3TFKA

42f3-p4b10/h2-ld
Total Genus 52
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
52
sequence length
174
structure length
174
Chain Sequence
PHSMRYYETATSRRGLGEPRYTSVGYVDDKEFVRFDSDAENPRYEPQVPWMEQEGPEYWERITQVAKGQEQWFRVNLRTLLGYYNQSAGGTHTLQRMYGCDVGSDGRLLRGYEQFAYDGCDYIALNEDLRTWTAADMAAQITRRKWEQAGAAEYYRAYLEGECVEWLHRYLKNG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title T cell receptor signaling is limited by docking geometry to peptide-major histocompatibility complex.
pubmed doi rcsb
source organism Mus musculus
molecule tags Immune system
molecule keywords H2-Ld SBM2
total genus 52
structure length 174
sequence length 174
ec nomenclature
pdb deposition date 2011-08-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00129 MHC_I Class I Histocompatibility antigen, domains alpha 1 and 2
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.500.10 Alpha Beta 2-Layer Sandwich Murine Class I Major Histocompatibility Complex, H2-DB; Chain A, domain 1 MHC class I-like antigen recognition-like 3tfkA00
3TBYA 5IB5A 1JPGA 1KPVA 3QQ3A 3L3HA 5C0IA 1LEGA 3CC5A 1T7YA 3BWAA 4U6YA 5IB2A 3HE6A 5HHPA 4PREA 4G8IA 5ENWA 3FONA 1QVOA 4PJDA 2F54A 3BW9A 1T0NA 1JGDA 1N5AA 1FZOA 1M6OA 4PRHA 5MEQA 3X12A 3LKPA 3FQTA 4U1NA 3FQRA 1ZT1A 2NX5A 3I6KA 1QSEA 3PWPA 3VJ6A 2PYEA 3FT4A 3RWEA 2RFXA 2D31A 3VFPA 3UTQA 3D18A 1HYRC 1VADA 3AU1A 4D0BA 1DDHA 5ISZA 1HSAA 5D9SA 1HHHA 1HHKA 2XFXA 3ARDA 1KPRA 3V5KA 3KWWA 4PRAA 4PRPA 1KJVA 4U1KA 1I4FA 3NFNA 4CVXA 1YDPA 3OV6A 1S9XA 1ZHKA 2ZOKA 4NSKA 4V3DB 1CE6A 3PQYA 3BZEA 4PV9A 3TO4A 2X4UA 3VRIA 2BVQA 1KJMA 3BP7A 1HHJA 1W0WA 4NQXA 2PO6A 4PJAA 3LKQA 4PGDA 3MRBA 5DDHA 5EO1A 3VFSA 4MNGA 3PABA 3D3VA 4NHUE 3RTQA 1ZS8A 3ILQC 1T7VA 1YN7A 4JRXA 3MRJA 4GUPA 4PJ8A 3HPJA 2F74A 3I6LD 5C09A 4HX1A 4PR5A 5BS0A 5IEKA 4JRYA 4Y2DA 1LDPH 5EFIA 2VE6A 4Z76A 2F53A 1JHTA 3VFMA 1ZHBA 1WBZA 3SPVA 1XR8A 2FIKA 3GSRA 4JQVA 2HJLA 5HHOA 4EI5A 4L8CA 4L29A 2GJ6A 4LCWA 2AXGA 3VFOA 3W39A 4Z77A 4U1LA 3GSNH 3OXSA 1TVHA 5IB4A 5JHDA 1FO0H 3L9RA 3KXFA 4PGCA 1A9EA 4L3EA 1EXUA 1T22A 3RL1A 4ELMA 1RJYA 1JUFA 1S7VA 3MREA 4U6XA 3GSOA 3I6GA 5F7DA 2GT9A 4K7FA 3UPRA 3SKMA 4JFOA 1N59A 2HLAA 1KTLA 3KLAA 1QR1A 4MXQA 4V3EB 5SWZA 4WU5A 4HUUA 5C07A 3RGVC 1B0RA 3KPPA 3GMNA 1ZSDA 4UQ3A 4WJ5A 3RWHA 5EU3A 4L9LC 2DYPA 2JCCA 5SWQA 5D7LA 2X4RA 3QULA 4Y4HA 3X13A 3M1BA 5HYJA 3LV3A 3KPNA 3TBVA 3TA3A 5C0BA 2FO4A 2X4QA 1T7ZA 2ZSWA 4D0CA 1MHCA 3L3GA 4XXCA 3DMMA 1I1YA 1QEWA 3C8KA 1G7QA 1EEZA 3B6SA 4HUVA 5EU5A 3LKRA 4L4TA 4F7MA 5D7JC 4MVBA 5E8OA 4L8SC 3RWFA 1FFPA 4MS8A 3ROLA 1JGEA 3VFWA 1LK2A 5H94A 3VXPA 1S7XA 4PRNA 3REWA 1R3HA 3E3QA 1TMCA 1OF2A 4QRTA 5E9DA 4JFPA 3UTSA 3MRHA 1M05A 3P9MA 1I7UA 5EU6A 5IEHA 4QRUA 4GKNA 1A1OA 1MWAH 2X4NA 4PG2A 3BZFA 3MRLA 2NW3A 4E5XA 4ZUWA 1S7UA 3TFKA 3TZVC 3GMOA 4NQVA 3AREA 3QDJA 2GAZA 4L8DA 1OSZA 5IM7A 1ED3A 3KPSA 1S7QA 1AGBA 1QQDA 4L4VA 3TJHA 2OL3H 4GKSA 4I4WA 3SDCA 5C0FA 2BSRA 1UXSA 4ONOA 1RK0A 1WBXA 3P9LA 1BD2A 3TO2A 2CLZA 5J6GA 4HWZA 2YPLA 5E6IC 3KPRA 1I1AA 5EU4A 5F1NA 3MRNA 5C0AA 4QRPA 5DEGA 4HUWA 3VWJA 3IT8D 3P73A 5L2JA 3E6FA 3MGTA 1B0GA 4U1HA 1FZKA 2VLJA 4PG9A 3TF7A 1QO3A 2P5EA 3DBXA 1XZ0A 4U1JA 3HCVA 4U1MA 1CG9A 5MEPA 2ESVA 2FZ3A 3FOMA 5HHNA 4PJXA 2HJKA 5B38A 3JTSA 3E6HA 3RZCA 5HGAA 3VFRA 5E00A 3B3IA 1KJ2H 1OGAA 4WW2C 3CVHA 1U58A 1ZT7A 3GSWA 3TIDA 1S7WA 2CLVA 5BXFA 1EEYA 4ZUVA 4Y4KA 3C9NA 1N3NA 2GTWA 2VLLA 4N8VA 3ILPA 2BCKA 1NEZA 1GZQA 2MHAA 3P4MA 1OGTA 3G08A 3DTXA 5C0JA 3VXMA 4U1IA 4N0FA 4E0RA 5D2NA 4LCCC 1A1MA 2H6PA 5MENA 1GZPA 3LKSA 5C0GA 4X6CA 1K5NA 1LQVA 3KPLA 3MRRA 4NO2A 5D5MA 3D25A 2VLRA 1L8JA 3BGMA 2BNRA 1W0VA 4EN3C 2GITA 3HG1A 1P7QA 1T1WA 4QRQA 3O9WA 4PDCE 5DEFA 1FFNA 3E2HA 3RWIA 1S9YA 1T0MA 1T20A 4LCYA 4PJIA 3RWGA 4O2CA 3KYOA 3BHBA 1T1ZA 4G9DA 1RK1A 3MA7A 5EO0A 1I7RA 4IRJA 3VXOA 3X11A 4JFDA 4G43A 3UBXA 4N5EA 3SCMA 3DX6A 1S8DA 4O2EA 4PGBA 3VXRA 4F7EA 4S0UC 5ACZA 1T1XA 3TBTA 3WLBA 4NO0A 4Z78A 1K8DA 1AGDA 1JPFA 3FFCA 3GJFA 3MR9A 5HGHA 2CLRA 4QRRA 1WBYA 4WU7A 1MI5A 5FKPA 4PJ5A 1JE6A 3PWLA 4NQEA 4G8GA 3RL2A 4FTVA 5C0DA 2HN7A 2YEZA 1DUYA 1ZT4A 1DE4A 3PWNA 2CIKA 4WDIA 1HHIA 1S7RA 3PWUA 4PJ9A 3FOLA 3ARBA 1LEKA 3QDGA 2UWEA 2VLKA 5J1AA 1A1NA 3OX8A 3GMRA 4ZUSA 3WUWA 1AGEA 4I48A 1KPUA 3O3EA 3UTTA 1JF1A 5C0CA 3FQNA 1HHGA 5F9JA 3ROOA 1VACA 3TBSA 3ARGA 3HE7A 1RJZA 3H7BA 3QFDA 3MYJA 3GIVA 3JVGA 1I1FA 3KPOA 2AV1A 2X4OA 4MJ5A 4PJCA 2J8UA 3MRIA 3GMLA 5BJTA 1ZHNA 3L3JA 1NAMH 3L3DA 2X4TA 1HOCA 5IVXA 3MRDA 5HGDA 5INDA 3O3DA 1HSBA 4WO4A 3VXNA 1A9BA 4MQ7A 3WS6A 3RWJA 1P1ZA 5FA3A 1G6RH 2BSSA 4U1SA 5EUOA 4NT6A 1T80A 4O2FA 2E7LE 3BUYA 3MGOA 3MV7A 4PJEA 4IRSA 3U0PA 5C08A 3TN0A 3VWKA 2XPGA 3BXNA 1MHEA 1XH3A 3RWCA 3HAEA 1AKJA 4NO5A 3V5HA 4PJHA 2CIIA 4IIQC 3L3IA 3CPLA 3H9SA 5FA4A 3JTCA 2WY3A 4UQ2A 3BP4A 1E28A 3DXAA 3P4NA 1AGCA 3BVNA 5GSRA 3KPMA 4PJFA 4X6EA 2A83A 3ARFA 1FG2A 1QRNA 3V5DA 1IM3A 1P4LA 4F7PA 5GSVA 3GMQA 3H9HA 4NQDA 3FQXA 3D39A 3PWVA 1Z5LA 5HGBA 1ZVSA 1IM9A 4NNXA 5HHMA 3CZFA 4G42A 4MJIA 2OI9A 3O3BA 1LP9A 3SDDA 1UXWA 3LN4A 3QQ4A 3FQUA 4CW1A 3LN5A 4PRIA 1AO7A 3HUJA 3MRPA 4IHOA 1NANH 1JFMA 4X6DA 3VRJA 5D7IA 4G9FA 4JFEA 2YPKA 4N0UA 3T1FA 5F1IA 4QOKA 1C16A 3TIEA 1FZMA 3GMMA 3LKNA 1ONQA 5E8NA 1B3JA 1BQHA 3GSUA 4WWKC 1E27A 1QSFA 2FYYA 1EFXA 3MRGA 2X4PA 3GSVA 5EOTA 4G59A 4ZAKA 1YN6A 3FTGA 3ERYA 3LKOA 3RUGA 1UQSA 4NQCA 3IXAA 4MNQA 3BEWA 3QZWA 3BH8A 5IB3A 3D2UA 3WL9A 3T8XA 3VFUA 1INQA 3TPUE 4ZFZA 1W72A 3DX7A 1YPZA 3KPQA 1S7TA 3W0WA 5FDWA 5INCA 1S9WA 1CD1A 1BIIA 4F7TA 3BEVA 3MROA 4MJ6A 2AKRA 2AV7A 3O3AA 4N0CA 1G7PA 4PJBA 3SKOA 2VABA 3VXSA 3GSXA 4JFQA 3OXRA 2CKBH 1SYSA 3MV9A 3VFTA 2ZOLA 2AK4A 3GMPA 2V2WA 3S6CA 3VXUA 4ZUUA 5MERA 4L3CA 3MRFA 4HS3A 2X4SA 4Y16A 1AGFA 3CH1A 4PJ7A 4FFEX 5B39A 5C0EA 2GUOA 3WS3A 1TVBA 1T1YA 3BO8A 3MRCA 5IB1A 4PRDA 5D2LA 4EUPA 1FFOA 4JFFA 3M17A 1I7TA 3VFNA 1LD9A 3KYNA 3VCLA 4D0DA 5MEOA 1VGKA 1X7QA 3GSQA 3BH9A 3O8XA 3P77A 1DUZA 1SYVA 4PJGA 5C9JA 5J6HA 3O4LA 4MX7A 4APQA 5E8PA 4X6FA 1KJ3H 3MRQA 4NNYA 2ZSVA 1FZJA 3SJVA 2BVOA 2V2XA 1Q94A 4HV8A 4PP8C 5L2KA 1N2RA 3ES6A 1T21A 3MRMA 3P4OA 3QUZA 4Y4FA 4CVZA 4F7CA 3DX8A 3CCHA 5AD0A 2VAAA 3MRKA 4JQXA 2FWOA 1T7XA 3QI9A 3QUKA 2BVPA 3QDMA 3TBWA 2AXFA 5SWSA 3AM8A 4ZUTA 4PRBA 3PWJA 1T7WA 4WUUA 3QUYA 2H26A 3X14A 2BSTA 3FRUA 5BRZA 5IROA 1KBGH 3SDAA 1ZHLA 2GTZA 4L8BA 5HHQA 4QRSA 3QUXA 3TVMA 3MV8A 3QFJA 4PGEA 3FT2A 4LHUA 4NO3A 1S7SA 4HKJA 1QLFA 3ECBA 4LNRA 2BNQA 1ZAGA 3CDGA 2C7UA 3FQWA 3VFVA 3VH8A 2P5WA 4HUXA 4PV8A 4K71B 1A6ZA 1KCGC 3SDXA 1PQZA 3RWDA 3QEQA 2X70A 3HLAA 1BZ9A 3JTTA 3FT3A 2Q7YA 3L3KA 1XR9A
chains in the Genus database with same CATH superfamily
3TBYA 5IB5A 1JPGA 1KPVA 3QQ3A 3L3HA 5C0IA 1LEGA 3CC5A 1T7YA 3BWAA 4U6YA 5IB2A 3HE6A 5HHPA 4PREA 4G8IA 5ENWA 3FONA 1QVOA 4PJDA 2F54A 3BW9A 1T0NA 1JGDA 1N5AA 1FZOA 1M6OA 4PRHA 5MEQA 3X12A 3LKPA 3FQTA 4BKWA 4U1NA 3FQRA 1ZT1A 2NX5A 3I6KA 1QSEA 3PWPA 3VJ6A 2PYEA 3FT4A 3RWEA 2RFXA 2D31A 3VFPA 3UTQA 3D18A 1HYRC 1VADA 3AU1A 4D0BA 1DDHA 5ISZA 1HSAA 5D9SA 1HHHA 1HHKA 2XFXA 3ARDA 1KPRA 3V5KA 3KWWA 4PRAA 4PRPA 1KJVA 4U1KA 1I4FA 3NFNA 4CVXA 1YDPA 3OV6A 1S9XA 1ZHKA 2ZOKA 4NSKA 4V3DB 1CE6A 3PQYA 3BZEA 4PV9A 3TO4A 2X4UA 3VRIA 2BVQA 1KJMA 3BP7A 1HHJA 1W0WA 4NQXA 2PO6A 4PJAA 3LKQA 4PGDA 3MRBA 5DDHA 5EO1A 3VFSA 4MNGA 3PABA 3D3VA 4NHUE 3RTQA 1ZS8A 3ILQC 1T7VA 1YN7A 4JRXA 3MRJA 4GUPA 4PJ8A 3HPJA 2F74A 3I6LD 5C09A 4HX1A 4PR5A 5BS0A 5IEKA 4JRYA 4Y2DA 1LDPH 5EFIA 2VE6A 4Z76A 2F53A 1JHTA 3VFMA 1ZHBA 1WBZA 3SPVA 1XR8A 2FIKA 3GSRA 4JQVA 2HJLA 5HHOA 4EI5A 4L8CA 4L29A 2GJ6A 4LCWA 2AXGA 3VFOA 3W39A 4Z77A 4U1LA 3GSNH 3OXSA 1TVHA 5IB4A 5JHDA 1FO0H 3L9RA 3KXFA 4PGCA 1A9EA 4L3EA 1EXUA 1T22A 3RL1A 4ELMA 1RJYA 1JUFA 1S7VA 3MREA 4U6XA 3GSOA 3I6GA 5F7DA 2GT9A 4K7FA 3UPRA 3SKMA 4JFOA 1N59A 2HLAA 1KTLA 3KLAA 1QR1A 4JO8A 4MXQA 4V3EB 5SWZA 4WU5A 4HUUA 5C07A 3RGVC 1B0RA 3KPPA 3GMNA 1ZSDA 4UQ3A 4WJ5A 3RWHA 5EU3A 4L9LC 2DYPA 2JCCA 5SWQA 5D7LA 2X4RA 3QULA 4Y4HA 3X13A 3M1BA 5HYJA 3LV3A 2IA1A 3KPNA 3TBVA 3TA3A 5C0BA 2FO4A 2X4QA 1T7ZA 2ZSWA 4D0CA 1MHCA 3L3GA 4XXCA 3DMMA 1I1YA 1QEWA 3C8KA 1G7QA 1EEZA 3B6SA 4HUVA 5EU5A 3LKRA 4L4TA 4F7MA 5D7JC 4MVBA 5E8OA 4L8SC 3RWFA 1FFPA 4MS8A 3ROLA 1JGEA 3VFWA 1LK2A 5H94A 3VXPA 1S7XA 4PRNA 3REWA 1R3HA 3E3QA 1TMCA 1OF2A 4QRTA 5E9DA 4JFPA 3UTSA 3MRHA 1M05A 3P9MA 1I7UA 5EU6A 5IEHA 4QRUA 4GKNA 1A1OA 1MWAH 2X4NA 4PG2A 3BZFA 3MRLA 2NW3A 4E5XA 4ZUWA 1S7UA 3TFKA 3TZVC 3GMOA 4NQVA 3AREA 3QDJA 2GAZA 4L8DA 1OSZA 5IM7A 1ED3A 3KPSA 1S7QA 1AGBA 1QQDA 4L4VA 3TJHA 2OL3H 4GKSA 4I4WA 3SDCA 5C0FA 2BSRA 1UXSA 4ONOA 1RK0A 1WBXA 3P9LA 1BD2A 3TO2A 2CLZA 5J6GA 4HWZA 2YPLA 5E6IC 3KPRA 1I1AA 5EU4A 5F1NA 3MRNA 5C0AA 4QRPA 5DEGA 4HUWA 3VWJA 3IT8D 3P73A 5L2JA 3E6FA 3MGTA 1B0GA 4U1HA 1FZKA 2VLJA 4PG9A 3TF7A 1QO3A 2P5EA 3DBXA 1XZ0A 4U1JA 3HCVA 4U1MA 1CG9A 5MEPA 2ESVA 2FZ3A 3FOMA 5HHNA 4PJXA 2HJKA 5B38A 3I0TA 3JTSA 3E6HA 3RZCA 5HGAA 3VFRA 5E00A 3B3IA 1KJ2H 1OGAA 4WW2C 3CVHA 1U58A 1ZT7A 3GSWA 3TIDA 1S7WA 2CLVA 5BXFA 1EEYA 4ZUVA 4Y4KA 3C9NA 1N3NA 2O5NA 2GTWA 2VLLA 4N8VA 3ILPA 2BCKA 1NEZA 1GZQA 2MHAA 3P4MA 1OGTA 3G08A 3DTXA 5C0JA 3VXMA 4U1IA 4N0FA 4E0RA 5D2NA 4LCCC 2NYKA 1A1MA 2H6PA 5MENA 1GZPA 3LKSA 5C0GA 4X6CA 1K5NA 1LQVA 3KPLA 3MRRA 4NO2A 5D5MA 3D25A 2VLRA 1L8JA 3BGMA 2BNRA 1W0VA 4EN3C 2GITA 3HG1A 1P7QA 1T1WA 4QRQA 3O9WA 4PDCE 5DEFA 1FFNA 3E2HA 3RWIA 1S9YA 1T0MA 1T20A 4LCYA 4PJIA 3RWGA 4O2CA 3KYOA 3BHBA 1T1ZA 4G9DA 1RK1A 3MA7A 5EO0A 1I7RA 4IRJA 3VXOA 3X11A 4JFDA 4G43A 3UBXA 4N5EA 3SCMA 3DX6A 1S8DA 4O2EA 4PGBA 3VXRA 4F7EA 4S0UC 5ACZA 1T1XA 3TBTA 3WLBA 4NO0A 4Z78A 1K8DA 1AGDA 1JPFA 3FFCA 3GJFA 3MR9A 5HGHA 2CLRA 4QRRA 1WBYA 4WU7A 1MI5A 5FKPA 4PJ5A 1JE6A 3PWLA 4NQEA 4G8GA 3RL2A 4FTVA 5C0DA 2HN7A 2YEZA 1DUYA 1ZT4A 1DE4A 3PWNA 2CIKA 4WDIA 1HHIA 1S7RA 3PWUA 4PJ9A 3FOLA 3ARBA 1LEKA 3QDGA 2UWEA 2VLKA 5J1AA 1A1NA 3OX8A 3GMRA 4ZUSA 3WUWA 1AGEA 4I48A 1KPUA 3O3EA 3UTTA 1JF1A 5C0CA 3FQNA 1HHGA 5F9JA 3ROOA 1VACA 3TBSA 3ARGA 3HE7A 1RJZA 3H7BA 3QFDA 3MYJA 3GIVA 3JVGA 1I1FA 3KPOA 2AV1A 2X4OA 4MJ5A 4G59C 4PJCA 2J8UA 3MRIA 3GMLA 5BJTA 1ZHNA 3L3JA 1NAMH 3L3DA 2X4TA 1HOCA 5IVXA 3MRDA 5HGDA 5INDA 3O3DA 1HSBA 4WO4A 3VXNA 1A9BA 4MQ7A 3WS6A 3RWJA 1P1ZA 5FA3A 1G6RH 2BSSA 4U1SA 5EUOA 4NT6A 1T80A 4O2FA 2E7LE 3BUYA 3MGOA 3MV7A 4PJEA 4IRSA 3U0PA 5C08A 3TN0A 3VWKA 2XPGA 3BXNA 1MHEA 1XH3A 3RWCA 3HAEA 1AKJA 4NO5A 3V5HA 4PJHA 2CIIA 4IIQC 3L3IA 3CPLA 3H9SA 5FA4A 3JTCA 2WY3A 4UQ2A 3BP4A 1E28A 3DXAA 3P4NA 1AGCA 3BVNA 5GSRA 3KPMA 4PJFA 4X6EA 2A83A 3ARFA 1FG2A 1QRNA 3V5DA 1IM3A 1P4LA 4F7PA 5GSVA 3GMQA 3H9HA 4NQDA 3FQXA 3D39A 3PWVA 1Z5LA 5HGBA 1ZVSA 1IM9A 4NNXA 5HHMA 3CZFA 4G42A 4MJIA 2OI9A 3O3BA 1LP9A 3SDDA 1UXWA 3LN4A 3QQ4A 3FQUA 4CW1A 3LN5A 4PRIA 1AO7A 3HUJA 3MRPA 4IHOA 1NANH 1JFMA 4X6DA 3VRJA 5D7IA 4G9FA 4JFEA 2YPKA 4N0UA 3T1FA 5F1IA 4QOKA 1C16A 3TIEA 1FZMA 3GMMA 3LKNA 1ONQA 5E8NA 1B3JA 1BQHA 3GSUA 4WWKC 1E27A 1QSFA 2FYYA 1EFXA 3MRGA 2X4PA 3GSVA 5EOTA 4G59A 4ZAKA 1YN6A 3FTGA 3ERYA 3LKOA 3RUGA 1UQSA 4NQCA 3IXAA 4MNQA 3BEWA 3QZWA 3BH8A 5IB3A 3D2UA 3WL9A 3T8XA 3VFUA 1INQA 3TPUE 4ZFZA 1W72A 3DX7A 1YPZA 3KPQA 1S7TA 3W0WA 5FDWA 5INCA 1S9WA 1CD1A 1BIIA 4F7TA 3BEVA 3MROA 4MJ6A 2AKRA 2AV7A 3O3AA 4N0CA 1G7PA 4PJBA 3SKOA 2VABA 3VXSA 3GSXA 4JFQA 3OXRA 2CKBH 1SYSA 3MV9A 3VFTA 2ZOLA 2AK4A 3GMPA 2V2WA 3S6CA 3VXUA 4ZUUA 5MERA 4L3CA 3MRFA 4HS3A 2X4SA 4Y16A 1AGFA 3CH1A 4PJ7A 4FFEX 5B39A 5C0EA 2GUOA 3WS3A 1TVBA 1T1YA 3BO8A 3MRCA 5IB1A 4PRDA 5D2LA 4EUPA 1FFOA 4JFFA 3M17A 1I7TA 3VFNA 1LD9A 3KYNA 3VCLA 4D0DA 5MEOA 1VGKA 1X7QA 3GSQA 3BH9A 3O8XA 3P77A 1DUZA 1SYVA 4PJGA 5C9JA 5J6HA 3O4LA 4MX7A 4APQA 5E8PA 4X6FA 1KJ3H 3MRQA 4NNYA 2ZSVA 1FZJA 3SJVA 2BVOA 2V2XA 1Q94A 4HV8A 4PP8C 5L2KA 1N2RA 3ES6A 1T21A 3MRMA 3P4OA 3QUZA 4Y4FA 4CVZA 4F7CA 3DX8A 3CCHA 5AD0A 2VAAA 3MRKA 4JQXA 2FWOA 1T7XA 3QI9A 3QUKA 2BVPA 3QDMA 3TBWA 2AXFA 5SWSA 3AM8A 4ZUTA 4PRBA 3PWJA 1T7WA 4WUUA 3QUYA 2H26A 3X14A 2BSTA 3FRUA 5BRZA 5IROA 1KBGH 3SDAA 1ZHLA 2GTZA 4L8BA 5HHQA 4QRSA 3QUXA 3TVMA 3MV8A 3QFJA 4PGEA 3FT2A 4LHUA 4NO3A 1S7SA 4HKJA 1QLFA 3ECBA 4LNRA 2BNQA 1ZAGA 3CDGA 2C7UA 3FQWA 3VFVA 3VH8A 2P5WA 4HUXA 4PV8A 4K71B 1A6ZA 1KCGC 3SDXA 1PQZA 3RWDA 3QEQA 2X70A 3HLAA 1BZ9A 3JTTA 3FT3A 2Q7YA 3L3KA 1XR9A
chains in the Genus database with same CATH topology
3TBYA 5IB5A 1JPGA 1KPVA 3QQ3A 3L3HA 5C0IA 1LEGA 3CC5A 1T7YA 3BWAA 4U6YA 5IB2A 3HE6A 5HHPA 4PREA 4G8IA 5ENWA 3FONA 1QVOA 4PJDA 2F54A 3BW9A 1T0NA 1JGDA 1N5AA 1FZOA 1M6OA 4PRHA 5MEQA 3X12A 3LKPA 3FQTA 4U1NA 3FQRA 1ZT1A 2NX5A 3I6KA 1QSEA 3PWPA 3VJ6A 2PYEA 3FT4A 3RWEA 2RFXA 2D31A 3VFPA 3UTQA 3D18A 1HYRC 1VADA 3AU1A 4D0BA 1DDHA 5ISZA 1HSAA 5D9SA 1HHHA 1HHKA 2XFXA 3ARDA 1KPRA 3V5KA 3KWWA 4PRAA 4PRPA 1KJVA 4U1KA 1I4FA 3NFNA 4CVXA 1YDPA 3OV6A 1S9XA 1ZHKA 2ZOKA 4NSKA 4V3DB 1CE6A 3PQYA 3BZEA 4PV9A 3TO4A 2X4UA 3VRIA 2BVQA 1KJMA 3BP7A 1HHJA 1W0WA 4NQXA 2PO6A 4PJAA 3LKQA 4PGDA 3MRBA 5DDHA 5EO1A 3VFSA 4MNGA 3PABA 3D3VA 4NHUE 3RTQA 1ZS8A 3ILQC 1T7VA 1YN7A 4JRXA 3MRJA 4GUPA 4PJ8A 3HPJA 2F74A 3I6LD 5C09A 4HX1A 4PR5A 5BS0A 5IEKA 4JRYA 4Y2DA 1LDPH 5EFIA 2VE6A 4Z76A 2F53A 1JHTA 3VFMA 1ZHBA 1WBZA 3SPVA 1XR8A 2FIKA 3GSRA 4JQVA 2HJLA 5HHOA 4EI5A 4L8CA 4L29A 2GJ6A 4LCWA 2AXGA 3VFOA 3W39A 4Z77A 4U1LA 3GSNH 3OXSA 1TVHA 5IB4A 5JHDA 1FO0H 3L9RA 3KXFA 4PGCA 1A9EA 4L3EA 1EXUA 1T22A 3RL1A 4ELMA 1RJYA 1JUFA 1S7VA 3MREA 4U6XA 3GSOA 3I6GA 5F7DA 2GT9A 4K7FA 3UPRA 3SKMA 4JFOA 1N59A 2HLAA 1KTLA 3KLAA 1QR1A 4MXQA 4V3EB 5SWZA 4WU5A 4HUUA 5C07A 3RGVC 1B0RA 3KPPA 3GMNA 1ZSDA 4UQ3A 4WJ5A 3RWHA 5EU3A 4L9LC 2DYPA 2JCCA 5SWQA 5D7LA 2X4RA 3QULA 4Y4HA 3X13A 3M1BA 5HYJA 3LV3A 3KPNA 3TBVA 3TA3A 5C0BA 2FO4A 2X4QA 1T7ZA 2ZSWA 4D0CA 1MHCA 3L3GA 4XXCA 3DMMA 1I1YA 1QEWA 3C8KA 1G7QA 1EEZA 3B6SA 4HUVA 5EU5A 3LKRA 4L4TA 4F7MA 5D7JC 4MVBA 5E8OA 4L8SC 3RWFA 1FFPA 4MS8A 3ROLA 1JGEA 3VFWA 1LK2A 5H94A 3VXPA 1S7XA 4PRNA 3REWA 1R3HA 3E3QA 1TMCA 1OF2A 4QRTA 5E9DA 4JFPA 3UTSA 3MRHA 1M05A 3P9MA 1I7UA 5EU6A 5IEHA 4QRUA 4GKNA 1A1OA 1MWAH 2X4NA 4PG2A 3BZFA 3MRLA 2NW3A 4E5XA 4ZUWA 1S7UA 3TFKA 3TZVC 3GMOA 4NQVA 3AREA 3QDJA 2GAZA 4L8DA 1OSZA 5IM7A 1ED3A 3KPSA 1S7QA 1AGBA 1QQDA 4L4VA 3TJHA 2OL3H 4GKSA 4I4WA 3SDCA 5C0FA 2BSRA 1UXSA 4ONOA 1RK0A 1WBXA 3P9LA 1BD2A 3TO2A 2CLZA 5J6GA 4HWZA 2YPLA 5E6IC 3KPRA 1I1AA 5EU4A 5F1NA 3MRNA 5C0AA 4QRPA 5DEGA 4HUWA 3VWJA 3IT8D 3P73A 5L2JA 3E6FA 3MGTA 1B0GA 4U1HA 1FZKA 2VLJA 4PG9A 3TF7A 1QO3A 2P5EA 3DBXA 1XZ0A 4U1JA 3HCVA 4U1MA 1CG9A 5MEPA 2ESVA 2FZ3A 3FOMA 5HHNA 4PJXA 2HJKA 5B38A 3JTSA 3E6HA 3RZCA 5HGAA 3VFRA 5E00A 3B3IA 1KJ2H 1OGAA 4WW2C 3CVHA 1U58A 1ZT7A 3GSWA 3TIDA 1S7WA 2CLVA 5BXFA 1EEYA 4ZUVA 4Y4KA 3C9NA 1N3NA 2GTWA 2VLLA 4N8VA 3ILPA 2BCKA 1NEZA 1GZQA 2MHAA 3P4MA 1OGTA 3G08A 3DTXA 5C0JA 3VXMA 4U1IA 4N0FA 4E0RA 5D2NA 4LCCC 1A1MA 2H6PA 5MENA 1GZPA 3LKSA 5C0GA 4X6CA 1K5NA 1LQVA 3KPLA 3MRRA 4NO2A 5D5MA 3D25A 2VLRA 1L8JA 3BGMA 2BNRA 1W0VA 4EN3C 2GITA 3HG1A 1P7QA 1T1WA 4QRQA 3O9WA 4PDCE 5DEFA 1FFNA 3E2HA 3RWIA 1S9YA 1T0MA 1T20A 4LCYA 4PJIA 3RWGA 4O2CA 3KYOA 3BHBA 1T1ZA 4G9DA 1RK1A 3MA7A 5EO0A 1I7RA 4IRJA 3VXOA 3X11A 4JFDA 4G43A 3UBXA 4N5EA 3SCMA 3DX6A 1S8DA 4O2EA 4PGBA 3VXRA 4F7EA 4S0UC 5ACZA 1T1XA 3TBTA 3WLBA 4NO0A 4Z78A 1K8DA 1AGDA 1JPFA 3FFCA 3GJFA 3MR9A 5HGHA 2CLRA 4QRRA 1WBYA 4WU7A 1MI5A 5FKPA 4PJ5A 1JE6A 3PWLA 4NQEA 4G8GA 3RL2A 4FTVA 5C0DA 2HN7A 2YEZA 1DUYA 1ZT4A 1DE4A 3PWNA 2CIKA 4WDIA 1HHIA 1S7RA 3PWUA 4PJ9A 3FOLA 3ARBA 1LEKA 3QDGA 2UWEA 2VLKA 5J1AA 1A1NA 3OX8A 3GMRA 4ZUSA 3WUWA 1AGEA 4I48A 1KPUA 3O3EA 3UTTA 1JF1A 5C0CA 3FQNA 1HHGA 5F9JA 3ROOA 1VACA 3TBSA 3ARGA 3HE7A 1RJZA 3H7BA 3QFDA 3MYJA 3GIVA 3JVGA 1I1FA 3KPOA 2AV1A 2X4OA 4MJ5A 4PJCA 2J8UA 3MRIA 3GMLA 5BJTA 1ZHNA 3L3JA 1NAMH 3L3DA 2X4TA 1HOCA 5IVXA 3MRDA 5HGDA 5INDA 3O3DA 1HSBA 4WO4A 3VXNA 1A9BA 4MQ7A 3WS6A 3RWJA 1P1ZA 5FA3A 1G6RH 2BSSA 4U1SA 5EUOA 4NT6A 1T80A 4O2FA 2E7LE 3BUYA 3MGOA 3MV7A 4PJEA 4IRSA 3U0PA 5C08A 3TN0A 3VWKA 2XPGA 3BXNA 1MHEA 1XH3A 3RWCA 3HAEA 1AKJA 4NO5A 3V5HA 4PJHA 2CIIA 4IIQC 3L3IA 3CPLA 3H9SA 5FA4A 3JTCA 2WY3A 4UQ2A 3BP4A 1E28A 3DXAA 3P4NA 1AGCA 3BVNA 5GSRA 3KPMA 4PJFA 4X6EA 2A83A 3ARFA 1FG2A 1QRNA 3V5DA 1IM3A 1P4LA 4F7PA 5GSVA 3GMQA 3H9HA 4NQDA 3FQXA 3D39A 3PWVA 1Z5LA 5HGBA 1ZVSA 1IM9A 4NNXA 5HHMA 3CZFA 4G42A 4MJIA 2OI9A 3O3BA 1LP9A 3SDDA 1UXWA 3LN4A 3QQ4A 3FQUA 4CW1A 3LN5A 4PRIA 1AO7A 3HUJA 3MRPA 4IHOA 1NANH 1JFMA 4X6DA 3VRJA 5D7IA 4G9FA 4JFEA 2YPKA 4N0UA 3T1FA 5F1IA 4QOKA 1C16A 3TIEA 1FZMA 3GMMA 3LKNA 1ONQA 5E8NA 1B3JA 1BQHA 3GSUA 4WWKC 1E27A 1QSFA 2FYYA 1EFXA 3MRGA 2X4PA 3GSVA 5EOTA 4G59A 4ZAKA 1YN6A 3FTGA 3ERYA 3LKOA 3RUGA 1UQSA 4NQCA 3IXAA 4MNQA 3BEWA 3QZWA 3BH8A 5IB3A 3D2UA 3WL9A 3T8XA 3VFUA 1INQA 3TPUE 4ZFZA 1W72A 3DX7A 1YPZA 3KPQA 1S7TA 3W0WA 5FDWA 5INCA 1S9WA 1CD1A 1BIIA 4F7TA 3BEVA 3MROA 4MJ6A 2AKRA 2AV7A 3O3AA 4N0CA 1G7PA 4PJBA 3SKOA 2VABA 3VXSA 3GSXA 4JFQA 3OXRA 2CKBH 1SYSA 3MV9A 3VFTA 2ZOLA 2AK4A 3GMPA 2V2WA 3S6CA 3VXUA 4ZUUA 5MERA 4L3CA 3MRFA 4HS3A 2X4SA 4Y16A 1AGFA 3CH1A 4PJ7A 4FFEX 5B39A 5C0EA 2GUOA 3WS3A 1TVBA 1T1YA 3BO8A 3MRCA 5IB1A 4PRDA 5D2LA 4EUPA 1FFOA 4JFFA 3M17A 1I7TA 3VFNA 1LD9A 3KYNA 3VCLA 4D0DA 5MEOA 1VGKA 1X7QA 3GSQA 3BH9A 3O8XA 3P77A 1DUZA 1SYVA 4PJGA 5C9JA 5J6HA 3O4LA 4MX7A 4APQA 5E8PA 4X6FA 1KJ3H 3MRQA 4NNYA 2ZSVA 1FZJA 3SJVA 2BVOA 2V2XA 1Q94A 4HV8A 4PP8C 5L2KA 1N2RA 3ES6A 1T21A 3MRMA 3P4OA 3QUZA 4Y4FA 4CVZA 4F7CA 3DX8A 3CCHA 5AD0A 2VAAA 3MRKA 4JQXA 2FWOA 1T7XA 3QI9A 3QUKA 2BVPA 3QDMA 3TBWA 2AXFA 5SWSA 3AM8A 4ZUTA 4PRBA 3PWJA 1T7WA 4WUUA 3QUYA 2H26A 3X14A 2BSTA 3FRUA 5BRZA 5IROA 1KBGH 3SDAA 1ZHLA 2GTZA 4L8BA 5HHQA 4QRSA 3QUXA 3TVMA 3MV8A 3QFJA 4PGEA 3FT2A 4LHUA 4NO3A 1S7SA 4HKJA 1QLFA 3ECBA 4LNRA 2BNQA 1ZAGA 3CDGA 2C7UA 3FQWA 3VFVA 3VH8A 2P5WA 4HUXA 4PV8A 4K71B 1A6ZA 1KCGC 3SDXA 1PQZA 3RWDA 3QEQA 2X70A 3HLAA 1BZ9A 3JTTA 3FT3A 2Q7YA 3L3KA 1XR9A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3TBY A;  5IB5 A;  1JPG A;  1KPV A;  3QQ3 A;  3L3H A;  5C0I A;  1LEG A;  3CC5 A;  1T7Y A;  3BWA A;  4U6Y A;  5IB2 A;  3HE6 A;  5HHP A;  4PRE A;  4G8I A;  5ENW A;  3FON A;  1QVO A;  4PJD A;  2F54 A;  3BW9 A;  1T0N A;  1JGD A;  1N5A A;  1FZO A;  1M6O A;  4PRH A;  5MEQ A;  3X12 A;  3LKP A;  3FQT A;  4U1N A;  3FQR A;  1ZT1 A;  2NX5 A;  3I6K A;  1QSE A;  3PWP A;  3VJ6 A;  2PYE A;  3FT4 A;  3RWE A;  2RFX A;  2D31 A;  3VFP A;  3UTQ A;  3D18 A;  1HYR C;  1VAD A;  3AU1 A;  4D0B A;  1DDH A;  5ISZ A;  1HSA A;  5D9S A;  1HHH A;  1HHK A;  2XFX A;  3ARD A;  1KPR A;  3V5K A;  3KWW A;  4PRA A;  4PRP A;  1KJV A;  4U1K A;  1I4F A;  3NFN A;  4CVX A;  1YDP A;  3OV6 A;  1S9X A;  1ZHK A;  2ZOK A;  4NSK A;  4V3D B;  1CE6 A;  3PQY A;  3BZE A;  4PV9 A;  3TO4 A;  2X4U A;  3VRI A;  2BVQ A;  1KJM A;  3BP7 A;  1HHJ A;  1W0W A;  4NQX A;  2PO6 A;  4PJA A;  3LKQ A;  4PGD A;  3MRB A;  5DDH A;  5EO1 A;  3VFS A;  4MNG A;  3PAB A;  3D3V A;  4NHU E;  3RTQ A;  1ZS8 A;  3ILQ C;  1T7V A;  1YN7 A;  4JRX A;  3MRJ A;  4GUP A;  4PJ8 A;  3HPJ A;  2F74 A;  3I6L D;  5C09 A;  4HX1 A;  4PR5 A;  5BS0 A;  5IEK A;  4JRY A;  4Y2D A;  1LDP H;  5EFI A;  2VE6 A;  4Z76 A;  2F53 A;  1JHT A;  3VFM A;  1ZHB A;  1WBZ A;  3SPV A;  1XR8 A;  2FIK A;  3GSR A;  4JQV A;  2HJL A;  5HHO A;  4EI5 A;  4L8C A;  4L29 A;  2GJ6 A;  4LCW A;  2AXG A;  3VFO A;  3W39 A;  4Z77 A;  4U1L A;  3GSN H;  3OXS A;  1TVH A;  5IB4 A;  5JHD A;  1FO0 H;  3L9R A;  3KXF A;  4PGC A;  1A9E A;  4L3E A;  1EXU A;  1T22 A;  3RL1 A;  4ELM A;  1RJY A;  1JUF A;  1S7V A;  3MRE A;  4U6X A;  3GSO A;  3I6G A;  5F7D A;  2GT9 A;  4K7F A;  3UPR A;  3SKM A;  4JFO A;  1N59 A;  2HLA A;  1KTL A;  3KLA A;  1QR1 A;  4MXQ A;  4V3E B;  5SWZ A;  4WU5 A;  4HUU A;  5C07 A;  3RGV C;  1B0R A;  3KPP A;  3GMN A;  1ZSD A;  4UQ3 A;  4WJ5 A;  3RWH A;  5EU3 A;  4L9L C;  2DYP A;  2JCC A;  5SWQ A;  5D7L A;  2X4R A;  3QUL A;  4Y4H A;  3X13 A;  3M1B A;  5HYJ A;  3LV3 A;  3KPN A;  3TBV A;  3TA3 A;  5C0B A;  2FO4 A;  2X4Q A;  1T7Z A;  2ZSW A;  4D0C A;  1MHC A;  3L3G A;  4XXC A;  3DMM A;  1I1Y A;  1QEW A;  3C8K A;  1G7Q A;  1EEZ A;  3B6S A;  4HUV A;  5EU5 A;  3LKR A;  4L4T A;  4F7M A;  5D7J C;  4MVB A;  5E8O A;  4L8S C;  3RWF A;  1FFP A;  4MS8 A;  3ROL A;  1JGE A;  3VFW A;  1LK2 A;  5H94 A;  3VXP A;  1S7X A;  4PRN A;  3REW A;  1R3H A;  3E3Q A;  1TMC A;  1OF2 A;  4QRT A;  5E9D A;  4JFP A;  3UTS A;  3MRH A;  1M05 A;  3P9M A;  1I7U A;  5EU6 A;  5IEH A;  4QRU A;  4GKN A;  1A1O A;  1MWA H;  2X4N A;  4PG2 A;  3BZF A;  3MRL A;  2NW3 A;  4E5X A;  4ZUW A;  1S7U A;  3TFK A;  3TZV C;  3GMO A;  4NQV A;  3ARE A;  3QDJ A;  2GAZ A;  4L8D A;  1OSZ A;  5IM7 A;  1ED3 A;  3KPS A;  1S7Q A;  1AGB A;  1QQD A;  4L4V A;  3TJH A;  2OL3 H;  4GKS A;  4I4W A;  3SDC A;  5C0F A;  2BSR A;  1UXS A;  4ONO A;  1RK0 A;  1WBX A;  3P9L A;  1BD2 A;  3TO2 A;  2CLZ A;  5J6G A;  4HWZ A;  2YPL A;  5E6I C;  3KPR A;  1I1A A;  5EU4 A;  5F1N A;  3MRN A;  5C0A A;  4QRP A;  5DEG A;  4HUW A;  3VWJ A;  3IT8 D;  3P73 A;  5L2J A;  3E6F A;  3MGT A;  1B0G A;  4U1H A;  1FZK A;  2VLJ A;  4PG9 A;  3TF7 A;  1QO3 A;  2P5E A;  3DBX A;  1XZ0 A;  4U1J A;  3HCV A;  4U1M A;  1CG9 A;  5MEP A;  2ESV A;  2FZ3 A;  3FOM A;  5HHN A;  4PJX A;  2HJK A;  5B38 A;  3JTS A;  3E6H A;  3RZC A;  5HGA A;  3VFR A;  5E00 A;  3B3I A;  1KJ2 H;  1OGA A;  4WW2 C;  3CVH A;  1U58 A;  1ZT7 A;  3GSW A;  3TID A;  1S7W A;  2CLV A;  5BXF A;  1EEY A;  4ZUV A;  4Y4K A;  3C9N A;  1N3N A;  2GTW A;  2VLL A;  4N8V A;  3ILP A;  2BCK A;  1NEZ A;  1GZQ A;  2MHA A;  3P4M A;  1OGT A;  3G08 A;  3DTX A;  5C0J A;  3VXM A;  4U1I A;  4N0F A;  4E0R A;  5D2N A;  4LCC C;  1A1M A;  2H6P A;  5MEN A;  1GZP A;  3LKS A;  5C0G A;  4X6C A;  1K5N A;  1LQV A;  3KPL A;  3MRR A;  4NO2 A;  5D5M A;  3D25 A;  2VLR A;  1L8J A;  3BGM A;  2BNR A;  1W0V A;  4EN3 C;  2GIT A;  3HG1 A;  1P7Q A;  1T1W A;  4QRQ A;  3O9W A;  4PDC E;  5DEF A;  1FFN A;  3E2H A;  3RWI A;  1S9Y A;  1T0M A;  1T20 A;  4LCY A;  4PJI A;  3RWG A;  4O2C A;  3KYO A;  3BHB A;  1T1Z A;  4G9D A;  1RK1 A;  3MA7 A;  5EO0 A;  1I7R A;  4IRJ A;  3VXO A;  3X11 A;  4JFD A;  4G43 A;  3UBX A;  4N5E A;  3SCM A;  3DX6 A;  1S8D A;  4O2E A;  4PGB A;  3VXR A;  4F7E A;  4S0U C;  5ACZ A;  1T1X A;  3TBT A;  3WLB A;  4NO0 A;  4Z78 A;  1K8D A;  1AGD A;  1JPF A;  3FFC A;  3GJF A;  3MR9 A;  5HGH A;  2CLR A;  4QRR A;  1WBY A;  4WU7 A;  1MI5 A;  5FKP A;  4PJ5 A;  1JE6 A;  3PWL A;  4NQE A;  4G8G A;  3RL2 A;  4FTV A;  5C0D A;  2HN7 A;  2YEZ A;  1DUY A;  1ZT4 A;  1DE4 A;  3PWN A;  2CIK A;  4WDI A;  1HHI A;  1S7R A;  3PWU A;  4PJ9 A;  3FOL A;  3ARB A;  1LEK A;  3QDG A;  2UWE A;  2VLK A;  5J1A A;  1A1N A;  3OX8 A;  3GMR A;  4ZUS A;  3WUW A;  1AGE A;  4I48 A;  1KPU A;  3O3E A;  3UTT A;  1JF1 A;  5C0C A;  3FQN A;  1HHG A;  5F9J A;  3ROO A;  1VAC A;  3TBS A;  3ARG A;  3HE7 A;  1RJZ A;  3H7B A;  3QFD A;  3MYJ A;  3GIV A;  3JVG A;  1I1F A;  3KPO A;  2AV1 A;  2X4O A;  4MJ5 A;  4PJC A;  2J8U A;  3MRI A;  3GML A;  5BJT A;  1ZHN A;  3L3J A;  1NAM H;  3L3D A;  2X4T A;  1HOC A;  5IVX A;  3MRD A;  5HGD A;  5IND A;  3O3D A;  1HSB A;  4WO4 A;  3VXN A;  1A9B A;  4MQ7 A;  3WS6 A;  3RWJ A;  1P1Z A;  5FA3 A;  1G6R H;  2BSS A;  4U1S A;  5EUO A;  4NT6 A;  1T80 A;  4O2F A;  2E7L E;  3BUY A;  3MGO A;  3MV7 A;  4PJE A;  4IRS A;  3U0P A;  5C08 A;  3TN0 A;  3VWK A;  2XPG A;  3BXN A;  1MHE A;  1XH3 A;  3RWC A;  3HAE A;  1AKJ A;  4NO5 A;  3V5H A;  4PJH A;  2CII A;  4IIQ C;  3L3I A;  3CPL A;  3H9S A;  5FA4 A;  3JTC A;  2WY3 A;  4UQ2 A;  3BP4 A;  1E28 A;  3DXA A;  3P4N A;  1AGC A;  3BVN A;  5GSR A;  3KPM A;  4PJF A;  4X6E A;  2A83 A;  3ARF A;  1FG2 A;  1QRN A;  3V5D A;  1IM3 A;  1P4L A;  4F7P A;  5GSV A;  3GMQ A;  3H9H A;  4NQD A;  3FQX A;  3D39 A;  3PWV A;  1Z5L A;  5HGB A;  1ZVS A;  1IM9 A;  4NNX A;  5HHM A;  3CZF A;  4G42 A;  4MJI A;  2OI9 A;  3O3B A;  1LP9 A;  3SDD A;  1UXW A;  3LN4 A;  3QQ4 A;  3FQU A;  4CW1 A;  3LN5 A;  4PRI A;  1AO7 A;  3HUJ A;  3MRP A;  4IHO A;  1NAN H;  1JFM A;  4X6D A;  3VRJ A;  5D7I A;  4G9F A;  4JFE A;  2YPK A;  4N0U A;  3T1F A;  5F1I A;  4QOK A;  1C16 A;  3TIE A;  1FZM A;  3GMM A;  3LKN A;  1ONQ A;  5E8N A;  1B3J A;  1BQH A;  3GSU A;  4WWK C;  1E27 A;  1QSF A;  2FYY A;  1EFX A;  3MRG A;  2X4P A;  3GSV A;  5EOT A;  4G59 A;  4ZAK A;  1YN6 A;  3FTG A;  3ERY A;  3LKO A;  3RUG A;  1UQS A;  4NQC A;  3IXA A;  4MNQ A;  3BEW A;  3QZW A;  3BH8 A;  5IB3 A;  3D2U A;  3WL9 A;  3T8X A;  3VFU A;  1INQ A;  3TPU E;  4ZFZ A;  1W72 A;  3DX7 A;  1YPZ A;  3KPQ A;  1S7T A;  3W0W A;  5FDW A;  5INC A;  1S9W A;  1CD1 A;  1BII A;  4F7T A;  3BEV A;  3MRO A;  4MJ6 A;  2AKR A;  2AV7 A;  3O3A A;  4N0C A;  1G7P A;  4PJB A;  3SKO A;  2VAB A;  3VXS A;  3GSX A;  4JFQ A;  3OXR A;  2CKB H;  1SYS A;  3MV9 A;  3VFT A;  2ZOL A;  2AK4 A;  3GMP A;  2V2W A;  3S6C A;  3VXU A;  4ZUU A;  5MER A;  4L3C A;  3MRF A;  4HS3 A;  2X4S A;  4Y16 A;  1AGF A;  3CH1 A;  4PJ7 A;  4FFE X;  5B39 A;  5C0E A;  2GUO A;  3WS3 A;  1TVB A;  1T1Y A;  3BO8 A;  3MRC A;  5IB1 A;  4PRD A;  5D2L A;  4EUP A;  1FFO A;  4JFF A;  3M17 A;  1I7T A;  3VFN A;  1LD9 A;  3KYN A;  3VCL A;  4D0D A;  5MEO A;  1VGK A;  1X7Q A;  3GSQ A;  3BH9 A;  3O8X A;  3P77 A;  1DUZ A;  1SYV A;  4PJG A;  5C9J A;  5J6H A;  3O4L A;  4MX7 A;  4APQ A;  5E8P A;  4X6F A;  1KJ3 H;  3MRQ A;  4NNY A;  2ZSV A;  1FZJ A;  3SJV A;  2BVO A;  2V2X A;  1Q94 A;  4HV8 A;  4PP8 C;  5L2K A;  1N2R A;  3ES6 A;  1T21 A;  3MRM A;  3P4O A;  3QUZ A;  4Y4F A;  4CVZ A;  4F7C A;  3DX8 A;  3CCH A;  5AD0 A;  2VAA A;  3MRK A;  4JQX A;  2FWO A;  1T7X A;  3QI9 A;  3QUK A;  2BVP A;  3QDM A;  3TBW A;  2AXF A;  5SWS A;  3AM8 A;  4ZUT A;  4PRB A;  3PWJ A;  1T7W A;  4WUU A;  3QUY A;  2H26 A;  3X14 A;  2BST A;  3FRU A;  5BRZ A;  5IRO A;  1KBG H;  3SDA A;  1ZHL A;  2GTZ A;  4L8B A;  5HHQ A;  4QRS A;  3QUX A;  3TVM A;  3MV8 A;  3QFJ A;  4PGE A;  3FT2 A;  4LHU A;  4NO3 A;  1S7S A;  4HKJ A;  1QLF A;  3ECB A;  4LNR A;  2BNQ A;  1ZAG A;  3CDG A;  2C7U A;  3FQW A;  3VFV A;  3VH8 A;  2P5W A;  4HUX A;  4PV8 A;  4K71 B;  1A6Z A;  1KCG C;  3SDX A;  1PQZ A;  3RWD A;  3QEQ A;  2X70 A;  3HLA A;  1BZ9 A;  3JTT A;  3FT3 A;  2Q7Y A;  3L3K A;  1XR9 A; 
#chains in the Genus database with same CATH topology
 3TBY A;  5IB5 A;  1JPG A;  1KPV A;  3QQ3 A;  3L3H A;  5C0I A;  1LEG A;  3CC5 A;  1T7Y A;  3BWA A;  4U6Y A;  5IB2 A;  3HE6 A;  5HHP A;  4PRE A;  4G8I A;  5ENW A;  3FON A;  1QVO A;  4PJD A;  2F54 A;  3BW9 A;  1T0N A;  1JGD A;  1N5A A;  1FZO A;  1M6O A;  4PRH A;  5MEQ A;  3X12 A;  3LKP A;  3FQT A;  4BKW A;  4U1N A;  3FQR A;  1ZT1 A;  2NX5 A;  3I6K A;  1QSE A;  3PWP A;  3VJ6 A;  2PYE A;  3FT4 A;  3RWE A;  2RFX A;  2D31 A;  3VFP A;  3UTQ A;  3D18 A;  1HYR C;  1VAD A;  3AU1 A;  4D0B A;  1DDH A;  5ISZ A;  1HSA A;  5D9S A;  1HHH A;  1HHK A;  2XFX A;  3ARD A;  1KPR A;  3V5K A;  3KWW A;  4PRA A;  4PRP A;  1KJV A;  4U1K A;  1I4F A;  3NFN A;  4CVX A;  1YDP A;  3OV6 A;  1S9X A;  1ZHK A;  2ZOK A;  4NSK A;  4V3D B;  1CE6 A;  3PQY A;  3BZE A;  4PV9 A;  3TO4 A;  2X4U A;  3VRI A;  2BVQ A;  1KJM A;  3BP7 A;  1HHJ A;  1W0W A;  4NQX A;  2PO6 A;  4PJA A;  3LKQ A;  4PGD A;  3MRB A;  5DDH A;  5EO1 A;  3VFS A;  4MNG A;  3PAB A;  3D3V A;  4NHU E;  3RTQ A;  1ZS8 A;  3ILQ C;  1T7V A;  1YN7 A;  4JRX A;  3MRJ A;  4GUP A;  4PJ8 A;  3HPJ A;  2F74 A;  3I6L D;  5C09 A;  4HX1 A;  4PR5 A;  5BS0 A;  5IEK A;  4JRY A;  4Y2D A;  1LDP H;  5EFI A;  2VE6 A;  4Z76 A;  2F53 A;  1JHT A;  3VFM A;  1ZHB A;  1WBZ A;  3SPV A;  1XR8 A;  2FIK A;  3GSR A;  4JQV A;  2HJL A;  5HHO A;  4EI5 A;  4L8C A;  4L29 A;  2GJ6 A;  4LCW A;  2AXG A;  3VFO A;  3W39 A;  4Z77 A;  4U1L A;  3GSN H;  3OXS A;  1TVH A;  5IB4 A;  5JHD A;  1FO0 H;  3L9R A;  3KXF A;  4PGC A;  1A9E A;  4L3E A;  1EXU A;  1T22 A;  3RL1 A;  4ELM A;  1RJY A;  1JUF A;  1S7V A;  3MRE A;  4U6X A;  3GSO A;  3I6G A;  5F7D A;  2GT9 A;  4K7F A;  3UPR A;  3SKM A;  4JFO A;  1N59 A;  2HLA A;  1KTL A;  3KLA A;  1QR1 A;  4JO8 A;  4MXQ A;  4V3E B;  5SWZ A;  4WU5 A;  4HUU A;  5C07 A;  3RGV C;  1B0R A;  3KPP A;  3GMN A;  1ZSD A;  4UQ3 A;  4WJ5 A;  3RWH A;  5EU3 A;  4L9L C;  2DYP A;  2JCC A;  5SWQ A;  5D7L A;  2X4R A;  3QUL A;  4Y4H A;  3X13 A;  3M1B A;  5HYJ A;  3LV3 A;  2IA1 A;  3KPN A;  3TBV A;  3TA3 A;  5C0B A;  2FO4 A;  2X4Q A;  1T7Z A;  2ZSW A;  4D0C A;  1MHC A;  3L3G A;  4XXC A;  3DMM A;  1I1Y A;  1QEW A;  3C8K A;  1G7Q A;  1EEZ A;  3B6S A;  4HUV A;  5EU5 A;  3LKR A;  4L4T A;  4F7M A;  5D7J C;  4MVB A;  5E8O A;  4L8S C;  3RWF A;  1FFP A;  4MS8 A;  3ROL A;  1JGE A;  3VFW A;  1LK2 A;  5H94 A;  3VXP A;  1S7X A;  4PRN A;  3REW A;  1R3H A;  3E3Q A;  1TMC A;  1OF2 A;  4QRT A;  5E9D A;  4JFP A;  3UTS A;  3MRH A;  1M05 A;  3P9M A;  1I7U A;  5EU6 A;  5IEH A;  4QRU A;  4GKN A;  1A1O A;  1MWA H;  2X4N A;  4PG2 A;  3BZF A;  3MRL A;  2NW3 A;  4E5X A;  4ZUW A;  1S7U A;  3TFK A;  3TZV C;  3GMO A;  4NQV A;  3ARE A;  3QDJ A;  2GAZ A;  4L8D A;  1OSZ A;  5IM7 A;  1ED3 A;  3KPS A;  1S7Q A;  1AGB A;  1QQD A;  4L4V A;  3TJH A;  2OL3 H;  4GKS A;  4I4W A;  3SDC A;  5C0F A;  2BSR A;  1UXS A;  4ONO A;  1RK0 A;  1WBX A;  3P9L A;  1BD2 A;  3TO2 A;  2CLZ A;  5J6G A;  4HWZ A;  2YPL A;  5E6I C;  3KPR A;  1I1A A;  5EU4 A;  5F1N A;  3MRN A;  5C0A A;  4QRP A;  5DEG A;  4HUW A;  3VWJ A;  3IT8 D;  3P73 A;  5L2J A;  3E6F A;  3MGT A;  1B0G A;  4U1H A;  1FZK A;  2VLJ A;  4PG9 A;  3TF7 A;  1QO3 A;  2P5E A;  3DBX A;  1XZ0 A;  4U1J A;  3HCV A;  4U1M A;  1CG9 A;  5MEP A;  2ESV A;  2FZ3 A;  3FOM A;  5HHN A;  4PJX A;  2HJK A;  5B38 A;  3I0T A;  3JTS A;  3E6H A;  3RZC A;  5HGA A;  3VFR A;  5E00 A;  3B3I A;  1KJ2 H;  1OGA A;  4WW2 C;  3CVH A;  1U58 A;  1ZT7 A;  3GSW A;  3TID A;  1S7W A;  2CLV A;  5BXF A;  1EEY A;  4ZUV A;  4Y4K A;  3C9N A;  1N3N A;  2O5N A;  2GTW A;  2VLL A;  4N8V A;  3ILP A;  2BCK A;  1NEZ A;  1GZQ A;  2MHA A;  3P4M A;  1OGT A;  3G08 A;  3DTX A;  5C0J A;  3VXM A;  4U1I A;  4N0F A;  4E0R A;  5D2N A;  4LCC C;  2NYK A;  1A1M A;  2H6P A;  5MEN A;  1GZP A;  3LKS A;  5C0G A;  4X6C A;  1K5N A;  1LQV A;  3KPL A;  3MRR A;  4NO2 A;  5D5M A;  3D25 A;  2VLR A;  1L8J A;  3BGM A;  2BNR A;  1W0V A;  4EN3 C;  2GIT A;  3HG1 A;  1P7Q A;  1T1W A;  4QRQ A;  3O9W A;  4PDC E;  5DEF A;  1FFN A;  3E2H A;  3RWI A;  1S9Y A;  1T0M A;  1T20 A;  4LCY A;  4PJI A;  3RWG A;  4O2C A;  3KYO A;  3BHB A;  1T1Z A;  4G9D A;  1RK1 A;  3MA7 A;  5EO0 A;  1I7R A;  4IRJ A;  3VXO A;  3X11 A;  4JFD A;  4G43 A;  3UBX A;  4N5E A;  3SCM A;  3DX6 A;  1S8D A;  4O2E A;  4PGB A;  3VXR A;  4F7E A;  4S0U C;  5ACZ A;  1T1X A;  3TBT A;  3WLB A;  4NO0 A;  4Z78 A;  1K8D A;  1AGD A;  1JPF A;  3FFC A;  3GJF A;  3MR9 A;  5HGH A;  2CLR A;  4QRR A;  1WBY A;  4WU7 A;  1MI5 A;  5FKP A;  4PJ5 A;  1JE6 A;  3PWL A;  4NQE A;  4G8G A;  3RL2 A;  4FTV A;  5C0D A;  2HN7 A;  2YEZ A;  1DUY A;  1ZT4 A;  1DE4 A;  3PWN A;  2CIK A;  4WDI A;  1HHI A;  1S7R A;  3PWU A;  4PJ9 A;  3FOL A;  3ARB A;  1LEK A;  3QDG A;  2UWE A;  2VLK A;  5J1A A;  1A1N A;  3OX8 A;  3GMR A;  4ZUS A;  3WUW A;  1AGE A;  4I48 A;  1KPU A;  3O3E A;  3UTT A;  1JF1 A;  5C0C A;  3FQN A;  1HHG A;  5F9J A;  3ROO A;  1VAC A;  3TBS A;  3ARG A;  3HE7 A;  1RJZ A;  3H7B A;  3QFD A;  3MYJ A;  3GIV A;  3JVG A;  1I1F A;  3KPO A;  2AV1 A;  2X4O A;  4MJ5 A;  4G59 C;  4PJC A;  2J8U A;  3MRI A;  3GML A;  5BJT A;  1ZHN A;  3L3J A;  1NAM H;  3L3D A;  2X4T A;  1HOC A;  5IVX A;  3MRD A;  5HGD A;  5IND A;  3O3D A;  1HSB A;  4WO4 A;  3VXN A;  1A9B A;  4MQ7 A;  3WS6 A;  3RWJ A;  1P1Z A;  5FA3 A;  1G6R H;  2BSS A;  4U1S A;  5EUO A;  4NT6 A;  1T80 A;  4O2F A;  2E7L E;  3BUY A;  3MGO A;  3MV7 A;  4PJE A;  4IRS A;  3U0P A;  5C08 A;  3TN0 A;  3VWK A;  2XPG A;  3BXN A;  1MHE A;  1XH3 A;  3RWC A;  3HAE A;  1AKJ A;  4NO5 A;  3V5H A;  4PJH A;  2CII A;  4IIQ C;  3L3I A;  3CPL A;  3H9S A;  5FA4 A;  3JTC A;  2WY3 A;  4UQ2 A;  3BP4 A;  1E28 A;  3DXA A;  3P4N A;  1AGC A;  3BVN A;  5GSR A;  3KPM A;  4PJF A;  4X6E A;  2A83 A;  3ARF A;  1FG2 A;  1QRN A;  3V5D A;  1IM3 A;  1P4L A;  4F7P A;  5GSV A;  3GMQ A;  3H9H A;  4NQD A;  3FQX A;  3D39 A;  3PWV A;  1Z5L A;  5HGB A;  1ZVS A;  1IM9 A;  4NNX A;  5HHM A;  3CZF A;  4G42 A;  4MJI A;  2OI9 A;  3O3B A;  1LP9 A;  3SDD A;  1UXW A;  3LN4 A;  3QQ4 A;  3FQU A;  4CW1 A;  3LN5 A;  4PRI A;  1AO7 A;  3HUJ A;  3MRP A;  4IHO A;  1NAN H;  1JFM A;  4X6D A;  3VRJ A;  5D7I A;  4G9F A;  4JFE A;  2YPK A;  4N0U A;  3T1F A;  5F1I A;  4QOK A;  1C16 A;  3TIE A;  1FZM A;  3GMM A;  3LKN A;  1ONQ A;  5E8N A;  1B3J A;  1BQH A;  3GSU A;  4WWK C;  1E27 A;  1QSF A;  2FYY A;  1EFX A;  3MRG A;  2X4P A;  3GSV A;  5EOT A;  4G59 A;  4ZAK A;  1YN6 A;  3FTG A;  3ERY A;  3LKO A;  3RUG A;  1UQS A;  4NQC A;  3IXA A;  4MNQ A;  3BEW A;  3QZW A;  3BH8 A;  5IB3 A;  3D2U A;  3WL9 A;  3T8X A;  3VFU A;  1INQ A;  3TPU E;  4ZFZ A;  1W72 A;  3DX7 A;  1YPZ A;  3KPQ A;  1S7T A;  3W0W A;  5FDW A;  5INC A;  1S9W A;  1CD1 A;  1BII A;  4F7T A;  3BEV A;  3MRO A;  4MJ6 A;  2AKR A;  2AV7 A;  3O3A A;  4N0C A;  1G7P A;  4PJB A;  3SKO A;  2VAB A;  3VXS A;  3GSX A;  4JFQ A;  3OXR A;  2CKB H;  1SYS A;  3MV9 A;  3VFT A;  2ZOL A;  2AK4 A;  3GMP A;  2V2W A;  3S6C A;  3VXU A;  4ZUU A;  5MER A;  4L3C A;  3MRF A;  4HS3 A;  2X4S A;  4Y16 A;  1AGF A;  3CH1 A;  4PJ7 A;  4FFE X;  5B39 A;  5C0E A;  2GUO A;  3WS3 A;  1TVB A;  1T1Y A;  3BO8 A;  3MRC A;  5IB1 A;  4PRD A;  5D2L A;  4EUP A;  1FFO A;  4JFF A;  3M17 A;  1I7T A;  3VFN A;  1LD9 A;  3KYN A;  3VCL A;  4D0D A;  5MEO A;  1VGK A;  1X7Q A;  3GSQ A;  3BH9 A;  3O8X A;  3P77 A;  1DUZ A;  1SYV A;  4PJG A;  5C9J A;  5J6H A;  3O4L A;  4MX7 A;  4APQ A;  5E8P A;  4X6F A;  1KJ3 H;  3MRQ A;  4NNY A;  2ZSV A;  1FZJ A;  3SJV A;  2BVO A;  2V2X A;  1Q94 A;  4HV8 A;  4PP8 C;  5L2K A;  1N2R A;  3ES6 A;  1T21 A;  3MRM A;  3P4O A;  3QUZ A;  4Y4F A;  4CVZ A;  4F7C A;  3DX8 A;  3CCH A;  5AD0 A;  2VAA A;  3MRK A;  4JQX A;  2FWO A;  1T7X A;  3QI9 A;  3QUK A;  2BVP A;  3QDM A;  3TBW A;  2AXF A;  5SWS A;  3AM8 A;  4ZUT A;  4PRB A;  3PWJ A;  1T7W A;  4WUU A;  3QUY A;  2H26 A;  3X14 A;  2BST A;  3FRU A;  5BRZ A;  5IRO A;  1KBG H;  3SDA A;  1ZHL A;  2GTZ A;  4L8B A;  5HHQ A;  4QRS A;  3QUX A;  3TVM A;  3MV8 A;  3QFJ A;  4PGE A;  3FT2 A;  4LHU A;  4NO3 A;  1S7S A;  4HKJ A;  1QLF A;  3ECB A;  4LNR A;  2BNQ A;  1ZAG A;  3CDG A;  2C7U A;  3FQW A;  3VFV A;  3VH8 A;  2P5W A;  4HUX A;  4PV8 A;  4K71 B;  1A6Z A;  1KCG C;  3SDX A;  1PQZ A;  3RWD A;  3QEQ A;  2X70 A;  3HLA A;  1BZ9 A;  3JTT A;  3FT3 A;  2Q7Y A;  3L3K A;  1XR9 A; 
#chains in the Genus database with same CATH homology
 3TBY A;  5IB5 A;  1JPG A;  1KPV A;  3QQ3 A;  3L3H A;  5C0I A;  1LEG A;  3CC5 A;  1T7Y A;  3BWA A;  4U6Y A;  5IB2 A;  3HE6 A;  5HHP A;  4PRE A;  4G8I A;  5ENW A;  3FON A;  1QVO A;  4PJD A;  2F54 A;  3BW9 A;  1T0N A;  1JGD A;  1N5A A;  1FZO A;  1M6O A;  4PRH A;  5MEQ A;  3X12 A;  3LKP A;  3FQT A;  4U1N A;  3FQR A;  1ZT1 A;  2NX5 A;  3I6K A;  1QSE A;  3PWP A;  3VJ6 A;  2PYE A;  3FT4 A;  3RWE A;  2RFX A;  2D31 A;  3VFP A;  3UTQ A;  3D18 A;  1HYR C;  1VAD A;  3AU1 A;  4D0B A;  1DDH A;  5ISZ A;  1HSA A;  5D9S A;  1HHH A;  1HHK A;  2XFX A;  3ARD A;  1KPR A;  3V5K A;  3KWW A;  4PRA A;  4PRP A;  1KJV A;  4U1K A;  1I4F A;  3NFN A;  4CVX A;  1YDP A;  3OV6 A;  1S9X A;  1ZHK A;  2ZOK A;  4NSK A;  4V3D B;  1CE6 A;  3PQY A;  3BZE A;  4PV9 A;  3TO4 A;  2X4U A;  3VRI A;  2BVQ A;  1KJM A;  3BP7 A;  1HHJ A;  1W0W A;  4NQX A;  2PO6 A;  4PJA A;  3LKQ A;  4PGD A;  3MRB A;  5DDH A;  5EO1 A;  3VFS A;  4MNG A;  3PAB A;  3D3V A;  4NHU E;  3RTQ A;  1ZS8 A;  3ILQ C;  1T7V A;  1YN7 A;  4JRX A;  3MRJ A;  4GUP A;  4PJ8 A;  3HPJ A;  2F74 A;  3I6L D;  5C09 A;  4HX1 A;  4PR5 A;  5BS0 A;  5IEK A;  4JRY A;  4Y2D A;  1LDP H;  5EFI A;  2VE6 A;  4Z76 A;  2F53 A;  1JHT A;  3VFM A;  1ZHB A;  1WBZ A;  3SPV A;  1XR8 A;  2FIK A;  3GSR A;  4JQV A;  2HJL A;  5HHO A;  4EI5 A;  4L8C A;  4L29 A;  2GJ6 A;  4LCW A;  2AXG A;  3VFO A;  3W39 A;  4Z77 A;  4U1L A;  3GSN H;  3OXS A;  1TVH A;  5IB4 A;  5JHD A;  1FO0 H;  3L9R A;  3KXF A;  4PGC A;  1A9E A;  4L3E A;  1EXU A;  1T22 A;  3RL1 A;  4ELM A;  1RJY A;  1JUF A;  1S7V A;  3MRE A;  4U6X A;  3GSO A;  3I6G A;  5F7D A;  2GT9 A;  4K7F A;  3UPR A;  3SKM A;  4JFO A;  1N59 A;  2HLA A;  1KTL A;  3KLA A;  1QR1 A;  4MXQ A;  4V3E B;  5SWZ A;  4WU5 A;  4HUU A;  5C07 A;  3RGV C;  1B0R A;  3KPP A;  3GMN A;  1ZSD A;  4UQ3 A;  4WJ5 A;  3RWH A;  5EU3 A;  4L9L C;  2DYP A;  2JCC A;  5SWQ A;  5D7L A;  2X4R A;  3QUL A;  4Y4H A;  3X13 A;  3M1B A;  5HYJ A;  3LV3 A;  3KPN A;  3TBV A;  3TA3 A;  5C0B A;  2FO4 A;  2X4Q A;  1T7Z A;  2ZSW A;  4D0C A;  1MHC A;  3L3G A;  4XXC A;  3DMM A;  1I1Y A;  1QEW A;  3C8K A;  1G7Q A;  1EEZ A;  3B6S A;  4HUV A;  5EU5 A;  3LKR A;  4L4T A;  4F7M A;  5D7J C;  4MVB A;  5E8O A;  4L8S C;  3RWF A;  1FFP A;  4MS8 A;  3ROL A;  1JGE A;  3VFW A;  1LK2 A;  5H94 A;  3VXP A;  1S7X A;  4PRN A;  3REW A;  1R3H A;  3E3Q A;  1TMC A;  1OF2 A;  4QRT A;  5E9D A;  4JFP A;  3UTS A;  3MRH A;  1M05 A;  3P9M A;  1I7U A;  5EU6 A;  5IEH A;  4QRU A;  4GKN A;  1A1O A;  1MWA H;  2X4N A;  4PG2 A;  3BZF A;  3MRL A;  2NW3 A;  4E5X A;  4ZUW A;  1S7U A;  3TFK A;  3TZV C;  3GMO A;  4NQV A;  3ARE A;  3QDJ A;  2GAZ A;  4L8D A;  1OSZ A;  5IM7 A;  1ED3 A;  3KPS A;  1S7Q A;  1AGB A;  1QQD A;  4L4V A;  3TJH A;  2OL3 H;  4GKS A;  4I4W A;  3SDC A;  5C0F A;  2BSR A;  1UXS A;  4ONO A;  1RK0 A;  1WBX A;  3P9L A;  1BD2 A;  3TO2 A;  2CLZ A;  5J6G A;  4HWZ A;  2YPL A;  5E6I C;  3KPR A;  1I1A A;  5EU4 A;  5F1N A;  3MRN A;  5C0A A;  4QRP A;  5DEG A;  4HUW A;  3VWJ A;  3IT8 D;  3P73 A;  5L2J A;  3E6F A;  3MGT A;  1B0G A;  4U1H A;  1FZK A;  2VLJ A;  4PG9 A;  3TF7 A;  1QO3 A;  2P5E A;  3DBX A;  1XZ0 A;  4U1J A;  3HCV A;  4U1M A;  1CG9 A;  5MEP A;  2ESV A;  2FZ3 A;  3FOM A;  5HHN A;  4PJX A;  2HJK A;  5B38 A;  3JTS A;  3E6H A;  3RZC A;  5HGA A;  3VFR A;  5E00 A;  3B3I A;  1KJ2 H;  1OGA A;  4WW2 C;  3CVH A;  1U58 A;  1ZT7 A;  3GSW A;  3TID A;  1S7W A;  2CLV A;  5BXF A;  1EEY A;  4ZUV A;  4Y4K A;  3C9N A;  1N3N A;  2GTW A;  2VLL A;  4N8V A;  3ILP A;  2BCK A;  1NEZ A;  1GZQ A;  2MHA A;  3P4M A;  1OGT A;  3G08 A;  3DTX A;  5C0J A;  3VXM A;  4U1I A;  4N0F A;  4E0R A;  5D2N A;  4LCC C;  1A1M A;  2H6P A;  5MEN A;  1GZP A;  3LKS A;  5C0G A;  4X6C A;  1K5N A;  1LQV A;  3KPL A;  3MRR A;  4NO2 A;  5D5M A;  3D25 A;  2VLR A;  1L8J A;  3BGM A;  2BNR A;  1W0V A;  4EN3 C;  2GIT A;  3HG1 A;  1P7Q A;  1T1W A;  4QRQ A;  3O9W A;  4PDC E;  5DEF A;  1FFN A;  3E2H A;  3RWI A;  1S9Y A;  1T0M A;  1T20 A;  4LCY A;  4PJI A;  3RWG A;  4O2C A;  3KYO A;  3BHB A;  1T1Z A;  4G9D A;  1RK1 A;  3MA7 A;  5EO0 A;  1I7R A;  4IRJ A;  3VXO A;  3X11 A;  4JFD A;  4G43 A;  3UBX A;  4N5E A;  3SCM A;  3DX6 A;  1S8D A;  4O2E A;  4PGB A;  3VXR A;  4F7E A;  4S0U C;  5ACZ A;  1T1X A;  3TBT A;  3WLB A;  4NO0 A;  4Z78 A;  1K8D A;  1AGD A;  1JPF A;  3FFC A;  3GJF A;  3MR9 A;  5HGH A;  2CLR A;  4QRR A;  1WBY A;  4WU7 A;  1MI5 A;  5FKP A;  4PJ5 A;  1JE6 A;  3PWL A;  4NQE A;  4G8G A;  3RL2 A;  4FTV A;  5C0D A;  2HN7 A;  2YEZ A;  1DUY A;  1ZT4 A;  1DE4 A;  3PWN A;  2CIK A;  4WDI A;  1HHI A;  1S7R A;  3PWU A;  4PJ9 A;  3FOL A;  3ARB A;  1LEK A;  3QDG A;  2UWE A;  2VLK A;  5J1A A;  1A1N A;  3OX8 A;  3GMR A;  4ZUS A;  3WUW A;  1AGE A;  4I48 A;  1KPU A;  3O3E A;  3UTT A;  1JF1 A;  5C0C A;  3FQN A;  1HHG A;  5F9J A;  3ROO A;  1VAC A;  3TBS A;  3ARG A;  3HE7 A;  1RJZ A;  3H7B A;  3QFD A;  3MYJ A;  3GIV A;  3JVG A;  1I1F A;  3KPO A;  2AV1 A;  2X4O A;  4MJ5 A;  4PJC A;  2J8U A;  3MRI A;  3GML A;  5BJT A;  1ZHN A;  3L3J A;  1NAM H;  3L3D A;  2X4T A;  1HOC A;  5IVX A;  3MRD A;  5HGD A;  5IND A;  3O3D A;  1HSB A;  4WO4 A;  3VXN A;  1A9B A;  4MQ7 A;  3WS6 A;  3RWJ A;  1P1Z A;  5FA3 A;  1G6R H;  2BSS A;  4U1S A;  5EUO A;  4NT6 A;  1T80 A;  4O2F A;  2E7L E;  3BUY A;  3MGO A;  3MV7 A;  4PJE A;  4IRS A;  3U0P A;  5C08 A;  3TN0 A;  3VWK A;  2XPG A;  3BXN A;  1MHE A;  1XH3 A;  3RWC A;  3HAE A;  1AKJ A;  4NO5 A;  3V5H A;  4PJH A;  2CII A;  4IIQ C;  3L3I A;  3CPL A;  3H9S A;  5FA4 A;  3JTC A;  2WY3 A;  4UQ2 A;  3BP4 A;  1E28 A;  3DXA A;  3P4N A;  1AGC A;  3BVN A;  5GSR A;  3KPM A;  4PJF A;  4X6E A;  2A83 A;  3ARF A;  1FG2 A;  1QRN A;  3V5D A;  1IM3 A;  1P4L A;  4F7P A;  5GSV A;  3GMQ A;  3H9H A;  4NQD A;  3FQX A;  3D39 A;  3PWV A;  1Z5L A;  5HGB A;  1ZVS A;  1IM9 A;  4NNX A;  5HHM A;  3CZF A;  4G42 A;  4MJI A;  2OI9 A;  3O3B A;  1LP9 A;  3SDD A;  1UXW A;  3LN4 A;  3QQ4 A;  3FQU A;  4CW1 A;  3LN5 A;  4PRI A;  1AO7 A;  3HUJ A;  3MRP A;  4IHO A;  1NAN H;  1JFM A;  4X6D A;  3VRJ A;  5D7I A;  4G9F A;  4JFE A;  2YPK A;  4N0U A;  3T1F A;  5F1I A;  4QOK A;  1C16 A;  3TIE A;  1FZM A;  3GMM A;  3LKN A;  1ONQ A;  5E8N A;  1B3J A;  1BQH A;  3GSU A;  4WWK C;  1E27 A;  1QSF A;  2FYY A;  1EFX A;  3MRG A;  2X4P A;  3GSV A;  5EOT A;  4G59 A;  4ZAK A;  1YN6 A;  3FTG A;  3ERY A;  3LKO A;  3RUG A;  1UQS A;  4NQC A;  3IXA A;  4MNQ A;  3BEW A;  3QZW A;  3BH8 A;  5IB3 A;  3D2U A;  3WL9 A;  3T8X A;  3VFU A;  1INQ A;  3TPU E;  4ZFZ A;  1W72 A;  3DX7 A;  1YPZ A;  3KPQ A;  1S7T A;  3W0W A;  5FDW A;  5INC A;  1S9W A;  1CD1 A;  1BII A;  4F7T A;  3BEV A;  3MRO A;  4MJ6 A;  2AKR A;  2AV7 A;  3O3A A;  4N0C A;  1G7P A;  4PJB A;  3SKO A;  2VAB A;  3VXS A;  3GSX A;  4JFQ A;  3OXR A;  2CKB H;  1SYS A;  3MV9 A;  3VFT A;  2ZOL A;  2AK4 A;  3GMP A;  2V2W A;  3S6C A;  3VXU A;  4ZUU A;  5MER A;  4L3C A;  3MRF A;  4HS3 A;  2X4S A;  4Y16 A;  1AGF A;  3CH1 A;  4PJ7 A;  4FFE X;  5B39 A;  5C0E A;  2GUO A;  3WS3 A;  1TVB A;  1T1Y A;  3BO8 A;  3MRC A;  5IB1 A;  4PRD A;  5D2L A;  4EUP A;  1FFO A;  4JFF A;  3M17 A;  1I7T A;  3VFN A;  1LD9 A;  3KYN A;  3VCL A;  4D0D A;  5MEO A;  1VGK A;  1X7Q A;  3GSQ A;  3BH9 A;  3O8X A;  3P77 A;  1DUZ A;  1SYV A;  4PJG A;  5C9J A;  5J6H A;  3O4L A;  4MX7 A;  4APQ A;  5E8P A;  4X6F A;  1KJ3 H;  3MRQ A;  4NNY A;  2ZSV A;  1FZJ A;  3SJV A;  2BVO A;  2V2X A;  1Q94 A;  4HV8 A;  4PP8 C;  5L2K A;  1N2R A;  3ES6 A;  1T21 A;  3MRM A;  3P4O A;  3QUZ A;  4Y4F A;  4CVZ A;  4F7C A;  3DX8 A;  3CCH A;  5AD0 A;  2VAA A;  3MRK A;  4JQX A;  2FWO A;  1T7X A;  3QI9 A;  3QUK A;  2BVP A;  3QDM A;  3TBW A;  2AXF A;  5SWS A;  3AM8 A;  4ZUT A;  4PRB A;  3PWJ A;  1T7W A;  4WUU A;  3QUY A;  2H26 A;  3X14 A;  2BST A;  3FRU A;  5BRZ A;  5IRO A;  1KBG H;  3SDA A;  1ZHL A;  2GTZ A;  4L8B A;  5HHQ A;  4QRS A;  3QUX A;  3TVM A;  3MV8 A;  3QFJ A;  4PGE A;  3FT2 A;  4LHU A;  4NO3 A;  1S7S A;  4HKJ A;  1QLF A;  3ECB A;  4LNR A;  2BNQ A;  1ZAG A;  3CDG A;  2C7U A;  3FQW A;  3VFV A;  3VH8 A;  2P5W A;  4HUX A;  4PV8 A;  4K71 B;  1A6Z A;  1KCG C;  3SDX A;  1PQZ A;  3RWD A;  3QEQ A;  2X70 A;  3HLA A;  1BZ9 A;  3JTT A;  3FT3 A;  2Q7Y A;  3L3K A;  1XR9 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...