3TFKA

42f3-p4b10/h2-ld
Total Genus 52
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
52
sequence length
174
structure length
174
Chain Sequence
PHSMRYYETATSRRGLGEPRYTSVGYVDDKEFVRFDSDAENPRYEPQVPWMEQEGPEYWERITQVAKGQEQWFRVNLRTLLGYYNQSAGGTHTLQRMYGCDVGSDGRLLRGYEQFAYDGCDYIALNEDLRTWTAADMAAQITRRKWEQAGAAEYYRAYLEGECVEWLHRYLKNG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords H2-Ld SBM2
publication title T cell receptor signaling is limited by docking geometry to peptide-major histocompatibility complex.
pubmed doi rcsb
source organism Mus musculus
molecule tags Immune system
total genus 52
structure length 174
sequence length 174
ec nomenclature
pdb deposition date 2011-08-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00129 MHC_I Class I Histocompatibility antigen, domains alpha 1 and 2
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.500.10 Alpha Beta 2-Layer Sandwich Murine Class I Major Histocompatibility Complex, H2-DB; Chain A, domain 1 MHC class I-like antigen recognition-like 3tfkA00
3X13A 3E3QA 3QUXA 4N0FA 3SKMA 4PJ8A 5DDHA 3VJ6A 4UQ2A 4U1HA 4F7PA 1T22A 3SCMA 4L3CA 3PWUA 4PRBA 4Y2DA 1NAMH 1EFXA 4NT6A 3TZVC 2E7LE 1T1WA 5MEOA 4HUXA 3UTQA 2VE6A 5EFIA 3O3BA 4Y4KA 5EU5A 3S6CA 3BXNA 3VXPA 1A6ZA 3L9RA 3GMPA 5E8PA 5C0BA 2ZSWA 3LN4A 5F1IA 5C07A 3TIEA 4D0DA 5D5MA 2BVQA 2X4QA 3GMQA 2XPGA 3GMRA 3E6HA 4HKJA 1QLFA 2X70A 1N59A 4PJEA 4G42A 4G9FA 2P5WA 3FQUA 4IRJA 3LN5A 1QRNA 2VAAA 4JFQA 2OI9A 3CPLA 1UXSA 3KPMA 2DYPA 3TBVA 3FT2A 3VFTA 3PWLA 3BH9A 3O3EA 4U1SA 3JTCA 3KWWA 1E27A 2VABA 2FIKA 4U1NA 4PGBA 4EN3C 3AU1A 3GSUA 3VRJA 3FT4A 3CDGA 5D7IA 2VLJA 3PWVA 4JFEA 3VCLA 4PG2A 3C8KA 1ZT4A 3DX7A 3L3IA 1ZHNA 1ZT1A 1FZJA 3D3VA 1P4LA 3QZWA 4HUUA 4PJCA 2GJ6A 2CLRA 4U1LA 5E00A 5FA4A 3FFCA 3GSQA 3CZFA 4K71B 4NO5A 3VXUA 5IB4A 2P5EA 1T7XA 3GSXA 2BNQA 4PP8C 1FFOA 3LKNA 3WL9A 2VLRA 2YPLA 2FZ3A 5C0DA 5D7LA 3HLAA 3DTXA 5HHPA 5HHNA 4LCYA 4HWZA 3L3DA 1K5NA 3RL2A 3TO2A 2HN7A 2VLKA 1MHCA 2CIKA 1T0NA 1AGFA 2X4TA 2YPKA 3TBYA 4O2CA 2AV7A 4PJHA 2BVOA 4FFEX 4L4TA 4U6YA 1W72A 2ZOKA 3AREA 2BSRA 4CVXA 2F53A 1AGBA 3TN0A 3LV3A 3RWDA 3UTSA 3HE7A 3MRPA 5EU6A 3QUZA 4NQEA 3HCVA 4PJIA 1W0VA 3H9SA 3FQTA 3KPRA 4FTVA 1KJ3H 1WBZA 4U1JA 1KJVA 3GIVA 3TA3A 1M05A 4MNQA 2X4NA 4NQXA 3O4LA 4ZUVA 3KPLA 1LD9A 3ERYA 1DDHA 3MYJA 2HJKA 1S7UA 5DEGA 4V3DB 3BUYA 3FQXA 2YEZA 3RWJA 4CVZA 1PQZA 4I48A 3KPNA 3MRCA 4PJAA 1KCGC 3ECBA 3H7BA 3OX8A 4JFFA 5SWZA 1T7ZA 4Z77A 3U0PA 3DX8A 4PJ9A 4PRPA 4L29A 4WW2C 2AK4A 4MVBA 3RUGA 1OGTA 1JPGA 3KXFA 3FQRA 3FRUA 1JHTA 1XR8A 2MHAA 2WY3A 3B3IA 3CC5A 1ZHBA 1ZVSA 4JQVA 4JRYA 4E5XA 1JGDA 1TMCA 1I1YA 5BXFA 4Y4FA 4PJ7A 3RWIA 3TIDA 2H26A 1NEZA 4WO4A 4HUWA 1I7UA 5C0FA 4G43A 4PRAA 5MENA 4L8BA 4MJIA 3TVMA 4N0UA 1BQHA 2XFXA 3MRLA 3P4OA 4JFDA 2Q7YA 5HGAA 3WS3A 3W39A 3MREA 3VFMA 1MWAH 1RJYA 3GMNA 4ELMA 1JPFA 1LK2A 4WU7A 3FTGA 4EUPA 1FG2A 1N2RA 3MR9A 2PO6A 3LKPA 3LKRA 1I7RA 4ZUTA 5B39A 5J6HA 3GMLA 1OGAA 5H94A 3L3JA 3DMMA 4PGDA 1CG9A 1HSAA 1S7VA 1S9XA 3VH8A 2J8UA 3ARFA 4MJ6A 3VFUA 5FA3A 4APQA 3BO8A 4ZFZA 3VXRA 3BP7A 1YDPA 1HYRC 3FT3A 3QDGA 5HHOA 4LNRA 4ZUUA 1VGKA 3D39A 3MRQA 3UBXA 5HGBA 4PJDA 3VFOA 3IXAA 1BD2A 1R3HA 4X6CA 5D7JC 1KPRA 3JTSA 3ROLA 3W0WA 1A1NA 1AKJA 3M17A 4U6XA 1Q94A 4PR5A 1QQDA 5BRZA 1JFMA 3FQNA 4NO0A 4NNXA 1NANH 1CD1A 2C7UA 5ENWA 4PV8A 3LKQA 3SJVA 3NFNA 3VXMA 2GUOA 4F7EA 4PV9A 2X4OA 3QQ4A 3IT8D 1S8DA 3TBTA 5B38A 2BSTA 4L4VA 4QRRA 1ZSDA 5SWSA 3MGTA 3CVHA 1W0WA 5L2KA 3RL1A 4NO3A 1CE6A 3QFDA 2AXFA 3QI9A 4O2FA 4QRPA 1QSEA 1T1YA 4D0BA 3VXOA 3KPPA 4PGEA 1EEYA 3SDAA 4L8CA 4X6DA 3SDCA 5D2LA 3PQYA 2CLVA 3GMMA 5IVXA 5C0EA 4LCCC 2F54A 1SYSA 3REWA 3SDDA 4MX7A 4EI5A 1DE4A 2X4PA 5AD0A 3VFPA 1K8DA 4PRIA 1T7VA 1P7QA 1WBYA 3V5HA 3ARGA 3TPUE 4PRHA 5F7DA 4PGCA 2H6PA 4IRSA 3TBWA 3GJFA 2X4UA 4HV8A 1HSBA 4O2EA 1AO7A 3KLAA 4HUVA 4MQ7A 3JTTA 3V5KA 3MRDA 1M6OA 1B3JA 3PWJA 4Z76A 3OV6A 2PYEA 1UXWA 1FO0H 3P73A 5C09A 4QRQA 3BEWA 3MROA 4PJBA 5GSVA 4E0RA 2HJLA 1S7RA 3RTQA 1FFNA 4MJ5A 2ZOLA 5MEPA 3KPSA 2CKBH 1ZHKA 2FWOA 4F7TA 1VADA 2V2XA 4NQCA 3X14A 1LEGA 3BW9A 4PRNA 1WBXA 5BS0A 3GSVA 3ARDA 5E6IC 1YN6A 3TFKA 3MRMA 4PJFA 5C0IA 1KBGH 4JQXA 4F7CA 4WUUA 3HPJA 5IM7A 3QEQA 4X6EA 3RWHA 1FZMA 4JFPA 5IEKA 5F1NA 2GITA 3QUKA 3BZFA 3I6KA 4N0CA 4Z78A 3FONA 3GSOA 2HLAA 1I1FA 1MHEA 3E6FA 3C9NA 5F9JA 4QOKA 1HHKA 3WLBA 1A1MA 2X4RA 2AV1A 5HGDA 4L8DA 5HGHA 1GZQA 3OXRA 3P9MA 4ZUWA 3KPOA 4GKNA 5DEFA 3MRGA 3MGOA 1ZHLA 1JGEA 5IEHA 3VXNA 1KJ2H 1G6RH 1TVBA 3HUJA 4X6FA 2RFXA 2F74A 1ZAGA 4U1MA 3L3HA 1ZS8A 3RWCA 5E9DA 1HHHA 4Y4HA 1XH3A 1LDPH 3DBXA 4PJGA 5INCA 4JFOA 3VFWA 3BHBA 3X12A 3RZCA 2CLZA 1XZ0A 3TO4A 1S7WA 1XR9A 3BGMA 3P77A 2FYYA 3HE6A 2FO4A 1G7PA 3SDXA 4F7MA 2NX5A 1YN7A 4MXQA 1ED3A 2V2WA 3SPVA 5E8NA 1HOCA 2A83A 4XXCA 1S7TA 4HS3A 2BNRA 5D2NA 3P4MA 1A9BA 4V3EB 3BP4A 1X7QA 4WWKC 2VLLA 5C9JA 1B0GA 3VWKA 5L2JA 1T80A 3RWFA 3ILPA 5FKPA 3BVNA 5EU4A 1GZPA 1AGCA 4CW1A 1IM9A 3X11A 4IHOA 3GSRA 3TJHA 5D9SA 3B6SA 4NQVA 5EOTA 3RGVC 3P4NA 4MS8A 4ZAKA 3RWGA 3PWNA 3ES6A 5MEQA 5SWQA 3HAEA 1QVOA 3TF7A 1S7XA 3MV8A 3MRRA 5C0JA 1N3NA 1QO3A 3QFJA 2GAZA 3SKOA 4HX1A 3T8XA 3MRNA 3G08A 1LEKA 1T7YA 4NSKA 4WDIA 3H9HA 5HHQA 5E8OA 1QEWA 1OSZA 4PG9A 2AKRA 4G8GA 4LHUA 5EO0A 3D25A 3L3GA 4D0CA 3PABA 3OXSA 3O3DA 1L8JA 4L8SC 3MV7A 3M1BA 1KTLA 3PWPA 4PDCE 4QRUA 5ISZA 5IB1A 3GMOA 3FOLA 3MV9A 1UQSA 5EUOA 1P1ZA 1DUYA 1T1ZA 3MRBA 3JVGA 1A1OA 1S9WA 5C0CA 3LKSA 1TVHA 1U58A 2GTWA 3HG1A 3AM8A 4PJ5A 1INQA 2BVPA 3CH1A 5C08A 3MRJA 2CIIA 4NNYA 4G59A 1BIIA 5INDA 1VACA 3DX6A 1JE6A 4S0UC 3I6GA 5EO1A 3D18A 1ONQA 4I4WA 3UTTA 4IIQC 5IB3A 3WUWA 1MI5A 3RWEA 3P9LA 4Y16A 4U1KA 3TBSA 3BEVA 5FDWA 1B0RA 1ZT7A 2GT9A 2D31A 1N5AA 1EXUA 1JUFA 3VFNA 4K7FA 1I7TA 2GTZA 4NHUE 5C0AA 3UPRA 3KYOA 4N8VA 2OL3H 1QSFA 5ACZA 5HHMA 3VXSA 1IM3A 1C16A 3MRHA 1FZKA 1T1XA 3ARBA 4L3EA 3KPQA 2AXGA 4NO2A 3GSNH 1AGDA 2ESVA 3QDMA 5HYJA 1OF2A 4L9LC 3LKOA 1I1AA 3VFSA 3BWAA 3CCHA 4ZUSA 1HHGA 2UWEA 1SYVA 4GKSA 4LCWA 4MNGA 1I4FA 4QRTA 5J1AA 1S9YA 5J6GA 3V5DA 1RK0A 3ILQC 1KPVA 3MRKA 3VFVA 3O9WA 2JCCA 3O8XA 3QULA 1JF1A 5EU3A 3FQWA 1DUZA 5MERA 1KJMA 3QUYA 1S7QA 4PREA 3WS6A 3BZEA 5GSRA 1G7QA 1FZOA 1LQVA 1FFPA 2BSSA 3FOMA 1Z5LA 1T0MA 4ONOA 1RJZA 3MA7A 3MRIA 1RK1A 2BCKA 4GUPA 1S7SA 5IB5A 4G8IA 5C0GA 3MRFA 1BZ9A 3KYNA 5IB2A 5JHDA 2X4SA 3O3AA 1YPZA 3E2HA 3I6LD 1QR1A 1EEZA 3DXAA 2NW3A 1LP9A 3QDJA 1KPUA 3VFRA 4U1IA 1T20A 3L3KA 4PRDA 4QRSA 4WU5A 4PJXA 5IROA 3ROOA 1A9EA 1HHIA 5BJTA 4NQDA 4N5EA 1E28A 4JRXA 1HHJA 1T21A 3QQ3A 4UQ3A 3BH8A 1AGEA 2ZSVA 4G9DA 4WJ5A 3VWJA 3VRIA 3T1FA 1T7WA 3D2UA 3GSWA
chains in the Genus database with same CATH superfamily
3X13A 3E3QA 3QUXA 4N0FA 3SKMA 4PJ8A 5DDHA 3VJ6A 4UQ2A 4U1HA 4F7PA 1T22A 3SCMA 4L3CA 3PWUA 4PRBA 4Y2DA 1NAMH 1EFXA 4NT6A 3TZVC 2E7LE 1T1WA 5MEOA 4HUXA 3UTQA 2VE6A 5EFIA 3O3BA 4Y4KA 5EU5A 3S6CA 3BXNA 3VXPA 1A6ZA 3L9RA 3GMPA 5E8PA 5C0BA 2ZSWA 3LN4A 5F1IA 5C07A 3TIEA 4D0DA 5D5MA 2BVQA 2X4QA 3GMQA 2XPGA 3GMRA 3E6HA 4HKJA 1QLFA 2X70A 1N59A 4PJEA 4G42A 4G9FA 2P5WA 3FQUA 4IRJA 3LN5A 1QRNA 2VAAA 4JFQA 2OI9A 3CPLA 4BKWA 1UXSA 3KPMA 2DYPA 3TBVA 3FT2A 3VFTA 3PWLA 3BH9A 3O3EA 4U1SA 3JTCA 3KWWA 1E27A 2VABA 2FIKA 4U1NA 4PGBA 4EN3C 3AU1A 3GSUA 3VRJA 3FT4A 3CDGA 5D7IA 2VLJA 3PWVA 4JFEA 3VCLA 4PG2A 3C8KA 1ZT4A 3DX7A 3L3IA 1ZHNA 1ZT1A 1FZJA 3D3VA 1P4LA 3QZWA 4HUUA 4PJCA 2GJ6A 2CLRA 4U1LA 5E00A 5FA4A 3FFCA 3GSQA 3CZFA 4K71B 4NO5A 3VXUA 5IB4A 2P5EA 1T7XA 3GSXA 2BNQA 4PP8C 1FFOA 3LKNA 3WL9A 2VLRA 2YPLA 2FZ3A 5C0DA 5D7LA 3HLAA 3DTXA 5HHPA 5HHNA 4LCYA 4HWZA 3L3DA 1K5NA 3RL2A 3TO2A 2HN7A 2VLKA 1MHCA 2CIKA 1T0NA 1AGFA 2X4TA 2YPKA 3TBYA 4O2CA 2AV7A 4PJHA 2BVOA 4FFEX 4L4TA 4U6YA 1W72A 2ZOKA 3AREA 2BSRA 4CVXA 2F53A 1AGBA 3TN0A 3LV3A 3RWDA 3UTSA 3HE7A 3MRPA 5EU6A 3QUZA 4NQEA 3HCVA 4PJIA 1W0VA 3H9SA 3FQTA 3KPRA 4FTVA 1KJ3H 1WBZA 4U1JA 1KJVA 3GIVA 3TA3A 1M05A 4MNQA 2X4NA 4NQXA 3O4LA 4ZUVA 3KPLA 1LD9A 3ERYA 1DDHA 3MYJA 2HJKA 1S7UA 5DEGA 4V3DB 3BUYA 3FQXA 2YEZA 3RWJA 4CVZA 1PQZA 4I48A 3KPNA 3MRCA 4PJAA 1KCGC 3ECBA 2NYKA 3H7BA 3OX8A 4JFFA 1T7ZA 5SWZA 4Z77A 3U0PA 3DX8A 4PJ9A 4PRPA 4L29A 4WW2C 2AK4A 4MVBA 3RUGA 1OGTA 1JPGA 3KXFA 3FQRA 3FRUA 1JHTA 1XR8A 2MHAA 2WY3A 3B3IA 3CC5A 1ZHBA 1ZVSA 4JQVA 4JRYA 4E5XA 1JGDA 1TMCA 1I1YA 5BXFA 4Y4FA 4PJ7A 3RWIA 3TIDA 2H26A 1NEZA 4WO4A 4HUWA 1I7UA 5C0FA 4G43A 4PRAA 5MENA 4L8BA 4MJIA 3TVMA 4N0UA 1BQHA 2XFXA 3MRLA 3P4OA 4JFDA 2Q7YA 5HGAA 3WS3A 3W39A 3MREA 3VFMA 1MWAH 1RJYA 3GMNA 4ELMA 1JPFA 1LK2A 4WU7A 3FTGA 4EUPA 1FG2A 1N2RA 3MR9A 2PO6A 3LKPA 3LKRA 1I7RA 4ZUTA 5B39A 5J6HA 3GMLA 1OGAA 5H94A 3L3JA 3DMMA 4PGDA 1CG9A 1HSAA 1S7VA 1S9XA 3VH8A 2J8UA 3ARFA 4MJ6A 3VFUA 5FA3A 4APQA 3BO8A 4ZFZA 3VXRA 3BP7A 1YDPA 1HYRC 3FT3A 3QDGA 5HHOA 4LNRA 4ZUUA 1VGKA 3D39A 3MRQA 3UBXA 5HGBA 4PJDA 3VFOA 3IXAA 1BD2A 1R3HA 4X6CA 5D7JC 1KPRA 3JTSA 3ROLA 3W0WA 1A1NA 1AKJA 3M17A 4U6XA 1Q94A 4PR5A 1QQDA 5BRZA 1JFMA 3FQNA 4NO0A 4NNXA 1NANH 1CD1A 2C7UA 5ENWA 4PV8A 3LKQA 3SJVA 3NFNA 3VXMA 2GUOA 4F7EA 4PV9A 2X4OA 3QQ4A 3IT8D 1S8DA 3TBTA 5B38A 2BSTA 4L4VA 4QRRA 1ZSDA 5SWSA 3MGTA 3CVHA 1W0WA 5L2KA 3RL1A 4NO3A 1CE6A 3QFDA 2AXFA 3QI9A 4O2FA 4QRPA 1QSEA 1T1YA 4D0BA 3VXOA 3KPPA 4PGEA 1EEYA 3SDAA 4L8CA 4X6DA 3SDCA 5D2LA 3PQYA 2CLVA 3GMMA 5IVXA 5C0EA 4LCCC 2F54A 1SYSA 3REWA 3SDDA 4MX7A 4EI5A 1DE4A 2X4PA 5AD0A 3VFPA 1K8DA 4PRIA 1T7VA 1P7QA 1WBYA 3V5HA 3ARGA 3TPUE 4PRHA 5F7DA 4PGCA 2H6PA 4IRSA 3TBWA 3GJFA 2X4UA 4HV8A 1HSBA 4O2EA 1AO7A 3KLAA 4HUVA 4MQ7A 3JTTA 3V5KA 3MRDA 1M6OA 1B3JA 3PWJA 4Z76A 3OV6A 2PYEA 1UXWA 1FO0H 3P73A 5C09A 4QRQA 3BEWA 3MROA 4PJBA 5GSVA 4E0RA 2HJLA 1S7RA 3RTQA 1FFNA 4MJ5A 2ZOLA 5MEPA 3KPSA 4G59C 2CKBH 1ZHKA 2FWOA 4F7TA 1VADA 2V2XA 4NQCA 3X14A 1LEGA 3BW9A 4PRNA 1WBXA 5BS0A 3GSVA 3ARDA 5E6IC 1YN6A 4JO8A 3TFKA 3MRMA 4PJFA 5C0IA 1KBGH 4JQXA 4F7CA 4WUUA 3HPJA 5IM7A 3QEQA 4X6EA 3RWHA 1FZMA 4JFPA 5IEKA 5F1NA 2GITA 3QUKA 3BZFA 3I6KA 4N0CA 4Z78A 3FONA 3GSOA 2HLAA 1I1FA 1MHEA 3E6FA 3C9NA 5F9JA 4QOKA 1HHKA 3WLBA 1A1MA 2X4RA 2AV1A 5HGDA 4L8DA 5HGHA 1GZQA 3OXRA 3P9MA 4ZUWA 3KPOA 4GKNA 5DEFA 3MRGA 3MGOA 1ZHLA 1JGEA 5IEHA 3VXNA 1KJ2H 1G6RH 1TVBA 3HUJA 4X6FA 2RFXA 2F74A 1ZAGA 4U1MA 3L3HA 1ZS8A 3RWCA 5E9DA 1HHHA 4Y4HA 1XH3A 1LDPH 3DBXA 4PJGA 5INCA 4JFOA 3VFWA 3BHBA 3X12A 3RZCA 2CLZA 1XZ0A 3TO4A 1S7WA 1XR9A 3BGMA 3P77A 2FYYA 3HE6A 2FO4A 1G7PA 3SDXA 4F7MA 2NX5A 1YN7A 4MXQA 1ED3A 2V2WA 3SPVA 5E8NA 1HOCA 2A83A 4XXCA 1S7TA 4HS3A 2BNRA 5D2NA 3P4MA 1A9BA 4V3EB 3BP4A 1X7QA 4WWKC 2VLLA 5C9JA 1B0GA 3VWKA 5L2JA 1T80A 3RWFA 3ILPA 5FKPA 3BVNA 5EU4A 1GZPA 1AGCA 4CW1A 1IM9A 3X11A 4IHOA 3GSRA 3TJHA 5D9SA 3B6SA 4NQVA 5EOTA 3RGVC 3P4NA 4MS8A 4ZAKA 3RWGA 3PWNA 3ES6A 5MEQA 5SWQA 3HAEA 1QVOA 3TF7A 1S7XA 3MV8A 3MRRA 5C0JA 1N3NA 1QO3A 2O5NA 3QFJA 2GAZA 3SKOA 4HX1A 3T8XA 3MRNA 3G08A 1LEKA 1T7YA 4NSKA 4WDIA 3H9HA 5HHQA 5E8OA 1QEWA 1OSZA 4PG9A 2AKRA 4G8GA 4LHUA 5EO0A 3D25A 3L3GA 4D0CA 3PABA 3OXSA 3O3DA 1L8JA 4L8SC 3MV7A 3M1BA 1KTLA 3PWPA 4PDCE 4QRUA 5ISZA 5IB1A 3GMOA 3FOLA 3MV9A 1UQSA 5EUOA 1P1ZA 1DUYA 1T1ZA 3MRBA 3JVGA 1A1OA 1S9WA 5C0CA 3LKSA 1TVHA 1U58A 2GTWA 3HG1A 3AM8A 4PJ5A 1INQA 2BVPA 3CH1A 5C08A 3MRJA 2CIIA 4NNYA 4G59A 1BIIA 5INDA 1VACA 3DX6A 1JE6A 3I0TA 4S0UC 3I6GA 5EO1A 3D18A 1ONQA 4I4WA 3UTTA 4IIQC 5IB3A 3WUWA 1MI5A 3RWEA 3P9LA 4Y16A 4U1KA 3TBSA 3BEVA 5FDWA 2IA1A 1B0RA 1ZT7A 2GT9A 2D31A 1N5AA 1EXUA 1JUFA 3VFNA 4K7FA 1I7TA 2GTZA 4NHUE 5C0AA 3UPRA 3KYOA 4N8VA 2OL3H 1QSFA 5ACZA 5HHMA 3VXSA 1IM3A 1C16A 3MRHA 1FZKA 1T1XA 3ARBA 4L3EA 3KPQA 2AXGA 4NO2A 3GSNH 1AGDA 2ESVA 3QDMA 5HYJA 1OF2A 4L9LC 3LKOA 1I1AA 3VFSA 3BWAA 3CCHA 4ZUSA 1HHGA 2UWEA 1SYVA 4GKSA 4LCWA 4MNGA 1I4FA 4QRTA 5J1AA 1S9YA 5J6GA 3V5DA 1RK0A 3ILQC 1KPVA 3MRKA 3VFVA 3O9WA 2JCCA 3O8XA 3QULA 1JF1A 5EU3A 3FQWA 1DUZA 5MERA 1KJMA 3QUYA 1S7QA 4PREA 3WS6A 3BZEA 5GSRA 1G7QA 1FZOA 1LQVA 1FFPA 2BSSA 3FOMA 1Z5LA 1T0MA 4ONOA 1RJZA 3MA7A 3MRIA 1RK1A 2BCKA 4GUPA 1S7SA 5IB5A 4G8IA 5C0GA 3MRFA 1BZ9A 3KYNA 5IB2A 5JHDA 2X4SA 3O3AA 1YPZA 3E2HA 3I6LD 1QR1A 1EEZA 3DXAA 2NW3A 1LP9A 3QDJA 1KPUA 3VFRA 4U1IA 1T20A 3L3KA 4PRDA 4QRSA 4WU5A 4PJXA 5IROA 3ROOA 1A9EA 1HHIA 5BJTA 4NQDA 4N5EA 1E28A 4JRXA 1HHJA 1T21A 3QQ3A 4UQ3A 3BH8A 1AGEA 2ZSVA 4G9DA 4WJ5A 3VWJA 3VRIA 3T1FA 1T7WA 3D2UA 3GSWA
chains in the Genus database with same CATH topology
3X13A 3E3QA 3QUXA 4N0FA 3SKMA 4PJ8A 5DDHA 3VJ6A 4UQ2A 4U1HA 4F7PA 1T22A 3SCMA 4L3CA 3PWUA 4PRBA 4Y2DA 1NAMH 1EFXA 4NT6A 3TZVC 2E7LE 1T1WA 5MEOA 4HUXA 3UTQA 2VE6A 5EFIA 3O3BA 4Y4KA 5EU5A 3S6CA 3BXNA 3VXPA 1A6ZA 3L9RA 3GMPA 5E8PA 5C0BA 2ZSWA 3LN4A 5F1IA 5C07A 3TIEA 4D0DA 5D5MA 2BVQA 2X4QA 3GMQA 2XPGA 3GMRA 3E6HA 4HKJA 1QLFA 2X70A 1N59A 4PJEA 4G42A 4G9FA 2P5WA 3FQUA 4IRJA 3LN5A 1QRNA 2VAAA 4JFQA 2OI9A 3CPLA 1UXSA 3KPMA 2DYPA 3TBVA 3FT2A 3VFTA 3PWLA 3BH9A 3O3EA 4U1SA 3JTCA 3KWWA 1E27A 2VABA 2FIKA 4U1NA 4PGBA 4EN3C 3AU1A 3GSUA 3VRJA 3FT4A 3CDGA 5D7IA 2VLJA 3PWVA 4JFEA 3VCLA 4PG2A 3C8KA 1ZT4A 3DX7A 3L3IA 1ZHNA 1ZT1A 1FZJA 3D3VA 1P4LA 3QZWA 4HUUA 4PJCA 2GJ6A 2CLRA 4U1LA 5E00A 5FA4A 3FFCA 3GSQA 3CZFA 4K71B 4NO5A 3VXUA 5IB4A 2P5EA 1T7XA 3GSXA 2BNQA 4PP8C 1FFOA 3LKNA 3WL9A 2VLRA 2YPLA 2FZ3A 5C0DA 5D7LA 3HLAA 3DTXA 5HHPA 5HHNA 4LCYA 4HWZA 3L3DA 1K5NA 3RL2A 3TO2A 2HN7A 2VLKA 1MHCA 2CIKA 1T0NA 1AGFA 2X4TA 2YPKA 3TBYA 4O2CA 2AV7A 4PJHA 2BVOA 4FFEX 4L4TA 4U6YA 1W72A 2ZOKA 3AREA 2BSRA 4CVXA 2F53A 1AGBA 3TN0A 3LV3A 3RWDA 3UTSA 3HE7A 3MRPA 5EU6A 3QUZA 4NQEA 3HCVA 4PJIA 1W0VA 3H9SA 3FQTA 3KPRA 4FTVA 1KJ3H 1WBZA 4U1JA 1KJVA 3GIVA 3TA3A 1M05A 4MNQA 2X4NA 4NQXA 3O4LA 4ZUVA 3KPLA 1LD9A 3ERYA 1DDHA 3MYJA 2HJKA 1S7UA 5DEGA 4V3DB 3BUYA 3FQXA 2YEZA 3RWJA 4CVZA 1PQZA 4I48A 3KPNA 3MRCA 4PJAA 1KCGC 3ECBA 3H7BA 3OX8A 4JFFA 5SWZA 1T7ZA 4Z77A 3U0PA 3DX8A 4PJ9A 4PRPA 4L29A 4WW2C 2AK4A 4MVBA 3RUGA 1OGTA 1JPGA 3KXFA 3FQRA 3FRUA 1JHTA 1XR8A 2MHAA 2WY3A 3B3IA 3CC5A 1ZHBA 1ZVSA 4JQVA 4JRYA 4E5XA 1JGDA 1TMCA 1I1YA 5BXFA 4Y4FA 4PJ7A 3RWIA 3TIDA 2H26A 1NEZA 4WO4A 4HUWA 1I7UA 5C0FA 4G43A 4PRAA 5MENA 4L8BA 4MJIA 3TVMA 4N0UA 1BQHA 2XFXA 3MRLA 3P4OA 4JFDA 2Q7YA 5HGAA 3WS3A 3W39A 3MREA 3VFMA 1MWAH 1RJYA 3GMNA 4ELMA 1JPFA 1LK2A 4WU7A 3FTGA 4EUPA 1FG2A 1N2RA 3MR9A 2PO6A 3LKPA 3LKRA 1I7RA 4ZUTA 5B39A 5J6HA 3GMLA 1OGAA 5H94A 3L3JA 3DMMA 4PGDA 1CG9A 1HSAA 1S7VA 1S9XA 3VH8A 2J8UA 3ARFA 4MJ6A 3VFUA 5FA3A 4APQA 3BO8A 4ZFZA 3VXRA 3BP7A 1YDPA 1HYRC 3FT3A 3QDGA 5HHOA 4LNRA 4ZUUA 1VGKA 3D39A 3MRQA 3UBXA 5HGBA 4PJDA 3VFOA 3IXAA 1BD2A 1R3HA 4X6CA 5D7JC 1KPRA 3JTSA 3ROLA 3W0WA 1A1NA 1AKJA 3M17A 4U6XA 1Q94A 4PR5A 1QQDA 5BRZA 1JFMA 3FQNA 4NO0A 4NNXA 1NANH 1CD1A 2C7UA 5ENWA 4PV8A 3LKQA 3SJVA 3NFNA 3VXMA 2GUOA 4F7EA 4PV9A 2X4OA 3QQ4A 3IT8D 1S8DA 3TBTA 5B38A 2BSTA 4L4VA 4QRRA 1ZSDA 5SWSA 3MGTA 3CVHA 1W0WA 5L2KA 3RL1A 4NO3A 1CE6A 3QFDA 2AXFA 3QI9A 4O2FA 4QRPA 1QSEA 1T1YA 4D0BA 3VXOA 3KPPA 4PGEA 1EEYA 3SDAA 4L8CA 4X6DA 3SDCA 5D2LA 3PQYA 2CLVA 3GMMA 5IVXA 5C0EA 4LCCC 2F54A 1SYSA 3REWA 3SDDA 4MX7A 4EI5A 1DE4A 2X4PA 5AD0A 3VFPA 1K8DA 4PRIA 1T7VA 1P7QA 1WBYA 3V5HA 3ARGA 3TPUE 4PRHA 5F7DA 4PGCA 2H6PA 4IRSA 3TBWA 3GJFA 2X4UA 4HV8A 1HSBA 4O2EA 1AO7A 3KLAA 4HUVA 4MQ7A 3JTTA 3V5KA 3MRDA 1M6OA 1B3JA 3PWJA 4Z76A 3OV6A 2PYEA 1UXWA 1FO0H 3P73A 5C09A 4QRQA 3BEWA 3MROA 4PJBA 5GSVA 4E0RA 2HJLA 1S7RA 3RTQA 1FFNA 4MJ5A 2ZOLA 5MEPA 3KPSA 2CKBH 1ZHKA 2FWOA 4F7TA 1VADA 2V2XA 4NQCA 3X14A 1LEGA 3BW9A 4PRNA 1WBXA 5BS0A 3GSVA 3ARDA 5E6IC 1YN6A 3TFKA 3MRMA 4PJFA 5C0IA 1KBGH 4JQXA 4F7CA 4WUUA 3HPJA 5IM7A 3QEQA 4X6EA 3RWHA 1FZMA 4JFPA 5IEKA 5F1NA 2GITA 3QUKA 3BZFA 3I6KA 4N0CA 4Z78A 3FONA 3GSOA 2HLAA 1I1FA 1MHEA 3E6FA 3C9NA 5F9JA 4QOKA 1HHKA 3WLBA 1A1MA 2X4RA 2AV1A 5HGDA 4L8DA 5HGHA 1GZQA 3OXRA 3P9MA 4ZUWA 3KPOA 4GKNA 5DEFA 3MRGA 3MGOA 1ZHLA 1JGEA 5IEHA 3VXNA 1KJ2H 1G6RH 1TVBA 3HUJA 4X6FA 2RFXA 2F74A 1ZAGA 4U1MA 3L3HA 1ZS8A 3RWCA 5E9DA 1HHHA 4Y4HA 1XH3A 1LDPH 3DBXA 4PJGA 5INCA 4JFOA 3VFWA 3BHBA 3X12A 3RZCA 2CLZA 1XZ0A 3TO4A 1S7WA 1XR9A 3BGMA 3P77A 2FYYA 3HE6A 2FO4A 1G7PA 3SDXA 4F7MA 2NX5A 1YN7A 4MXQA 1ED3A 2V2WA 3SPVA 5E8NA 1HOCA 2A83A 4XXCA 1S7TA 4HS3A 2BNRA 5D2NA 3P4MA 1A9BA 4V3EB 3BP4A 1X7QA 4WWKC 2VLLA 5C9JA 1B0GA 3VWKA 5L2JA 1T80A 3RWFA 3ILPA 5FKPA 3BVNA 5EU4A 1GZPA 1AGCA 4CW1A 1IM9A 3X11A 4IHOA 3GSRA 3TJHA 5D9SA 3B6SA 4NQVA 5EOTA 3RGVC 3P4NA 4MS8A 4ZAKA 3RWGA 3PWNA 3ES6A 5MEQA 5SWQA 3HAEA 1QVOA 3TF7A 1S7XA 3MV8A 3MRRA 5C0JA 1N3NA 1QO3A 3QFJA 2GAZA 3SKOA 4HX1A 3T8XA 3MRNA 3G08A 1LEKA 1T7YA 4NSKA 4WDIA 3H9HA 5HHQA 5E8OA 1QEWA 1OSZA 4PG9A 2AKRA 4G8GA 4LHUA 5EO0A 3D25A 3L3GA 4D0CA 3PABA 3OXSA 3O3DA 1L8JA 4L8SC 3MV7A 3M1BA 1KTLA 3PWPA 4PDCE 4QRUA 5ISZA 5IB1A 3GMOA 3FOLA 3MV9A 1UQSA 5EUOA 1P1ZA 1DUYA 1T1ZA 3MRBA 3JVGA 1A1OA 1S9WA 5C0CA 3LKSA 1TVHA 1U58A 2GTWA 3HG1A 3AM8A 4PJ5A 1INQA 2BVPA 3CH1A 5C08A 3MRJA 2CIIA 4NNYA 4G59A 1BIIA 5INDA 1VACA 3DX6A 1JE6A 4S0UC 3I6GA 5EO1A 3D18A 1ONQA 4I4WA 3UTTA 4IIQC 5IB3A 3WUWA 1MI5A 3RWEA 3P9LA 4Y16A 4U1KA 3TBSA 3BEVA 5FDWA 1B0RA 1ZT7A 2GT9A 2D31A 1N5AA 1EXUA 1JUFA 3VFNA 4K7FA 1I7TA 2GTZA 4NHUE 5C0AA 3UPRA 3KYOA 4N8VA 2OL3H 1QSFA 5ACZA 5HHMA 3VXSA 1IM3A 1C16A 3MRHA 1FZKA 1T1XA 3ARBA 4L3EA 3KPQA 2AXGA 4NO2A 3GSNH 1AGDA 2ESVA 3QDMA 5HYJA 1OF2A 4L9LC 3LKOA 1I1AA 3VFSA 3BWAA 3CCHA 4ZUSA 1HHGA 2UWEA 1SYVA 4GKSA 4LCWA 4MNGA 1I4FA 4QRTA 5J1AA 1S9YA 5J6GA 3V5DA 1RK0A 3ILQC 1KPVA 3MRKA 3VFVA 3O9WA 2JCCA 3O8XA 3QULA 1JF1A 5EU3A 3FQWA 1DUZA 5MERA 1KJMA 3QUYA 1S7QA 4PREA 3WS6A 3BZEA 5GSRA 1G7QA 1FZOA 1LQVA 1FFPA 2BSSA 3FOMA 1Z5LA 1T0MA 4ONOA 1RJZA 3MA7A 3MRIA 1RK1A 2BCKA 4GUPA 1S7SA 5IB5A 4G8IA 5C0GA 3MRFA 1BZ9A 3KYNA 5IB2A 5JHDA 2X4SA 3O3AA 1YPZA 3E2HA 3I6LD 1QR1A 1EEZA 3DXAA 2NW3A 1LP9A 3QDJA 1KPUA 3VFRA 4U1IA 1T20A 3L3KA 4PRDA 4QRSA 4WU5A 4PJXA 5IROA 3ROOA 1A9EA 1HHIA 5BJTA 4NQDA 4N5EA 1E28A 4JRXA 1HHJA 1T21A 3QQ3A 4UQ3A 3BH8A 1AGEA 2ZSVA 4G9DA 4WJ5A 3VWJA 3VRIA 3T1FA 1T7WA 3D2UA 3GSWA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3X13 A;  3E3Q A;  3QUX A;  4N0F A;  3SKM A;  4PJ8 A;  5DDH A;  3VJ6 A;  4UQ2 A;  4U1H A;  4F7P A;  1T22 A;  3SCM A;  4L3C A;  3PWU A;  4PRB A;  4Y2D A;  1NAM H;  1EFX A;  4NT6 A;  3TZV C;  2E7L E;  1T1W A;  5MEO A;  4HUX A;  3UTQ A;  2VE6 A;  5EFI A;  3O3B A;  4Y4K A;  5EU5 A;  3S6C A;  3BXN A;  3VXP A;  1A6Z A;  3L9R A;  3GMP A;  5E8P A;  5C0B A;  2ZSW A;  3LN4 A;  5F1I A;  5C07 A;  3TIE A;  4D0D A;  5D5M A;  2BVQ A;  2X4Q A;  3GMQ A;  2XPG A;  3GMR A;  3E6H A;  4HKJ A;  1QLF A;  2X70 A;  1N59 A;  4PJE A;  4G42 A;  4G9F A;  2P5W A;  3FQU A;  4IRJ A;  3LN5 A;  1QRN A;  2VAA A;  4JFQ A;  2OI9 A;  3CPL A;  1UXS A;  3KPM A;  2DYP A;  3TBV A;  3FT2 A;  3VFT A;  3PWL A;  3BH9 A;  3O3E A;  4U1S A;  3JTC A;  3KWW A;  1E27 A;  2VAB A;  2FIK A;  4U1N A;  4PGB A;  4EN3 C;  3AU1 A;  3GSU A;  3VRJ A;  3FT4 A;  3CDG A;  5D7I A;  2VLJ A;  3PWV A;  4JFE A;  3VCL A;  4PG2 A;  3C8K A;  1ZT4 A;  3DX7 A;  3L3I A;  1ZHN A;  1ZT1 A;  1FZJ A;  3D3V A;  1P4L A;  3QZW A;  4HUU A;  4PJC A;  2GJ6 A;  2CLR A;  4U1L A;  5E00 A;  5FA4 A;  3FFC A;  3GSQ A;  3CZF A;  4K71 B;  4NO5 A;  3VXU A;  5IB4 A;  2P5E A;  1T7X A;  3GSX A;  2BNQ A;  4PP8 C;  1FFO A;  3LKN A;  3WL9 A;  2VLR A;  2YPL A;  2FZ3 A;  5C0D A;  5D7L A;  3HLA A;  3DTX A;  5HHP A;  5HHN A;  4LCY A;  4HWZ A;  3L3D A;  1K5N A;  3RL2 A;  3TO2 A;  2HN7 A;  2VLK A;  1MHC A;  2CIK A;  1T0N A;  1AGF A;  2X4T A;  2YPK A;  3TBY A;  4O2C A;  2AV7 A;  4PJH A;  2BVO A;  4FFE X;  4L4T A;  4U6Y A;  1W72 A;  2ZOK A;  3ARE A;  2BSR A;  4CVX A;  2F53 A;  1AGB A;  3TN0 A;  3LV3 A;  3RWD A;  3UTS A;  3HE7 A;  3MRP A;  5EU6 A;  3QUZ A;  4NQE A;  3HCV A;  4PJI A;  1W0V A;  3H9S A;  3FQT A;  3KPR A;  4FTV A;  1KJ3 H;  1WBZ A;  4U1J A;  1KJV A;  3GIV A;  3TA3 A;  1M05 A;  4MNQ A;  2X4N A;  4NQX A;  3O4L A;  4ZUV A;  3KPL A;  1LD9 A;  3ERY A;  1DDH A;  3MYJ A;  2HJK A;  1S7U A;  5DEG A;  4V3D B;  3BUY A;  3FQX A;  2YEZ A;  3RWJ A;  4CVZ A;  1PQZ A;  4I48 A;  3KPN A;  3MRC A;  4PJA A;  1KCG C;  3ECB A;  3H7B A;  3OX8 A;  4JFF A;  5SWZ A;  1T7Z A;  4Z77 A;  3U0P A;  3DX8 A;  4PJ9 A;  4PRP A;  4L29 A;  4WW2 C;  2AK4 A;  4MVB A;  3RUG A;  1OGT A;  1JPG A;  3KXF A;  3FQR A;  3FRU A;  1JHT A;  1XR8 A;  2MHA A;  2WY3 A;  3B3I A;  3CC5 A;  1ZHB A;  1ZVS A;  4JQV A;  4JRY A;  4E5X A;  1JGD A;  1TMC A;  1I1Y A;  5BXF A;  4Y4F A;  4PJ7 A;  3RWI A;  3TID A;  2H26 A;  1NEZ A;  4WO4 A;  4HUW A;  1I7U A;  5C0F A;  4G43 A;  4PRA A;  5MEN A;  4L8B A;  4MJI A;  3TVM A;  4N0U A;  1BQH A;  2XFX A;  3MRL A;  3P4O A;  4JFD A;  2Q7Y A;  5HGA A;  3WS3 A;  3W39 A;  3MRE A;  3VFM A;  1MWA H;  1RJY A;  3GMN A;  4ELM A;  1JPF A;  1LK2 A;  4WU7 A;  3FTG A;  4EUP A;  1FG2 A;  1N2R A;  3MR9 A;  2PO6 A;  3LKP A;  3LKR A;  1I7R A;  4ZUT A;  5B39 A;  5J6H A;  3GML A;  1OGA A;  5H94 A;  3L3J A;  3DMM A;  4PGD A;  1CG9 A;  1HSA A;  1S7V A;  1S9X A;  3VH8 A;  2J8U A;  3ARF A;  4MJ6 A;  3VFU A;  5FA3 A;  4APQ A;  3BO8 A;  4ZFZ A;  3VXR A;  3BP7 A;  1YDP A;  1HYR C;  3FT3 A;  3QDG A;  5HHO A;  4LNR A;  4ZUU A;  1VGK A;  3D39 A;  3MRQ A;  3UBX A;  5HGB A;  4PJD A;  3VFO A;  3IXA A;  1BD2 A;  1R3H A;  4X6C A;  5D7J C;  1KPR A;  3JTS A;  3ROL A;  3W0W A;  1A1N A;  1AKJ A;  3M17 A;  4U6X A;  1Q94 A;  4PR5 A;  1QQD A;  5BRZ A;  1JFM A;  3FQN A;  4NO0 A;  4NNX A;  1NAN H;  1CD1 A;  2C7U A;  5ENW A;  4PV8 A;  3LKQ A;  3SJV A;  3NFN A;  3VXM A;  2GUO A;  4F7E A;  4PV9 A;  2X4O A;  3QQ4 A;  3IT8 D;  1S8D A;  3TBT A;  5B38 A;  2BST A;  4L4V A;  4QRR A;  1ZSD A;  5SWS A;  3MGT A;  3CVH A;  1W0W A;  5L2K A;  3RL1 A;  4NO3 A;  1CE6 A;  3QFD A;  2AXF A;  3QI9 A;  4O2F A;  4QRP A;  1QSE A;  1T1Y A;  4D0B A;  3VXO A;  3KPP A;  4PGE A;  1EEY A;  3SDA A;  4L8C A;  4X6D A;  3SDC A;  5D2L A;  3PQY A;  2CLV A;  3GMM A;  5IVX A;  5C0E A;  4LCC C;  2F54 A;  1SYS A;  3REW A;  3SDD A;  4MX7 A;  4EI5 A;  1DE4 A;  2X4P A;  5AD0 A;  3VFP A;  1K8D A;  4PRI A;  1T7V A;  1P7Q A;  1WBY A;  3V5H A;  3ARG A;  3TPU E;  4PRH A;  5F7D A;  4PGC A;  2H6P A;  4IRS A;  3TBW A;  3GJF A;  2X4U A;  4HV8 A;  1HSB A;  4O2E A;  1AO7 A;  3KLA A;  4HUV A;  4MQ7 A;  3JTT A;  3V5K A;  3MRD A;  1M6O A;  1B3J A;  3PWJ A;  4Z76 A;  3OV6 A;  2PYE A;  1UXW A;  1FO0 H;  3P73 A;  5C09 A;  4QRQ A;  3BEW A;  3MRO A;  4PJB A;  5GSV A;  4E0R A;  2HJL A;  1S7R A;  3RTQ A;  1FFN A;  4MJ5 A;  2ZOL A;  5MEP A;  3KPS A;  2CKB H;  1ZHK A;  2FWO A;  4F7T A;  1VAD A;  2V2X A;  4NQC A;  3X14 A;  1LEG A;  3BW9 A;  4PRN A;  1WBX A;  5BS0 A;  3GSV A;  3ARD A;  5E6I C;  1YN6 A;  3TFK A;  3MRM A;  4PJF A;  5C0I A;  1KBG H;  4JQX A;  4F7C A;  4WUU A;  3HPJ A;  5IM7 A;  3QEQ A;  4X6E A;  3RWH A;  1FZM A;  4JFP A;  5IEK A;  5F1N A;  2GIT A;  3QUK A;  3BZF A;  3I6K A;  4N0C A;  4Z78 A;  3FON A;  3GSO A;  2HLA A;  1I1F A;  1MHE A;  3E6F A;  3C9N A;  5F9J A;  4QOK A;  1HHK A;  3WLB A;  1A1M A;  2X4R A;  2AV1 A;  5HGD A;  4L8D A;  5HGH A;  1GZQ A;  3OXR A;  3P9M A;  4ZUW A;  3KPO A;  4GKN A;  5DEF A;  3MRG A;  3MGO A;  1ZHL A;  1JGE A;  5IEH A;  3VXN A;  1KJ2 H;  1G6R H;  1TVB A;  3HUJ A;  4X6F A;  2RFX A;  2F74 A;  1ZAG A;  4U1M A;  3L3H A;  1ZS8 A;  3RWC A;  5E9D A;  1HHH A;  4Y4H A;  1XH3 A;  1LDP H;  3DBX A;  4PJG A;  5INC A;  4JFO A;  3VFW A;  3BHB A;  3X12 A;  3RZC A;  2CLZ A;  1XZ0 A;  3TO4 A;  1S7W A;  1XR9 A;  3BGM A;  3P77 A;  2FYY A;  3HE6 A;  2FO4 A;  1G7P A;  3SDX A;  4F7M A;  2NX5 A;  1YN7 A;  4MXQ A;  1ED3 A;  2V2W A;  3SPV A;  5E8N A;  1HOC A;  2A83 A;  4XXC A;  1S7T A;  4HS3 A;  2BNR A;  5D2N A;  3P4M A;  1A9B A;  4V3E B;  3BP4 A;  1X7Q A;  4WWK C;  2VLL A;  5C9J A;  1B0G A;  3VWK A;  5L2J A;  1T80 A;  3RWF A;  3ILP A;  5FKP A;  3BVN A;  5EU4 A;  1GZP A;  1AGC A;  4CW1 A;  1IM9 A;  3X11 A;  4IHO A;  3GSR A;  3TJH A;  5D9S A;  3B6S A;  4NQV A;  5EOT A;  3RGV C;  3P4N A;  4MS8 A;  4ZAK A;  3RWG A;  3PWN A;  3ES6 A;  5MEQ A;  5SWQ A;  3HAE A;  1QVO A;  3TF7 A;  1S7X A;  3MV8 A;  3MRR A;  5C0J A;  1N3N A;  1QO3 A;  3QFJ A;  2GAZ A;  3SKO A;  4HX1 A;  3T8X A;  3MRN A;  3G08 A;  1LEK A;  1T7Y A;  4NSK A;  4WDI A;  3H9H A;  5HHQ A;  5E8O A;  1QEW A;  1OSZ A;  4PG9 A;  2AKR A;  4G8G A;  4LHU A;  5EO0 A;  3D25 A;  3L3G A;  4D0C A;  3PAB A;  3OXS A;  3O3D A;  1L8J A;  4L8S C;  3MV7 A;  3M1B A;  1KTL A;  3PWP A;  4PDC E;  4QRU A;  5ISZ A;  5IB1 A;  3GMO A;  3FOL A;  3MV9 A;  1UQS A;  5EUO A;  1P1Z A;  1DUY A;  1T1Z A;  3MRB A;  3JVG A;  1A1O A;  1S9W A;  5C0C A;  3LKS A;  1TVH A;  1U58 A;  2GTW A;  3HG1 A;  3AM8 A;  4PJ5 A;  1INQ A;  2BVP A;  3CH1 A;  5C08 A;  3MRJ A;  2CII A;  4NNY A;  4G59 A;  1BII A;  5IND A;  1VAC A;  3DX6 A;  1JE6 A;  4S0U C;  3I6G A;  5EO1 A;  3D18 A;  1ONQ A;  4I4W A;  3UTT A;  4IIQ C;  5IB3 A;  3WUW A;  1MI5 A;  3RWE A;  3P9L A;  4Y16 A;  4U1K A;  3TBS A;  3BEV A;  5FDW A;  1B0R A;  1ZT7 A;  2GT9 A;  2D31 A;  1N5A A;  1EXU A;  1JUF A;  3VFN A;  4K7F A;  1I7T A;  2GTZ A;  4NHU E;  5C0A A;  3UPR A;  3KYO A;  4N8V A;  2OL3 H;  1QSF A;  5ACZ A;  5HHM A;  3VXS A;  1IM3 A;  1C16 A;  3MRH A;  1FZK A;  1T1X A;  3ARB A;  4L3E A;  3KPQ A;  2AXG A;  4NO2 A;  3GSN H;  1AGD A;  2ESV A;  3QDM A;  5HYJ A;  1OF2 A;  4L9L C;  3LKO A;  1I1A A;  3VFS A;  3BWA A;  3CCH A;  4ZUS A;  1HHG A;  2UWE A;  1SYV A;  4GKS A;  4LCW A;  4MNG A;  1I4F A;  4QRT A;  5J1A A;  1S9Y A;  5J6G A;  3V5D A;  1RK0 A;  3ILQ C;  1KPV A;  3MRK A;  3VFV A;  3O9W A;  2JCC A;  3O8X A;  3QUL A;  1JF1 A;  5EU3 A;  3FQW A;  1DUZ A;  5MER A;  1KJM A;  3QUY A;  1S7Q A;  4PRE A;  3WS6 A;  3BZE A;  5GSR A;  1G7Q A;  1FZO A;  1LQV A;  1FFP A;  2BSS A;  3FOM A;  1Z5L A;  1T0M A;  4ONO A;  1RJZ A;  3MA7 A;  3MRI A;  1RK1 A;  2BCK A;  4GUP A;  1S7S A;  5IB5 A;  4G8I A;  5C0G A;  3MRF A;  1BZ9 A;  3KYN A;  5IB2 A;  5JHD A;  2X4S A;  3O3A A;  1YPZ A;  3E2H A;  3I6L D;  1QR1 A;  1EEZ A;  3DXA A;  2NW3 A;  1LP9 A;  3QDJ A;  1KPU A;  3VFR A;  4U1I A;  1T20 A;  3L3K A;  4PRD A;  4QRS A;  4WU5 A;  4PJX A;  5IRO A;  3ROO A;  1A9E A;  1HHI A;  5BJT A;  4NQD A;  4N5E A;  1E28 A;  4JRX A;  1HHJ A;  1T21 A;  3QQ3 A;  4UQ3 A;  3BH8 A;  1AGE A;  2ZSV A;  4G9D A;  4WJ5 A;  3VWJ A;  3VRI A;  3T1F A;  1T7W A;  3D2U A;  3GSW A; 
#chains in the Genus database with same CATH topology
 3X13 A;  3E3Q A;  3QUX A;  4N0F A;  3SKM A;  4PJ8 A;  5DDH A;  3VJ6 A;  4UQ2 A;  4U1H A;  4F7P A;  1T22 A;  3SCM A;  4L3C A;  3PWU A;  4PRB A;  4Y2D A;  1NAM H;  1EFX A;  4NT6 A;  3TZV C;  2E7L E;  1T1W A;  5MEO A;  4HUX A;  3UTQ A;  2VE6 A;  5EFI A;  3O3B A;  4Y4K A;  5EU5 A;  3S6C A;  3BXN A;  3VXP A;  1A6Z A;  3L9R A;  3GMP A;  5E8P A;  5C0B A;  2ZSW A;  3LN4 A;  5F1I A;  5C07 A;  3TIE A;  4D0D A;  5D5M A;  2BVQ A;  2X4Q A;  3GMQ A;  2XPG A;  3GMR A;  3E6H A;  4HKJ A;  1QLF A;  2X70 A;  1N59 A;  4PJE A;  4G42 A;  4G9F A;  2P5W A;  3FQU A;  4IRJ A;  3LN5 A;  1QRN A;  2VAA A;  4JFQ A;  2OI9 A;  3CPL A;  4BKW A;  1UXS A;  3KPM A;  2DYP A;  3TBV A;  3FT2 A;  3VFT A;  3PWL A;  3BH9 A;  3O3E A;  4U1S A;  3JTC A;  3KWW A;  1E27 A;  2VAB A;  2FIK A;  4U1N A;  4PGB A;  4EN3 C;  3AU1 A;  3GSU A;  3VRJ A;  3FT4 A;  3CDG A;  5D7I A;  2VLJ A;  3PWV A;  4JFE A;  3VCL A;  4PG2 A;  3C8K A;  1ZT4 A;  3DX7 A;  3L3I A;  1ZHN A;  1ZT1 A;  1FZJ A;  3D3V A;  1P4L A;  3QZW A;  4HUU A;  4PJC A;  2GJ6 A;  2CLR A;  4U1L A;  5E00 A;  5FA4 A;  3FFC A;  3GSQ A;  3CZF A;  4K71 B;  4NO5 A;  3VXU A;  5IB4 A;  2P5E A;  1T7X A;  3GSX A;  2BNQ A;  4PP8 C;  1FFO A;  3LKN A;  3WL9 A;  2VLR A;  2YPL A;  2FZ3 A;  5C0D A;  5D7L A;  3HLA A;  3DTX A;  5HHP A;  5HHN A;  4LCY A;  4HWZ A;  3L3D A;  1K5N A;  3RL2 A;  3TO2 A;  2HN7 A;  2VLK A;  1MHC A;  2CIK A;  1T0N A;  1AGF A;  2X4T A;  2YPK A;  3TBY A;  4O2C A;  2AV7 A;  4PJH A;  2BVO A;  4FFE X;  4L4T A;  4U6Y A;  1W72 A;  2ZOK A;  3ARE A;  2BSR A;  4CVX A;  2F53 A;  1AGB A;  3TN0 A;  3LV3 A;  3RWD A;  3UTS A;  3HE7 A;  3MRP A;  5EU6 A;  3QUZ A;  4NQE A;  3HCV A;  4PJI A;  1W0V A;  3H9S A;  3FQT A;  3KPR A;  4FTV A;  1KJ3 H;  1WBZ A;  4U1J A;  1KJV A;  3GIV A;  3TA3 A;  1M05 A;  4MNQ A;  2X4N A;  4NQX A;  3O4L A;  4ZUV A;  3KPL A;  1LD9 A;  3ERY A;  1DDH A;  3MYJ A;  2HJK A;  1S7U A;  5DEG A;  4V3D B;  3BUY A;  3FQX A;  2YEZ A;  3RWJ A;  4CVZ A;  1PQZ A;  4I48 A;  3KPN A;  3MRC A;  4PJA A;  1KCG C;  3ECB A;  2NYK A;  3H7B A;  3OX8 A;  4JFF A;  1T7Z A;  5SWZ A;  4Z77 A;  3U0P A;  3DX8 A;  4PJ9 A;  4PRP A;  4L29 A;  4WW2 C;  2AK4 A;  4MVB A;  3RUG A;  1OGT A;  1JPG A;  3KXF A;  3FQR A;  3FRU A;  1JHT A;  1XR8 A;  2MHA A;  2WY3 A;  3B3I A;  3CC5 A;  1ZHB A;  1ZVS A;  4JQV A;  4JRY A;  4E5X A;  1JGD A;  1TMC A;  1I1Y A;  5BXF A;  4Y4F A;  4PJ7 A;  3RWI A;  3TID A;  2H26 A;  1NEZ A;  4WO4 A;  4HUW A;  1I7U A;  5C0F A;  4G43 A;  4PRA A;  5MEN A;  4L8B A;  4MJI A;  3TVM A;  4N0U A;  1BQH A;  2XFX A;  3MRL A;  3P4O A;  4JFD A;  2Q7Y A;  5HGA A;  3WS3 A;  3W39 A;  3MRE A;  3VFM A;  1MWA H;  1RJY A;  3GMN A;  4ELM A;  1JPF A;  1LK2 A;  4WU7 A;  3FTG A;  4EUP A;  1FG2 A;  1N2R A;  3MR9 A;  2PO6 A;  3LKP A;  3LKR A;  1I7R A;  4ZUT A;  5B39 A;  5J6H A;  3GML A;  1OGA A;  5H94 A;  3L3J A;  3DMM A;  4PGD A;  1CG9 A;  1HSA A;  1S7V A;  1S9X A;  3VH8 A;  2J8U A;  3ARF A;  4MJ6 A;  3VFU A;  5FA3 A;  4APQ A;  3BO8 A;  4ZFZ A;  3VXR A;  3BP7 A;  1YDP A;  1HYR C;  3FT3 A;  3QDG A;  5HHO A;  4LNR A;  4ZUU A;  1VGK A;  3D39 A;  3MRQ A;  3UBX A;  5HGB A;  4PJD A;  3VFO A;  3IXA A;  1BD2 A;  1R3H A;  4X6C A;  5D7J C;  1KPR A;  3JTS A;  3ROL A;  3W0W A;  1A1N A;  1AKJ A;  3M17 A;  4U6X A;  1Q94 A;  4PR5 A;  1QQD A;  5BRZ A;  1JFM A;  3FQN A;  4NO0 A;  4NNX A;  1NAN H;  1CD1 A;  2C7U A;  5ENW A;  4PV8 A;  3LKQ A;  3SJV A;  3NFN A;  3VXM A;  2GUO A;  4F7E A;  4PV9 A;  2X4O A;  3QQ4 A;  3IT8 D;  1S8D A;  3TBT A;  5B38 A;  2BST A;  4L4V A;  4QRR A;  1ZSD A;  5SWS A;  3MGT A;  3CVH A;  1W0W A;  5L2K A;  3RL1 A;  4NO3 A;  1CE6 A;  3QFD A;  2AXF A;  3QI9 A;  4O2F A;  4QRP A;  1QSE A;  1T1Y A;  4D0B A;  3VXO A;  3KPP A;  4PGE A;  1EEY A;  3SDA A;  4L8C A;  4X6D A;  3SDC A;  5D2L A;  3PQY A;  2CLV A;  3GMM A;  5IVX A;  5C0E A;  4LCC C;  2F54 A;  1SYS A;  3REW A;  3SDD A;  4MX7 A;  4EI5 A;  1DE4 A;  2X4P A;  5AD0 A;  3VFP A;  1K8D A;  4PRI A;  1T7V A;  1P7Q A;  1WBY A;  3V5H A;  3ARG A;  3TPU E;  4PRH A;  5F7D A;  4PGC A;  2H6P A;  4IRS A;  3TBW A;  3GJF A;  2X4U A;  4HV8 A;  1HSB A;  4O2E A;  1AO7 A;  3KLA A;  4HUV A;  4MQ7 A;  3JTT A;  3V5K A;  3MRD A;  1M6O A;  1B3J A;  3PWJ A;  4Z76 A;  3OV6 A;  2PYE A;  1UXW A;  1FO0 H;  3P73 A;  5C09 A;  4QRQ A;  3BEW A;  3MRO A;  4PJB A;  5GSV A;  4E0R A;  2HJL A;  1S7R A;  3RTQ A;  1FFN A;  4MJ5 A;  2ZOL A;  5MEP A;  3KPS A;  4G59 C;  2CKB H;  1ZHK A;  2FWO A;  4F7T A;  1VAD A;  2V2X A;  4NQC A;  3X14 A;  1LEG A;  3BW9 A;  4PRN A;  1WBX A;  5BS0 A;  3GSV A;  3ARD A;  5E6I C;  1YN6 A;  4JO8 A;  3TFK A;  3MRM A;  4PJF A;  5C0I A;  1KBG H;  4JQX A;  4F7C A;  4WUU A;  3HPJ A;  5IM7 A;  3QEQ A;  4X6E A;  3RWH A;  1FZM A;  4JFP A;  5IEK A;  5F1N A;  2GIT A;  3QUK A;  3BZF A;  3I6K A;  4N0C A;  4Z78 A;  3FON A;  3GSO A;  2HLA A;  1I1F A;  1MHE A;  3E6F A;  3C9N A;  5F9J A;  4QOK A;  1HHK A;  3WLB A;  1A1M A;  2X4R A;  2AV1 A;  5HGD A;  4L8D A;  5HGH A;  1GZQ A;  3OXR A;  3P9M A;  4ZUW A;  3KPO A;  4GKN A;  5DEF A;  3MRG A;  3MGO A;  1ZHL A;  1JGE A;  5IEH A;  3VXN A;  1KJ2 H;  1G6R H;  1TVB A;  3HUJ A;  4X6F A;  2RFX A;  2F74 A;  1ZAG A;  4U1M A;  3L3H A;  1ZS8 A;  3RWC A;  5E9D A;  1HHH A;  4Y4H A;  1XH3 A;  1LDP H;  3DBX A;  4PJG A;  5INC A;  4JFO A;  3VFW A;  3BHB A;  3X12 A;  3RZC A;  2CLZ A;  1XZ0 A;  3TO4 A;  1S7W A;  1XR9 A;  3BGM A;  3P77 A;  2FYY A;  3HE6 A;  2FO4 A;  1G7P A;  3SDX A;  4F7M A;  2NX5 A;  1YN7 A;  4MXQ A;  1ED3 A;  2V2W A;  3SPV A;  5E8N A;  1HOC A;  2A83 A;  4XXC A;  1S7T A;  4HS3 A;  2BNR A;  5D2N A;  3P4M A;  1A9B A;  4V3E B;  3BP4 A;  1X7Q A;  4WWK C;  2VLL A;  5C9J A;  1B0G A;  3VWK A;  5L2J A;  1T80 A;  3RWF A;  3ILP A;  5FKP A;  3BVN A;  5EU4 A;  1GZP A;  1AGC A;  4CW1 A;  1IM9 A;  3X11 A;  4IHO A;  3GSR A;  3TJH A;  5D9S A;  3B6S A;  4NQV A;  5EOT A;  3RGV C;  3P4N A;  4MS8 A;  4ZAK A;  3RWG A;  3PWN A;  3ES6 A;  5MEQ A;  5SWQ A;  3HAE A;  1QVO A;  3TF7 A;  1S7X A;  3MV8 A;  3MRR A;  5C0J A;  1N3N A;  1QO3 A;  2O5N A;  3QFJ A;  2GAZ A;  3SKO A;  4HX1 A;  3T8X A;  3MRN A;  3G08 A;  1LEK A;  1T7Y A;  4NSK A;  4WDI A;  3H9H A;  5HHQ A;  5E8O A;  1QEW A;  1OSZ A;  4PG9 A;  2AKR A;  4G8G A;  4LHU A;  5EO0 A;  3D25 A;  3L3G A;  4D0C A;  3PAB A;  3OXS A;  3O3D A;  1L8J A;  4L8S C;  3MV7 A;  3M1B A;  1KTL A;  3PWP A;  4PDC E;  4QRU A;  5ISZ A;  5IB1 A;  3GMO A;  3FOL A;  3MV9 A;  1UQS A;  5EUO A;  1P1Z A;  1DUY A;  1T1Z A;  3MRB A;  3JVG A;  1A1O A;  1S9W A;  5C0C A;  3LKS A;  1TVH A;  1U58 A;  2GTW A;  3HG1 A;  3AM8 A;  4PJ5 A;  1INQ A;  2BVP A;  3CH1 A;  5C08 A;  3MRJ A;  2CII A;  4NNY A;  4G59 A;  1BII A;  5IND A;  1VAC A;  3DX6 A;  1JE6 A;  3I0T A;  4S0U C;  3I6G A;  5EO1 A;  3D18 A;  1ONQ A;  4I4W A;  3UTT A;  4IIQ C;  5IB3 A;  3WUW A;  1MI5 A;  3RWE A;  3P9L A;  4Y16 A;  4U1K A;  3TBS A;  3BEV A;  5FDW A;  2IA1 A;  1B0R A;  1ZT7 A;  2GT9 A;  2D31 A;  1N5A A;  1EXU A;  1JUF A;  3VFN A;  4K7F A;  1I7T A;  2GTZ A;  4NHU E;  5C0A A;  3UPR A;  3KYO A;  4N8V A;  2OL3 H;  1QSF A;  5ACZ A;  5HHM A;  3VXS A;  1IM3 A;  1C16 A;  3MRH A;  1FZK A;  1T1X A;  3ARB A;  4L3E A;  3KPQ A;  2AXG A;  4NO2 A;  3GSN H;  1AGD A;  2ESV A;  3QDM A;  5HYJ A;  1OF2 A;  4L9L C;  3LKO A;  1I1A A;  3VFS A;  3BWA A;  3CCH A;  4ZUS A;  1HHG A;  2UWE A;  1SYV A;  4GKS A;  4LCW A;  4MNG A;  1I4F A;  4QRT A;  5J1A A;  1S9Y A;  5J6G A;  3V5D A;  1RK0 A;  3ILQ C;  1KPV A;  3MRK A;  3VFV A;  3O9W A;  2JCC A;  3O8X A;  3QUL A;  1JF1 A;  5EU3 A;  3FQW A;  1DUZ A;  5MER A;  1KJM A;  3QUY A;  1S7Q A;  4PRE A;  3WS6 A;  3BZE A;  5GSR A;  1G7Q A;  1FZO A;  1LQV A;  1FFP A;  2BSS A;  3FOM A;  1Z5L A;  1T0M A;  4ONO A;  1RJZ A;  3MA7 A;  3MRI A;  1RK1 A;  2BCK A;  4GUP A;  1S7S A;  5IB5 A;  4G8I A;  5C0G A;  3MRF A;  1BZ9 A;  3KYN A;  5IB2 A;  5JHD A;  2X4S A;  3O3A A;  1YPZ A;  3E2H A;  3I6L D;  1QR1 A;  1EEZ A;  3DXA A;  2NW3 A;  1LP9 A;  3QDJ A;  1KPU A;  3VFR A;  4U1I A;  1T20 A;  3L3K A;  4PRD A;  4QRS A;  4WU5 A;  4PJX A;  5IRO A;  3ROO A;  1A9E A;  1HHI A;  5BJT A;  4NQD A;  4N5E A;  1E28 A;  4JRX A;  1HHJ A;  1T21 A;  3QQ3 A;  4UQ3 A;  3BH8 A;  1AGE A;  2ZSV A;  4G9D A;  4WJ5 A;  3VWJ A;  3VRI A;  3T1F A;  1T7W A;  3D2U A;  3GSW A; 
#chains in the Genus database with same CATH homology
 3X13 A;  3E3Q A;  3QUX A;  4N0F A;  3SKM A;  4PJ8 A;  5DDH A;  3VJ6 A;  4UQ2 A;  4U1H A;  4F7P A;  1T22 A;  3SCM A;  4L3C A;  3PWU A;  4PRB A;  4Y2D A;  1NAM H;  1EFX A;  4NT6 A;  3TZV C;  2E7L E;  1T1W A;  5MEO A;  4HUX A;  3UTQ A;  2VE6 A;  5EFI A;  3O3B A;  4Y4K A;  5EU5 A;  3S6C A;  3BXN A;  3VXP A;  1A6Z A;  3L9R A;  3GMP A;  5E8P A;  5C0B A;  2ZSW A;  3LN4 A;  5F1I A;  5C07 A;  3TIE A;  4D0D A;  5D5M A;  2BVQ A;  2X4Q A;  3GMQ A;  2XPG A;  3GMR A;  3E6H A;  4HKJ A;  1QLF A;  2X70 A;  1N59 A;  4PJE A;  4G42 A;  4G9F A;  2P5W A;  3FQU A;  4IRJ A;  3LN5 A;  1QRN A;  2VAA A;  4JFQ A;  2OI9 A;  3CPL A;  1UXS A;  3KPM A;  2DYP A;  3TBV A;  3FT2 A;  3VFT A;  3PWL A;  3BH9 A;  3O3E A;  4U1S A;  3JTC A;  3KWW A;  1E27 A;  2VAB A;  2FIK A;  4U1N A;  4PGB A;  4EN3 C;  3AU1 A;  3GSU A;  3VRJ A;  3FT4 A;  3CDG A;  5D7I A;  2VLJ A;  3PWV A;  4JFE A;  3VCL A;  4PG2 A;  3C8K A;  1ZT4 A;  3DX7 A;  3L3I A;  1ZHN A;  1ZT1 A;  1FZJ A;  3D3V A;  1P4L A;  3QZW A;  4HUU A;  4PJC A;  2GJ6 A;  2CLR A;  4U1L A;  5E00 A;  5FA4 A;  3FFC A;  3GSQ A;  3CZF A;  4K71 B;  4NO5 A;  3VXU A;  5IB4 A;  2P5E A;  1T7X A;  3GSX A;  2BNQ A;  4PP8 C;  1FFO A;  3LKN A;  3WL9 A;  2VLR A;  2YPL A;  2FZ3 A;  5C0D A;  5D7L A;  3HLA A;  3DTX A;  5HHP A;  5HHN A;  4LCY A;  4HWZ A;  3L3D A;  1K5N A;  3RL2 A;  3TO2 A;  2HN7 A;  2VLK A;  1MHC A;  2CIK A;  1T0N A;  1AGF A;  2X4T A;  2YPK A;  3TBY A;  4O2C A;  2AV7 A;  4PJH A;  2BVO A;  4FFE X;  4L4T A;  4U6Y A;  1W72 A;  2ZOK A;  3ARE A;  2BSR A;  4CVX A;  2F53 A;  1AGB A;  3TN0 A;  3LV3 A;  3RWD A;  3UTS A;  3HE7 A;  3MRP A;  5EU6 A;  3QUZ A;  4NQE A;  3HCV A;  4PJI A;  1W0V A;  3H9S A;  3FQT A;  3KPR A;  4FTV A;  1KJ3 H;  1WBZ A;  4U1J A;  1KJV A;  3GIV A;  3TA3 A;  1M05 A;  4MNQ A;  2X4N A;  4NQX A;  3O4L A;  4ZUV A;  3KPL A;  1LD9 A;  3ERY A;  1DDH A;  3MYJ A;  2HJK A;  1S7U A;  5DEG A;  4V3D B;  3BUY A;  3FQX A;  2YEZ A;  3RWJ A;  4CVZ A;  1PQZ A;  4I48 A;  3KPN A;  3MRC A;  4PJA A;  1KCG C;  3ECB A;  3H7B A;  3OX8 A;  4JFF A;  5SWZ A;  1T7Z A;  4Z77 A;  3U0P A;  3DX8 A;  4PJ9 A;  4PRP A;  4L29 A;  4WW2 C;  2AK4 A;  4MVB A;  3RUG A;  1OGT A;  1JPG A;  3KXF A;  3FQR A;  3FRU A;  1JHT A;  1XR8 A;  2MHA A;  2WY3 A;  3B3I A;  3CC5 A;  1ZHB A;  1ZVS A;  4JQV A;  4JRY A;  4E5X A;  1JGD A;  1TMC A;  1I1Y A;  5BXF A;  4Y4F A;  4PJ7 A;  3RWI A;  3TID A;  2H26 A;  1NEZ A;  4WO4 A;  4HUW A;  1I7U A;  5C0F A;  4G43 A;  4PRA A;  5MEN A;  4L8B A;  4MJI A;  3TVM A;  4N0U A;  1BQH A;  2XFX A;  3MRL A;  3P4O A;  4JFD A;  2Q7Y A;  5HGA A;  3WS3 A;  3W39 A;  3MRE A;  3VFM A;  1MWA H;  1RJY A;  3GMN A;  4ELM A;  1JPF A;  1LK2 A;  4WU7 A;  3FTG A;  4EUP A;  1FG2 A;  1N2R A;  3MR9 A;  2PO6 A;  3LKP A;  3LKR A;  1I7R A;  4ZUT A;  5B39 A;  5J6H A;  3GML A;  1OGA A;  5H94 A;  3L3J A;  3DMM A;  4PGD A;  1CG9 A;  1HSA A;  1S7V A;  1S9X A;  3VH8 A;  2J8U A;  3ARF A;  4MJ6 A;  3VFU A;  5FA3 A;  4APQ A;  3BO8 A;  4ZFZ A;  3VXR A;  3BP7 A;  1YDP A;  1HYR C;  3FT3 A;  3QDG A;  5HHO A;  4LNR A;  4ZUU A;  1VGK A;  3D39 A;  3MRQ A;  3UBX A;  5HGB A;  4PJD A;  3VFO A;  3IXA A;  1BD2 A;  1R3H A;  4X6C A;  5D7J C;  1KPR A;  3JTS A;  3ROL A;  3W0W A;  1A1N A;  1AKJ A;  3M17 A;  4U6X A;  1Q94 A;  4PR5 A;  1QQD A;  5BRZ A;  1JFM A;  3FQN A;  4NO0 A;  4NNX A;  1NAN H;  1CD1 A;  2C7U A;  5ENW A;  4PV8 A;  3LKQ A;  3SJV A;  3NFN A;  3VXM A;  2GUO A;  4F7E A;  4PV9 A;  2X4O A;  3QQ4 A;  3IT8 D;  1S8D A;  3TBT A;  5B38 A;  2BST A;  4L4V A;  4QRR A;  1ZSD A;  5SWS A;  3MGT A;  3CVH A;  1W0W A;  5L2K A;  3RL1 A;  4NO3 A;  1CE6 A;  3QFD A;  2AXF A;  3QI9 A;  4O2F A;  4QRP A;  1QSE A;  1T1Y A;  4D0B A;  3VXO A;  3KPP A;  4PGE A;  1EEY A;  3SDA A;  4L8C A;  4X6D A;  3SDC A;  5D2L A;  3PQY A;  2CLV A;  3GMM A;  5IVX A;  5C0E A;  4LCC C;  2F54 A;  1SYS A;  3REW A;  3SDD A;  4MX7 A;  4EI5 A;  1DE4 A;  2X4P A;  5AD0 A;  3VFP A;  1K8D A;  4PRI A;  1T7V A;  1P7Q A;  1WBY A;  3V5H A;  3ARG A;  3TPU E;  4PRH A;  5F7D A;  4PGC A;  2H6P A;  4IRS A;  3TBW A;  3GJF A;  2X4U A;  4HV8 A;  1HSB A;  4O2E A;  1AO7 A;  3KLA A;  4HUV A;  4MQ7 A;  3JTT A;  3V5K A;  3MRD A;  1M6O A;  1B3J A;  3PWJ A;  4Z76 A;  3OV6 A;  2PYE A;  1UXW A;  1FO0 H;  3P73 A;  5C09 A;  4QRQ A;  3BEW A;  3MRO A;  4PJB A;  5GSV A;  4E0R A;  2HJL A;  1S7R A;  3RTQ A;  1FFN A;  4MJ5 A;  2ZOL A;  5MEP A;  3KPS A;  2CKB H;  1ZHK A;  2FWO A;  4F7T A;  1VAD A;  2V2X A;  4NQC A;  3X14 A;  1LEG A;  3BW9 A;  4PRN A;  1WBX A;  5BS0 A;  3GSV A;  3ARD A;  5E6I C;  1YN6 A;  3TFK A;  3MRM A;  4PJF A;  5C0I A;  1KBG H;  4JQX A;  4F7C A;  4WUU A;  3HPJ A;  5IM7 A;  3QEQ A;  4X6E A;  3RWH A;  1FZM A;  4JFP A;  5IEK A;  5F1N A;  2GIT A;  3QUK A;  3BZF A;  3I6K A;  4N0C A;  4Z78 A;  3FON A;  3GSO A;  2HLA A;  1I1F A;  1MHE A;  3E6F A;  3C9N A;  5F9J A;  4QOK A;  1HHK A;  3WLB A;  1A1M A;  2X4R A;  2AV1 A;  5HGD A;  4L8D A;  5HGH A;  1GZQ A;  3OXR A;  3P9M A;  4ZUW A;  3KPO A;  4GKN A;  5DEF A;  3MRG A;  3MGO A;  1ZHL A;  1JGE A;  5IEH A;  3VXN A;  1KJ2 H;  1G6R H;  1TVB A;  3HUJ A;  4X6F A;  2RFX A;  2F74 A;  1ZAG A;  4U1M A;  3L3H A;  1ZS8 A;  3RWC A;  5E9D A;  1HHH A;  4Y4H A;  1XH3 A;  1LDP H;  3DBX A;  4PJG A;  5INC A;  4JFO A;  3VFW A;  3BHB A;  3X12 A;  3RZC A;  2CLZ A;  1XZ0 A;  3TO4 A;  1S7W A;  1XR9 A;  3BGM A;  3P77 A;  2FYY A;  3HE6 A;  2FO4 A;  1G7P A;  3SDX A;  4F7M A;  2NX5 A;  1YN7 A;  4MXQ A;  1ED3 A;  2V2W A;  3SPV A;  5E8N A;  1HOC A;  2A83 A;  4XXC A;  1S7T A;  4HS3 A;  2BNR A;  5D2N A;  3P4M A;  1A9B A;  4V3E B;  3BP4 A;  1X7Q A;  4WWK C;  2VLL A;  5C9J A;  1B0G A;  3VWK A;  5L2J A;  1T80 A;  3RWF A;  3ILP A;  5FKP A;  3BVN A;  5EU4 A;  1GZP A;  1AGC A;  4CW1 A;  1IM9 A;  3X11 A;  4IHO A;  3GSR A;  3TJH A;  5D9S A;  3B6S A;  4NQV A;  5EOT A;  3RGV C;  3P4N A;  4MS8 A;  4ZAK A;  3RWG A;  3PWN A;  3ES6 A;  5MEQ A;  5SWQ A;  3HAE A;  1QVO A;  3TF7 A;  1S7X A;  3MV8 A;  3MRR A;  5C0J A;  1N3N A;  1QO3 A;  3QFJ A;  2GAZ A;  3SKO A;  4HX1 A;  3T8X A;  3MRN A;  3G08 A;  1LEK A;  1T7Y A;  4NSK A;  4WDI A;  3H9H A;  5HHQ A;  5E8O A;  1QEW A;  1OSZ A;  4PG9 A;  2AKR A;  4G8G A;  4LHU A;  5EO0 A;  3D25 A;  3L3G A;  4D0C A;  3PAB A;  3OXS A;  3O3D A;  1L8J A;  4L8S C;  3MV7 A;  3M1B A;  1KTL A;  3PWP A;  4PDC E;  4QRU A;  5ISZ A;  5IB1 A;  3GMO A;  3FOL A;  3MV9 A;  1UQS A;  5EUO A;  1P1Z A;  1DUY A;  1T1Z A;  3MRB A;  3JVG A;  1A1O A;  1S9W A;  5C0C A;  3LKS A;  1TVH A;  1U58 A;  2GTW A;  3HG1 A;  3AM8 A;  4PJ5 A;  1INQ A;  2BVP A;  3CH1 A;  5C08 A;  3MRJ A;  2CII A;  4NNY A;  4G59 A;  1BII A;  5IND A;  1VAC A;  3DX6 A;  1JE6 A;  4S0U C;  3I6G A;  5EO1 A;  3D18 A;  1ONQ A;  4I4W A;  3UTT A;  4IIQ C;  5IB3 A;  3WUW A;  1MI5 A;  3RWE A;  3P9L A;  4Y16 A;  4U1K A;  3TBS A;  3BEV A;  5FDW A;  1B0R A;  1ZT7 A;  2GT9 A;  2D31 A;  1N5A A;  1EXU A;  1JUF A;  3VFN A;  4K7F A;  1I7T A;  2GTZ A;  4NHU E;  5C0A A;  3UPR A;  3KYO A;  4N8V A;  2OL3 H;  1QSF A;  5ACZ A;  5HHM A;  3VXS A;  1IM3 A;  1C16 A;  3MRH A;  1FZK A;  1T1X A;  3ARB A;  4L3E A;  3KPQ A;  2AXG A;  4NO2 A;  3GSN H;  1AGD A;  2ESV A;  3QDM A;  5HYJ A;  1OF2 A;  4L9L C;  3LKO A;  1I1A A;  3VFS A;  3BWA A;  3CCH A;  4ZUS A;  1HHG A;  2UWE A;  1SYV A;  4GKS A;  4LCW A;  4MNG A;  1I4F A;  4QRT A;  5J1A A;  1S9Y A;  5J6G A;  3V5D A;  1RK0 A;  3ILQ C;  1KPV A;  3MRK A;  3VFV A;  3O9W A;  2JCC A;  3O8X A;  3QUL A;  1JF1 A;  5EU3 A;  3FQW A;  1DUZ A;  5MER A;  1KJM A;  3QUY A;  1S7Q A;  4PRE A;  3WS6 A;  3BZE A;  5GSR A;  1G7Q A;  1FZO A;  1LQV A;  1FFP A;  2BSS A;  3FOM A;  1Z5L A;  1T0M A;  4ONO A;  1RJZ A;  3MA7 A;  3MRI A;  1RK1 A;  2BCK A;  4GUP A;  1S7S A;  5IB5 A;  4G8I A;  5C0G A;  3MRF A;  1BZ9 A;  3KYN A;  5IB2 A;  5JHD A;  2X4S A;  3O3A A;  1YPZ A;  3E2H A;  3I6L D;  1QR1 A;  1EEZ A;  3DXA A;  2NW3 A;  1LP9 A;  3QDJ A;  1KPU A;  3VFR A;  4U1I A;  1T20 A;  3L3K A;  4PRD A;  4QRS A;  4WU5 A;  4PJX A;  5IRO A;  3ROO A;  1A9E A;  1HHI A;  5BJT A;  4NQD A;  4N5E A;  1E28 A;  4JRX A;  1HHJ A;  1T21 A;  3QQ3 A;  4UQ3 A;  3BH8 A;  1AGE A;  2ZSV A;  4G9D A;  4WJ5 A;  3VWJ A;  3VRI A;  3T1F A;  1T7W A;  3D2U A;  3GSW A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...