3TFKA

42f3-p4b10/h2-ld
Total Genus 52
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
52
sequence length
174
structure length
174
Chain Sequence
b'PHSMRYYETATSRRGLGEPRYTSVGYVDDKEFVRFDSDAENPRYEPQVPWMEQEGPEYWERITQVAKGQEQWFRVNLRTLLGYYNQSAGGTHTLQRMYGCDVGSDGRLLRGYEQFAYDGCDYIALNEDLRTWTAADMAAQITRRKWEQAGAAEYYRAYLEGECVEWLHRYLKNG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords H2-Ld SBM2
publication title T cell receptor signaling is limited by docking geometry to peptide-major histocompatibility complex.
pubmed doi rcsb
source organism Mus musculus
molecule tags Immune system
total genus 52
structure length 174
sequence length 174
ec nomenclature
pdb deposition date 2011-08-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00129 MHC_I Class I Histocompatibility antigen, domains alpha 1 and 2
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.500.10 Alpha Beta 2-Layer Sandwich Murine Class I Major Histocompatibility Complex, H2-DB; Chain A, domain 1 MHC class I-like antigen recognition-like 3tfkA00
2BSRA 3PWNA 4PG9A 3OXRA 1E27A 2AKRA 4LCCC 1FFOA 5C0BA 1S7WA 3HCVA 5IB5A 4PRBA 1QQDA 2C7UA 3RUGA 1YN6A 3L3HA 2D31A 1VACA 4WJ5A 1K5NA 1VGKA 5D5MA 1W0VA 1EEYA 5IB2A 1T80A 4PRHA 4G59A 1ZT4A 1T7YA 3BP4A 1LQVA 3MRIA 4PJCA 1HHJA 1UXSA 4MXQA 3T1FA 3LKSA 4MJ6A 3RZCA 3HAEA 4WO4A 5C0EA 4MQ7A 5E00A 3QFDA 1S7TA 4Y16A 2GUOA 4HWZA 1VADA 3TF7A 4GKNA 3HE6A 4APQA 1B0GA 4U1JA 1LP9A 3O3DA 5ISZA 3VXMA 4F7TA 1K8DA 4V3EB 1A6ZA 4NO0A 4CW1A 4G9FA 2CIIA 1OGTA 1I4FA 2VLJA 3B6SA 4K7FA 5H94A 3VFNA 4PGDA 4PRNA 3SCMA 2HLAA 3DTXA 1SYVA 4Y4HA 1RK1A 3TO4A 5HHMA 1PQZA 4U1KA 2H26A 3C9NA 4HV8A 2HJLA 1A1NA 1CD1A 2FWOA 5C0GA 3L3IA 3DX7A 4PDCE 3AREA 1W0WA 4NQCA 3MV9A 3ILPA 3V5HA 3VXUA 3BP7A 5IB1A 1QEWA 3V5KA 5C09A 3SKOA 1JFMA 1ZHNA 3MRRA 2HN7A 3E6FA 3KWWA 4PJ7A 4MVBA 4ZFZA 5C0JA 3FFCA 4Z78A 5C0FA 1KPUA 2BSTA 4JFDA 1HHHA 1FG2A 3BEVA 3L9RA 4NT6A 4Z76A 4LCYA 3RTQA 2FO4A 5EUOA 3UBXA 4N0FA 2X4NA 1S7XA 2F53A 2ZSWA 3WUWA 1S7SA 3MRQA 3MGOA 1ZSDA 2X4UA 1FFPA 2VLRA 3RWGA 3MGTA 4X6DA 3RL1A 1QO3A 3KPLA 3LKPA 3W0WA 5HYJA 5D7JC 3TIEA 4U6YA 4E0RA 1KTLA 3GSRA 4NQVA 4QRSA 3MRCA 2VABA 3DX6A 1XH3A 4PJAA 1WBXA 4HUXA 4N8VA 3VFUA 1B0RA 4JFPA 5J6HA 5F1IA 3LN4A 4PJIA 3GSQA 4HUVA 1JPFA 2FYYA 3M1BA 4S0UC 1MHEA 4NO5A 3DX8A 3UPRA 1KPRA 1I1YA 4L4VA 4PRDA 2ZOLA 1RJZA 3TBVA 4PJ5A 5SWQA 3TBYA 1L8JA 2VLLA 1IM9A 2XPGA 4JRYA 1ZAGA 2BSSA 3GSUA 3O4LA 3MV7A 1R3HA 1T1XA 3TA3A 1C16A 1E28A 4L9LC 1TVBA 3QFJA 3KPMA 4NO2A 2XFXA 3H9HA 1KJ3H 3BW9A 3JTTA 4IHOA 2MHAA 1JPGA 1WBYA 3SJVA 3NFNA 1S9XA 3D39A 3VFMA 1ZT7A 1HOCA 3W39A 3P73A 3RL2A 1Q94A 3CVHA 5EU4A 2BVPA 4D0CA 2NX5A 3VFTA 4QRQA 3AU1A 1T20A 3SDDA 3SKMA 4ELMA 4PGBA 1LD9A 1HHGA 3ROOA 5C0IA 1N3NA 4Y4KA 3TBTA 1FZOA 4ZUSA 5HGBA 1W72A 1T0NA 4HS3A 4U1NA 2A83A 3CPLA 1T1YA 1KBGH 2X4OA 3JTCA 3MRFA 3CDGA 1FZJA 4N5EA 3PWUA 4IIQC 2BVOA 3OX8A 3RWCA 4CVZA 1NANH 3I6GA 3FRUA 3ES6A 2PO6A 4WU5A 3GJFA 3KXFA 4X6CA 3TBWA 4MS8A 3L3GA 3OXSA 2VLKA 4NNXA 1HYRC 4QRRA 4JQXA 5HGAA 2CLVA 3GMOA 5EU5A 4JFFA 5HHNA 3E6HA 3FQUA 1BIIA 1QR1A 3KPRA 1NAMH 1XR9A 1Z5LA 1ZT1A 3QQ3A 4U1MA 4G8IA 4ZUVA 3MRNA 1QSEA 5C0CA 3H9SA 1I7UA 2AV7A 4F7CA 1RK0A 4PRIA 4PJEA 2X4QA 1EFXA 3MRPA 3M17A 1HHKA 1T21A 5GSRA 5B38A 3VFPA 3KPPA 1S7QA 4PG2A 4CVXA 4F7EA 5FDWA 5F1NA 1MHCA 1JE6A 1ZS8A 1JGDA 1ONQA 1T22A 3BEWA 1AKJA 3PABA 1A1MA 1T1ZA 3VRIA 2FIKA 4HUUA 3VXPA 4LHUA 4HUWA 3GMPA 4MNQA 4U1IA 3ECBA 3GSVA 4JFOA 1N59A 4GUPA 3MRMA 5HGDA 2F54A 3HLAA 3FOMA 3O9WA 4WWKC 2BVQA 4L29A 3LKOA 3MYJA 2HJKA 3L3DA 1N5AA 3GSNH 2ESVA 1FZKA 4E5XA 3QI9A 1X7QA 1AGFA 1U58A 5IEKA 4PR5A 1MWAH 1T7WA 5EFIA 3GMNA 3KPOA 4NO3A 4ZUWA 4ZAKA 2DYPA 4L4TA 4WU7A 3FQWA 4K71B 3RWEA 5FA4A 5BJTA 2GITA 5HGHA 3X11A 3UTSA 1T1WA 3GSXA 3QULA 3QQ4A 4L8BA 3D2UA 3PWJA 2X4RA 3TIDA 1T7VA 1BD2A 5AD0A 1YN7A 2OI9A 3VWJA 5EOTA 1G7QA 5D2LA 3UTTA 3DXAA 3VFVA 3X12A 2X4PA 5JHDA 3PWLA 3X13A 1FZMA 3D3VA 4MNGA 5C07A 1QRNA 3FT2A 3GMQA 2V2WA 4HKJA 5DDHA 3QUYA 4U1HA 3ARGA 3MRGA 4FFEX 3O3EA 5MENA 4IRJA 3O3BA 3P9MA 4WDIA 3QDGA 4U1LA 2BNRA 2F74A 4MJIA 1I1FA 3SPVA 4O2FA 1OSZA 4QRPA 3MR9A 4HX1A 4NQEA 1LEGA 3GMRA 4ONOA 3KYNA 4IRSA 2AV1A 2NW3A 3RWIA 3FONA 3KPNA 5FA3A 4QRTA 4F7MA 2VE6A 3GSOA 2ZOKA 1P1ZA 1T0MA 3MA7A 3B3IA 4PJGA 1DDHA 3LKRA 5D7LA 4PJDA 3VFRA 2GJ6A 1S8DA 2FZ3A 5E8OA 4N0CA 1M6OA 1RJYA 3MRKA 3OV6A 3FT4A 3QUXA 4WW2C 3BZEA 3REWA 1I7TA 1TVHA 3VJ6A 3MREA 4LNRA 1QVOA 5C0AA 3I6KA 1MI5A 1EXUA 1A9BA 1P4LA 3TN0A 3HPJA 3WS3A 4Z77A 5IROA 2E7LE 1EEZA 4XXCA 3VXOA 5E9DA 3ROLA 3P4NA 3AM8A 5J1AA 1GZQA 5MEOA 2P5EA 3ERYA 3HE7A 3RGVC 2YPKA 3V5DA 3TFKA 5BRZA 2ZSVA 5D2NA 1UQSA 1AGDA 3VXNA 2OL3H 3BWAA 4EI5A 2YEZA 4PJHA 3JVGA 4PRPA 1ZHLA 4PV8A 2YPLA 1YDPA 1LDPH 3IXAA 5DEFA 3GMMA 5B39A 5HHQA 4PREA 5EU6A 3VXRA 1JGEA 3FT3A 3P4MA 4UQ3A 1KCGC 1LK2A 3BO8A 5GSVA 1CG9A 5HHOA 1AGBA 3P77A 4Y2DA 5ENWA 3KPSA 3CC5A 1S7VA 3QUKA 4PRAA 1S9WA 4WUUA 1DE4A 4NQDA 4I48A 1DUYA 5HHPA 5IM7A 3VFWA 5F7DA 3SDCA 1LEKA 5MERA 2J8UA 4PJ9A 3MV8A 3HUJA 3P9LA 3C8KA 4NSKA 5ACZA 1OGAA 1FO0H 1P7QA 2V2XA 4U6XA 3DBXA 4F7PA 3KYOA 4LCWA 3T8XA 1T7XA 3QEQA 3RWJA 3BUYA 4O2EA 4PGEA 2CLZA 4JQVA 5IB4A 4G43A 3BGMA 1FFNA 3E3QA 1KJMA 4L3EA 4O2CA 5INCA 2WY3A 2CKBH 1SYSA 2X70A 3ARFA 5EO1A 4PP8C 3SDXA 5D7IA 3LKNA 4Y4FA 5SWZA 5BS0A 3GSWA 4NHUE 4U1SA 3PQYA 3CZFA 3BHBA 3BH8A 4ZUTA 3MRHA 2X4SA 3ARBA 5IVXA 3UTQA 5L2KA 1DUZA 3MROA 3IT8D 3VH8A 3L3JA 3ILQC 4D0DA 1AGCA 1JF1A 5BXFA 1OF2A 4MX7A 4QRUA 3TO2A 3L3KA 4G42A 1KJVA 4MJ5A 5IEHA 4JRXA 1UXWA 3QDMA 1B3JA 2AK4A 1QSFA 1AGEA 3JTSA 1HHIA 1XZ0A 4ZUUA 5EO0A 3U0PA 1KPVA 1S7RA 4L8DA 4UQ2A 4PJBA 3VCLA 3QUZA 5C9JA 3O3AA 3VRJA 4PGCA 1YPZA 3RWFA 3QZWA 2AXFA 2GTWA 5C0DA 3TJHA 5MEPA 2CIKA 1G6RH 3FQRA 2JCCA 1M05A 3VFSA 2CLRA 5E8PA 5DEGA 1IM3A 1CE6A 3TBSA 3QDJA 1HSAA 4GKSA 2Q7YA 4NNYA 2BCKA 5MEQA 3CCHA 4EUPA 3PWPA 3DMMA 4JFEA 5C08A 3BH9A 2PYEA 1NEZA 1T7ZA 3I6LD 5SWSA 3LV3A 4X6EA 3BXNA 4EN3C 1JHTA 3LKQA 1INQA 3FQNA 3X14A 2P5WA 1JUFA 4D0BA 5E8NA 3KPQA 4L8SC 5FKPA 1I1AA 1KJ2H 2GT9A 4QOKA 5E6IC 4X6FA 4JFQA 2BNQA 1ZHKA 3HG1A 4L8CA 4PJFA 3MRBA 3D25A 3E2HA 4N0UA 3WLBA 1S7UA 5J6GA 1XR8A 1ZHBA 1HSBA 2AXGA 3MRDA 1N2RA 5EU3A 1BQHA 3KLAA 4V3DB 3RWDA 5D9SA 3FOLA 3SDAA 3CH1A 3FTGA 3GMLA 1ZVSA 1A1OA 4PV9A 1A9EA 3TVMA 3H7BA 3S6CA 4PJ8A 2X4TA 5L2JA 1I7RA 4I4WA 3ARDA 3FQTA 2UWEA 3FQXA 3WS6A 1ED3A 3D18A 3O8XA 2GAZA 3GIVA 5INDA 1BZ9A 2VAAA 1G7PA 1GZPA 3MRJA 5IB3A 3VWKA 2GTZA 4NQXA 5F9JA 3PWVA 2RFXA 3WL9A 2H6PA 1AO7A 1S9YA 4PJXA 3G08A 4G9DA 3P4OA 3MRLA 4G8GA 4L3CA 4FTVA 3LN5A 3TZVC 3VXSA 1QLFA 3RWHA 3BVNA 1WBZA 3VFOA 3TPUE 1TMCA 3BZFA
chains in the Genus database with same CATH superfamily
2BSRA 3PWNA 4PG9A 3OXRA 1E27A 2AKRA 4LCCC 1FFOA 5C0BA 1S7WA 3HCVA 5IB5A 4PRBA 1QQDA 2C7UA 3RUGA 1YN6A 3L3HA 2D31A 1VACA 4WJ5A 1K5NA 1VGKA 5D5MA 1W0VA 1EEYA 5IB2A 1T80A 4PRHA 4G59A 1ZT4A 1T7YA 3BP4A 1LQVA 3MRIA 4PJCA 1HHJA 1UXSA 4MXQA 3T1FA 3LKSA 4MJ6A 3RZCA 3HAEA 4WO4A 5C0EA 4MQ7A 5E00A 3QFDA 1S7TA 4Y16A 2GUOA 4HWZA 1VADA 3TF7A 4GKNA 3HE6A 4APQA 1B0GA 4U1JA 1LP9A 3O3DA 5ISZA 3VXMA 4F7TA 1K8DA 4V3EB 1A6ZA 4NO0A 4CW1A 4G9FA 2CIIA 1OGTA 1I4FA 2VLJA 3B6SA 4K7FA 5H94A 3VFNA 4PGDA 4PRNA 3SCMA 2HLAA 3DTXA 1SYVA 4Y4HA 1RK1A 3TO4A 5HHMA 1PQZA 4U1KA 2H26A 3C9NA 4HV8A 2HJLA 1A1NA 1CD1A 2FWOA 5C0GA 3L3IA 3DX7A 4PDCE 3AREA 1W0WA 4NQCA 3MV9A 3ILPA 3V5HA 3VXUA 3BP7A 5IB1A 1QEWA 3V5KA 5C09A 3SKOA 1JFMA 1ZHNA 3MRRA 2HN7A 3E6FA 3KWWA 4PJ7A 4MVBA 4ZFZA 5C0JA 3FFCA 4Z78A 5C0FA 1KPUA 2BSTA 4JFDA 1HHHA 1FG2A 3BEVA 3L9RA 4NT6A 4Z76A 4LCYA 3RTQA 2FO4A 5EUOA 3UBXA 4N0FA 2X4NA 1S7XA 2F53A 2ZSWA 3WUWA 1S7SA 3MRQA 3MGOA 1ZSDA 2X4UA 1FFPA 2VLRA 3RWGA 3I0TA 3MGTA 4X6DA 3RL1A 1QO3A 3KPLA 3LKPA 3W0WA 5HYJA 5D7JC 3TIEA 4U6YA 4E0RA 1KTLA 3GSRA 4NQVA 4QRSA 3MRCA 2VABA 3DX6A 1XH3A 4PJAA 1WBXA 4HUXA 4N8VA 3VFUA 1B0RA 4JFPA 5J6HA 5F1IA 3LN4A 4PJIA 3GSQA 4HUVA 1JPFA 2FYYA 3M1BA 4S0UC 1MHEA 4NO5A 3DX8A 3UPRA 1KPRA 1I1YA 4L4VA 4PRDA 2ZOLA 1RJZA 3TBVA 4PJ5A 5SWQA 3TBYA 1L8JA 2VLLA 1IM9A 2XPGA 4JRYA 1ZAGA 2BSSA 3GSUA 3O4LA 3MV7A 1R3HA 1T1XA 3TA3A 1C16A 1E28A 4L9LC 1TVBA 3QFJA 3KPMA 4NO2A 2XFXA 3H9HA 1KJ3H 3BW9A 3JTTA 4IHOA 2MHAA 1JPGA 1WBYA 3SJVA 3NFNA 1S9XA 3D39A 3VFMA 1ZT7A 1HOCA 3W39A 3P73A 3RL2A 1Q94A 3CVHA 5EU4A 2BVPA 4D0CA 2NX5A 3VFTA 4QRQA 3AU1A 1T20A 3SDDA 3SKMA 4ELMA 4PGBA 1LD9A 1HHGA 3ROOA 5C0IA 1N3NA 4Y4KA 3TBTA 1FZOA 4ZUSA 5HGBA 1W72A 1T0NA 4HS3A 4U1NA 2A83A 3CPLA 1T1YA 1KBGH 2X4OA 3JTCA 3MRFA 3CDGA 1FZJA 4N5EA 3PWUA 4IIQC 2BVOA 3OX8A 3RWCA 4CVZA 1NANH 3I6GA 3FRUA 3ES6A 2PO6A 4WU5A 3GJFA 3KXFA 4X6CA 3TBWA 4MS8A 3L3GA 3OXSA 2VLKA 4NNXA 1HYRC 4QRRA 4JQXA 5HGAA 2CLVA 3GMOA 5EU5A 4JFFA 5HHNA 3E6HA 3FQUA 1BIIA 1QR1A 3KPRA 4BKWA 1NAMH 1XR9A 1Z5LA 1ZT1A 3QQ3A 4U1MA 4G8IA 4ZUVA 3MRNA 1QSEA 5C0CA 3H9SA 1I7UA 2AV7A 4F7CA 1RK0A 4PRIA 4PJEA 2X4QA 1EFXA 3MRPA 3M17A 1HHKA 1T21A 5GSRA 5B38A 3VFPA 3KPPA 1S7QA 4PG2A 4CVXA 4F7EA 5FDWA 5F1NA 1MHCA 1JE6A 1ZS8A 1JGDA 1ONQA 1T22A 3BEWA 1AKJA 3PABA 1A1MA 1T1ZA 3VRIA 2FIKA 4HUUA 3VXPA 4LHUA 4HUWA 3GMPA 4MNQA 4U1IA 3ECBA 3GSVA 4JFOA 1N59A 4GUPA 3MRMA 5HGDA 2F54A 3HLAA 3FOMA 3O9WA 4WWKC 2BVQA 4L29A 3LKOA 3MYJA 2HJKA 3L3DA 1N5AA 3GSNH 2ESVA 1FZKA 4E5XA 3QI9A 1X7QA 1AGFA 1U58A 5IEKA 4PR5A 1MWAH 1T7WA 5EFIA 3GMNA 3KPOA 4NO3A 4ZUWA 4ZAKA 2DYPA 4L4TA 4WU7A 3FQWA 4K71B 3RWEA 5FA4A 5BJTA 2GITA 5HGHA 3X11A 3UTSA 1T1WA 3GSXA 3QULA 3QQ4A 4L8BA 3D2UA 3PWJA 2X4RA 3TIDA 1T7VA 1BD2A 5AD0A 1YN7A 2OI9A 3VWJA 5EOTA 1G7QA 5D2LA 3UTTA 3DXAA 3VFVA 3X12A 2X4PA 5JHDA 3PWLA 3X13A 1FZMA 3D3VA 4MNGA 5C07A 1QRNA 3FT2A 3GMQA 2V2WA 4HKJA 5DDHA 3QUYA 4U1HA 3ARGA 3MRGA 4FFEX 3O3EA 5MENA 4IRJA 3O3BA 3P9MA 4WDIA 3QDGA 4U1LA 2BNRA 2F74A 4MJIA 1I1FA 3SPVA 4O2FA 1OSZA 4QRPA 3MR9A 4HX1A 4NQEA 1LEGA 3GMRA 4ONOA 3KYNA 4IRSA 2AV1A 2NW3A 3RWIA 3FONA 3KPNA 5FA3A 4QRTA 4F7MA 2VE6A 3GSOA 2ZOKA 1P1ZA 1T0MA 3MA7A 3B3IA 4PJGA 2IA1A 1DDHA 3LKRA 5D7LA 4PJDA 3VFRA 2GJ6A 1S8DA 2FZ3A 5E8OA 4N0CA 1M6OA 1RJYA 3MRKA 3OV6A 3FT4A 3QUXA 4WW2C 3BZEA 3REWA 1I7TA 1TVHA 3VJ6A 3MREA 4LNRA 1QVOA 5C0AA 3I6KA 1MI5A 1EXUA 1A9BA 1P4LA 3TN0A 3HPJA 3WS3A 4Z77A 5IROA 2E7LE 1EEZA 4XXCA 3VXOA 5E9DA 3ROLA 3P4NA 3AM8A 5J1AA 1GZQA 5MEOA 2P5EA 3ERYA 3HE7A 3RGVC 2YPKA 3V5DA 3TFKA 5BRZA 2ZSVA 5D2NA 1UQSA 1AGDA 3VXNA 2OL3H 3BWAA 4EI5A 2YEZA 4PJHA 3JVGA 4PRPA 1ZHLA 4PV8A 2YPLA 1YDPA 1LDPH 3IXAA 5DEFA 3GMMA 5B39A 5HHQA 4PREA 5EU6A 3VXRA 1JGEA 3FT3A 3P4MA 4UQ3A 1KCGC 1LK2A 3BO8A 5GSVA 1CG9A 5HHOA 1AGBA 3P77A 4Y2DA 5ENWA 3KPSA 3CC5A 1S7VA 3QUKA 4PRAA 1S9WA 4WUUA 1DE4A 4NQDA 4I48A 1DUYA 5HHPA 5IM7A 3VFWA 5F7DA 3SDCA 1LEKA 5MERA 2J8UA 4PJ9A 3MV8A 3HUJA 3P9LA 3C8KA 4NSKA 5ACZA 1OGAA 1FO0H 1P7QA 2V2XA 4U6XA 3DBXA 4F7PA 3KYOA 4LCWA 3T8XA 4JO8A 1T7XA 3QEQA 3RWJA 3BUYA 4O2EA 4PGEA 2CLZA 4JQVA 5IB4A 4G43A 3BGMA 1FFNA 3E3QA 1KJMA 4L3EA 4O2CA 5INCA 2WY3A 2CKBH 1SYSA 2X70A 3ARFA 5EO1A 4PP8C 3SDXA 5D7IA 3LKNA 4Y4FA 5SWZA 5BS0A 3GSWA 4NHUE 4U1SA 3PQYA 3CZFA 3BHBA 3BH8A 4ZUTA 3MRHA 2X4SA 3ARBA 5IVXA 3UTQA 5L2KA 1DUZA 3MROA 3IT8D 3VH8A 3L3JA 3ILQC 4D0DA 1AGCA 1JF1A 5BXFA 1OF2A 4MX7A 2NYKA 4QRUA 3TO2A 3L3KA 4G42A 1KJVA 4MJ5A 5IEHA 4JRXA 1UXWA 3QDMA 1B3JA 2AK4A 1QSFA 1AGEA 3JTSA 1HHIA 1XZ0A 4ZUUA 5EO0A 3U0PA 1KPVA 1S7RA 4L8DA 4UQ2A 4PJBA 3VCLA 3QUZA 5C9JA 3O3AA 3VRJA 4PGCA 1YPZA 3RWFA 3QZWA 2AXFA 2GTWA 5C0DA 3TJHA 5MEPA 2CIKA 1G6RH 3FQRA 2JCCA 1M05A 3VFSA 2CLRA 5E8PA 5DEGA 1IM3A 1CE6A 3TBSA 3QDJA 1HSAA 4GKSA 2Q7YA 4G59C 4NNYA 2BCKA 5MEQA 3CCHA 4EUPA 3PWPA 3DMMA 4JFEA 5C08A 3BH9A 2PYEA 1NEZA 1T7ZA 3I6LD 5SWSA 3LV3A 4X6EA 3BXNA 4EN3C 1JHTA 3LKQA 1INQA 3FQNA 3X14A 2P5WA 1JUFA 4D0BA 5E8NA 3KPQA 4L8SC 5FKPA 1I1AA 1KJ2H 2GT9A 4QOKA 5E6IC 4X6FA 4JFQA 2BNQA 1ZHKA 3HG1A 4L8CA 4PJFA 3MRBA 3D25A 3E2HA 4N0UA 3WLBA 1S7UA 5J6GA 1XR8A 2O5NA 1ZHBA 1HSBA 2AXGA 3MRDA 1N2RA 5EU3A 1BQHA 3KLAA 4V3DB 3RWDA 5D9SA 3FOLA 3SDAA 3CH1A 3FTGA 3GMLA 1ZVSA 1A1OA 4PV9A 1A9EA 3TVMA 3H7BA 3S6CA 4PJ8A 2X4TA 5L2JA 1I7RA 4I4WA 3ARDA 3FQTA 2UWEA 3FQXA 3WS6A 1ED3A 3D18A 3O8XA 2GAZA 3GIVA 5INDA 1BZ9A 2VAAA 1G7PA 1GZPA 3MRJA 5IB3A 3VWKA 2GTZA 4NQXA 5F9JA 3PWVA 2RFXA 3WL9A 2H6PA 1AO7A 1S9YA 4PJXA 3G08A 4G9DA 3P4OA 3MRLA 4G8GA 4L3CA 4FTVA 3LN5A 3TZVC 3VXSA 1QLFA 3RWHA 3BVNA 1WBZA 3VFOA 3TPUE 1TMCA 3BZFA
chains in the Genus database with same CATH topology
2BSRA 3PWNA 4PG9A 3OXRA 1E27A 2AKRA 4LCCC 1FFOA 5C0BA 1S7WA 3HCVA 5IB5A 4PRBA 1QQDA 2C7UA 3RUGA 1YN6A 3L3HA 2D31A 1VACA 4WJ5A 1K5NA 1VGKA 5D5MA 1W0VA 1EEYA 5IB2A 1T80A 4PRHA 4G59A 1ZT4A 1T7YA 3BP4A 1LQVA 3MRIA 4PJCA 1HHJA 1UXSA 4MXQA 3T1FA 3LKSA 4MJ6A 3RZCA 3HAEA 4WO4A 5C0EA 4MQ7A 5E00A 3QFDA 1S7TA 4Y16A 2GUOA 4HWZA 1VADA 3TF7A 4GKNA 3HE6A 4APQA 1B0GA 4U1JA 1LP9A 3O3DA 5ISZA 3VXMA 4F7TA 1K8DA 4V3EB 1A6ZA 4NO0A 4CW1A 4G9FA 2CIIA 1OGTA 1I4FA 2VLJA 3B6SA 4K7FA 5H94A 3VFNA 4PGDA 4PRNA 3SCMA 2HLAA 3DTXA 1SYVA 4Y4HA 1RK1A 3TO4A 5HHMA 1PQZA 4U1KA 2H26A 3C9NA 4HV8A 2HJLA 1A1NA 1CD1A 2FWOA 5C0GA 3L3IA 3DX7A 4PDCE 3AREA 1W0WA 4NQCA 3MV9A 3ILPA 3V5HA 3VXUA 3BP7A 5IB1A 1QEWA 3V5KA 5C09A 3SKOA 1JFMA 1ZHNA 3MRRA 2HN7A 3E6FA 3KWWA 4PJ7A 4MVBA 4ZFZA 5C0JA 3FFCA 4Z78A 5C0FA 1KPUA 2BSTA 4JFDA 1HHHA 1FG2A 3BEVA 3L9RA 4NT6A 4Z76A 4LCYA 3RTQA 2FO4A 5EUOA 3UBXA 4N0FA 2X4NA 1S7XA 2F53A 2ZSWA 3WUWA 1S7SA 3MRQA 3MGOA 1ZSDA 2X4UA 1FFPA 2VLRA 3RWGA 3MGTA 4X6DA 3RL1A 1QO3A 3KPLA 3LKPA 3W0WA 5HYJA 5D7JC 3TIEA 4U6YA 4E0RA 1KTLA 3GSRA 4NQVA 4QRSA 3MRCA 2VABA 3DX6A 1XH3A 4PJAA 1WBXA 4HUXA 4N8VA 3VFUA 1B0RA 4JFPA 5J6HA 5F1IA 3LN4A 4PJIA 3GSQA 4HUVA 1JPFA 2FYYA 3M1BA 4S0UC 1MHEA 4NO5A 3DX8A 3UPRA 1KPRA 1I1YA 4L4VA 4PRDA 2ZOLA 1RJZA 3TBVA 4PJ5A 5SWQA 3TBYA 1L8JA 2VLLA 1IM9A 2XPGA 4JRYA 1ZAGA 2BSSA 3GSUA 3O4LA 3MV7A 1R3HA 1T1XA 3TA3A 1C16A 1E28A 4L9LC 1TVBA 3QFJA 3KPMA 4NO2A 2XFXA 3H9HA 1KJ3H 3BW9A 3JTTA 4IHOA 2MHAA 1JPGA 1WBYA 3SJVA 3NFNA 1S9XA 3D39A 3VFMA 1ZT7A 1HOCA 3W39A 3P73A 3RL2A 1Q94A 3CVHA 5EU4A 2BVPA 4D0CA 2NX5A 3VFTA 4QRQA 3AU1A 1T20A 3SDDA 3SKMA 4ELMA 4PGBA 1LD9A 1HHGA 3ROOA 5C0IA 1N3NA 4Y4KA 3TBTA 1FZOA 4ZUSA 5HGBA 1W72A 1T0NA 4HS3A 4U1NA 2A83A 3CPLA 1T1YA 1KBGH 2X4OA 3JTCA 3MRFA 3CDGA 1FZJA 4N5EA 3PWUA 4IIQC 2BVOA 3OX8A 3RWCA 4CVZA 1NANH 3I6GA 3FRUA 3ES6A 2PO6A 4WU5A 3GJFA 3KXFA 4X6CA 3TBWA 4MS8A 3L3GA 3OXSA 2VLKA 4NNXA 1HYRC 4QRRA 4JQXA 5HGAA 2CLVA 3GMOA 5EU5A 4JFFA 5HHNA 3E6HA 3FQUA 1BIIA 1QR1A 3KPRA 1NAMH 1XR9A 1Z5LA 1ZT1A 3QQ3A 4U1MA 4G8IA 4ZUVA 3MRNA 1QSEA 5C0CA 3H9SA 1I7UA 2AV7A 4F7CA 1RK0A 4PRIA 4PJEA 2X4QA 1EFXA 3MRPA 3M17A 1HHKA 1T21A 5GSRA 5B38A 3VFPA 3KPPA 1S7QA 4PG2A 4CVXA 4F7EA 5FDWA 5F1NA 1MHCA 1JE6A 1ZS8A 1JGDA 1ONQA 1T22A 3BEWA 1AKJA 3PABA 1A1MA 1T1ZA 3VRIA 2FIKA 4HUUA 3VXPA 4LHUA 4HUWA 3GMPA 4MNQA 4U1IA 3ECBA 3GSVA 4JFOA 1N59A 4GUPA 3MRMA 5HGDA 2F54A 3HLAA 3FOMA 3O9WA 4WWKC 2BVQA 4L29A 3LKOA 3MYJA 2HJKA 3L3DA 1N5AA 3GSNH 2ESVA 1FZKA 4E5XA 3QI9A 1X7QA 1AGFA 1U58A 5IEKA 4PR5A 1MWAH 1T7WA 5EFIA 3GMNA 3KPOA 4NO3A 4ZUWA 4ZAKA 2DYPA 4L4TA 4WU7A 3FQWA 4K71B 3RWEA 5FA4A 5BJTA 2GITA 5HGHA 3X11A 3UTSA 1T1WA 3GSXA 3QULA 3QQ4A 4L8BA 3D2UA 3PWJA 2X4RA 3TIDA 1T7VA 1BD2A 5AD0A 1YN7A 2OI9A 3VWJA 5EOTA 1G7QA 5D2LA 3UTTA 3DXAA 3VFVA 3X12A 2X4PA 5JHDA 3PWLA 3X13A 1FZMA 3D3VA 4MNGA 5C07A 1QRNA 3FT2A 3GMQA 2V2WA 4HKJA 5DDHA 3QUYA 4U1HA 3ARGA 3MRGA 4FFEX 3O3EA 5MENA 4IRJA 3O3BA 3P9MA 4WDIA 3QDGA 4U1LA 2BNRA 2F74A 4MJIA 1I1FA 3SPVA 4O2FA 1OSZA 4QRPA 3MR9A 4HX1A 4NQEA 1LEGA 3GMRA 4ONOA 3KYNA 4IRSA 2AV1A 2NW3A 3RWIA 3FONA 3KPNA 5FA3A 4QRTA 4F7MA 2VE6A 3GSOA 2ZOKA 1P1ZA 1T0MA 3MA7A 3B3IA 4PJGA 1DDHA 3LKRA 5D7LA 4PJDA 3VFRA 2GJ6A 1S8DA 2FZ3A 5E8OA 4N0CA 1M6OA 1RJYA 3MRKA 3OV6A 3FT4A 3QUXA 4WW2C 3BZEA 3REWA 1I7TA 1TVHA 3VJ6A 3MREA 4LNRA 1QVOA 5C0AA 3I6KA 1MI5A 1EXUA 1A9BA 1P4LA 3TN0A 3HPJA 3WS3A 4Z77A 5IROA 2E7LE 1EEZA 4XXCA 3VXOA 5E9DA 3ROLA 3P4NA 3AM8A 5J1AA 1GZQA 5MEOA 2P5EA 3ERYA 3HE7A 3RGVC 2YPKA 3V5DA 3TFKA 5BRZA 2ZSVA 5D2NA 1UQSA 1AGDA 3VXNA 2OL3H 3BWAA 4EI5A 2YEZA 4PJHA 3JVGA 4PRPA 1ZHLA 4PV8A 2YPLA 1YDPA 1LDPH 3IXAA 5DEFA 3GMMA 5B39A 5HHQA 4PREA 5EU6A 3VXRA 1JGEA 3FT3A 3P4MA 4UQ3A 1KCGC 1LK2A 3BO8A 5GSVA 1CG9A 5HHOA 1AGBA 3P77A 4Y2DA 5ENWA 3KPSA 3CC5A 1S7VA 3QUKA 4PRAA 1S9WA 4WUUA 1DE4A 4NQDA 4I48A 1DUYA 5HHPA 5IM7A 3VFWA 5F7DA 3SDCA 1LEKA 5MERA 2J8UA 4PJ9A 3MV8A 3HUJA 3P9LA 3C8KA 4NSKA 5ACZA 1OGAA 1FO0H 1P7QA 2V2XA 4U6XA 3DBXA 4F7PA 3KYOA 4LCWA 3T8XA 1T7XA 3QEQA 3RWJA 3BUYA 4O2EA 4PGEA 2CLZA 4JQVA 5IB4A 4G43A 3BGMA 1FFNA 3E3QA 1KJMA 4L3EA 4O2CA 5INCA 2WY3A 2CKBH 1SYSA 2X70A 3ARFA 5EO1A 4PP8C 3SDXA 5D7IA 3LKNA 4Y4FA 5SWZA 5BS0A 3GSWA 4NHUE 4U1SA 3PQYA 3CZFA 3BHBA 3BH8A 4ZUTA 3MRHA 2X4SA 3ARBA 5IVXA 3UTQA 5L2KA 1DUZA 3MROA 3IT8D 3VH8A 3L3JA 3ILQC 4D0DA 1AGCA 1JF1A 5BXFA 1OF2A 4MX7A 4QRUA 3TO2A 3L3KA 4G42A 1KJVA 4MJ5A 5IEHA 4JRXA 1UXWA 3QDMA 1B3JA 2AK4A 1QSFA 1AGEA 3JTSA 1HHIA 1XZ0A 4ZUUA 5EO0A 3U0PA 1KPVA 1S7RA 4L8DA 4UQ2A 4PJBA 3VCLA 3QUZA 5C9JA 3O3AA 3VRJA 4PGCA 1YPZA 3RWFA 3QZWA 2AXFA 2GTWA 5C0DA 3TJHA 5MEPA 2CIKA 1G6RH 3FQRA 2JCCA 1M05A 3VFSA 2CLRA 5E8PA 5DEGA 1IM3A 1CE6A 3TBSA 3QDJA 1HSAA 4GKSA 2Q7YA 4NNYA 2BCKA 5MEQA 3CCHA 4EUPA 3PWPA 3DMMA 4JFEA 5C08A 3BH9A 2PYEA 1NEZA 1T7ZA 3I6LD 5SWSA 3LV3A 4X6EA 3BXNA 4EN3C 1JHTA 3LKQA 1INQA 3FQNA 3X14A 2P5WA 1JUFA 4D0BA 5E8NA 3KPQA 4L8SC 5FKPA 1I1AA 1KJ2H 2GT9A 4QOKA 5E6IC 4X6FA 4JFQA 2BNQA 1ZHKA 3HG1A 4L8CA 4PJFA 3MRBA 3D25A 3E2HA 4N0UA 3WLBA 1S7UA 5J6GA 1XR8A 1ZHBA 1HSBA 2AXGA 3MRDA 1N2RA 5EU3A 1BQHA 3KLAA 4V3DB 3RWDA 5D9SA 3FOLA 3SDAA 3CH1A 3FTGA 3GMLA 1ZVSA 1A1OA 4PV9A 1A9EA 3TVMA 3H7BA 3S6CA 4PJ8A 2X4TA 5L2JA 1I7RA 4I4WA 3ARDA 3FQTA 2UWEA 3FQXA 3WS6A 1ED3A 3D18A 3O8XA 2GAZA 3GIVA 5INDA 1BZ9A 2VAAA 1G7PA 1GZPA 3MRJA 5IB3A 3VWKA 2GTZA 4NQXA 5F9JA 3PWVA 2RFXA 3WL9A 2H6PA 1AO7A 1S9YA 4PJXA 3G08A 4G9DA 3P4OA 3MRLA 4G8GA 4L3CA 4FTVA 3LN5A 3TZVC 3VXSA 1QLFA 3RWHA 3BVNA 1WBZA 3VFOA 3TPUE 1TMCA 3BZFA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2BSR A;  3PWN A;  4PG9 A;  3OXR A;  1E27 A;  2AKR A;  4LCC C;  1FFO A;  5C0B A;  1S7W A;  3HCV A;  5IB5 A;  4PRB A;  1QQD A;  2C7U A;  3RUG A;  1YN6 A;  3L3H A;  2D31 A;  1VAC A;  4WJ5 A;  1K5N A;  1VGK A;  5D5M A;  1W0V A;  1EEY A;  5IB2 A;  1T80 A;  4PRH A;  4G59 A;  1ZT4 A;  1T7Y A;  3BP4 A;  1LQV A;  3MRI A;  4PJC A;  1HHJ A;  1UXS A;  4MXQ A;  3T1F A;  3LKS A;  4MJ6 A;  3RZC A;  3HAE A;  4WO4 A;  5C0E A;  4MQ7 A;  5E00 A;  3QFD A;  1S7T A;  4Y16 A;  2GUO A;  4HWZ A;  1VAD A;  3TF7 A;  4GKN A;  3HE6 A;  4APQ A;  1B0G A;  4U1J A;  1LP9 A;  3O3D A;  5ISZ A;  3VXM A;  4F7T A;  1K8D A;  4V3E B;  1A6Z A;  4NO0 A;  4CW1 A;  4G9F A;  2CII A;  1OGT A;  1I4F A;  2VLJ A;  3B6S A;  4K7F A;  5H94 A;  3VFN A;  4PGD A;  4PRN A;  3SCM A;  2HLA A;  3DTX A;  1SYV A;  4Y4H A;  1RK1 A;  3TO4 A;  5HHM A;  1PQZ A;  4U1K A;  2H26 A;  3C9N A;  4HV8 A;  2HJL A;  1A1N A;  1CD1 A;  2FWO A;  5C0G A;  3L3I A;  3DX7 A;  4PDC E;  3ARE A;  1W0W A;  4NQC A;  3MV9 A;  3ILP A;  3V5H A;  3VXU A;  3BP7 A;  5IB1 A;  1QEW A;  3V5K A;  5C09 A;  3SKO A;  1JFM A;  1ZHN A;  3MRR A;  2HN7 A;  3E6F A;  3KWW A;  4PJ7 A;  4MVB A;  4ZFZ A;  5C0J A;  3FFC A;  4Z78 A;  5C0F A;  1KPU A;  2BST A;  4JFD A;  1HHH A;  1FG2 A;  3BEV A;  3L9R A;  4NT6 A;  4Z76 A;  4LCY A;  3RTQ A;  2FO4 A;  5EUO A;  3UBX A;  4N0F A;  2X4N A;  1S7X A;  2F53 A;  2ZSW A;  3WUW A;  1S7S A;  3MRQ A;  3MGO A;  1ZSD A;  2X4U A;  1FFP A;  2VLR A;  3RWG A;  3MGT A;  4X6D A;  3RL1 A;  1QO3 A;  3KPL A;  3LKP A;  3W0W A;  5HYJ A;  5D7J C;  3TIE A;  4U6Y A;  4E0R A;  1KTL A;  3GSR A;  4NQV A;  4QRS A;  3MRC A;  2VAB A;  3DX6 A;  1XH3 A;  4PJA A;  1WBX A;  4HUX A;  4N8V A;  3VFU A;  1B0R A;  4JFP A;  5J6H A;  5F1I A;  3LN4 A;  4PJI A;  3GSQ A;  4HUV A;  1JPF A;  2FYY A;  3M1B A;  4S0U C;  1MHE A;  4NO5 A;  3DX8 A;  3UPR A;  1KPR A;  1I1Y A;  4L4V A;  4PRD A;  2ZOL A;  1RJZ A;  3TBV A;  4PJ5 A;  5SWQ A;  3TBY A;  1L8J A;  2VLL A;  1IM9 A;  2XPG A;  4JRY A;  1ZAG A;  2BSS A;  3GSU A;  3O4L A;  3MV7 A;  1R3H A;  1T1X A;  3TA3 A;  1C16 A;  1E28 A;  4L9L C;  1TVB A;  3QFJ A;  3KPM A;  4NO2 A;  2XFX A;  3H9H A;  1KJ3 H;  3BW9 A;  3JTT A;  4IHO A;  2MHA A;  1JPG A;  1WBY A;  3SJV A;  3NFN A;  1S9X A;  3D39 A;  3VFM A;  1ZT7 A;  1HOC A;  3W39 A;  3P73 A;  3RL2 A;  1Q94 A;  3CVH A;  5EU4 A;  2BVP A;  4D0C A;  2NX5 A;  3VFT A;  4QRQ A;  3AU1 A;  1T20 A;  3SDD A;  3SKM A;  4ELM A;  4PGB A;  1LD9 A;  1HHG A;  3ROO A;  5C0I A;  1N3N A;  4Y4K A;  3TBT A;  1FZO A;  4ZUS A;  5HGB A;  1W72 A;  1T0N A;  4HS3 A;  4U1N A;  2A83 A;  3CPL A;  1T1Y A;  1KBG H;  2X4O A;  3JTC A;  3MRF A;  3CDG A;  1FZJ A;  4N5E A;  3PWU A;  4IIQ C;  2BVO A;  3OX8 A;  3RWC A;  4CVZ A;  1NAN H;  3I6G A;  3FRU A;  3ES6 A;  2PO6 A;  4WU5 A;  3GJF A;  3KXF A;  4X6C A;  3TBW A;  4MS8 A;  3L3G A;  3OXS A;  2VLK A;  4NNX A;  1HYR C;  4QRR A;  4JQX A;  5HGA A;  2CLV A;  3GMO A;  5EU5 A;  4JFF A;  5HHN A;  3E6H A;  3FQU A;  1BII A;  1QR1 A;  3KPR A;  1NAM H;  1XR9 A;  1Z5L A;  1ZT1 A;  3QQ3 A;  4U1M A;  4G8I A;  4ZUV A;  3MRN A;  1QSE A;  5C0C A;  3H9S A;  1I7U A;  2AV7 A;  4F7C A;  1RK0 A;  4PRI A;  4PJE A;  2X4Q A;  1EFX A;  3MRP A;  3M17 A;  1HHK A;  1T21 A;  5GSR A;  5B38 A;  3VFP A;  3KPP A;  1S7Q A;  4PG2 A;  4CVX A;  4F7E A;  5FDW A;  5F1N A;  1MHC A;  1JE6 A;  1ZS8 A;  1JGD A;  1ONQ A;  1T22 A;  3BEW A;  1AKJ A;  3PAB A;  1A1M A;  1T1Z A;  3VRI A;  2FIK A;  4HUU A;  3VXP A;  4LHU A;  4HUW A;  3GMP A;  4MNQ A;  4U1I A;  3ECB A;  3GSV A;  4JFO A;  1N59 A;  4GUP A;  3MRM A;  5HGD A;  2F54 A;  3HLA A;  3FOM A;  3O9W A;  4WWK C;  2BVQ A;  4L29 A;  3LKO A;  3MYJ A;  2HJK A;  3L3D A;  1N5A A;  3GSN H;  2ESV A;  1FZK A;  4E5X A;  3QI9 A;  1X7Q A;  1AGF A;  1U58 A;  5IEK A;  4PR5 A;  1MWA H;  1T7W A;  5EFI A;  3GMN A;  3KPO A;  4NO3 A;  4ZUW A;  4ZAK A;  2DYP A;  4L4T A;  4WU7 A;  3FQW A;  4K71 B;  3RWE A;  5FA4 A;  5BJT A;  2GIT A;  5HGH A;  3X11 A;  3UTS A;  1T1W A;  3GSX A;  3QUL A;  3QQ4 A;  4L8B A;  3D2U A;  3PWJ A;  2X4R A;  3TID A;  1T7V A;  1BD2 A;  5AD0 A;  1YN7 A;  2OI9 A;  3VWJ A;  5EOT A;  1G7Q A;  5D2L A;  3UTT A;  3DXA A;  3VFV A;  3X12 A;  2X4P A;  5JHD A;  3PWL A;  3X13 A;  1FZM A;  3D3V A;  4MNG A;  5C07 A;  1QRN A;  3FT2 A;  3GMQ A;  2V2W A;  4HKJ A;  5DDH A;  3QUY A;  4U1H A;  3ARG A;  3MRG A;  4FFE X;  3O3E A;  5MEN A;  4IRJ A;  3O3B A;  3P9M A;  4WDI A;  3QDG A;  4U1L A;  2BNR A;  2F74 A;  4MJI A;  1I1F A;  3SPV A;  4O2F A;  1OSZ A;  4QRP A;  3MR9 A;  4HX1 A;  4NQE A;  1LEG A;  3GMR A;  4ONO A;  3KYN A;  4IRS A;  2AV1 A;  2NW3 A;  3RWI A;  3FON A;  3KPN A;  5FA3 A;  4QRT A;  4F7M A;  2VE6 A;  3GSO A;  2ZOK A;  1P1Z A;  1T0M A;  3MA7 A;  3B3I A;  4PJG A;  1DDH A;  3LKR A;  5D7L A;  4PJD A;  3VFR A;  2GJ6 A;  1S8D A;  2FZ3 A;  5E8O A;  4N0C A;  1M6O A;  1RJY A;  3MRK A;  3OV6 A;  3FT4 A;  3QUX A;  4WW2 C;  3BZE A;  3REW A;  1I7T A;  1TVH A;  3VJ6 A;  3MRE A;  4LNR A;  1QVO A;  5C0A A;  3I6K A;  1MI5 A;  1EXU A;  1A9B A;  1P4L A;  3TN0 A;  3HPJ A;  3WS3 A;  4Z77 A;  5IRO A;  2E7L E;  1EEZ A;  4XXC A;  3VXO A;  5E9D A;  3ROL A;  3P4N A;  3AM8 A;  5J1A A;  1GZQ A;  5MEO A;  2P5E A;  3ERY A;  3HE7 A;  3RGV C;  2YPK A;  3V5D A;  3TFK A;  5BRZ A;  2ZSV A;  5D2N A;  1UQS A;  1AGD A;  3VXN A;  2OL3 H;  3BWA A;  4EI5 A;  2YEZ A;  4PJH A;  3JVG A;  4PRP A;  1ZHL A;  4PV8 A;  2YPL A;  1YDP A;  1LDP H;  3IXA A;  5DEF A;  3GMM A;  5B39 A;  5HHQ A;  4PRE A;  5EU6 A;  3VXR A;  1JGE A;  3FT3 A;  3P4M A;  4UQ3 A;  1KCG C;  1LK2 A;  3BO8 A;  5GSV A;  1CG9 A;  5HHO A;  1AGB A;  3P77 A;  4Y2D A;  5ENW A;  3KPS A;  3CC5 A;  1S7V A;  3QUK A;  4PRA A;  1S9W A;  4WUU A;  1DE4 A;  4NQD A;  4I48 A;  1DUY A;  5HHP A;  5IM7 A;  3VFW A;  5F7D A;  3SDC A;  1LEK A;  5MER A;  2J8U A;  4PJ9 A;  3MV8 A;  3HUJ A;  3P9L A;  3C8K A;  4NSK A;  5ACZ A;  1OGA A;  1FO0 H;  1P7Q A;  2V2X A;  4U6X A;  3DBX A;  4F7P A;  3KYO A;  4LCW A;  3T8X A;  1T7X A;  3QEQ A;  3RWJ A;  3BUY A;  4O2E A;  4PGE A;  2CLZ A;  4JQV A;  5IB4 A;  4G43 A;  3BGM A;  1FFN A;  3E3Q A;  1KJM A;  4L3E A;  4O2C A;  5INC A;  2WY3 A;  2CKB H;  1SYS A;  2X70 A;  3ARF A;  5EO1 A;  4PP8 C;  3SDX A;  5D7I A;  3LKN A;  4Y4F A;  5SWZ A;  5BS0 A;  3GSW A;  4NHU E;  4U1S A;  3PQY A;  3CZF A;  3BHB A;  3BH8 A;  4ZUT A;  3MRH A;  2X4S A;  3ARB A;  5IVX A;  3UTQ A;  5L2K A;  1DUZ A;  3MRO A;  3IT8 D;  3VH8 A;  3L3J A;  3ILQ C;  4D0D A;  1AGC A;  1JF1 A;  5BXF A;  1OF2 A;  4MX7 A;  4QRU A;  3TO2 A;  3L3K A;  4G42 A;  1KJV A;  4MJ5 A;  5IEH A;  4JRX A;  1UXW A;  3QDM A;  1B3J A;  2AK4 A;  1QSF A;  1AGE A;  3JTS A;  1HHI A;  1XZ0 A;  4ZUU A;  5EO0 A;  3U0P A;  1KPV A;  1S7R A;  4L8D A;  4UQ2 A;  4PJB A;  3VCL A;  3QUZ A;  5C9J A;  3O3A A;  3VRJ A;  4PGC A;  1YPZ A;  3RWF A;  3QZW A;  2AXF A;  2GTW A;  5C0D A;  3TJH A;  5MEP A;  2CIK A;  1G6R H;  3FQR A;  2JCC A;  1M05 A;  3VFS A;  2CLR A;  5E8P A;  5DEG A;  1IM3 A;  1CE6 A;  3TBS A;  3QDJ A;  1HSA A;  4GKS A;  2Q7Y A;  4NNY A;  2BCK A;  5MEQ A;  3CCH A;  4EUP A;  3PWP A;  3DMM A;  4JFE A;  5C08 A;  3BH9 A;  2PYE A;  1NEZ A;  1T7Z A;  3I6L D;  5SWS A;  3LV3 A;  4X6E A;  3BXN A;  4EN3 C;  1JHT A;  3LKQ A;  1INQ A;  3FQN A;  3X14 A;  2P5W A;  1JUF A;  4D0B A;  5E8N A;  3KPQ A;  4L8S C;  5FKP A;  1I1A A;  1KJ2 H;  2GT9 A;  4QOK A;  5E6I C;  4X6F A;  4JFQ A;  2BNQ A;  1ZHK A;  3HG1 A;  4L8C A;  4PJF A;  3MRB A;  3D25 A;  3E2H A;  4N0U A;  3WLB A;  1S7U A;  5J6G A;  1XR8 A;  1ZHB A;  1HSB A;  2AXG A;  3MRD A;  1N2R A;  5EU3 A;  1BQH A;  3KLA A;  4V3D B;  3RWD A;  5D9S A;  3FOL A;  3SDA A;  3CH1 A;  3FTG A;  3GML A;  1ZVS A;  1A1O A;  4PV9 A;  1A9E A;  3TVM A;  3H7B A;  3S6C A;  4PJ8 A;  2X4T A;  5L2J A;  1I7R A;  4I4W A;  3ARD A;  3FQT A;  2UWE A;  3FQX A;  3WS6 A;  1ED3 A;  3D18 A;  3O8X A;  2GAZ A;  3GIV A;  5IND A;  1BZ9 A;  2VAA A;  1G7P A;  1GZP A;  3MRJ A;  5IB3 A;  3VWK A;  2GTZ A;  4NQX A;  5F9J A;  3PWV A;  2RFX A;  3WL9 A;  2H6P A;  1AO7 A;  1S9Y A;  4PJX A;  3G08 A;  4G9D A;  3P4O A;  3MRL A;  4G8G A;  4L3C A;  4FTV A;  3LN5 A;  3TZV C;  3VXS A;  1QLF A;  3RWH A;  3BVN A;  1WBZ A;  3VFO A;  3TPU E;  1TMC A;  3BZF A; 
#chains in the Genus database with same CATH topology
 2BSR A;  3PWN A;  4PG9 A;  3OXR A;  1E27 A;  2AKR A;  4LCC C;  1FFO A;  5C0B A;  1S7W A;  3HCV A;  5IB5 A;  4PRB A;  1QQD A;  2C7U A;  3RUG A;  1YN6 A;  3L3H A;  2D31 A;  1VAC A;  4WJ5 A;  1K5N A;  1VGK A;  5D5M A;  1W0V A;  1EEY A;  5IB2 A;  1T80 A;  4PRH A;  4G59 A;  1ZT4 A;  1T7Y A;  3BP4 A;  1LQV A;  3MRI A;  4PJC A;  1HHJ A;  1UXS A;  4MXQ A;  3T1F A;  3LKS A;  4MJ6 A;  3RZC A;  3HAE A;  4WO4 A;  5C0E A;  4MQ7 A;  5E00 A;  3QFD A;  1S7T A;  4Y16 A;  2GUO A;  4HWZ A;  1VAD A;  3TF7 A;  4GKN A;  3HE6 A;  4APQ A;  1B0G A;  4U1J A;  1LP9 A;  3O3D A;  5ISZ A;  3VXM A;  4F7T A;  1K8D A;  4V3E B;  1A6Z A;  4NO0 A;  4CW1 A;  4G9F A;  2CII A;  1OGT A;  1I4F A;  2VLJ A;  3B6S A;  4K7F A;  5H94 A;  3VFN A;  4PGD A;  4PRN A;  3SCM A;  2HLA A;  3DTX A;  1SYV A;  4Y4H A;  1RK1 A;  3TO4 A;  5HHM A;  1PQZ A;  4U1K A;  2H26 A;  3C9N A;  4HV8 A;  2HJL A;  1A1N A;  1CD1 A;  2FWO A;  5C0G A;  3L3I A;  3DX7 A;  4PDC E;  3ARE A;  1W0W A;  4NQC A;  3MV9 A;  3ILP A;  3V5H A;  3VXU A;  3BP7 A;  5IB1 A;  1QEW A;  3V5K A;  5C09 A;  3SKO A;  1JFM A;  1ZHN A;  3MRR A;  2HN7 A;  3E6F A;  3KWW A;  4PJ7 A;  4MVB A;  4ZFZ A;  5C0J A;  3FFC A;  4Z78 A;  5C0F A;  1KPU A;  2BST A;  4JFD A;  1HHH A;  1FG2 A;  3BEV A;  3L9R A;  4NT6 A;  4Z76 A;  4LCY A;  3RTQ A;  2FO4 A;  5EUO A;  3UBX A;  4N0F A;  2X4N A;  1S7X A;  2F53 A;  2ZSW A;  3WUW A;  1S7S A;  3MRQ A;  3MGO A;  1ZSD A;  2X4U A;  1FFP A;  2VLR A;  3RWG A;  3I0T A;  3MGT A;  4X6D A;  3RL1 A;  1QO3 A;  3KPL A;  3LKP A;  3W0W A;  5HYJ A;  5D7J C;  3TIE A;  4U6Y A;  4E0R A;  1KTL A;  3GSR A;  4NQV A;  4QRS A;  3MRC A;  2VAB A;  3DX6 A;  1XH3 A;  4PJA A;  1WBX A;  4HUX A;  4N8V A;  3VFU A;  1B0R A;  4JFP A;  5J6H A;  5F1I A;  3LN4 A;  4PJI A;  3GSQ A;  4HUV A;  1JPF A;  2FYY A;  3M1B A;  4S0U C;  1MHE A;  4NO5 A;  3DX8 A;  3UPR A;  1KPR A;  1I1Y A;  4L4V A;  4PRD A;  2ZOL A;  1RJZ A;  3TBV A;  4PJ5 A;  5SWQ A;  3TBY A;  1L8J A;  2VLL A;  1IM9 A;  2XPG A;  4JRY A;  1ZAG A;  2BSS A;  3GSU A;  3O4L A;  3MV7 A;  1R3H A;  1T1X A;  3TA3 A;  1C16 A;  1E28 A;  4L9L C;  1TVB A;  3QFJ A;  3KPM A;  4NO2 A;  2XFX A;  3H9H A;  1KJ3 H;  3BW9 A;  3JTT A;  4IHO A;  2MHA A;  1JPG A;  1WBY A;  3SJV A;  3NFN A;  1S9X A;  3D39 A;  3VFM A;  1ZT7 A;  1HOC A;  3W39 A;  3P73 A;  3RL2 A;  1Q94 A;  3CVH A;  5EU4 A;  2BVP A;  4D0C A;  2NX5 A;  3VFT A;  4QRQ A;  3AU1 A;  1T20 A;  3SDD A;  3SKM A;  4ELM A;  4PGB A;  1LD9 A;  1HHG A;  3ROO A;  5C0I A;  1N3N A;  4Y4K A;  3TBT A;  1FZO A;  4ZUS A;  5HGB A;  1W72 A;  1T0N A;  4HS3 A;  4U1N A;  2A83 A;  3CPL A;  1T1Y A;  1KBG H;  2X4O A;  3JTC A;  3MRF A;  3CDG A;  1FZJ A;  4N5E A;  3PWU A;  4IIQ C;  2BVO A;  3OX8 A;  3RWC A;  4CVZ A;  1NAN H;  3I6G A;  3FRU A;  3ES6 A;  2PO6 A;  4WU5 A;  3GJF A;  3KXF A;  4X6C A;  3TBW A;  4MS8 A;  3L3G A;  3OXS A;  2VLK A;  4NNX A;  1HYR C;  4QRR A;  4JQX A;  5HGA A;  2CLV A;  3GMO A;  5EU5 A;  4JFF A;  5HHN A;  3E6H A;  3FQU A;  1BII A;  1QR1 A;  3KPR A;  4BKW A;  1NAM H;  1XR9 A;  1Z5L A;  1ZT1 A;  3QQ3 A;  4U1M A;  4G8I A;  4ZUV A;  3MRN A;  1QSE A;  5C0C A;  3H9S A;  1I7U A;  2AV7 A;  4F7C A;  1RK0 A;  4PRI A;  4PJE A;  2X4Q A;  1EFX A;  3MRP A;  3M17 A;  1HHK A;  1T21 A;  5GSR A;  5B38 A;  3VFP A;  3KPP A;  1S7Q A;  4PG2 A;  4CVX A;  4F7E A;  5FDW A;  5F1N A;  1MHC A;  1JE6 A;  1ZS8 A;  1JGD A;  1ONQ A;  1T22 A;  3BEW A;  1AKJ A;  3PAB A;  1A1M A;  1T1Z A;  3VRI A;  2FIK A;  4HUU A;  3VXP A;  4LHU A;  4HUW A;  3GMP A;  4MNQ A;  4U1I A;  3ECB A;  3GSV A;  4JFO A;  1N59 A;  4GUP A;  3MRM A;  5HGD A;  2F54 A;  3HLA A;  3FOM A;  3O9W A;  4WWK C;  2BVQ A;  4L29 A;  3LKO A;  3MYJ A;  2HJK A;  3L3D A;  1N5A A;  3GSN H;  2ESV A;  1FZK A;  4E5X A;  3QI9 A;  1X7Q A;  1AGF A;  1U58 A;  5IEK A;  4PR5 A;  1MWA H;  1T7W A;  5EFI A;  3GMN A;  3KPO A;  4NO3 A;  4ZUW A;  4ZAK A;  2DYP A;  4L4T A;  4WU7 A;  3FQW A;  4K71 B;  3RWE A;  5FA4 A;  5BJT A;  2GIT A;  5HGH A;  3X11 A;  3UTS A;  1T1W A;  3GSX A;  3QUL A;  3QQ4 A;  4L8B A;  3D2U A;  3PWJ A;  2X4R A;  3TID A;  1T7V A;  1BD2 A;  5AD0 A;  1YN7 A;  2OI9 A;  3VWJ A;  5EOT A;  1G7Q A;  5D2L A;  3UTT A;  3DXA A;  3VFV A;  3X12 A;  2X4P A;  5JHD A;  3PWL A;  3X13 A;  1FZM A;  3D3V A;  4MNG A;  5C07 A;  1QRN A;  3FT2 A;  3GMQ A;  2V2W A;  4HKJ A;  5DDH A;  3QUY A;  4U1H A;  3ARG A;  3MRG A;  4FFE X;  3O3E A;  5MEN A;  4IRJ A;  3O3B A;  3P9M A;  4WDI A;  3QDG A;  4U1L A;  2BNR A;  2F74 A;  4MJI A;  1I1F A;  3SPV A;  4O2F A;  1OSZ A;  4QRP A;  3MR9 A;  4HX1 A;  4NQE A;  1LEG A;  3GMR A;  4ONO A;  3KYN A;  4IRS A;  2AV1 A;  2NW3 A;  3RWI A;  3FON A;  3KPN A;  5FA3 A;  4QRT A;  4F7M A;  2VE6 A;  3GSO A;  2ZOK A;  1P1Z A;  1T0M A;  3MA7 A;  3B3I A;  4PJG A;  2IA1 A;  1DDH A;  3LKR A;  5D7L A;  4PJD A;  3VFR A;  2GJ6 A;  1S8D A;  2FZ3 A;  5E8O A;  4N0C A;  1M6O A;  1RJY A;  3MRK A;  3OV6 A;  3FT4 A;  3QUX A;  4WW2 C;  3BZE A;  3REW A;  1I7T A;  1TVH A;  3VJ6 A;  3MRE A;  4LNR A;  1QVO A;  5C0A A;  3I6K A;  1MI5 A;  1EXU A;  1A9B A;  1P4L A;  3TN0 A;  3HPJ A;  3WS3 A;  4Z77 A;  5IRO A;  2E7L E;  1EEZ A;  4XXC A;  3VXO A;  5E9D A;  3ROL A;  3P4N A;  3AM8 A;  5J1A A;  1GZQ A;  5MEO A;  2P5E A;  3ERY A;  3HE7 A;  3RGV C;  2YPK A;  3V5D A;  3TFK A;  5BRZ A;  2ZSV A;  5D2N A;  1UQS A;  1AGD A;  3VXN A;  2OL3 H;  3BWA A;  4EI5 A;  2YEZ A;  4PJH A;  3JVG A;  4PRP A;  1ZHL A;  4PV8 A;  2YPL A;  1YDP A;  1LDP H;  3IXA A;  5DEF A;  3GMM A;  5B39 A;  5HHQ A;  4PRE A;  5EU6 A;  3VXR A;  1JGE A;  3FT3 A;  3P4M A;  4UQ3 A;  1KCG C;  1LK2 A;  3BO8 A;  5GSV A;  1CG9 A;  5HHO A;  1AGB A;  3P77 A;  4Y2D A;  5ENW A;  3KPS A;  3CC5 A;  1S7V A;  3QUK A;  4PRA A;  1S9W A;  4WUU A;  1DE4 A;  4NQD A;  4I48 A;  1DUY A;  5HHP A;  5IM7 A;  3VFW A;  5F7D A;  3SDC A;  1LEK A;  5MER A;  2J8U A;  4PJ9 A;  3MV8 A;  3HUJ A;  3P9L A;  3C8K A;  4NSK A;  5ACZ A;  1OGA A;  1FO0 H;  1P7Q A;  2V2X A;  4U6X A;  3DBX A;  4F7P A;  3KYO A;  4LCW A;  3T8X A;  4JO8 A;  1T7X A;  3QEQ A;  3RWJ A;  3BUY A;  4O2E A;  4PGE A;  2CLZ A;  4JQV A;  5IB4 A;  4G43 A;  3BGM A;  1FFN A;  3E3Q A;  1KJM A;  4L3E A;  4O2C A;  5INC A;  2WY3 A;  2CKB H;  1SYS A;  2X70 A;  3ARF A;  5EO1 A;  4PP8 C;  3SDX A;  5D7I A;  3LKN A;  4Y4F A;  5SWZ A;  5BS0 A;  3GSW A;  4NHU E;  4U1S A;  3PQY A;  3CZF A;  3BHB A;  3BH8 A;  4ZUT A;  3MRH A;  2X4S A;  3ARB A;  5IVX A;  3UTQ A;  5L2K A;  1DUZ A;  3MRO A;  3IT8 D;  3VH8 A;  3L3J A;  3ILQ C;  4D0D A;  1AGC A;  1JF1 A;  5BXF A;  1OF2 A;  4MX7 A;  2NYK A;  4QRU A;  3TO2 A;  3L3K A;  4G42 A;  1KJV A;  4MJ5 A;  5IEH A;  4JRX A;  1UXW A;  3QDM A;  1B3J A;  2AK4 A;  1QSF A;  1AGE A;  3JTS A;  1HHI A;  1XZ0 A;  4ZUU A;  5EO0 A;  3U0P A;  1KPV A;  1S7R A;  4L8D A;  4UQ2 A;  4PJB A;  3VCL A;  3QUZ A;  5C9J A;  3O3A A;  3VRJ A;  4PGC A;  1YPZ A;  3RWF A;  3QZW A;  2AXF A;  2GTW A;  5C0D A;  3TJH A;  5MEP A;  2CIK A;  1G6R H;  3FQR A;  2JCC A;  1M05 A;  3VFS A;  2CLR A;  5E8P A;  5DEG A;  1IM3 A;  1CE6 A;  3TBS A;  3QDJ A;  1HSA A;  4GKS A;  2Q7Y A;  4G59 C;  4NNY A;  2BCK A;  5MEQ A;  3CCH A;  4EUP A;  3PWP A;  3DMM A;  4JFE A;  5C08 A;  3BH9 A;  2PYE A;  1NEZ A;  1T7Z A;  3I6L D;  5SWS A;  3LV3 A;  4X6E A;  3BXN A;  4EN3 C;  1JHT A;  3LKQ A;  1INQ A;  3FQN A;  3X14 A;  2P5W A;  1JUF A;  4D0B A;  5E8N A;  3KPQ A;  4L8S C;  5FKP A;  1I1A A;  1KJ2 H;  2GT9 A;  4QOK A;  5E6I C;  4X6F A;  4JFQ A;  2BNQ A;  1ZHK A;  3HG1 A;  4L8C A;  4PJF A;  3MRB A;  3D25 A;  3E2H A;  4N0U A;  3WLB A;  1S7U A;  5J6G A;  1XR8 A;  2O5N A;  1ZHB A;  1HSB A;  2AXG A;  3MRD A;  1N2R A;  5EU3 A;  1BQH A;  3KLA A;  4V3D B;  3RWD A;  5D9S A;  3FOL A;  3SDA A;  3CH1 A;  3FTG A;  3GML A;  1ZVS A;  1A1O A;  4PV9 A;  1A9E A;  3TVM A;  3H7B A;  3S6C A;  4PJ8 A;  2X4T A;  5L2J A;  1I7R A;  4I4W A;  3ARD A;  3FQT A;  2UWE A;  3FQX A;  3WS6 A;  1ED3 A;  3D18 A;  3O8X A;  2GAZ A;  3GIV A;  5IND A;  1BZ9 A;  2VAA A;  1G7P A;  1GZP A;  3MRJ A;  5IB3 A;  3VWK A;  2GTZ A;  4NQX A;  5F9J A;  3PWV A;  2RFX A;  3WL9 A;  2H6P A;  1AO7 A;  1S9Y A;  4PJX A;  3G08 A;  4G9D A;  3P4O A;  3MRL A;  4G8G A;  4L3C A;  4FTV A;  3LN5 A;  3TZV C;  3VXS A;  1QLF A;  3RWH A;  3BVN A;  1WBZ A;  3VFO A;  3TPU E;  1TMC A;  3BZF A; 
#chains in the Genus database with same CATH homology
 2BSR A;  3PWN A;  4PG9 A;  3OXR A;  1E27 A;  2AKR A;  4LCC C;  1FFO A;  5C0B A;  1S7W A;  3HCV A;  5IB5 A;  4PRB A;  1QQD A;  2C7U A;  3RUG A;  1YN6 A;  3L3H A;  2D31 A;  1VAC A;  4WJ5 A;  1K5N A;  1VGK A;  5D5M A;  1W0V A;  1EEY A;  5IB2 A;  1T80 A;  4PRH A;  4G59 A;  1ZT4 A;  1T7Y A;  3BP4 A;  1LQV A;  3MRI A;  4PJC A;  1HHJ A;  1UXS A;  4MXQ A;  3T1F A;  3LKS A;  4MJ6 A;  3RZC A;  3HAE A;  4WO4 A;  5C0E A;  4MQ7 A;  5E00 A;  3QFD A;  1S7T A;  4Y16 A;  2GUO A;  4HWZ A;  1VAD A;  3TF7 A;  4GKN A;  3HE6 A;  4APQ A;  1B0G A;  4U1J A;  1LP9 A;  3O3D A;  5ISZ A;  3VXM A;  4F7T A;  1K8D A;  4V3E B;  1A6Z A;  4NO0 A;  4CW1 A;  4G9F A;  2CII A;  1OGT A;  1I4F A;  2VLJ A;  3B6S A;  4K7F A;  5H94 A;  3VFN A;  4PGD A;  4PRN A;  3SCM A;  2HLA A;  3DTX A;  1SYV A;  4Y4H A;  1RK1 A;  3TO4 A;  5HHM A;  1PQZ A;  4U1K A;  2H26 A;  3C9N A;  4HV8 A;  2HJL A;  1A1N A;  1CD1 A;  2FWO A;  5C0G A;  3L3I A;  3DX7 A;  4PDC E;  3ARE A;  1W0W A;  4NQC A;  3MV9 A;  3ILP A;  3V5H A;  3VXU A;  3BP7 A;  5IB1 A;  1QEW A;  3V5K A;  5C09 A;  3SKO A;  1JFM A;  1ZHN A;  3MRR A;  2HN7 A;  3E6F A;  3KWW A;  4PJ7 A;  4MVB A;  4ZFZ A;  5C0J A;  3FFC A;  4Z78 A;  5C0F A;  1KPU A;  2BST A;  4JFD A;  1HHH A;  1FG2 A;  3BEV A;  3L9R A;  4NT6 A;  4Z76 A;  4LCY A;  3RTQ A;  2FO4 A;  5EUO A;  3UBX A;  4N0F A;  2X4N A;  1S7X A;  2F53 A;  2ZSW A;  3WUW A;  1S7S A;  3MRQ A;  3MGO A;  1ZSD A;  2X4U A;  1FFP A;  2VLR A;  3RWG A;  3MGT A;  4X6D A;  3RL1 A;  1QO3 A;  3KPL A;  3LKP A;  3W0W A;  5HYJ A;  5D7J C;  3TIE A;  4U6Y A;  4E0R A;  1KTL A;  3GSR A;  4NQV A;  4QRS A;  3MRC A;  2VAB A;  3DX6 A;  1XH3 A;  4PJA A;  1WBX A;  4HUX A;  4N8V A;  3VFU A;  1B0R A;  4JFP A;  5J6H A;  5F1I A;  3LN4 A;  4PJI A;  3GSQ A;  4HUV A;  1JPF A;  2FYY A;  3M1B A;  4S0U C;  1MHE A;  4NO5 A;  3DX8 A;  3UPR A;  1KPR A;  1I1Y A;  4L4V A;  4PRD A;  2ZOL A;  1RJZ A;  3TBV A;  4PJ5 A;  5SWQ A;  3TBY A;  1L8J A;  2VLL A;  1IM9 A;  2XPG A;  4JRY A;  1ZAG A;  2BSS A;  3GSU A;  3O4L A;  3MV7 A;  1R3H A;  1T1X A;  3TA3 A;  1C16 A;  1E28 A;  4L9L C;  1TVB A;  3QFJ A;  3KPM A;  4NO2 A;  2XFX A;  3H9H A;  1KJ3 H;  3BW9 A;  3JTT A;  4IHO A;  2MHA A;  1JPG A;  1WBY A;  3SJV A;  3NFN A;  1S9X A;  3D39 A;  3VFM A;  1ZT7 A;  1HOC A;  3W39 A;  3P73 A;  3RL2 A;  1Q94 A;  3CVH A;  5EU4 A;  2BVP A;  4D0C A;  2NX5 A;  3VFT A;  4QRQ A;  3AU1 A;  1T20 A;  3SDD A;  3SKM A;  4ELM A;  4PGB A;  1LD9 A;  1HHG A;  3ROO A;  5C0I A;  1N3N A;  4Y4K A;  3TBT A;  1FZO A;  4ZUS A;  5HGB A;  1W72 A;  1T0N A;  4HS3 A;  4U1N A;  2A83 A;  3CPL A;  1T1Y A;  1KBG H;  2X4O A;  3JTC A;  3MRF A;  3CDG A;  1FZJ A;  4N5E A;  3PWU A;  4IIQ C;  2BVO A;  3OX8 A;  3RWC A;  4CVZ A;  1NAN H;  3I6G A;  3FRU A;  3ES6 A;  2PO6 A;  4WU5 A;  3GJF A;  3KXF A;  4X6C A;  3TBW A;  4MS8 A;  3L3G A;  3OXS A;  2VLK A;  4NNX A;  1HYR C;  4QRR A;  4JQX A;  5HGA A;  2CLV A;  3GMO A;  5EU5 A;  4JFF A;  5HHN A;  3E6H A;  3FQU A;  1BII A;  1QR1 A;  3KPR A;  1NAM H;  1XR9 A;  1Z5L A;  1ZT1 A;  3QQ3 A;  4U1M A;  4G8I A;  4ZUV A;  3MRN A;  1QSE A;  5C0C A;  3H9S A;  1I7U A;  2AV7 A;  4F7C A;  1RK0 A;  4PRI A;  4PJE A;  2X4Q A;  1EFX A;  3MRP A;  3M17 A;  1HHK A;  1T21 A;  5GSR A;  5B38 A;  3VFP A;  3KPP A;  1S7Q A;  4PG2 A;  4CVX A;  4F7E A;  5FDW A;  5F1N A;  1MHC A;  1JE6 A;  1ZS8 A;  1JGD A;  1ONQ A;  1T22 A;  3BEW A;  1AKJ A;  3PAB A;  1A1M A;  1T1Z A;  3VRI A;  2FIK A;  4HUU A;  3VXP A;  4LHU A;  4HUW A;  3GMP A;  4MNQ A;  4U1I A;  3ECB A;  3GSV A;  4JFO A;  1N59 A;  4GUP A;  3MRM A;  5HGD A;  2F54 A;  3HLA A;  3FOM A;  3O9W A;  4WWK C;  2BVQ A;  4L29 A;  3LKO A;  3MYJ A;  2HJK A;  3L3D A;  1N5A A;  3GSN H;  2ESV A;  1FZK A;  4E5X A;  3QI9 A;  1X7Q A;  1AGF A;  1U58 A;  5IEK A;  4PR5 A;  1MWA H;  1T7W A;  5EFI A;  3GMN A;  3KPO A;  4NO3 A;  4ZUW A;  4ZAK A;  2DYP A;  4L4T A;  4WU7 A;  3FQW A;  4K71 B;  3RWE A;  5FA4 A;  5BJT A;  2GIT A;  5HGH A;  3X11 A;  3UTS A;  1T1W A;  3GSX A;  3QUL A;  3QQ4 A;  4L8B A;  3D2U A;  3PWJ A;  2X4R A;  3TID A;  1T7V A;  1BD2 A;  5AD0 A;  1YN7 A;  2OI9 A;  3VWJ A;  5EOT A;  1G7Q A;  5D2L A;  3UTT A;  3DXA A;  3VFV A;  3X12 A;  2X4P A;  5JHD A;  3PWL A;  3X13 A;  1FZM A;  3D3V A;  4MNG A;  5C07 A;  1QRN A;  3FT2 A;  3GMQ A;  2V2W A;  4HKJ A;  5DDH A;  3QUY A;  4U1H A;  3ARG A;  3MRG A;  4FFE X;  3O3E A;  5MEN A;  4IRJ A;  3O3B A;  3P9M A;  4WDI A;  3QDG A;  4U1L A;  2BNR A;  2F74 A;  4MJI A;  1I1F A;  3SPV A;  4O2F A;  1OSZ A;  4QRP A;  3MR9 A;  4HX1 A;  4NQE A;  1LEG A;  3GMR A;  4ONO A;  3KYN A;  4IRS A;  2AV1 A;  2NW3 A;  3RWI A;  3FON A;  3KPN A;  5FA3 A;  4QRT A;  4F7M A;  2VE6 A;  3GSO A;  2ZOK A;  1P1Z A;  1T0M A;  3MA7 A;  3B3I A;  4PJG A;  1DDH A;  3LKR A;  5D7L A;  4PJD A;  3VFR A;  2GJ6 A;  1S8D A;  2FZ3 A;  5E8O A;  4N0C A;  1M6O A;  1RJY A;  3MRK A;  3OV6 A;  3FT4 A;  3QUX A;  4WW2 C;  3BZE A;  3REW A;  1I7T A;  1TVH A;  3VJ6 A;  3MRE A;  4LNR A;  1QVO A;  5C0A A;  3I6K A;  1MI5 A;  1EXU A;  1A9B A;  1P4L A;  3TN0 A;  3HPJ A;  3WS3 A;  4Z77 A;  5IRO A;  2E7L E;  1EEZ A;  4XXC A;  3VXO A;  5E9D A;  3ROL A;  3P4N A;  3AM8 A;  5J1A A;  1GZQ A;  5MEO A;  2P5E A;  3ERY A;  3HE7 A;  3RGV C;  2YPK A;  3V5D A;  3TFK A;  5BRZ A;  2ZSV A;  5D2N A;  1UQS A;  1AGD A;  3VXN A;  2OL3 H;  3BWA A;  4EI5 A;  2YEZ A;  4PJH A;  3JVG A;  4PRP A;  1ZHL A;  4PV8 A;  2YPL A;  1YDP A;  1LDP H;  3IXA A;  5DEF A;  3GMM A;  5B39 A;  5HHQ A;  4PRE A;  5EU6 A;  3VXR A;  1JGE A;  3FT3 A;  3P4M A;  4UQ3 A;  1KCG C;  1LK2 A;  3BO8 A;  5GSV A;  1CG9 A;  5HHO A;  1AGB A;  3P77 A;  4Y2D A;  5ENW A;  3KPS A;  3CC5 A;  1S7V A;  3QUK A;  4PRA A;  1S9W A;  4WUU A;  1DE4 A;  4NQD A;  4I48 A;  1DUY A;  5HHP A;  5IM7 A;  3VFW A;  5F7D A;  3SDC A;  1LEK A;  5MER A;  2J8U A;  4PJ9 A;  3MV8 A;  3HUJ A;  3P9L A;  3C8K A;  4NSK A;  5ACZ A;  1OGA A;  1FO0 H;  1P7Q A;  2V2X A;  4U6X A;  3DBX A;  4F7P A;  3KYO A;  4LCW A;  3T8X A;  1T7X A;  3QEQ A;  3RWJ A;  3BUY A;  4O2E A;  4PGE A;  2CLZ A;  4JQV A;  5IB4 A;  4G43 A;  3BGM A;  1FFN A;  3E3Q A;  1KJM A;  4L3E A;  4O2C A;  5INC A;  2WY3 A;  2CKB H;  1SYS A;  2X70 A;  3ARF A;  5EO1 A;  4PP8 C;  3SDX A;  5D7I A;  3LKN A;  4Y4F A;  5SWZ A;  5BS0 A;  3GSW A;  4NHU E;  4U1S A;  3PQY A;  3CZF A;  3BHB A;  3BH8 A;  4ZUT A;  3MRH A;  2X4S A;  3ARB A;  5IVX A;  3UTQ A;  5L2K A;  1DUZ A;  3MRO A;  3IT8 D;  3VH8 A;  3L3J A;  3ILQ C;  4D0D A;  1AGC A;  1JF1 A;  5BXF A;  1OF2 A;  4MX7 A;  4QRU A;  3TO2 A;  3L3K A;  4G42 A;  1KJV A;  4MJ5 A;  5IEH A;  4JRX A;  1UXW A;  3QDM A;  1B3J A;  2AK4 A;  1QSF A;  1AGE A;  3JTS A;  1HHI A;  1XZ0 A;  4ZUU A;  5EO0 A;  3U0P A;  1KPV A;  1S7R A;  4L8D A;  4UQ2 A;  4PJB A;  3VCL A;  3QUZ A;  5C9J A;  3O3A A;  3VRJ A;  4PGC A;  1YPZ A;  3RWF A;  3QZW A;  2AXF A;  2GTW A;  5C0D A;  3TJH A;  5MEP A;  2CIK A;  1G6R H;  3FQR A;  2JCC A;  1M05 A;  3VFS A;  2CLR A;  5E8P A;  5DEG A;  1IM3 A;  1CE6 A;  3TBS A;  3QDJ A;  1HSA A;  4GKS A;  2Q7Y A;  4NNY A;  2BCK A;  5MEQ A;  3CCH A;  4EUP A;  3PWP A;  3DMM A;  4JFE A;  5C08 A;  3BH9 A;  2PYE A;  1NEZ A;  1T7Z A;  3I6L D;  5SWS A;  3LV3 A;  4X6E A;  3BXN A;  4EN3 C;  1JHT A;  3LKQ A;  1INQ A;  3FQN A;  3X14 A;  2P5W A;  1JUF A;  4D0B A;  5E8N A;  3KPQ A;  4L8S C;  5FKP A;  1I1A A;  1KJ2 H;  2GT9 A;  4QOK A;  5E6I C;  4X6F A;  4JFQ A;  2BNQ A;  1ZHK A;  3HG1 A;  4L8C A;  4PJF A;  3MRB A;  3D25 A;  3E2H A;  4N0U A;  3WLB A;  1S7U A;  5J6G A;  1XR8 A;  1ZHB A;  1HSB A;  2AXG A;  3MRD A;  1N2R A;  5EU3 A;  1BQH A;  3KLA A;  4V3D B;  3RWD A;  5D9S A;  3FOL A;  3SDA A;  3CH1 A;  3FTG A;  3GML A;  1ZVS A;  1A1O A;  4PV9 A;  1A9E A;  3TVM A;  3H7B A;  3S6C A;  4PJ8 A;  2X4T A;  5L2J A;  1I7R A;  4I4W A;  3ARD A;  3FQT A;  2UWE A;  3FQX A;  3WS6 A;  1ED3 A;  3D18 A;  3O8X A;  2GAZ A;  3GIV A;  5IND A;  1BZ9 A;  2VAA A;  1G7P A;  1GZP A;  3MRJ A;  5IB3 A;  3VWK A;  2GTZ A;  4NQX A;  5F9J A;  3PWV A;  2RFX A;  3WL9 A;  2H6P A;  1AO7 A;  1S9Y A;  4PJX A;  3G08 A;  4G9D A;  3P4O A;  3MRL A;  4G8G A;  4L3C A;  4FTV A;  3LN5 A;  3TZV C;  3VXS A;  1QLF A;  3RWH A;  3BVN A;  1WBZ A;  3VFO A;  3TPU E;  1TMC A;  3BZF A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...