI5 A;  2FO4 A;  4JFQ A;  2VLK A;  3S6C A;  5HYJ A;  1NEZ A;  4L3C A;  4S0U C;  3IXA A;  4NHU E;  4Y2D A;  3LN5 A;  3QUY A;  3VFS A;  2F53 A;  2FIK A;  3P4O A;  1JFM A;  1AGC A;  1S7T A;  4ZUT A;  1XZ0 A;  5MEN A;  1T1W A;  3L3H A;  4WU7 A;  5C08 A;  3TVM A;  3GMQ A;  3QDM A;  3GSU A;  4L4V A;  3LKO A;  4PJX A;  3M17 A;  2GT9 A;  3CPL A;  2X4N A;  3GSQ A;  3L3I A;  3O3A A;  1I7R A;  3LKN A;  4JFE A;  4MNG A;  5IB3 A;  4PJB A;  3RZC A;  5HHP A;  3MRI A;  3CDG A;  5MEQ A;  3MRL A;  3GMN A;  4IRJ A;  5IB5 A;  2NW3 A;  3GMR A;  1QVO A;  1LD9 A;  1R3H A;  4ZAK A;  4PDC E;  3MRF A;  5HHN A;  1FFP A;  3HPJ A;  1DE4 A;  4G9F A;  3VWK A;  4LCW A;  5D5M A;  4L8C A;  3JVG A;  3E6F A;  3E3Q A;  1EEZ A;  4UQ2 A;  4D0B A;  1N2R A;  3FFC A;  3TBT A;  4ZUU A;  3WS6 A;  4V3E B;  2AXF A;  2XPG A;  3FON A;  3GSN H;  3KYO A;  1A6Z A;  4HUX A;  1S7R A;  3O9W A;  3ILP A;  5C0G A;  4PRB A;  1UQS A;  3MR9 A;  2BVQ A;  2NX5 A;  1FZK A;  1FO0 H;  1FZJ A;  3LKR A;  2P5E A;  3MV9 A;  4F7E A;  1BD2 A;  4L29 A;  4NNY A;  5IB4 A;  1HSB A;  2D31 A;  3O3E A;  4PR5 A;  3PWL A;  3RL1 A;  3QUL A;  3MRJ A;  5EU5 A;  1VGK A;  5DEF A;  1S9W A;  3TPU E;  1KPR A;  3GSX A;  2RFX A;  3L9R A;  5E00 A;  5FA4 A;  3RWG A;  3T8X A;  5BS0 A;  1NAN H;  3QUZ A;  1N5A A;  4ZFZ A;  1QEW A;  3FQX A;  5C0D A;  1TMC A;  3ROO A;  4U1M A;  5ISZ A;  1S7U A;  2X4P A;  3MRN A;  3VWJ A;  2X70 A;  2X4Q A;  3GIV A;  3SDA A;  3MRP A;  3GSV A;  5D7I A;  3BVN A;  1LEK A;  4U6X A;  3MGT A;  5HHM A;  3VXO A;  3PAB A;  3CVH A;  1A1N A;  1E28 A;  3VFU A;  1U58 A;  3RWI A;  4QOK A;  3SDX A;  5HGB A;  1HHH A;  4N8V A;  4E5X A;  1Z5L A;  3FT2 A;  1JGE A;  1S7V A;  3MRK A;  4F7C A;  4PJA A;  3QDJ A;  1P7Q A;  3JTC A;  1QO3 A;  4U1H A;  3RWC A;  3E6H A;  2ZSV A;  1M05 A;  2HJK A;  5FKP A;  4WDI A;  1RJY A;  3GML A;  4ZUV A;  4LHU A;  4L3E A;  1FZO A;  5EUO A;  3KXF A;  3LKQ A;  4G42 A;  2CLZ A;  3KWW A;  4JRY A;  4K71 B;  4HV8 A;  3ARD A;  2V2W A;  4QRQ A;  5EFI A;  5BXF A;  1W0V A;  5HGD A;  3MRO A;  4PJG A;  3L3G A;  3PWV A;  3GSO A;  4PGB A;  4WJ5 A;  3PQY A;  2GIT A;  2VAB A;  1KJ2 H;  1IM9 A;  3PWP A;  4WWK C;  1B3J A;  1RK0 A;  4XXC A;  4LNR A;  1KCG C;  3B6S A;  4U1S A;  3W39 A;  3WS3 A;  5IB1 A;  3NFN A;  1IM3 A;  3LKS A;  4X6D A;  1FFN A;  5HGH A;  5BRZ A;  4MXQ A;  1QSE A;  3FQT A;  4NO3 A;  3HCV A;  1S7X A;  1CE6 A;  3C8K A;  2DYP A;  3CCH A;  3VH8 A;  3D39 A;  3GSR A;  1T7Z A;  1QSF A;  3FOM A;  1KJV A;  3SKM A;  3MRH A;  2X4S A;  4PG9 A;  4PG2 A;  4U1I A;  3TN0 A;  4APQ A;  5J6G A;  4Z77 A;  3RWE A;  3BEV A;  4U6Y A;  3VXN A;  4D0C A;  1A9E A;  3OXR A;  3GJF A;  3VFP A;  1HSA A;  4PJ7 A;  3LKP A;  4NNX A;  1MHE A;  1WBX A;  4PRE A;  1Q94 A;  3PWJ A;  1T7V A;  3D18 A;  3P9M A;  1QLF A;  4JFP A;  3VFV A;  3VCL A;  3FQW A;  3QEQ A;  1LDP H;  4PJE A;  3TZV C;  3MRC A;  3D25 A;  2YPL A;  2X4U A;  1I1A A;  3TBW A;  4PJD A;  2FZ3 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...