2YPLA

Structural features underlying t-cell receptor sensitivity to concealed mhc class i micropolymorphisms
Total Genus 71
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
71
sequence length
274
structure length
274
Chain Sequence
GSHSMRYFYTAMSRPGRGEPRFIAVGYVDDTQFVRFDSDAASPRMAPRAPWIEQEGPEYWDGETRNMKASAQTYRENLRIALRYYNQSEAGSHIIQVMYGCDVGPDGRLLRGHDQYAYDGKDYIALNEDLSSWTAADTAAQIIQRKWEAARVAEQLRAYLEGLCVEWLRRYLENGKETLQRADPPKTHVTHHPISDHEATLRCWALGFYPAEITLTWQRDGEDQTQDTELVETRPAGDRTFQKWAAVVVPSGEEQRYTCHVQHEGLPKPLTLRW
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system/viral protein
molecule keywords HLA CLASS I HISTOCOMPATIBILITY ANTIGEN, B-57 ALPHA CHAIN
publication title Structural Features Underlying T-Cell Receptor Sensitivity to Concealed Mhc Class I Micropolymorphisms.
pubmed doi rcsb
source organism Homo sapiens
total genus 71
structure length 274
sequence length 274
ec nomenclature
pdb deposition date 2012-10-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00129 MHC_I Class I Histocompatibility antigen, domains alpha 1 and 2
A PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2yplA02
3.30.500.10 Alpha Beta 2-Layer Sandwich Murine Class I Major Histocompatibility Complex, H2-DB; Chain A, domain 1 MHC class I-like antigen recognition-like 2yplA01
5I66B 3QWRD 2VDRL 3WXWL 1KTRL 4X5WA 3EDEA 1A6UH 2OJZL 3GSNB 4NN7C 4P2RE 4N0UB 3WLWC 4EI5D 1U91A 1OAYL 2XWTB 3O2DL 1GZPA 4KJYA 3OHXB 3CXDL 2C4XA 1AO7E 4YH6A 4MQTB 2EYRB 3P73B 4NRYA 1A1NB 1BFOA 3PGFH 3WEXB 5MEND 1IGFL 3HZKA 1NANI 5HHMB 5GSRB 4B53A 1QRNA 3LQAH 1BD2A 2R2CA 4PRPB 2IAMA 4LIQL 3ZL4H 4Z76B 1MH5B 3TFKC 1D5IL 5D1XB 3ARBD 2GJZA 2H26A 4OD1L 4Y16B 1QFWH 2WWKT 4L3EE 1L7TH 4X80H 4XNXL 5HY9A 5DJ8B 4R4BA 3RGVA 2VDML 3ALWA 3T65B 3WIIH 4RGOH 3B9EA 3DURB 5E8PA 2P1YA 2X4TB 3OTTA 3RA7L 1Q9WA 2X9YA 2VXSH 4TSBL 4RMRA 4P46D 3MFFB 4NKMB 3IXAA 3SDAB 5DI8A 5ID1B 1Y6MR 4E5XA 2XOTA 2E8ZA 1C5CH 1FG2A 1LO2L 3QUML 5D93B 3MV01 3GI9L 2WBWB 4DGIH 4Y4FA 5E08H 4LHUD 3FO2B 5IB1A 4JO2L 2LABA 4ZTOH 4JM2F 2QJDA 1AGCB 4NYLA 1U58B 2E7BA 3OAYH 3O6ML 1TVBA 5DJDA 1WTLA 1HHHB 3JV6A 4X5XA 3SCMD 1UVQB 1QSED 3BDBA 5IVXE 1I9EA 1UWGH 1J0IA 5F1NB 3O2WH 4NC2B 3NPSB 2FO4B 1QACA 1K8DB 2DD8H 3EHBC 2A77L 1KIRA 3VXNB 3U0WH 3MX0A 2BY2A 4Z7UB 3QG6B 4HKBA 3RWGB 1U92B 4HUKB 1YMMB 4JY5L 4Y19B 3IF1A 3O8XA 1IKFL 1NCAH 3G6DH 3QXDB 3R06A 5I71C 4PJDE 1G7HB 5FK9B 3CU1A 3RAJL 3ROOB 1B3JA 1C5BH 4F2MA 3VG9B 4ZD3H 5KSVA 1Q9LA 3MJ7B 2D0GA 1JTTA 1CBVL 4LEXH 1DUYA 3OJMB 2KQNA 4OZFA 2APVA 3CVHB 1F4WH 1OPGH 3LPFA 4ETQB 1JZ2A 5I76B 5IBLD 3HTLX 1UH3A 1NAKH 1R3KA 2BERA 3EO9L 2AKRA 1UWEL 1CL7H 1ADQA 3Q1SH 1U8IA 2KUTA 1DQMH 4R26L 3I6GB 1LILA 1Z3GH 4JO4L 1FLTX 4QRQB 1N6QH 4QHKI 1Y18B 1MCPH 3IXTB 2I9LB 1IRAY 2P45B 4OLYL 4WFGE 4AH2A 2AJXH 2G5BB 5LJYH 1X5ZA 5DMYA 4QHUA 4H1LH 1I8MB 1X5KA 5IB2B 4JFZH 3B5GA 5JTWA 3EBAA 3JBG7 5F9WB 5I75B 4EXKA 4L4TB 4MB5A 4RQQA 1RUKH 5AG9A 2H32B 3VI3E 4EVNA 3FO1A 1WF5A 2Y07L 3QEUB 4WO4C 1INEL 5I8OL 1R24B 1GL4B 4LVOB 3UYRL 3DV4A 5C0IA 2MPAH 1ETZB 1DLHA 4DW2H 2YPVH 1CG9B 4ZUWA 1T1YB 2JB5L 1T0MA 5EORH 1Q0XH 4PRHA 4TUKL 1Q9OB 4PRIB 4LPUA 4UTBL 2XA8L 1IGJB 2PXYA 1ED3A 4MCZA 3MV7D 1QVOA 4OLVL 4Q97A 2XZQL 4PRAB 2IG2L 2J8OA 1SEQH 2X9XA 1BZ7A 5LAXA 1P9MA 2AAVA 1C12A 3F8UB 4ISVB 5CILL 2GY7B 2CKBB 4LVHC 2ZP0T 4AM0B 2ATPB 4U7SA 3SKNB 1VB9A 2C4FU 2KH2B 1QPXA 1LK3L 1QBLH 1NC4A 1TXKA 2R56L 1T03L 4GSDL 4RGNC 5C7XL 4Z5RA 3BT2L 3EO0A 2JJWA 2X70A 4YHYC 1I9IH 4ODXB 4XP4L 1MWAA 3CDCA 3QIBB 4NO2A 2GTZA 4N8CH 5T3XL 2MTPA 3WL9B 3NCFB 4AMKL 3M45A 3A67L 4JDVA 5I8EB 1L7IH 3QEQD 1I1RA 4M62L 1HI6B 3QNZB 3HMXH 4HS3A 4G6ML 5DO2D 1EAPA 1D6EA 4AG4H 5E9DD 5BRZA 4Z7NE 4NCC1 1JGEA 3REVA 3ILQC 3MRRA 1QFUL 1SQ2N 43C9A 5D71L 3SE9H 3UJTH 3RWJB 3U30C 3PWVB 2MKWA 4LCYA 3VDCA 3MA7A 4XNUL 1F4HA 4BUHA 2F5AH 1JNHA 1KC5H 4XMLH 5KAQF 1RK0A 4QF1B 3BWUC 1LE9B 1MHHA 4JM4H 5DLMH 1W0YT 4EI5A 3AXLB 3G5XA 2I25N 4Y5XB 1YN6A 4KK9C 2XYCA 4RAUA 1YEHH 4U33A 4PP2B 2VXUL 3L3OB 3P77B 1KTKE 4U6XA 1BQSA 3L3HB 2F53B 2HYMA 4G6KH 5FUCC 4E0RA 1A1OA 4MHHG 4MMZC 4Z0XB 3E3QA 4PJEF 1DEEA 3RVVC 3FQWB 4R2GD 2FGWL 2VLRB 4HS8L 4DTGL 1B0RA 4LSSL 4NKQB 3VRIA 2E9IA 3EGSA 5FEBA 1ZHLA 3ARBA 5KS9A 4ZS6C 2WSKA 5CINH 4F57L 3IDJA 2QSVA 1Z9SA 5TF1L 3ZMRA 4Y5VA 4LSDA 5E6YA 1BBJA 1FNAA 5BZWA 1HHGA 3MOAH 1XIWB 5L8JB 3D5OF 4IJ3C 4PYGA 4WCYL 4DN3H 5A16B 3FB5A 4WW2A 5JW4Q 4DVBA 1EBPA 2NX5B 1U8KA 1XCQB 2ICWA 2BFVH 1GC1C 4P46A 2P7TB 3B4NA 4O9HL 5D1ZC 1S7SA 1CD1B 4PY8I 2EXYD 1G9EA 5J89A 3D3VD 4FQXB 5C08A 3KXFA 4I2XE 1WEJL 1F8TL 2OZ4H 3MLPA 3FOMB 4YDKH 4N68A 4LHUA 5B38G 3TVMC 4Y4KD 3ZTJG 3TA3D 5B38B 2OI9A 4BELD 5C9JA 2YUWA 1FORL 5LCVH 5F89A 3ARGB 3FFDA 4KDTC 4NNPL 5F9JB 2XPGA 3OAZK 1PY4A 4KWUA 5GRYA 5MI0B 4UTAH 1KPUA 5DHVA 4J1UB 1KB5H 3LN5B 1OAKH 2GK0B 5FF6A 1NJ9B 2R2HA 2VZUA 4QOKB 3SCMA 3E8UL 2K1MA 2LU4A 4XVSH 3FQTB 1P4BL 1PLGH 4OT1H 2QL1A 3ES6B 4HV8A 4TRPL 1ZLVK 1KXQE 5TE4L 1BEYL 1FGVH 3OG6B 1X5YA 4FN0A 2DMCA 2AK1H 4EIGB 1LK2A 2PYEA 4OF7A 3HB3C 5ETUB 2XRAH 2F15A 3OR7A 3B8SA 2NY0C 5DD1H 5GQBA 2ZG2A 4CMMB 2C1OB 4FQJL 3AY4A 3QH3B 2APFA 4RRPG 3EO1A 4K71C 5I9QC 5D72L 5HHNB 1IL1A 3RY5A 1U6AH 4Z7QE 5J1TC 2NYYD 3LKQB 5TE6H 1KBGH 4I3SH 1WTGT 1A0QH 5A40E 3WKMH 3GUTB 1TQBB 3MJ8A 3BRDA 1I1AC 4FQHA 2KL6A 6FABL 2DQDH 4CJ1A 5L8LB 2AGJL 4MHHI 4O02L 3EFDL 2D2OA 3PF2A 5AZ2L 1HSAB 3WFEH 2BVPB 3HNSH 5EBWA 4OTXL 3SO3C 4F8TA 2VLLA 4HD9A 3IDYB 4JFQB 5E1HB 3F5WB 1HCFX 1HWGB 3V4VH 4TOYH 2WWMC 2A9NL 5HHVL 3QUYD 4GG8B 1F4YL 1K85A 4JQIL 2H8PA 1PYWA 2Q76A 1H3UA 4KI1A 3D85A 1DBJL 4PJ5B 2BNQE 3F58H 4X6CE 1XGRA 2LVCA 4P23D 3QHFL 5IM7B 4AEHH 1NPUA 4YHIB 3PP3K 1KCRH 4L8SC 1IEBB 4QHLA 2AJ3A 3BGFC 4X8XA 2Q3ZA 5DVKA 3Q6GL 3S34L 4Z0BL 3CDYA 1NMAH 5ESQA 4YGAB 3MV8E 4YPGB 3BKYH 4HUWB 3FTGA 4Q0XH 3RP1A 4UQ2A 4QRRD 3BH9A 4ZOCA 2AK4B 1U95A 3BPCA 4QRSB 5DZNA 4CDGC 5DEGB 2W0PA 3W5MA 4OLXL 2XY1A 3GKWH 2EDEA 3MV7A 5ICZB 5CJ5A 3CMGA 3HPLA 1A6UL 1E4KC 1BBDH 3RDTD 3EOAB 1KCLA 1CICB 2HT3D 4TN9A 4KK6D 3ZKND 1TJGH 3PGFL 5B3JE 3K2UH 3BEVA 3M17A 5ITFB 1RU9H 3CZFB 1NC2D 1T3FB 1PKQA 4X99B 3LQAL 3MLSH 4V2CB 4IMKA 4YHLH 1IAOB 1OT2A 3P9WB 3ZL4L 1I9RH 4XCEB 2HT4D 4MJID 3V6OE 1T7YA 4OAWA 4JGMA 3ZDXE 5ALBH 5JO5B 1QFWL 4M5ZH 1AGFA 4DJMA 3O3UN 1DQJA 2QKIA 2WMPA 1XF1A 3WSQH 3LD8B 1L7TL 4X80L 1MHPH 2QSCH 3QEQA 1VPOH 3MODH 4PGEA 4LLQA 5EC2B 3AAZA 3WIIL 4RGOL 5E9DA 3UP1A 1O7VA 2FGZA 1CDBA 5FM5O 1OP5H 4FNLH 4MGXA 3RPIA 2VQ1B 3VXTB 2VXSL 1XGQA 5HSFA 4PP1C 5FO7A 2Q7NA 5FGCE 1N0LA 3DROB 4ZOAA 2DBJA 3QAZC 1CLOH 1FNHA 1T2JA 1C5CL 2F54E 3L5WA 5FYKU 3X13B 5HGAB 4I4WB 3I75B 2R1WA 3MRMA 4QWWD 4DGIL 1FL3B 4F33B 1IGYA 5E08L 1YNKH 1RUAH 4PLKD 3KHOA 1MY7A 1JFMA 3T09A 1IM3A 4KKCC 2DAVA 4ZTOL 4MA8H 4UU9A 3BVNA 4D3CH 1R5WA 5C0NC 2Q20A 2VIRB 3ZE1E 4MNQD 3O3BB 2A6JA 4XAKE 3N50A 3L3JB 2A2QT 1UWGL 1NMCC 3MREA 1UZ8A 3O2WL 2VC2H 5L2JA 2DD8L 1F5WA 3GMQB 2J8UF 3KNBA 4FFEX 2GT9A 4UUJB 2YUXA 3U0WL 3WUWB 1G7LA 3T1FA 3L3GB 1NCAL 3G6DL 2AV7A 4JRXD 2W65A 3NTCH 1WBZB 4EIZC 5LQBH 1C5BL 1YUHB 4I0PC 1L6ZA 4ZD3L 1VERA 5IW1A 1MFAH 3LKOA 3EAKA 4OJFH 4LEXL 4PG2C 2HTLD 1JZ3A 4GMTH 4P5TC 4X98A 2DLGA 4LSPH 5CGYC 2E7MA 4C55A 1HZHH 3TPKA 3D3VA 1F4WL 1OPGL 4PJHA 4L3AA 5C07E 3QP3A 1UXSA 3HRZB 4CNIA 3TN0D 2B0SH 1NAKL 2BHZA 4ZPVB 2FLBT 3O6FB 2XWJB 2HTKC 1CL7L 3FCTB 3Q1SL 3JXAA 1UGNA 2CXGA 3K2MC 1DQML 4Y4KA 3RL2B 2CO6B 1Z3GL 5EUOF 2R15A 1N6QL 1ZA3A 3DV6B 3H0TA 5C0AB 1MCPL 4PREB 1BLNB 1MHEB 1FE8H 5I1JH 5I1GH 3JWOH 2X4QB 3FT2A 2AJXL 2XZCH 2W0KA 2VR4A 1EHLH 4MAUH 1XH3B 1G7PB 3X14B 4JFZL 1EO7A 2EDYA 3B3IA 3W9EA 2VDOH 1YDPB 3L1OH 4UOW1 1CDGA 3V9FA 2OJEA 1ZT7A 2C3HA 2A6IA 1RUKL 4QTIH 3FQXA 3GB7A 1V3KA 3O3AB 3PWNA 5JQ6H 1KIPA 3SGKA 1N8ZB 1V7MH 2ZOLB 3PE9A 3FO0H 3G6JF 3N1PC 4O4YH 1N3NB 4H88H 3OKEB 4ZXBB 2MPAL 5EU5A 3QCUH 3ARDA 4DW2L 2YPVL 1T22B 2IAMC 4D9RD 4P4KD 5EORL 1Q0XL 4CW1B 2FX9H 1VACA 4JKWA 2WZPD 5ADOH 2ATKB 43CAA 4C4KO 1NCWH 1S7UA 3CFEA 5KSAB 1RIHH 1SEQL 4K3JH 3ARFB 4GW1A 4TUOB 2HKFH 2JCCF 3IDIA 3KLHD 4HMEA 4RMSA 3RGVC 3CXHJ 3OB0K 3TWCH 4YGVA 5DUPH 5IVXA 2VXVH 3JV5A 5BVPH 1AXTH 3NIFF 2GKIA 3KPOA 5I16B 1G9NH 4X9GA 1ZTXH 5DFWH 2HH0H 1QBLL 1IZJA 4HKZB 3TCXA 1D3CA 4O2EA 1F6LL 4N0UE 4M93B 5EZOH 1I9IL 3H9HB 5DS8A 2ENSA 5DVOA 2F58H 3BDYH 3QIWB 2Z93A 1T5WB 4N8CL 3IU3B 2NNAB 3DXAB 2NXYD 3T1WA 1F6AB 5HHME 1ACYH 4Y4FC 3HCVB 4DGVH 3NN8A 5FYLD 2IQ9H 1L7IL 4PRPE 5DGRA 3CGTA 3HMXL 4AG4L 5BZDB 2FO1A 4QRRA 2VZTA 3VDBA 1LE5A 3V8CA 1ZT4A 1OF2A 3SE9L 3UMTA 1RK1A 5TQ2H 3UJTL 1M7DB 3CFIC 5C8JB 2FHCA 4HGWB 1ZVSB 1AKJD 1MCNA 3C5SA 2F5AL 4JY4B 1KC5L 4NC1E 3MXVH 4LLMB 1AC6A 4XMLL 2FJGB 4HBQA 3ARSA 2MHAA 4JM4L 5LG1A 3S35X 5DLML 4NQCD 1S7WA 4UDTB 5L2KD 2I9TB 1U3YA 1GGTA 3O8XC 1YEHL 3KS0H 5F9DC 4JPWH 1J1XH 2MSPA 1BOGA 4OLZH 5AUMA 1JZ8A 4G6KL 1KSRA 5HYQB 1U8QB 1CGSH 1H3TA 2ERJC 4YBLC 5F9OH 3O3DB 1A7RH 1SY6A 1JVKA 2XKNB 3VXUB 5EO9A 3BYTA 2W9DH 2GITA 1FYTE 1KJ2B 2X7LA 1MCIA 4CKVX 2KZ1B 4G43B 3LEVH 2NY3D 5CINL 2EDRA 2ADIA 4F9PA 3BN9D 3RWIA 3U2SB 2HVJA 3UPRB 3MOAL 5CCKH 1U93B 4AT6A 2G75B 4L8DA 3ARXA 4DN3L 1NBVH 1T89A 4HZLB 3UROR 3R8QA 2ARJA 3ULUC 2BFVL 4WUUB 3FL7A 2N56A 5DQDH 4F7EA 2YD1A 2J3SA 4OGXH 4Z7UE 5F21B 1MCFA 4L1HA 1YMME 4Y19E 5KVEH 1MVUA 3IJSB 1T21A 3DSFH 5HGBA 4JCLA 2Z31D 2DWEA 1KNOA 4NQDB 4Q9QH 2OZ4L 4YX2H 5IT2H 3DIFA 4YDKL 1RULH 1J10A 3TJHD 1KTLA 4P2YA 5IIEB 2IBGA 5F3HB 1Q9KA 4KXZI 4UOJA 5LCVL 3BP7B 2NZ9C 4QY8B 4UTAL 4PRNA 1KB5L 4MNQA 4UBDC 3TPUB 4ZMAT 1OAKL 4WJ5B 2B4CH 4PJCB 1JYNA 2W07A 2PXYC 4XVSL 3B5TA 5E2WH 1PLGL 2R2BA 4OT1L 5J4MA 3UDWA 1FGVL 1F42A 2AK1L 4OGAD 5DHXB 1EPFA 1P9MC 1NBZA 4NUJB 2ITDB 2XRAL 3IFOB 2ZUVA 3FB6A 4MNGE 5DD1L 3PWPD 1FIEA 5I71B 5CJ8A 4R7NB 1BJ1J 1DEDA 1IAIM 1U8PB 1F4AA 2J2ZA 4DQOH 4L4TE 1XGTB 1U6AL 1FZKA 5TE6L 4NPYA 1KBGL 4I3SL 5HVWA 5ANMB 4IRZH 5DQJA 4JZNB 3WCYA 1A0QL 5EU7E 3BUYA 3WKML 2DQDL 3C60D 1F11A 3ARVA 3TN0A 5IOPA 3IAPA 3JTTB 3CFDB 3WFEL 3MSPA 1TVHA 3HNSL 4PJ8D 4QEGA 3WJLA 4S0TD 4PRIE 5ERWB 3V4VL 4TOYL 1A64A 4BQCA 4U1GC 3H6JA 1MUJA 2WP3O 3MXWH 3VXSB 2DB8A 2A9MH 4HH9B 3D25A 1CDUA 4YIQB 3LSOA 3F58L 4EI5C 1IMHC 3L7EA 4AEHL 3CUPB 1NFIB 1KCRL 2R2EB 1SMOA 4HBCH 1BQHA 3PIQB 1NMAL 5E8OA 3HZVB 3BKYL 4Q0XL 2C26A 3DRTA 1NEZG 4I2XA 4RA0C 3E3QC 4PY7A 2VZ3A 4P4KA 3MR9B 4BFEA 3SGEH 5HPOA 1T0NB 3VH8G 4JN2A 1XEDA 2X1XR 3GKWL 3ARBC 4NIKB 3VH8B 1WC7A 3P2TA 4HHAB 4Y5VC 5GSVB 1BBDL 4A2LA 3VDAA 4LASH 2R4SH 2ZCKH 1CFSA 1TJGL 3FB7B 1J0YA 4L29B 3K2UL 4L4VB 1RU9L 4WW2C 3QI9A 1WWAX 5GS1A 1OWRM 3MLSL 5IFJA 3DX9B 4YHLL 5E95B 4P46C 1I9RL 4YHYB 4JLRB 5IHZA 2OSLA 1S7RA 2DJSA 4PGDB 3QNYA 2B2XH 2IPUG 3SDXF 5F72S 5D4QA 3JVGA 5ALBL 3D18B 4NDMA 2VITA 4M5ZL 4P5KB 3BZFA 3HKFA 4JKKA 1C8PA 2F53E 3KDMB 1UQSB 3GSOA 4OZIF 4KKLD 3WSQL 3LN9A 1AR1D 1MHPL 2QSCL 1VPOL 2OI9C 3MODL 2XNAB 4HKXB 4BA8A 4ZO8A 2VLRE 1TCRA 5AZEH 3BP6B 1OSZB 2H41A 3EYQD 3EIFA 4FNLL 4YHOH 5DURB 1S5IH 3U30B 3SCMC 1AKJA 2Z8WC 4LLDB 5A43C 5EBMA 1UZ6F 1A1MB 4WI5A 4AQ1B 5BQ7A 4JKMA 1CLOL 1NBQA 2ZSWB 3BPLC 4NQCA 3EKCA 5GHWH 5L2KA 3MUGB 4JANA 4NUGH 2PETA 1YNKL 4E41B 1RUAL 4ZFOL 5E00B 4X6DA 3U6RA 2NX5E 4NHUB 3AY4C 2DOCA 3WV0A 1D5XA 4X6CA 1WZLA 4MA8L 3VGEA 3ULSA 1A3QA 3I2CH 2IADA 4ORZC 2CMRH 3SDCB 1N26A 2MCPH 4MNHA 4D3CL 4JGUA 3NCMA 4PGCA 1BX2B 4LL9A 4Z7OE 2ZJSH 2V9QA 3LIZH 3MV8A 5JDJA 3AM8A 3IU4H 5IBLC 2VB5A 2VC2L 1X6LA 5FOJA 2ID5A 4MYWB 3PWJB 5T1MB 3VXMB 5DYOA 4IS6A 4OZGF 5F7HA 1OLLA 2BVYA 1MJ7H 3ZKSD 1YEJH 1I7UA 3J7HA 4QOKE 2EEAA 4H8WC 2WBJD 3KLAB 3NTCL 5LQBL 3MRKA 4JFYB 3LEXB 2V5RA 1WUNT 3LS5H 3PG2A 5GS3A 3WLBB 4ZYKA 1MFAL 4OJFL 5D1ZB 2GTWA 5JXAH 2Y9RT 4GMTL 1S78D 4LSPL 1NAMA 5EIVA 1R0AH 1HZHL 3MTRA 4JKPH 3DVNB 3MRBB 5E99H 2Z31A 4M48H 4JFED 5HYFA 3GDBA 4XP6H 2B0SL 1MRDH 3TVMB 4Y2DD 5DJAA 1X7QB 2DTMH 1NCUA 2BRQA 1CXKA 1K3IA 5IW6A 2E9BA 2CDFA 5C92A 3X11A 4K9EH 1B90A 4PY8J 2N7BA 1FE8L 3BKMH 5I1JL 5I1GL 3JWOL 1CE6B 1J05B 1G7IB 1CE1H 2XZCL 1N5YH 4CVWA 4N9GB 4MAUL 1EHLL 4S0SD 2BSRB 3GRWH 3VXRB 4IM8A 2IH3A 2G5RA 4GRMA 1UEYA 2F74B 2VDOL 3L1OL 2HJKB 2ITCA 2ZUQC 2ADJB 3QUZD 3GMPB 2UZXB 4JVPA 1FHGA 4LNVA 4QTIL 3NGBC 3QDGB 4MQ7A 1F3DH 5JQ6L 1P1ZB 2DYPD 2NY0B 1T7ZA 1G6RH 1DBKH 1V7ML 4LCCB 2BVUA 1DBBH 3FO0L 4Z77A 1G84A 4O4YL 3GMMA 3OPZH 1S8DB 4H88L 3GMNA 4KJQD 1U8MB 4PJ5E 5I9QB 2F54A 3QCUL 4IMKC 3KYMA 3QDHA 1UACH 2W92A 4UQ3B 3MO1A 3D69A 4GG6F 2FX9L 3BESR 4PBXA 5HDOA 3FB8B 4XXCA 5JDSB 5ADOL 1I8IB 1YQVH 2GQHA 1I1AB 1NCWL 2WIIA 4QCIB 3C60A 2UZIH 1RIHL 2VYRE 3CFKB 4K3JL 3FONB 4LCWB 5IVZB 2HKFL 1D5MB 5BV7C 3FRUA 1HHKA 3NFPA 1R3HA 1GGCH 2AK4E 3SO3B 3UTOA 1ERNA 4PJ8A 3TWCL 5CAYB 2I5YH 5DUPL 1OGTA 2VXVL 5BVPL 1AXTL 4BFIA 4G7VH 1G9NL 1CTNA 3NAAH 1ZTXL 2HH0L 3B83A 2R69H 3MRGB 5DK0B 3BX7C 2D7PA 5FUOH 3VFWA 1A9EA 5D96C 5E8NA 5EZOL 1Y0LB 2BY3A 4F9LA 3O4LB 1X5GA 4FFYH 3S5LA 2H6PA 1MCHA 2F58L 3BDYL 4X0KB 5HHQB 1J1PH 1XR9B 1WV7T 4L8SB 1ACYL 1XZ0A 3BGFB 2VO5A 4GAYB 1ZVYA 4LCIH 5D2LB 4DGVL 5D7SH 5GGQH 2IQ9L 3T8XB 5DD3H 4LAQH 5FCSH 9CGTA 2V7NB 4WVRA 1SVZA 1M6OB 5KAQG 4L3CA 3C6LD 4R2GC 4LGRB 1FJ1B 5TQ2L 4N8VB 3OKMA 5EN2A 5FO8B 3KPRB 1LP9F 4ZODA 2P5WB 4LNRB 2J12B 3MXVL 3WIFA 3PQYB 5CIPB 3E2HA 5I1DA 1WFUA 1MREH 4GH7B 6CGTA 4AL8H 3HI1B 3ARTA 4P4RB 4GJTB 4GFTB 1J8HB 3VMNA 5FO9B 4DKFH 4G5ZH 3B43A 3TBVA 4R96A 4ZUTB 1FFPA 2Z35A 3OG4B 5I1KH 4JPWL 1J1XL 4PBWD 1QR4A 3QULA 4OLZL 1DZBA 1ZSDA 4UNUA 1AGBA 1XGUA 3MOBH 4Z95H 3BO8A 3JTSA 3IKCB 1CGSL 3BWAA 5F9OL 4JFXA 1A7RL 2EZ0D 5IQ7H 1XF5B 1L0XA 3IDNB 4P48A 2EXYC 2W9DL 4M6NH 5JA8B 4CDHA 2CGRH 3CDGA 4K07A 3LEVL 1P4LA 5DJYB 1MRFH 1VGKB 1WIOA 3ZKXB 3FT3A 3IGAA 3QEHA 2FDBP 3CX5J 1VKXB 5HDBE 4Y4KC 3UZEA 5CCKL 2X9WA 2VUOA 4L4JA 3TH2T 3KLSA 2HT2D 2I24N 1UFUA 2YA2A 3ZKMD 4I5BB 5DJXA 3WFBH 1NBVL 4EI6A 3HZYA 5E5RB 5JQHC 1FNGB 4GW5B 3QT2A 2V6HA 3MUY1 4PJIB 5DQDL 1FC2D 2BZDA 4JB9H 4OGXL 3O3EB 3QAZB 5KVEL 3FRPA 5EC1A 2E8YA 3DSFL 1WBXB 4HF5H 1KN2H 2R1XB 4Q9QL 3SDYH 1UA6H 3SGKC 4N0UA 4YX2L 5IT2L 1BIIB 1VESA 1RULL 2VRAA 4UMGA 3X17A 5IVNA 1MLBB 5GJSH 1YC7A 4QHNB 5CSZB 3ARDC 4RAVB 4JFOB 3RL1B 4PJ9D 1N2RA 1QRKA 4K9EC 2JIXD 3O11B 4W6XB 1UJ3A 2B4CL 5F7UA 2XZAH 3BD5A 3X3FH 5IG7A 4G8GD 4HK0B 1NMCB 5E2WL 5HI3C 5CBEA 4R4ND 5J9PB 1YMHA 3TIDA 3QNXB 3BN3B 3GBLA 1UKTA 1KFAH 1I8KA 4S11A 5C0AE 1B9ZA 5JIKA 3GBNH 4QRUB 1KIUA 4Y16A 5IQ9A 1ONQA 4GS7C 1KTDA 4OV5B 4U0QB 4HKJA 1DFBH 3ZSSA 5IWLA 1TZGH 4NQSB 3QUYC 2WBJA 1I7ZA 3MRNB 2PW2A 3T65A 4I0PB 2EYTB 4DQOL 4JRYD 2MQ3A 2KPNA 4CRPA 1GYAA 3ULVE 2JB6B 2X4TA 4GO6B 3MJ9A 1T5XA 4IRZL 5T33H 2RB8A 1N59A 1DP0A 3MFFA 5H2BA 3WIHA 3VFPA 4I9WE 3LKNB 1FVCA 4JFEA 1VSCA 3BGMA 3CJJA 2BXZA 4WGWB 4Y2DA 4ODUB 1FYTA 3UTZB 3FO2A 4G42B 5DC0A 4KQ4H 3MXWL 5JORB 3VFGH 3T4AA 2A9ML 4WFHE 1MCKA 1R3JA 3RUGA 3A6CH 5J0BA 1HHHA 2YD7A 4ZUVA 1O0VA 3QUZA 1GZPB 4K8RD 2DS4A 1F13A 4EUPG 2Y72A 2FO4A 5FYJE 4NRYB 2HT3C 4HBCL 1BFOB 3VXNA 3ZKNC 1YEGH 3HZKB 4Z7VF 4X9HA 2FJFA 4N8PA 4QRPD 1QRNB 1PQZA 3D39E 1BD2B 3P0YH 2EKSA 2J6EA 3RTQD 2IAMB 1K5NA 2AQ3A 1I1CA 3ROOA 3DXAE 1FG9C 2HT4C 4GRWH 1QFOA 4JFDD 3T0EB 2H26B 2ED8A 1OGAD 2XQYK 1WK0A 15C8H 1U42A 4F9PC 1N0XH 3U4EA 4FFVD 1FCCA 3ARED 2HMID 1DVFB 3RGVB 4LASL 1C7SA 1W72H 4OQ1A 2R4SL 3MLVH 2ZCKL 3MLRH 5KOVC 5IB3A 2LTQC 5E8PB 1T89C 1CD0A 4N0CA 4RX4A 4G6FB 1Q9WB 1Y18A 4W81A 1FZOB 4PD4K 4JZOA 1MY5A 2VNCA 3HUJA 2NY1D 3IXAB 4MNGA 1DUZA 4JFHD 2YD6A 5DI8B 5F96H 4E5XB 2B2XL 1I8MA 1AGDA 3OQ3B 4ZG1A 5D7IE 5I1LA 1I3VA 2ORBH 4ONOA 1EEQA 5IP4A 4QWWC 4Y4FB 4L4TA 4ODBD 4PLKC 4QXTA 5MHSD 3QUXD 3MV9E 4F15C 4OD3H 3DHMA 5JHDD 3VXUE 1CLYH 1A21A 1SBBA 4QNPF 2V5YA 1BM3H 5AZEL 1TVBB 3WKNA 3C6LA 5DJDB 4YHOL 4M6OH 1S5IL 4MVBD 4X5XB 4YUEH 2X4SA 5F1KC 4N1EA 4JG1H 5LXGH 3UDWC 2NW2A 4M7LH 1Q9OA 1BVKA 5GHWL 4HKBB 4AK1A 1RQ5A 5F1OB 4Z7WE 4NUGL 3O8XB 4TNWK 4JHZA 1BOYA 3OL2A 3R06B 4GXUM 1JHTA 3PWLA 4UT7H 3NABH 1T6WA 4WUUE 3S97C 4F2MB 5KSVB 3I2CL 1WWCA 4AM0A 2CMRL 5CLTA 2MCPL 1U8JA 3SKNA 1QLEH 2ERJB 4YBLB 3QXAA 1HHJB 1O5DT 1TTFA 2HTLC 4OZFB 4NQDE 4HJGA 2ZJSL 5GGRA 3LIZL 1D9KD 3IU4L 4RZCA 5C0CD 4NNXA 1D5ZB 3RGHA 1RMFH 3TN0C 3VFMB 2AKRB 4FQ2H 2D3VA 1U8IB 2FWOA 1MJ7L 1DN0A 4LPWA 1NDGA 3WJLC 3TPUE 1T20A 2EO9A 1YEJL 1ROWA 1JHKH 3EJJX 1EIBA 4OZ4A 4PJCE 4X7TA 5C0BD 1YEDB 1HI6A 3QNZA 5DJ6B 4AH2B 1ZV5A 1KG0A 4IRSD 4PV8A 4QO1A 3TH4T 5KG9A 3C6SA 3LS5L 2VDKH 2XTJD 2X05A 3VGFA 4PJBF 4GKZA 4RISH 5EO1B 3RWJA 3PWVA 4PJFB 1R0AL 4JKPL 4RQQB 4UB0H 1TIUA 5E99L 4I13B 4KI5F 4EVNB 4M48L 4LP5A 4XP6L 1JL8A 1MRDL 2FBJH 3VD4A 2DTML 4FFWC 3V2AR 3DV4B 1RV6X 1JNLH 4JCMA 1DLHB 5ANME 4K9EL 3F65A 2A73A 3BKML 3PV7A 1Q38A 1KYOJ 1T0MB 3FAWA 4PRBB 3KG5A 2JIXA 4FHBD 4P4KC 4GLRH 4QRTA 1CE1L 4PRHB 1N5YL 3H9SB 1ED3B 4M7ZC 4LPVA 3GRWL 4MCZB 1OP3K 3NIDE 4G8GA 4EBQH 5ICYA 1DJSA 1SEBB 3BOVA 3EYFA 4MDJA 1BZ7B 5LAXB 3KLHC 1WWWX 1C12B 5C09D 4RWYH 4XMPH 3MGTA 1G6RL 1DBKL 1Z9LA 3VXSE 1DBBL 2NY6D 2VKWA 3OPZL 1Q1JH 3QI9C 2QQKH 5GS1C 1NC4B 5F6HI 4V3EB 3INUH 2EH7H 5FYKD 4JRYA 4H0HB 2GIYA 5KSUA 1UACL 3EO0B 4P9HH 4E42A 4Z5RB 5KVDH 2X70B 1MWAB 2FR4A 2LU7A 2C4FT 1XCQA 2GTZB 4ZNEE 3RRQA 1YQVL 3P9LA 3JVGC 5L9DH 3MNZA 1CD1A 2UZIL 5SWZD 2VR9A 3DX7B 4JDVB 3QFJB 3ZE0E 5DZOA 4OIBA 3MRDA 4HS3B 1R6VA 4RFNC 1GGCL 1EAPB 1D6EB 2YXMA 4UILH 2I5YL 5BRZB 1TNMA 1JGEB 3REVB 2E7LA 3MRRB 43C9B 5B38A 1TJIH 4U1GB 4G7VL 8FABB 3X12A 3NAAL 3CCHB 4LCYB 3PJSA 4HFWA 2R69L 1MIEH 3MA7B 5FUOL 4MJ4A 3LN5A 3UTPE 4YHZH 1RK0B 2GK0A 1S9XA 2HVKA 1MHHB 4FFYL 5B39G 4QOKA 4EI5B 4XP5H 1MRCH 5IBUB 3D2UD 3G5XB 2O5YH 2W59A 2AJVH 3CC5A 1J1PL 3ES6A 3RX7A 1YN6B 1HEZB 4L4VE 1SJHA 4LCIL 3J8F7 5D7SL 5MENB 5GGQL 1JF5A 3ABZA 4EDXA 5ETUA 4PJ7A 2VABA 5DD3L 4LAQL 4U6XB 4PJXF 4E0RB 4QRPA 1A1OB 1RSFA 1NCCH 4CMMA 1DEEB 3RTQA 5CP3A 1TETH 4AQOA 3VD7A 3JUZA 4A6YH 1P4IH 4NQVA 3VRIB 3SE4A 3EGSB 4RRPA 3S96A 3MLXH 4XI5D 4XVJH 4JFDA 3ARBB 5KS9B 1NCBH 3AM8C 2Z92B 3ET9F 2NY3C 3GUTA 3BN9C 3EUUA 1Q94B 4WRLA 2IQAA 1BBJB 1MREL 2EDDA 5BZWB 1HHGB 4LDLB 3OR6A 1QSFD 3AREA 4AL8L 3DUSB 1UWXH 1NEUA 5FYJU 4DKFL 4G5ZL 4WFHD 3T3PF 4NN5B 2Y25A 3HPJA 5I1KL 3FB5B 5C0RH 4WW2B 3D0LB 4DVBB 4TYUA 4QKXB 1INDH 1U8KB 2ICWB 4JFQA 3MOBL 4Z95L 4P46B 3RWHA 4NSKA 1S7SB 5IQ7L 1ITBB 5GRXG 3U83A 4E41E 4MMXC 3GSNH 4M6NL 1PBYA 4PJ5A 2Z31C 2EXWD 4XBGA 4NHUE 4HWZA 2CGRL 3T0DA 1MRFL 5FUCE 5IM7A 4LHUB 2GYSA 2KZWA 4M1GH 3MBXH 2FRGP 1X4XA 3IVKA 5C9JB 5F89B 1W8NA 3FFDB 5JHDA 1MAKA 1BFSA 2XPGB 3LH2H 1KPUB 5DHVB 2Q87A 4YPGA 3WFBL 1ZHNA 2C3WA 1JRHH 5FF6B 1NCNA 2R2HB 1JZ5A 1AP2A 3SCMB 1QSEB 4XBPA 3FJTA 3VXME 5DEGA 4JB9L 1EHAA 1I3RB 1LK2B 3S36H 2PYEB 3L6FB 2JE8A 1KN2L 4HF5L 4FA8A 3OR7B 1I75A 4K3EH 3V5HA 3SDYL 1UA6L 1BJMA 3QRGH 1ORQA 4KRLB 5D7KE 3V0WH 2YR3A 1NBYA 5AWNH 2YA0A 5GJSL 3EO1B 1LGVA 1KCSH 4S1DD 1FFNB 3T2QA 2VISB 1IL1B 1BF2A 3PL6A 2Z91A 4JAMA 5ITFA 4X99A 4K3HA 2Y4SA 4XXCC 4F7CA 3WIHH 5BS0E 2XZAL 3X3FL 4JKLA 4KRMB 4PJGB 1D9KA 4FQHB 4G9FD 4XCEA 4CUCA 3C60C 5C0CA 3PDDA 4LCUB 4N90D 1IGCH 1KFAL 5EG6C 4LSRH 3P11H 5JO5A 3GBNL 5EBWB 5DF0A 2X44D 7CGTA 4PJ8C 1YY8A 2VLLB 2VN7A 3QXUA 4KMTH 5LKNA 1DFBL 5C0BA 5D5MA 1TZGL 3VXRE 5J6HB 1SYSA 1IAMA 2VTFA 4IRSA 2H8PB 1PYWB 1FCGA 2Q76B 3RQ3A 4ZFGH 1AJ7H 4WWKD 4F9LC 4GOSA 1XGRB 4F37K 5T33L 3BISA 4K94H 3TZVA 4WWID 3CSGA 2HRLA 1TFHA 4QHLB 3T08A 5HGAA 4I4WA 1TJHH 3FTGB 4GXUN 2J6EH 2V2WA 5MEQA 1LEIA 4UQ2B 3BJ91 1M7XA 1IILE 1U95B 3BPCB 4KQ4L 4XX1G 4OZHF 3FMGH 3TF7A 3VFGL 1FFOA 4HLZH 3T0BA 4LCWE 1WAAA 1Q0YH 3CVHH 3MV7B 3O3BA 4ZTPH 3A6CL 3HPLB 4LDEB 3EW3B 3F6IA 3E2HC 1TCMA 2P5ED 2WV3A 1W0VA 3NGBB 2G60H 4WHTB 5C09A 4HULB 3IFNH 4R90H 3GMQA 3DTXA 4UUJA 4QLRA 1YEGL 5DEZA 1CXHA 5JOPD 4NRZA 2WW8A 3O4LE 3ETBF 4YNYA 3P0YL 3HE6D 5LGHH 2NXZD 3M07A 1IEHA 4ONGH 3THMH 2WY3A 4NN6C 3LB6D 3MACH 4OAWB 4H25A 3STZA 1EA9C 1DSFH 5D2LE 5DGQA 3D1MC 1OD7A 15C8L 4ELMF 1AGFB 2R9HD 4YDLB 5SWZA 2H32H 1DQJB 4DCQA 2QKIB 3I6KA 1N0XL 4J12A 4KKLC 5BV7B 3QEQB 3Q6FA 1CGVA 4PGEB 4LLQB 5F1IA 1W72L 4WHYG 3MLVL 3MLRL 3SOBH 1ZE3C 3PDOA 1UH4A 3O6FA 2XWJA 5E9DB 3FCTA 1L0YA 5DUMH 5SWSD 4UIMA 2YUVA 3KPRE 2P5WE 3MNVA 3UO1H 3EYQC 3RPIB 1OWWA 1WLHA 5C0AA 3V7AG 4PREA 1XGQB 3PQYE 4OQTH 2Q1EA 5FO7B 5I2IA 4YO0A 2ZG3A 4G8IA 2VAAA 4D9QD 2YMXH 4LRIA 1L0QA 3W82A 3DI3B 3ISWA 4YC2C 5F96L 1J8HE 2D31B 1G7PA 3L5WB 3X14A 3C9NB 4LGPB 1U8NB 2R1WB 3MRMB 2ORBL 4FTVD 3BD3A 1IGYB 3KPMA 4PRDA 1OOAA 1ZAGA 1NFDB 5CUSH 4OD3L 1YEFH 2ZOLA 4UU9B 3BVNB 4HEPG 2BXYA 1CLYL 1DR9A 1NCTA 1R5WB 2M26A 5AAMA 1BM3L 1V7NH 4R2GB 4M6OL 1P84J 2MQCA 4D0BA 1UJ3C 3KPQA 4YUEL 3ZE2E 2EDJA 1LMKA 3MREB 1KJVA 3PP4H 4JG1L 1UZ8B 3JZ7A 3UJIH 5L2JB 5LXGL 4M7LL 3GMLB 3T0XA 1PVHA 3KNBB 3QO0A 2C9AA 4Y16C 5KN5B 5KSAA 2BY0A 3DX6A 3ZHKA 1G7LB 2ZPKH 3IB4A 5GS2H 2AV7B 5K93A 2UWEB 4UT7L 5IWLC 2W65B 3NABL 4O2FB 4PJIE 2WBJC 4QGTA 3E6FB 1TMCA 2D0HA 4NQTA 3V6FA 4WI4A 5IW1B 3GBMH 3LKOB 3STBA 1QLEL 4X98B 5T1KA 1S78C 1OT1A 3HAEG 3D3VB 3IJYB 3ALPA 3VD3A 4PJHB 1UYWH 3D39A 1PG7H 4LSVH 1UXSB 4JHBA 4CNIB 1H3PH 5BVJA 3H9HA 1RMFL 3UTTD 1R5IA 4G8FA 3QIWA 1T5WA 5ENWA 3I02B 3IU3A 4FQ2L 2NNAA 1ULVA 4Y2DC 3DXAA 4Y4KB 3TA3B 3P30H 1G1CA 1NH6A 1ZA3B 3H0TB 3L9RA 4XPAH 4DEPC 2AI0H 1ODAA 1HQ4A 1JHKL 2M1KA 2NLJA 3AROA 4MD0A 3TBSB 2X4PB 4GRLD 2Q8BH 4POYA 1C5DA 2VDKL 5M95B 4EQ3A 1YC8A 3B3IB 4RISL 3W9EB 4OLEA 3NPZB 2OJEB 1HHIA 2A6IB 4HGWA 1ZVSA 3K80A 1JF1A 2W60A 3QUZC 4UB0L 3GB7B 2YC1A 2FJGA 4OFIA 4WNQA 1KIPB 2V7HB 1X5IA 2FBJL 3RIFF 4U7MA 4JM2D 2I9TA 4KJQC 1JNLL 5EU5B 3ARDB 5D7IA 4AENB 2YUZA 2YD5A 3S3JA 4AEIH 3VGAB 4LLVB 1VACB 1XAUA 2VAJA 3OXSA 3SDDD 1JIBA 1U8QA 4OM0H 2IFGA 43CAB 1S7UB 3HNTH 3MV9A 3C2AH 3CFEB 4EBQL 4G9FA 3VXUA 3LEYH 3MOQA 3LDBC 5ITBH 1KJ2A 2HWZH 1A7NH 4G43A 4GS7B 4RWYL 1LO0H 4YDJA 3TCLA 4D2NA 4YGVB 4XMPL 5IVXB 3TBWB 1F6FB 3UPRA 2CJUH 3KPOB 2OTWA 1U93A 4Q2ZA 3LN4B 3QZWG 4Y8AA 3QUYB 4N0CC 2A83A 1Q1JL 3HC3H 2PW1B 2QQKL 4G6JH 3QZWB 3INUL 2EH7L 4O2EB 4WY7H 1GHFH 5KVDL 4P9HL 3E6HA 1U9KA 4Z7WA 4WWKA 1TENA 4M03A 3TIEA 4XNZC 5EU4A 2X42A 4CMHC 2BNUA 2Z93B 1JWUA 4BSWB 2IAND 2I07A 5L9DL 5KSBE 1PKOA 4HJJH 5I75C 1X5FA 1QRNE 3NN8B 1BD2E 3O45A 5D1XD 5FGRA 5BS0D 3MRIA 3K4DA 3AU1A 5C6TH 4UILL 5CP7A 4QRRB 1LE5B 1ZT4B 1OF2B 3T0EE 1TJIL 3B9AA 3C6LC 1Z2KA 1RK1B 5F3HA 1E27B 4BKLB 4YQXH 5DTFB 4Y7MA 1HH9B 1MIEL 1KCVH 4K23H 3C5SB 3W39A 4GAJH 4DFIA 3ARQA 4YHZL 5F3BA 2MHAB 2CD0A 4UOW0 1S7WB 4XP5L 1MRCL 4OFYD 3OAZH 5DJ2A 1FSKB 2O5YL 2AJVL 4P59H 3I85A 1WGOA 3Q3GA 1EX0A 2GJ6D 2DRUA 3UBXG 5DMGD 3Q5TA 2UY6A 1BOGB 2EDWA 4N5ED 1NC2B 1ZLVH 1NCCL 3ESUF 3HE6A 5JHLH 4NKDA 1TETL 4BUGA 1V3JA 1P4IL 2EDXA 4A6YL 2EZ0C 1HNFA 4YEFA 4MJIB 2CUIA 5D7LE 3MLXL 2GITB 4XVJL 4GBXD 2X7LB 1NCBL 5ANMA 4MWFA 4JZNA 3SE8H 2ADIB 3RWIB 1R5VA 2HVJB 5HI4D 4L8DB 2CRMA 3ZKMC 1G7MA 2LTQB 3ME0A 4WFFD 5AYQA 5SWSA 5C0RL 5JMRA 2ARJB 5GRVL 2NMSA 1INDL 3A6OA 1RUPH 2M2DA 4ODHH 4F7EB 3OKKA 4HMCA 4XZUA 1FL6A 2A74A 4O58H 3RHWK 1T21B 4KJPC 4HH9A 5HGBB 3GSNL 3LKRB 4Y89A 4FTVA 2DWEB 1KNOB 2X5PA 1YPZA 5C0DA 2JK5A 3DIFB 2FD6H 1NLBH 4BSVA 1NSNH 1IC1A 1HSBA 4M1GL 3MBXL 1KTLB 4PJDF 4NM8H 4F15B 3LVEA 1MCOH 4G59A 1EJOH 4Q58C 2J8UE 3LH2L 2XTLA 4FQCH 4PRNB 4LMQE 4JQVA 4MNQB 3PP3H 3DHJA 3QBTB 1JRHL 2EO1A 5GGTA 1NEZA 5MP6H 1X5XA 2ED7A 2OL3A 1HK6A 2R2BB 3B9VA 3T0WA 4R4NC 1EERB 2GY5A 4U49A 2C7UA 3GJFA 4LKCA 2CK2A 3S36L 3VH8A 5C0JA 4U3HA 3SHSA 2BOCA 4K3EL 3FB6B 4XB8A 5D7JD 3QRGL 4D0CA 2JJTA 5GSVA 2AV1A 3ULUE 3V0WL 4JRXB 5AWNL 1VA9A 1UT9A 1WZ1H 3ZZ1A 1KCSL 2QQNH 2DQFB 4F3FA 3FB7A 5F7LB 1AGEA 4PJFE 3FFCD 1FZKB 3FOLB 3TBYA 4NPYB 3UBXI 5DQJB 3REWA 4F7PB 3BUYB 3DX9A 3WIHL 1I3GH 1CL7I 3K8LA 3VI3F 1KB9K 2AEPH 3TN0B 4ONHA 3UTTA 4HZAA 1IGCL 2XG5A 1NDMA 5IOPB 4NFBA 4LSRL 3P11L 2YD9A 2ZWLT 3X3GH 4XNQA 4P5KA 1FVDA 1UCTA 3KDMA 4KMTL 4LKXA 2E7LC 3H9SE 4FMFA 2NPLX 2XNAA 4I0KA 4UDUB 4NFCA 1S9VB 4Y1AD 5DK2A 3MRHB 4ZFGL 3G6JE 2APXA 1AJ7L 1OSZA 3D25B 3LSOB 5EBGA 5FGSA 2OMBA 4ALAH 1EFXD 3PUCA 2I27N 1ZEAH 4K94L 3P4OA 5EZIH 4K8RC 5K9KA 3L7EB 2EDTA 4LLDA 1T7WA 2XFXB 1JYVA 5GJTH 1K4DA 4G3YH 4TVPD 1BQHB 4HC1H 4JPIA 5E8OB 1TJHL 2QADD 4JM2A 3QDJD 4CJ0A 3MLTA 2J6EL 3DRTB 4W70A 2VLKD 4MA3A 2QHRH 2HFGH 4I2XB 4N5UA 3RTQC 4P4KB 3OF6D 5DJCA 3FMGL 2KKQA 1VADA 3SE4C 2Q6WA 3SDCA 5EZLA 4JN2B 3SDDA 4M7ZB 4TNVF 1H0DB 3LZFH 1X5AA 1Q0YL 3CVHL 1WC7B 3QFJE 2L4OA 4ZTPL 1XR8A 1TQBC 1LD9A 1JPTH 4C83B 4KV5E 4FFVC 2H2SD 2G60L 3AREC 5IHLB 2HMIC 3IFNL 4R90L 3PWJA 3VXMA 1CFSB 4Z7NF 1J5OH 2C1PB 1CGXA 1SJEA 5C71A 5GS1B 5IFJB 1LVEA 5LGHL 3KJ6H 4ONGL 3THML 1S7RB 3QO1A 3MACL 3RHWF 1FDLH 3N1GC 1DSFL 1G1YA 2IANA 5MENE 3ULVH 2NXYB 4NDMB 2VITB 4JR9H 1OAQH 3BZFB 5CBAA 2FJHA 3C5JB 4HWNA 5IKCA 5F6HJ 3GSOB 5JA9A 4PGZA 5ISZD 1YA5A 2YBRA 3RBSA 5BS0A 3SOBL 1S7QA 1TCRB 4MCYA 2Y06H 5B4MD 1X7QA 3O0RH 5DUML 5KS9E 1XIWD 3UO1L 3VGBA 4OF3A 3BSZH 3MLYH 3VU2A 1AKJB 4JVUA 4OQTL 5JMOC 1J05A 4KMLB 5EBMB 1SMAA 2YMXL 3W11D 4YAQB 5SWQB 1RZKH 1GZQA 4HSQA 5BQ7B 1VFUA 4NQCB 3VXRA 4OFYA 5HJ3A 5L2KB 1OTTD 2GJ6A 2ADJA 2OCFD 3GMPA 3U6RB 4X6DB 2IALA 4GAGH 5D8JH 2B8OT 2VXTH 5SX4H 1D5XB 4X6CB 3MUJA 3IS0X 3ULSB 5CUSL 1DQQA 4N5EA 5FYJH 2VN4A 1YEFL 4HX1A 4LCCA 1A6TA 3PL6C 1VFAA 32C2A 4YPJA 1V7NL 4PGCB 2K9UA 3MV8B 4MAYD 3CXHK 4GBXA 1D9KC 3PP4L 3UJIL 2X1QA 3WXVH 2NY3B 4NT6B 5M94B 5DYOB 4IS6B 3JV0A 4MA7H 3HE7D 2DIJA 4Z8FH 1P2CB 2GFBB 4M6AA 4LCWA 2OR8A 2ZPKL 1KXTB 5I0ZA 3LD8C 4WUKH 1QSEE 5JXED 2HFEA 1TZHB 3MRKB 4IRSC 1CD9B 1CR9H 4ZYKB 2W0LA 3GBML 1XF2A 3O4OC 3QQNA 5BOZG 5T3ZD 5HGHB 2GTWB 1NAMB 1LEGB 4WTZG 1JTPA 4NWUH 4BJLA 1C16A 4NBZB 3TZVC 5IMLA 1U36A 1UYWL 2Z31B 1PG7L 4LSVL 5A2IH 1YJDH 1Q8MA 1H3PL 4GUPB 3BP5B 5D70H 1XGPA 5DJAB 3UC0H 5HHQA 5IW6B 3P30L 2CDFB 2HN7A 4GRWF 4J7RA 1MCEA 3X11B 4GAYA 1WZMA 3AUVA 4XPAL 2AI0L 1H3XA 2ICCA 1MEXH 3P4MA 3UPAA 2Q86A 5CEZD 4PJGE 3KPNB 4P2QD 1MFBH 5DD5H 3TF7C 2DLTA 2Q8BL 2E9JA 1M6OA 2OS7A 3I6LD 2IH3B 4GRMB 4OD2A 1KJ2H 2ITCB 4KHTH 4JRWA 4C56D 3LRGA 3KPRA 2P5WA 2PUQT 3M1BB 4MQ7B 2G2RA 4Y0GA 5CIPA 1CXLA 4ZSOB 5D7JA 3A0OA 2B1AH 4Z77B 3Q0HA 1E4XI 1TPXC 2NY6C 1YEKH 4X4MA 3GMNB 5FO9A 1T04B 3KYMB 5FA3A 2XQYG 4PJEA 1R3LA 3L5XH 5TQ0H 1A14H 3FFCA 3LKPA 3MO1B 3D69B 4AEIL 4JJ5A 4U1KB 5GGSA 4W4OA 5LGKA 4OM0L 1AXSA 4Z9KB 3HNTL 2WIIB 5E8DH 3C2AL 3C60B 2L0DA 4FXGA 1I8LA 4LOUC 3LEYL 2ESVD 5ITBL 2DJUA 5JW4R 3EDJA 2IBZX 1HHKB 2HWZL 4O00A 3NFPB 1A7NL 5J11B 1R3HB 1EGJA 1EEYA 5DJYA 1LO0L 4PJ8B 4TTDD 1OGTB 3O6FC 5MEPA 2P8PB 2CJUL 1IBGH 4JDZA 4DUXA 1Q72H 3MV7E 3HC3L 4G6JL 4R7DA 5CZVH 4PG9A 4WY7L 3MZTA 3V0AC 3VFWB 5IF0A 4Y1AA 1GHFL 1A9EB 2R0KH 5E8NB 2Z4QA 4LDOB 2QR0A 5EOTA 1JWSA 3MCKA 4LRIC 1KEGL 4GW5A 4HUNB 2H6PB 3KAAA 1EFXA 2EE3A 4PJIA 4LLAA 2D7TH 4HJJL 1XZ0B 3QQ4A 3H42H 1YECH 4MZ2A 3KPSD 2NY5C 3ULVC 5B3JF 3T4YB 3QHZH 2AQ2A 4KKAD 4HK3J 3QDJA 5C6TL 5HI5D 1BIIA 4O51A 1O7SA 3IAGC 1TZIA 4L3CB 4XRCA 3DJ9A 1FLRH 1I9JH 4P3DB 3OF6A 1JE6A 4XWGH 1WICA 1WZKA 3OX8A 4RAVA 2LV4A 2CO7B 3OKMB 4JFOA 3RL1A 4YQXL 4K23L 1KCVL 2HFFA 4XI5C 1VHPA 2BX5A 3CMOH 4TUJA 4GAJL 3O11A 3QEQE 4X7EC 5I1AA 3E2HB 5I1DB 4WFED 4GQ9H 5F9AC 5E9DE 3C5ZD 4P59L 4ELKA 5GRVK 5KSAC 2NQCA 4W6YB 1UC6A 2GSGA 2ZG1A 3TBVB 3BRGC 4R96B 1KXVC 3T3ME 2Q7YA 4QRUA 3DNKA 3QULB 1ZSDB 4OV5A 4J3XA 4ODTH 1AGBB 2B39A 1XGUB 3C09B 2LAAA 3BO8B 5JHLL 5DK3A 4JFXB 1NGPH 3CAFA 2XXMB 3VXOA 4N0RA 3UTSD 4XTRD 3O6KH 5IB4A 2PTUA 3BH8A 3QPQD 2EXWC 3CDGB 3QQ9D 1P4LB 4PLOB 2IPKA 3SE8L 2EIZB 4C54A 1NFDE 4X6BB 5JIIA 2WWKO 3IGAB 3QIWC 3QEHB 4DN4L 5I74C 2E7CA 5ISZA 3RKDD 3ILPA 1UZ6E 3B9KD 2OTPA 4D8PA 2F8XC 3G04B 4EI6B 5EOCH 3S8WA 3HZYB 3ZE1F 5E1AA 1U3HD 5FB8A 2Y5EA 2EDHA 4PJAB 4TPRH 1RUPL 3VD5A 4ODHL 4YXKH 5HVFB 3SPVB 3JUYA 4H26B 5FGBA 1K8IA 4YC2B 3ZDYE 4O58L 5EC1B 4P2OD 3QA3A 2WLYA 1A7QH 2UWEE 4XVUD 3EYVA 4WI7A 5DZLA 4KMQA 5JPMA 2FD6L 1NLBL 1YJDC 1NSNL 1T6VN 1XF3A 3ZO0A 3PGDA 2VL5B 3UAJD 4EUPA 4NM8L 1MCOL 1EJOL 5I15H 3GKZA 2Z8RA 5FA4A 1G6VK 3D3VE 1N2RB 5KSBA 4FQCL 3PDGA 4FG6C 3RNQA 4PJHE 5F6IC 4D0DA 2PKDA 3OGCA 3NMEA 1UJ3B 5IG7B 5MP6L 3MBED 3ESVF 4MAYA 2HRPH 5CBEB 1YMHB 3VMPA 3TIDB 1KF9B 1I8KB 3T0EA 4XVTH 5SX5K 3N9GH 2X4NA 4YBHA 5IQ9B 1BZ9A 1E4WH 3HE7A 3QG7H 1ONQB 5J3HD 1KTDB 2ADFH 5EWIH 1GJIA 4IRJD 4IMLA 4HKJB 1DVFA 2WBJB 1I7ZB 4POZD 5JXEA 1WZ1L 2PW2B 3RVUD 3TT1H 4FMKA 1AD9B 2QQNL 4M8QA 4WWKC 1T5XB 1ZKAA 1N59B 2VLMD 3BIBX 1I3GL 5GZND 1FZOA 5H2BB 3C08H 5CJQH 3VFPB 1FVCB 4X9FA 2YSSB 4JFEB 2AEPL 4MD4A 3BGMB 4Q9BA 4M3JA 3ELAT 1G7QA 1K6QH 4Y2DB 5CSGA 1UM5H 3F7RA 3X3GL 4Y4HD 5D7LA 1PG7W 5EU3A 1FYTB 4LRNH 3CU7A 4DEPB 3K8KA 2Z8SA 5F7DA 5CD5D 4I3GA 3TM6A 1YY9D 3D87B 5CD3A 4KROD 4P2QA 5MERA 3T4AB 3D6GA 4OUUA 3RU8H 1F58H 1R3JB 3P4NA 3RUGB 4QT5A 4ZUVB 1J0JA 3GJEA 4ALAL 1ZEAL 3QUZB 4J8RA 3KWWA 4C56A 5EZIL 3DVFA 3QHTC 4XCYA 2JKXA 5GJTL 4U2ZA 2VWEE 4PPTA 2DYPB 4G3YL 4HC1L 5HYJD 2WAHA 2DQUH 3NCYS 2FJFB 5T3XD 1PQZB 1GXEA 2EKSB 1ND0A 2QHRL 2BNRD 2HFGL 3RIAK 1K5NB 3HE6C 5IK3A 2NXZC 2AERT 1GC1H 3LB6C 2ICEB 3LZFL 1HHJA 1QKZH 2OXGA 2GAZA 2J8UA 3LDBB 1QNZH 4LP4A 5FDWA 2CRYA 1JPTL 4LHJB 2XACC 3U4EB 1ORSA 4LARH 4QRRE 5FM5M 1DQTA 2FHFA 1D5ZA 2YPLE 4D9LH 5JIHA 5IB3B 3VFMA 1RZIB 1J5OL 3VMOA 1QTYT 1KENH 1IJ9A 3O2DA 1UB6A 5JIPA 4JZOB 1YEDA 1D5BA 3KJ6L 1LWRA 3HUJB 5DJ6A 4MNGB 1DUZB 4XNZB 1T1XA 5IJVA 1JV5A 3BZ4A 1AGDB 4CMHB 1FDLL 5I1LB 3DX8B 5FCUH 5EO1A 3ULVL 1VEMA 4JR9L 1OAQL 3K4ZA 3VFVA 4PJFA 5GGUA 3KPSA 4U1LA 4QXTB 4KRPD 5EUOA 5HD8D 4MJIE 2Y06L 3OKOA 3NFSH 3O0RL 2VZ1A 1KELH 4PLJD 4JQVC 3C6LB 3SJVD 3BSZL 2X4SB 3MLYL 4Y5YA 2W0FB 4PRBA 1N6VA 1KT2A 2NW2B 3H9SA 1RZKL 4DZBA 1BVKB 4NO3A 3F7VA 3BE1H 4ODVH 3C5ZA 4UT9H 1SEBA 3EZ8A 2JJTC 3G6JA 4GAGL 2EC9U 5D8JL 4B5EA 1JHTB 1K2DA 2VXTL 3PWLB 4CU7A 1ZHKA 4JVWA 4PB0H 3Q2CA 1X9QA 1XT5A 4DUVA 4XP9H 5FYJL 3WFZA 4HJ0C 1U8JB 1CFTA 3VFSA 5BMFH 1U3ZA 4UAOB 3QXAB 5EIIA 4Z7UF 1JWMA 4HJGB 1HYSD 3GM8A 4I77H 5GGRB 1JNNH 4IOFD 3UTSA 5IEKB 4JEGB 1HILA 1QSZA 4RZCB 4NNXB 3WXVL 1J88A 3NCEB 4ETYA 4MA7L 2FWOB 4K3DH 4Z8FL 2DLFH 1DN0B 1ZHBA 1NDGB 4P57B 4MNQE 1EHNA 3NCYP 1T20B 1JN6A 3B9KA 3DX7A 3QFJA 4X7TB 4OZ4B 1R3IH 2ZNXA 4WUKL 4M00A 1KG0B 4PV8B 1U3HA 4NWTH 4X6FA 3T0VA 4X9IA 5DVNA 1CR9L 3SKMA 5KG9B 3C6SB 2UYLA 3GSVA 8FABA 4GKZB 5DD6A 3CCHA 1ZLUK 4WDIA 3MC0A 4NWUL 5EPMA 1JCKA 4M61A 4S1QH 5CIPH 4P2OA 1G7JB 3QWRA 1BVLA 4CVZA 4JRXE 1YJDL 2QQLH 5D70L 1J87A 3S37H 5B39A 4ZS7H 3UC0L 4HIHA 4JM2C 5FECA 4UT6H 4YK4C 1HEZA 1RAMA 5IHBA 3NIGF 3PHOA 3LV3B 1QPPA 2A73B 3RIAF 5BW7A 5MENA 1MEXL 2HLFD 2JIXB 4MXVE 4QRTB 4FZ8H 3EOBA 1MFBL 5DD5L 3TV3H 3VCLA 5DRNA 3SDCC 2HJLA 3SDDC 4G8GB 1T0PB 3MBEA 1T1ZA 2XI9A 5ICYB 1KJ2L 3S6CA 3EYFB 4KTYA 4KHTL 4MDJB 1MAJA 1EGJH 1CFBA 2IGFH 1DANU 4KU1A 2Z92A 4HDIA 4AEEA 4F7TA 3MGTB 4ZUUA 4IRJA 1EUTA 1Q94A 2B1AL 4J23A 1H3GA 2HA1A 3FKUS 1XGYH 1YEKL 3DUSA 4KUCF 2VDLH 1DDHA 2F9BT 4U0RC 4WO4D 2D4DA 4JRYB 4E42B 5KSUB 1S9YB 3L5XL 1OTSD 5TQ0L 1A14L 4WTWA 3D0LA 3RI5K 2FR4B 1BREA 2HKHH 3OSKA 1N7MH 1GOGA 5L8KB 3IETA 3P9LB 3FO9A 3MNZB 5E8DL 5CS7A 4B7IA 2DMKA 1QFPA 3LMJH 2NY4C 3EYOA 3MRDB 4D9RE 4Y4HA 3L7FA 3PHQA 4LPYA 4WU7A 4KK5D 4DOHB 5J1SC 1IBGL 2EYSA 3X12B 1Q72L 3DMMD 4PS4H 4LFHG 3PJSB 4HFWB 3WDHA 5CZVL 1FZMA 1G0YR 3KPTA 2ZUXA 2R0KL 5HGGS 5IEHA 1MNUH 5D2NA 1S9XB 2HVKB 3S4SG 1QSEA 4L8BB 3V52H 4RGND 1ZGLP 2B5IC 3CC5B 2D7TL 1PD6A 1W0WA 1FL5A 1SJHB 5KW9H 3H42L 1YECL 1J0HA 4J3SA 5DJZB 5DMGC 1I3RA 3GMOA 5HYJA 1T80A 3L6FA 2ICES 4I18A 3QHZL 4EDXB 4PJ7B 2VABB 1X3DA 4OBSA 4QRPB 4N5EC 3SGEI 4LCCC 4YFLF 2BSTA 3RTQB 2BNRA 4Q6IA 1K3ZA 4Z18A 4NZRH 1FLRL 1LO4H 1I9JL 2FHBA 4NQVB 1F00I 4XWGL 4KY1H 1OP9A 1BP3B 1FFNA 4LVNC 2VISA 3S96B 3MRLA 4JFDB 3LQZA 1TITA 4GBXC 5FYLE 1OGAB 3CMOL 1OHQA 1J8KA 1AI1H 1FP5A 3AVEA 5F93C 3EDDA 2IQAB 4GQ9L 4JFFD 5EB9A 4PJGA 3JV4A 3OR6B 3AREB 2AXHA 5HI4C 4LCUA 3V5KA 3RVTC 1MVFA 1GGBH 3HPJB 4U1HA 3VFTA 1DCLA 4ODTL 4KK9D 5A2JH 1A2YA 4P0DA 3ALXA 5LGJA 4YHMH 3RWHB 4NQCE 4NSKB 3OAUH 1RIVH 2NY1B 5J6HA 4V1DD 5L2KE 1NGPL 4TSCH 1Z5LA 2COQA 4HAGA 3RY6A 1TLKA 3O6KL 4X6DE 3W0WD 3RVVD 4XBGB 5ILTH 4M6MH 4HWZB 4HG4K 3MLWH 2A38A 4RBPK 1OCWH 2PF6A 3IVKB 2CRIA 5E8EA 4RIRA 5JHDB 5INDA 2YD2A 3ARPA 1IT9H 2DQJH 5EOCL 3VRLE 5GS0C 1ZHNB 3KGRA 3LS4H 1AP2B 1OW0A 4TPRL 5IMKA 4Z7OF 4XBPB 2YPLD 3BFOA 4YXKL 3Q5OA 4MX7A 5I8KH 4ZO6A 1U8HA 2ILLA 3ZT6A 1LEKB 4ZOEA 3DYPA 3P0VH 4H5SA 3LY6A 5TF0A 1A7QL 3V5HB 3MQIA 5D7JC 1ORQB 5DFVD 4ACPA 5DXWA 4WHTA 1NBYB 1RUQH 5F8QC 4M1CC 1BF8A 3QQ3A 3WNOA 2W1NA 5I15L 3RJQB 1IGTA 3F7QA 3PL6B 2Z91B 1T4KB 4JAMB 1RI8A 2FSEA 1NGWA 4F7CB 4NKOA 4W4OC 4ODSH 4MA1C 1DLFH 1A6AA 1NQBA 1D9KB 3RWEA 2HRPL 2YPKA 1U41A 1E6JH 3PV6A 5C0CB 3OV6A 1I8LC 5I0DA 1KUMA 1CVRA 1RZJC 4DKAA 4HUXB 4XVTL 4HUUA 3N9GL 1E4WL 1EO5A 3MMEA 3QG7L 3D48R 2IF7A 2ADFL 1L9NA 2E7HA 5EWIL 1YY8B 2CDGA 3ZKXC 4RDQF 3GSRA 3MCLH 2F19H 5C0BB 3TH3T 5D5MB 2CK0H 3QDGD 3HB3D 1SYSB 4IRSB 3TT1L 5D6CA 2NY2C 1DBAH 5T1DH 2XTJB 3O4OB 1DL7H 2GHWB 5JNYA 3TBTA 4YFDB 3L5IA 5E7BA 2P4AB 4ZSOE 3TZVB 5EDXA 2JLLA 4S2SA 3PWPE 3C08L 4P9MH 2RIKA 1MQKH 5CJQL 5MEOA 2D31A 4H0IA 4OZIA 3C9NA 1U8NA 1K6QL 4HCRA 1UM5L 2QADC 3TO4D 2V2WB 5MEQB 1LEIB 3K4AA 3DVGA 4LRNL 3CX2A 4BQ6A 4FQPA 1NFDA 4F8QA 3BMVA 3WO3B 1FFOB 4OKDA 3KYKH 4OZFH 3RU8L 1F58L 3I50H 4LLUA 4R8WH 3SGDI 1I1FA 1QBAA 1W0VB 1PGRB 2H2SC 4HUMB 5C09B 3GMLA 1ADQH 3DTXB 4O5LH 1TPXB 2NY6B 2EIDA 2DQUL 2E6PA 2DWDA 5K59E 5KN5A 4CBPA 3HLAB 3CK0H 5FAAA 4NRZB 4YNYB 4OIAA 2UWEA 4O2FA 2AP2A 3ULUH 3WNLA 2WBKA 3DUHA 3E6FA 1GC1L 2UUDH 4LQFH 1IE5A 4H25B 3STZB 1NGQH 4IIQA 1HH6A 1QKZL 4XPTH 4Q9RH 5AD0A 5SWZB 1RJYB 1QNZL 4HUVB 3IJYA 4DCQB 2CLRA 3I6KB 1S7TA 3HAEA 4LARL 1KIQA 3Q6FB 5F1IB 4D9LL 3PDOB 1HOCA 1CFNA 2QQQA 3I02A 5ESAB 1KENL 4UIMB 3TA3A 3MNVB 3DMMA 3P3YA 5FKPA 5I2IB 4U05A 4YO0B 4G8IB 5FGBC 2VAAB 1AQDA 3DUUB 3TBSA 3PABA 2X4PA 4JO3H 1FRGH 4J3UA 5FCUL 3D2UB 5A2KH 1WFTA 3P9MA 2V9RA 1KYOK 3KPMB 1A6ZB 4PRDB 2V5MA 2W9EH 4NNYB 1QLFA 4X4XA 4WW1A 5IW3A 4ZQKA 4PGBA 3VFRA 5ACLA 1PY9A 2V7HA 4EDWH 5GGSY 5E7FA 2AJZB 5E5MA 3NFSL 4R0LB 1KELL 4OI8A 1JP5A 4D0BB 3KPQB 5B22A 4AENA 4K2UH 1MWAH 3O6LH 3U0PA 4YBQD 1A7BA 5IB5A 4MAYC 1KJVB 5DHYB 4LLVA 2KQMA 1EH9A 2APBA 2BOBA 1FC1A 4ERSH 3T0EC 1CDCA 4JFFA 3QO0B 4J3WA 2QSTA 5HDBF 3HE7C 4PP1D 3BE1L 1MI5D 4ODVL 4X6EA 4UT9L 3CFBA 1YZZA 2CIIA 3DX6B 3I9GH 4PJAE 1IC4H 1DVFC 1VFOA 1OP3H 4ZO9A 5JXEC 4PB0L 1C08A 1TMCB 2XT1B 4XP9L 4MQSB 3V6FB 3TBWA 5DT1H 4FABH 5BMFL 3AGVA 3CPLA 3LN4A 4GG6A 3QUYA 3SGJA 2PW1A 5T1KB 5E94B 4V1DA 3QZWA 1JNJA 1UKQA 4I77L 1JNNL 3BD4A 4ZO7A 3D39B 5C0ND 3W0WA 5BVJB 1NUGA 4BH7A 5EU6D 1R5IB 4P23A 3R0NA 4G8FB 1FAKT 1YYMH 5ENWB 1WITA 3BPNC 4UIKH 5I74B 4BSWA 2UVFA 4K3DL 2DLFL 5F88A 3BIKA 1Z9MA 3L9RB 4J6RH 5FV1L 1HQ4B 2X2YA 1R3IL 1DE4B 2WK2A 4KC3B 3WS3A 5J06A 2NLJB 5K9JH 5INCA 3GHEH 4MD0B 5EUKA 4AIZB 5KVFH 4NWTL 4I3RH 2E6QA 5FUZH 1C5DB 3V5DB 2YPLA 1E27A 4BKLA 1HHIB 1V3LA 5DTFA 2W60B 1JF1B 1HH9A 1M71A 2V17H 2X6MA 3VA2C 1CDIA 1MFDH 3VWJD 3UCRA 2YC1B 4S1QL 4WNQB 1QFHA 1JGLH 3EYSH 4P5TD 1AIFB 2QQLL 3S37L 2N1KA 4KUZH 1J9CT 4ZS7L 2MFNA 3RDTA 3VD9A 1VFMA 5IJKA 4UT6L 4J3VA 5D7IB 1TVDA 1P5UA 5TDOA 1J0ZA 3T2OA 3UBXA 3DYMA 3RVXC 3C8DA 2PO6D 2QSQA 3T0AA 4FZ8L 4XMKH 4DZ8A 5F6IB 1NC2A 5GISH 3TV3L 5KVMC 3OXSB 4JFEE 1J7VR 3QCTH 4BFGA 1WCBA 1JPSH 1LP9A 4OCNC 3MV9B 2WUBH 5ICXB 4G9FB 3O9WD 4OCYH 1SBSH 4MJIA 1MJ8H 1NGXA 2UZYB 5AG8A 4NRXB 2FEDC 1EGJL 2IGFL 1IGMH 4XC1H 5HGDA 4YDJB 4U3CA 3TCLB 2ZUTA 25C8H 4TTDC 3TO2A 2X1OA 3ECBA 1U2HA 3IDGA 2OTWB 3I3DA 4Q2ZB 1XGYL 4MSWA 2A83B 2VDLL 3RUGE 5DHVH 5DSCA 2YS4A 4YXLH 3E6HB 3KYAA 4Z7WB 2B1HH 5HVHC 4WWKB 4GKSB 4NQEE 3TIEB 3DECA 5IR1A 5EU4B 4CVXA 2X89D 3FZUC 2BNUB 2HKHL 1JWUB 1YNTA 1N7ML 1KGCD 2I07B 3CZJA 3QEGH 4JZJA 4Z78A 4OFPA 3W81A 4NP4H 3GSUA 4LU5H 3H7BB 3LMJL 3O45B 3LKRA 3MRIB 4KKAC 3DO3A 3TO4A 3AU1B 5HYSG 5CP7B 5HI5C 1UCBH 5F7FA 4NO0D 4OB5H 5HYSB 2A0LC 1J1OH 1ZMYA 1OTUD 1KACB 4N1CA 4PS4L 4PBVC 3W39B 1AQKH 4Y5YC 3RNKB 4GT7A 1RZ8B 5DEFB 1CGWA 2BP3A 1MNUL 5F3BB 5C2BH 4KI5D 1MLCB 5DJ2B 3V52L 4WU5A 3C5ZC 3Q3GB 5KW9L 2BDNH 1OL0A 2RFXA 3STLB 2CRZA 2FIKA 3HUJE 3P4LA 1EBAA 2F8OA 4YZFE 4GKNA 1JI2A 4H8WH 4KAQH 4PDCE 3HE6B 4NKDB 2NXZB 4JRXA 4NZRL 2E5EA 1LO4L 1CTOA 4KY1L 3BP4A 2DQFA 2YD4A 2DKUA 2YRZA 3FOLA 4XTRC 3L5HA 4BM7A 4MWFB 1AI1L 2DM3A 3QQ9C 4RAHA 4F7PA 1R5VB 4YDIH 5GZOC 5JOFB 2ZUUA 5DRXA 3B9KC 1G7MB 2P46B 3GIVA 1GGBL 5SWSB 2SEBA 1U3HC 4BZ2H 3DYOA 1BAFH 2LAGB 1PX3A 4YHML 3OKKB 1CVSC 4UDUA 1FL6B 4XZUB 3OAUL 1RIVL 2A74B 1S9VA 4TSCL 5HHPA 3AC0A 1A02N 2EKJA 3EJYD 3DO7B 3MRHA 4P2OC 5ILTL 2L7UA 4FTVB 4M6ML 1YPZB 5C0DB 3MLWL 4U7KA 2JK5B 1A9BA 4BSVB 3VJ6A 1OCWL 3K81A 1UJTA 1HSBB 4OFVA 4WENB 2XFXA 1IEAA 4WI2A 5GIRA 5H37H 3KJ4C 1INQA 5BW7C 2FL5B 1IT9L 2DQJL 3ROLB 1UH2A 2IPUK 5ACMA 3LS4L 4OCWH 2WM0A 4NHCH 1NEZB 5AAWA 2OL3B 3MBEC 3KR3H 4FS0A 5C0FA 5I8KL 2X4RB 2C7UB 2R8SH 1FFRA 3GJFB 1RD6A 1NLDH 1FVEA 4LKCB 1H0DA 1B0WA 3P0VL 5C0JB 4HQQH 2BOCB 3CNKA 5J3HC 5BV7H 4YJZL 4IRJC 3GSQA 4D0CB 4YHPA 3R8BB 4C83A 4M9PA 2AV1B 4Z7VA 4PJCF 3KPPA 1RUQL 2ZOKB 2GSIA 3RZCD 3HG1D 4NN5C 4F3FB 1AGEB 2C1PA 1PZ5A 2OZ4A 3TBYB 5BXFB 2EEBA 4NZJA 1B6DA 3REWB 4ODSL 2YWYA 1VDGA 4HPYH 3U4AA 1DLFL 2CR3A 5GZNC 2NZ9D 1IKNA 1VEOA 1P53A 2FH8A 1KJMB 5CZKA 1E6JL 3KVQA 3VWKD 5EU6A 4ONHB 4HCRH 3UTTB 1NDMB 4HIEA 2PXYD 3TT3H 4XNQB 1IGIH 3FT4A 4Y4HC 2VLJD 5EZJA 1FVDB 1EVUA 5IMMA 3C5JA 4LKXB 4ORGA 4KTEH 5CD5C 1YY9C 5I8CA 3MCLL 2F19L 5GGVH 4KVCH 2CK0L 4G8GE 1BWMA 2FX8H 2X4OA 1OD9A 4GRLB 5CGTA 4EN3D 1DBAL 5DK2B 5T1DL 1MCSA 2E9WA 2DDQH 4ENED 1DL7L 3F7YA 3NIDF 1IZKA 4ZAKD 2FECL 2P48B 3RPKA 5D2NC 1B4JH 5DWUH 3P4OB 3HFMH 5K9KB 3VWJA 4Y8DC 4P9ML 1MQKL 4U1NB 1K4DB 2OYPA 1PZUB 4YAQA 4P2CG 5SWQA 3OB8A 4KDVA 4JPIB 2EICA 4JRYE 4I18C 4JM2B 1P84K 3MLTB 4NOFA 4YK4B 2PYFA 3BW9A 4MA3B 3CSYB 1Z0NA 3DGCR 1QG3A 4Q6IC 2J1KA 3QPXH 1CIDA 5EOQH 5DJCB 2PO6A 1FO0B 4M7JH 1VADB 2Q6WB 3MROA 5EZLB 3SDDB 3KYKL 2HP4A 2DI8A 5H35A 4KFZC 4EOWH 3I50L 3O9WA 3IDMA 1XR8B 3DBXB 4R8WL 1LD9B 1ZANH 3CFJA 3IAQA 4DOHE 2E7LE 3ZE0F 1ADQL 5M7QA 4NT6A 5IBTH 4O5LL 3HA0A 4LPXA 2Y36H 3S36X 1P2CA 4K7PX 5B8CA 1SJEB 2GFBA 3CK0L 4JFPB 5CJOH 4QYOA 3SQOH 4U0RB 4XXDA 1F3JA 3ULUL 4R3SB 1TZHA 3QO1B 5T1LD 5KJRH 1MHCA 1A7OH 3RY6C 2X89A 4LQFL 2XA3A 5TDPB 1A4KA 1NGQL 2IANB 5HGHA 1WT5A 1CFVH 4XPTL 1M1SA 4PJ7E 4Q9RL 3VRJA 1LEGA 5CBAB 2FJHB 4QRPE 5IKCB 2P42B 4WTZA 1MCBA 2NY4B 4KRPC 4PTTA 3RX5A 2YBRB 2R0WH 5BS0B 4GUPA 3BP5A 1FNFA 1S7QB 5HD8C 4MCYB 1KPRA 4NO0A 3TJHA 4JFDE 5I19H 4PLJC 4G80A 1OGAE 4LBEA 1OW0C 4PJBA 2L7JA 3IRPX 3KPNA 4JO3L 1GZQB 1FRGL 4WHDA 5J56B 3G5ZA 5DA4A 5KOMC 2B5IB 5HJ3B 1LHZA 2Q8AH 1FIGH 2GJ6B 5J12C 2W9EL 2IALB 4NQED 5C08D 3M1BA 1UM6H 3H3KA 1WSST 3KXFD 4XBEH 2VSCA 4EDWL 1DQQB 4JO1H 4ZSOA 3OJDA 4HX1B 4JFHE 3PWPA 1A6TB 1ITCA 1VFAB 2VERN 32C2B 4YDVB 3IFLH 3QYCA 1T04A 4LVNB 3BI9X 1HYSC 4K2UL 1MWAL 3O6LL 4GBXB 4IOFC 4C57C 3DSNA 1IAII 2P8MA 1NKOA 5MHSE 4U1KA 4MLIA 1CLCA 5DUBA 4ERSL 1BPVA 5JHDE 1AY1H 1NGYA 3OZ9H 5DRWA 2BVEA 4YDLC 3QDMD 4U6HA 3I9GL 1VCAA 3S7GA 3VXPA 2VL4A 3ORJA 1QLRB 1IC4L 1E28A 5D6DA 3R0MA 2PYED 1FV1A 3QJHA 2HFEB 1FNLA 4KGLA 5DO2C 3AB0C 3CIQA 1S3KH 5DT1L 2P8PA 3CDFA 3MGOB 3NVQA 4FABL 1XF2B 1PX4A 2X1WL 1H5BA 4ZFOA 1X5LA 3EDFA 3E1F1 5CWSA 5C1MB 2BVQA 1T7XA 3WHXB 1C16B 5IMLB 2DI7A 3HNVH 4HLZG 2JELH 1ZT1B 4NOBA 5I6XC 1XGPB 4NBYB 4R9HA 3N1FC 1YYML 4UIKL 2EDNA 1RHFA 1RFDH 1JI1A 2HN7B 3RY4A 4NQUA 1B0GA 5D1QD 4J6RL 1JRHI 4AYFA 5F1SA 4JQXA 3T4YA 3P4MB 2Q86B 4XB7A 2HLFC 3MJGX 3N1QC 5K9JL 2FZ3B 3GHEL 5KVFL 5C0CE 4I3RL 5EO0A 5FUZL 1SY6H 1QHOA 5HHOD 4P3DA 4M5YH 4GMSH 5E03A 4OD2B 4YE4H 4OF8A 4L9LB 2V17L 3PHSA 1MFDL 2HJFA 2CR6A 3MLUH 2G2RB 5C0BE 1VGEH 2WINA 5D5ME 3D85D 1JGLL 3EYSL 4TSAH 3UYPA 5D7JB 4KUZL 4PV9A 5BOPA 2XTJE 4PJXA 1L9MA 3QWQB 1WBYB 3RZCA 3GFUA 5FA3B 4PJEB 3HG1A 1R3LB 3FFCB 4KK8D 4L8CA 3LKPB 1OTSC 3RWFA 4JJ5B 4XMKL 5C0GB 5GISL 5GGSB 4MA1B 5E4EC 2D9QB 2K7QA 3QCTL 1JPSL 2E27H 5HDQH 3TP4A 1AXSB 2NW3B 2WUBL 4IIQC 4FXGB 1ZLWK 4MQXD 4OCYL 1SBSL 1MJ8L 3T2PA 3VWKA 1IGML 4XC1L 3V4PH 1AFVH 2VDNH 3WO4C 1EEYB 2XKUA 4FXKA 3WS6A 2EIZA 2NTFB 2VLJA 1T1WA 25C8L 4X6BA 5MEPB 1T66D 4KK5C 1LNUA 1MJUH 4JDZB 3TA3C 2YRLA 1WAAE 3DMMC 1SYVA 2EH8H 2R1YA 4R7DB 1QBBA 1QQDA 4PG9B 2NY2B 5IF0B 1MCCA 4Y1AB 4YXLL 4EN3A 3G04A 2Z4QB 2QR0B 2B1HL 5EOTB 1JWSB 3MCKB 1ZGLA 4ZAKA 5A2LH 5C09E 1S7VB 4PJAA 1EFXB 1RVFL 2P44B 2XICA 3SPVA 4H26A 3LQAC 3QEGL 3QQ4B 3TNNA 3HS0A 2CLVB 4NP4L 1EEZB 4XNMA 4LU5L 5FYKE 2QADB 3TEUA 3QDJB 1PG7X 1MELA 1L4IA 4UI2A 4O51B 2VLKB 2XWBA 1UCBL 4M9OA 4OB5L 2VJXA 1J1OL 2VL5A 1TZIB 4XRCB 2UVEA 5FDYA 3MRQA 1JZ4A 2DQTH 3OX8B 3WE6A 3WHE1 1LDPH 5SWZE 4HIJA 1AQKL 2HFFB 2RHEA 2NYYC 5D2LF 3VGAC 4TUJB 5SV4A 5I1AB 4KGJA 5C2BL 4ELKB 2BDNL 4M3KB 2GSGB 2Q7YB 4X83A 3W9DA 3S88H 1AD0A 4BSJA 2OTUB 4H8WL 4KAQL 4JE4B 4TVSa 1F3DJ 3N06B 4P99A 2VWEC 5DVMA 3SGJC 1T7VA 1AD9A 5T1LA 3VXOB 5E5UB 1SM3H 4L5FH 5IB4B 1I4FA 3BH8B 2X1PA 4TULH 1G0XA 3H9ZA 2IPKB 3V95A 5DFTA 4P23C 5JW5A 1QP1A 4YDIL 4F7MB 4Y2OA 2XN9D 4DK6A 5ISZB 1E0OB 2YSSA 3ILPB 5GGVY 3PNWA 4D8PB 4WEBH 5E1AB 5FB8B 3WFHA 5IMOA 1A7PH 3GHBH 4JPKH 2VZSA 4BZ2L 3OJ2C 4HT1H 3ZE2F 3BYYA 1BAFL 3K46A 4I48B 1JFQH 3VFUB 5A3ID 4MJ6A 2Z9TA 1K8IB 4P2RD 1QSFE 4LFHD 3L3DB 4ODWA 2I60H 2NR6D 2VE6A 2J4WH 3QA3B 1AO7D 1VEPA 3EYVB 1FGNH 2CUMA 3CH1B 5JPMB 4F58H 1EFQA 1XF3B 4NQXB 3PGDB 5DFVC 4NQEA 1FSKC 3RDTC 5AEAA 5IJKC 1B2WH 4PJIF 4EUPB 2AW2A 2DYPA 4BZ1H 1SJXA 3BPOC 4KK6C 5FA4B 4X7SH 5KSBB 3QWOB 2DI9A 4OZHA 3RNQB 4D0DB 3OGCB 4BK5A 4OCWL 4NHCL 4HFUH 4PYHA 4N9OB 4MAYB 3KR3L 2XXCB 2FIRT 2XG4A 2VKXA 4L3ED 4XT1C 2R8SL 1CQKA 2ICEA 2A6DA 3QR2A 3SE3A 1NLDL 5HXMA 2X4NB 3C8KA 1KCGC 1BZ9B 3HE7B 3F12A 4NO5A 3KYOA 4HQQL 4K7FA 4XNYH 4U6YA 5FYLH 5K9OA 4IMLB 5BV7L 3QDMA 1MFNA 4MXWH 4WV1A 4OKVA 2DKSA 3IJHA 2R23B 2IMNA 1RZIA 1AXIB 1I1YA 4OCMC 5D9SA 4M8QB 5TH2A 1X5JA 3O41A 4YFLI 5IFAH 3BZEA 1RJLA 4GRWE 1MFEH 3CFCH 3ARDD 4HPYL 2OMNA 4OGZA 1E4XH 3LHPH 4RDQG 4ELMA 1JPST 4JZJC 4PR5A 4MD4B 3VFNB 4HCRL 3BPNB 3DX8A 5DQ9A 1G7QB 3U36A 3TT3L 1ZS8B 5D7LB 1IGIL 3TO4C 5HI3D 5EU3B 5D1QA 1U0QA 4DGYH 4KTEL 5F7DB 4PIRF 5E2VH 5GGVL 5CD3B 4KVCL 4UV4H 4P2QB 2FX8L 4G9FE 1FBIH