3TFKA

42f3-p4b10/h2-ld
Total Genus 52
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
52
sequence length
174
structure length
174
Chain Sequence
PHSMRYYETATSRRGLGEPRYTSVGYVDDKEFVRFDSDAENPRYEPQVPWMEQEGPEYWERITQVAKGQEQWFRVNLRTLLGYYNQSAGGTHTLQRMYGCDVGSDGRLLRGYEQFAYDGCDYIALNEDLRTWTAADMAAQITRRKWEQAGAAEYYRAYLEGECVEWLHRYLKNG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords H2-Ld SBM2
publication title T cell receptor signaling is limited by docking geometry to peptide-major histocompatibility complex.
pubmed doi rcsb
source organism Mus musculus
molecule tags Immune system
total genus 52
structure length 174
sequence length 174
ec nomenclature
pdb deposition date 2011-08-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00129 MHC_I Class I Histocompatibility antigen, domains alpha 1 and 2
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.500.10 Alpha Beta 2-Layer Sandwich Murine Class I Major Histocompatibility Complex, H2-DB; Chain A, domain 1 MHC class I-like antigen recognition-like 3tfkA00
3UTTA 1TVHA 5IB4A 4JFOA 4UQ2A 4WW2C 1JPGA 1WBYA 4QRTA 2NW3A 1KPVA 1RK1A 1L8JA 1LDPH 2ZOLA 1XH3A 3L3JA 3O3EA 1EXUA 3RWHA 4D0CA 3LKRA 3FQTA 1X7QA 4HX1A 3VXPA 1BZ9A 3RGVC 3V5DA 1MI5A 1S7TA 3VRJA 3D18A 4Z78A 4APQA 3MYJA 2F53A 2AV7A 4F7MA 1MHCA 1JGEA 2PYEA 4X6EA 3LKPA 3WS3A 5HGBA 2ZSWA 3I6GA 4IRJA 3VFWA 3VH8A 4NQCA 1M6OA 3TBTA 1QSFA 4JFDA 1K8DA 4O2FA 3SJVA 4F7TA 3HUJA 3TBSA 3HE7A 4U1MA 1A9BA 4NQDA 3DTXA 1HHIA 3FOLA 4E5XA 1EEYA 4MJIA 2OI9A 3PWPA 1CE6A 1BIIA 1TMCA 4GKNA 4N8VA 5EFIA 1FZOA 3LKNA 1E28A 3OXRA 2C7UA 4PJGA 1FZKA 5F1NA 2P5WA 4G9DA 1A1OA 1T20A 4PGDA 5INCA 1QRNA 5JHDA 5FKPA 5F1IA 5HGDA 4D0BA 1OGTA 1ZSDA 2GT9A 3SDXA 3O4LA 4PP8C 2GITA 4PRDA 3L3GA 5C0CA 5C0FA 1T1WA 1R3HA 1JE6A 3O3DA 1XR9A 3D2UA 3SKOA 1KPUA 1T7ZA 3KXFA 1QVOA 3LV3A 4IRSA 2PO6A 4HUVA 4L8SC 1RK0A 4N0FA 4Y4FA 3M17A 1I4FA 3PWJA 5IROA 3VFSA 3TVMA 3DMMA 2VLKA 3CC5A 3DXAA 3CVHA 1W72A 3BGMA 1ED3A 5D5MA 1P7QA 3MRCA 4ZUTA 1QLFA 2VLLA 5EOTA 3GMPA 5FDWA 4LCWA 2ZOKA 3LKOA 5E00A 1JUFA 1OSZA 4JFFA 4N5EA 4PR5A 1ZT1A 3MRHA 2ESVA 2BSRA 1G7QA 3BH8A 3L3DA 1N2RA 3BO8A 5IEHA 1I1YA 4L3EA 3VFOA 4PJ7A 4ZUSA 3P4MA 3D25A 3ROLA 2CKBH 3HG1A 5ACZA 3D3VA 2XPGA 3GMQA 1PQZA 2P5EA 3L3IA 1JPFA 4JRYA 4MVBA 4JQVA 2A83A 2VE6A 3BH9A 3VFMA 4Z77A 2D31A 3ERYA 5C0BA 3ES6A 4I48A 1QR1A 4LHUA 1N59A 4G59A 5MEPA 2BNRA 4MNQA 2AKRA 4PGBA 2WY3A 1BD2A 1GZQA 3GJFA 3JTSA 4PJXA 3REWA 5E6IC 3QDMA 1HHJA 3OXSA 3PABA 3GSXA 3BHBA 4O2EA 3VRIA 1JF1A 3TJHA 2CIKA 3VFVA 3FT4A 4G42A 1HYRC 3FFCA 1JGDA 2HLAA 2VLJA 1SYVA 3QUXA 2XFXA 3WL9A 4PG2A 1KJ2H 4HUWA 4PJ8A 4PJDA 4S0UC 4QRPA 3CCHA 1S7QA 5HHNA 3HAEA 5E9DA 2AK4A 4PRBA 3CH1A 2VLRA 3CPLA 4E0RA 2RFXA 2FWOA 3KWWA 1S9WA 3VXNA 1K5NA 3O3AA 3BEWA 1P1ZA 3V5KA 2F54A 4WUUA 4GUPA 4NO0A 1UXSA 3ARBA 1VGKA 3IT8D 3O9WA 3KPRA 1AO7A 4U6XA 3SDCA 1E27A 2J8UA 3BEVA 3PQYA 1GZPA 1AGFA 2HN7A 4G9FA 3P9LA 2X4SA 4ONOA 3P4OA 2F74A 1FFPA 5BXFA 1T1ZA 3P73A 4LNRA 1LD9A 4PJBA 4JRXA 3O3BA 3GMOA 4PJHA 1TVBA 3SDDA 3FQWA 3PWVA 3MRGA 4K7FA 3I6KA 1Q94A 3LKSA 3RZCA 2FIKA 4L4TA 3FRUA 4FTVA 4QRUA 2BSTA 4L29A 4PGCA 1FFOA 3GSOA 4JFEA 3MGOA 4HV8A 3KPSA 3X14A 3TBVA 4IHOA 1DDHA 3FQRA 4U1SA 1T0MA 5C0JA 5EUOA 3GSRA 1T0NA 2VAAA 3CZFA 4HWZA 3ARGA 1KCGC 1KJVA 3ILQC 3BP7A 5H94A 1U58A 4ZAKA 3GSUA 1HHKA 3TBYA 3TIDA 1QSEA 3ARFA 3SKMA 3C9NA 5EU5A 5IB3A 3E2HA 2YEZA 2BVOA 1T7XA 3MRLA 3VWJA 5D2NA 3MRMA 2H6PA 4L8BA 4PJCA 3ILPA 4ELMA 3VJ6A 4JFPA 3QI9A 3G08A 1G7PA 2OL3H 1M05A 3JTCA 1CD1A 5GSRA 5EU3A 3VFPA 4F7EA 3DX8A 3RUGA 1B0RA 3W0WA 3RWCA 1DUYA 4PRIA 1ZAGA 5D2LA 3SDAA 3WLBA 3FTGA 1S7SA 4L3CA 4L8CA 4NHUE 3VXOA 2BVQA 1AGDA 2V2XA 3BUYA 4NNXA 3TO2A 3X13A 2AV1A 5IB2A 4G8IA 4PJAA 4X6CA 4CW1A 5SWSA 1VADA 3MA7A 3MR9A 4Y4KA 5BJTA 4QOKA 4U1KA 1KBGH 1S9XA 2NX5A 2VABA 4L9LC 4NQEA 5C0EA 3SPVA 1LEGA 4X6DA 3VFRA 3HLAA 3FQNA 3QUZA 3HE6A 4ZUWA 5HGAA 1LK2A 3MRRA 1KJMA 1HSBA 2BSSA 3PWLA 4U1NA 3RWIA 4ZUVA 4EI5A 2HJLA 1HHHA 1HSAA 3P9MA 1CG9A 2V2WA 3UTQA 4MJ5A 3UPRA 3D39A 1W0WA 2X4NA 2ZSVA 5FA4A 1HHGA 4MX7A 1T7WA 5HHMA 4LCYA 3RTQA 1YPZA 5MENA 3DBXA 1IM9A 1T1XA 1UXWA 2BCKA 3HCVA 3KYNA 4WDIA 1WBZA 3BZEA 1FO0H 3TZVC 3M1BA 3VXUA 1T80A 2UWEA 1NEZA 1EFXA 1N3NA 4X6FA 1FZJA 3B3IA 5GSVA 5DEFA 3VCLA 3GSNH 2YPKA 3AU1A 3U0PA 3DX7A 1AGCA 1QEWA 1T1YA 3MRPA 1WBXA 3ROOA 5C08A 5MEOA 2DYPA 1MHEA 3H7BA 3X11A 3QQ3A 2X4UA 4WO4A 3TF7A 4PJ5A 4MXQA 1DUZA 1I1AA 3LKQA 4QRRA 2FZ3A 3GSVA 3MV7A 3BP4A 3VXMA 1HOCA 4MS8A 3OX8A 4N0CA 1P4LA 1ZT7A 4O2CA 1B0GA 1ZHLA 3W39A 1ZHNA 2CLZA 3GMMA 4NT6A 4CVXA 3QEQA 3VFUA 3MREA 5E8PA 3AREA 3BW9A 5EU4A 4NSKA 4Z76A 1BQHA 1FZMA 3GSQA 3KPOA 1OGAA 4PJEA 1B3JA 1DE4A 3LN5A 3RL2A 3RWDA 3H9HA 2HJKA 3FT3A 2FYYA 5MEQA 3TO4A 5ENWA 1KTLA 4NO5A 4D0DA 1FFNA 3MRBA 4PRAA 3GMLA 4NO3A 3NFNA 5D7IA 1QQDA 1QO3A 1AGEA 1ONQA 3V5HA 1T7YA 1N5AA 4I4WA 4PGEA 3B6SA 3KYOA 3VXSA 1A1NA 5HHQA 4PRHA 1JFMA 1LEKA 4F7CA 5B39A 1AGBA 1I7UA 1LQVA 4QRQA 2CLRA 2MHAA 3JTTA 4GKSA 3VWKA 3KPNA 4WJ5A 3L9RA 4Y4HA 4V3DB 2BVPA 2E7LE 3BWAA 3E6FA 3KPPA 4JFQA 3RWEA 3MRNA 3O8XA 1S7XA 4IIQC 4ZFZA 5FA3A 1IM3A 5BS0A 4EUPA 1C16A 4EN3C 3TA3A 2GTZA 1T21A 5HHPA 2FO4A 4MJ6A 3CDGA 3WS6A 2AXFA 5J1AA 3P77A 4K71B 3H9SA 5D7JC 3FOMA 1KJ3H 3I6LD 3MV9A 4Y16A 1YN7A 5HHOA 1XZ0A 3JVGA 4PJIA 4PJ9A 3AM8A 4HUXA 1S8DA 3BXNA 4MQ7A 4HS3A 2GUOA 2X70A 5HGHA 3QULA 3LN4A 1KPRA 2X4OA 1OF2A 3GSWA 3QUYA 4PDCE 3T1FA 5IVXA 5C0GA 3GIVA 4HKJA 4V3EB 3HPJA 5EO1A 3ARDA 4ZUUA 4F7PA 1LP9A 4G8GA 1XR8A 3MGTA 2Q7YA 4CVZA 3BZFA 1SYSA 3MRIA 5ISZA 5IM7A 2CIIA 2H26A 3QZWA 5IB1A 4HUUA 5C09A 1T22A 2BNQA 2X4RA 4L4VA 5J6GA 4MNGA 4PRNA 3OV6A 4PJFA 3QDGA 5L2KA 3VFNA 1UQSA 3IXAA 1S7RA 4WU7A 5D9SA 3VFTA 1INQA 3X12A 3P4NA 3PWUA 3MRDA 1S9YA 5IB5A 4PG9A 1A6ZA 4U1LA 2X4QA 3SCMA 3QDJA 2GTWA 3MROA 2JCCA 3C8KA 3FQXA 5E8OA 3TPUE 4NNYA 3WUWA 5HYJA 4PRPA 3VXRA 5C0AA 4UQ3A 3MV8A 5B38A 5J6HA 5SWQA 4L8DA 3E3QA 3BVNA 3FT2A 3L3KA 3GMNA 3MRKA 5MERA 3MRFA 5EO0A 3FQUA 1ZT4A 3KPQA 3S6CA 3KLAA 1ZHKA 3L3HA 3QUKA 4PV8A 4U1HA 4LCCC 1W0VA 3GMRA 4PV9A 1YDPA 5F7DA 5IEKA 1S7VA 1T7VA 3RL1A 1NAMH 4NQXA 4Y2DA 1ZVSA 5AD0A 3KPMA 1YN6A 4U1IA 3QFDA 1Z5LA 2GJ6A 3UTSA 5DEGA 5C07A 3QFJA 1A9EA 3DX6A 1A1MA 5C0DA 4U6YA 2YPLA 1ZS8A 5D7LA 4NQVA 2X4PA 1ZHBA 1RJZA 5INDA 3ECBA 2X4TA 2AXGA 1S7UA 1I7TA 3TFKA 5EU6A 3MRQA 5L2JA 3QQ4A 4WWKC 4WU5A 3RWGA 5C9JA 4NO2A 4N0UA 3RWFA 1I7RA 4JQXA 4PREA 5E8NA 3MRJA 5SWZA 3TN0A 3TIEA 3RWJA 1NANH 3T8XA 1MWAH 1S7WA 2CLVA 3FONA 1VACA 5F9JA 3E6HA 1EEZA 5DDHA 1JHTA 4XXCA 1I1FA 1AKJA 4U1JA 4FFEX 5BRZA 4QRSA 1FG2A 3TBWA 1G6RH 1RJYA 3PWNA 3UBXA 2GAZA 3KPLA 5C0IA 4G43A
chains in the Genus database with same CATH superfamily
3UTTA 1TVHA 5IB4A 4JFOA 4UQ2A 4WW2C 1JPGA 1WBYA 4QRTA 2NW3A 1KPVA 1RK1A 1L8JA 1LDPH 2ZOLA 1XH3A 3L3JA 3O3EA 1EXUA 3RWHA 4D0CA 3LKRA 3FQTA 1X7QA 4HX1A 3VXPA 1BZ9A 3RGVC 3V5DA 1MI5A 1S7TA 3VRJA 3D18A 4Z78A 4APQA 3MYJA 2F53A 2AV7A 4F7MA 1MHCA 1JGEA 2PYEA 4X6EA 3LKPA 3WS3A 5HGBA 2ZSWA 3I6GA 4IRJA 3VFWA 3VH8A 4NQCA 1M6OA 3TBTA 1QSFA 4JFDA 1K8DA 4O2FA 3SJVA 4F7TA 3HUJA 3TBSA 3HE7A 4U1MA 1A9BA 4NQDA 3DTXA 1HHIA 3FOLA 4E5XA 1EEYA 4MJIA 2OI9A 3PWPA 1CE6A 1BIIA 1TMCA 4GKNA 4N8VA 5EFIA 1FZOA 3LKNA 1E28A 3OXRA 2C7UA 4PJGA 1FZKA 5F1NA 2P5WA 4G9DA 1A1OA 1T20A 4PGDA 5INCA 1QRNA 5JHDA 5FKPA 5F1IA 5HGDA 4D0BA 1OGTA 1ZSDA 2GT9A 3SDXA 3O4LA 4PP8C 2GITA 4PRDA 3L3GA 5C0CA 5C0FA 1T1WA 1R3HA 1JE6A 3O3DA 1XR9A 3D2UA 3SKOA 1KPUA 1T7ZA 3KXFA 1QVOA 3LV3A 4IRSA 2PO6A 4HUVA 4L8SC 1RK0A 4N0FA 4Y4FA 3M17A 1I4FA 3PWJA 5IROA 3VFSA 3TVMA 3DMMA 2VLKA 3CC5A 3DXAA 3CVHA 1W72A 3BGMA 1ED3A 5D5MA 1P7QA 3MRCA 4ZUTA 1QLFA 2VLLA 5EOTA 3GMPA 5FDWA 4LCWA 2ZOKA 3LKOA 5E00A 1JUFA 1OSZA 4JFFA 4N5EA 4PR5A 1ZT1A 3MRHA 2ESVA 2BSRA 1G7QA 3BH8A 3L3DA 1N2RA 3BO8A 5IEHA 1I1YA 4L3EA 3VFOA 4PJ7A 4ZUSA 3P4MA 3D25A 3ROLA 2CKBH 3HG1A 5ACZA 3D3VA 2XPGA 3GMQA 1PQZA 2P5EA 3L3IA 1JPFA 4JRYA 4MVBA 4JQVA 2A83A 2VE6A 3BH9A 3VFMA 4Z77A 2D31A 3ERYA 5C0BA 3ES6A 4I48A 1QR1A 4G59C 4LHUA 1N59A 4G59A 5MEPA 2BNRA 4MNQA 2AKRA 4PGBA 2WY3A 1BD2A 1GZQA 3GJFA 3JTSA 4PJXA 3REWA 5E6IC 3QDMA 1HHJA 3OXSA 3PABA 3GSXA 3BHBA 4O2EA 3VRIA 1JF1A 3TJHA 2O5NA 2CIKA 3VFVA 3FT4A 4G42A 1HYRC 3FFCA 1JGDA 2HLAA 2VLJA 1SYVA 3QUXA 2XFXA 3WL9A 4PG2A 1KJ2H 2NYKA 4HUWA 4PJ8A 4PJDA 4QRPA 4S0UC 3CCHA 1S7QA 5HHNA 3HAEA 5E9DA 2AK4A 4PRBA 3CH1A 2VLRA 3CPLA 4E0RA 2RFXA 2FWOA 3KWWA 1S9WA 3VXNA 1K5NA 3O3AA 3BEWA 1P1ZA 3V5KA 2F54A 4WUUA 4GUPA 4NO0A 1UXSA 3ARBA 1VGKA 3IT8D 3O9WA 3KPRA 1AO7A 4U6XA 3SDCA 1E27A 2J8UA 3BEVA 3PQYA 1GZPA 1AGFA 2HN7A 4G9FA 3P9LA 2X4SA 4ONOA 3P4OA 2F74A 1FFPA 5BXFA 1T1ZA 3P73A 4LNRA 1LD9A 4PJBA 4JRXA 3O3BA 3GMOA 4PJHA 1TVBA 3SDDA 3FQWA 3PWVA 3MRGA 4K7FA 3I6KA 1Q94A 3LKSA 3RZCA 2FIKA 4L4TA 3FRUA 4FTVA 4QRUA 2BSTA 4L29A 4PGCA 1FFOA 3GSOA 4JFEA 3MGOA 4HV8A 3KPSA 3X14A 4BKWA 3TBVA 4IHOA 1DDHA 3FQRA 4U1SA 1T0MA 5C0JA 5EUOA 3GSRA 1T0NA 2VAAA 3CZFA 4HWZA 3ARGA 1KCGC 2IA1A 1KJVA 3ILQC 3BP7A 5H94A 1U58A 4ZAKA 3GSUA 1HHKA 3TBYA 3TIDA 1QSEA 3ARFA 3SKMA 3C9NA 5EU5A 5IB3A 3E2HA 2YEZA 2BVOA 1T7XA 3MRLA 3VWJA 5D2NA 3MRMA 2H6PA 4L8BA 4PJCA 3ILPA 4ELMA 3VJ6A 4JFPA 3QI9A 3G08A 1G7PA 2OL3H 1M05A 3JTCA 1CD1A 5GSRA 5EU3A 3VFPA 4F7EA 3DX8A 3RUGA 1B0RA 3W0WA 3RWCA 1DUYA 4PRIA 1ZAGA 5D2LA 3SDAA 3WLBA 3FTGA 1S7SA 4L3CA 4L8CA 4NHUE 3VXOA 2BVQA 1AGDA 2V2XA 3BUYA 4NNXA 3TO2A 3X13A 2AV1A 5IB2A 4G8IA 4PJAA 4X6CA 4CW1A 5SWSA 1VADA 3MA7A 3MR9A 4Y4KA 5BJTA 4QOKA 4U1KA 1KBGH 1S9XA 2NX5A 2VABA 4L9LC 4NQEA 5C0EA 3SPVA 1LEGA 4X6DA 3VFRA 3HLAA 3FQNA 3QUZA 3HE6A 4ZUWA 5HGAA 1LK2A 3MRRA 1KJMA 1HSBA 2BSSA 3PWLA 4U1NA 3RWIA 4ZUVA 4EI5A 2HJLA 1HHHA 1HSAA 3P9MA 1CG9A 2V2WA 3UTQA 4MJ5A 3UPRA 3D39A 1W0WA 2X4NA 2ZSVA 5FA4A 1HHGA 4MX7A 1T7WA 3I0TA 5HHMA 4LCYA 3RTQA 1YPZA 5MENA 3DBXA 1IM9A 1T1XA 1UXWA 2BCKA 3HCVA 3KYNA 4WDIA 1WBZA 3BZEA 1FO0H 3TZVC 3M1BA 3VXUA 1T80A 2UWEA 1NEZA 1EFXA 1N3NA 4X6FA 1FZJA 3B3IA 5GSVA 5DEFA 3VCLA 3GSNH 2YPKA 3AU1A 3U0PA 3DX7A 1AGCA 1QEWA 1T1YA 3MRPA 1WBXA 3ROOA 5C08A 5MEOA 2DYPA 1MHEA 3H7BA 3X11A 3QQ3A 2X4UA 4WO4A 3TF7A 4PJ5A 4MXQA 1DUZA 1I1AA 3LKQA 4QRRA 2FZ3A 3GSVA 3MV7A 3BP4A 3VXMA 1HOCA 4MS8A 3OX8A 4N0CA 1P4LA 1ZT7A 4O2CA 1B0GA 1ZHLA 3W39A 1ZHNA 2CLZA 3GMMA 4NT6A 4CVXA 3QEQA 3VFUA 3MREA 5E8PA 3AREA 3BW9A 5EU4A 4NSKA 4Z76A 1BQHA 1FZMA 3GSQA 3KPOA 1OGAA 4PJEA 1B3JA 1DE4A 3LN5A 3RL2A 3RWDA 3H9HA 2HJKA 3FT3A 2FYYA 5MEQA 3TO4A 5ENWA 1KTLA 4NO5A 4D0DA 1FFNA 3MRBA 4PRAA 3GMLA 4NO3A 3NFNA 5D7IA 1QQDA 1QO3A 1AGEA 1ONQA 3V5HA 1T7YA 1N5AA 4I4WA 4PGEA 3B6SA 3KYOA 3VXSA 1A1NA 5HHQA 4PRHA 1JFMA 1LEKA 4F7CA 5B39A 1AGBA 1I7UA 1LQVA 4QRQA 2CLRA 2MHAA 3JTTA 4GKSA 3VWKA 3KPNA 4WJ5A 3L9RA 4Y4HA 4V3DB 2BVPA 2E7LE 3BWAA 3E6FA 3KPPA 4JFQA 3RWEA 3MRNA 3O8XA 1S7XA 4IIQC 4ZFZA 5FA3A 1IM3A 5BS0A 4EUPA 1C16A 4EN3C 3TA3A 2GTZA 1T21A 5HHPA 2FO4A 4MJ6A 3CDGA 3WS6A 2AXFA 5J1AA 3P77A 4K71B 3H9SA 5D7JC 3FOMA 1KJ3H 3I6LD 3MV9A 4Y16A 1YN7A 5HHOA 1XZ0A 3JVGA 4PJIA 4PJ9A 3AM8A 4HUXA 1S8DA 3BXNA 4MQ7A 4HS3A 2GUOA 2X70A 5HGHA 3QULA 3LN4A 1KPRA 2X4OA 1OF2A 3GSWA 3QUYA 4PDCE 3T1FA 5IVXA 5C0GA 3GIVA 4HKJA 4V3EB 3HPJA 5EO1A 3ARDA 4ZUUA 4F7PA 1LP9A 4G8GA 1XR8A 3MGTA 2Q7YA 4CVZA 3BZFA 1SYSA 3MRIA 5ISZA 5IM7A 2CIIA 2H26A 3QZWA 5IB1A 4HUUA 5C09A 1T22A 2BNQA 2X4RA 4L4VA 5J6GA 4MNGA 4PRNA 3OV6A 4PJFA 3QDGA 4JO8A 3VFNA 5L2KA 1UQSA 3IXAA 1S7RA 4WU7A 5D9SA 3VFTA 1INQA 3X12A 3P4NA 3PWUA 3MRDA 1S9YA 5IB5A 4PG9A 1A6ZA 4U1LA 2X4QA 3SCMA 3QDJA 2GTWA 3MROA 2JCCA 3C8KA 3FQXA 5E8OA 3TPUE 4NNYA 3WUWA 5HYJA 4PRPA 3VXRA 5C0AA 4UQ3A 3MV8A 5B38A 5J6HA 5SWQA 4L8DA 3E3QA 3BVNA 3FT2A 3L3KA 3GMNA 3MRKA 5MERA 3MRFA 5EO0A 3FQUA 1ZT4A 3KPQA 3S6CA 3KLAA 1ZHKA 3L3HA 3QUKA 4PV8A 4U1HA 4LCCC 1W0VA 3GMRA 4PV9A 1YDPA 5F7DA 5IEKA 1S7VA 1T7VA 3RL1A 1NAMH 4NQXA 4Y2DA 1ZVSA 5AD0A 3KPMA 1YN6A 4U1IA 3QFDA 1Z5LA 2GJ6A 3UTSA 5DEGA 5C07A 3QFJA 1A9EA 3DX6A 1A1MA 5C0DA 4U6YA 2YPLA 1ZS8A 5D7LA 4NQVA 2X4PA 1ZHBA 1RJZA 5INDA 3ECBA 2X4TA 2AXGA 1S7UA 1I7TA 3TFKA 5EU6A 3MRQA 5L2JA 3QQ4A 4WWKC 4WU5A 3RWGA 5C9JA 4NO2A 4N0UA 3RWFA 1I7RA 4JQXA 4PREA 5E8NA 3MRJA 5SWZA 3TN0A 3TIEA 3RWJA 1NANH 3T8XA 1MWAH 1S7WA 2CLVA 3FONA 1VACA 5F9JA 3E6HA 1EEZA 5DDHA 1JHTA 4XXCA 1I1FA 1AKJA 4U1JA 4FFEX 5BRZA 4QRSA 1FG2A 3TBWA 1G6RH 1RJYA 3PWNA 3UBXA 2GAZA 3KPLA 5C0IA 4G43A
chains in the Genus database with same CATH topology
3UTTA 1TVHA 5IB4A 4JFOA 4UQ2A 4WW2C 1JPGA 1WBYA 4QRTA 2NW3A 1KPVA 1RK1A 1L8JA 1LDPH 2ZOLA 1XH3A 3L3JA 3O3EA 1EXUA 3RWHA 4D0CA 3LKRA 3FQTA 1X7QA 4HX1A 3VXPA 1BZ9A 3RGVC 3V5DA 1MI5A 1S7TA 3VRJA 3D18A 4Z78A 4APQA 3MYJA 2F53A 2AV7A 4F7MA 1MHCA 1JGEA 2PYEA 4X6EA 3LKPA 3WS3A 5HGBA 2ZSWA 3I6GA 4IRJA 3VFWA 3VH8A 4NQCA 1M6OA 3TBTA 1QSFA 4JFDA 1K8DA 4O2FA 3SJVA 4F7TA 3HUJA 3TBSA 3HE7A 4U1MA 1A9BA 4NQDA 3DTXA 1HHIA 3FOLA 4E5XA 1EEYA 4MJIA 2OI9A 3PWPA 1CE6A 1BIIA 1TMCA 4GKNA 4N8VA 5EFIA 1FZOA 3LKNA 1E28A 3OXRA 2C7UA 4PJGA 1FZKA 5F1NA 2P5WA 4G9DA 1A1OA 1T20A 4PGDA 5INCA 1QRNA 5JHDA 5FKPA 5F1IA 5HGDA 4D0BA 1OGTA 1ZSDA 2GT9A 3SDXA 3O4LA 4PP8C 2GITA 4PRDA 3L3GA 5C0CA 5C0FA 1T1WA 1R3HA 1JE6A 3O3DA 1XR9A 3D2UA 3SKOA 1KPUA 1T7ZA 3KXFA 1QVOA 3LV3A 4IRSA 2PO6A 4HUVA 4L8SC 1RK0A 4N0FA 4Y4FA 3M17A 1I4FA 3PWJA 5IROA 3VFSA 3TVMA 3DMMA 2VLKA 3CC5A 3DXAA 3CVHA 1W72A 3BGMA 1ED3A 5D5MA 1P7QA 3MRCA 4ZUTA 1QLFA 2VLLA 5EOTA 3GMPA 5FDWA 4LCWA 2ZOKA 3LKOA 5E00A 1JUFA 1OSZA 4JFFA 4N5EA 4PR5A 1ZT1A 3MRHA 2ESVA 2BSRA 1G7QA 3BH8A 3L3DA 1N2RA 3BO8A 5IEHA 1I1YA 4L3EA 3VFOA 4PJ7A 4ZUSA 3P4MA 3D25A 3ROLA 2CKBH 3HG1A 5ACZA 3D3VA 2XPGA 3GMQA 1PQZA 2P5EA 3L3IA 1JPFA 4JRYA 4MVBA 4JQVA 2A83A 2VE6A 3BH9A 3VFMA 4Z77A 2D31A 3ERYA 5C0BA 3ES6A 4I48A 1QR1A 4LHUA 1N59A 4G59A 5MEPA 2BNRA 4MNQA 2AKRA 4PGBA 2WY3A 1BD2A 1GZQA 3GJFA 3JTSA 4PJXA 3REWA 5E6IC 3QDMA 1HHJA 3OXSA 3PABA 3GSXA 3BHBA 4O2EA 3VRIA 1JF1A 3TJHA 2CIKA 3VFVA 3FT4A 4G42A 1HYRC 3FFCA 1JGDA 2HLAA 2VLJA 1SYVA 3QUXA 2XFXA 3WL9A 4PG2A 1KJ2H 4HUWA 4PJ8A 4PJDA 4S0UC 4QRPA 3CCHA 1S7QA 5HHNA 3HAEA 5E9DA 2AK4A 4PRBA 3CH1A 2VLRA 3CPLA 4E0RA 2RFXA 2FWOA 3KWWA 1S9WA 3VXNA 1K5NA 3O3AA 3BEWA 1P1ZA 3V5KA 2F54A 4WUUA 4GUPA 4NO0A 1UXSA 3ARBA 1VGKA 3IT8D 3O9WA 3KPRA 1AO7A 4U6XA 3SDCA 1E27A 2J8UA 3BEVA 3PQYA 1GZPA 1AGFA 2HN7A 4G9FA 3P9LA 2X4SA 4ONOA 3P4OA 2F74A 1FFPA 5BXFA 1T1ZA 3P73A 4LNRA 1LD9A 4PJBA 4JRXA 3O3BA 3GMOA 4PJHA 1TVBA 3SDDA 3FQWA 3PWVA 3MRGA 4K7FA 3I6KA 1Q94A 3LKSA 3RZCA 2FIKA 4L4TA 3FRUA 4FTVA 4QRUA 2BSTA 4L29A 4PGCA 1FFOA 3GSOA 4JFEA 3MGOA 4HV8A 3KPSA 3X14A 3TBVA 4IHOA 1DDHA 3FQRA 4U1SA 1T0MA 5C0JA 5EUOA 3GSRA 1T0NA 2VAAA 3CZFA 4HWZA 3ARGA 1KCGC 1KJVA 3ILQC 3BP7A 5H94A 1U58A 4ZAKA 3GSUA 1HHKA 3TBYA 3TIDA 1QSEA 3ARFA 3SKMA 3C9NA 5EU5A 5IB3A 3E2HA 2YEZA 2BVOA 1T7XA 3MRLA 3VWJA 5D2NA 3MRMA 2H6PA 4L8BA 4PJCA 3ILPA 4ELMA 3VJ6A 4JFPA 3QI9A 3G08A 1G7PA 2OL3H 1M05A 3JTCA 1CD1A 5GSRA 5EU3A 3VFPA 4F7EA 3DX8A 3RUGA 1B0RA 3W0WA 3RWCA 1DUYA 4PRIA 1ZAGA 5D2LA 3SDAA 3WLBA 3FTGA 1S7SA 4L3CA 4L8CA 4NHUE 3VXOA 2BVQA 1AGDA 2V2XA 3BUYA 4NNXA 3TO2A 3X13A 2AV1A 5IB2A 4G8IA 4PJAA 4X6CA 4CW1A 5SWSA 1VADA 3MA7A 3MR9A 4Y4KA 5BJTA 4QOKA 4U1KA 1KBGH 1S9XA 2NX5A 2VABA 4L9LC 4NQEA 5C0EA 3SPVA 1LEGA 4X6DA 3VFRA 3HLAA 3FQNA 3QUZA 3HE6A 4ZUWA 5HGAA 1LK2A 3MRRA 1KJMA 1HSBA 2BSSA 3PWLA 4U1NA 3RWIA 4ZUVA 4EI5A 2HJLA 1HHHA 1HSAA 3P9MA 1CG9A 2V2WA 3UTQA 4MJ5A 3UPRA 3D39A 1W0WA 2X4NA 2ZSVA 5FA4A 1HHGA 4MX7A 1T7WA 5HHMA 4LCYA 3RTQA 1YPZA 5MENA 3DBXA 1IM9A 1T1XA 1UXWA 2BCKA 3HCVA 3KYNA 4WDIA 1WBZA 3BZEA 1FO0H 3TZVC 3M1BA 3VXUA 1T80A 2UWEA 1NEZA 1EFXA 1N3NA 4X6FA 1FZJA 3B3IA 5GSVA 5DEFA 3VCLA 3GSNH 2YPKA 3AU1A 3U0PA 3DX7A 1AGCA 1QEWA 1T1YA 3MRPA 1WBXA 3ROOA 5C08A 5MEOA 2DYPA 1MHEA 3H7BA 3X11A 3QQ3A 2X4UA 4WO4A 3TF7A 4PJ5A 4MXQA 1DUZA 1I1AA 3LKQA 4QRRA 2FZ3A 3GSVA 3MV7A 3BP4A 3VXMA 1HOCA 4MS8A 3OX8A 4N0CA 1P4LA 1ZT7A 4O2CA 1B0GA 1ZHLA 3W39A 1ZHNA 2CLZA 3GMMA 4NT6A 4CVXA 3QEQA 3VFUA 3MREA 5E8PA 3AREA 3BW9A 5EU4A 4NSKA 4Z76A 1BQHA 1FZMA 3GSQA 3KPOA 1OGAA 4PJEA 1B3JA 1DE4A 3LN5A 3RL2A 3RWDA 3H9HA 2HJKA 3FT3A 2FYYA 5MEQA 3TO4A 5ENWA 1KTLA 4NO5A 4D0DA 1FFNA 3MRBA 4PRAA 3GMLA 4NO3A 3NFNA 5D7IA 1QQDA 1QO3A 1AGEA 1ONQA 3V5HA 1T7YA 1N5AA 4I4WA 4PGEA 3B6SA 3KYOA 3VXSA 1A1NA 5HHQA 4PRHA 1JFMA 1LEKA 4F7CA 5B39A 1AGBA 1I7UA 1LQVA 4QRQA 2CLRA 2MHAA 3JTTA 4GKSA 3VWKA 3KPNA 4WJ5A 3L9RA 4Y4HA 4V3DB 2BVPA 2E7LE 3BWAA 3E6FA 3KPPA 4JFQA 3RWEA 3MRNA 3O8XA 1S7XA 4IIQC 4ZFZA 5FA3A 1IM3A 5BS0A 4EUPA 1C16A 4EN3C 3TA3A 2GTZA 1T21A 5HHPA 2FO4A 4MJ6A 3CDGA 3WS6A 2AXFA 5J1AA 3P77A 4K71B 3H9SA 5D7JC 3FOMA 1KJ3H 3I6LD 3MV9A 4Y16A 1YN7A 5HHOA 1XZ0A 3JVGA 4PJIA 4PJ9A 3AM8A 4HUXA 1S8DA 3BXNA 4MQ7A 4HS3A 2GUOA 2X70A 5HGHA 3QULA 3LN4A 1KPRA 2X4OA 1OF2A 3GSWA 3QUYA 4PDCE 3T1FA 5IVXA 5C0GA 3GIVA 4HKJA 4V3EB 3HPJA 5EO1A 3ARDA 4ZUUA 4F7PA 1LP9A 4G8GA 1XR8A 3MGTA 2Q7YA 4CVZA 3BZFA 1SYSA 3MRIA 5ISZA 5IM7A 2CIIA 2H26A 3QZWA 5IB1A 4HUUA 5C09A 1T22A 2BNQA 2X4RA 4L4VA 5J6GA 4MNGA 4PRNA 3OV6A 4PJFA 3QDGA 5L2KA 3VFNA 1UQSA 3IXAA 1S7RA 4WU7A 5D9SA 3VFTA 1INQA 3X12A 3P4NA 3PWUA 3MRDA 1S9YA 5IB5A 4PG9A 1A6ZA 4U1LA 2X4QA 3SCMA 3QDJA 2GTWA 3MROA 2JCCA 3C8KA 3FQXA 5E8OA 3TPUE 4NNYA 3WUWA 5HYJA 4PRPA 3VXRA 5C0AA 4UQ3A 3MV8A 5B38A 5J6HA 5SWQA 4L8DA 3E3QA 3BVNA 3FT2A 3L3KA 3GMNA 3MRKA 5MERA 3MRFA 5EO0A 3FQUA 1ZT4A 3KPQA 3S6CA 3KLAA 1ZHKA 3L3HA 3QUKA 4PV8A 4U1HA 4LCCC 1W0VA 3GMRA 4PV9A 1YDPA 5F7DA 5IEKA 1S7VA 1T7VA 3RL1A 1NAMH 4NQXA 4Y2DA 1ZVSA 5AD0A 3KPMA 1YN6A 4U1IA 3QFDA 1Z5LA 2GJ6A 3UTSA 5DEGA 5C07A 3QFJA 1A9EA 3DX6A 1A1MA 5C0DA 4U6YA 2YPLA 1ZS8A 5D7LA 4NQVA 2X4PA 1ZHBA 1RJZA 5INDA 3ECBA 2X4TA 2AXGA 1S7UA 1I7TA 3TFKA 5EU6A 3MRQA 5L2JA 3QQ4A 4WWKC 4WU5A 3RWGA 5C9JA 4NO2A 4N0UA 3RWFA 1I7RA 4JQXA 4PREA 5E8NA 3MRJA 5SWZA 3TN0A 3TIEA 3RWJA 1NANH 3T8XA 1MWAH 1S7WA 2CLVA 3FONA 1VACA 5F9JA 3E6HA 1EEZA 5DDHA 1JHTA 4XXCA 1I1FA 1AKJA 4U1JA 4FFEX 5BRZA 4QRSA 1FG2A 3TBWA 1G6RH 1RJYA 3PWNA 3UBXA 2GAZA 3KPLA 5C0IA 4G43A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3UTT A;  1TVH A;  5IB4 A;  4JFO A;  4UQ2 A;  4WW2 C;  1JPG A;  1WBY A;  4QRT A;  2NW3 A;  1KPV A;  1RK1 A;  1L8J A;  1LDP H;  2ZOL A;  1XH3 A;  3L3J A;  3O3E A;  1EXU A;  3RWH A;  4D0C A;  3LKR A;  3FQT A;  1X7Q A;  4HX1 A;  3VXP A;  1BZ9 A;  3RGV C;  3V5D A;  1MI5 A;  1S7T A;  3VRJ A;  3D18 A;  4Z78 A;  4APQ A;  3MYJ A;  2F53 A;  2AV7 A;  4F7M A;  1MHC A;  1JGE A;  2PYE A;  4X6E A;  3LKP A;  3WS3 A;  5HGB A;  2ZSW A;  3I6G A;  4IRJ A;  3VFW A;  3VH8 A;  4NQC A;  1M6O A;  3TBT A;  1QSF A;  4JFD A;  1K8D A;  4O2F A;  3SJV A;  4F7T A;  3HUJ A;  3TBS A;  3HE7 A;  4U1M A;  1A9B A;  4NQD A;  3DTX A;  1HHI A;  3FOL A;  4E5X A;  1EEY A;  4MJI A;  2OI9 A;  3PWP A;  1CE6 A;  1BII A;  1TMC A;  4GKN A;  4N8V A;  5EFI A;  1FZO A;  3LKN A;  1E28 A;  3OXR A;  2C7U A;  4PJG A;  1FZK A;  5F1N A;  2P5W A;  4G9D A;  1A1O A;  1T20 A;  4PGD A;  5INC A;  1QRN A;  5JHD A;  5FKP A;  5F1I A;  5HGD A;  4D0B A;  1OGT A;  1ZSD A;  2GT9 A;  3SDX A;  3O4L A;  4PP8 C;  2GIT A;  4PRD A;  3L3G A;  5C0C A;  5C0F A;  1T1W A;  1R3H A;  1JE6 A;  3O3D A;  1XR9 A;  3D2U A;  3SKO A;  1KPU A;  1T7Z A;  3KXF A;  1QVO A;  3LV3 A;  4IRS A;  2PO6 A;  4HUV A;  4L8S C;  1RK0 A;  4N0F A;  4Y4F A;  3M17 A;  1I4F A;  3PWJ A;  5IRO A;  3VFS A;  3TVM A;  3DMM A;  2VLK A;  3CC5 A;  3DXA A;  3CVH A;  1W72 A;  3BGM A;  1ED3 A;  5D5M A;  1P7Q A;  3MRC A;  4ZUT A;  1QLF A;  2VLL A;  5EOT A;  3GMP A;  5FDW A;  4LCW A;  2ZOK A;  3LKO A;  5E00 A;  1JUF A;  1OSZ A;  4JFF A;  4N5E A;  4PR5 A;  1ZT1 A;  3MRH A;  2ESV A;  2BSR A;  1G7Q A;  3BH8 A;  3L3D A;  1N2R A;  3BO8 A;  5IEH A;  1I1Y A;  4L3E A;  3VFO A;  4PJ7 A;  4ZUS A;  3P4M A;  3D25 A;  3ROL A;  2CKB H;  3HG1 A;  5ACZ A;  3D3V A;  2XPG A;  3GMQ A;  1PQZ A;  2P5E A;  3L3I A;  1JPF A;  4JRY A;  4MVB A;  4JQV A;  2A83 A;  2VE6 A;  3BH9 A;  3VFM A;  4Z77 A;  2D31 A;  3ERY A;  5C0B A;  3ES6 A;  4I48 A;  1QR1 A;  4LHU A;  1N59 A;  4G59 A;  5MEP A;  2BNR A;  4MNQ A;  2AKR A;  4PGB A;  2WY3 A;  1BD2 A;  1GZQ A;  3GJF A;  3JTS A;  4PJX A;  3REW A;  5E6I C;  3QDM A;  1HHJ A;  3OXS A;  3PAB A;  3GSX A;  3BHB A;  4O2E A;  3VRI A;  1JF1 A;  3TJH A;  2CIK A;  3VFV A;  3FT4 A;  4G42 A;  1HYR C;  3FFC A;  1JGD A;  2HLA A;  2VLJ A;  1SYV A;  3QUX A;  2XFX A;  3WL9 A;  4PG2 A;  1KJ2 H;  4HUW A;  4PJ8 A;  4PJD A;  4S0U C;  4QRP A;  3CCH A;  1S7Q A;  5HHN A;  3HAE A;  5E9D A;  2AK4 A;  4PRB A;  3CH1 A;  2VLR A;  3CPL A;  4E0R A;  2RFX A;  2FWO A;  3KWW A;  1S9W A;  3VXN A;  1K5N A;  3O3A A;  3BEW A;  1P1Z A;  3V5K A;  2F54 A;  4WUU A;  4GUP A;  4NO0 A;  1UXS A;  3ARB A;  1VGK A;  3IT8 D;  3O9W A;  3KPR A;  1AO7 A;  4U6X A;  3SDC A;  1E27 A;  2J8U A;  3BEV A;  3PQY A;  1GZP A;  1AGF A;  2HN7 A;  4G9F A;  3P9L A;  2X4S A;  4ONO A;  3P4O A;  2F74 A;  1FFP A;  5BXF A;  1T1Z A;  3P73 A;  4LNR A;  1LD9 A;  4PJB A;  4JRX A;  3O3B A;  3GMO A;  4PJH A;  1TVB A;  3SDD A;  3FQW A;  3PWV A;  3MRG A;  4K7F A;  3I6K A;  1Q94 A;  3LKS A;  3RZC A;  2FIK A;  4L4T A;  3FRU A;  4FTV A;  4QRU A;  2BST A;  4L29 A;  4PGC A;  1FFO A;  3GSO A;  4JFE A;  3MGO A;  4HV8 A;  3KPS A;  3X14 A;  3TBV A;  4IHO A;  1DDH A;  3FQR A;  4U1S A;  1T0M A;  5C0J A;  5EUO A;  3GSR A;  1T0N A;  2VAA A;  3CZF A;  4HWZ A;  3ARG A;  1KCG C;  1KJV A;  3ILQ C;  3BP7 A;  5H94 A;  1U58 A;  4ZAK A;  3GSU A;  1HHK A;  3TBY A;  3TID A;  1QSE A;  3ARF A;  3SKM A;  3C9N A;  5EU5 A;  5IB3 A;  3E2H A;  2YEZ A;  2BVO A;  1T7X A;  3MRL A;  3VWJ A;  5D2N A;  3MRM A;  2H6P A;  4L8B A;  4PJC A;  3ILP A;  4ELM A;  3VJ6 A;  4JFP A;  3QI9 A;  3G08 A;  1G7P A;  2OL3 H;  1M05 A;  3JTC A;  1CD1 A;  5GSR A;  5EU3 A;  3VFP A;  4F7E A;  3DX8 A;  3RUG A;  1B0R A;  3W0W A;  3RWC A;  1DUY A;  4PRI A;  1ZAG A;  5D2L A;  3SDA A;  3WLB A;  3FTG A;  1S7S A;  4L3C A;  4L8C A;  4NHU E;  3VXO A;  2BVQ A;  1AGD A;  2V2X A;  3BUY A;  4NNX A;  3TO2 A;  3X13 A;  2AV1 A;  5IB2 A;  4G8I A;  4PJA A;  4X6C A;  4CW1 A;  5SWS A;  1VAD A;  3MA7 A;  3MR9 A;  4Y4K A;  5BJT A;  4QOK A;  4U1K A;  1KBG H;  1S9X A;  2NX5 A;  2VAB A;  4L9L C;  4NQE A;  5C0E A;  3SPV A;  1LEG A;  4X6D A;  3VFR A;  3HLA A;  3FQN A;  3QUZ A;  3HE6 A;  4ZUW A;  5HGA A;  1LK2 A;  3MRR A;  1KJM A;  1HSB A;  2BSS A;  3PWL A;  4U1N A;  3RWI A;  4ZUV A;  4EI5 A;  2HJL A;  1HHH A;  1HSA A;  3P9M A;  1CG9 A;  2V2W A;  3UTQ A;  4MJ5 A;  3UPR A;  3D39 A;  1W0W A;  2X4N A;  2ZSV A;  5FA4 A;  1HHG A;  4MX7 A;  1T7W A;  5HHM A;  4LCY A;  3RTQ A;  1YPZ A;  5MEN A;  3DBX A;  1IM9 A;  1T1X A;  1UXW A;  2BCK A;  3HCV A;  3KYN A;  4WDI A;  1WBZ A;  3BZE A;  1FO0 H;  3TZV C;  3M1B A;  3VXU A;  1T80 A;  2UWE A;  1NEZ A;  1EFX A;  1N3N A;  4X6F A;  1FZJ A;  3B3I A;  5GSV A;  5DEF A;  3VCL A;  3GSN H;  2YPK A;  3AU1 A;  3U0P A;  3DX7 A;  1AGC A;  1QEW A;  1T1Y A;  3MRP A;  1WBX A;  3ROO A;  5C08 A;  5MEO A;  2DYP A;  1MHE A;  3H7B A;  3X11 A;  3QQ3 A;  2X4U A;  4WO4 A;  3TF7 A;  4PJ5 A;  4MXQ A;  1DUZ A;  1I1A A;  3LKQ A;  4QRR A;  2FZ3 A;  3GSV A;  3MV7 A;  3BP4 A;  3VXM A;  1HOC A;  4MS8 A;  3OX8 A;  4N0C A;  1P4L A;  1ZT7 A;  4O2C A;  1B0G A;  1ZHL A;  3W39 A;  1ZHN A;  2CLZ A;  3GMM A;  4NT6 A;  4CVX A;  3QEQ A;  3VFU A;  3MRE A;  5E8P A;  3ARE A;  3BW9 A;  5EU4 A;  4NSK A;  4Z76 A;  1BQH A;  1FZM A;  3GSQ A;  3KPO A;  1OGA A;  4PJE A;  1B3J A;  1DE4 A;  3LN5 A;  3RL2 A;  3RWD A;  3H9H A;  2HJK A;  3FT3 A;  2FYY A;  5MEQ A;  3TO4 A;  5ENW A;  1KTL A;  4NO5 A;  4D0D A;  1FFN A;  3MRB A;  4PRA A;  3GML A;  4NO3 A;  3NFN A;  5D7I A;  1QQD A;  1QO3 A;  1AGE A;  1ONQ A;  3V5H A;  1T7Y A;  1N5A A;  4I4W A;  4PGE A;  3B6S A;  3KYO A;  3VXS A;  1A1N A;  5HHQ A;  4PRH A;  1JFM A;  1LEK A;  4F7C A;  5B39 A;  1AGB A;  1I7U A;  1LQV A;  4QRQ A;  2CLR A;  2MHA A;  3JTT A;  4GKS A;  3VWK A;  3KPN A;  4WJ5 A;  3L9R A;  4Y4H A;  4V3D B;  2BVP A;  2E7L E;  3BWA A;  3E6F A;  3KPP A;  4JFQ A;  3RWE A;  3MRN A;  3O8X A;  1S7X A;  4IIQ C;  4ZFZ A;  5FA3 A;  1IM3 A;  5BS0 A;  4EUP A;  1C16 A;  4EN3 C;  3TA3 A;  2GTZ A;  1T21 A;  5HHP A;  2FO4 A;  4MJ6 A;  3CDG A;  3WS6 A;  2AXF A;  5J1A A;  3P77 A;  4K71 B;  3H9S A;  5D7J C;  3FOM A;  1KJ3 H;  3I6L D;  3MV9 A;  4Y16 A;  1YN7 A;  5HHO A;  1XZ0 A;  3JVG A;  4PJI A;  4PJ9 A;  3AM8 A;  4HUX A;  1S8D A;  3BXN A;  4MQ7 A;  4HS3 A;  2GUO A;  2X70 A;  5HGH A;  3QUL A;  3LN4 A;  1KPR A;  2X4O A;  1OF2 A;  3GSW A;  3QUY A;  4PDC E;  3T1F A;  5IVX A;  5C0G A;  3GIV A;  4HKJ A;  4V3E B;  3HPJ A;  5EO1 A;  3ARD A;  4ZUU A;  4F7P A;  1LP9 A;  4G8G A;  1XR8 A;  3MGT A;  2Q7Y A;  4CVZ A;  3BZF A;  1SYS A;  3MRI A;  5ISZ A;  5IM7 A;  2CII A;  2H26 A;  3QZW A;  5IB1 A;  4HUU A;  5C09 A;  1T22 A;  2BNQ A;  2X4R A;  4L4V A;  5J6G A;  4MNG A;  4PRN A;  3OV6 A;  4PJF A;  3QDG A;  5L2K A;  3VFN A;  1UQS A;  3IXA A;  1S7R A;  4WU7 A;  5D9S A;  3VFT A;  1INQ A;  3X12 A;  3P4N A;  3PWU A;  3MRD A;  1S9Y A;  5IB5 A;  4PG9 A;  1A6Z A;  4U1L A;  2X4Q A;  3SCM A;  3QDJ A;  2GTW A;  3MRO A;  2JCC A;  3C8K A;  3FQX A;  5E8O A;  3TPU E;  4NNY A;  3WUW A;  5HYJ A;  4PRP A;  3VXR A;  5C0A A;  4UQ3 A;  3MV8 A;  5B38 A;  5J6H A;  5SWQ A;  4L8D A;  3E3Q A;  3BVN A;  3FT2 A;  3L3K A;  3GMN A;  3MRK A;  5MER A;  3MRF A;  5EO0 A;  3FQU A;  1ZT4 A;  3KPQ A;  3S6C A;  3KLA A;  1ZHK A;  3L3H A;  3QUK A;  4PV8 A;  4U1H A;  4LCC C;  1W0V A;  3GMR A;  4PV9 A;  1YDP A;  5F7D A;  5IEK A;  1S7V A;  1T7V A;  3RL1 A;  1NAM H;  4NQX A;  4Y2D A;  1ZVS A;  5AD0 A;  3KPM A;  1YN6 A;  4U1I A;  3QFD A;  1Z5L A;  2GJ6 A;  3UTS A;  5DEG A;  5C07 A;  3QFJ A;  1A9E A;  3DX6 A;  1A1M A;  5C0D A;  4U6Y A;  2YPL A;  1ZS8 A;  5D7L A;  4NQV A;  2X4P A;  1ZHB A;  1RJZ A;  5IND A;  3ECB A;  2X4T A;  2AXG A;  1S7U A;  1I7T A;  3TFK A;  5EU6 A;  3MRQ A;  5L2J A;  3QQ4 A;  4WWK C;  4WU5 A;  3RWG A;  5C9J A;  4NO2 A;  4N0U A;  3RWF A;  1I7R A;  4JQX A;  4PRE A;  5E8N A;  3MRJ A;  5SWZ A;  3TN0 A;  3TIE A;  3RWJ A;  1NAN H;  3T8X A;  1MWA H;  1S7W A;  2CLV A;  3FON A;  1VAC A;  5F9J A;  3E6H A;  1EEZ A;  5DDH A;  1JHT A;  4XXC A;  1I1F A;  1AKJ A;  4U1J A;  4FFE X;  5BRZ A;  4QRS A;  1FG2 A;  3TBW A;  1G6R H;  1RJY A;  3PWN A;  3UBX A;  2GAZ A;  3KPL A;  5C0I A;  4G43 A; 
#chains in the Genus database with same CATH topology
 3UTT A;  1TVH A;  5IB4 A;  4JFO A;  4UQ2 A;  4WW2 C;  1JPG A;  1WBY A;  4QRT A;  2NW3 A;  1KPV A;  1RK1 A;  1L8J A;  1LDP H;  2ZOL A;  1XH3 A;  3L3J A;  3O3E A;  1EXU A;  3RWH A;  4D0C A;  3LKR A;  3FQT A;  1X7Q A;  4HX1 A;  3VXP A;  1BZ9 A;  3RGV C;  3V5D A;  1MI5 A;  1S7T A;  3VRJ A;  3D18 A;  4Z78 A;  4APQ A;  3MYJ A;  2F53 A;  2AV7 A;  4F7M A;  1MHC A;  1JGE A;  2PYE A;  4X6E A;  3LKP A;  3WS3 A;  5HGB A;  2ZSW A;  3I6G A;  4IRJ A;  3VFW A;  3VH8 A;  4NQC A;  1M6O A;  3TBT A;  1QSF A;  4JFD A;  1K8D A;  4O2F A;  3SJV A;  4F7T A;  3HUJ A;  3TBS A;  3HE7 A;  4U1M A;  1A9B A;  4NQD A;  3DTX A;  1HHI A;  3FOL A;  4E5X A;  1EEY A;  4MJI A;  2OI9 A;  3PWP A;  1CE6 A;  1BII A;  1TMC A;  4GKN A;  4N8V A;  5EFI A;  1FZO A;  3LKN A;  1E28 A;  3OXR A;  2C7U A;  4PJG A;  1FZK A;  5F1N A;  2P5W A;  4G9D A;  1A1O A;  1T20 A;  4PGD A;  5INC A;  1QRN A;  5JHD A;  5FKP A;  5F1I A;  5HGD A;  4D0B A;  1OGT A;  1ZSD A;  2GT9 A;  3SDX A;  3O4L A;  4PP8 C;  2GIT A;  4PRD A;  3L3G A;  5C0C A;  5C0F A;  1T1W A;  1R3H A;  1JE6 A;  3O3D A;  1XR9 A;  3D2U A;  3SKO A;  1KPU A;  1T7Z A;  3KXF A;  1QVO A;  3LV3 A;  4IRS A;  2PO6 A;  4HUV A;  4L8S C;  1RK0 A;  4N0F A;  4Y4F A;  3M17 A;  1I4F A;  3PWJ A;  5IRO A;  3VFS A;  3TVM A;  3DMM A;  2VLK A;  3CC5 A;  3DXA A;  3CVH A;  1W72 A;  3BGM A;  1ED3 A;  5D5M A;  1P7Q A;  3MRC A;  4ZUT A;  1QLF A;  2VLL A;  5EOT A;  3GMP A;  5FDW A;  4LCW A;  2ZOK A;  3LKO A;  5E00 A;  1JUF A;  1OSZ A;  4JFF A;  4N5E A;  4PR5 A;  1ZT1 A;  3MRH A;  2ESV A;  2BSR A;  1G7Q A;  3BH8 A;  3L3D A;  1N2R A;  3BO8 A;  5IEH A;  1I1Y A;  4L3E A;  3VFO A;  4PJ7 A;  4ZUS A;  3P4M A;  3D25 A;  3ROL A;  2CKB H;  3HG1 A;  5ACZ A;  3D3V A;  2XPG A;  3GMQ A;  1PQZ A;  2P5E A;  3L3I A;  1JPF A;  4JRY A;  4MVB A;  4JQV A;  2A83 A;  2VE6 A;  3BH9 A;  3VFM A;  4Z77 A;  2D31 A;  3ERY A;  5C0B A;  3ES6 A;  4I48 A;  1QR1 A;  4G59 C;  4LHU A;  1N59 A;  4G59 A;  5MEP A;  2BNR A;  4MNQ A;  2AKR A;  4PGB A;  2WY3 A;  1BD2 A;  1GZQ A;  3GJF A;  3JTS A;  4PJX A;  3REW A;  5E6I C;  3QDM A;  1HHJ A;  3OXS A;  3PAB A;  3GSX A;  3BHB A;  4O2E A;  3VRI A;  1JF1 A;  3TJH A;  2O5N A;  2CIK A;  3VFV A;  3FT4 A;  4G42 A;  1HYR C;  3FFC A;  1JGD A;  2HLA A;  2VLJ A;  1SYV A;  3QUX A;  2XFX A;  3WL9 A;  4PG2 A;  1KJ2 H;  2NYK A;  4HUW A;  4PJ8 A;  4PJD A;  4QRP A;  4S0U C;  3CCH A;  1S7Q A;  5HHN A;  3HAE A;  5E9D A;  2AK4 A;  4PRB A;  3CH1 A;  2VLR A;  3CPL A;  4E0R A;  2RFX A;  2FWO A;  3KWW A;  1S9W A;  3VXN A;  1K5N A;  3O3A A;  3BEW A;  1P1Z A;  3V5K A;  2F54 A;  4WUU A;  4GUP A;  4NO0 A;  1UXS A;  3ARB A;  1VGK A;  3IT8 D;  3O9W A;  3KPR A;  1AO7 A;  4U6X A;  3SDC A;  1E27 A;  2J8U A;  3BEV A;  3PQY A;  1GZP A;  1AGF A;  2HN7 A;  4G9F A;  3P9L A;  2X4S A;  4ONO A;  3P4O A;  2F74 A;  1FFP A;  5BXF A;  1T1Z A;  3P73 A;  4LNR A;  1LD9 A;  4PJB A;  4JRX A;  3O3B A;  3GMO A;  4PJH A;  1TVB A;  3SDD A;  3FQW A;  3PWV A;  3MRG A;  4K7F A;  3I6K A;  1Q94 A;  3LKS A;  3RZC A;  2FIK A;  4L4T A;  3FRU A;  4FTV A;  4QRU A;  2BST A;  4L29 A;  4PGC A;  1FFO A;  3GSO A;  4JFE A;  3MGO A;  4HV8 A;  3KPS A;  3X14 A;  4BKW A;  3TBV A;  4IHO A;  1DDH A;  3FQR A;  4U1S A;  1T0M A;  5C0J A;  5EUO A;  3GSR A;  1T0N A;  2VAA A;  3CZF A;  4HWZ A;  3ARG A;  1KCG C;  2IA1 A;  1KJV A;  3ILQ C;  3BP7 A;  5H94 A;  1U58 A;  4ZAK A;  3GSU A;  1HHK A;  3TBY A;  3TID A;  1QSE A;  3ARF A;  3SKM A;  3C9N A;  5EU5 A;  5IB3 A;  3E2H A;  2YEZ A;  2BVO A;  1T7X A;  3MRL A;  3VWJ A;  5D2N A;  3MRM A;  2H6P A;  4L8B A;  4PJC A;  3ILP A;  4ELM A;  3VJ6 A;  4JFP A;  3QI9 A;  3G08 A;  1G7P A;  2OL3 H;  1M05 A;  3JTC A;  1CD1 A;  5GSR A;  5EU3 A;  3VFP A;  4F7E A;  3DX8 A;  3RUG A;  1B0R A;  3W0W A;  3RWC A;  1DUY A;  4PRI A;  1ZAG A;  5D2L A;  3SDA A;  3WLB A;  3FTG A;  1S7S A;  4L3C A;  4L8C A;  4NHU E;  3VXO A;  2BVQ A;  1AGD A;  2V2X A;  3BUY A;  4NNX A;  3TO2 A;  3X13 A;  2AV1 A;  5IB2 A;  4G8I A;  4PJA A;  4X6C A;  4CW1 A;  5SWS A;  1VAD A;  3MA7 A;  3MR9 A;  4Y4K A;  5BJT A;  4QOK A;  4U1K A;  1KBG H;  1S9X A;  2NX5 A;  2VAB A;  4L9L C;  4NQE A;  5C0E A;  3SPV A;  1LEG A;  4X6D A;  3VFR A;  3HLA A;  3FQN A;  3QUZ A;  3HE6 A;  4ZUW A;  5HGA A;  1LK2 A;  3MRR A;  1KJM A;  1HSB A;  2BSS A;  3PWL A;  4U1N A;  3RWI A;  4ZUV A;  4EI5 A;  2HJL A;  1HHH A;  1HSA A;  3P9M A;  1CG9 A;  2V2W A;  3UTQ A;  4MJ5 A;  3UPR A;  3D39 A;  1W0W A;  2X4N A;  2ZSV A;  5FA4 A;  1HHG A;  4MX7 A;  1T7W A;  3I0T A;  5HHM A;  4LCY A;  3RTQ A;  1YPZ A;  5MEN A;  3DBX A;  1IM9 A;  1T1X A;  1UXW A;  2BCK A;  3HCV A;  3KYN A;  4WDI A;  1WBZ A;  3BZE A;  1FO0 H;  3TZV C;  3M1B A;  3VXU A;  1T80 A;  2UWE A;  1NEZ A;  1EFX A;  1N3N A;  4X6F A;  1FZJ A;  3B3I A;  5GSV A;  5DEF A;  3VCL A;  3GSN H;  2YPK A;  3AU1 A;  3U0P A;  3DX7 A;  1AGC A;  1QEW A;  1T1Y A;  3MRP A;  1WBX A;  3ROO A;  5C08 A;  5MEO A;  2DYP A;  1MHE A;  3H7B A;  3X11 A;  3QQ3 A;  2X4U A;  4WO4 A;  3TF7 A;  4PJ5 A;  4MXQ A;  1DUZ A;  1I1A A;  3LKQ A;  4QRR A;  2FZ3 A;  3GSV A;  3MV7 A;  3BP4 A;  3VXM A;  1HOC A;  4MS8 A;  3OX8 A;  4N0C A;  1P4L A;  1ZT7 A;  4O2C A;  1B0G A;  1ZHL A;  3W39 A;  1ZHN A;  2CLZ A;  3GMM A;  4NT6 A;  4CVX A;  3QEQ A;  3VFU A;  3MRE A;  5E8P A;  3ARE A;  3BW9 A;  5EU4 A;  4NSK A;  4Z76 A;  1BQH A;  1FZM A;  3GSQ A;  3KPO A;  1OGA A;  4PJE A;  1B3J A;  1DE4 A;  3LN5 A;  3RL2 A;  3RWD A;  3H9H A;  2HJK A;  3FT3 A;  2FYY A;  5MEQ A;  3TO4 A;  5ENW A;  1KTL A;  4NO5 A;  4D0D A;  1FFN A;  3MRB A;  4PRA A;  3GML A;  4NO3 A;  3NFN A;  5D7I A;  1QQD A;  1QO3 A;  1AGE A;  1ONQ A;  3V5H A;  1T7Y A;  1N5A A;  4I4W A;  4PGE A;  3B6S A;  3KYO A;  3VXS A;  1A1N A;  5HHQ A;  4PRH A;  1JFM A;  1LEK A;  4F7C A;  5B39 A;  1AGB A;  1I7U A;  1LQV A;  4QRQ A;  2CLR A;  2MHA A;  3JTT A;  4GKS A;  3VWK A;  3KPN A;  4WJ5 A;  3L9R A;  4Y4H A;  4V3D B;  2BVP A;  2E7L E;  3BWA A;  3E6F A;  3KPP A;  4JFQ A;  3RWE A;  3MRN A;  3O8X A;  1S7X A;  4IIQ C;  4ZFZ A;  5FA3 A;  1IM3 A;  5BS0 A;  4EUP A;  1C16 A;  4EN3 C;  3TA3 A;  2GTZ A;  1T21 A;  5HHP A;  2FO4 A;  4MJ6 A;  3CDG A;  3WS6 A;  2AXF A;  5J1A A;  3P77 A;  4K71 B;  3H9S A;  5D7J C;  3FOM A;  1KJ3 H;  3I6L D;  3MV9 A;  4Y16 A;  1YN7 A;  5HHO A;  1XZ0 A;  3JVG A;  4PJI A;  4PJ9 A;  3AM8 A;  4HUX A;  1S8D A;  3BXN A;  4MQ7 A;  4HS3 A;  2GUO A;  2X70 A;  5HGH A;  3QUL A;  3LN4 A;  1KPR A;  2X4O A;  1OF2 A;  3GSW A;  3QUY A;  4PDC E;  3T1F A;  5IVX A;  5C0G A;  3GIV A;  4HKJ A;  4V3E B;  3HPJ A;  5EO1 A;  3ARD A;  4ZUU A;  4F7P A;  1LP9 A;  4G8G A;  1XR8 A;  3MGT A;  2Q7Y A;  4CVZ A;  3BZF A;  1SYS A;  3MRI A;  5ISZ A;  5IM7 A;  2CII A;  2H26 A;  3QZW A;  5IB1 A;  4HUU A;  5C09 A;  1T22 A;  2BNQ A;  2X4R A;  4L4V A;  5J6G A;  4MNG A;  4PRN A;  3OV6 A;  4PJF A;  3QDG A;  4JO8 A;  3VFN A;  5L2K A;  1UQS A;  3IXA A;  1S7R A;  4WU7 A;  5D9S A;  3VFT A;  1INQ A;  3X12 A;  3P4N A;  3PWU A;  3MRD A;  1S9Y A;  5IB5 A;  4PG9 A;  1A6Z A;  4U1L A;  2X4Q A;  3SCM A;  3QDJ A;  2GTW A;  3MRO A;  2JCC A;  3C8K A;  3FQX A;  5E8O A;  3TPU E;  4NNY A;  3WUW A;  5HYJ A;  4PRP A;  3VXR A;  5C0A A;  4UQ3 A;  3MV8 A;  5B38 A;  5J6H A;  5SWQ A;  4L8D A;  3E3Q A;  3BVN A;  3FT2 A;  3L3K A;  3GMN A;  3MRK A;  5MER A;  3MRF A;  5EO0 A;  3FQU A;  1ZT4 A;  3KPQ A;  3S6C A;  3KLA A;  1ZHK A;  3L3H A;  3QUK A;  4PV8 A;  4U1H A;  4LCC C;  1W0V A;  3GMR A;  4PV9 A;  1YDP A;  5F7D A;  5IEK A;  1S7V A;  1T7V A;  3RL1 A;  1NAM H;  4NQX A;  4Y2D A;  1ZVS A;  5AD0 A;  3KPM A;  1YN6 A;  4U1I A;  3QFD A;  1Z5L A;  2GJ6 A;  3UTS A;  5DEG A;  5C07 A;  3QFJ A;  1A9E A;  3DX6 A;  1A1M A;  5C0D A;  4U6Y A;  2YPL A;  1ZS8 A;  5D7L A;  4NQV A;  2X4P A;  1ZHB A;  1RJZ A;  5IND A;  3ECB A;  2X4T A;  2AXG A;  1S7U A;  1I7T A;  3TFK A;  5EU6 A;  3MRQ A;  5L2J A;  3QQ4 A;  4WWK C;  4WU5 A;  3RWG A;  5C9J A;  4NO2 A;  4N0U A;  3RWF A;  1I7R A;  4JQX A;  4PRE A;  5E8N A;  3MRJ A;  5SWZ A;  3TN0 A;  3TIE A;  3RWJ A;  1NAN H;  3T8X A;  1MWA H;  1S7W A;  2CLV A;  3FON A;  1VAC A;  5F9J A;  3E6H A;  1EEZ A;  5DDH A;  1JHT A;  4XXC A;  1I1F A;  1AKJ A;  4U1J A;  4FFE X;  5BRZ A;  4QRS A;  1FG2 A;  3TBW A;  1G6R H;  1RJY A;  3PWN A;  3UBX A;  2GAZ A;  3KPL A;  5C0I A;  4G43 A; 
#chains in the Genus database with same CATH homology
 3UTT A;  1TVH A;  5IB4 A;  4JFO A;  4UQ2 A;  4WW2 C;  1JPG A;  1WBY A;  4QRT A;  2NW3 A;  1KPV A;  1RK1 A;  1L8J A;  1LDP H;  2ZOL A;  1XH3 A;  3L3J A;  3O3E A;  1EXU A;  3RWH A;  4D0C A;  3LKR A;  3FQT A;  1X7Q A;  4HX1 A;  3VXP A;  1BZ9 A;  3RGV C;  3V5D A;  1MI5 A;  1S7T A;  3VRJ A;  3D18 A;  4Z78 A;  4APQ A;  3MYJ A;  2F53 A;  2AV7 A;  4F7M A;  1MHC A;  1JGE A;  2PYE A;  4X6E A;  3LKP A;  3WS3 A;  5HGB A;  2ZSW A;  3I6G A;  4IRJ A;  3VFW A;  3VH8 A;  4NQC A;  1M6O A;  3TBT A;  1QSF A;  4JFD A;  1K8D A;  4O2F A;  3SJV A;  4F7T A;  3HUJ A;  3TBS A;  3HE7 A;  4U1M A;  1A9B A;  4NQD A;  3DTX A;  1HHI A;  3FOL A;  4E5X A;  1EEY A;  4MJI A;  2OI9 A;  3PWP A;  1CE6 A;  1BII A;  1TMC A;  4GKN A;  4N8V A;  5EFI A;  1FZO A;  3LKN A;  1E28 A;  3OXR A;  2C7U A;  4PJG A;  1FZK A;  5F1N A;  2P5W A;  4G9D A;  1A1O A;  1T20 A;  4PGD A;  5INC A;  1QRN A;  5JHD A;  5FKP A;  5F1I A;  5HGD A;  4D0B A;  1OGT A;  1ZSD A;  2GT9 A;  3SDX A;  3O4L A;  4PP8 C;  2GIT A;  4PRD A;  3L3G A;  5C0C A;  5C0F A;  1T1W A;  1R3H A;  1JE6 A;  3O3D A;  1XR9 A;  3D2U A;  3SKO A;  1KPU A;  1T7Z A;  3KXF A;  1QVO A;  3LV3 A;  4IRS A;  2PO6 A;  4HUV A;  4L8S C;  1RK0 A;  4N0F A;  4Y4F A;  3M17 A;  1I4F A;  3PWJ A;  5IRO A;  3VFS A;  3TVM A;  3DMM A;  2VLK A;  3CC5 A;  3DXA A;  3CVH A;  1W72 A;  3BGM A;  1ED3 A;  5D5M A;  1P7Q A;  3MRC A;  4ZUT A;  1QLF A;  2VLL A;  5EOT A;  3GMP A;  5FDW A;  4LCW A;  2ZOK A;  3LKO A;  5E00 A;  1JUF A;  1OSZ A;  4JFF A;  4N5E A;  4PR5 A;  1ZT1 A;  3MRH A;  2ESV A;  2BSR A;  1G7Q A;  3BH8 A;  3L3D A;  1N2R A;  3BO8 A;  5IEH A;  1I1Y A;  4L3E A;  3VFO A;  4PJ7 A;  4ZUS A;  3P4M A;  3D25 A;  3ROL A;  2CKB H;  3HG1 A;  5ACZ A;  3D3V A;  2XPG A;  3GMQ A;  1PQZ A;  2P5E A;  3L3I A;  1JPF A;  4JRY A;  4MVB A;  4JQV A;  2A83 A;  2VE6 A;  3BH9 A;  3VFM A;  4Z77 A;  2D31 A;  3ERY A;  5C0B A;  3ES6 A;  4I48 A;  1QR1 A;  4LHU A;  1N59 A;  4G59 A;  5MEP A;  2BNR A;  4MNQ A;  2AKR A;  4PGB A;  2WY3 A;  1BD2 A;  1GZQ A;  3GJF A;  3JTS A;  4PJX A;  3REW A;  5E6I C;  3QDM A;  1HHJ A;  3OXS A;  3PAB A;  3GSX A;  3BHB A;  4O2E A;  3VRI A;  1JF1 A;  3TJH A;  2CIK A;  3VFV A;  3FT4 A;  4G42 A;  1HYR C;  3FFC A;  1JGD A;  2HLA A;  2VLJ A;  1SYV A;  3QUX A;  2XFX A;  3WL9 A;  4PG2 A;  1KJ2 H;  4HUW A;  4PJ8 A;  4PJD A;  4S0U C;  4QRP A;  3CCH A;  1S7Q A;  5HHN A;  3HAE A;  5E9D A;  2AK4 A;  4PRB A;  3CH1 A;  2VLR A;  3CPL A;  4E0R A;  2RFX A;  2FWO A;  3KWW A;  1S9W A;  3VXN A;  1K5N A;  3O3A A;  3BEW A;  1P1Z A;  3V5K A;  2F54 A;  4WUU A;  4GUP A;  4NO0 A;  1UXS A;  3ARB A;  1VGK A;  3IT8 D;  3O9W A;  3KPR A;  1AO7 A;  4U6X A;  3SDC A;  1E27 A;  2J8U A;  3BEV A;  3PQY A;  1GZP A;  1AGF A;  2HN7 A;  4G9F A;  3P9L A;  2X4S A;  4ONO A;  3P4O A;  2F74 A;  1FFP A;  5BXF A;  1T1Z A;  3P73 A;  4LNR A;  1LD9 A;  4PJB A;  4JRX A;  3O3B A;  3GMO A;  4PJH A;  1TVB A;  3SDD A;  3FQW A;  3PWV A;  3MRG A;  4K7F A;  3I6K A;  1Q94 A;  3LKS A;  3RZC A;  2FIK A;  4L4T A;  3FRU A;  4FTV A;  4QRU A;  2BST A;  4L29 A;  4PGC A;  1FFO A;  3GSO A;  4JFE A;  3MGO A;  4HV8 A;  3KPS A;  3X14 A;  3TBV A;  4IHO A;  1DDH A;  3FQR A;  4U1S A;  1T0M A;  5C0J A;  5EUO A;  3GSR A;  1T0N A;  2VAA A;  3CZF A;  4HWZ A;  3ARG A;  1KCG C;  1KJV A;  3ILQ C;  3BP7 A;  5H94 A;  1U58 A;  4ZAK A;  3GSU A;  1HHK A;  3TBY A;  3TID A;  1QSE A;  3ARF A;  3SKM A;  3C9N A;  5EU5 A;  5IB3 A;  3E2H A;  2YEZ A;  2BVO A;  1T7X A;  3MRL A;  3VWJ A;  5D2N A;  3MRM A;  2H6P A;  4L8B A;  4PJC A;  3ILP A;  4ELM A;  3VJ6 A;  4JFP A;  3QI9 A;  3G08 A;  1G7P A;  2OL3 H;  1M05 A;  3JTC A;  1CD1 A;  5GSR A;  5EU3 A;  3VFP A;  4F7E A;  3DX8 A;  3RUG A;  1B0R A;  3W0W A;  3RWC A;  1DUY A;  4PRI A;  1ZAG A;  5D2L A;  3SDA A;  3WLB A;  3FTG A;  1S7S A;  4L3C A;  4L8C A;  4NHU E;  3VXO A;  2BVQ A;  1AGD A;  2V2X A;  3BUY A;  4NNX A;  3TO2 A;  3X13 A;  2AV1 A;  5IB2 A;  4G8I A;  4PJA A;  4X6C A;  4CW1 A;  5SWS A;  1VAD A;  3MA7 A;  3MR9 A;  4Y4K A;  5BJT A;  4QOK A;  4U1K A;  1KBG H;  1S9X A;  2NX5 A;  2VAB A;  4L9L C;  4NQE A;  5C0E A;  3SPV A;  1LEG A;  4X6D A;  3VFR A;  3HLA A;  3FQN A;  3QUZ A;  3HE6 A;  4ZUW A;  5HGA A;  1LK2 A;  3MRR A;  1KJM A;  1HSB A;  2BSS A;  3PWL A;  4U1N A;  3RWI A;  4ZUV A;  4EI5 A;  2HJL A;  1HHH A;  1HSA A;  3P9M A;  1CG9 A;  2V2W A;  3UTQ A;  4MJ5 A;  3UPR A;  3D39 A;  1W0W A;  2X4N A;  2ZSV A;  5FA4 A;  1HHG A;  4MX7 A;  1T7W A;  5HHM A;  4LCY A;  3RTQ A;  1YPZ A;  5MEN A;  3DBX A;  1IM9 A;  1T1X A;  1UXW A;  2BCK A;  3HCV A;  3KYN A;  4WDI A;  1WBZ A;  3BZE A;  1FO0 H;  3TZV C;  3M1B A;  3VXU A;  1T80 A;  2UWE A;  1NEZ A;  1EFX A;  1N3N A;  4X6F A;  1FZJ A;  3B3I A;  5GSV A;  5DEF A;  3VCL A;  3GSN H;  2YPK A;  3AU1 A;  3U0P A;  3DX7 A;  1AGC A;  1QEW A;  1T1Y A;  3MRP A;  1WBX A;  3ROO A;  5C08 A;  5MEO A;  2DYP A;  1MHE A;  3H7B A;  3X11 A;  3QQ3 A;  2X4U A;  4WO4 A;  3TF7 A;  4PJ5 A;  4MXQ A;  1DUZ A;  1I1A A;  3LKQ A;  4QRR A;  2FZ3 A;  3GSV A;  3MV7 A;  3BP4 A;  3VXM A;  1HOC A;  4MS8 A;  3OX8 A;  4N0C A;  1P4L A;  1ZT7 A;  4O2C A;  1B0G A;  1ZHL A;  3W39 A;  1ZHN A;  2CLZ A;  3GMM A;  4NT6 A;  4CVX A;  3QEQ A;  3VFU A;  3MRE A;  5E8P A;  3ARE A;  3BW9 A;  5EU4 A;  4NSK A;  4Z76 A;  1BQH A;  1FZM A;  3GSQ A;  3KPO A;  1OGA A;  4PJE A;  1B3J A;  1DE4 A;  3LN5 A;  3RL2 A;  3RWD A;  3H9H A;  2HJK A;  3FT3 A;  2FYY A;  5MEQ A;  3TO4 A;  5ENW A;  1KTL A;  4NO5 A;  4D0D A;  1FFN A;  3MRB A;  4PRA A;  3GML A;  4NO3 A;  3NFN A;  5D7I A;  1QQD A;  1QO3 A;  1AGE A;  1ONQ A;  3V5H A;  1T7Y A;  1N5A A;  4I4W A;  4PGE A;  3B6S A;  3KYO A;  3VXS A;  1A1N A;  5HHQ A;  4PRH A;  1JFM A;  1LEK A;  4F7C A;  5B39 A;  1AGB A;  1I7U A;  1LQV A;  4QRQ A;  2CLR A;  2MHA A;  3JTT A;  4GKS A;  3VWK A;  3KPN A;  4WJ5 A;  3L9R A;  4Y4H A;  4V3D B;  2BVP A;  2E7L E;  3BWA A;  3E6F A;  3KPP A;  4JFQ A;  3RWE A;  3MRN A;  3O8X A;  1S7X A;  4IIQ C;  4ZFZ A;  5FA3 A;  1IM3 A;  5BS0 A;  4EUP A;  1C16 A;  4EN3 C;  3TA3 A;  2GTZ A;  1T21 A;  5HHP A;  2FO4 A;  4MJ6 A;  3CDG A;  3WS6 A;  2AXF A;  5J1A A;  3P77 A;  4K71 B;  3H9S A;  5D7J C;  3FOM A;  1KJ3 H;  3I6L D;  3MV9 A;  4Y16 A;  1YN7 A;  5HHO A;  1XZ0 A;  3JVG A;  4PJI A;  4PJ9 A;  3AM8 A;  4HUX A;  1S8D A;  3BXN A;  4MQ7 A;  4HS3 A;  2GUO A;  2X70 A;  5HGH A;  3QUL A;  3LN4 A;  1KPR A;  2X4O A;  1OF2 A;  3GSW A;  3QUY A;  4PDC E;  3T1F A;  5IVX A;  5C0G A;  3GIV A;  4HKJ A;  4V3E B;  3HPJ A;  5EO1 A;  3ARD A;  4ZUU A;  4F7P A;  1LP9 A;  4G8G A;  1XR8 A;  3MGT A;  2Q7Y A;  4CVZ A;  3BZF A;  1SYS A;  3MRI A;  5ISZ A;  5IM7 A;  2CII A;  2H26 A;  3QZW A;  5IB1 A;  4HUU A;  5C09 A;  1T22 A;  2BNQ A;  2X4R A;  4L4V A;  5J6G A;  4MNG A;  4PRN A;  3OV6 A;  4PJF A;  3QDG A;  5L2K A;  3VFN A;  1UQS A;  3IXA A;  1S7R A;  4WU7 A;  5D9S A;  3VFT A;  1INQ A;  3X12 A;  3P4N A;  3PWU A;  3MRD A;  1S9Y A;  5IB5 A;  4PG9 A;  1A6Z A;  4U1L A;  2X4Q A;  3SCM A;  3QDJ A;  2GTW A;  3MRO A;  2JCC A;  3C8K A;  3FQX A;  5E8O A;  3TPU E;  4NNY A;  3WUW A;  5HYJ A;  4PRP A;  3VXR A;  5C0A A;  4UQ3 A;  3MV8 A;  5B38 A;  5J6H A;  5SWQ A;  4L8D A;  3E3Q A;  3BVN A;  3FT2 A;  3L3K A;  3GMN A;  3MRK A;  5MER A;  3MRF A;  5EO0 A;  3FQU A;  1ZT4 A;  3KPQ A;  3S6C A;  3KLA A;  1ZHK A;  3L3H A;  3QUK A;  4PV8 A;  4U1H A;  4LCC C;  1W0V A;  3GMR A;  4PV9 A;  1YDP A;  5F7D A;  5IEK A;  1S7V A;  1T7V A;  3RL1 A;  1NAM H;  4NQX A;  4Y2D A;  1ZVS A;  5AD0 A;  3KPM A;  1YN6 A;  4U1I A;  3QFD A;  1Z5L A;  2GJ6 A;  3UTS A;  5DEG A;  5C07 A;  3QFJ A;  1A9E A;  3DX6 A;  1A1M A;  5C0D A;  4U6Y A;  2YPL A;  1ZS8 A;  5D7L A;  4NQV A;  2X4P A;  1ZHB A;  1RJZ A;  5IND A;  3ECB A;  2X4T A;  2AXG A;  1S7U A;  1I7T A;  3TFK A;  5EU6 A;  3MRQ A;  5L2J A;  3QQ4 A;  4WWK C;  4WU5 A;  3RWG A;  5C9J A;  4NO2 A;  4N0U A;  3RWF A;  1I7R A;  4JQX A;  4PRE A;  5E8N A;  3MRJ A;  5SWZ A;  3TN0 A;  3TIE A;  3RWJ A;  1NAN H;  3T8X A;  1MWA H;  1S7W A;  2CLV A;  3FON A;  1VAC A;  5F9J A;  3E6H A;  1EEZ A;  5DDH A;  1JHT A;  4XXC A;  1I1F A;  1AKJ A;  4U1J A;  4FFE X;  5BRZ A;  4QRS A;  1FG2 A;  3TBW A;  1G6R H;  1RJY A;  3PWN A;  3UBX A;  2GAZ A;  3KPL A;  5C0I A;  4G43 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...