3TFKA

42f3-p4b10/h2-ld
Total Genus 52
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
52
sequence length
174
structure length
174
Chain Sequence
PHSMRYYETATSRRGLGEPRYTSVGYVDDKEFVRFDSDAENPRYEPQVPWMEQEGPEYWERITQVAKGQEQWFRVNLRTLLGYYNQSAGGTHTLQRMYGCDVGSDGRLLRGYEQFAYDGCDYIALNEDLRTWTAADMAAQITRRKWEQAGAAEYYRAYLEGECVEWLHRYLKNG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system
molecule keywords H2-Ld SBM2
publication title T cell receptor signaling is limited by docking geometry to peptide-major histocompatibility complex.
pubmed doi rcsb
source organism Mus musculus
total genus 52
structure length 174
sequence length 174
ec nomenclature
pdb deposition date 2011-08-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00129 MHC_I Class I Histocompatibility antigen, domains alpha 1 and 2
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.500.10 Alpha Beta 2-Layer Sandwich Murine Class I Major Histocompatibility Complex, H2-DB; Chain A, domain 1 MHC class I-like antigen recognition-like 3tfkA00
4CVXA 3L3GA 1S8DA 3E2HA 1ZAGA 3CCHA 2FWOA 1W0WA 2JCCA 2GT9A 1K5NA 3TBVA 4F7EA 1JGEA 2BVQA 3MROA 4PJDA 4WJ5A 2XPGA 3GMPA 1X7QA 1QVOA 1IM9A 2HJKA 3MRKA 3W0WA 1P7QA 3ROLA 2MHAA 3KYNA 1JHTA 3CDGA 4JQVA 3UTQA 1BIIA 1SYSA 1XH3A 3P4NA 4HS3A 4U1JA 1JPGA 2D31A 3BWAA 4GKSA 3ERYA 3DX7A 4JFEA 3SDXA 2X4QA 3BO8A 3MRRA 3VFNA 1XR8A 3WS3A 2BSTA 1ZT4A 3GSQA 5D2NA 2UWEA 4X6FA 2ZSVA 5MENA 1T7ZA 4ZUSA 4HKJA 3CC5A 3TO4A 3G08A 4MNQA 5HGHA 3GSRA 5EFIA 3I6LD 4HUXA 1GZQA 4FTVA 4MQ7A 2X4OA 4U1IA 3VXSA 3HAEA 3P9LA 5IM7A 2NX5A 4F7PA 1YN6A 5C0IA 3E3QA 4PJIA 4I48A 4EN3C 3LKRA 3D39A 1LD9A 1Q94A 4L4TA 5DDHA 5E8PA 3RWHA 3UTTA 3D18A 3TIDA 1FZJA 1A9BA 5HHPA 3TBWA 2GUOA 4QRRA 1KJ3H 3IT8D 5DEFA 3DMMA 1T1YA 2ESVA 4GUPA 5H94A 4Y4FA 3VFRA 3ECBA 5B38A 1RJZA 1XR9A 3VFVA 1L8JA 2ZSWA 2CLVA 3MRGA 4CW1A 1KTLA 4F7CA 1W72A 1PQZA 4ZFZA 3X13A 1HOCA 3CPLA 3MGTA 4N8VA 5ACZA 1NANH 2X70A 5J6GA 2X4UA 3O4LA 3FT3A 4JFFA 4Y2DA 4MJ6A 2AV1A 2E7LE 3TJHA 1I1FA 5C0DA 1JUFA 3QUYA 3GSWA 4ZUTA 3GJFA 4HV8A 2BSSA 4XXCA 3ARGA 4PJGA 3VFWA 5EUOA 3KXFA 5INCA 2A83A 3X14A 4ELMA 1A1MA 4F7TA 1BZ9A 2FO4A 3TBTA 4PRBA 2V2WA 3L3JA 3W39A 3MRJA 1G7QA 4PJXA 1NEZA 3VWJA 2PYEA 1Z5LA 4N5EA 3KPRA 2CIKA 1P1ZA 3OXSA 4U1NA 1FZOA 3TBYA 3P77A 4GKNA 5GSVA 3QDMA 2X4NA 5INDA 1S9YA 4F7MA 1FG2A 3P9MA 1ZS8A 4UQ3A 3MYJA 5D7LA 4NQEA 1CD1A 1A1NA 2VAAA 5F1IA 1E28A 4PJEA 1MHCA 4PJBA 3LKQA 3BP4A 3BW9A 5EO1A 1QRNA 4JFPA 4O2FA 4Y4HA 3AREA 1MI5A 5L2KA 1M05A 1T0MA 2VABA 3B6SA 3FQUA 1HHIA 3MRDA 4PG2A 4L9LC 3ARFA 3MRLA 4QRSA 3PWJA 2YPLA 3MRBA 1I7UA 3O3BA 3PQYA 4U1SA 1TVBA 2HN7A 3PWPA 3MA7A 3BP7A 3CZFA 4PJHA 2AV7A 4QRUA 5F1NA 4PJ5A 3VFUA 1LDPH 2DYPA 2HLAA 3KPSA 2VLLA 4JRYA 3O3AA 4WU5A 4IHOA 3RWCA 1QO3A 4U1HA 5HGAA 4JFDA 3D2UA 1KPUA 4G8IA 4NQXA 2GITA 3UBXA 4FFEX 5B39A 3TO2A 4HUWA 4ZUUA 5D5MA 4JFOA 1B0RA 4U1KA 1EFXA 1A6ZA 5HHMA 5C08A 3MRQA 3QEQA 5C0BA 3QULA 1KPVA 3FRUA 5C07A 3QDJA 2HJLA 3KPOA 2VLRA 2BNQA 5DEGA 3JTSA 3KWWA 2WY3A 1ZT1A 5D7JC 4LNRA 2F53A 1G7PA 5E6IC 2RFXA 3RWJA 1W0VA 3T8XA 4PR5A 3BUYA 4L29A 1HHGA 3ROOA 3MRPA 3O3DA 2ZOKA 3V5HA 2FZ3A 2FYYA 3FOLA 4K71B 5HHOA 4IRJA 1VADA 3DTXA 4PV9A 3MRIA 2X4SA 1JE6A 4N0UA 3RUGA 3TVMA 3GMOA 4V3EB 1TVHA 1ZHNA 5IB2A 4PJ9A 3ARDA 2CLZA 3MV8A 4QRQA 3FFCA 3VCLA 3VXMA 5HGDA 3H7BA 3PWNA 3T1FA 1AGBA 3MR9A 3L3IA 4NHUE 3SCMA 3MREA 1FZMA 3MGOA 3U0PA 2VLJA 3TBSA 5IB4A 4NT6A 3VFSA 1QSEA 1KJVA 2V2XA 3L3HA 3SKOA 5C09A 4IRSA 1T80A 1QLFA 2X4PA 4HWZA 2J8UA 4ONOA 3UTSA 4NO3A 5IVXA 3GSOA 5EOTA 1YDPA 3DBXA 3V5KA 5MEOA 3KLAA 4PGEA 4MS8A 3VRIA 3FT2A 5C0EA 1E27A 3HE7A 3M17A 4PGDA 2FIKA 1I4FA 3FQNA 5BJTA 1KPRA 3RL2A 3HLAA 5BS0A 3RZCA 1FZKA 5FKPA 4L8BA 1T7VA 5FA3A 2NW3A 1IM3A 4PG9A 3X11A 3GMRA 3GMQA 3HE6A 2GTWA 1KJ2H 4MNGA 2H6PA 3DX6A 1S9WA 3ILQC 4I4WA 4MX7A 4EUPA 5IEHA 2YEZA 1FO0H 3GMMA 3HPJA 3HCVA 1ED3A 2OI9A 4L8SC 4X6CA 3QZWA 3AM8A 1KBGH 1I7TA 1ZSDA 2C7UA 2OL3H 1FFOA 3MV7A 4PJCA 4G8GA 3JVGA 3KPLA 3GSXA 3PWUA 1JF1A 1CE6A 4PRIA 3RWGA 1T7WA 1HHKA 3LN5A 3P73A 5F9JA 1FFNA 1WBZA 4IIQC 1DE4A 1HHJA 4PGCA 1T20A 2CIIA 3VXUA 1B0GA 3VH8A 3FQRA 3GMLA 1P4LA 4LHUA 2X4TA 1S7WA 1UXWA 1ZT7A 4PREA 1BD2A 3H9SA 2PO6A 3FONA 3LKNA 3TF7A 3BHBA 4JRXA 3BH9A 1QQDA 3QQ4A 3BEWA 3FTGA 3MRHA 1NAMH 1UXSA 3TZVC 3M1BA 1OF2A 3D3VA 3D25A 4NNYA 4WW2C 1G6RH 4JFQA 4G9FA 3VFOA 4ZAKA 1B3JA 4PRNA 1ONQA 3SDAA 3TIEA 1S7TA 3BXNA 5IB5A 4WDIA 4PJ7A 3BVNA 3E6HA 3IXAA 5GSRA 3VJ6A 2XFXA 4PDCE 3TPUE 1T1XA 3AU1A 3FQXA 1QSFA 3P4OA 4MJIA 1FFPA 1S7SA 4NNXA 5EU6A 1KCGC 1EXUA 3PWVA 1LQVA 1UQSA 3S6CA 3SPVA 5BRZA 4L8CA 1ZVSA 3VXRA 1T1WA 3OV6A 4ZUWA 4JQXA 2BCKA 1QEWA 4L3CA 1C16A 1N2RA 3MRNA 2P5WA 3FT4A 3QFDA 2F74A 5EU5A 1I7RA 1N59A 4HUUA 4O2CA 3UPRA 4EI5A 3QI9A 5C0JA 2AKRA 3RWDA 2P5EA 3OX8A 3GSNH 3O3EA 1OGAA 4APQA 1MWAH 3MRMA 3LN4A 4Z76A 3O9WA 4PGBA 5ENWA 5D9SA 1U58A 3NFNA 4QRTA 3JTCA 3QUKA 2F54A 1INQA 3MRFA 4MVBA 3RL1A 1AGDA 1VGKA 3VRJA 5FA4A 5J6HA 4PRHA 5EU4A 3BGMA 5SWSA 5EU3A 1AKJA 3X12A 5C0FA 1LP9A 3DXAA 1OSZA 1S7UA 3FOMA 4PJAA 1S7RA 5SWZA 1ZHKA 3KPNA 5HHNA 2BSRA 2GJ6A 3VXNA 1LEGA 1T22A 4NQCA 3SDCA 1AGCA 1T7XA 4NQVA 2VLKA 5E00A 3GMNA 2X4RA 3LKSA 3QDGA 4PRAA 1MHEA 4D0BA 1RJYA 2AXGA 1EEYA 4O2EA 3MV9A 5C0CA 5L2JA 2BVPA 4LCWA 1T0NA 4NQDA 3V5DA 3PABA 2H26A 4PP8C 3C8KA 3I6GA 3O8XA 4U6XA 4Z78A 5HGBA 4LCYA 4X6DA 3JTTA 3MRCA 1S9XA 1TMCA 1N5AA 3BZEA 2ZOLA 1ZHBA 3VFMA 4G42A 4PV8A 5C9JA 1AGEA 1WBYA 1DDHA 3QFJA 4NSKA 5IROA 2VE6A 3TN0A 5FDWA 1HSBA 4G59A 3SJVA 4PRPA 3HG1A 4ZUVA 4L4VA 4U1LA 3REWA 5BXFA 3VXOA 1M6OA 4WU7A 4WUUA 3VFTA 3L3KA 3DX8A 5EO0A 4QOKA 4WO4A 3QUXA 3TA3A 4UQ2A 3KPQA 4Y4KA 3RWEA 1ZHLA 4E0RA 3GSUA 2Q7YA 3LKPA 3SDDA 5E9DA 2BNRA 1YN7A 3SKMA 4G43A 4Z77A 3WUWA 3GIVA 1S7VA 1SYVA 2AK4A 3KPMA 5JHDA 5SWQA 3VFPA 1XZ0A 3CH1A 3RWIA 1VACA 3FQTA 3L9RA 4HX1A 5E8NA 3WL9A 2GAZA 3RWFA 3KYOA 1WBXA 3ILPA 4V3DB 2GTZA 1BQHA 1T1ZA 1OGTA 3L3DA 3TFKA 5AD0A 3WS6A 1A1OA 4D0CA 1RK1A 2CKBH 4Y16A 5D7IA 5MERA 1I1AA 1YPZA 5J1AA 4G9DA 4U1MA 5IB1A 1AO7A 1R3HA 2AXFA 4N0FA 4PRDA 4LCCC 3OXRA 1DUYA 5IEKA 1S7QA 1T7YA 3RTQA 3P4MA 4NO0A 1HHHA 3C9NA 3WLBA 4D0DA 5ISZA 1HYRC 4HUVA 3H9HA 4L3EA 1DUZA 1K8DA 3FQWA 4QRPA 1HSAA 3KPPA 3QUZA 1JGDA 4N0CA 4NO2A 1T21A 1QR1A 4PJ8A 3VWKA 3BH8A 5IB3A 3HUJA 1LK2A 3CVHA 3ARBA 4S0UC 2YPKA 5D2LA 2BVOA 5HHQA 5MEPA 3LKOA 4E5XA 1JFMA 4X6EA 1AGFA 1S7XA 3GSVA 1N3NA 5HYJA 5E8OA 5MEQA 4U6YA 1GZPA 4L8DA 1KJMA 4MXQA 1RK0A 5C0AA 3PWLA 1I1YA 4K7FA 4MJ5A 1A9EA 4CVZA 5C0GA 3I6KA 3VXPA 5F7DA 1LEKA 3BZFA 2CLRA 1CG9A 3E6FA 3ES6A 3QQ3A 1JPFA 1EEZA 3B3IA 3RGVC 4PJFA 3BEVA 4WWKC 3LV3A 4NO5A
chains in the Genus database with same CATH superfamily
4CVXA 3L3GA 1S8DA 3E2HA 1ZAGA 3CCHA 2FWOA 1W0WA 2JCCA 2GT9A 1K5NA 3TBVA 4F7EA 1JGEA 2BVQA 3MROA 4PJDA 4WJ5A 2XPGA 3GMPA 1X7QA 1QVOA 1IM9A 2HJKA 3MRKA 3W0WA 1P7QA 3ROLA 2MHAA 3KYNA 1JHTA 3CDGA 4JQVA 3UTQA 1BIIA 1SYSA 1XH3A 3P4NA 4HS3A 4U1JA 1JPGA 4JO8A 2D31A 3BWAA 4GKSA 3ERYA 3DX7A 4JFEA 3SDXA 2X4QA 3BO8A 3MRRA 3VFNA 1XR8A 3WS3A 2BSTA 1ZT4A 3GSQA 5D2NA 2UWEA 4X6FA 2ZSVA 5MENA 1T7ZA 4ZUSA 4HKJA 3CC5A 3TO4A 3G08A 4MNQA 5HGHA 3GSRA 5EFIA 3I6LD 4HUXA 1GZQA 4FTVA 4MQ7A 2X4OA 4U1IA 3VXSA 3HAEA 3P9LA 5IM7A 2NX5A 4F7PA 1YN6A 5C0IA 3E3QA 4PJIA 4I48A 4EN3C 3LKRA 3D39A 1LD9A 1Q94A 4L4TA 5DDHA 5E8PA 3RWHA 3UTTA 3D18A 3TIDA 1FZJA 1A9BA 5HHPA 3TBWA 2GUOA 4QRRA 1KJ3H 3IT8D 5DEFA 4G59C 3DMMA 1T1YA 2ESVA 4GUPA 5H94A 4Y4FA 3VFRA 3ECBA 5B38A 1RJZA 1XR9A 3VFVA 1L8JA 2ZSWA 2CLVA 3MRGA 4CW1A 1KTLA 4F7CA 1W72A 1PQZA 4ZFZA 3X13A 1HOCA 3CPLA 3MGTA 4N8VA 5ACZA 1NANH 2X70A 5J6GA 2X4UA 3O4LA 3FT3A 4JFFA 4Y2DA 4MJ6A 2AV1A 2E7LE 3TJHA 1I1FA 5C0DA 1JUFA 3QUYA 3GSWA 4ZUTA 3GJFA 4HV8A 2BSSA 4XXCA 3ARGA 4PJGA 3VFWA 5EUOA 3KXFA 5INCA 2A83A 3X14A 4ELMA 1A1MA 4F7TA 1BZ9A 2FO4A 3TBTA 4PRBA 2V2WA 3L3JA 3W39A 3MRJA 1G7QA 4PJXA 1NEZA 3VWJA 2PYEA 1Z5LA 4N5EA 3KPRA 2CIKA 1P1ZA 3OXSA 4U1NA 1FZOA 3TBYA 3P77A 4GKNA 5GSVA 3QDMA 2X4NA 5INDA 1S9YA 4F7MA 1FG2A 3P9MA 1ZS8A 4UQ3A 3MYJA 5D7LA 4NQEA 1CD1A 1A1NA 2VAAA 5F1IA 1E28A 4PJEA 1MHCA 4PJBA 3LKQA 3BP4A 3BW9A 5EO1A 1QRNA 4JFPA 4O2FA 4Y4HA 3AREA 1MI5A 5L2KA 1M05A 1T0MA 2VABA 3B6SA 3FQUA 1HHIA 3MRDA 4PG2A 4L9LC 3ARFA 3MRLA 4QRSA 3PWJA 2YPLA 3MRBA 1I7UA 3O3BA 3PQYA 4U1SA 1TVBA 2HN7A 3PWPA 3MA7A 3BP7A 3CZFA 4PJHA 2AV7A 4QRUA 5F1NA 4PJ5A 3VFUA 1LDPH 2DYPA 2HLAA 3KPSA 2VLLA 4JRYA 3O3AA 4WU5A 4IHOA 3RWCA 1QO3A 4U1HA 5HGAA 4JFDA 3D2UA 1KPUA 4G8IA 4NQXA 2GITA 3UBXA 4FFEX 5B39A 3TO2A 4HUWA 4ZUUA 5D5MA 4JFOA 1B0RA 4U1KA 1EFXA 1A6ZA 5HHMA 5C08A 3MRQA 3QEQA 5C0BA 3QULA 1KPVA 3FRUA 5C07A 3QDJA 2HJLA 3KPOA 2VLRA 2BNQA 5DEGA 3JTSA 3KWWA 2WY3A 1ZT1A 5D7JC 4LNRA 2F53A 1G7PA 5E6IC 2RFXA 3RWJA 1W0VA 3T8XA 4PR5A 3BUYA 4L29A 1HHGA 3ROOA 3MRPA 3O3DA 2ZOKA 3V5HA 2FZ3A 2FYYA 3FOLA 4K71B 5HHOA 4IRJA 1VADA 3DTXA 4PV9A 3MRIA 2X4SA 1JE6A 4N0UA 3RUGA 3TVMA 3GMOA 4V3EB 1TVHA 1ZHNA 5IB2A 4PJ9A 3ARDA 2CLZA 3MV8A 4QRQA 3FFCA 3VCLA 3VXMA 5HGDA 3H7BA 3PWNA 3T1FA 1AGBA 3MR9A 3L3IA 4NHUE 3SCMA 3MREA 1FZMA 3MGOA 3U0PA 2VLJA 3TBSA 5IB4A 4NT6A 3VFSA 1QSEA 1KJVA 2V2XA 3L3HA 3SKOA 5C09A 4IRSA 1T80A 1QLFA 2X4PA 4HWZA 2J8UA 4ONOA 3UTSA 4NO3A 5IVXA 3GSOA 5EOTA 1YDPA 3DBXA 3V5KA 5MEOA 3KLAA 4PGEA 4MS8A 3VRIA 3FT2A 5C0EA 1E27A 3HE7A 3M17A 4PGDA 2FIKA 1I4FA 3FQNA 5BJTA 1KPRA 3RL2A 3HLAA 5BS0A 3RZCA 1FZKA 5FKPA 4L8BA 1T7VA 5FA3A 2NW3A 1IM3A 4PG9A 3X11A 3GMRA 3GMQA 3HE6A 2GTWA 1KJ2H 4MNGA 2H6PA 3DX6A 1S9WA 3ILQC 4I4WA 4MX7A 4EUPA 5IEHA 2YEZA 1FO0H 3GMMA 3HPJA 3HCVA 1ED3A 2OI9A 4L8SC 4X6CA 3QZWA 3AM8A 1KBGH 1I7TA 1ZSDA 2C7UA 2OL3H 1FFOA 3MV7A 4PJCA 4G8GA 3JVGA 3KPLA 3GSXA 3PWUA 1JF1A 1CE6A 4PRIA 3RWGA 1T7WA 1HHKA 3LN5A 3P73A 5F9JA 1FFNA 1WBZA 4IIQC 1DE4A 1HHJA 4PGCA 1T20A 2CIIA 3VXUA 1B0GA 3VH8A 3FQRA 3GMLA 1P4LA 4LHUA 2X4TA 1S7WA 1UXWA 1ZT7A 4PREA 1BD2A 3H9SA 2PO6A 3FONA 3LKNA 3TF7A 3BHBA 4JRXA 3BH9A 1QQDA 3QQ4A 3BEWA 3FTGA 3MRHA 1NAMH 1UXSA 3TZVC 3M1BA 1OF2A 3D3VA 3D25A 4NNYA 4WW2C 1G6RH 4JFQA 4G9FA 3VFOA 4ZAKA 1B3JA 4PRNA 1ONQA 3SDAA 3TIEA 1S7TA 3BXNA 5IB5A 4WDIA 4PJ7A 3BVNA 3E6HA 3IXAA 5GSRA 3VJ6A 2XFXA 4PDCE 3TPUE 1T1XA 3AU1A 3FQXA 1QSFA 3P4OA 4MJIA 1FFPA 1S7SA 4NNXA 5EU6A 1KCGC 1EXUA 3PWVA 1LQVA 1UQSA 3S6CA 3SPVA 5BRZA 4L8CA 1ZVSA 3VXRA 1T1WA 3OV6A 4ZUWA 4JQXA 2BCKA 1QEWA 4L3CA 1C16A 1N2RA 3MRNA 2P5WA 3FT4A 3QFDA 2F74A 5EU5A 1I7RA 1N59A 4HUUA 4O2CA 3UPRA 4EI5A 3QI9A 5C0JA 2AKRA 3RWDA 2P5EA 3OX8A 3GSNH 3O3EA 1OGAA 4APQA 1MWAH 3MRMA 3LN4A 4Z76A 3O9WA 4PGBA 5ENWA 5D9SA 1U58A 3NFNA 4QRTA 3JTCA 3QUKA 2F54A 1INQA 3MRFA 4MVBA 3RL1A 1AGDA 1VGKA 3VRJA 5FA4A 4BKWA 5J6HA 4PRHA 5EU4A 3BGMA 5SWSA 5EU3A 1AKJA 3X12A 5C0FA 1LP9A 3DXAA 1OSZA 1S7UA 2IA1A 3FOMA 1S7RA 4PJAA 5SWZA 1ZHKA 3KPNA 5HHNA 2BSRA 2GJ6A 3VXNA 1LEGA 1T22A 4NQCA 3SDCA 1AGCA 1T7XA 4NQVA 2VLKA 5E00A 3GMNA 2X4RA 3LKSA 3QDGA 4PRAA 1MHEA 4D0BA 1RJYA 2AXGA 1EEYA 4O2EA 3MV9A 5C0CA 5L2JA 2BVPA 4LCWA 1T0NA 4NQDA 3V5DA 3PABA 2H26A 4PP8C 3C8KA 3I6GA 3O8XA 4U6XA 4Z78A 5HGBA 4LCYA 4X6DA 3JTTA 3MRCA 1S9XA 1TMCA 1N5AA 3BZEA 2ZOLA 1ZHBA 3VFMA 4G42A 4PV8A 5C9JA 1AGEA 1WBYA 1DDHA 3QFJA 4NSKA 5IROA 2VE6A 3TN0A 5FDWA 1HSBA 4G59A 3SJVA 4PRPA 3HG1A 4ZUVA 4L4VA 4U1LA 3REWA 5BXFA 3VXOA 1M6OA 4WU7A 4WUUA 3VFTA 3L3KA 3DX8A 5EO0A 4QOKA 4WO4A 3QUXA 3TA3A 4UQ2A 3KPQA 4Y4KA 3RWEA 1ZHLA 4E0RA 3GSUA 2Q7YA 3LKPA 3SDDA 5E9DA 2BNRA 1YN7A 3SKMA 4G43A 4Z77A 3WUWA 3GIVA 1S7VA 1SYVA 2AK4A 3KPMA 5JHDA 5SWQA 3VFPA 1XZ0A 3CH1A 3RWIA 1VACA 3FQTA 3L9RA 4HX1A 5E8NA 3WL9A 2GAZA 3RWFA 3KYOA 1WBXA 3ILPA 4V3DB 2GTZA 1BQHA 1T1ZA 1OGTA 3L3DA 3TFKA 5AD0A 3WS6A 1A1OA 4D0CA 1RK1A 2CKBH 4Y16A 5D7IA 5MERA 1I1AA 1YPZA 5J1AA 4G9DA 4U1MA 5IB1A 1AO7A 1R3HA 2AXFA 4N0FA 4PRDA 4LCCC 3OXRA 1DUYA 5IEKA 1S7QA 1T7YA 3RTQA 3P4MA 4NO0A 1HHHA 3C9NA 3WLBA 2NYKA 4D0DA 5ISZA 1HYRC 4HUVA 3H9HA 4L3EA 1DUZA 1K8DA 3FQWA 4QRPA 1HSAA 3KPPA 3QUZA 1JGDA 4N0CA 4NO2A 1T21A 2O5NA 1QR1A 4PJ8A 3VWKA 3BH8A 5IB3A 3HUJA 1LK2A 3CVHA 3I0TA 3ARBA 4S0UC 2YPKA 5D2LA 2BVOA 5HHQA 5MEPA 3LKOA 4E5XA 1JFMA 4X6EA 1AGFA 1S7XA 3GSVA 1N3NA 5HYJA 5E8OA 5MEQA 4U6YA 1GZPA 4L8DA 1KJMA 4MXQA 1RK0A 5C0AA 3PWLA 1I1YA 4K7FA 4MJ5A 1A9EA 4CVZA 5C0GA 3I6KA 3VXPA 5F7DA 1LEKA 3BZFA 2CLRA 1CG9A 3E6FA 3ES6A 3QQ3A 1JPFA 1EEZA 3B3IA 3RGVC 4PJFA 3BEVA 4WWKC 3LV3A 4NO5A
chains in the Genus database with same CATH topology
4CVXA 3L3GA 1S8DA 3E2HA 1ZAGA 3CCHA 2FWOA 1W0WA 2JCCA 2GT9A 1K5NA 3TBVA 4F7EA 1JGEA 2BVQA 3MROA 4PJDA 4WJ5A 2XPGA 3GMPA 1X7QA 1QVOA 1IM9A 2HJKA 3MRKA 3W0WA 1P7QA 3ROLA 2MHAA 3KYNA 1JHTA 3CDGA 4JQVA 3UTQA 1BIIA 1SYSA 1XH3A 3P4NA 4HS3A 4U1JA 1JPGA 2D31A 3BWAA 4GKSA 3ERYA 3DX7A 4JFEA 3SDXA 2X4QA 3BO8A 3MRRA 3VFNA 1XR8A 3WS3A 2BSTA 1ZT4A 3GSQA 5D2NA 2UWEA 4X6FA 2ZSVA 5MENA 1T7ZA 4ZUSA 4HKJA 3CC5A 3TO4A 3G08A 4MNQA 5HGHA 3GSRA 5EFIA 3I6LD 4HUXA 1GZQA 4FTVA 4MQ7A 2X4OA 4U1IA 3VXSA 3HAEA 3P9LA 5IM7A 2NX5A 4F7PA 1YN6A 5C0IA 3E3QA 4PJIA 4I48A 4EN3C 3LKRA 3D39A 1LD9A 1Q94A 4L4TA 5DDHA 5E8PA 3RWHA 3UTTA 3D18A 3TIDA 1FZJA 1A9BA 5HHPA 3TBWA 2GUOA 4QRRA 1KJ3H 3IT8D 5DEFA 3DMMA 1T1YA 2ESVA 4GUPA 5H94A 4Y4FA 3VFRA 3ECBA 5B38A 1RJZA 1XR9A 3VFVA 1L8JA 2ZSWA 2CLVA 3MRGA 4CW1A 1KTLA 4F7CA 1W72A 1PQZA 4ZFZA 3X13A 1HOCA 3CPLA 3MGTA 4N8VA 5ACZA 1NANH 2X70A 5J6GA 2X4UA 3O4LA 3FT3A 4JFFA 4Y2DA 4MJ6A 2AV1A 2E7LE 3TJHA 1I1FA 5C0DA 1JUFA 3QUYA 3GSWA 4ZUTA 3GJFA 4HV8A 2BSSA 4XXCA 3ARGA 4PJGA 3VFWA 5EUOA 3KXFA 5INCA 2A83A 3X14A 4ELMA 1A1MA 4F7TA 1BZ9A 2FO4A 3TBTA 4PRBA 2V2WA 3L3JA 3W39A 3MRJA 1G7QA 4PJXA 1NEZA 3VWJA 2PYEA 1Z5LA 4N5EA 3KPRA 2CIKA 1P1ZA 3OXSA 4U1NA 1FZOA 3TBYA 3P77A 4GKNA 5GSVA 3QDMA 2X4NA 5INDA 1S9YA 4F7MA 1FG2A 3P9MA 1ZS8A 4UQ3A 3MYJA 5D7LA 4NQEA 1CD1A 1A1NA 2VAAA 5F1IA 1E28A 4PJEA 1MHCA 4PJBA 3LKQA 3BP4A 3BW9A 5EO1A 1QRNA 4JFPA 4O2FA 4Y4HA 3AREA 1MI5A 5L2KA 1M05A 1T0MA 2VABA 3B6SA 3FQUA 1HHIA 3MRDA 4PG2A 4L9LC 3ARFA 3MRLA 4QRSA 3PWJA 2YPLA 3MRBA 1I7UA 3O3BA 3PQYA 4U1SA 1TVBA 2HN7A 3PWPA 3MA7A 3BP7A 3CZFA 4PJHA 2AV7A 4QRUA 5F1NA 4PJ5A 3VFUA 1LDPH 2DYPA 2HLAA 3KPSA 2VLLA 4JRYA 3O3AA 4WU5A 4IHOA 3RWCA 1QO3A 4U1HA 5HGAA 4JFDA 3D2UA 1KPUA 4G8IA 4NQXA 2GITA 3UBXA 4FFEX 5B39A 3TO2A 4HUWA 4ZUUA 5D5MA 4JFOA 1B0RA 4U1KA 1EFXA 1A6ZA 5HHMA 5C08A 3MRQA 3QEQA 5C0BA 3QULA 1KPVA 3FRUA 5C07A 3QDJA 2HJLA 3KPOA 2VLRA 2BNQA 5DEGA 3JTSA 3KWWA 2WY3A 1ZT1A 5D7JC 4LNRA 2F53A 1G7PA 5E6IC 2RFXA 3RWJA 1W0VA 3T8XA 4PR5A 3BUYA 4L29A 1HHGA 3ROOA 3MRPA 3O3DA 2ZOKA 3V5HA 2FZ3A 2FYYA 3FOLA 4K71B 5HHOA 4IRJA 1VADA 3DTXA 4PV9A 3MRIA 2X4SA 1JE6A 4N0UA 3RUGA 3TVMA 3GMOA 4V3EB 1TVHA 1ZHNA 5IB2A 4PJ9A 3ARDA 2CLZA 3MV8A 4QRQA 3FFCA 3VCLA 3VXMA 5HGDA 3H7BA 3PWNA 3T1FA 1AGBA 3MR9A 3L3IA 4NHUE 3SCMA 3MREA 1FZMA 3MGOA 3U0PA 2VLJA 3TBSA 5IB4A 4NT6A 3VFSA 1QSEA 1KJVA 2V2XA 3L3HA 3SKOA 5C09A 4IRSA 1T80A 1QLFA 2X4PA 4HWZA 2J8UA 4ONOA 3UTSA 4NO3A 5IVXA 3GSOA 5EOTA 1YDPA 3DBXA 3V5KA 5MEOA 3KLAA 4PGEA 4MS8A 3VRIA 3FT2A 5C0EA 1E27A 3HE7A 3M17A 4PGDA 2FIKA 1I4FA 3FQNA 5BJTA 1KPRA 3RL2A 3HLAA 5BS0A 3RZCA 1FZKA 5FKPA 4L8BA 1T7VA 5FA3A 2NW3A 1IM3A 4PG9A 3X11A 3GMRA 3GMQA 3HE6A 2GTWA 1KJ2H 4MNGA 2H6PA 3DX6A 1S9WA 3ILQC 4I4WA 4MX7A 4EUPA 5IEHA 2YEZA 1FO0H 3GMMA 3HPJA 3HCVA 1ED3A 2OI9A 4L8SC 4X6CA 3QZWA 3AM8A 1KBGH 1I7TA 1ZSDA 2C7UA 2OL3H 1FFOA 3MV7A 4PJCA 4G8GA 3JVGA 3KPLA 3GSXA 3PWUA 1JF1A 1CE6A 4PRIA 3RWGA 1T7WA 1HHKA 3LN5A 3P73A 5F9JA 1FFNA 1WBZA 4IIQC 1DE4A 1HHJA 4PGCA 1T20A 2CIIA 3VXUA 1B0GA 3VH8A 3FQRA 3GMLA 1P4LA 4LHUA 2X4TA 1S7WA 1UXWA 1ZT7A 4PREA 1BD2A 3H9SA 2PO6A 3FONA 3LKNA 3TF7A 3BHBA 4JRXA 3BH9A 1QQDA 3QQ4A 3BEWA 3FTGA 3MRHA 1NAMH 1UXSA 3TZVC 3M1BA 1OF2A 3D3VA 3D25A 4NNYA 4WW2C 1G6RH 4JFQA 4G9FA 3VFOA 4ZAKA 1B3JA 4PRNA 1ONQA 3SDAA 3TIEA 1S7TA 3BXNA 5IB5A 4WDIA 4PJ7A 3BVNA 3E6HA 3IXAA 5GSRA 3VJ6A 2XFXA 4PDCE 3TPUE 1T1XA 3AU1A 3FQXA 1QSFA 3P4OA 4MJIA 1FFPA 1S7SA 4NNXA 5EU6A 1KCGC 1EXUA 3PWVA 1LQVA 1UQSA 3S6CA 3SPVA 5BRZA 4L8CA 1ZVSA 3VXRA 1T1WA 3OV6A 4ZUWA 4JQXA 2BCKA 1QEWA 4L3CA 1C16A 1N2RA 3MRNA 2P5WA 3FT4A 3QFDA 2F74A 5EU5A 1I7RA 1N59A 4HUUA 4O2CA 3UPRA 4EI5A 3QI9A 5C0JA 2AKRA 3RWDA 2P5EA 3OX8A 3GSNH 3O3EA 1OGAA 4APQA 1MWAH 3MRMA 3LN4A 4Z76A 3O9WA 4PGBA 5ENWA 5D9SA 1U58A 3NFNA 4QRTA 3JTCA 3QUKA 2F54A 1INQA 3MRFA 4MVBA 3RL1A 1AGDA 1VGKA 3VRJA 5FA4A 5J6HA 4PRHA 5EU4A 3BGMA 5SWSA 5EU3A 1AKJA 3X12A 5C0FA 1LP9A 3DXAA 1OSZA 1S7UA 3FOMA 4PJAA 1S7RA 5SWZA 1ZHKA 3KPNA 5HHNA 2BSRA 2GJ6A 3VXNA 1LEGA 1T22A 4NQCA 3SDCA 1AGCA 1T7XA 4NQVA 2VLKA 5E00A 3GMNA 2X4RA 3LKSA 3QDGA 4PRAA 1MHEA 4D0BA 1RJYA 2AXGA 1EEYA 4O2EA 3MV9A 5C0CA 5L2JA 2BVPA 4LCWA 1T0NA 4NQDA 3V5DA 3PABA 2H26A 4PP8C 3C8KA 3I6GA 3O8XA 4U6XA 4Z78A 5HGBA 4LCYA 4X6DA 3JTTA 3MRCA 1S9XA 1TMCA 1N5AA 3BZEA 2ZOLA 1ZHBA 3VFMA 4G42A 4PV8A 5C9JA 1AGEA 1WBYA 1DDHA 3QFJA 4NSKA 5IROA 2VE6A 3TN0A 5FDWA 1HSBA 4G59A 3SJVA 4PRPA 3HG1A 4ZUVA 4L4VA 4U1LA 3REWA 5BXFA 3VXOA 1M6OA 4WU7A 4WUUA 3VFTA 3L3KA 3DX8A 5EO0A 4QOKA 4WO4A 3QUXA 3TA3A 4UQ2A 3KPQA 4Y4KA 3RWEA 1ZHLA 4E0RA 3GSUA 2Q7YA 3LKPA 3SDDA 5E9DA 2BNRA 1YN7A 3SKMA 4G43A 4Z77A 3WUWA 3GIVA 1S7VA 1SYVA 2AK4A 3KPMA 5JHDA 5SWQA 3VFPA 1XZ0A 3CH1A 3RWIA 1VACA 3FQTA 3L9RA 4HX1A 5E8NA 3WL9A 2GAZA 3RWFA 3KYOA 1WBXA 3ILPA 4V3DB 2GTZA 1BQHA 1T1ZA 1OGTA 3L3DA 3TFKA 5AD0A 3WS6A 1A1OA 4D0CA 1RK1A 2CKBH 4Y16A 5D7IA 5MERA 1I1AA 1YPZA 5J1AA 4G9DA 4U1MA 5IB1A 1AO7A 1R3HA 2AXFA 4N0FA 4PRDA 4LCCC 3OXRA 1DUYA 5IEKA 1S7QA 1T7YA 3RTQA 3P4MA 4NO0A 1HHHA 3C9NA 3WLBA 4D0DA 5ISZA 1HYRC 4HUVA 3H9HA 4L3EA 1DUZA 1K8DA 3FQWA 4QRPA 1HSAA 3KPPA 3QUZA 1JGDA 4N0CA 4NO2A 1T21A 1QR1A 4PJ8A 3VWKA 3BH8A 5IB3A 3HUJA 1LK2A 3CVHA 3ARBA 4S0UC 2YPKA 5D2LA 2BVOA 5HHQA 5MEPA 3LKOA 4E5XA 1JFMA 4X6EA 1AGFA 1S7XA 3GSVA 1N3NA 5HYJA 5E8OA 5MEQA 4U6YA 1GZPA 4L8DA 1KJMA 4MXQA 1RK0A 5C0AA 3PWLA 1I1YA 4K7FA 4MJ5A 1A9EA 4CVZA 5C0GA 3I6KA 3VXPA 5F7DA 1LEKA 3BZFA 2CLRA 1CG9A 3E6FA 3ES6A 3QQ3A 1JPFA 1EEZA 3B3IA 3RGVC 4PJFA 3BEVA 4WWKC 3LV3A 4NO5A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4CVX A;  3L3G A;  1S8D A;  3E2H A;  1ZAG A;  3CCH A;  2FWO A;  1W0W A;  2JCC A;  2GT9 A;  1K5N A;  3TBV A;  4F7E A;  1JGE A;  2BVQ A;  3MRO A;  4PJD A;  4WJ5 A;  2XPG A;  3GMP A;  1X7Q A;  1QVO A;  1IM9 A;  2HJK A;  3MRK A;  3W0W A;  1P7Q A;  3ROL A;  2MHA A;  3KYN A;  1JHT A;  3CDG A;  4JQV A;  3UTQ A;  1BII A;  1SYS A;  1XH3 A;  3P4N A;  4HS3 A;  4U1J A;  1JPG A;  2D31 A;  3BWA A;  4GKS A;  3ERY A;  3DX7 A;  4JFE A;  3SDX A;  2X4Q A;  3BO8 A;  3MRR A;  3VFN A;  1XR8 A;  3WS3 A;  2BST A;  1ZT4 A;  3GSQ A;  5D2N A;  2UWE A;  4X6F A;  2ZSV A;  5MEN A;  1T7Z A;  4ZUS A;  4HKJ A;  3CC5 A;  3TO4 A;  3G08 A;  4MNQ A;  5HGH A;  3GSR A;  5EFI A;  3I6L D;  4HUX A;  1GZQ A;  4FTV A;  4MQ7 A;  2X4O A;  4U1I A;  3VXS A;  3HAE A;  3P9L A;  5IM7 A;  2NX5 A;  4F7P A;  1YN6 A;  5C0I A;  3E3Q A;  4PJI A;  4I48 A;  4EN3 C;  3LKR A;  3D39 A;  1LD9 A;  1Q94 A;  4L4T A;  5DDH A;  5E8P A;  3RWH A;  3UTT A;  3D18 A;  3TID A;  1FZJ A;  1A9B A;  5HHP A;  3TBW A;  2GUO A;  4QRR A;  1KJ3 H;  3IT8 D;  5DEF A;  3DMM A;  1T1Y A;  2ESV A;  4GUP A;  5H94 A;  4Y4F A;  3VFR A;  3ECB A;  5B38 A;  1RJZ A;  1XR9 A;  3VFV A;  1L8J A;  2ZSW A;  2CLV A;  3MRG A;  4CW1 A;  1KTL A;  4F7C A;  1W72 A;  1PQZ A;  4ZFZ A;  3X13 A;  1HOC A;  3CPL A;  3MGT A;  4N8V A;  5ACZ A;  1NAN H;  2X70 A;  5J6G A;  2X4U A;  3O4L A;  3FT3 A;  4JFF A;  4Y2D A;  4MJ6 A;  2AV1 A;  2E7L E;  3TJH A;  1I1F A;  5C0D A;  1JUF A;  3QUY A;  3GSW A;  4ZUT A;  3GJF A;  4HV8 A;  2BSS A;  4XXC A;  3ARG A;  4PJG A;  3VFW A;  5EUO A;  3KXF A;  5INC A;  2A83 A;  3X14 A;  4ELM A;  1A1M A;  4F7T A;  1BZ9 A;  2FO4 A;  3TBT A;  4PRB A;  2V2W A;  3L3J A;  3W39 A;  3MRJ A;  1G7Q A;  4PJX A;  1NEZ A;  3VWJ A;  2PYE A;  1Z5L A;  4N5E A;  3KPR A;  2CIK A;  1P1Z A;  3OXS A;  4U1N A;  1FZO A;  3TBY A;  3P77 A;  4GKN A;  5GSV A;  3QDM A;  2X4N A;  5IND A;  1S9Y A;  4F7M A;  1FG2 A;  3P9M A;  1ZS8 A;  4UQ3 A;  3MYJ A;  5D7L A;  4NQE A;  1CD1 A;  1A1N A;  2VAA A;  5F1I A;  1E28 A;  4PJE A;  1MHC A;  4PJB A;  3LKQ A;  3BP4 A;  3BW9 A;  5EO1 A;  1QRN A;  4JFP A;  4O2F A;  4Y4H A;  3ARE A;  1MI5 A;  5L2K A;  1M05 A;  1T0M A;  2VAB A;  3B6S A;  3FQU A;  1HHI A;  3MRD A;  4PG2 A;  4L9L C;  3ARF A;  3MRL A;  4QRS A;  3PWJ A;  2YPL A;  3MRB A;  1I7U A;  3O3B A;  3PQY A;  4U1S A;  1TVB A;  2HN7 A;  3PWP A;  3MA7 A;  3BP7 A;  3CZF A;  4PJH A;  2AV7 A;  4QRU A;  5F1N A;  4PJ5 A;  3VFU A;  1LDP H;  2DYP A;  2HLA A;  3KPS A;  2VLL A;  4JRY A;  3O3A A;  4WU5 A;  4IHO A;  3RWC A;  1QO3 A;  4U1H A;  5HGA A;  4JFD A;  3D2U A;  1KPU A;  4G8I A;  4NQX A;  2GIT A;  3UBX A;  4FFE X;  5B39 A;  3TO2 A;  4HUW A;  4ZUU A;  5D5M A;  4JFO A;  1B0R A;  4U1K A;  1EFX A;  1A6Z A;  5HHM A;  5C08 A;  3MRQ A;  3QEQ A;  5C0B A;  3QUL A;  1KPV A;  3FRU A;  5C07 A;  3QDJ A;  2HJL A;  3KPO A;  2VLR A;  2BNQ A;  5DEG A;  3JTS A;  3KWW A;  2WY3 A;  1ZT1 A;  5D7J C;  4LNR A;  2F53 A;  1G7P A;  5E6I C;  2RFX A;  3RWJ A;  1W0V A;  3T8X A;  4PR5 A;  3BUY A;  4L29 A;  1HHG A;  3ROO A;  3MRP A;  3O3D A;  2ZOK A;  3V5H A;  2FZ3 A;  2FYY A;  3FOL A;  4K71 B;  5HHO A;  4IRJ A;  1VAD A;  3DTX A;  4PV9 A;  3MRI A;  2X4S A;  1JE6 A;  4N0U A;  3RUG A;  3TVM A;  3GMO A;  4V3E B;  1TVH A;  1ZHN A;  5IB2 A;  4PJ9 A;  3ARD A;  2CLZ A;  3MV8 A;  4QRQ A;  3FFC A;  3VCL A;  3VXM A;  5HGD A;  3H7B A;  3PWN A;  3T1F A;  1AGB A;  3MR9 A;  3L3I A;  4NHU E;  3SCM A;  3MRE A;  1FZM A;  3MGO A;  3U0P A;  2VLJ A;  3TBS A;  5IB4 A;  4NT6 A;  3VFS A;  1QSE A;  1KJV A;  2V2X A;  3L3H A;  3SKO A;  5C09 A;  4IRS A;  1T80 A;  1QLF A;  2X4P A;  4HWZ A;  2J8U A;  4ONO A;  3UTS A;  4NO3 A;  5IVX A;  3GSO A;  5EOT A;  1YDP A;  3DBX A;  3V5K A;  5MEO A;  3KLA A;  4PGE A;  4MS8 A;  3VRI A;  3FT2 A;  5C0E A;  1E27 A;  3HE7 A;  3M17 A;  4PGD A;  2FIK A;  1I4F A;  3FQN A;  5BJT A;  1KPR A;  3RL2 A;  3HLA A;  5BS0 A;  3RZC A;  1FZK A;  5FKP A;  4L8B A;  1T7V A;  5FA3 A;  2NW3 A;  1IM3 A;  4PG9 A;  3X11 A;  3GMR A;  3GMQ A;  3HE6 A;  2GTW A;  1KJ2 H;  4MNG A;  2H6P A;  3DX6 A;  1S9W A;  3ILQ C;  4I4W A;  4MX7 A;  4EUP A;  5IEH A;  2YEZ A;  1FO0 H;  3GMM A;  3HPJ A;  3HCV A;  1ED3 A;  2OI9 A;  4L8S C;  4X6C A;  3QZW A;  3AM8 A;  1KBG H;  1I7T A;  1ZSD A;  2C7U A;  2OL3 H;  1FFO A;  3MV7 A;  4PJC A;  4G8G A;  3JVG A;  3KPL A;  3GSX A;  3PWU A;  1JF1 A;  1CE6 A;  4PRI A;  3RWG A;  1T7W A;  1HHK A;  3LN5 A;  3P73 A;  5F9J A;  1FFN A;  1WBZ A;  4IIQ C;  1DE4 A;  1HHJ A;  4PGC A;  1T20 A;  2CII A;  3VXU A;  1B0G A;  3VH8 A;  3FQR A;  3GML A;  1P4L A;  4LHU A;  2X4T A;  1S7W A;  1UXW A;  1ZT7 A;  4PRE A;  1BD2 A;  3H9S A;  2PO6 A;  3FON A;  3LKN A;  3TF7 A;  3BHB A;  4JRX A;  3BH9 A;  1QQD A;  3QQ4 A;  3BEW A;  3FTG A;  3MRH A;  1NAM H;  1UXS A;  3TZV C;  3M1B A;  1OF2 A;  3D3V A;  3D25 A;  4NNY A;  4WW2 C;  1G6R H;  4JFQ A;  4G9F A;  3VFO A;  4ZAK A;  1B3J A;  4PRN A;  1ONQ A;  3SDA A;  3TIE A;  1S7T A;  3BXN A;  5IB5 A;  4WDI A;  4PJ7 A;  3BVN A;  3E6H A;  3IXA A;  5GSR A;  3VJ6 A;  2XFX A;  4PDC E;  3TPU E;  1T1X A;  3AU1 A;  3FQX A;  1QSF A;  3P4O A;  4MJI A;  1FFP A;  1S7S A;  4NNX A;  5EU6 A;  1KCG C;  1EXU A;  3PWV A;  1LQV A;  1UQS A;  3S6C A;  3SPV A;  5BRZ A;  4L8C A;  1ZVS A;  3VXR A;  1T1W A;  3OV6 A;  4ZUW A;  4JQX A;  2BCK A;  1QEW A;  4L3C A;  1C16 A;  1N2R A;  3MRN A;  2P5W A;  3FT4 A;  3QFD A;  2F74 A;  5EU5 A;  1I7R A;  1N59 A;  4HUU A;  4O2C A;  3UPR A;  4EI5 A;  3QI9 A;  5C0J A;  2AKR A;  3RWD A;  2P5E A;  3OX8 A;  3GSN H;  3O3E A;  1OGA A;  4APQ A;  1MWA H;  3MRM A;  3LN4 A;  4Z76 A;  3O9W A;  4PGB A;  5ENW A;  5D9S A;  1U58 A;  3NFN A;  4QRT A;  3JTC A;  3QUK A;  2F54 A;  1INQ A;  3MRF A;  4MVB A;  3RL1 A;  1AGD A;  1VGK A;  3VRJ A;  5FA4 A;  5J6H A;  4PRH A;  5EU4 A;  3BGM A;  5SWS A;  5EU3 A;  1AKJ A;  3X12 A;  5C0F A;  1LP9 A;  3DXA A;  1OSZ A;  1S7U A;  3FOM A;  4PJA A;  1S7R A;  5SWZ A;  1ZHK A;  3KPN A;  5HHN A;  2BSR A;  2GJ6 A;  3VXN A;  1LEG A;  1T22 A;  4NQC A;  3SDC A;  1AGC A;  1T7X A;  4NQV A;  2VLK A;  5E00 A;  3GMN A;  2X4R A;  3LKS A;  3QDG A;  4PRA A;  1MHE A;  4D0B A;  1RJY A;  2AXG A;  1EEY A;  4O2E A;  3MV9 A;  5C0C A;  5L2J A;  2BVP A;  4LCW A;  1T0N A;  4NQD A;  3V5D A;  3PAB A;  2H26 A;  4PP8 C;  3C8K A;  3I6G A;  3O8X A;  4U6X A;  4Z78 A;  5HGB A;  4LCY A;  4X6D A;  3JTT A;  3MRC A;  1S9X A;  1TMC A;  1N5A A;  3BZE A;  2ZOL A;  1ZHB A;  3VFM A;  4G42 A;  4PV8 A;  5C9J A;  1AGE A;  1WBY A;  1DDH A;  3QFJ A;  4NSK A;  5IRO A;  2VE6 A;  3TN0 A;  5FDW A;  1HSB A;  4G59 A;  3SJV A;  4PRP A;  3HG1 A;  4ZUV A;  4L4V A;  4U1L A;  3REW A;  5BXF A;  3VXO A;  1M6O A;  4WU7 A;  4WUU A;  3VFT A;  3L3K A;  3DX8 A;  5EO0 A;  4QOK A;  4WO4 A;  3QUX A;  3TA3 A;  4UQ2 A;  3KPQ A;  4Y4K A;  3RWE A;  1ZHL A;  4E0R A;  3GSU A;  2Q7Y A;  3LKP A;  3SDD A;  5E9D A;  2BNR A;  1YN7 A;  3SKM A;  4G43 A;  4Z77 A;  3WUW A;  3GIV A;  1S7V A;  1SYV A;  2AK4 A;  3KPM A;  5JHD A;  5SWQ A;  3VFP A;  1XZ0 A;  3CH1 A;  3RWI A;  1VAC A;  3FQT A;  3L9R A;  4HX1 A;  5E8N A;  3WL9 A;  2GAZ A;  3RWF A;  3KYO A;  1WBX A;  3ILP A;  4V3D B;  2GTZ A;  1BQH A;  1T1Z A;  1OGT A;  3L3D A;  3TFK A;  5AD0 A;  3WS6 A;  1A1O A;  4D0C A;  1RK1 A;  2CKB H;  4Y16 A;  5D7I A;  5MER A;  1I1A A;  1YPZ A;  5J1A A;  4G9D A;  4U1M A;  5IB1 A;  1AO7 A;  1R3H A;  2AXF A;  4N0F A;  4PRD A;  4LCC C;  3OXR A;  1DUY A;  5IEK A;  1S7Q A;  1T7Y A;  3RTQ A;  3P4M A;  4NO0 A;  1HHH A;  3C9N A;  3WLB A;  4D0D A;  5ISZ A;  1HYR C;  4HUV A;  3H9H A;  4L3E A;  1DUZ A;  1K8D A;  3FQW A;  4QRP A;  1HSA A;  3KPP A;  3QUZ A;  1JGD A;  4N0C A;  4NO2 A;  1T21 A;  1QR1 A;  4PJ8 A;  3VWK A;  3BH8 A;  5IB3 A;  3HUJ A;  1LK2 A;  3CVH A;  3ARB A;  4S0U C;  2YPK A;  5D2L A;  2BVO A;  5HHQ A;  5MEP A;  3LKO A;  4E5X A;  1JFM A;  4X6E A;  1AGF A;  1S7X A;  3GSV A;  1N3N A;  5HYJ A;  5E8O A;  5MEQ A;  4U6Y A;  1GZP A;  4L8D A;  1KJM A;  4MXQ A;  1RK0 A;  5C0A A;  3PWL A;  1I1Y A;  4K7F A;  4MJ5 A;  1A9E A;  4CVZ A;  5C0G A;  3I6K A;  3VXP A;  5F7D A;  1LEK A;  3BZF A;  2CLR A;  1CG9 A;  3E6F A;  3ES6 A;  3QQ3 A;  1JPF A;  1EEZ A;  3B3I A;  3RGV C;  4PJF A;  3BEV A;  4WWK C;  3LV3 A;  4NO5 A; 
#chains in the Genus database with same CATH topology
 4CVX A;  3L3G A;  1S8D A;  3E2H A;  1ZAG A;  3CCH A;  2FWO A;  1W0W A;  2JCC A;  2GT9 A;  1K5N A;  3TBV A;  4F7E A;  1JGE A;  2BVQ A;  3MRO A;  4PJD A;  4WJ5 A;  2XPG A;  3GMP A;  1X7Q A;  1QVO A;  1IM9 A;  2HJK A;  3MRK A;  3W0W A;  1P7Q A;  3ROL A;  2MHA A;  3KYN A;  1JHT A;  3CDG A;  4JQV A;  3UTQ A;  1BII A;  1SYS A;  1XH3 A;  3P4N A;  4HS3 A;  4U1J A;  1JPG A;  4JO8 A;  2D31 A;  3BWA A;  4GKS A;  3ERY A;  3DX7 A;  4JFE A;  3SDX A;  2X4Q A;  3BO8 A;  3MRR A;  3VFN A;  1XR8 A;  3WS3 A;  2BST A;  1ZT4 A;  3GSQ A;  5D2N A;  2UWE A;  4X6F A;  2ZSV A;  5MEN A;  1T7Z A;  4ZUS A;  4HKJ A;  3CC5 A;  3TO4 A;  3G08 A;  4MNQ A;  5HGH A;  3GSR A;  5EFI A;  3I6L D;  4HUX A;  1GZQ A;  4FTV A;  4MQ7 A;  2X4O A;  4U1I A;  3VXS A;  3HAE A;  3P9L A;  5IM7 A;  2NX5 A;  4F7P A;  1YN6 A;  5C0I A;  3E3Q A;  4PJI A;  4I48 A;  4EN3 C;  3LKR A;  3D39 A;  1LD9 A;  1Q94 A;  4L4T A;  5DDH A;  5E8P A;  3RWH A;  3UTT A;  3D18 A;  3TID A;  1FZJ A;  1A9B A;  5HHP A;  3TBW A;  2GUO A;  4QRR A;  1KJ3 H;  3IT8 D;  5DEF A;  4G59 C;  3DMM A;  1T1Y A;  2ESV A;  4GUP A;  5H94 A;  4Y4F A;  3VFR A;  3ECB A;  5B38 A;  1RJZ A;  1XR9 A;  3VFV A;  1L8J A;  2ZSW A;  2CLV A;  3MRG A;  4CW1 A;  1KTL A;  4F7C A;  1W72 A;  1PQZ A;  4ZFZ A;  3X13 A;  1HOC A;  3CPL A;  3MGT A;  4N8V A;  5ACZ A;  1NAN H;  2X70 A;  5J6G A;  2X4U A;  3O4L A;  3FT3 A;  4JFF A;  4Y2D A;  4MJ6 A;  2AV1 A;  2E7L E;  3TJH A;  1I1F A;  5C0D A;  1JUF A;  3QUY A;  3GSW A;  4ZUT A;  3GJF A;  4HV8 A;  2BSS A;  4XXC A;  3ARG A;  4PJG A;  3VFW A;  5EUO A;  3KXF A;  5INC A;  2A83 A;  3X14 A;  4ELM A;  1A1M A;  4F7T A;  1BZ9 A;  2FO4 A;  3TBT A;  4PRB A;  2V2W A;  3L3J A;  3W39 A;  3MRJ A;  1G7Q A;  4PJX A;  1NEZ A;  3VWJ A;  2PYE A;  1Z5L A;  4N5E A;  3KPR A;  2CIK A;  1P1Z A;  3OXS A;  4U1N A;  1FZO A;  3TBY A;  3P77 A;  4GKN A;  5GSV A;  3QDM A;  2X4N A;  5IND A;  1S9Y A;  4F7M A;  1FG2 A;  3P9M A;  1ZS8 A;  4UQ3 A;  3MYJ A;  5D7L A;  4NQE A;  1CD1 A;  1A1N A;  2VAA A;  5F1I A;  1E28 A;  4PJE A;  1MHC A;  4PJB A;  3LKQ A;  3BP4 A;  3BW9 A;  5EO1 A;  1QRN A;  4JFP A;  4O2F A;  4Y4H A;  3ARE A;  1MI5 A;  5L2K A;  1M05 A;  1T0M A;  2VAB A;  3B6S A;  3FQU A;  1HHI A;  3MRD A;  4PG2 A;  4L9L C;  3ARF A;  3MRL A;  4QRS A;  3PWJ A;  2YPL A;  3MRB A;  1I7U A;  3O3B A;  3PQY A;  4U1S A;  1TVB A;  2HN7 A;  3PWP A;  3MA7 A;  3BP7 A;  3CZF A;  4PJH A;  2AV7 A;  4QRU A;  5F1N A;  4PJ5 A;  3VFU A;  1LDP H;  2DYP A;  2HLA A;  3KPS A;  2VLL A;  4JRY A;  3O3A A;  4WU5 A;  4IHO A;  3RWC A;  1QO3 A;  4U1H A;  5HGA A;  4JFD A;  3D2U A;  1KPU A;  4G8I A;  4NQX A;  2GIT A;  3UBX A;  4FFE X;  5B39 A;  3TO2 A;  4HUW A;  4ZUU A;  5D5M A;  4JFO A;  1B0R A;  4U1K A;  1EFX A;  1A6Z A;  5HHM A;  5C08 A;  3MRQ A;  3QEQ A;  5C0B A;  3QUL A;  1KPV A;  3FRU A;  5C07 A;  3QDJ A;  2HJL A;  3KPO A;  2VLR A;  2BNQ A;  5DEG A;  3JTS A;  3KWW A;  2WY3 A;  1ZT1 A;  5D7J C;  4LNR A;  2F53 A;  1G7P A;  5E6I C;  2RFX A;  3RWJ A;  1W0V A;  3T8X A;  4PR5 A;  3BUY A;  4L29 A;  1HHG A;  3ROO A;  3MRP A;  3O3D A;  2ZOK A;  3V5H A;  2FZ3 A;  2FYY A;  3FOL A;  4K71 B;  5HHO A;  4IRJ A;  1VAD A;  3DTX A;  4PV9 A;  3MRI A;  2X4S A;  1JE6 A;  4N0U A;  3RUG A;  3TVM A;  3GMO A;  4V3E B;  1TVH A;  1ZHN A;  5IB2 A;  4PJ9 A;  3ARD A;  2CLZ A;  3MV8 A;  4QRQ A;  3FFC A;  3VCL A;  3VXM A;  5HGD A;  3H7B A;  3PWN A;  3T1F A;  1AGB A;  3MR9 A;  3L3I A;  4NHU E;  3SCM A;  3MRE A;  1FZM A;  3MGO A;  3U0P A;  2VLJ A;  3TBS A;  5IB4 A;  4NT6 A;  3VFS A;  1QSE A;  1KJV A;  2V2X A;  3L3H A;  3SKO A;  5C09 A;  4IRS A;  1T80 A;  1QLF A;  2X4P A;  4HWZ A;  2J8U A;  4ONO A;  3UTS A;  4NO3 A;  5IVX A;  3GSO A;  5EOT A;  1YDP A;  3DBX A;  3V5K A;  5MEO A;  3KLA A;  4PGE A;  4MS8 A;  3VRI A;  3FT2 A;  5C0E A;  1E27 A;  3HE7 A;  3M17 A;  4PGD A;  2FIK A;  1I4F A;  3FQN A;  5BJT A;  1KPR A;  3RL2 A;  3HLA A;  5BS0 A;  3RZC A;  1FZK A;  5FKP A;  4L8B A;  1T7V A;  5FA3 A;  2NW3 A;  1IM3 A;  4PG9 A;  3X11 A;  3GMR A;  3GMQ A;  3HE6 A;  2GTW A;  1KJ2 H;  4MNG A;  2H6P A;  3DX6 A;  1S9W A;  3ILQ C;  4I4W A;  4MX7 A;  4EUP A;  5IEH A;  2YEZ A;  1FO0 H;  3GMM A;  3HPJ A;  3HCV A;  1ED3 A;  2OI9 A;  4L8S C;  4X6C A;  3QZW A;  3AM8 A;  1KBG H;  1I7T A;  1ZSD A;  2C7U A;  2OL3 H;  1FFO A;  3MV7 A;  4PJC A;  4G8G A;  3JVG A;  3KPL A;  3GSX A;  3PWU A;  1JF1 A;  1CE6 A;  4PRI A;  3RWG A;  1T7W A;  1HHK A;  3LN5 A;  3P73 A;  5F9J A;  1FFN A;  1WBZ A;  4IIQ C;  1DE4 A;  1HHJ A;  4PGC A;  1T20 A;  2CII A;  3VXU A;  1B0G A;  3VH8 A;  3FQR A;  3GML A;  1P4L A;  4LHU A;  2X4T A;  1S7W A;  1UXW A;  1ZT7 A;  4PRE A;  1BD2 A;  3H9S A;  2PO6 A;  3FON A;  3LKN A;  3TF7 A;  3BHB A;  4JRX A;  3BH9 A;  1QQD A;  3QQ4 A;  3BEW A;  3FTG A;  3MRH A;  1NAM H;  1UXS A;  3TZV C;  3M1B A;  1OF2 A;  3D3V A;  3D25 A;  4NNY A;  4WW2 C;  1G6R H;  4JFQ A;  4G9F A;  3VFO A;  4ZAK A;  1B3J A;  4PRN A;  1ONQ A;  3SDA A;  3TIE A;  1S7T A;  3BXN A;  5IB5 A;  4WDI A;  4PJ7 A;  3BVN A;  3E6H A;  3IXA A;  5GSR A;  3VJ6 A;  2XFX A;  4PDC E;  3TPU E;  1T1X A;  3AU1 A;  3FQX A;  1QSF A;  3P4O A;  4MJI A;  1FFP A;  1S7S A;  4NNX A;  5EU6 A;  1KCG C;  1EXU A;  3PWV A;  1LQV A;  1UQS A;  3S6C A;  3SPV A;  5BRZ A;  4L8C A;  1ZVS A;  3VXR A;  1T1W A;  3OV6 A;  4ZUW A;  4JQX A;  2BCK A;  1QEW A;  4L3C A;  1C16 A;  1N2R A;  3MRN A;  2P5W A;  3FT4 A;  3QFD A;  2F74 A;  5EU5 A;  1I7R A;  1N59 A;  4HUU A;  4O2C A;  3UPR A;  4EI5 A;  3QI9 A;  5C0J A;  2AKR A;  3RWD A;  2P5E A;  3OX8 A;  3GSN H;  3O3E A;  1OGA A;  4APQ A;  1MWA H;  3MRM A;  3LN4 A;  4Z76 A;  3O9W A;  4PGB A;  5ENW A;  5D9S A;  1U58 A;  3NFN A;  4QRT A;  3JTC A;  3QUK A;  2F54 A;  1INQ A;  3MRF A;  4MVB A;  3RL1 A;  1AGD A;  1VGK A;  3VRJ A;  5FA4 A;  4BKW A;  5J6H A;  4PRH A;  5EU4 A;  3BGM A;  5SWS A;  5EU3 A;  1AKJ A;  3X12 A;  5C0F A;  1LP9 A;  3DXA A;  1OSZ A;  1S7U A;  2IA1 A;  3FOM A;  1S7R A;  4PJA A;  5SWZ A;  1ZHK A;  3KPN A;  5HHN A;  2BSR A;  2GJ6 A;  3VXN A;  1LEG A;  1T22 A;  4NQC A;  3SDC A;  1AGC A;  1T7X A;  4NQV A;  2VLK A;  5E00 A;  3GMN A;  2X4R A;  3LKS A;  3QDG A;  4PRA A;  1MHE A;  4D0B A;  1RJY A;  2AXG A;  1EEY A;  4O2E A;  3MV9 A;  5C0C A;  5L2J A;  2BVP A;  4LCW A;  1T0N A;  4NQD A;  3V5D A;  3PAB A;  2H26 A;  4PP8 C;  3C8K A;  3I6G A;  3O8X A;  4U6X A;  4Z78 A;  5HGB A;  4LCY A;  4X6D A;  3JTT A;  3MRC A;  1S9X A;  1TMC A;  1N5A A;  3BZE A;  2ZOL A;  1ZHB A;  3VFM A;  4G42 A;  4PV8 A;  5C9J A;  1AGE A;  1WBY A;  1DDH A;  3QFJ A;  4NSK A;  5IRO A;  2VE6 A;  3TN0 A;  5FDW A;  1HSB A;  4G59 A;  3SJV A;  4PRP A;  3HG1 A;  4ZUV A;  4L4V A;  4U1L A;  3REW A;  5BXF A;  3VXO A;  1M6O A;  4WU7 A;  4WUU A;  3VFT A;  3L3K A;  3DX8 A;  5EO0 A;  4QOK A;  4WO4 A;  3QUX A;  3TA3 A;  4UQ2 A;  3KPQ A;  4Y4K A;  3RWE A;  1ZHL A;  4E0R A;  3GSU A;  2Q7Y A;  3LKP A;  3SDD A;  5E9D A;  2BNR A;  1YN7 A;  3SKM A;  4G43 A;  4Z77 A;  3WUW A;  3GIV A;  1S7V A;  1SYV A;  2AK4 A;  3KPM A;  5JHD A;  5SWQ A;  3VFP A;  1XZ0 A;  3CH1 A;  3RWI A;  1VAC A;  3FQT A;  3L9R A;  4HX1 A;  5E8N A;  3WL9 A;  2GAZ A;  3RWF A;  3KYO A;  1WBX A;  3ILP A;  4V3D B;  2GTZ A;  1BQH A;  1T1Z A;  1OGT A;  3L3D A;  3TFK A;  5AD0 A;  3WS6 A;  1A1O A;  4D0C A;  1RK1 A;  2CKB H;  4Y16 A;  5D7I A;  5MER A;  1I1A A;  1YPZ A;  5J1A A;  4G9D A;  4U1M A;  5IB1 A;  1AO7 A;  1R3H A;  2AXF A;  4N0F A;  4PRD A;  4LCC C;  3OXR A;  1DUY A;  5IEK A;  1S7Q A;  1T7Y A;  3RTQ A;  3P4M A;  4NO0 A;  1HHH A;  3C9N A;  3WLB A;  2NYK A;  4D0D A;  5ISZ A;  1HYR C;  4HUV A;  3H9H A;  4L3E A;  1DUZ A;  1K8D A;  3FQW A;  4QRP A;  1HSA A;  3KPP A;  3QUZ A;  1JGD A;  4N0C A;  4NO2 A;  1T21 A;  2O5N A;  1QR1 A;  4PJ8 A;  3VWK A;  3BH8 A;  5IB3 A;  3HUJ A;  1LK2 A;  3CVH A;  3I0T A;  3ARB A;  4S0U C;  2YPK A;  5D2L A;  2BVO A;  5HHQ A;  5MEP A;  3LKO A;  4E5X A;  1JFM A;  4X6E A;  1AGF A;  1S7X A;  3GSV A;  1N3N A;  5HYJ A;  5E8O A;  5MEQ A;  4U6Y A;  1GZP A;  4L8D A;  1KJM A;  4MXQ A;  1RK0 A;  5C0A A;  3PWL A;  1I1Y A;  4K7F A;  4MJ5 A;  1A9E A;  4CVZ A;  5C0G A;  3I6K A;  3VXP A;  5F7D A;  1LEK A;  3BZF A;  2CLR A;  1CG9 A;  3E6F A;  3ES6 A;  3QQ3 A;  1JPF A;  1EEZ A;  3B3I A;  3RGV C;  4PJF A;  3BEV A;  4WWK C;  3LV3 A;  4NO5 A; 
#chains in the Genus database with same CATH homology
 4CVX A;  3L3G A;  1S8D A;  3E2H A;  1ZAG A;  3CCH A;  2FWO A;  1W0W A;  2JCC A;  2GT9 A;  1K5N A;  3TBV A;  4F7E A;  1JGE A;  2BVQ A;  3MRO A;  4PJD A;  4WJ5 A;  2XPG A;  3GMP A;  1X7Q A;  1QVO A;  1IM9 A;  2HJK A;  3MRK A;  3W0W A;  1P7Q A;  3ROL A;  2MHA A;  3KYN A;  1JHT A;  3CDG A;  4JQV A;  3UTQ A;  1BII A;  1SYS A;  1XH3 A;  3P4N A;  4HS3 A;  4U1J A;  1JPG A;  2D31 A;  3BWA A;  4GKS A;  3ERY A;  3DX7 A;  4JFE A;  3SDX A;  2X4Q A;  3BO8 A;  3MRR A;  3VFN A;  1XR8 A;  3WS3 A;  2BST A;  1ZT4 A;  3GSQ A;  5D2N A;  2UWE A;  4X6F A;  2ZSV A;  5MEN A;  1T7Z A;  4ZUS A;  4HKJ A;  3CC5 A;  3TO4 A;  3G08 A;  4MNQ A;  5HGH A;  3GSR A;  5EFI A;  3I6L D;  4HUX A;  1GZQ A;  4FTV A;  4MQ7 A;  2X4O A;  4U1I A;  3VXS A;  3HAE A;  3P9L A;  5IM7 A;  2NX5 A;  4F7P A;  1YN6 A;  5C0I A;  3E3Q A;  4PJI A;  4I48 A;  4EN3 C;  3LKR A;  3D39 A;  1LD9 A;  1Q94 A;  4L4T A;  5DDH A;  5E8P A;  3RWH A;  3UTT A;  3D18 A;  3TID A;  1FZJ A;  1A9B A;  5HHP A;  3TBW A;  2GUO A;  4QRR A;  1KJ3 H;  3IT8 D;  5DEF A;  3DMM A;  1T1Y A;  2ESV A;  4GUP A;  5H94 A;  4Y4F A;  3VFR A;  3ECB A;  5B38 A;  1RJZ A;  1XR9 A;  3VFV A;  1L8J A;  2ZSW A;  2CLV A;  3MRG A;  4CW1 A;  1KTL A;  4F7C A;  1W72 A;  1PQZ A;  4ZFZ A;  3X13 A;  1HOC A;  3CPL A;  3MGT A;  4N8V A;  5ACZ A;  1NAN H;  2X70 A;  5J6G A;  2X4U A;  3O4L A;  3FT3 A;  4JFF A;  4Y2D A;  4MJ6 A;  2AV1 A;  2E7L E;  3TJH A;  1I1F A;  5C0D A;  1JUF A;  3QUY A;  3GSW A;  4ZUT A;  3GJF A;  4HV8 A;  2BSS A;  4XXC A;  3ARG A;  4PJG A;  3VFW A;  5EUO A;  3KXF A;  5INC A;  2A83 A;  3X14 A;  4ELM A;  1A1M A;  4F7T A;  1BZ9 A;  2FO4 A;  3TBT A;  4PRB A;  2V2W A;  3L3J A;  3W39 A;  3MRJ A;  1G7Q A;  4PJX A;  1NEZ A;  3VWJ A;  2PYE A;  1Z5L A;  4N5E A;  3KPR A;  2CIK A;  1P1Z A;  3OXS A;  4U1N A;  1FZO A;  3TBY A;  3P77 A;  4GKN A;  5GSV A;  3QDM A;  2X4N A;  5IND A;  1S9Y A;  4F7M A;  1FG2 A;  3P9M A;  1ZS8 A;  4UQ3 A;  3MYJ A;  5D7L A;  4NQE A;  1CD1 A;  1A1N A;  2VAA A;  5F1I A;  1E28 A;  4PJE A;  1MHC A;  4PJB A;  3LKQ A;  3BP4 A;  3BW9 A;  5EO1 A;  1QRN A;  4JFP A;  4O2F A;  4Y4H A;  3ARE A;  1MI5 A;  5L2K A;  1M05 A;  1T0M A;  2VAB A;  3B6S A;  3FQU A;  1HHI A;  3MRD A;  4PG2 A;  4L9L C;  3ARF A;  3MRL A;  4QRS A;  3PWJ A;  2YPL A;  3MRB A;  1I7U A;  3O3B A;  3PQY A;  4U1S A;  1TVB A;  2HN7 A;  3PWP A;  3MA7 A;  3BP7 A;  3CZF A;  4PJH A;  2AV7 A;  4QRU A;  5F1N A;  4PJ5 A;  3VFU A;  1LDP H;  2DYP A;  2HLA A;  3KPS A;  2VLL A;  4JRY A;  3O3A A;  4WU5 A;  4IHO A;  3RWC A;  1QO3 A;  4U1H A;  5HGA A;  4JFD A;  3D2U A;  1KPU A;  4G8I A;  4NQX A;  2GIT A;  3UBX A;  4FFE X;  5B39 A;  3TO2 A;  4HUW A;  4ZUU A;  5D5M A;  4JFO A;  1B0R A;  4U1K A;  1EFX A;  1A6Z A;  5HHM A;  5C08 A;  3MRQ A;  3QEQ A;  5C0B A;  3QUL A;  1KPV A;  3FRU A;  5C07 A;  3QDJ A;  2HJL A;  3KPO A;  2VLR A;  2BNQ A;  5DEG A;  3JTS A;  3KWW A;  2WY3 A;  1ZT1 A;  5D7J C;  4LNR A;  2F53 A;  1G7P A;  5E6I C;  2RFX A;  3RWJ A;  1W0V A;  3T8X A;  4PR5 A;  3BUY A;  4L29 A;  1HHG A;  3ROO A;  3MRP A;  3O3D A;  2ZOK A;  3V5H A;  2FZ3 A;  2FYY A;  3FOL A;  4K71 B;  5HHO A;  4IRJ A;  1VAD A;  3DTX A;  4PV9 A;  3MRI A;  2X4S A;  1JE6 A;  4N0U A;  3RUG A;  3TVM A;  3GMO A;  4V3E B;  1TVH A;  1ZHN A;  5IB2 A;  4PJ9 A;  3ARD A;  2CLZ A;  3MV8 A;  4QRQ A;  3FFC A;  3VCL A;  3VXM A;  5HGD A;  3H7B A;  3PWN A;  3T1F A;  1AGB A;  3MR9 A;  3L3I A;  4NHU E;  3SCM A;  3MRE A;  1FZM A;  3MGO A;  3U0P A;  2VLJ A;  3TBS A;  5IB4 A;  4NT6 A;  3VFS A;  1QSE A;  1KJV A;  2V2X A;  3L3H A;  3SKO A;  5C09 A;  4IRS A;  1T80 A;  1QLF A;  2X4P A;  4HWZ A;  2J8U A;  4ONO A;  3UTS A;  4NO3 A;  5IVX A;  3GSO A;  5EOT A;  1YDP A;  3DBX A;  3V5K A;  5MEO A;  3KLA A;  4PGE A;  4MS8 A;  3VRI A;  3FT2 A;  5C0E A;  1E27 A;  3HE7 A;  3M17 A;  4PGD A;  2FIK A;  1I4F A;  3FQN A;  5BJT A;  1KPR A;  3RL2 A;  3HLA A;  5BS0 A;  3RZC A;  1FZK A;  5FKP A;  4L8B A;  1T7V A;  5FA3 A;  2NW3 A;  1IM3 A;  4PG9 A;  3X11 A;  3GMR A;  3GMQ A;  3HE6 A;  2GTW A;  1KJ2 H;  4MNG A;  2H6P A;  3DX6 A;  1S9W A;  3ILQ C;  4I4W A;  4MX7 A;  4EUP A;  5IEH A;  2YEZ A;  1FO0 H;  3GMM A;  3HPJ A;  3HCV A;  1ED3 A;  2OI9 A;  4L8S C;  4X6C A;  3QZW A;  3AM8 A;  1KBG H;  1I7T A;  1ZSD A;  2C7U A;  2OL3 H;  1FFO A;  3MV7 A;  4PJC A;  4G8G A;  3JVG A;  3KPL A;  3GSX A;  3PWU A;  1JF1 A;  1CE6 A;  4PRI A;  3RWG A;  1T7W A;  1HHK A;  3LN5 A;  3P73 A;  5F9J A;  1FFN A;  1WBZ A;  4IIQ C;  1DE4 A;  1HHJ A;  4PGC A;  1T20 A;  2CII A;  3VXU A;  1B0G A;  3VH8 A;  3FQR A;  3GML A;  1P4L A;  4LHU A;  2X4T A;  1S7W A;  1UXW A;  1ZT7 A;  4PRE A;  1BD2 A;  3H9S A;  2PO6 A;  3FON A;  3LKN A;  3TF7 A;  3BHB A;  4JRX A;  3BH9 A;  1QQD A;  3QQ4 A;  3BEW A;  3FTG A;  3MRH A;  1NAM H;  1UXS A;  3TZV C;  3M1B A;  1OF2 A;  3D3V A;  3D25 A;  4NNY A;  4WW2 C;  1G6R H;  4JFQ A;  4G9F A;  3VFO A;  4ZAK A;  1B3J A;  4PRN A;  1ONQ A;  3SDA A;  3TIE A;  1S7T A;  3BXN A;  5IB5 A;  4WDI A;  4PJ7 A;  3BVN A;  3E6H A;  3IXA A;  5GSR A;  3VJ6 A;  2XFX A;  4PDC E;  3TPU E;  1T1X A;  3AU1 A;  3FQX A;  1QSF A;  3P4O A;  4MJI A;  1FFP A;  1S7S A;  4NNX A;  5EU6 A;  1KCG C;  1EXU A;  3PWV A;  1LQV A;  1UQS A;  3S6C A;  3SPV A;  5BRZ A;  4L8C A;  1ZVS A;  3VXR A;  1T1W A;  3OV6 A;  4ZUW A;  4JQX A;  2BCK A;  1QEW A;  4L3C A;  1C16 A;  1N2R A;  3MRN A;  2P5W A;  3FT4 A;  3QFD A;  2F74 A;  5EU5 A;  1I7R A;  1N59 A;  4HUU A;  4O2C A;  3UPR A;  4EI5 A;  3QI9 A;  5C0J A;  2AKR A;  3RWD A;  2P5E A;  3OX8 A;  3GSN H;  3O3E A;  1OGA A;  4APQ A;  1MWA H;  3MRM A;  3LN4 A;  4Z76 A;  3O9W A;  4PGB A;  5ENW A;  5D9S A;  1U58 A;  3NFN A;  4QRT A;  3JTC A;  3QUK A;  2F54 A;  1INQ A;  3MRF A;  4MVB A;  3RL1 A;  1AGD A;  1VGK A;  3VRJ A;  5FA4 A;  5J6H A;  4PRH A;  5EU4 A;  3BGM A;  5SWS A;  5EU3 A;  1AKJ A;  3X12 A;  5C0F A;  1LP9 A;  3DXA A;  1OSZ A;  1S7U A;  3FOM A;  4PJA A;  1S7R A;  5SWZ A;  1ZHK A;  3KPN A;  5HHN A;  2BSR A;  2GJ6 A;  3VXN A;  1LEG A;  1T22 A;  4NQC A;  3SDC A;  1AGC A;  1T7X A;  4NQV A;  2VLK A;  5E00 A;  3GMN A;  2X4R A;  3LKS A;  3QDG A;  4PRA A;  1MHE A;  4D0B A;  1RJY A;  2AXG A;  1EEY A;  4O2E A;  3MV9 A;  5C0C A;  5L2J A;  2BVP A;  4LCW A;  1T0N A;  4NQD A;  3V5D A;  3PAB A;  2H26 A;  4PP8 C;  3C8K A;  3I6G A;  3O8X A;  4U6X A;  4Z78 A;  5HGB A;  4LCY A;  4X6D A;  3JTT A;  3MRC A;  1S9X A;  1TMC A;  1N5A A;  3BZE A;  2ZOL A;  1ZHB A;  3VFM A;  4G42 A;  4PV8 A;  5C9J A;  1AGE A;  1WBY A;  1DDH A;  3QFJ A;  4NSK A;  5IRO A;  2VE6 A;  3TN0 A;  5FDW A;  1HSB A;  4G59 A;  3SJV A;  4PRP A;  3HG1 A;  4ZUV A;  4L4V A;  4U1L A;  3REW A;  5BXF A;  3VXO A;  1M6O A;  4WU7 A;  4WUU A;  3VFT A;  3L3K A;  3DX8 A;  5EO0 A;  4QOK A;  4WO4 A;  3QUX A;  3TA3 A;  4UQ2 A;  3KPQ A;  4Y4K A;  3RWE A;  1ZHL A;  4E0R A;  3GSU A;  2Q7Y A;  3LKP A;  3SDD A;  5E9D A;  2BNR A;  1YN7 A;  3SKM A;  4G43 A;  4Z77 A;  3WUW A;  3GIV A;  1S7V A;  1SYV A;  2AK4 A;  3KPM A;  5JHD A;  5SWQ A;  3VFP A;  1XZ0 A;  3CH1 A;  3RWI A;  1VAC A;  3FQT A;  3L9R A;  4HX1 A;  5E8N A;  3WL9 A;  2GAZ A;  3RWF A;  3KYO A;  1WBX A;  3ILP A;  4V3D B;  2GTZ A;  1BQH A;  1T1Z A;  1OGT A;  3L3D A;  3TFK A;  5AD0 A;  3WS6 A;  1A1O A;  4D0C A;  1RK1 A;  2CKB H;  4Y16 A;  5D7I A;  5MER A;  1I1A A;  1YPZ A;  5J1A A;  4G9D A;  4U1M A;  5IB1 A;  1AO7 A;  1R3H A;  2AXF A;  4N0F A;  4PRD A;  4LCC C;  3OXR A;  1DUY A;  5IEK A;  1S7Q A;  1T7Y A;  3RTQ A;  3P4M A;  4NO0 A;  1HHH A;  3C9N A;  3WLB A;  4D0D A;  5ISZ A;  1HYR C;  4HUV A;  3H9H A;  4L3E A;  1DUZ A;  1K8D A;  3FQW A;  4QRP A;  1HSA A;  3KPP A;  3QUZ A;  1JGD A;  4N0C A;  4NO2 A;  1T21 A;  1QR1 A;  4PJ8 A;  3VWK A;  3BH8 A;  5IB3 A;  3HUJ A;  1LK2 A;  3CVH A;  3ARB A;  4S0U C;  2YPK A;  5D2L A;  2BVO A;  5HHQ A;  5MEP A;  3LKO A;  4E5X A;  1JFM A;  4X6E A;  1AGF A;  1S7X A;  3GSV A;  1N3N A;  5HYJ A;  5E8O A;  5MEQ A;  4U6Y A;  1GZP A;  4L8D A;  1KJM A;  4MXQ A;  1RK0 A;  5C0A A;  3PWL A;  1I1Y A;  4K7F A;  4MJ5 A;  1A9E A;  4CVZ A;  5C0G A;  3I6K A;  3VXP A;  5F7D A;  1LEK A;  3BZF A;  2CLR A;  1CG9 A;  3E6F A;  3ES6 A;  3QQ3 A;  1JPF A;  1EEZ A;  3B3I A;  3RGV C;  4PJF A;  3BEV A;  4WWK C;  3LV3 A;  4NO5 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...