2YPLA

Structural features underlying t-cell receptor sensitivity to concealed mhc class i micropolymorphisms
Total Genus 71
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
71
sequence length
274
structure length
274
Chain Sequence
GSHSMRYFYTAMSRPGRGEPRFIAVGYVDDTQFVRFDSDAASPRMAPRAPWIEQEGPEYWDGETRNMKASAQTYRENLRIALRYYNQSEAGSHIIQVMYGCDVGPDGRLLRGHDQYAYDGKDYIALNEDLSSWTAADTAAQIIQRKWEAARVAEQLRAYLEGLCVEWLRRYLENGKETLQRADPPKTHVTHHPISDHEATLRCWALGFYPAEITLTWQRDGEDQTQDTELVETRPAGDRTFQKWAAVVVPSGEEQRYTCHVQHEGLPKPLTLRW
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HLA CLASS I HISTOCOMPATIBILITY ANTIGEN, B-57 ALPHA CHAIN
publication title Structural Features Underlying T-Cell Receptor Sensitivity to Concealed Mhc Class I Micropolymorphisms.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system/viral protein
total genus 71
structure length 274
sequence length 274
ec nomenclature
pdb deposition date 2012-10-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00129 MHC_I Class I Histocompatibility antigen, domains alpha 1 and 2
A PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2yplA02
3.30.500.10 Alpha Beta 2-Layer Sandwich Murine Class I Major Histocompatibility Complex, H2-DB; Chain A, domain 1 MHC class I-like antigen recognition-like 2yplA01
1N6QL 5MEQA 2EO9A 3ZYIA 3MRDA 4QRUB 4WTWA 2FHCA 4L1DA 3MR9A 2AQ1A 3FQTA 3LEXA 4K71C 1QSFA 5LXGL 2B4CC 5ESVA 4XPTL 1UGNA 4G8FA 4DWHA 4XAWH 4CDHA 5CGMA 5LWYH 5C0GA 1T5WA 1FG2A 1J1PH 3KPNA 1XGUA 4HQQH 3TN0C 3L5HA 5EBWA 2F53D 4HKJB 1ADQA 5BQ7B 1FZKA 4WFFD 4OT1H 2VLLB 3WXWH 3T1WA 1HKFA 3BX7C 3NFPA 4R4ND 4XRCB 4L8SB 5A2IH 5C9KA 5GS0H 1X5KA 3ME0A 4OSUH 3KPSA 4DW2L 2AQ2A 4M7LT 4PUBH 2A74B 4PRIB 4R3SB 2ICES 1ZGLP 4IM8A 5FGBA 3PP4L 5CP7A 4YQXH 4GLRH 1AHWA 3CCHB 1BWWA 4F33A 4RDQF 4LCYB 3L5IA 1SY6L 3WNPA 3GKZA 2YD6A 5HHXL 3ZTNH 4LCWE 4GKOA 2CIIA 3BZDA 2X4TA 3QUML 4JDVA 1FV1A 3SE3A 1P84J 3ECBB 2RB8A 3FB6B 3IDXH 3MQIA 3FMGL 4NRZB 4O2CB 2B1AH 2YD4A 4NZJA 2J6EA 3F62A 3DUUA 5GRJL 4G6FD 1DE4B 3B9VA 5FYKU 2XN9D 1IKNA 4ODXA 4HMDA 1KTLA 5EO0B 4IOIA 2NW2B 4PJ8D 4LSSH 5JPMB 4MJ6B 4U1KA 1FGNL 3SOBH 4XCNA 1FNGA 4K7PX 4H26A 2H9GB 3ARQA 5SWZB 3BT2H 5CGYD 3WDJA 4OFYD 2ENYA 4E41E 4JG0H 2ESVD 5FOBA 1MIEL 4GAGH 3UPRA 2BVPA 1AE6H 2M8XA 4XP5L 2AS5M 4Z7NF 3I6KB 2W9EH 5GS1B 2OX5A 2YD7A 1PEZA 4WFGD 1VB9A 1U91B 3EJJX 1X6LA 1KNOB 2ZSVA 4F57H 5ESQA 3O41A 1A6WH 4Y5XC 3JBG7 3F7QA 2R8SL 3HPJB 2F54E 4HIXH 2VDNH 1LD9A 1R3HB 5HYSA 4DVBB 1N0LA 1FNEB 3SDAB 4WVRA 3V95A 3VE0B 3UTSD 2OSLB 1MHCA 5KW9H 3CH1A 2R1YB 5JW3L 3QRFM 3SO5A 3TNMB 2X4RB 5IB3B 4KZEH 5BVJB 4QRPD 5GIRA 3QHFH 3LPGA 5FYJL 1HHKA 4NHUE 4FOMA 4UB0H 4ONOA 5KSAB 3QAZC 4I77L 3UEZA 2R0ZL 4PJIB 1G9ML 1RZFL 1F6AA 1MCFA 3ZTJH 5KS9B 1CD9B 2XWJB 4HK0A 3TBYB 1I8LC 1PKQA 4XXCC 3AXLA 2EYTA 4OV5A 4QRQB 4HBQA 4HIJA 4YE4L 5LCVH 1W72H 1T7XA 1V7MH 3MLZH 2DMCA 3VFSA 2F53A 2VO5A 4BK5A 1MAMH 4Y1AE 3SE9L 1MIMH 2CH8A 2YD9A 2JIXD 1BFVL 2X7LA 3T4YB 4OZGB 4WEMB 3V79C 1LEGB 5L9DL 2AEPH 3DIFB 5D5ME 3MBXH 3ZKNC 4JFFB 2VXVL 4MB5A 3PWJA 1BQHB 5CSZA 5A16A 2ZOKA 2R2CA 4TSAH 4PTTA 5I2IA 2E9JA 4URTB 2OS7A 3MSPA 2DQTL 1BD2E 4L4VA 2QJDA 5FYJD 1RUQL 3KLSA 3H0TA 1NC4B 3D69B 5A2LH 4LVHB 3W39A 4TNWF 1G6RA 5AYUH 2EDXA 1F3DJ 4HS8H 5EPMA 3V0VA 1AQKH 3QUKB 5JOEA 4MLIA 2D31A 3ULUL 1KCLA 3DTXA 2XN9A 3TA3B 5IIEB 2IFFL 3QDGB 1MFCL 4NQVA 3TJHC 3RKDC 3QWQB 3RU8L 5I8OL 3HAEA 4PJ8A 3UTPD 4JFYA 4ODHH 1W72B 1A02N 2P42B 4FFYH 1UACL 5F9WC 3WXVL 4QYOA 3H3KA 4RWHA 1BF8A 4JKPH 3TBVB 3I6GA 3ZHLA 3DRQA 2X4NA 5JR1H 4B0MM 1NJ9B 2EDKA 4OFYA 4YGVA 5FB8A 3MBEB 4LSUH 3G04A 1XGRB 1I3RA 5HVHC 1LK3H 3O81A 1TJGH 2F5AL 3W0WE 4WW2C 3C09B 5C71A 5HDQL 3BKCH 3RWHA 2NZIA 4HIEA 1SY6A 3HE7C 4V1DE 3S3PA 3SDCB 1WWAX 1EA9C 4MZ3A 1B0WA 2DQEH 1CQKA 3IJYA 3QUMA 3RWEA 1CFNB 1GCFA 5H35B 2NY5H 4ONFH 1KFAH 3EJZD 3P2TA 3L1OL 3NGBC 4YBLB 1FPTL 5EORH 3PJSB 3GSVA 2R15A 2OTWB 5C0AB 3ULUD 2BVOA 2ZOLA 3BQUD 1R3LB 2EKJA 3KS0J 4QRPA 5GZOD 3IGAA 4EVNA 4B50A 4GAYB 2ORBH 5ANMB 2D9QB 3VDAA 4JAMB 4JO2H 2DQGL 1JHKH 1F5WA 4MA3B 5KANI 3QIWC 4IRJC 1NCDH 2DQUH 2QQKH 2VITB 5KSVA 1KPVA 4PJFE 2MTPA 3DUHA 1XGQB 5A2JH 4EN3B 1UCTA 4N0RA 4Y2DD 3K2UL 4YO0A 1X7QB 3CSBA 1RMFH 2QADB 2C4FT 1WFTA 3N1GC 5KSBB 1SBBA 1A7OL 1NBZA 3HMXH 4DKEH 4X5XB 5IEHA 1CL7I 2JIXA 5D1ZC 1RZJH 5IFAH 4JLRA 4L4TD 4XVSH 2MQ0A 1M1SA 4YHLL 4PJ7A 3RJQB 2ZKHL 4M4RA 3BGFC 4K3EL 5I8EB 1MJ8L 2P24A 3O11B 4XP4H 5DT1H 4PB9H 5F7DB 9CGTA 1RUKH 5D1XC 3HUJA 5KVMC 1G7HB 5ITFB 3MGTB 3EHBD 1KJVB 5CJOH 3RL1A 5DI8B 2IANB 2A38A 1AKJD 4X5LA 5IK3B 7CGTA 4GMTH 1URLA 4MAYC 1QR1B 5C7XH 3IJHB 2X4UA 3RPKA 3UYOD 3MCG1 4R97C 3B3IB 4P4KB 2Q7NA 4ZAKC 2JTDA 4JO4L 4HJ0D 3BAEH 5E2TH 4BJLA 5CJQL 3LN5B 1XFPA 3O45A 3T77B 5KAQG 5JLZA 2B5IC 1NBVH 5C08E 2MSPA 4FTVD 1IT9H 4P57A 1MJ7L 3D0VA 4JANA 3SCMD 3WKMH 1MRCH 3ELAT 1TZGL 1MCKA 1N26A 1CYGA 2W65A 5EZLA 3QWOB 1R3KA 4OF7A 4NN7B 5HTSA 4UTAH 4HXAL 4OM0L 1CK0L 2YK1H 3MRCB 3SKNB 3HNSH 1KT2A 4TUKH 3S8WA 4ZYKA 2D3VA 3FT4B 2CDFB 1F4WL 4Y5YA 5D72L 4F37F 1WISA 2BSTB 1I85C 2HRPH 1Q94A 4GJTB 4U1JA 1NANI 1ZHNA 3KDMA 3SKMB 1I1FB 3L3DB 1IC4L 1I8MA 1RY7B 3VU2A 4PY8J 4MDJA 4OGXH 3A6BH 1JI1A 3RUGF 1U8JB 5E4IA 1FJ1A 4AENB 1P4BH 1ZA3B 1EO5A 2XKNA 1UXWA 5B4MD 1UKQA 3OKMA 3RZWA 1MRFH 1FE8H 3EOAA 3QIBC 1K6QH 3QDMD 5D5MF 4OF8A 5IW1B 5E8EA 4OLYL 3CFDB 1OF2B 2NXZC 3BQUA 3IAQA 4OF6A 3SGKA 3TGXA 3QIUB 2NY3B 1U95B 4J6RH 3L5JA 4PD4J 2CUHA 1I9JL 4JKMA 4LU5H 3GGWB 4QT5B 2DQHH 1TTGA 3CMGA 1X5JA 3K7UA 3TF7C 4UILH 4XBEL 3MFGB 3MRJA 3BXNB 1AD0A 5EU7C 5KJRH 1L0QA 4JJ5B 3SDXF 4WY7H 4KMLB 4RZCA 2Y1VA 2XNAB 3QQ9D 2RFXB 3BRDA 4CJ1A 4YDJB 4Y2DA 4NM4H 1Z0MA 2VN4A 1DR9A 3VXRD 3Q3GB 3LQMA 1KJ2L 1C12A 5B39A 3SDDC 4LCUB 1FSKB 1T1XA 4KKAC 1QFWI 1S9WB 3G6JF 3Q6FA 1LEKA 3LDBB 3LKNB 5AAMA 4L4TA 4HPYH 5C3LD 3V52H 1OP3H 1YY9C 1R5VB 3KNBB 2X1XR 5HI3C 5ADPH 2VTFA 3STZA 1FVCB 1Q9OB 5ISZA 3LEXB 3H42H 2CLZA 3RNQA 2FGZA 4GKSA 1AKJA 1RHFA 2I26N 1FL5B 4XNMA 5SWSB 2GCYB 5EOTB 5EU5A 1NCWL 5DUPH 5DVOA 1D5IL 1C08B 2YD8A 4OD1L 3LCYA 2VUYA 1DP0A 4HWNA 3BD4A 5EBMA 5DRXA 1Q38A 5KANG 1J5OH 1UM4H 3B9EA 4J3WA 5A2FA 1YNKH 2R56H 4WCYH 4LSRL 4YPGA 4FFWD 2DWDA 3L7EB 1FZKB 4U1MA 2HKFH 1BLNB 4ZPTA 2CDEA 1CCZA 4CVXB 4ZUVA 5HI4D 5HGHB 3P9LB 2AK1H 4FQHA 3T0ED 4M6NH 3GSQA 4G59A 4OZIE 4Y16C 2EXWC 3SCMA 3GBMH 1CFSA 4DZ8B 4EI6A 2VXTL 4UUJB 1OGTB 1WQVT 4P3CH 1U2HA 3MRHB 2Y5EA 2XTJB 4KK5C 4TN9A 2DAVA 4LLWA 2H6PA 2Q8AL 1FVEA 1WZ1H 4AG4L 5IVZA 2CIIB 1MCCA 4JY6A 1AQDA 4JDVB 1UZ8A 2P48B 2BSSB 3GMRB 2DQJL 4TUJA 5J11B 2Z93B 4JQXC 4CMHB 2QV2A 1P9MA 3TEUA 1VHPA 2VZUA 3W2DL 4J3UA 4GRWE 4S1SL 4GAFB 2DM3A 4LP4A 4ALAL 4DGIL 4Y4KD 3N1FC 1WCBA 2B8OT 4Z18A 4LASH 3NZHL 3QO0B 1A14L 4CVWA 4K8RC 1RIUL 3QFJE 4GRLB 4JGMA 2DN7A 3T04D 1J8HE 5GGVL 3QXWA 5AG9A 4X6CF 5TF0A 2A2QT 1FNGB 4L9LC 3H9ZA 3QR2A 3INUH 4ETQB 1JWMA 2E3VA 4ZOAA 3ILPB 3QDMA 3UTQB 1LDSA 4M03A 1RUAL 1YECL 4UQ2B 4X4YA 4R0LB 5CHNA 2AJ3B 4WO4C 2WV3A 3U7AA 1QKZL 5FYLH 1J0HA 2BY0A 3MRQB 3RVVD 4N0YL 3R0NA 1YEEH 4JGUA 5IHLB 3BP4A 1HDMA 1OP9A 2GY5A 2FGWL 4JVWA 4U33A 1R5IA 3QH3A 4QHMA 5SV4A 1G7IB 4JY5L 1ZAGA 2XOTA 2N4IA 3ARDC 3U4EA 2WBJD 3MODL 4Z7VB 4KVNH 3OKEA 5EC2A 4D8PA 5CGTA 1RK1A 3TYGH 3VXRA 1IJ9A 1RQ5A 4G8IA 3EYSL 4PJEE 1OY3B 2ADJA 1AI1H 3O6LL 4FQ2L 5E2WH 3HC3H 4QTIH 5GIRB 1YDPA 1S9KC 1QG3A 3TPKA 1KCUL 1C7TA 2GSIA 2NYYD 3FZUD 1KJMA 2EDYA 1N6QH 1JIBA 1YEJH 1TQBB 4KJPD 3CSYB 4U1LA 4XGZA 4R8WL 1KXTB 2W92A 3QNXA 4OIIH 2KZWA 3ULVH 4B5EA 4XPTH 3FQNA 4HK0B 4MA1B 3P77B 5EDXA 4P2QB 3HAEH 1BJ8A 2UVFA 1SJHA 4F9PA 5FUZH 3CDGA 5DSCA 5TPWL 4NO0D 1S7WB 5DD6A 4OF0A 3MLYL 4IHOA 4ORGB 4L5FL 4TTDD 4WJ5B 3NCEB 4PJCB 3T0EA 2YPLD 4BQCA 3PP4H 4RISL 1F2QA 2OL3A 3KPOA 4FZEL 3QXVA 4TNWK 5FOJA 1DN2A 5FKAA 3CSPA 3KYAA 4KJWD 5F7EL 1KJ2A 5FECA 3E3QE 4PJBE 3QUMH 4QF1A 4Y4FC 4XHJD 5I2IB 1S7VB 4KZDL 3D39B 4L4VB 1EZVY 3SKOA 1S7TB 3OXRA 3HS0A 3LHPL 3MLUL 4R26L 3OKLB 2GSGA 3I2CL 4NDMB 5GRJH 1NFDF 4GAJL 4V1DD 5B3JE 1S3KL 4C54A 3DTXB 3QJFB 2FX8L 5EZIL 4M8QA 4W70A 2OP4L 4DK6A 1X5ZA 3NBNA 2EEAA 5HHPB 4S11A 3HAEB 5EZJA 1FGNH 1JPSL 4DUWA 4JRXE 4JZJC 4ZMAT 4NPYB 2YD3A 2EIEA 2APTA 5EU3B 1KPUA 1HXMB 2NCMA 4MQ7A 3EW3B 4PJGE 1KCGC 3O2WL 3U30B 4S1RL 2Z35B 3G08B 1JRHH 3BO8A 4B53A 3BKJH 3MRNB 5LGHL 4OZFG 4MJ2A 5B38A 1JZ4A 4H5SB 1MCPL 4M5ZH 4ZTPH 4NNYA 3ULSB 2LU3A 2FL5A 3BRGC 3FO9B 5EOCH 4ODVL 4HXBL 5C0BE 1JUFA 1FRGL 4U05A 4ZOCA 2XG4A 4G7YH 3QCVL 1QUNA 2DI7A 1FGVL 2FBJL 2LQRA 4GS7C 5E99H 2CRYA 2J2ZA 1WC7B 5CSGA 1OP5H 1U9KA 3X14A 3CUPB 5BVPL 4D0DA 2G5BB 3GB7A 4P5KB 4LIQH 4UAOB 5MERA 3U6RB 3RDTC 5J8OA 4OZIF 2A83A 2P7TB 5JW3H 1D5ZA 4DJMA 4PJDE 3DSFL 5EU6E 5JPNA 2ZOLB 5IHBA 4QRTA 1NGYA 2EC9T 1WK0A 1IAII 2LABA 1S7SA 3C87A 4LHUB 4RNRA 2OQJA 3RL2B 1HXYB 1I8IA 2BRQA 2XZCH 2NY4C 5FO8A 1G9MH 3FO0L 3P11L 4ACPA 3HLAB 1RZFH 2KBGA 1NLDH 1E28B 5H37H 1QP1A 5I1AB 1A7PH 4CADA 4X4MA 5HI5C 1B0GB 2JCCB 4JFHD 1K4DA 1MRDL 4K94H 4RAVA 3BDBA 1KPVB 2F5BH 1FL6A 5F1NA 4YNYA 1UKTA 4YO0B 4BELD 3SE9H 1T0NB 1A5FL 1YPZB 2NY1C 2LVEA 5JUEH 4QHUB 4NO0A 3RIFF 4JJHA 3V6OA 2JIXB 1RHHA 4X6EB 1NDMA 1T0PB 3GMQB 5HHMB 1VEOA 4NIKB 2GKIA 3WSQL 2YPLA 4JFXB 4LEOA 4XHQA 2V7HA 4MA7H 2X4PB 3WE6A 4PRHD 4Z7UE 4ZFZA 3LQAL 2VXVH 4LLMA 2BY3A 2AK4E 2VL5A 1AC6A 4I9WE 4MSWB 5DMIH 2P45B 2Y6SD 2LAAA 3OQ3B 1RJCA 5IWLC 1C5CL 3LKOA 5CWSB 4PRAA 3QUZD 4X6DF 1RUQH 2I25N 4KGJA 1X5LA 3O4LD 1X4ZA 5EWIL 5F7LB 1NGWA 5I1JL 1JWUB 2P43B 1AGCA 4JZOB 4KRPC 1EHAA 3TM6A 1VFAA 2D4FA 2FEDD 3UZEA 1MHEA 3IJSA 2EDNA 5DMKA 5ID1B 5AZ2H 3TV3L 1N6VA 4KRNA 1MFCH 5ICYB 1FBIH 4U6YB 4XCEA 5I8OH 3OAUH 2J8UA 4PJEF 2DQCL 1A2YA 4F37K 4P2OC 1T1WB 3TIEB 1JYXA 1UACH 3WXVH 2E8ZA 4U3HA 3EDDA 3FO1B 5CEYA 3G5YB 5I73C 1S9VB 4JREB 1BZ9B 4HGMA 1U92A 4LLVB 3RWGB 2ATKB 4ZS7L 4Y5YB 2AV1B 4X9HA 2BRRL 3RWCB 5HDQH 3KR3L 5CINL 5GGTL 2HJFB 2M26A 2DBJA 1I8MB 1KTRL 2E8YA 1RZ7L 4HUUA 2ZNXA 1UXWB 3VFPB 5E9DD 1WBXB 2JK5B 3OKMB 3GHEH 5IMLB 1FPTH 1SBSL 1I1AC 1VFOA 4N8VA 3D9AH 4R2GB 3OKKB 1K8IA 4PJHB 3FFDA 1DCLA 1ITBB 5LGJA 5DJ8B 2YN3A 4S1QH 2ZUQB 3PWPD 3ZZ1A 5I75B 3WL9A 4ZTOH 4XVUD 3TO4C 1BFOB 3GK8L 4ZUSA 4U3XA 2XG5A 2IPKA 5ICZB 5L2JA 2ICWA 5FM5M 4WUKH 3VWKB 1Y18B 3G5ZB 2X70A 4ZUTB 4LOUC 4KQ3L 2VWEE 2A73A 3QEHB 2EIDA 5JHDB 2BXZA 2E6PA 5BV7H 5IFHL 3DBXA 3WNMA 1RVFH 3HC4H 3FQXB 4YDVB 3KXFD 2HVKB 5EB9A 1Q9WB 2VDRH 4UQ3B 3R06A 1CGUA 5DQJA 1S8DB 3JWOC 4JGJA 1BWMA 1U8HB 5DJAB 3AS1A 2X40A 4JDTH 2I24N 4M61B 1OPGL 3T08A 4YHLH 4PJGF 5K9KA 4K3EH 1MJ8H 5SWQB 4V3DB 2XPGA 2V2TA 3I3DA 1MJUH 4LHJB 3WHXB 4PRHA 3EO1A 3IETA 1RJYA 3GSXA 2OBGA 3TBTA 2C26A 3O4OC 5ISZB 1VFMA 2B4CL 3BP7A 3VDBA 3MV01 5F6HJ 2FJFA 3A67L 1V7NL 4OLUH 3QUZA 4XNMB 3LKSB 5EU5B 4N0CD 3CD4A 2PXYB 3BZFA 3U0TA 3L6FB 3O4LA 1YN6A 1VACA 1LILA 4HH9B 3VH8B 3VJ6A 5J1SC 1HQRB 3BH8A 4PJIF 5L2KB 3NPZB 4PGBB 3X3FL 1TETH 3OWEA 1KXQE 3LKRA 3IFLL 4F15B 5K93A 5KS9F 4HMEA 1DLFL 4GBXC 5AWNH 3UTZB 3H9YA 5FYKH 1MJ7H 4FQHB 1A64A 2XWTB 3WO4B 5BV7B 4EI6B 1E4JA 1EJOL 1S5HA 1GGCH 3N85H 4LPUA 1KEGL 4MS8D 2FEEL 3MLRL 3I85A 4HXAH 4OM0H 1JK8B 2ZCLL 4JCMA 4M48H 2E7HA 2IH3A 4JFOB 4LLWB 1FVEB 5IVZB 3HZVB 3RWJA 1F4WH 4HWBH 4GUPB 1U58A 1RJZA 3CH8A 3W9DA 4EXKA 4J8RA 2GFBA 2QR0B 1DBAH 1Z3GH 4U6VH 4W68A 1BVKB 3HMWL 5JDSA 3AROA 4KY1H 1K8DB 4AJ0A 1BHGA 4YWGL 3PQYE 4NO5A 1YEIL 4JM2F 5E9DA 4F3FA 5JORA 3D87B 5FDWA 4BFIB 3QXDB 1BEYH 2KZ1B 1PEWA 1EMTL 1EBAA 3AC0A 3O8XB 3OV6A 1G0DA 4KVCL 1E4WL 3WHE0 2HTLD 5IVOA 4Z0XA 3PL6C 4OLYH 5ETUB 2AJYL 1CFTA 3PWNA 3CAFA 2VKWA 3HC0A 2VLRE 1NFIA 3KPRB 1CGYA 3PWPA 4R7NA 1N2RA 1U8PB 1I9JH 1LP9A 1ACZA 5EFIB 1MLBA 3B8SA 4YBQC 4HKBA 3H9SE 4XBEH 4AIOA 1IGJB 3OHXA 4OGAC 1R3JB 2E7BA 2BOCA 3U7YL 1CZ8L 1XF2A 4LK4A 3WJLA 4QHMB 1TMCA 4DKAA 5IVNA 3KXFA 1MCDA 3EOBA 3K8KA 3OKEB 5D2LA 1RUPH 5EC2B 1EEZB 4D8PB 1HEZA 1KJ2H 1W2KT 4RFOL 4YK4C 4P2RD 5GGTA 5TDOA 2QBWA 1HK6A 4JQIH 1K2DA 5INCA 1CGSH 3PWVA 1A6UH 3C6SA 2ITCA 2R2BB 5JOFA 4FFEX 2FIKA 3VWJC 1JWSA 4NFBA 3L5WB 1QYGH 1YDPB 1XGPA 3M1BB 2IPUG 1KJMB 1MLCB 3V5DA 8FABA 2AW2A 3VI3E 5E1AB 4OM1L 3QNXB 3MJ7A 2HLFD 1T20A 4M7JL 1P7KA 3FQNB 4OD1H 4ZD3H 4IIQA 4K23L 1FDLH 4YBHA 2IF7A 4YHNA 4N0CA 5KVEL 2YWZA 3U9PL 4L8SC 5TE4H 1ZGLA 5CEXB 4KDWA 4OUUB 4LL9A 2HJKA 3I6LE 5DSCB 2G2RB 1FFNB 5DD6B 4D9RE 1RK0A 2BNRB 4JN1H 5BS0E 2P5EE 3DX6A 4UDTA 3C60D 5TE6L 1AO7D 2ZCKL 3JWDC 5HHVL 1Q0XL 2VXTH 3QZWA 5DEGB 3WD5H 1W0YT 4ODSL 4MS8A 1IBGL 5C0JA 2Q8AH 5JXEC 1JF1B 2DTSA 1KUMA 1BIHA 4B41A 3WUWB 3TCXA 3HE6C 4HZLA 4N90E 1CICB 3KHQA 2X4OA 4N9GA 3SKOB 5AUMB 1CIDA 2GK0A 3VRLF 3PHOA 4S1SH 3WFEL 1DUYB 1EHXA 1ZTXL 4ALAH 4ZG1A 2FECI 3QDJD 5T3ZE 1VGEL 4NBXB 5C09D 1CR9L 2ADIB 3E3QC 1PVHA 4AK1A 5J6GA 5TQ0L 5CD5D 5C0BD 3PDDA 2BNQD 5HVFB 3V8CA 3NZHH 1A14H 1N3NA 3PWUB 4JG1H 4JPWH 4L29A 4YXKL 5GGVH 2A6DB 1F4XH 3D0LB 5CKGA 1HYSC 4JO1L 4RFEA 5H94B 4GG6B 3RA7L 2VZVA 4K55A 3TWCL 3RWIB 4DFIA 2EECA 4FMKA 3MXVL 5EU6D 1WEJL 4LRNH 2Y06H 4H0IA 3CK0L 4EEEA 3ARVA 1JTOA 1MVUB 1SEBA 3BMWA 5B38B 3BIKB 3IKCB 2OZ4L 4FQJL 3ZKND 2WY3A 3I9GH 2YPKA 3U2SB 4P49A 4C56B 2WW8A 5IUSA 1AP2B 1E4XI 4I3GA 2FGWH 3ARGC 2EDLA 4QXGL 4D0CB 4JY5H 1C16B 4H1LA 5I1GL 1Y6MR 2UVEA 3GMNB 1DQML 3MODH 2XRAL 5DK3A 3TESA 2HFTA 4OLVH 3CIQA 4NBZB 1TENA 1KB9J 1ZT1A 3H2WA 1JNNL 3KYNB 3VXQB 3EYSH 4P2RA 2A6JA 3CLEL 3FONA 4MXQC 1L0XA 2V5MA 1HKLH 2DQDL 3O6LH 3TJHD 4FQ2H 3RKDD 4FQCL 1KGCD 1KCUH 4MWFA 4S0UC 4U1SA 4IS6A 4KROB 1CGTA 1TQCC 2OQJB 4R7DA 3O2DH 1MFAH 5FO8B 1GGYA 3G5XA 3K8MA 4HV8B 1DBJL 3RIFK 3VRIA 4IRSD 2O5ZL 4JQVA 4RAVB 1YC7A 5A3IC 5I15H 1GOFA 1VENA 4YNYB 2NTFA 1OAZL 3F12B 4D9LH 3MJ8A 1UENA 1RULL 4ERSH 3DVIA 3ROLA 4XP6H 4D94A 4WHYG 3OJDA 2VDOL 5I1HL 4CN1A 3BP6B 3ZKXB 5IBUG 1GGBH 1CLOH 1CDBA 3DUSB 1KBGH 3B2VL 3DXAA 4NQSA 4RISH 3C60A 1AO7A 2VZSA 2XZQH 4FZEH 2V7HB 2FDBP 5J13B 4ZFZB 1SYSB 3HG1B 2WIIA 4OCWL 4GW4A 4JM2C 1LO2H 3LKOB 4NN6B 1MJJA 5DF0A 1J05B 3M45A 3NTCH 4DGYL 2OK0L 4YFEA 3LHPH 1NGWB 3JV5A 1DBML 1EPFA 3LKQA 4WUUB 3I2CH 3TA3C 4HUXA 1VFAB 3QDJA 3UZVB 1FZMB 5HHOA 5C09A 1MCEA 1QRNB 2PW2A 3CFBA 2H32H 5IFJA 3QIWD 5C0BA 2Q76B 2BNQA 2FX8H 4LMQE 4O58L 3KYMB 1I8LA 4MDIA 4XXCA 3QNYA 2CO6B 4XVTH 5KVGH 1GZPA 2W9DH 1JNLH 2WLZA 5D4QA 3DX9A 4PYGA 1CLYH 1QEWB 1FZJB 1VFUA 1F13A 1MCWM 1PLGL 4I2XA 5D70H 1A4JA 1HNGA 3MROA 1OGAE 2MPAH 4QOKE 5MHSD 5D1ZD 3MV7D 5D2NE 2DBLL 1RFDL 5EOCJ 5GS2H 3LH2L 3VFVB 1KIRA 1WSST 4Z7QE 1BIIA 1MCPH 3SDCC 2DF3A 4KRLB 4PG2C 3T1FB 2ZUSA 5D1XD 4IJ3B 2CKNA 3RTQD 4PV9A 3TYFA 5HYQB 1NAKL 1CBVL 4YDLB 1I3GL 2YBRA 2F15A 1FGVH 2K1MA 4YBLC 1BREA 1IGFL 5KOMC 3EDEA 5BVPH 5EBLB 3BUTA 1XEDA 4LSTL 4ELKA 1U8IA 3QDAA 4NKDB 1FO0H 1N59B 5DD0L 4ZAKD 5DJZB 1B2WL 2IG2L 2P1YA 4X98A 5CIPA 3DSFH 4Y8DC 4HUNB 1BPVA 2H32B 4NQCE 4LSPL 2A1WL 3IXTA 4FFZL 4DCQB 3LQZA 5K9QI 3TJHA 2D7MA 1JFMA 1QTYT 4Q6YA 1D5XB 4N0UE 3NIFF 1C7SA 3J8F7 4PTUB 5TH2A 2IPKB 3FO0H 1MI5E 4U2YA 4GQ9L 4OLXL 4KV5E 5C0EB 2X70B 4WV1C 3LEYH 3KPPA 5DA0B 4F7EB 1T1YB 2QADC 2A73B 3NABL 4J23A 4Y19D 1P53A 4L3EB 2W59A 3E0GA 4IRSA 35C8H 4CJ0A 5HYEA 3TZVC 2P8LB 3PNWA 3LN4A 4JFPB 4MGXA 2OZ4A 5ADOL 3WEXB 5T5NF 3V5HA 4HKXB 3CC5B 1EFXD 1A5FH 4DAGL 1ZHKA 4NT6A 3VCLB 1CD1B 1T03L 1FH5L 2Z91B 3VFWB 1XF3B 3SGDI 4Z7VF 2V2WB 2NR6C 4LLUB 3Q1SH 5D7IB 3VFRA 1AXSB 1I7TA 1FO0B 5E2UL 3UBXA 1F4YL 2VRAA 3O9WB 2GTWA 5D6CA 5EO9A 1MUJB 1FN4B 4Q0XL 2NXZD 1PDKA 4P4KC 4PGDB 5GRVK 4MX7A 4OB5H 2AAVA 2XZAH 5FKPB 3RP1A 3D3VB 3IDYB 2MWCA 4X80L 3GJEB 5INDB 4IBLT 1YQVH 2DIBA 2HYMA 2VN7A 4FQLL 3IFOA 4UDUB 5ID0A 4MMZC 3QIWA 3V6BR 1KCVL 1BZQK 2OMNA 5EIIB 1T21B 2Q6WB 1OSPL 3W82A 2PYFA 3RVUC 3G5VA 1QD0A 2DQCH 5EA0H 5GSVA 3QHTC 3MRIA 2FYYA 1LO0H 1G7QB 1RZJC 1FIGH 5CJXC 1UM6L 2IH3B 3LPWA 5FCSH 5D1ZA 3MV7A 3QI9B 5C70A 4KAQH 1QSEE 2BRRH 3WKNA 1E6JL 4K9EH 4GW5A 4Q6IB 1RJZB 4RMQA 3RY6C 3KR3H 5CINH 3W9DB 1O0VA 1CG9A 2EYSA 5GGTH 5D1XA 3SJVE 3RTQA 1AXTL 2O93L 3ARBB 4K3DH 3RGVD 3WJJC 1RZ7H 2Q86A 3JV6A 3O0RL 2R1WB 2AP2A 3TCLB 3NFSH 1JJUA 1ND0B 3CXDL 3U46B 4RMVA 4NO5B 4K8RL 5JORB 1BAFL 3VRJB 4ZFFA 1SBSH 4Y4HB 4KXZI 4UT7L 1WIPA 3T0XA 1G7MA 3DX8A 3QG7L 4ZAKA 4G9DA 1BECA 4Z7WE 2C4XA 5KN5A 4CVUA 5BMFL 4Y16D 2EXWD 2IPTH 4R7NB 4KKLC 4KQ4L 4LMQI 4H25A 1BQSA 2QSTA 4P5TB 1U41A 1P5VA 2E6QA 3OHXB 1HH6A 3DHMA 4QWWC 2X4SA 2VNCA 1WTLA 3RX8A 3VGAC 1XF2B 4Y19A 1BMGA 1XCTA 3NA9L 3UTTD 1RJLB 2ARJQ 1FSKC 1XF5A 1I85A 1HILB 3WO3B 3ES6B 5D2LB 4OFPA 4EBQH 1J1XL 3LDBC 4QRRE 1CXKA 1NCAL 4I0PD 3DSNA 1EFXA 5DJDA 3W11C 3PWVB 1QVOB 3MRMB 3S3SA 2ITCB 3QQ3B 4IRZH 5C0CE 2P5ED 2ICEA 3MRPB 5F9OH 1JWSB 4RGNB 4M1CC 4K8RD 3VFUA 1VKXB 2BSRA 3T8XA 3V6ZA 4XAKD 3AB0B 3B43A 5T1LB 4KK8C 4YR6B 1HE7A 1QZ1A 5K9QG 1YUHA 2V5YA 2B4CH 3RAJL 3NAAH 4AH2A 3K1DA 3QPXH 3G6AB 4HFWB 1CDHA 3EYUL 3LB6D 3ZDYF 4N90D 1IAMA 4TUOA 2Z92B 3VFNA 1UCBH 5I8KL 5J89A 2BNUA 1RURL 4XC1L 4ELMA 3MV8B 3C6LC 2D0HA 5J57B 4I13B 1A6VL 1F4AA 4HLZH 3TF7A 2HJKB 2W0PA 5D71L 1P1ZA 1KYOJ 4G8GB 4MJIB 1DLFH 5JZ7D 4GKZB 3V4VL 2DLTA 2VZTA 3X13B 4A2MA 1MNUL 4NQDD 3RVXC 1IARB 2H45A 2JCCF 5JXAL 5FA3B 2NY0C 2I9TB 3SGEI 3ARDD 2YWYA 4S2SA 4Q2ZA 1EJOH 4O2EA 1KEGH 3MLRH 1X5XA 3ZT6A 5DHYA 3O3DA 2X4QA 1JHLL 4NGHH 1YPZF 2MJWA 5J11C 5FUCE 1CXLA 3QNZA 4JE4B 3SDDA 3T4AB 5DTFA 4KV5F 1J0YA 1JGDA 5HDLA 2X4OB 4TVPL 2W38A 4R9HA 5IVXA 2GK0B 3T65A 3K81A 1WAAF 5ITBL 3RNKB 4OZ4A 4UOW1 4YX2H 2VZOA 3QRGH 4AT6B 1T0MA 1QRKA 3O3BB 4ONGH 4MAUH 3RGVA 3UYRH 4YWGH 5DVMA 1MQKH 1JE6A 3L95B 1EMTH 4KVCH 5F9JA 3MLWL 3TN0B 2C4FU 5E08H 3MV9D 2XFXA 4MNQB 1T04A 3JUZA 3MFFB 5DJYB 4GOSA 4C4KO 3L3GB 4ZFOB 2NNAB 3S6CA 4XBGB 3BZEA 4AMKL 4WWKD 3HNTL 5ESAA 1S7UB 3PV6B 1L0YA 3C8HA 3DROA 4Y16A 3IDGA 4WI9A 1TIUA 4M7LL 3K4DA 3HI1A 3M8OH 2YPKB 1ORQA 3AAZB 4Y4FD 5IKCA 1JZ6A 5FM4A 1FNLA 3CVHL 4AEHL 4FQIL 4IOFC 4BH8A 5FDYA 4TVPD 5HHQB 1OL0A 4JQXA 3UTTA 1K3IA 1HHJB 2HWZH 2YXFA 4G9FB 3QXUA 1DBBH 4I0PA 2F74A 4ESKA 2A6JB 3ZLQC 5KTEH 2NY2C 1DEDA 1FNAA 3HZYB 3FRUA 5FA4A 3VA2C 3CLFL 4HWEL 3R1GL 1SEQH 4LSVL 4DTGL 3AREC 4G80A 4UV4L 1A6AA 3RGHA 4OM1H 3MNVA 3FN0H 4PJHF 2ZCHL 2NX5B 3PDOB 1JL8A 4PGCA 3VRIB 4K23H 3NZ8B 3BI9X 3WIHH 4UNVA 3F7PC 4XP9L 2NTFB 2NXYD 2VLKD 3P9MA 1YJDC 3U4BH 2D0GA 3G9VA 1ZLVH 4XWOD 3SHSA 3S34L 2O61A 4IDLA 1IEHA 3QEQD 2J4WL 4J2XA 2JB5L 3AM8C 4JPKL 4Y5XB 4NQDA 4P23C 3DVNB 4X7FC 5HHVH 1GC1H 1Q0XH 3M17A 3DXAB 4NQSB 1SJXA 3ARDA 2I9LA 2Z31D 1FORH 2A9NH 2Y9RT 1NC2D 3RDTD 1MAJA 4XNQB 4X4ZA 2EH8H 4OF3A 1ZHBA 4FS0A 1P4LA 4QOKD 5DMJB 3TFKC 5C2BH 1M71B 5IMOB 4U2ZA 1CF8L 3H6JA 4LBEA 5D7JC 2JJTC 4AIZA 3EIFA 1CE1H 3VXMD 3WFEH 4X7TA 5DC4B 1MHPH 5KZCB 3LKQB 1A9BB 2NY4D 4X83A 2ARWA 4PLKC 3QAZB 4XNYH 4NQEE 1H3XA 4PGEA 1P7QD 5HHOB 3ORJA 1KB5H 4LSDA 5GGSB 2PW2B 3CFBB 1A3LL 3LS5H 5HI5D 4I1NB 1R5WA 3I02A 5FCUL 3GSUA 2DKMA 3QA3B 5C2UB 1G7LB 4XH2A 1DEEA 4YXKH 3V5KA 5F44A 1ZHLB 3DGGB 5DHXB 4JPIB 2CJUL 4HEME 1MCLA 3U30C 5GISL 3N9GH 4R96A 3VW3L 1OTTD 3OXSB 4I18A 3RA7H 4POZD 3MV9A 3TWCH 1A4JB 2NY1D 1FFOA 4PRBA 3MROB 4P3DA 4FABL 3PIQA 5KG9A 2B20A 2VXQL 3MREB 3CDFA 4WWKA 3O3AB 4U31A 1T7YA 4QXTB 4GXVL 1BIIB 4JVPA 1F3JA 4FQJH 2OZ4H 3RUGA 5L7XH 2X89D 3S35L 4Z8FH 1XZ0A 4KJQD 3ARFC 3EYOB 5CP3H 3S5LG 1MOEA 4Y4FA 2BCKA 4HT1L 3OAYK 2E7LA 2YRPA 1MCBA 2IALA 5IGXL 5GRWA 2ZNWA 4KRPD 2LTQC 4PJ5B 3BIAX 3IYLW 2XY2A 4PJXB 4YHPA 1T2XA 1U93B 3IAPA 1KB5B 3NIDF 2XY1A 2RJMA 3IXTB 4DVRL 3OKNA 5T5FL 4FQCH 5D6DC 4YDIL 4JZNA 5IQ9B 5EU4B 2P5WE 3EJYC 5MENB 3O6KL 3FFCE 5HHNB 1IC5L 4JZJA 1CE6B 3E6HA 2APXA 5TH2B 2FJGB 1PJ9A 4YHMH 3IKKA 4PBWD 3SDXA 3VXSD 5F9WB 1DBJH 1O7SA 5LKNA 5TDNB 1NKRA 2O5ZH 5H2BB 4NKOA 2ZPKH 5D7KE 5ICXA 3ZE2F 5HVHB 1RULH 4X8JA 1LO3H 1QLFB 1EO8L 2VLKA 3G6JA 1B0RB 3MCLL 4WW2B 3BEWA 4JRYB 3UO1L 1JZ7A 4DKFL 3HE7B 1HI6A 1ZHKB 4OD3H 3QEQA 3OZ9L 3WYRA 4HJGA 1C8PA 3CVHA 4HUWB 4FFVC 5DK0A 1Z9SA 1I1AD 2Z31A 5IW6A 5D1QD 1NC2A 2BJML 4OCWH 3RDTA 4OZHE 4NJ9L 4CN6A 4H20L 3RI5F 4HFUH 4LLDB 2GTWB 3EFFA 2O5XH 4DUVA 3VG9C 5HYJD 5HGDB 3RX5A 3GMMA 3OJMB 4U0QB 2OK0H 3GSOB 1MSPA 1GPOL 4WTZG 4HUVB 1ZEAL 4WFEE 3OX8A 3VXMA 1T22B 2BX5A 1CLZH 1P7QA 3KHOA 5E6YA 3SJVD 1NMCB 5DJ6B 3MA9H 5JQ6H 3ZKMC 1BFSA 2CXGA 4KKCC 4IRJB 1UB6A 4P4RA 2VLJA 3LEVH 4L1HA 2YA0A 4PRDB 5DGRA 5F3BA 2V5RA 1IGIL 5GSVB 1LE9A 1Y0LA 2Y07L 2HJLB 1FNSL 2C1PA 1D9KD 3K4ZA 4L8DB 1HSBA 4NKIL 4ZPVB 1RFDH 4N1EA 2Y72A 5E7BA 4ODUA 5TDPB 1T66C 1KB9K 2C3VA 2D7NA 4XT1C 4CAGA 1PBYA 1UG9A 1FFQA 2X41A 4NC1C 2X89A 1CG9B 1CBVH 3TPUA 5GSRA 2DLHA 3IFPA 2HFGH 3IFNH 2QQQA 1HOCA 3L3OB 5IWLA 2YMXL 5FO9A 1IGFH 4YC2C 4X6CA 1IFHH 1EHNA 1TVBB 2APFA 4R2GC 2A0LC 5C0DB 5JW5A 5C0ND 5IB5A 4MAYB 1ZVSB 4ZFFB 4P9ML 1MEXL 5DD0H 1DBKL 3MRFA 4GLRI 1B2WH 4R97B 4FP8L 5DMGC 5I75C 4ZAKB 5CZXC 4KTEL 4LAQL 2WP3O 4J4PD 4GBXD 4LSPH 4FFZH 5T1MA 3FQUB 5T3XH 1A7QL 3BPNC 3MLVH 4KJYA 2BZDA 3E6FA 4LDOB 5KN5B 4OKVA 5FF6A 5DHVB 2JB6B 4ZUUB 4HIIB 1CT8A 3K74B 5IR1A 3HI5L 2OI9A 4GQ9H 4UIKL 4GG6F 5ACZB 4QRSB 2GUOA 3MC0A 5DD3H 3VXSA 5J9PA 3NABH 5C0IB 5ALCL 2X4SB 1I1YB 1PG7X 3RBGA 3GSWA 4PY7A 4XWGL 2VQ1A 2VR4A 5B8CC 4H0GA 3P0VL 4XI5D 4L8BA 1RZGB 4F58L 1QBLL 1NDGB 1XGYL 4KK6C 3IU3B 3DURB 4MD0B 5C07B 2R1XA 4CNIB 1M05B 3VFTB 4LLQB 3S9DB 1AGDA 3UDWA 1IGYB 3VXUE 3S37X 5BRZD 5ERWA 1T03H 1CGVA 5D7LE 2ZSWA 1B6UA 5F8QC 1N5AB 3QIBB 3MJ9L 1I1AA 3C9NB 2W07A 4U6TA 3REWA 2CKBH 5D1QA 3D85D 3KAAA 4JFDD 3MLTA 2PXYC 3FKUS 1J1OL 4I4WA 3PL6D 4Q0XH 4XBPB 4FXKB 5HYJA 1TCRA 1AGEB 2MHAA 3TNNB 3U1SL 5C1MB 1PX4A 4XMPL 2ATPB 5JW4R 3BHBB 3BJLA 2IMNA 4F15C 1I8KB 1C5BL 3DX7B 4ZXBB 4NO2B 5I18L 3ZE1F 3QO1A 4HUKB 4X80H 3WO4C 2GJ6D 4PRPE 5BV7C 3LKPA 1KCVH 1NGZA 2XQBL 3UPAA 2CLVA 4G42B 1RZ8B 3CNKA 3WUZA 3S96A 2JKXA 3O6ML 2NW3A 3GI8L 3C5JB 1HQ4A 1HHHB 3QYCA 3FB7B 4Q2ZB 4Q74A 2R39A 2JJVA 5GJTH 5JNYA 1A6TA 2IMMA 1D9KA 3QNZB 3SDDB 4C57C 5F3HA 5IG7A 3GBNH 4EDXB 4MD4B 5I71B 4EI5C 3AMLA 2PYEB 1IQWH 2P8MB 1IQDA 2WWKO 1CFVL 1YYLL 1NFDA 2UWEB 2EC9U 1C5DA 3QBTB 5EUOB 4FXGB 5E8OA 2VR5A 5DA4A 4JKLA 5FIEA 1AXTH 2CKBB 4TOYL 3VXPB 4XAWL 2W0FB 3T3MF 3ZYJA 3KPLB 3O0RH 5I76A 4LFHD 3O8XC 5BO1L 4HQQL 3WNNA 3FQWA 2YSSA 2CRIA 4K8RH 3NFNA 1BAFH 4NZRH 1GYAA 4OCLC 4OT1L 3WXWL 1IZKA 1PY4A 4B7IA 3QG7H 4NCDA 3SPVA 5GS0L 4OSUL 3S4SA 3U9UB 4PRID 1J10A 1WJ3A 4UMGA 5JOPE 1KXVC 4GBXA 1XCQB 4OZHF 5GGRB 3VFOB 3BZEB 1QQDA 4BH7A 2HN7A 1QSFE 2VABA 1TCMA 1MFDL 1JYWA 1G1YA 4BSWA 5DZOA 3VI4E 1DUZB 3DVGA 3W81A 3ZTNL 4WFHD 1HIML 3ETBF 3PWLA 5ENWB 5IT2H 1OARH 4KKNA 3HE6D 3IDXL 2APWA 4UNTA 2B1AL 4HGWA 3GNML 1OQXA 5JO5B 3LZFH 3GM0A 1JPTL 2ZJSH 5I30H 1J1XH 3KPSE 4JO3L 2AXGB 1EHLH 4O2FA 2HAZA 2WMPA 1ZSDB 4LCWB 2KKQA 3H9HB 5DDHA 3BW9B 2H3NB 4P5MA 1XAUA 5BRZA 3SOBL 5ECJE 5SWZD 2XTJE 4FG6D 3C5ZC 5FA4B 4XMLL 3BPLC 2WIMA 3BWAA 3BPOC 3MRGB 4LRIC 1HYSD 5GS0D 1LNUA 3JVGA 4JG0L 4L9LB 4PV8B 1DQQA 3D85A 4GAGL 4GRMA 4JFDA 1AE6L 3F7YB 3PL6A 1XR8B 2W9EL 5DXWA 1N8ZB 1M7DA 3RIAF 4KDVA 5M95B 4XC1H 4WO4B 3MMEA 4F57L 4MVBD 1A6WL 3VXNB 4EDWH 2HG5A 2KPNA 2IQAB 5D71H 3WFHA 3V4VH 2MCPH 2GJ6A 4HIXL 2FHFA 1D3CA 1MNUH 3SDAD 4E41B 3P4NA 1AFVL 2ADGB 5HYFA 4WW1A 2OM5A 3IDJA 3VXTB 3JXAA 5IMKB 2I9LB 5HD8D 5IBTH 1BZ7B 3JTTA 4I0KA 4X6DA 2C3WA 4KZEL 1I7RA 1CICC 1NANH 2ARJA 3DV4A 2PW1B 4HS6A 5KSAD 4MXQD 1ZHBB 1KULA 1WZMA 4JY4A 5I1IH 3TIDA 3QXAB 3L7FB 1MFNA 3PHQB 2F54B 4QRUA 1QFOA 1SQ2N 1UYWH 1BQUA 3SE8H 4X7TB 3MJ9A 2CD0A 5D7IF 2X1WL 2HT4C 4PGEB 4UBDC 3CFKB 4C55A 1ZVHA 3ZE0F 5LCVL 3BH9B 5L0QC 1W72L 3IXAB 3A6CL 1R5WB 1V7ML 3MLZL 3C5SB 1A21A 4HKJA 1AC0A 3V7AE 5A3ID 5BQ7A 3T0BA 5BOZG 2VLLA 1MAML 4XRCA 4L8SA 1LGVA 1S7RA 2FZ3B 4JHWL 2OTPA 4KTYA 4PRIA 4R3SA 1T4KB 4PRBB 2B1HH 3ZSTA 2AEPL 4JFFD 5DWUH 3CCHA 5KG9B 4HAFA 2A6KA 2ZG1A 3EOTH 3PP3K 4LGRB 4YXHH 2QQNH 2YUVA 3RUGB 1PKQE 5DRZA 1BX2B 4LNVA 5F6HI 3SO3C 2YHGA 3VGGA 3ECBA 1OB1B 3DV6B 1NC4D 5CJ8A 3FB6A 1JNHB 2FLRT 4NRZA 4AEHH 5DQDH 4O2CA 3HE6A 1A0QL 2EYRA 2F53E 2AJZB 5AYUL 2A9MH 1UH4A 1RZKH 1QFWH 2BCKB 3GBLA 3SN6N 4HS8L 1DE4A 2IALB 4RGOH 5D5MB 2R0WH 1AQKL 2LFGA 3TA3D 3QDGD 5LAXB 5EO0A 2IGFH 2R2HB 4NP4L 4DUXA 2G60H 2VMFA 4PBXA 1S9YA 3EAKA 5JPMA 3WFCH 4MJ6A 5DUBA 1BD2B 4ODHL 1A9EB 4OI9A 1MF2H 2ZUTA 5E2VL 5HGBB 2H9GA 5SWZA 5CFHA 3R1GH 5FHAH 4DTGH 2R69H 2BP3A 3MNWB 2FR4B 3MBED 4L4VE 2VAAA 5LG1A 3VDCA 3K1KC 5K59E 2CLRB 4LSUL 1XR9B 3MGOB 3I6KA 5GS1A 2EE2A 3WN5C 5J56B 1TJGL 1OM3H 1U91A 5B3NA 1KNOA 1NEZG 3BKCL 2XYCA 3SDCD 4E42B 3ZKXC 3B8YA 2XN9E 2R0LL 4MVBA 3G6JB 5IB4B 3HPJA 2DQEL 5EH1A 2BVTA 5E8PB 2WZPD 4ONFL 1KFAL 1AR1D 2P46B 1R3HA 2JB5H 1LE5B 5BW7C 4FQXC 2H2PC 4OZFH 5HJ3B 1FNEA 1PYWB 3RI5K 4DVBA 3SDAA 5J13C 3ARGA 3VE0A 4HJJH 1NCUA 2OSLA 3T3PE 4RFNC 4KI5F 5EORL 5C0AD 2R1YA 1D6VL 3W0WB 1SJEB 1KJ3H 5L8LB 1HSAB 5JIPA 3TNMA 2X4RA 5IB3A 5IW6B 5BVJA 5E6IB 5DEFB 3B2UD 1NUGA 5E8DH 3EFFB 5KSAA 4MXQA 4TRPL 1PZ5B 4WFGE 1CF8H 4PJAF 4PJIA 2ORBL 4K7PH 1U8LB 1FFRA 1CXHA 2APVA 4JO2L 4KMQA 1QNZL 1JHKL 5KS9A 2XWJA 3MRRA 4RSVA 1NCDL 2DQUL 3BP5B 3S88L 4EN3D 1A3LH 2O26U 2QADD 1QFHA 4G6ML 2NY6B 1RMFL 2VLJB 3CFCH 1HINH 1QBAA 2WNGA 4U0RC 2V5SA 4XCFH 3HMXL 4DKEL 1QA9B 1CTOA 3VW3H 1NLBL 2B7DT 1RZJL 4HSQA 5IFAL 4QRPE 3T4YA 4OZGA 4XVSL 4CN4A 1LEGA 5FGCE 2R4RL 2NY1B 3DIFA 1L4IA 5D8JH 2VXQH 4OZFB 4JFFA 4XP4L 3U82B 4PB9L 1CD0A 2IAND 1BQHA 4MNGA 3PGDB 5IJVA 4YDLC 5GGVY 4DN4H 4X9IA 2YA1A 4XC3H 1PY9A 2D7OA 1LMKA 5ALBL 4QTHA 4JKWA 4JM2A 1NC4A 2I07B 3D69A 2H26B 4P4KD 5C7XL 5F9DC 3P30H 4F8TA 5AEAA 5IGXH 3BAEL 5E2TL 3DYMA 3QUKA 4YUEL 1KSRA 3H3PL 3V2AR 1H3PH 4H8WC 4KRPB 3TA3A 2XA3A 3MRFB 3QDGA 1IT9L 4PJ7E 3QPQD 3TBWB 5E5MB 1JF5A 4S0SD 1W72A 1T5XA 5EULV 4WHDA 3UJTH 3O6FB 1OSZB 1R6VA 3HUJE 5T33H 3RVUD 4GG8B 3TBVA 3O6KH 1J0KA 4UTAL 1IC5H 1NJ9A 1EVTC 2YK1L 3FB5B 4P2OB 3LRGA 3HNSL 3LIZL 4TUKL 3MBEA 1XGRA 5FYJE 1EEUA 5C08B 3UJIH 1T80A 3TVMC 3GSWB 1NGPH 4NHCL 3ZDZF 5CJ5A 4AQOA 2BMKB 5IJKA 3SDCA 5IM7A 1EO8H 3JWOH 4OGXL 3MCLH 1K85A 5EN2B 5H35A 5EG6C 1P4BL 2YUZA 4CGTA 3DJ9A 3UTPE 2R1XB 1A1OB 1MRFL 1FE8L 2GAZB 4PP2B 4BZ2H 1HYRC 5ERWB 4JR9H 2OTWA 4HGKC 5C0AA 5CUSL 3B9KC 1Z9OA 1R3LA 2BVYA 2FX9L 4BSVB 3QIUD 2NY3D 5DQ9A 5B21A 4ZDHB 4NJ9H 1MFEH 4EIGB 1UC6A 1T1ZB 1N5YH 1A7RL 1T89A 4GAYA 4UT6H 4LKCB 3IDYC 1TCRB 5ANMA 4M1GH 1UFUA 3S36X 4JAMA 2VZ3A 3BN9D 4UILL 4MA3A 3TO4B 3QCUL 2VITA 4YHKH 3QO1B 1UZ6E 4WY7L 1XGQA 1YNTB 4NUGH 4WV1A 4EN3A 4M8VA 3CZJA 1NGZB 4JM4L 5KSBA 3STBA 2ADFH 4NM4L 3IDMB 4X5XA 1GRWA 3ULUE 3O2VL 3NCYP 1DTUA 3WS6A 4JKKA 4S0TD 5IHZB 1WIUA 4HPYL 2EC8A 4Q6IC 5I8EA 3WDIA 3O11A 2F58L 5K59F 2DB8A 5F7DA 3KLHC 5SV3A 5ADPL 1G7HA 5ITFA 3MGTA 4BK4A 1KJVA 5DI8A 2IANA 3ARBC 1G7PB 5JTWA 3HFMH 2EDRA 3SY0B 3H42L 3MZGB 5IK3A 5SWSD 5TFSL 3K8LA 4WEBL 5I1DB 3O4OB 1QR1A 3U0PB 3Q2CA 4Y4HC 3IJHA 4OCMC 4DOHB 3KPQB 3B3IA 4N8CH 4P4KA 2RGSA 1J5OL 1U8NB 3LN5A 4GRWH 1YNKL 4P9MH 4JB9L 1MEXH 5DFVD 4IMKC 3T77A 1P69B 2HKFL 1TNMA 3IDIB 3SPVB 4L4TE 3Q5TA 2WUCH 4LAQH 4M7KH 3HI6L 3X11B 4JHAL 4UZGA 3GBML 3QWOA 2BHYA 3FT2B 4MMXC 2XTJD 5ISZE 3I75B 2HN7B 3C8KB 3HMXA 4GXUN 3MRCA 3HI5H 4UIKH 4X6FB 1JNJA 3FT4A 2CDFA 3HB3C 4KI5C 4QXUL 3ABZA 2BSTA 3MOQA 2OTUB 5D93C 4XWGH 1Q9LB 3SKMA 1I1FA 4OZIB 1JGVL 3L3DA 4HGWB 2Y36L 3RY6A 3GSRB 4F58H 1U8JA 1QBLH 4AENA 1ZA3A 2NPLX 1EGJL 4LASL 2HVJB 4RGNC 2GTZB 4GRLD 2H8PA 2YD5A 4CRPA 5DDHB 1FFPB 4TSCH 3AB0C 4MXVF 3TBSB 3NA4A 4P9HC 2FBOJ 4UTBH 2UY6A 4M93B 3INUL 3RIAK 5IW1A 3MJ9H 5I1EH 4GRWB 5I17B 3CFDA 1OF2A 3QIUA 1OTUD 5F89B 1INEH 5FGBC 5I1KL 1U95A 4PLJD 3DO7B 1ED3B 1UA6L 1AHWC 4F7TB 1RU9L 3PL6B 1OD9A 3GGWA 1NCCH 4HUMB 5HYSG 7FABH 3U1SH 1M7DB 2L0DA 3UTOA 3QFJB 5FYLL 3SKJL 4UT9H 1J8HB 4G8EB 1YEEL 3BXNA 1YJDL 1HWGB 2EDJA 2GEEA 4JJ5A 1JZ8A 5GHWH 4RRPA 3FB8B 2GJZB 3LOWA 2XNAA 3OJ2C 3WFHB 4WIQA 2YRZA 4WDIB 3E2HB 4YDJA 2VZ1A 4IOFD 4KVNL 3GI8H 3PE9A 4NUJB 4WW1B 3JWDH 3Q3GA 4GW1B 1V3JA 3QDME 4LCUA 3S7GA 1S9WA 2L4OA 5L8KB 1MAKA 3GMOB 3LKNA 4BZ1H 1AI1L 4YK4B 5E2WL 2CIKB 3DETD 3HC3L 4QTIL 4YAQB 1R5VA 3KNBA 1BVZA 1RIHH 5CMAB 3TIDB 1JHTA 1IC7L 1CFVH 1YYLH 3VWJB 1YEJL 1FVCA 1Q9OA 1KN4H 2PCPB 5DJ2B 3HTLX 4OIIL 5I6XC 3ULVL 1FL5A 4P2QD 5SWSA 2GCYA 5EOTA 4TOYH 1C08A 1KLGB 1F45A 4XPFH 4PJEB 3L9RA 4G6KH 5BO1H 1PX3A 4Y5VB 4DK3A 1MCHA 3VXRE 5FYLD 5FUZL 5I66B 3L7EA 1BLNA 1BVLB 4CVXA 5DC0A 1MPAL 2GIYA 3S97C 5HGHA 3MO1A 5I9QC 3P9LA 1S7RB 1QR4A 5T1KB 1A1MB 4DZ8A 2QSQA 3G9AB 4LGSB 4UUJA 1OGTA 4QHKI 4KI1A 2R0KH 3AY4C 4ZO8A 3MRHA 2A6KB 1J8KA 1MFDH 4X0KB 5ILTH 1HIMH 4XPAL 3D39D 3H7LA 4L4VD 5DRZB 5DJ0B 4L3CB 5J3HC 2BSSA 5E00B 2W9LA 3GMRA 3QISA 3HR6A 2Z93A 1KCKA 4XNUH 4M43L 4FHBD 3HE6B 2EYRB 3MRLB 3EYVB 3GNMH 4BSJA 4KGLA 1JPTH 4JO3H 5MP6L 2KH2B 3ULVD 3JSSA 4PB0H 3QO0A 1DDHB 2C7UB 5DJCB 4LPTA 3T0EE 3ULUF 3PABB 3CX5K 1S9YB 4GRLA 5DUBB 4JFQA 4X7SL 3WLWD 4ETQA 4HF5H 4BFBD 4XMLH 5JW4M 1TITA 3ILPA 5MEPB 5KVDH 1P5UA 3UTQA 2B2XH 5HPMB 3GMPB 4UQ2A 5GRYA 2VAAB 1JRHL 3SQOL 4R0LA 3BKJL 2AJ3A 5FXCH 3F65A 4EIZC 4M5ZL 4ZTPL 2HMIC 5EOCL 3MRQA 1G9NH 4JRXB 4G7YL 1GGIH 2D03H 4YHIB 1G7IA 1I7UA 4PJGB 3KPMB 4XZUB 5E99L 4XVJL 2PTTA 2FWOB 4CU6A 4Z7VA 1NL0H 1AFVH 1CD8A 1GHFH 4LIQL 3ARGB 2VSCA 5DZNA 4GQPH 3WDHA 4M1DH 1JPST 1V8HA 1WCQA 2OMBA 4PJ8C 1EO7A 1EGJA 3EYFB 4LHUD 4MQSB 2WK2A 4PFEA 1JGLH 4OBRA 1JN6B 4HEPG 1OAKL 3CSYA 4KMTL 2XZCL 5CGYC 5L6YH 1NLDL 3MYJB 4PREB 2CK2A 4FQQB 3MRRB 4RA0C 3AREA 5FV2A 4MJ5B 3P77A 1TQCB 1A7PL 1FQ9C 1OW0A 2N7BA 3PUCA 4J7RA 4P2QA 5F97E 4K94L 2F5BL 1TPXC 2HT2D 3A6CH 5FV1L 4KTDH 2VYRE 2NLJB 5TE7L 1KG0B 4WRLA 1U8OB 1T3FA 3CFJB 1REIA 3GI9L 1S7WA 1OAQL 4K7FB 2CQVA 5JUEL 3IAGC 4JHWH 4ORGA 5HHMD 5KAQF 1OHQA 3VD9A 4WJ5A 4PJCA 1Z9MA 5J12B 3QFDB 1GC1C 1NSNL 1U42A 2G75B 5F1IB 4MA7L 1L8JA 2XKUA 1A4KB 4KKBC 4MNGB 4WHYH 5DMIL 5IJVB 4X4ME 4QNPF 1S7VA 1ODAA 3BGMB 5BCAA 4MCYB 3D39A 1OVZA 1UKSA 4RQQB 1QFWM 4QTHB 4JM2B 1S7TA 2FO4A 1A0QH 3OKLA 1K3ZA 4XCYB 1G0YR 4NDMA 2X9YA 4Q58C 2AEWA 2QL1A 2UWEF 3FRPA 3V6OE 5AZ2L 5EUOF 4Z7UB 5IMMB 3QJFA 4NP4H 2AK4B 1FBIL 5HHPA 3DWTA 3ZKMD 2A77H 2YPLE 3OAUL 1T5XB 4NPYA 5F88A 32C2A 5E2VH 5EU3A 2AI0L 3QP3A 1HXMA 5IV2B 4PYHA 5HVGB 2Z35A 3G08A 4XPBL 1NUFA 3MRNA 1ZLUH 4WU5A 4GO6B 5I74B 4X7EC 3QHZL 1DQLL 3SQBA 4H5SA 3LN9A 2DLEA 3ULSA 3V8OA 2EICA 3FO9A 4JRWA 2VXSH 3MNZA 3ROOB 4LLAA 3T2OA 2R0LH 5IM7B 1WC7A 2GW5A 5LQBL 3CUPA 4PRNB 5IBUB 2J8UE 2G5BA 2XWBA 4P5KA 1J87A 1K4CB 3OB0K 3GHEL 4XB8A 3U6RA 4R2GD 1R0AL 1D6VH 1WVZA 1S78C 3KPTA 2P7TA 3D9AL 2DMKA 1DANT 1KEMH 2AJSL 5DQ9B 5DMGD 3KJ4B 2MFNA 4NRYB 4S1QL 2CK0H 1QLRB 5FK9B 4TTGA 3MLSH 4ZS6D 4ZTOL 4TRPH 4LHUA 4OGYL 3RL2A 1HXYA 4PR5B 3VWKD 5DO2D 5D6DA 3UP1A 3HLAA 1NMCC 1YEHH 4WUKL 4OQTL 5DLML 1E28A 1QNZH 2VR9A 2GITB 3N0PB 3TH2T 4IDJH 5B39G 4C4KT 5I1AA 1U8QB 5JHDD 3BVNA 1B0GA 2JCCA 1ZXQA 3S88H 5BV7L 4M62H 3EYQD 1RVFL 3HC4L 3VD7A 4WV1B 3DOSA 4G6MH 2VDRL 4EUPB 3ZYZA 5TJWK 3UC0L 3OGCB 1T0NA 1YPZA 3TZVB 5DS8A 4QHUA 1F02I 4DN3H 1NLBH 3WBDA 4X6EA 3GMQA 3EJZC 1VESA 2VDMH 4JDTL 4JHZA 5K9OA 5HHMA 12E8L 3NACL 4GFTB 4W6YB 2R4RH 4JFXA 4OIAA 2X4PA 4MZ2A 5DVLA 1WUNT 1WAAA 4ZOBA 1E4XH 1MJUL 3ULUC 5ISZD 4MSWA 3SGKC 5CWSA 2EH7H 1JMXA 1RPQA 1FVDB 4JFHE 5ALBH 3NPSC 2PXYD 4OLUL 1L7TH 2IJ0C 2E9BA 1JWUA 1YNLL 4JZOA 2BC4B 5L2KD 1KCSL 5ID1A 2BDNH 3E8UL 4U7MA 1GGUA 4YUEH 3H3PH 3WHE1 1TETL 4P48A 1ZLWK 4W4OC 5ICYA 5AWNL 5FYKL 4U6YA 4ZUWB 1NMAH 2XTLA 3MUY1 4Y2DC 2VQUA 1ZLVK 4U1IB 3GRWH 1T1WA 3TIEA 4PRHE 3N85L 1GGCL 2W91A 2IQ9H 3FO1A 43C9B 1ES0B 2VB5A 3G5YA 5GZND 1HH9B 1S9VA 5CEZL 3AVEA 5GGUB 2UZXB 1BZ9A 4ZQKB 4LQFH 4M48L 1T2QL 2ZUXA 3LIZH 4LLVA 2CDGB 5EIVA 3RWGA 2ATKA 3CFEB 1GGTA 2AV1A 3O4LE 4UV7H 2KDGA 4HWBL 1OAYL 3HNVL 4WGWB 4U1NB 1B9ZA 3RWCA 2HA1A 3EHBC 4P2CG 1OCWL 4NHCH 2HJFA 4APQB 1Q8MA 1WF5A 1WT5C 1DBAL 1Z3GL 4Z78B 4U6VL 4FZ8H 2V9TA 1JPGA 4E9LA 4KY1L 3RFZC 3VFPA 1WBXA 1Z9LA 2JK5A 4D9QD 5A43C 2H8PB 5EOQH 2FB4L 5IMLA 3O8XD 1BEYL 4Z5RA 4BQ9A 1DLHB 2EDQA 1PQZB 1HHGB 4M3KB 3OKKA 4PJHA 5CUSH 2FX9H 3DVFA 1JGEB 3KPRD 5DJ8A 5FYKD 2NY7H 1A7RH 4F7PB 2AJUL 4JEGB 1SVZA 3ARWA 1BFOA 2WSKA 4ZXBC 1IMHC 5ICZA 4LLYB 4N0FB 3PQYB 3QJHB 4N5EC 3VWKA 3SGJC 1Y18A 3T0AA 3G5ZA 1ZLSH 4U4BA 5CEZD 2XA8H 3QCUH 4ZUTA 3STLB 3QEHA 3PXJA 1H5BB 2NZ9C 5JHDA 4KPHH 4OCRL 3WIIL 5E9DE 3FQXA 4YDVA 5F8RC 5EO1B 5B22A 2HVKA 1Q9WA 5JIHA 1GZQB 1ZVYA 4JM4H 1IL1B 2DLIA 4UQ3A 2VLRB 1S8DA 3VGAB 2O5YL 1RUPL 2OJZL 3O2VH 1U8HA 3TO2B 3OMZA 3K46A 4PBVC 2WQRA 4JQIL 5B8CA 5I71C 5DJAA 2ERJC 4NO3B 1CGSL 3H9SB 2HTKD 4M61A 5B4MC 4OI7A 1A6UL 3PWPE 1YZZA 1LP9E 1FC2D 1OT2A 1QYGL 5SWQA 2F58H 4NCC2 3L5XH 4XNXH 2Y23A 3WHXA 1JHTB 1XH3B 1W0VB 2VERN 1WBZB 1JP5A 4RMTA 5TFSH 3OAYH 1UWXK 4WEBH 3GIVB 3LKSA 4KC3B 2PXYA 4ZD3L 1FDLL 5I8CA 3KXFE 3L6FA 3DNKA 3SDYH 4OCSH 5D2LE 3L9RB 4HH9A 3VH8A 1H3TA 15C8H 2ZUWA 1HQRA 5TE4L 3EUUA 5L2KA 4PGBA 5CLWA 3QUXB 1J0IA 4JB9H 4OQTA 3GSNB 5T3ZH 5T1DH 2BNRD 3UTZA 3C6LB 3OKDB 3MO1B 4DZBB 3D5OF 4E0RB 1EX0A 3HI6H 4JN1L 3GKWH 2XWTA 3QQ9C 4X4XB 2OJEB 4JHAH 3L3KA 2QKIA 4ZFGH 4EQ3A 1G7JA 4KFZC 1UQSB 4HBCH 1WICA 3WD5L 4LARH 2NY0B 1JK8A 2D7TH 4JFOA 4HC1H 3IVKA 3HZVA 1EJ6A 1VGKB 4QXUH 1CICD 5JA8B 4GUPA 4NYLB 4HK3J 4CW1B 4UINL 4CUCA 4C83B 2DM2A 3CMOH 5BS0B 2EDWA 4EI5A 4PJFF 1JGVH 2QR0A 1QSZA 1ETZB 2Y36H 3MUGA 1BVKA 5L88L 1EGJH 1K8DA 2ICWI 3SGDH 4UBDD 1UEYA 2RCSH 3WV0A 4JG1L 3OJVC 4JPWL 4BFIA 2BOBB 3QXDA 5J1AB 5I1CH 1AY1H 2IAMB 4JFQB 3O8XA 1F4XL 1X4YA 3QCTH 1UJ3B 5HI4C 4P46B 1B4RA 5ETUA 5J6HB 3T0EC 1BQLL 3BYTA 4LRNL 3KPRA 1UH3A 5I1KH 4LPXA 2DKSA 4NC0B 1CDYA 2Y06L 1UA6H 4U49A 1RU9H 1U8PA 5KOVC 5E56A 4O51B 1VADB 4OGZA 5EFIA 4C56D 3BWUC 3SKJH 4CL7A 3I9GL 5F7UA 4WWID 1IGJA 1R3JA 1P6FA 1YJDH 4UU9B 2EDTA 5IQ7L 4YZFE 1WLHA 3ZKQD 1I7UB 4X9GA 2PTTB 4HWBA 2EKSB 4OLVL 1EEZA 4Y4KC 2EEDA 2C1OB 5DRWB 2MKLC 1W0WB 4YJZL 2HT3D 2R2BA 2GK2A 1HKLL 2BERA 1IGMH 3L5WA 4BQ8A 4KROD 3M1BA 4U1HB 1TVHB 1IC7H 1MLCA 1IAOB 1N64L 1IGCL 2YXMA 2NY2B 1YYMH 4MHHI 4KWUA 3O2DL 1MFAL 2WP3T 5E1AA 3ZYOA 2RR3A 4GSDL 4L8CB 1X5AA 3AREB 1DJSA 2VIRB 4KXZH 4ZSOA 4Y2OA 1A47A 1S7QB 3O3EB 5I15L 2C5DC 2X05A 3R0MA 5CEXA 4XPGL 3RVVC 4D9LL 5C0RH 5BJTB 4ERSL 4OUUA 1T3FB 4P2RE 1TJHH 4XP6L 2G2RA 1MPAH 1FFNA 4N5UA 4I5BB 2BNRA 4NCC1 5D7SH 1GGBL 2J5LB 2H2SD 1CLOL 2WBJC 3CSGA 1TZHB 1KBGL 2H2PD 3HCVB 2Q7YA 3K3QA 4K3JL 5F7NC 3RWFB 5DEGA 1HWHB 3HG1D 2XZQL 4P23B 2QSCL 1IRAY 4W4NA 1JF1A 1D6EB 3WUWA 4XPAH 1LO2L 3T2QA 2KQNA 1VFBA 4I3SH 2PR4L 2NYYC 3EZJB 1CICA 2HH0H 1JGUL 3NTCL 5AUMA 2YR3A 4M43H 4WUUD 2FO4B 3UZQA 1DUYA 4KJPC 4OTXH 1UXSB 1QRND 2ADIA 5D7JB 3KGRA 5F9AC 5MP6H 3JTCA 3LSOA 4XTRD 1NGQH 3PWUA 3DXAE 1AO7E 3IDNB 5FUOL 1NFKA 4XVTL 5KVGL 2W9DL 3QT2A 2A6DA 1JNLL 3D0LA 3TT3H 1I4FA 4X7SH 1CLYL 5F88B 32C2B 4GG6A 5H94A 2Q3ZA 4M02A 1CTNA 2CMRL 1I9IH 4NFCA 5D70L 4IMLB 4I8DA 3RWIA 1FYTD 2MPAL 4TTDC 1Q1JH 1ZMYA 3SQOH 5HGAB 4WU5B 1NCTA 1MVUA 1P6AB 2DQIL 3BIKA 3FO2B 1XF1A 3IKCA 4I48A 3QDJE 3U2SA 4KJWC 5HHOE 5C09E 3MNZB 4C56A 1NMBH 1FG9C 3AU1B 1EBPA 5F7MC 4XHJC 1FLRH 1AP2A 3SGEH 2BNQE 1YN7B 4D0CA 2P8PB 2IEPA 1RV6X 1C16A 3HZMA 2WWKT 4XVJH 2XKSA 1OGAB 3JTSB 3GMNA 3ARFB 1RZKC 2XWBB 1FO0L 5E6IC 4WENB 3IRPX 4I2XE 3GJFB 3KYNA 3VXQA 1FLTX 2D0FA 2AXFB 3DMMB 2LTQB 3KYOA 5JHLL 2G9HB 4PS4H 2Z8WC 3HKFA 3M07A 1OAKH 1ONQB 4KMTH 3TH3T 1I9RH 5IBLC 1JVKA 1DN0A 4HV8A 4GRWF 4G6AC 4L3ED 3LEYL 2NY6C 3BVNB 5DGQA 2FSEB 5GS2D 4A6YH 1Q72H 35C8L 4QY8B 4NQCB 4L3AA 4QO1A 4NBYB 3F12A 5TE7H 4ZO7A 1YEDB 1YEGH 5CD3B 1YC8A 3GI9H 4N0UB 1OAQH 3BE1L 4MD5B 5DS8B 1M4KA 3BP6A 2COQA 3RZCB 3L3IB 4LAJH 5K9OB 3DUSA 3C08H 1KGCE 1NSNH 5HBBA 4JVUA 3FOLB 1SYSA 4YHOL 3HG1A 3Q1SL 4OJFH 3MJ6A 3O9WD 4O02H 4HS3B 5CAYB 1J05A 2DM4A 5C8JB 3LV3B 3S5LB 4RAUB 3QG6B 4MHHG 5DR5H 2RQ8A 3VG9B 3D3VD 4WUUA 4GT7A 4HPOH 4OB5L 5E1HB 2XZAL 4ONHB 3EZ8A 1FZMA 1QRNA 1T7VA 3O2DA 4WU7B 1YQVL 2Q76A 1ZS8B 3O6FC 4OD2B 3KYMA 1XF4A 2FEEI 4R90H 4NZUL 1PG7W 2XV6B 4A6YB 2Q1EA 3T2PA 3OR7A 1Q9KB 2DQFB 5EA0L 2AEQL 2AI0H 1QEWA 1OOAA 4MCZB 1FZJA 4HKZB 1LO0L 1FIGL 1JCKA 2MCG1 4BUGA 3QI9D 1FYTA 4XPBH 3GO1H 3SE4A 3T09A 3VFVA 3MLPA 4KAQL 4X99A 3QHZH 1DQLH 3EO0B 3R8QA 1TTFA 3T1FA 4K9EL 3RKPA 5FHBL 5BXFA 3KLHD 2GHWB 3CVIL 1D7FA 2Y6SC 3FT3B 4PLNC 1WFUA 4MYWB 3ARBD 1YMMA 5HYQA 4OFDA 1OQOA 1DSFH 4HD9A 2LAGB 1WGOA 1GL4B 1JPGB 1KIQB 4K3DL 3S98A 5LQBH 2UZIH 1NAMH 2YD1A 1XIWB 3NFSL 4NSKB 5EBLA 4Y4HD 4NKDA 1SHMA 1ORSB 2FEDC 1QSEB 2EDHA 4Z5RB 1N59A 4YC2B 1R0AH 1CN4A 1LO5B 2VISB 4JFEA 5DJZA 1DVFB 2VDKL 4RX4D 1UJTA 5MHSE 2AJSH 2H32A 3MV7E 1GVIA 3F6LA 1EZVX 4DCQA 3QEGL 3MX0A 4Z77B 3JWNC 4EXPX 4LF3B 2AQ3A 1D5XA 4PJBF 4OGYH 2IPTL 4RWYH 4PTUA 3VD4A 3BPNB 3R8BB 4P5TD 2AGJL 4X5WA 5C0EA 4OQTH 5DLMH 4S1DC 5FYJU 4B7LA 4F7EA 1T1YA 3MCKA 4L3EA 3DI2B 5LJYH 3D6GA 4KI5D 1ZT4B 3P73B 5B3JF 2P8LA 3AS0A 4Z7WB 4JFPA 3LQAC 4GMSH 4TVSa 1ZWIB 4XX1E 3Q5YA 2DJ4A 4NWTL 3WEXA 3UC0H 4HKXA 5BOPA 3CC5A 3OAZH 4EBQL 4Z7NE 3IT8D 5B8CB 3GIZH 3VCLA 1E4KA 2X10A 3PP3H 1CD1A 12E8H 1IEAB 3NACH 4RGND 4IRZL 2Z91A 3VFWA 5CBAB 2VE6B 4OF5A 1NAMB 5F9OL 3UPCA 1XF3A 3P4MB 4WI7A 2V2WA 5T1LD 2AV7B 5M94B 2X42A 2BVUA 4LLUA 5D7IA 1AXSA 5HDOA 1FO0A 1D5MB 5TQ2H 3O9WA 1MUJA 5BZDA 1FN4A 3NAAL 4ENEC 4QRRB 4Y19E 3QPXL 3RWDB 4PGDA 1UADC 4KK9C 3FCTB 1UCBL 1YNLH 3MV8D 5I8CB 2F19H 5FKPA 1KCSH 2J88H 3D3VA 3QZWG 5C0CB 4O4YH 2UY7A 3E8UH 3GJEA 4G8GD 4MJID 5INDA 4UDUA 2UYLB 4ZFOL 3P0GB 5EIIA 1T21A 2Q6WA 3L3HB 4PJDF 1F42A 4H88H 1VSCA 1KPRB 2E6JA 3L3KB 4U6XB 2X09A 2QKIB 1G7JB 1YEFH 3ZKSD 1G7QA 4QGTA 2V7NB 4XNZC 3BKYH 5CEZH 4NGHL 1T2QH 3IVKB 3QI9A 1ZA6B 2Y25A 3P0YH 1OAYH 1T7ZA 3HNVH 1OD7A 2AXHA 4ELME 4Q6IA 3N50A 2KQMA 3ARPA 4PDCE 1WBYB 4EI5B 1OCWH 3GMLA 3EKCA 3F58H 3BN3B 4ZNEA 5L8JB 1M7IB 4YX2L 3ARBA 3MUGB 5EU7E 1MCWW 4IIQC 3QRGL 3V0WL 2R1WA 4ONGL 3TCLA 1ND0A 4KHTL 4MAUL 3U46A 3SBWA 3UYRL 4M93C 2Q8BH 3D25B 5DRNB 1MQKL 2FB4H 3VRJA 4Y4HA 4BYHA 4FQ1L 3TN0D 4YHYB 2VKXA 4TULL 4MNQD 2JE8A 2IWGA 4Q9BA 4RX4A 1S7XB 5E08L 4X7CC 5IEKB 3OR6B 1MHHB 4Z7UF 1JTPA 3NOIA 2HRLA 2CXKA 5CLTA 2AJUH 3FQRA 3HRZA 4H1LG 5IVXE 3TT1L 5FO7B 3BEVB 2JJUA 3ALXA 5DYOB 1W8NA 4P5TA 2Q20A 3M8OL 2YZ8A 4HAGA 5D96B 3MA7B 2HFFA 3E2HC 4Q7DA 1ZK9A 1TDQA 5J3HD 4OCRH 3WIIH 1BBJB 3UBXI 5C0FB 2VC2H 1RJLA 1OAUL 4U1GB 1KIPB 1A3RH 1HILA 4G9FD 2DOCA 2GYSA 2O5YH 3ES6A 3CU7A 3VG0L 4AEIL 3GUTB 2HWZL 2OJZH 1LEIA 1DBBL 3EGSB 1QVOA 3MRMA 3QQ3A 5KTEL 3MRPA 4PJAA 2QHLA 2YZ1A 1GSMA 1T6WA 1VKXA 3C2SA 1BFTA 4PGJA 4NJAH 5F7FA 5K9JL 1TZIB 2B0SL 5JW4Q 1GH7A 5T1LA 4F2MA 3ARTA 3I84A 1U3HB 3TJEH 1SEQL 4YR6A 4EOWH 2HTLC 3ALPA 1EXUB 1MQ8A 2A6IB 4U6HB 1WITA 3C5ZB 2NX5D 3WLBB 3BPLB 4D0BA 3FN0L 2AABH 2WAHA 3BPOB 3G6AA 4HFWA 4RBPK 4Y5VC 4D3CH 4OFIA 1NGXA 3VMNA 4CMMB 5EC1B 2WLYA 1EUTA 1E27A 2Z92A 4ZSOB 1KTDB 2M2DA 3UTTE 3WIHL 3MV8A 3JV4B 2OXGA 2HMID 4LVNC 3U4BL 5JMOC 4G8GA 4MJIA 4JHBA 4GKZA 5M7QA 3X13A 1IM3B 5FA3A 3ET9F 1Y6NR 3OKYA 4WI6A 2I9TA 3K2MC 1U36A 3FN9A 3DXAD 3BDYH 1H15B 2EDOA 5DK2B 1GC1L 5GPRA 2Q7YB 4XAKE 3ZSSA 1FORL 2A9NL 2EIBA 4J3XA 1MCOH 4LKXB 1YY8B 4BQ6A 1H3UA 2EH8L 3T4AA 1IE5A 1VFBB 1F00I 3WS3B 5C2BL 2QTEA 4UINH 1K5NB 5KZCD 1CE1L 2VL4A 3RNKA 4F7MB 4P0DA 1MHPL 5HHOD 4XNYL 2Z8SA 1HCVA 5L88H 2FCBA 2HLFC 1XGTB 4AT6A 1KB5L 3O3BA 3NCBB 3P9WB 4JQVC 4NQDE 3LS5L 3LSOB 4R4BB 1UM5L 4G3YH 1AD9B 5HDBE 3BPCB 5L0QB 3L95A 5EBGA 5LGKA 3F5WB 5DFTA 3TN0A 1I4FB 3N9GL 5I16B 2DJUA 1DQTA 3CZFA 2HLAB 4MNQA 3BJ91 3MFFA 3MRBB 2DL2A 5DJYA 3L3GA 4ZFOA 2NNAA 1BQLH 5F1KC 4NQEB 4TYUA 4XBGA 3C60C 1JMZA 1EK3A 1KLUA 3NCFB 1S7UA 3PV6A 1JFQH 4YFDB 2CSPA 5AD0B 2W60B 1JV5B 4I48B 1IILE 5L7XL 4KKBD 3S35X 4Z8FL 3AY4A 2FNBA 3AAZA 5IQ7H 1F11A 4G7VL 2BVQA 4F7CB 3HZMB 3FHAA 3SO3B 3MLXH 1RZIA 5HHQA 4PJ5D 2WINB 1HHJA 1F58H 4G9FA 3ARRA 5CD5C 1DZBA 3MV9E 1UB5A 1L9MA 3MRKB 1CDJA 2EDEA 4NN5C 2P49B 3KYOB 4MQXC 2RHEA 3HZYA 1BM3L 5MEND 3DHJA 3D2UB 3RUGE 1OLLA 1N64H 1IGCH 3HPLB 4ELMF 4YHML 1DN0B 4GSDH 3U48A 2NX5A 3PDOA 5DD1H 3DO3A 3NZ8A 3NH7H 2E7LE 5I1LB 2ZUYA 4TVPE 1X44A 1HZHH 1G9NC 2YS4A 3WN5B 2ZPKL 4XPGH 3B9DA 1SYVB 1LO3L 3F6IA 4JRYD 2LVCA 3RJDA 2P5WB 3UBXG 4NOFA 5J12C 3HE7D 3FFCB 4Z76B 1EDQA 1R24B 1LVEA 4OD3L 4YEEA 4Y5XA 2CUIA 3DVNA 3B6SB 3RQ3A 3PGCB 4YGAB 4K3JH 1GIGH 4FQXB 2FX7H 3SDXE 2BK8A 3R4DA 2QSCH 4XNQA 4FN0A 5IVXF 1S78D 4RFNB 1V05A 5I0ZA 4HFUL 2O5XL 3BRFA 2PR4H 1M71A 5IMOA 1U8MB 3QUYB 5GQBA 1JGUH 4RDQG 4QCIB 5DJXB 4HDIB 3QSKB 3G6JE 2VLKE 1A9BA 1WFOA 2I27N 4XXDB 4AM0B 1CLZL 4UOJA 3MOAH 5GGSA 3QEQE 3MA9L 2ESVA 4IRJD 4H8WH 5JQ6L 4IRSC 1QBBA 1MELA 3V0AC 4OZHB 2QLVB 3QA3A 1XF4B 4LCCC 1G7LA 5FUOH 3LEVL 2NMSA 4EUPG 1PZUB 3F7RA 1U3YA 1ZHLA 3KJ6H 3DGGA 4NNXB 3WIHA 4JPIA 5FEBA 3OR7B 4G6JL 3U0WL 3OXSA 3KWWA 2PUQT 2CMRH 4U0RB 5I74C 3LAFA 1NBYB 4NRXB 1M6OB 1FYTB 4Y8AA 4OCYL 4YIQB 3MREA 3VI3F 5LBSH 4X6BB 3O3AA 4X99B 4PLOB 2VSDA 4QXTA 2DQIH 3VXME 3UTSA 1NBQA 1NEZB 5BXFB 4XX1G 1UWGH 2FJHB 4F9LC 2EDFA 1DQJB 3VFMB 3EYOA 1YMMB 2C3XA 5GS3A 1AGBB 2HFGL 3IFNL 2E27H 2VLJE 4OAWA 1B90A 1IFHL 4MAYD 1PSKL 2DMBA 4KUZH 4PJ9B 4M5YH 1FAIH 3QEUB 3AS3A 4N1CA 1INDL 3KYKH 4PJ5A 2KUTA 4PJXA 3KJ4C 4JFEB 4CVZB 2IPUK 1U93A 1KB5A 1EEYB 2MKWA 3QWRD 5T3XL 5IHUL 2PTVA 3B5HA 1Z0NA 3MLVL 5JHLH 1TLKA 5IROC 5EU4A 5IQ9A 5TF1H 3W9EB 5MENA 3CPLB 5HHNA 1ACYH 4WNQB 1CE6A 2AERT 1DQDH 2FJGA 4Z0BL 3TPUE 4X5WB 1S9XB 5TDNA 4M6ML 5DD3L 2P4AB 4X6CE 3HR5A 3MCKB 2AVGA 2DLFL 4JDZB 4HIHB 5H2BA 2BSED 3P4LA 4LCIL 4PG9B 2H1PL 2F8OA 1BGXH 1QLFA 5AYQA 1B0RA 3RTQC 3TVMB 5HDBF 4WW2A 3BE1H 4JRYA 5C07D 2P44B 2VWEC 3HE7A 5CP3A 2X1OA 3NIGE 1AH1A 1KLFA 1KCRL 4Z95H 4E5XA 3QULB 4HUWA 2DTMH 4HX1B 3QIBD 3AUVA 4YHOH 3ARYA 3H7BB 1OT1A 1N4XH 1IAKA 4JN2B 3VXSE 2CKBL 4EZMA 4LLDA 5BZDB 1Q0YL 5HGDA 1KELL 3FN3A 4JPVH 3B9KB 5T3XD 5C6TH 4Q9RH 3GSOA 4HUVA 3VXUB 1T22A 3G6DH 4ZXBD 4N5ED 5D7LB 4CU7A 3JUYA 3ESVF 4WI3A 5DJ6A 5IB1B 5MEOB 1EAPB 4IRJA 2NZ9D 3L3JB 4NZUH 3DYOA 5CBEB 2AJXH 1JPFA 4PRDA 2XXCB 1WV7T 1WZLA 3BGAA 2AEQH 2IH1B 4HHAB 4QHNA 2HJLA 1YMHB 4AIXA 1HCFX 3BSZL 5GJTL 4L8DA 3RPIA 1IM9B 1FZOB 3SDDD 5C9JB 4ZPVA 2R23B 4KKAD 5HYJE 3U36B 1BOGB 2PYED 3GBNL 1T6VN 4KH2A 4PRPB 1IQWL 5TDPA 4XP1L 2CR3A 2F8VA 4APQC 2AKRB 4J3VA 1YY9D 5FHBH 5HI3D 2SEBB 5IB2B 3CVIH 3REVB 3GMLB 3BISA 5SX4H 1QBML 3L3OA 5FFLA 1CDGA 2HFEB 1FAKT 2Y5TB 3HHRB 1TVBA 5C0DA 4NZRL 4MAYA