2XFXA

Cattle mhc class i n01301 presenting an 11mer from theileria parva
Total Genus 76
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
76
sequence length
277
structure length
277
Chain Sequence
GSHSLRYFHTAVSRPGLREPLFITVGYVDDTQFVRFDSDARDPRTEPRQPWMEKEGPEYWDRETQISKENALWYREALNNLRGYYNQSEAGSHTLQEMYGCDVGSDGRLRRGYEQYGYDGRDYLALNEDLRSWTAADTAAQISKRKMEAAGAAERFRNYLEGTCVEWLRRYLENGKDTLLRADPPKAHVTRHPSSEHEVTLRCWALGFYPEEISLTWQRNGEDQTQDMELVETRPSGDGNFQKWAALVVPSGEEQRYTCRVQHEGLQEPLTLRWEPG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system
molecule keywords MHC CLASS 1
publication title Mhc Class I Bound to an Immunodominant Theileria Parva Epitope Demonstrates Unconventional Presentation to T Cell Receptors.
pubmed doi rcsb
source organism Bos taurus
total genus 76
structure length 277
sequence length 277
ec nomenclature
pdb deposition date 2010-05-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00129 MHC_I Class I Histocompatibility antigen, domains alpha 1 and 2
A PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2xfxA02
3.30.500.10 Alpha Beta 2-Layer Sandwich Murine Class I Major Histocompatibility Complex, H2-DB; Chain A, domain 1 MHC class I-like antigen recognition-like 2xfxA01
1OAQH 5GISH 3QIWC 3ZYOA 3V6BR 3R8QA 4OT1H 3EO0A 1KC5L 3HI6L 1SJHA 5D5ME 5EFIB 1QP1A 4YXKL 2YMXL 1RI8A 1CIUA 4MJ6A 4WWKA 4M4PA 5HHOD 5MERA 2EC9U 2AXGA 1U6AH 4C56B 2DI8A 5EO1A 3PGDA 5DJ0B 1A7RH 3EGSA 1PKOA 3VCLA 2CDGA 2Q7NA 4UTBH 2LTQC 4LKCA 2FYYB 3O9WA 1DJSA 4EI6B 4PY7B 3VGEA 2IBZY 4TVPL 3WFDH 2OZ4A 4RGND 3OF6A 2I9TA 3LN4A 5I1GL 1KEGL 1TZIA 3B9KB 4MS8C 3AXLB 2IH1B 5JNYA 2P42B 4ZD3L 5F9JB 3RNQA 5DA0B 3TJHA 1UKTA 5FDYA 3GMOB 2GTWB 1D9KC 2NY5C 4G8EB 2V7NA 1WEJH 4Q9CA 3UDWA 1MELA 2D0FA 3LS4L 4FFWD 5MHSE 3A6BL 4XB7A 2APWA 1L0XA 2CXGA 4Z7UB 3VDCA 4RBPH 1BQHB 3TF7A 3WL9A 5IWLA 5JLZA 4KRPB 5C09D 4AEIL 2MFNA 4J6RH 4N5EA 1IC7H 3PWPE 3GMNA 3M07A 4XHJD 1YEFL 3QWRD 1UM5H 2VXQH 3ARVA 2BY1A 3N1PC 1MAKA 4HS8L 1HHHB 1EO7A 1T2XA 2K9UA 4ZAKB 4YHYC 2I5YH 1XGTA 4TYUA 2BX5A 5T1MB 5LXGH 5EORL 1FYHB 1BLNA 4LFHD 1UCBH 2PUQT 3P0VH 4Y16A 3BISA 2LAGB 3QEGH 3DVIA 3ZKMC 4EN3A 5E0QA 1KGCE 1W0VB 4NKOA 5HHME 4ELMF 3CK0L 5F3BA 1YECL 2Y36H 4HUVA 4MXQC 1NGXB 4Y4KD 4APQD 4LBEA 4M1GH 1CGXA 1F4HA 1JWSB 1R6VA 2QHLA 3DIFA 3LV3B 4POUB 1XMWA 4NHUA 3C08L 2BERA 3D25A 2PXYC 4NUJA 5FFLA 2X70A 3S5LG 3CXHK 3QCVL 4QY8A 1K6QL 3C5ZB 5D1QB 3RGVD 3T4YB 1MUJA 2J12B 2DQEH 5C0RL 3NAAL 4WUUE 3ZE1E 1J5OH 1GIGH 1KJ2H 1N5YH 1Q9KB 3K4DA 4K8RL 3PG2A 4TSBL 5T3ZE 3O3DA 5F88A 3RA7H 5ESVA 4N8CL 3SGJA 4LSRL 4GBXD 1RIHH 3VWKB 4OF3A 3NIDF 5L0QC 3MLTB 2AJZB 2R9HC 5FA3B 3UTQB 3QR2A 1SEQL 3QXDA 2FLBT 1OSPH 1T2QH 2F54A 3VH8G 4OCSL 1G6VK 3CUPB 3C5JA 4XP4L 2OR8A 4GQ9H 3MBEC 1OOAA 4BZYA 2A74A 3WSQH 3WDIA 1CLYL 2JTDA 4WDIA 2W1NA 3ERYA 1L4IA 5JO5A 5SWSD 3KXFD 3P2TA 2B4CC 5GS0D 4JCLA 4BSVB 3QEHA 3VRLF 4WTXA 1RZFH 5F9OH 5CAYB 2BC4B 3WXVH 4M61A 2JK5B 4D0CA 2VIRB 3B9KD 2VL5A 4NN6B 2X1WL 1T21A 3OAYK 4OF7A 1HE7A 2HFFA 3LZFL 1MAMH 5FKPA 3R06A 3TBYA 3WJLA 1KCSH 5IROC 1EUTA 4IIQA 1DN0B 2BSSB 3QWOA 2DBLL 1RIUL 1AR1C 2O5XH 5IMKA 1NMAL 5K59F 2VNCA 2G75B 1I7RB 4P4KB 4FOMA 4J4PD 5J3HD 2E9JA 4N9OB 3R0MA 1G1YA 4R6UA 4W4OC 5C0IB 4PJXA 3AREA 1YEGH 2MPAL 1PG7H 4NM4L 5IB4A 4QRPE 2DQTL 4UV4L 5B8CA 2I60H 4NN7B 1UA6L 2OTWA 5IMLB 3NIGF 2OXHA 4LSTL 3FO9A 4WJ5B 4UAOB 3NACH 4XNZB 2AJYH 1NLDL 1HSBA 4Z78A 1JF6A 2VUYA 4O51A 4YGAB 4OKVB 3TPKA 3FMGL 1QRND 1BVKB 5E8EA 3T0VA 3QRFM 4L3ED 2FX7L 3WIIL 4P5KA 4NC2B 2ESVD 1NUFA 4JO4L 3KPSA 4PJFB 3QG6A 5FYKE 2IANE 3KDMB 3O3UN 1MF2L 3RTQD 4V1DA 1SJEB 5CGMA 1N7ML 2J88H 3D2UB 3NCFB 4LLWA 3L3IA 4I18A 4LARH 4D9RE 1FZJB 5ID1A 2Q86A 2YWZA 3L3JA 2OI9A 2JF1A 1ZAGA 3MODL 4PPTA 3TC9A 5J9PB 1V3JA 3L3GA 4WFHE 3ARBD 4MNGE 4HIIA 4R4FH 3QUMA 2HT3D 1C1EL 5AYUH 2BSTB 4DN4L 1MQKL 3HE7B 4Y5XB 5GGUA 1MRFH 5EU7E 1XIWB 4MJID 3AROA 4GAJH 4MD5B 4G6MH 3VI4E 3ROOA 4L8DB 2E7BA 5FHBH 4NIKB 5MEOB 2FJHA 1D6VH 1FLRL 5DRXB 2HRPL 3EKCA 4JANA 5JW4M 3PV6A 1DR9A 4P9MH 2BJMH 2E9BA 3CVHL 1AH1A 4XC3H 2H8PB 1II4E 4OFPA 2DTSA 5GJTL 1LO4H 5FHAL 5HI4C 1GOFA 3KPLB 2WMPA 3VFRA 1R5IB 4K7PH 4LLQB 1A3RL 4P5TA 4OCYL 1KTDB 2ENYA 2BXZA 1MNUH 4OCRL 5I73B 3TPUB 5D4QA 3K8MA 3TA3B 5KVGL 3N9GL 4I4WA 5DWUL 2KQNA 4ODVL 4QTHB 4L8SA 5E5MB 3IKCA 1IGYA 4GKSA 4Z7NF 1I7ZB 2X9WA 3O8XA 1NCWH 4RGMC 1J9CT 1ZVSA 2LU4A 1DBAL 5D7JC 3QXUA 2AABH 3L3DB 1Z9OA 4NQCE 1YQVL 1J05B 3MXVL 4X98B 5BS0E 4QRTA 5FDWA 2FBOJ 1OPGH 3TCLA 4F2MA 4TSCL 4JY4B 4KROC 4CAGA 2BVUA 4OIIH 3HUJA 4PRDB 4LCYA 5IF0A 4R0LB 3MLSL 4CU6A 1AQKL 4K3EH 5BO1H 1U2HA 4JRXE 1HHKA 4LPXA 2NCMA 3QDGE 4PUBL 4QRUB 4XP6L 4QT5B 2IPUK 4PJ9D 4LHQB 1AGEB 3X14A 3OKOB 4PJHA 4WWID 3O41A 3KJ4C 2VZSA 4OD3L 4KQ3L 3LQZA 5DTFB 4Z7WF 5T1LA 3NN8B 4U1KB 4OAWA 1MCCA 4P46A 1VDGA 1NFDB 4JPKL 5D2NE 5C0EB 4ZOAA 4GXUM 4OUUB 1MCQA 3LQAL 2L7JA 2F5BL 5D7LE 2ICWJ 4JN1H 1N4XL 3V6ZB 5JMRA 4HWZB 4PRPE 2XFXB 2ZUQB 4HIHA 4MWFB 1C5CH 1EFXD 3SDCB 4X0KA 5HD8D 3ULUE 1MLBA 5DRZA 3VW3L 2OSLA 3BH9B 5JA9A 4JFQA 4OCLC 1ONQB 5JUEL 4PREA 4U0RB 5F70A 3UTPE 1RURL 5DK3A 4L3CA 2V2TA 3U2SB 4G80A 1WBZA 5DD0L 3SO3B 4U6YB 5FO7A 1KN2H 1PLGL 3H9YA 1KENL 5HHXH 2XZAH 2IH3B 2BXYA 3ROLA 3OJVC 2I9LB 5BVJA 4NO0A 3VGHA 3LD8C 1T20B 3BPCA 1M4KA 1WIUA 4OM1H 4XMLL 3I6LE 3WLWC 1GC1L 1MFDH 1U3JA 3RY6C 5I76B 1ZGLA 3ZTNH 3MXWH 2FHCA 2YD6A 2JELL 3AY4A 5MHSD 4X4YB 3HZVA 5CP3H 1XT5A 3MA9L 4AT6A 3KNBA 1FGNH 1F13A 3IRZA 3IXAA 2GK0B 5HHNB 4M8QA 1JPSH 3BGMA 4AMKH 2WQ8A 3PWPD 2LE9A 4EUPA 2AJ3B 1AFVL 2NY1B 3ARFC 1VFAB 4HIXL 3BPNC 2ORBL 2D7NA 2VB5A 4NRXB 4DZBA 3OHXA 3BMWA 3GI9H 4EZMA 4FQJL 5KSAD 5C07E 1T83A 2JB6B 4F9LA 5ACLA 2R69L 1B4JL 4L4TE 4DWHA 1BX2B 4HS3B 1KGCD 4YPJA 5HHMD 3S7GA 4P2RB 3AU1B 2AW2A 1U8NA 1JN6A 4PB0L 5IVXB 4JFDA 1A6AB 5C8JB 1UKQA 1SY6A 3RWJA 4RGOH 1XZ0B 3LPWA 3P0GB 4H0GA 4WU7B 1OCWL 3NTCL 4M6ML 3QP3A 1A7NH 1K5NB 1K4DA 3QDJB 2E7LC 1CGYA 3L6FA 2VZTA 3ALXA 5F9WB 3THMH 1EAPA 4WUUD 5JXEC 4ERSH 3GHBL 2NY0D 2RBLA 5T3ZD 2XKNB 3G6JA 3LKRA 4LDEB 5C0JA 2EDTA 4BQCA 1AHWA 3T0WA 5GGSY 5D72H 4EOWH 1REIA 3UYRH 2WBKA 4PLOB 5EIVA 5L8KB 4X6FA 2QQNH 5CEXB 4QRQA 3U0PB 5FECB 1IC4L 4F7CA 1A3QA 4Y5VA 1NGPH 4H5SA 1KTKE 1JGLL 3BT2H 1GGCL 1S7TB 5DRNB 4KDTC 4MQSB 1OSZB 3SE9H 2H2SD 3HR5A 1IGML 1BJ8A 2X4PB 3HC3H 5FA4A 1FO0B 2NR6C 4OCWL 3GSOA 5C09A 1CFBA 5CJXC 5KSBB 5C9KA 5TPWL 5J7CC 3C9NA 3QWRA 3QEQB 5JXAL 5GGTA 4YHIA 1NDGB 4PJXF 1KTRL 1N59B 2IFFH 4I1NB 4PJIE 4ODHH 5C71A 4HF5L 1V3MA 3G6AA 2H2PC 3I02B 4OF6A 4HK3J 2UWEA 1LVEA 5EZLA 5E94B 4Y4KA 4ODXA 3TZVC 5FGBC 3ARPA 4QRPD 5CS7A 2X42A 1MY5A 5DMYA 2I9TB 2AP2A 1NEZA 1TZIB 1ITBB 1M05A 5E6ZA 3FQWA 2UZIL 3GDBA 3MV8B 4XNUH 3C8DA 4CVZB 3OKMA 1ADQH 1FZMA 3NFSH 5DHYA 4ACPA 5IVZA 4FHBD 1VGEH 1MQ8A 3FQNB 5KG9B 3GSRA 3A67H 3RGVA 4NOFA 4KK9D 5J89A 3O11B 2OQJB 2W0FB 4M43H 4NWUH 2EZ0D 1ACZA 3CX5J 3QA3B 1FBIH 4HW6A 4CVWA 5JLZB 3O45B 5BZDB 4ALAH 2Y7QB 1K2DB 4G6KL 4GBXA 3RDTB 1Z6JT 5F72S 5D6DC 2IAND 3GMNB 3TYFA 3D0LA 3TN0D 2NNAB 2PYEE 4KK5C 4L1DA 2QR0A 3KYNA 5BJTA 4GMSH 4N0UA 1IAIM 4D9RD 1G7HB 4PJ8B 1VADB 3QNXA 1J1PL 3V7AG 4WFHD 2A0LD 1T6VN 4JDZB 1WVZA 2DMBA 4XWOC 3TFKD 3HMXL 3VFMB 5SWSA 3FOMB 3MJ7A 1S7XA 3KXFA 2J8UE 4ZYKB 4XPHL 4K23L 5LBSH 2NY4D 3RHWF 1CE1L 2R8SH 3VXNB 5FYLH 2O61A 2YUZA 1KB5A 4OLUH 4HLZH 4ONHA 3DROB 4RWHA 4I3SL 3GRWA 1IBGH 4QHKI 4NSKA 1SYSA 1T22B 1KF9B 4FQLH 3MUHL 2P8MB 4JG1H 3QI9B 4PTTB 4R3SA 4AIZA 1SMAA 1JWUA 4YWGL 4NOBA 4HHAB 1E4JA 1UH2A 3MLVL 1UWGH 3FB7B 4ZNEA 5I1IH 2MSPA 3R4DA 5IHLB 3S3SA 4OZHB 4I2XA 1YNKL 3P40A 4OFVA 3OGCB 4NKIL 5D7SL 3QXDB 1AC0A 3ARDC 3PHQB 2EECA 3CFEA 5B21A 1GOGA 2BDNL 3C5JB 1J0IA 4NQCD 2DKUA 4QF1A 2AQ1A 4HX1B 2HAZA 3WNPA 1MHHA 4UNUA 5BS0D 1QRNA 1JPGB 4HUWA 2UZXB 4G8FB 2P5EA 1EEUA 4L3EA 2A38A 3D85B 3ZKNC 2NY7L 3MA7A 1G9ML 1LO2H 1D5XA 3WFBL 2ESVA 4Q58C 4DJMA 4ODUA 4EDWH 3LMJH 3RTQA 4JRXD 1S9VB 4WV1A 4RMQA 4PJHF 2D7TH 2VZ3A 4PGJA 3BQUD 3QDGD 3WFCH 3NCJH 4P57A 2ZUTA 4L9LB 3RIAF 4JKPH 2ZPKH 4PJAB 2CLVB 4ZFOL 5I66A 4GG6E 3ARBA 2HKFL 2ZCHL 5E8NA 5DJXB 2DDQL 4WW2C 4NZTL 5TE6L 1FGVL 3LRGA 4U7MA 1KJMA 1CTOA 4XTRC 5CILL 3UZEA 3SQOL 5IB4B 4MJIA 1NLBH 2MKLC 3IDMB 5H37G 4LSSH 1H3WM 2CDFB 2ZKHL 3LVEA 3GMMA 2LFGA 3MFFA 5DJYA 3LSOA 4EXKA 1R5WB 4TQEH 5IT2H 5D7LD 2OR9H 3O6LL 5DXWA 3MPCA 4PRPD 1B0RB 1LNUB 3DI3B 1MFBL 3AS2A 3OZ9L 4NJ9H 4TSAL 4YC2B 3MOQA 5CBEA 4F7TB 1IFHH 3ULUD 3M1BB 4C57C 5IR1B 1NGQL 2BZDA 3QAZB 2EIZA 4ORGB 1NANI 4L29B 3M45A 2BOCB 3IDYC 4PGEA 3UTPD 5CBAA 3VDBA 4PG9A 1JUFA 4LEOB 3TJEH 4I18B 4UDUA 5CGTA 5EN2B 2IGFH 5C0AB 3RBSA 5CD3B 1EMTL 5L9DL 1BZ9B 3UTTB 2P5WE 1X4YA 5C0DA 4BH7B 1YEIH 2JJWA 2X9YA 1T3FB 3NPSB 43C9B 3BRDA 3V52H 3HLAA 1V3KA 2EYTA 4OV5A 1U92B 5CZKA 3ROOB 3REWA 1OM3H 3D0VB 2BNQB 3HMWH 5HPMB 5GSRB 3I6LD 1R3JB 1Q9OA 2X9XA 4HV8A 1NAKL 5EBWB 2VR9A 1Y18A 3LKNB 1CU4H 4DUWA 4PJ9A 3GSNA 2X4NA 3AS3A 3GBLA 4HJJL 4HUXA 4OCNC 1LILA 4W70A 1A6WH 4MA8H 4Y4FB 4YX2H 1RHFA 1BVLA 2EEBA 2R29L 4IS6A 4P5TB 5DC9B 4N9GA 3R8BB 4IRJB 2QSCH 4R26L 2H6PA 5C07D 1UADC 3OG6B 4JKWA 2VDML 3DHJA 4L4TD 1FG2B 3OKEA 4AEFA 4IMKC 5DUPH 1JMZA 5EA0L 1LK2B 4DQOH 2NZIA 4QXUL 5GGVH 5BMFH 1EFXA 4PP1C 1VFOA 1MJ7H 1MY7A 3BSZL 4F2MB 1CD1B 3NFNA 4GAGL 4HFUH 5D5MA 4L3AA 2DQHL 1AD0B 4P2OC 2UYLA 3HUJB 3EZ8A 2P4AB 1A1NB 1UM4H 1HHKB 3E8UH 5BXFA 1CFVH 4PJCB 4E5XA 4Z18A 1W0WB 3G6JF 4E0RB 4HULB 1LE9A 4UNVA 2ICEB 3BDXA 3BN9D 4UU9B 5DZNA 4NNPH 2ZUSA 5SWZA 1QACA 2D31B 3O41B 3EJZD 3ZE2F 3GIZH 1IAII 1YJDC 5ITBL 1UVQA 3DX8B 4QYOB 2Q7YB 4U0QB 1ODAA 4RIRB 4HIJB 4I48B 4KH2A 3Q6FA 2GAZB 3LKSA 5IUSA 5IFHL 1AE6L 2VKWA 1HH9B 1X6LA 3P0YL 4XC1L 1DEDA 4P3CL 4XCCH 4JZJA 3PXHA 4NT6A 4N8VG 1U8QB 3MCLL 4Y8AA 5L2KE 2R2BA 4M1CC 4ZOEA 1TVHA 3SDXE 3F62A 1FO0L 1P4IL 4Z0BL 4NO5A 4LLYB 3CX5K 1A6TA 2Q20A 3PWPA 5DRZB 3STBA 3QUXB 3FCTA 4JFEB 3ZT7A 4K94L 5HDLA 4KJQD 5ERWA 4QRSB 4DGYH 2CDEA 4PREB 5CD5D 5KSAA 1AGDB 1ZSDB 1JZ4A 2UWEF 4ZOCA 5IVNA 4G80B 4RFNC 2R0KL 1HEZB 4WTZA 1T5XA 4JQVC 4Y4HD 3ZTJG 5TH2A 2W9EL 2E6QA 5HHMA 1FN4A 3IJSB 4AEIH 2DWEB 5FO8A 1J1OH 3VFSA 3PWLA 3TVMD 1PX4A 1FV1B 2OZ4L 1PKQE 4KMTH 1OQOA 5LGKA 2VISB 5FKAA 4Y2DD 3V7MA 1RZJC 4W4NA 5CIPA 4DTGH 4WNQB 5FM4A 1F3JB 1G9EA 4F37F 5BVJB 1F6LL 5FK9A 4RFOH 1HCVA 2ATPA 1X5FA 3QB7C 1NCUA 4L8BA 3GJEA 1K8DA 5F7YC 3BH8A 4HC1L 2Q6WA 4BUGA 3OMZA 4WUUA 5K93A 5GS2D 1S7SA 1LO0L 2BNUA 4CN6A 4M8QB 1RULL 1DQDL 5DHVH 3HPJB 2ARJB 3HNVH 5JR1H 2PYED 3SGEI 3DSFL 3WIFB 5K33A 4ZSOE 3N50A 2X4TB 3MJ9A 1Z5LB 4ZXBD 5C08E 4MQ7B 1EPFA 2VSCA 3TO4C 4XH2A 3CLEH 3MLXL 4LRNL 4QRRE 4ZUUA 5LGHL 3CLFL 4K8RH 1KIRA 4MAYC 5F96L 4J3SA 3QYCA 4EI5D 4UT6L 4N8CH 4KVNL 4OFYD 4LEXL 1U8NB 3Q5TA 1DEEA 4JFDB 1GVIA 1SEQH 1I7TB 3O3BB 5IB3B 5DGRA 4OZFB 4OCSH 4X6CE 1DN2A 1PBYA 1QOKA 2J8HA 5DJCA 2ICES 4ETQB 4XP4H 4BK5A 4OIBA 3U30C 2P5WB 4JRWA 5I1LB 4POZC 1P9MA 3PGFL 4DCQB 3WD5L 1S9KC 1P7KB 5A2FA 1G9NC 1I3RB 2E7HA 5A43C 3LKRB 4GAFB 4B7LA 1A2YB 1KXVC 1IKFL 1OAKH 1OY3B 4QRPA 3UC0L 1KJVA 5GGRY 1QSVA 3IU3A 1A9EA 3ZYJA 1P6AB 3KJ6L 4HWBA 1JHTB 4OKDA 4PRBB 3G5YB 1JI2A 1DVFB 4QRQB 3JV0A 3G5XA 3RVXC 3I6GA 1DUZA 3SDAB 3UJTH 3DETC 4KK8D 1CR9H 3EDEA 4YE4L 2ZUWA 4UUJB 3VXRA 1CLOH 2ERJC 4NM4H 2P46B 4S1QL 4D9LH 1I1AD 4LSQH 2VDOL 3BP7A 4G43B 4H26A 5FYJU 2WUBH 3O2DH 2ICCA 5BV7H 2E5EA 2IANA 2VE6A 4DGVH 4LSTH 4YR6A 3TN0A 3TP4A 3MYZA 5IBUB 4L4VE 3IDUA 3HI5H 2E9WA 5H2BB 1C5DB 3L5JA 2EIBA 1ED3A 1NMCC 1MLCA 3Q0HA 1OB1A 4HT1H 5INDB 3VE0B 5FOBA 2PO6C 4MNGA 1NANH 3TFKA 2BMKB 2LU7A 3S97C 3RWCA 4LIQE 5FF6B 1CS6A 5D1ZB 3FN3A 5F1IB 2A6JB 4JJHA 4U33A 4JPIB 2XXCB 2DWDA 4J2XA 4D3CL 1MEXH 3BUTA 5HHVH 3PDDA 3RWDB 5HVFB 3UPAA 3PGCB 4GS7C 2IQAB 1OTUD 3V4UL 4DN4H 1E6OH 5KVEL 3BO8A 1F4YL 3EIFA 5DR5L 2L0DA 3BWAA 1FE8L 1N2RA 4V2CB 1LO5A 3NCEB 5DO2C 3WN5A 1F11A 2WNGA 4RFEB 2XN9B 4M5ZH 4NKQB 4QCIB 2EDBA 5C0FB 5A16A 2WK2A 4KV5F 2IQ9L 1EA9C 1A1MA 1L9NA 5E6IB 5GQBA 2P5WD 2IEPA 3SCMA 2DYPD 5AWNL 4KTDH 3GSQB 4NQCA 3I84A 5L2KB 4RMRA 1FFOA 3FRUA 4LP5A 3G08A 8FABB 1FFPB 5BS0A 3EDKA 3B43A 3IFPA 5EZIH 5JMOC 2IMMA 4U1LA 4GKZA 1JFQL 4ODVH 5F7DA 4LDOB 3WNLA 5GS1B 2HFEB 2N7AA 1DBAH 3L3HA 3L95B 1B0GA 3BQUA 1AP2A 3QDGA 2CXKA 5IMOA 1U8JA 4O9HL 5J13B 1T04B 4XMPL 3SDAD 2E6PA 1YQVH 1K85A 4CVUA 2VQ1A 2XNAB 3OAZK 4LCCC 1JHLL 3TLRA 1CICB 1QVOA 2AEIT 4U1IA 2ENSA 5F1SA 2R39A 3MSPA 4I2XB 5D2NA 5AYQA 4M6OL 4XP6H 1H3PH 5I1HH 3GNMH 3T0XA 1NUDA 5D7LA 1KJ2A 5JDSB 4NKMA 5D5MF 1IAIH 4HMCA 1MVUA 4PRPA 2C3HA 2G5BA 4H88H 3ZKQD 2N56A 2YK1L 4NO2B 4JHBA 2VERN 3ORJA 4CGTA 2H9GA 2VZUA 5CMAA 1KXTB 4AL8L 2EIEA 4WFEE 3GIVB 5F6IC 3QIWB 4KJYB 4LVOB 3MLUL 1TFHA 3IETA 1S3KH 4KMLB 3QIUC 2BSRB 1BIIB 4JPKH 4F33A 4GMTH 3O2VH 1JGEB 2HFGH 4A6YB 1E4XL 3PWJB 2OJZL 4UDTA 1T1XA 5KN5A 5HVGB 4M62H 3RL2A 3OL2A 5GZND 1U95B 4P57B 2W92A 3V4VL 3EHBC 5DJ2B 4JLRB 1VCAA 3RJQB 1CG9A 3H9ZA 3QUKB 5E1AB 3NGBB 5GRXG 2EE3A 1F3RB 1OAXL 3OR7A 3FT2A 4FQPA 3OJ2C 5T33L 4X7DC 3MRCB 2WWKT 2YPLB 3DNKA 3BHBB 3K0WA 3FQTA 1CVSC 4ETYA 3GSVA 5I1JH 1EXUB 3F7PC 4JY6A 3HE6A 4X6CB 1KB9J 1TVBA 3UYPA 4FFVD 5TFSL 4FNLL 2NMSA 1SEBB 1D9KB 2DB8A 3JWDL 3QDAA 2COQA 4OGZA 1FRGH 1HI6B 4BQ8A 2WBJD 3LRSA 4V2BA 4XVJL 1KENH 2H32H 2FSEA 3QFJB 1CD8A 3VRIA 2GSIA 5D70L 5DF0A 3QH3B 2KZ1B 4YUEL 1JP5A 1RZ8B 3WIHA 1BD2E 4WO4C 1KLGA 4XMLH 4LCWB 5ILTH 1S7WA 4HZLB 1FORH 3ECBA 1F97A 1T5WB 4NBZB 4PG9B 5CJQH 5JW3L 2JELH 1SM3L 4ZPTA 5C07A 25C8H 4YHYB 4UDUB 1K4CB 4HXAL 3BGFC 3IDGB 3SGEH 3DURA 2AXJA 3E6FB 4Y0GA 5HHPA 1AFVH 4G7VH 2R23B 3KPOA 3S4SA 3VWJC 1Z9SA 5HDBF 5C7XH 4TTGA 3REWB 1OP9A 1UJ3A 2NY2C 1IQDA 3ZE1F 4X6DA 1Q9OB 5B4MD 2PXYB 3K8KA 1Y6KR 3MOAL 1FZKA 2IBBA 4O2FA 4IMLB 1WISA 4MA7H 4AENB 3M17A 1A14L 4J3OC 3OKLA 4HUXB 4X5XA 4I5BA 1I3GL 3KPTA 3RPIA 2P7TA 3S36L 1DLHA 2LVEA 1GH7A 3V5HB 2GW5A 4NGHH 2MCPL 5EDXA 2FD6L 3U6RB 4WI8A 1F4WH 4OBSA 3OGOE 4H20L 5L0QB 1T1YA 3DRTB 4KRNA 1HSAB 4Q9BA 1ZLWK 4DZ8B 2HWZL 5C08D 1DDHB 1BFTA 1QBAA 4LHUA 4YDIL 4QRRD 4OZIB 3DV4B 1WIPA 4G6AC 4GRWB 5IB2A 1I8MA 1Q0YL 1NBYB 3P4OA 3VRJB 4S0UC 3VXUE 4ZFZA 4PG2A 2C3XA 5DD5L 4JGJA 3FQXB 4DEPB 4DKFH 1PD6A 3K74B 1V7NL 1SY6L 4ONGL 5DD1H 5DEGA 4Y19E 5CEZE 3CIQA 1H8SA 4MZ3A 2J6EH 4BKLB 3ZYZA 1ERNA 4XZUA 4K8RC 4MS8D 4FQIH 4GRLC 4PJEB 4E5XB 2YD3A 1BZQK 5CSZA 3LEYH 1H0DB 3O4LE 2IAMB 4PJIA 1HILA 2Y6SC 4Y4HA 1AY1L 5T5FH 5SWZB 3MRJB 3RJDA 4K55A 2YSSA 3HPLB 1YPZE 4MX7A 3TVMA 3MRFA 1YDPA 1BF8A 5TPWH 1BJ1H 2FGWH 3ZDZE 1DQLL 4QXTA 3TNNB 1ZHBA 3VXQA 4YJZL 2R4RL 3W0WE 3Q6FB 5CGYC 5ACZA 2RB8A 3H9HB 1A64A 3TO2A 2FIKA 3VXOB 2P49B 1RZGA 4JZJB 1M6OB 5HI3C 4JHZA 4M48L 4N0CC 1P7QA 3H9SE 4PB9L 1NGWA 4P9HH 1ETZA 4XPFL 1PX3A 3WDJA 2ICWA 3ZKMD 4R7DA 4EDXA 1RHHB 2I26N 4NO5B 3VFPB 2C4FU 3P73A 4OQTH 4BZ2L 2PYEA 1T66C 4MYWB 4JKKA 3KPNA 4L4VD 2YEZB 1O7SA 1MHCA 4MJ5B 4ZXBA 3K1KC 3ARGC 2CIIA 1OTTC 3H8NA 1KG0A 4UTAH 4PJ7E 1T5XB 2E7LE 3U7WH 3VI4F 5H37H 2X4QA 4XNYH 1QR1A 2OX5A 4OFYA 2RCSL 1WF5A 4L5FL 3UYOD 5I8EA 1QRKA 2BCKB 1BPVA 1BOYA 3S37H 3UBXG 4JVWA 1RJZA 4MCYA 2XG4A 3HZMA 4EUPG 2QSQA 4ZO6A 2R9HD 5E1HB 1TCRA 4L8BB 2UUDH 3L1OH 3FN0L 3CU7A 3RWHA 1FPTH 4XPBL 4RRPG 3QJHA 2F74A 4OIAA 3IF1A 4U4BA 3MBED 3WUWB 3VA6A 3EYVA 2HTLC 4ZG1A 4XHQA 2BNUB 2VUOA 3SKJL 5EUOB 1U8OB 5BQ7B 4JAMB 3BKCH 2X1QA 5T3XH 1CBVL 4PLKC 1ZT4A 1I8IB 4B50A 4GAYB 4PJ5E 4U7KA 3GM8A 3RVVD 2P24B 4GW5B 5EBMA 4K3GA 1AR1D 5IOPA 3B2VH 4X80H 4ZOBA 4S1DC 2XV6B 3BEVA 4K3DH 1I1AA 2D7QA 1G1CA 4JM2B 2R1YB 1DLFH 4N5UA 1YNKH 2B1AH 3UROR 5ID0B 4P4RA 2VLJB 2VYRE 3QWQB 1BM3L 4MNQA 4Z7VE 1YUHA 3GRWL 5ETUB 5F7MC 2ATKA 4Y2OA 2CIKB 5MEQA 5TDNA 1AXSA 3OG4B 1LD9B 1BBJB 5LCVL 5HYFA 2X10A 4AEHL 1EEYA 2EDLA 4GG6A 4WI7A 4ODTL 1RZIB 4I77L 4M7KL 5GSVB 1YA5A 3KJ4B 2ZNXA 1FNEB 4FQCL 4CW1A 3MCKA 2NYYD 3PL6B 1JBJA 2X4SB 3TH4T 2VRAA 2VQUA 3S36X 1KB9K 3QPQC 1A7OH 2NTSP 2YPVL 4TRPH 4DK6A 3ULUF 2DD8H 4G5ZH 3CFBB 3TBVA 4EQ3A 3QDMA 4X9GA 1OP3K 4LFHG 3GMRB 2RFXB 2R0ZL 1FGVH 3WEXB 4UNTA 4WFED 4XCYB 3SQOH 4U3CA 5FCUL 1ZGLM 3FAXA 4PV8A 3UJIL 4ZFFB 5C6WH 5TDOA 4A6YL 1LEGA 5CZXC 5MEPB 2HMIC 1NEZG 2WW8A 4LVEA 4P5MB 5C0BE 4BFIA 4CN1A 1S8DB 1OB1B 1X9QA 2DYPA 4TSAH 5FOBB 3LKOB 5GRUH 1MJUH 4WHTB 5DI8A 1J1XH 2OLDA 4AM0A 1X5HA 4OI9A 3FO0L 3LQAC 3O6FB 1QSZA 1FVEB 1T0MA 2WAHA 1P2CA 4U3XA 5EC2A 1BQLL 4OCXH 3OB0K 3LD8B 3ULSB 2Y1VA 5CEYB 4C55A 3A6CL 2FO4B 4RQQA 5L9DH 3D39B 5IGXL 5I8CB 4X83A 1AIFB 3I6KA 2Y5EA 4Z5RB 3MRDB 5D7JD 3EBAA 2HLFD 3QXAB 5EO0A 3U36B 5ELIA 1R3IL 3IFNL 4LU5L 3LS5H 4D9QE 2FZ3B 1T89A 4PGDA 3AMLA 5EU6B 1JGDA 1INDL 1INEH 2Z35B 1ADQA 4YFLF 1BD2D 4OBRA 3WN5B 4KROD 3BJLA 4TUKL 1T4KA 1TJGL 2G5RA 3W0WB 1OTSC 1FJ1B 3ZTJH 2Z92B 1ZS8B 3BPNB 4JPWH 3MR9B 1BMGA 3HI1B 4OLEA 1GGIH 5CLTA 1WZMA 3Q1SH 4Z7OE 2ZCLH 4NRYB 4HKZA 4N90E 3SCMB 3PHOB 3QFDA 4I0KA 1LDPL 3CSYA 4YLQT 1FFNB 1PSKL 4XNMA 3W39A 3G08B 1WZ1L 4XWGH 1GC1C 4MDIB 5D93B 2BNRB 2G60L 4X6DF 2GEEA 4JO1H 1ZT7B 2Y9RT 2QADD 3DO3A 4YO0A 5LWYL 4O58H 1ZA3A 4G8IB 1U58A 2HH0H 3PWVB 3L3HB 4TPRH 1NBZA 4KRPC 4NWTH 5DK2A 2NLJA 4MHHI 5EG6C 2YA2A 1X5IA 3GSNL 3UO1L 5EA0H 5I9QB 2IG2L 1IQWH 4KAQL 3S6CA 1F4XH 3UCRA 5JHDE 3BEWB 2DQDL 1DFBL 4TNWK 1JNJA 1TQCB 4BFGA 3IXTA 3MV01 4U1IB 3MJGX 4C54A 1Z0MA 3VFGL 3JTTA 5EC1B 5C70A 5HGHB 4PGZA 1PZ5B 4PJBA 1AKJB 2YKLL 4OLYL 1KJ2B 4MVBA 4JDVA 2WBJA 1X5LA 2J4WH 4ZODA 3ABZA 5IG7B 2C1PA 3SDXA 2VWEE 2AKRA 4U2ZA 5CMAB 2X4RB 3VXUD 2BVQB 4QWWC 2JJVA 1HOCA 2SEBA 1WZKA 1I9EA 4RAHA 5ADOH 5EOCH 4GW4A 3MGTB 1GPOL 1EAJA 1OF2A 4MMZC 4G6FD 4Y19D 5CEZD 4PJIF 5D2LE 3Q2CA 4LNRB 4ODWB 4W81A 3ES6B 4O2EA 3CVIL 3KR3L 1P4LB 2EDFA 4N8PA 3WLWD 1NC4B 3O4LD 3VWKC 3BZFB 3E1F1 4NQSB 3U46A 3QXTA 4M7JL 3T2QA 2NY3B 3ZO0A 5DD3H 1P4IH 5EUKB 3TEUA 4WRLA 2VDQH 1PKQA 3EYUL 3FQRA 5FV1L 3VG0L 3UJJL 5HVWA 3MREA 2EKSB 2ADFL 2YRLA 3RKDC 1RJYB 3TZVB 4LCUA 4Q0XL 3GSVB 5ABDE 3Q6GL 4JY6B 3HE6B 1J86A 5IEKB 3ARFD 1E4KA 1TVBB 3SE3C 4OM0L 1FL6A 1MPAH 1CDBA 5SV4A 1S7UB 4Q9QH 3B9AA 3UPRB 3AVEA 4R4BB 4TTDC 1CFNA 3H9SD 1T03L 3S34L 4NN6C 4CVXB 2QV2A 3Q3GB 1A7BA 2A6KB 2BOBA 3RWEB 3AUVA 1XCQA 2FECL 1EVTC 4JM4H 1KBGL 2UZYB 1HDMA 3O2WL 4YDVB 4P4KC 3OJDA 4ZSOA 4R8WH 4Z8FL 1S7WB 3BKML 1R0AH 3SY0A 3QQ4A 5C08A 4NUGL 2J8UF 1WBXA 2HLAA 3IDNA 2Q8BH 4QRRA 1G7LB 2QQKL 3E2HB 3MUGA 3EUUA 2QKIB 2V17L 2D3VA 1UZ8A 1NCTA 4UAOC 2FJFB 5I2IB 4XNZC 1TZHA 2ZSVA 1OGTA 4R2GC 4NBYB 5IQ9B 3S4SB 3WHXA 1LK3L 1TDQA 5D1XD 4RDQG 3RWIB 4OGXH 2Y4SA 5FYJL 4MS8A 2GUOA 1Z2KA 3MLXH 1YY8A 3DX9A 3IGAA 2AQ2A 3EOBB 4WCYL 2BFVL 4KTEL 4HKBA 3X3FH 4UT6H 5E7BA 3FQUA 4I5BB 3HAEA 1U8LA 4NQXA 4ZQKB 3T04D 1BWMA 3RKPA 3JTCA 1Y6NR 2NR6D 2OTUA 2FDBP 3FFCA 2MQ3A 1NJ9B 2DM7A 3FT3B 1OGAE 1I9IL 1NCDH 3QRGH 4PY8I 4EVNB 3HE7C 2P45B 4PJ5D 4Y5XC 5KOMC 5INCB 3ULVL 1ZXQA 3CSGA 1LP9B 1YEHL 2MQCA 3ARDB 4LHUB 3CFJA 3PP3K 5IM7B 1ZVHA 4YQXL 3VGAB 4KQ4H 3SDDC 1U8HA 5CSBA 4JQIL 3UC0H 3G6DL 2H2PD 2MKWA 5C0ND 2Z4QB 4BSWA 1IT9L 1ZTXH 5JORB 4LP4A 4JY5H 4IM8A 2YS4A 1Y0LA 1I9JH 2EYRB 2QHRL 4L4VA 3HS0B 2NXYB 4GG6F 4I0PA 5CINH 4P3DB 4LSUH 3WO4B 2IBGA 4P2QB 1GGBL 4R97B 1L7TL 1CDGA 5JHLL 2FCBA 5AZEH 5ICXA 1U3HC 4HD9A 1T1ZB 4XXCC 3FJTA 3SJVE 3BUYB 1LE5A 4OZGB 1YDPB 2VDRL 1L8JA 4LHJB 5E8DL 2PW1A 4U1SA 3WFZA 4NKDA 4HWBL 2AGJH 1QFUH 1VHPA 1FYTB 3C6LA 3QNYA 1NC2B 4KK5D 4FQ1L 4PRHE 4XBEH 3TO2B 2X6MA 1G9MC 4YFEA 5DUMH 4YGVA 2WINA 3KLDA 5KAQF 5ESAB 4WHDA 5IFAL 3SEPA 1JV5A 3CDGB 1U0QA 3MBEA 4UIKL 4WTZG 3B8SA 2CJUL 2O5YH 1UEMA 4XWOD 3I75B 5FXCH 1JNHB 3SKOB 3GBNH 2VITA 3HR6A 3BD4A 4KPHH 5C0BD 4YBLC 5EZOH 4JDTL 1MHCB 5HTSA 4PRIB 3V4UH 4JKLA 3MROA 4OT1L 5KVEH 5E5RB 5GPRA 1VACB 1ZV5A 3LN5A 2X7LA 4M9PA 1YMHB 1A9BB 1KLUA 3MNZA 3PWUA 1AGFB 2VLRA 3IB4A 1U6AL 3L9RB 3GJFH 4MA1C 4E42A 1NCAH 5ALCL 3B4NA 2ZUQC 1A7RL 4UTBL 3HZMB 3SDCC 4HCRA 1HINH 4ISVB 4BFEA 3C8KB 1QSEE 4H1LA 4LSDA 4IHOB 4OJFL 4HJGA 2EDNA 3KPPB 4QOKB 3QUMH 1G7IA 1AR2A 3AFLA 4JFXA 4U0RC 4QHLA 2IPKB 4D9QD 1VESA 4RZCA 1ORSB 5JPNB 1TMCA 4WTWA 4O02H 5DMKA 1I8KA 1PW3A 4XNXH 5EPMA 2J2ZA 1UQSA 3ZKND 1XEDA 4LLDA 4OFDA 1X5KA 2DLEA 4U1JA 3NPZB 3UMTA 1ZT4B 2EYSA 3NCYS 5IQ7H 3VFOA 2R15A 3H3PH 2XWJA 4U6XB 4XBGA 4N90D 3FTGA 4J6RL 1A4KB 1IC7L 4Y89A 4QHNA 4LCIH 1UM5L 2GJJA 2VXQL 1E27A 4TULL 5KSVB 2P8LB 3FFDA 5CFHA 1LQVA 3CXDH 4OTXH 4XTRD 2PTTA 4P2OB 1UCBL 1EHLL 4CNIB 3P0VL 2HVJA 4LAQH 4MNQB 4KKAC 1ZHLA 3QEGL 4I0CC 1AO7B 1TVDA 3MX0A 3F5WB 5TDNB 4WEBH 1KPVB 4H0IA 4NZRH 2Y36L 2NY1C 2YK1H 3KYAA 2Z93A 3EAKA 1T7YA 4WY7H 4D0DB 3G5ZA 2XYCA 3NFPB 4HK0A 4M1GL 5JHDD 4Y1AE 3OXRB 1I1YA 1M7XA 2Z0BA 4LKXB 3QUYC 4PJBF 4FQQA 1HH6A 2NZ9D 4HFWA 2Y25A 1Q8MA 4HIEB 3SDXF 3QIBA 3E6HB 1J5OL 1GIGL 1KJ2L 2JCCB 3C60D 1N5YL 4YIQA 4OD2A 5I8OH 5CJ5A 5D7JA 3RA7L 2DAVA 2CGRL 2FB4H 3JV6B 1VFBB 3CFKA 2VLMD 4KVCH 3EFFA 4ZUWB 2IPUG 3HC0A 4LOUC 1T2QL 1BD2A 4K07A 1G0DA 1OGAB 2BY2A 5I17A 4PBWD 3WXWH 5TDOB 2ED7A 4BYHA 2E7CA 4GQ9L 1I3UA 3JWDH 1QEWA 4X4XB 3WSQL 4PIRF 3REVB 4Z77A 3V8OA 1LHZA 4MQXC 3TIEB 5TQ2L 4RAVB 3MV9E 1NDMA 5T1KD 1KCLA 2A9NH 4RFNB 4FXGB 5F9OL 3VFVB 3WXVL 1YNTB 3DUUA 4IDLA 4YUEH 1QFPA 5DD6A 2BK8A 4UQ2A 2C3VA 3CGTA 3GMPB 1MAML 2AV1B 3V95A 3VI3E 5HVHB 1KCSL 2Z91B 5E2UH 1CFTA 3T1FB 2O5XL 4S10A 4RAUB 4GKNA 3BP6A 3K4ZA 5B39A 2Y23A 1IEAA 1A6ZB 1URLA 1H9VA 1QSFE 2C1OA 3MGAA 3NA9L 5DJ8A 4HXAH 3RU8H 1XGUB 2IPTH 1F3DH 3CFDB 5GHWL 1FSKC 4S1RH 1EFQA 1YEGL 1PG7L 4J8RA 4MD0B 4WWKC 5EO0B 1F58H 3VXTA 4K94C 2I60L 4V3DB 4HH8A 2DMCA 2A1WH 2I27N 5IJVB 4HLJA 4PP1D 5I8KL 3NACL 5FGCB 4P48A 2AJYL 4XI5C 5DJDA 4PJDE 5FB8A 2YXMA 1S9WB 4PRHB 5KSUB 4J7RA 5LGJB 2DQGH 3DVNB 3RP1A 1YN6B 2ZZUT 4YHPA 1UB6A 1A0QL 5DJAA 1A14H 2Q8AH 3GSUB 1MIEH 1IC5H 2NX5E 1JTOA 3ZT5A 2EH8H 4NQEE 3TO4B 1DE4A 1Z9LA 3P11H 3TJHC 4AG4H 4X8JB 3OXSB 3S88H 2OMBA 4EUPH 3UDWC 1D6EA 1JK8A 4RMTA 2J88L 3DXAE 2HN7A 4H20H 3IJHA 4LARL 4YO0B 4Y19A 1SHMA 3RWGB 3MLZH 4QO1A 5IB1B 2G9HA 4R4NC 3TF7C 3BP4B 5IFJA 5IWLC 2AXHA 4N5EC 5FO9B 4XCFH 2GKIA 3IDJA 3EFDL 3O4LA 1P53A 4R4FL 3RDTC 5AYUL 3W9EA 4M5YL 3EJYD 5E9DB 4FG6C 1MRFL 3BP5A 2GJZB 3IKKA 1H15B 2GITA 4GAJL 4G6ML 1EEQA 2F53A 3VFNA 1YPZA 5FHBL 1D6VL 4M1CD 3PP4L 4PJ8C 3GUTB 4Z95H 4P9ML 2BJML 1H5BA 4EN3C 4XC3L 4KKLC 3ARFA 1LO4L 3CMGA 5ITFB 5KS9E 2J3SA 4M4RA 4LVNB 3BYTA 1CTNA 4OB5H 3T8XB 4FA8A 5H94A 4TVPE 4U49A 1U3YA 3H9SA 1S7RA 4JO3H 3BKYL 4IEFB 1WCBB 5IIEA 1S5HA 1XGRA 3DVGA 2ERJB 3LEXB 4JRYB 3RX7A 3QI9C 3CD4A 4XGZB 1NCWL 2JJUA 4GW4B 5I74B 1I4FA 4NRZA 3V79C 3S98A 3UZQA 5F1NA 2AABL 4QXGH 4V3EB 1FCCA 3GZKA 1VPOL 1AGBB 1J8KA 5M7QA 5KTEL 2V2XA 1QA9A 4YBQD 3MUY1 1NMCB 4PJ7A 2E7LA 4XPFH 1OPGL 3U46B 2PYFA 1NCCH 1IL1A 3F12A 4OIIL 3QO1A 3SJVD 3B8YA 4K3EL 2X41A 5BO1L 4LLMA 1GZQB 2AEPH 2RHEA 4Z0XA 3T2NL 3DBXB 2EDEA 2X44D 1U91B 5D1XA 3GB7B 5GGTH 2ITCA 1OHQA 4PRHD 4MB4A 5JIKA 4NBXB 4UMGA 1G7PB 3PDOB 2CO6B 5EWIL 1PQZA 4KZDH 3NMEA 4GRMB 1D5BA 4TUOB 2RCSH 2YD8A 3SPVB 1QLEH 3B6SB 3WJLC 4MAYD 3GK8L 1XCQB 1CDIA 3KPRE 3V9FA 1AI1H 5CJXA 2FECI 4JN1L 3TV3H 4BSJA 4MGXA 4PJ5A 3K2UH 2GTZB 4K9EH 4KGJA 2H32A 1VFMA 1C5CL 1IM9B 3A6OA 1WBXB 3MRQA 3OJMB 2APXA 1B2WH 3UX9B 4F57H 3MV11 1C12A 1W72A 1E28A 3WV0A 2VH5H 4POZD 5DQ9A 3UP1A 1TZHB 2A9MH 5HYJB 2VR4A 1OGTB 1L6ZA 4IJ3C 2BY0A 5F7NC 5FGBA 2JIXB 2EKJA 4NO3B 5E00B 3VMOA 1QSED 1KN2L 1IJ9A 3MV9B 3MMEA 3DX9B 2GYSA 5B38A 2Y07H 2XZAL 2ZNWA 5SX5K 3MLYH 4D94A 3CMOH 3DETD 5GS0H 3VMPA 1YMME 5JOFA 1YN7B 1RIVH 4I18C 4NQXB 3WMSA 1RZKH 1QKZH 1G7QB 2DQFB 1KB5H 4OD1H 4OM1L 2R2EA 5BOPA 5SWQA 1MFDL 3EYFB 3VXSB 3MXWL 3FFCB 1PG7X 3GRWH 3NZ8B 4X4ME 3O3AB 1Q0XH 3P9MA 3L5WB 2VLLB 4XAWH 1CE6B 2J5LC 3MRHB 4WVRA 5DDHB 4PGCB 1XCTB 5LCVH 1NL0H 1G0XA 2ADIB 1MHEA 4RWYH 3PQYD 1JPSL 3IVKB 1HQ4B 4M7KH 3RVWD 3FL7A 1PG7W 1FNGA 2PO6D 2ZOLA 1GYAA 2HKHH 3QSKB 3ZMRA 1KNOA 4KY1H 3GI9L 4AIOA 2A83A 3JXAA 4FXKA 1KT2B 2HG5A 4Y4FC 3UTZA 1QO3A 2F5AH 5C6PB 4P5TC 5C0BA 3WS6C 2BRQA 3I2CH 4I0PB 1ZHNA 4KHXH 4JJ5B 4IRJC 1QPPA 3GMQA 2CRZA 5IHZA 3B5GA 5GGSA 2WUCH 4JZOA 3IS0X 4Y1AD 2EE6A 2I07A 1K8IB 3S5LB 3O8XC 2FATH 3ZZ1A 5BRZE 5FCUH 4RGOL 3EYOB 3WKMH 3DXAB 4OI7A 2AEQL 4IRZL 3SE4C 1A7NL 3VXME 2GY5A 1W8OA 3TBTA 4IDJL 3C6LB 4CMMB 2KPNA 1T0PB 1EK3A 3THML 1DUYA 1L6XA 1I1CA 4RMVA 2VL4A 1Q9LB 4ERSL 4U05A 1KTLA 1WFUA 1A7QH 5K9KB 2WINB 1FL5B 3ZSSA 3QJFA 4RNRA 4XRCA 3VH8B 1JV5B 3H42H 5D72L 4NDMA 2YBRA 3IDXH 3UYRL 4FZ8H 4FXLA 3T65A 2HT4C 1N5AB 4K7PX 4K71B 4TNVK 5ISZE 2QQNL 4M8VA 5DUBB 3C09C 1P1ZB 1KCGC 4WO4B 2VABA 1NGPL 1ZHKB 1RK1B 3BT2L 4GLRI 4HPYH 3SE9L 4HDIA 5E8OA 3KS0J 2EDDA 1M7IA 1MCEA 2BVOB 2W0KA 3HC3L 4MSWA 3CDCA 1JGUH 1HHIA 3MROB 1EBAA 2GJ6E 1R3IH 3B3IA 4P46C 1NPUA 5A2JH 3F7VA 4OQTA 1XF5B 3GBMH 3P9LA 4ZDHB 2CLRB 4YK4B 4WW2A 4ELKB 2B2XH 4E42B 4EIZC 4F7MA 3VWJB 2V7HB 5DURB 5ANME 3MNWA 1QSFD 2IFFL 4ODHL 5IW6A 3C87A 5IBTL 5DQDH 1LDPH 2WLYA 4C83A 2GFBA 4R90H 3QUXC 1U3ZA 3OKDA 5C0CB 4J12A 43CAB 2ADGA 4CADA 1GRWA 5JHDA 3DSNA 4DAGH 1DSFL 3FO1A 4QHLB 4YPGB 3V0VB 1ZLUK 2DQIL 2G60H 3RFZC 2MHAA 2FJGB 4ZUTA 3SGKC 5DMKB 4XNUL 5KVFH 1ADQL 3NFSL 5BOZG 3SKMA 2GCYB 1WC7B 1VGEL 1TCMA 1ZA6B 4CRPA 1Q94A 2VLKE 3A67L 3F58H 3QIUD 4W6YB 4YFDB 4P23B 2AERT 5DMGC 4M43L 4NWUL 3C60A 2XWJB 2C7UA 2YR3A 1FBIL 4BJLA 4ZO8A 3RL1A 3KLHC 2NX5D 3BW9B 3EHBD 4NQED 4ALAL 3MZTA 2X40A 3IFLH 5DHVB 4PJGA 2F58L 5BZWB 4WI3A 3DXAD 3FFDB 4F7EB 3AY4C 4GMSL 3ZSTA 2QTEA 5AUMB 4NNYA 5D2LA 3QULA 4IRSB 2PW2A 1RY7B 2DI7A 2X4UB 3H0TB 1J8HE 3BIKA 1KIQA 1LEKA 4X99A 1YPZF 3KWWB 3SBWA 1B9ZA 2AK1L 1GGUA 2B5IC 3ZDZF 5T1KA 1PZUB 3PJSA 5LBSL 3J7HA 3TT1H 4U2YA 2R8SL 3LIZL 4NC1E 5IMMB 5FYLL 4OLUL 3LQMA 2NTFA 4C56E 1IBGL 1HXYA 5ESQA 1QLRA 4FQLL 2WANA 3EO9H 3MGOA 3HRZB 3MRRA 4JG1L 4WFFE 3ILPA 2WZPD 1KEMH 3CVIH 1VA9A 5JPMB 2WV3A 5KAQG 2CKBA 2D9CA 5J11B 3RQ3A 3FB5A 1HHJB 1IAKB 2VXVH 4LGRB 4YNYA 1N8ZA 1UWGL 3BZ4A 2A73B 5GRJH 1ZE3C 2F8XC 1XGPA 1ZANH 4IMKA 1R3LB 4JFFB 3VG0H 3RUGB 5E5UB 3IJYA 5DC0A 2YD2A 1I1FB 1M7DA 2E7MA 4PJ7F 9CGTA 1EEZA 3GI8H 3T0AA 4Z7UE 2DRUA 3D5OF 2DN7A 2NY2D 4RGNC 1V8HA 1AHWC 5J6HA 3T77A 4G42A 1D5MB 4R7NA 5BV7B 1JPFA 1IE5A 1DVFC 4NQTA 4EDWL 3LMJL 5JIIA 2W9LA 2D7TL 2C5DC 4N0FA 3ZDXE 3F65A 3IFOB 3WFCL 3NCJL 3ZL4H 3FB8B 5JW5B 3DRQA 3U0TB 4EJ1C 1DQJA 1FZOA 2XWTA 4GJTB 4JKPL 4RMUA 3OAYH 4ZPVA 4UQ3B 4NUGH 5D7IE 1IEBA 2EXWC 3MCG1 5HXMA 3J8F7 5IBUG 2B7DT 2CD0A 5EU5A 2W0PA 3QCUH 2HVKA 1UXWA 3VXTB 1NLBL 3F6IA 4LSSL 4ONFH 4G6AD 4P2YA 3MRNB 4FFYH 5CIPH 3KPRD 1SBSH 4TQEL 5LVEA 5CZVH 5IT2L 4LPVA 4NYLB 2OR9L 5CKAA 5FB8B 3LRHA 1XF4A 5J6GA 4KI1A 5F3HA 4I9WE 4OSUL 5DYOA 3QEUB 3WUZA 5D1ZC 4GOSA 4NJ9L 6FABH 3D3VB 2FL5B 4F9PA 4GRLD 4YFLI 1IFHL 5CJOH 5T3ZH 4S1SH 2VAAA 1G6RA 4WU5A 1C5BH 5GRYA 1DE4B 5LAXA 2Y6SD 4G7YH 4JQVA 4Z7VF 3JTSB 3QCTH 2Q76B 3R1GH 3D18A 4S0SD 2YD1A 1UB5B 3TJEL 3RGVC 3CVHB 2NW2A 2VDKH 2XTJD 1I9IH 1T80A 5I6XC 4PTUB 1B0WA 2IGFL 1BAFH 2AJUL 4NNXA 3MJ9H 4RA0C 3EYQC 1PY4A 1XF3B 1YEHH 1NFIA 1FAIH 1YEIL 4LF3A 3ARXA 4XCEB 5HGDB 4CJ1A 2VSDA 3W9EB 1MI5A 5EULV 4JQIH 3BP5B 1YMMD 2FBJH 3EO1A 5HI3D 3VXPA 4N0CD 3MYJB 3SJVA 2AV7A 2F53B 3O3EA 3VFNB 1OM3L 1A3LH 1PYWA 3HMWL 3MV7B 5E6IC 1KPRA 3MUJA 3V6FB 4DKDC 2RIKA 1JZ8A 1OP5K 4JN2B 1CU4L 4NPYA 3BX7C 2WWMC 1SMOA 3E3QE 1ORQB 1A6WL 4MA8L 3DMMA 1OWWA 4Q2ZA 2ZSWB 4WUKH 2YC1B 2FEDC 3MRMB 4HGWB 3RZCB 4XP5H 1BFOA 1QNZH 2DL9A 3ARGD 1HZHL 2OYPA 3STLB 4EBQL 5JZ7D 2QSCL 2G2RA 1OLZA 1HWGB 2VDRH 1JTTA 4MAYA 5DEFB 2FWOB 5E8DH 4HWUA 5IBLD 1HYRC 3TCXA 1QBMH 2NW3A 1S78C 5IP4A 4FQHB 4LVHB 3WE6A 3QQ3A 5DUPL 3FZUC 2PCPA 1CICC 4WHYG 1ND0A 4DQOL 4Q6YA 3X11A 1UXSA 5GGVL 3KPMB 5BMFL 3GMLB 3QUZB 5MENB 3CCHB 1NCNA 1P84J 2PYFB 1T0NB 4CKVX 2CJUH 4TNWF 5BRZD 5DEZA 3W5MA 1YNLL 5FYKH 3C5SA 1UM4L 4P99A 3E8UL 5EH1A 3VXMD 1CFVL 1XF1A 2HTLD 1QHOA 3CPLA 5EOTA 2J1KA 1QSEA 4NNPL 4LVOC 2H3NB 3QQNA 1ZMYA 3GIZL 4KHTH 5HGAB 3ZE0E 4MA3A 4FTVE 4HKXA 3KYMA 4NZUL 4OLZH 4WV1C 5DJZA 4PV9A 5KVDH 4ELME 5E2TL 4YHNB 5I19H 3TBSB 4S1DD 5L8LB 1JNLH 2ICWI 5ALCH 3T4AA 5ISZD 1CLCA 3DUSB 4Z7OF 3NGBC 4Z6AT 4CDHA 2D7OA 4XCCL 4BH8B 4OJFH 3AAZB 3RAJH 1MJ8L 1A1OB 5ENWB 2H32B 3VFTA 4AJ0A 3HZYA 3T0BA 1A6VH 3PQYA 4WW2F 2GJ6D 5GXBB 3TPUE 4ZO7A 3FO2B 4N1CA 2PO6A 4GUPB 3MLWH 4Y5YA 1WGOA 3HAEG 4DGYL 4WIQA 3U4BH 2W60B 3NIDE 2A6IB 3C6SA 3T2PA 4HS6A 1VGKA 2FHFA 1AQDA 1MH5A 1S9YB 1YC7A 1JVKA 4PP8C 1J1OL 3CZFB 4M3KB 1KIPA 4KMTL 4ZFGL 1IGTA 4LDLB 1H3TA 4Y1AA 3WBDA 4DTGL 4TULH 3WFHA 2VAJA 2ZP0T 4RFOL 2F15A 3TGXA 1G7JA 5J1AA 1T7XA 4BM7A 3VRLE 2VLKD 1EHLH 3T0EB 1FNLA 1KN4H 4FQXD 5D7IB 4PJGF 3RWFB 1WFOA 1HHGA 4IOSD 5KANI 3NCMA 5GS3A 3MRBA 2K3TA 3DTXB 2IADA 1BECA 1MCWW 2UVFA 4U6HA 1BWWA 3RY4A 5D2LF 3HNVL 5JR1L 1RUAH 1NFDE 1EH9A 3OX8A 4LLAA 1JF1A 3ARYA 4FXKB 1KYOJ 4F3FB 5KZCB 1ZWIB 5F97E 3BPLB 3NIGE 1N3NA 1J8HD 3CLEL 1CGWA 2GT9B 5JDJA 1ULVA 2CGRH 5GRVL 4M7LT 2D9QB 5GGRA 3HG1E 4FQ2H 5IW3A 1F6AA 1N0LA 1OT2A 3ULUH 5L6YH 4LCCA 1EERB 5HHQB 4C56D 32C2A 3T0DA 1CWVA 1FVCA 3GO1H 1FIGH 4Q7DA 4WFFD 3X12A 4Z76A 3KYOA 1QSFA 3BD3A 4AK1A 1OTSD 2VN7A 5TQ2H 2ZUUA 4P59L 4DEPC 5HD8C 3K80A 3WS3A 5EZJB 4UB0H 1JPST 4UIMB 1OAKL 1O0VA 1U8KA 2A6DA 1L7IH 3QJFB 4BQ6A 1RAMA 5JA8B 2R0WH 5C0GA 4UILL 4EXPX 5HYEA 5DS8B 2CLZA 2IAMC 4PJDA 3P77B 2DI9A 3QIUA 1F2XK 3UJTL 1CR9L 3NA9H 2UY6A 3VJ6A 3C8HA 5GHWH 1F42A 4DKEL 1JHKH 4F8TA 1M7IB 4KRPD 1CLOL 4D9LL 3U7YL 1CFQA 4LSQL 4MSWB 3HRPA 3MRIB 5J0BA 4OLWL 4H1LG 4NQEA 3MLRH 2WUBL 3O2DL 5FM5M 4WW1A 5BV7L 4LGPB 4DGVL 2YPKB 4E41B 3P9LB 4ZAKD 5I8KH 3WLBA 2JKXA 3Q5YA 1JZ2A 3WIHH 3L3OB 4LLVA 1NAMA 3HI5L 4JZJC 3CH1A 4X7TB 4R2GB 1WBYB 2PN5A 2R2HA 4HT1L 1KPUA 5L2JB 1A0QH 3TH3T 4AQOA 3W9DA 2VOTA 3I50H 4P2RE 3W5NA 4U1MB 1FCGA 1T6WA 1C08A 4Q97A 5CP7A 5F1OB 5IVXE 4PP2B 1TIUA 3LEVL 5C6TH 4CADB 5EU3A 1GAFL 3TNMA 3GJFA 3NOIA 1R3KB 3BZEA 5T1DH 5F7HA 4OGYL 3QDJE 4J1UB 4QWWD 1MEXL 5FM8A 3C5ZD 4B41A 5D1QD 5HHVL 1S5IH 1G7MA 1R24B 4I9WD 5DZLA 1WFNA 4A2LA 5KS9A 3EFDH 4I3RH 4XNQA 4M5YH 1E6OL 1HXMA 3MTRA 3U9UB 1MREH 3RL1B 4G59A 5EO9A 4FTVB 3VWKD 2X4OB 4ELMB 4U31A 4QNPF 3PP4H 3SDDB 2IBZX 3SGDH 1YEDB 2L4OA 4KI5C 4M00A 2NXZB 4M5ZL 3SDYH 2V6HA 4QGYA 3LKPA 3WUWG 1UEYA 3BOVA 5E8PB 4HG4K 4G9FB 2AS5M 3BAEH 3RKDD 2P43B 3MO1A 2PW2B 2NY0C 5E2WL 2FR4A 4KTDL 4H25A 3FHAA 4MMXC 3I3DA 4MB3A 2HJFA 3BKYH 4O2CA 4WGWB 1BZ7A 5EZIL 5KSBE 1P84K 4K7FB 1ACYH 1CVRA 4QHUA 2NQCA 3ULVC 3QEQE 1U3HB 1A4JB 3N06B 3NCYP 1IM3A 4CDGC 2Z31A 2DL2A 2ZOKA 1VPOH 4ZO9A 2ITDA 5KTEH 2CK0H 1JWMB 4P4KD 2W65B 4BA8A 1RUQL 3PIQA 4X6BB 4GW1B 4JM2C 2OTPA 4YXHH 4MD4A 4HGMA 4YNYB 3INUL 3FT4A 3HKFA 3L3KA 3T3PE 3TBWB 35C8H 3MV8E 1Q9WA 3T2NH 5DFVC 3KPRA 1A5FH 4XMKL 3H6JA 1H3PL 5I1HL 3HZKB 1P9MC 3GNML 3JZ7A 1IGJA 4HKJA 1HCFX 5ICZB 4PGBA 4ZFOB 3S3JA 1IAIL 1MSPA 3D69B 3QHFL 4H88L 1I3VA 3KPQA 2EEAA 4YBLB 5B39G 5EWIH 1CZ8H 3K2MC 2ED9A 4GRLA 4JB9H 5GS2H 3P4LA 3PL6C 2M8XA 4L8CB 1DZBA 1MIMH 3L7EA 1S3KL 2GSGB 3LKQA 1OAUH 3AMKA 3EOTH 3GK8H 4GMTL 3O2VL 3D2UD 2HFGL 3S8WA 4XCNA 4AH2B 3KYKH 1U93A 4N1EA 4M62L 3BXNB 4KK9C 3UXFA 3G9VA 4MA1B 4ORZC 2DLFH 2ADJA 3B2UD 2AJXH 1S7VB 4HGKC 5DK0A 3STZB 2R1WA 3JWOH 4F7PB 3HE7D 3OKKB 2OJEA 1D5ZB 3S35L 5CWSB 3HG1B 1XIWD 4XVUC 4HUUB 15C8H 4FTVD 5AZ2H 5J12B 1YMMA 3VD3A 4N0CA 4OLVH 1XF2B 5I1JL 4NHUE 1U8MA 3ESUF 1CL7H 3OR6A 4JFYA 1FVDB 4MZ2A 1R3HA 4N8VB 3TH2T 4DFHA 1B3JA 1DQQB 4X4MA 5F89A 4GG8B 1SYVA 5IEHA 1FRGL 5J6GB 1XF4B 5F3HB 4F80A 3I9GL 5EU7C 3O6FC 4KUZH 4DVBA 4JFPA 3N1FC 5C9JA 1GZPA 3D48R 4HMDA 1CDYA 1LEIB 3ARGA 2EXYC 3TA3D 1M1SA 3U1SH 2ID5A 4OZHE 3QHZL 3IDIA 1I75A 3WHE1 3GSXA 1RK0B 2IALB 5I1DB 5ILTL 1S9XA 1FORL 3IU4H 5CJQL 1TQBC 1UWXK 1NGYA 2F54E 1YEEH 5IKCB 2HP4A 3ARRA 25C8L 1KYOK 3UTSB 5TJWK 3CC5A 5DSCA 3ALWA 5C3TA 1NGZA 4D8PB 3ARSA 2XWBA 4WI2A 2UVEA 3GGWA 2VC2H 2HTKC 4R9HA 3UBXA 5TDPB 4FABH 5DJ6B 4XVTH 1KJ3L 3WN5C 1MI5B 4U1GC 2WLZA 1QPXA 2H26B 4G7VL 4PLJC 3WJJA 1XH3B 2ZUVA 1CIDA 5BRZA 5C7XL 4RRPA 3F7YB 1KPRB 3VXMA 3SCMC 4NQDB 2Y5TA 4MDJB 1U8PA 3QUYB 2V5RA 3DGCR 1TETH 4XPTH 1PJ9A 3SQBA 4TUJA 5KW9L 4PJAE 4WENB 3VMNA 4MA7L 2KUTA 3LHPL 4MNHA 5D93C 1RJLB 4X6EB 5FAAA 1D7FA 3EOAA 5IV2B 3DMMB 4Q2ZB 8CGTA 3P4MA 1KFAL 1WTLA 2AK4B 5HYSA 1QQDA 3OBAA 4NGHL 1HQRB 4ZUVA 2AEQH 4IRZH 5HHOA 3T2OA 3S96B 5EIIA 1F4WL 5DC4B 4X5WA 5I9QC 4IDJH 2GIYA 2W38A 3NIFE 2BVPA 1IAOA 3PABA 1C16A 3U0WL 5K9QG 1JRHH 1AD9B 4PY8J 1MRCH 3V5KB 3SDCD 2FX8H 1TQCC 2CRYA 2HJKA 3DX6B 4OZ4A 3VI3F 2E3VA 1KUMA 2GJ6A 2KQMA 4XBPB 5AD0B 4G8GB 2DBJA 4DKFL 5F6HJ 2IF7A 5DD1L 3PWNA 1RQ5A 5F21B 4O4YH 2J6EL 1HK6A 1U42A 5D9SA 4FQIL 2EO9A 4Z7WB 2X05A 5C0AE 1OARH 1S7QB 1VKXA 3LEYL 5ANMA 1CT8A 3UTTE 4R96A 1P69B 3CPLB 3T3MF 4KJWC 5T5FL 1C7SA 3DX7A 5H35A 4KGLA 3TIDA 5EU4A 3EO0B 1X7QA 4EQ2A 1SJHB 2OP4L 1N6QH 4K7PY 3V5DA 1FSKB 2FGWL 2BRRH 4PJDF 3KYMB 3QNZA 1BOGA 5E56A 4MJ6B 4WWKB 5HYQA 2BNQE 5MERB 5CJBA 2AXGB 5EO1B 3PGDB 2VLKA 3EGSB 3VCLB 2NY3C 4JZNA 1KULA 1CF8H 2CDGB 3DO7A 5HJ3A 4LKCB 2WIIA 2A77H 4FQXA 5IBTH 3O9WB 5C2BH 1FC2D 2C3GA 4P9HL 5BCAA 4KKAD 1U2CA 4APQA 5GRZA 2VXTH 4ZUSA 3LN4B 1DSFH 3HE6C 3DGGA 2DQIH 2NY1D 4OQTL 5B38G 5JNYB 3NZHH 2GI7A 3RNQB 1I8LC 3QO0A 2V7NB 2QJDA 1ES0A 4G6JL 3NBNA 3P30H 4UTAL 1J8HA 4P2RD 3U7WL 1VEOA 5IW1A 4XNYL 3WL9B 1ZT1A 1IEHA 4M3JA 1OAYH 1IGTB 1EDQA 2F58H 5EFIA 5FYKD 3HUJE 2HJLA 4QTIH 1T1WA 3S37L 3MZGB 1EHAA 1XGTB 1NCBH 1CGTA 4C56A 5KS9F 3QDJD 4PJCE 1BLNB 5DJ0A 1WJ3A 3E2HC 5EBLA 3L1OL 4DOHB 4LOUD 4Y16B 1FPTL 4EN3B 2FYYA 4NKOB 1PVHA 5F3BB 2AK1H 4PY7A 2B1HH 4HUVB 5HGGS 2N7BA 3MRBB 4LBEB 2JJSC 4FP8H 3ZHDA 4MQXD 3LIZH 1WCQA 1NMBL 3DIFB 1WICA 3B9KA 4IOFD 3AXLA 4NHUB 3D25B 5F9JA 3BKCL 4NUJB 5T3XL 3GMOA 2X70B 4G8EA 4QY8B 2PF6A 1T7WA 2BVEA 3BN9C 1RU9H 1MUJB 3K46A 1ZEAL 2OCFD 4J4PA 2DLIA 4Z7UA 3B2VL 1A47A 2R4SH 4X80L 3O3DB 5F88B 5ESVB 4K3DL 3GFUA 5MI0B 4CL7A 1DLFL 2B1AL 3ZDYE 4HAFA 3QEQD 1HHHA 4JFEE 4ZAKA 5K9JH 2F54B 5T1MA 1WK0A 3VGAC 4YXLH 4N68A 4FFZH 4MXWH 3X12B 2A74B 2LABA 1W0VA 4WDIB 3BVNA 4KKCD 5JO5B 1G0YR 1NGXA 3WS3B 3QEHB 4M61B 2NXYC 4D0CB 1JWSA 3LV3A 4C4KT 3U4EA 2VL5B 3MV8D 1T21B 3HB3C 3WO4C 2HFFB 4R97C 5FKPB 3R06B 3TBYB 1OD7A 1OQXA 4IIQB 3QWOB 1UGNA 5IMKB 4WHYH 3C5ZA 5D1QA 1A7OL 2WY3A 3T4YA 1YYMH 4TRPL 3V2AR 3VGGA 2DD8L 1MAJA 4G5ZL 4CBPA 3TVMC 1Q9KA 2ZCKH 4PJXB 4XX1E 3AREB 5I18H 1WWCA 1CDCA 4UBDD 5A3ID 1MCSA 3RDTD 3DECA 3VWKA 5B8CB 3O4OB 3MLTA 1W2KT 4P0DA 3VD9A 2OTWB 4FG6D 2AJZA 1F90H 5FA3A 3UTQA 3FO9B 1HSBB 4Z78B 4PJ8D 4IJ3B 3CUPA 3BDYH 5GJSH 4OSUH 4O51B 2X1XR 4RSVA 5GRUL 1MJUL 4KKLD 1J1XL 5E8EB 1GCFA 3SE3A 4QGTA 4K2UL 4P5KB 4BSVA 1C08B 5B22A 6CGTA 2BC4A 4HH9A 2JK5A 3FAWA 3KPSB 3QG6B 4JFDE 4X7EC 5K9OA 1JGVH 1DBKH 3GJFB 4V1DB 4TNVF 4ZXBC 4OCXL 4LLWB 3L3IB 5ID1B 1DN0A 5IESL 1UYWH 2Q86B 2AJUH 3L3JB 2OI9B 2EDRA 3QI9D 2BVTA 3AS0A 4QHMA 3L3GB 1TNMA 1I7RA 4P4KA 3E3QA 2NY5H 4HIIB 3QUMB 5E6YA 2J5LB 5B3JE 5GGUB 3K81A 3LS5L 3HAEH 4UT9H 4RGNE 1G6RL 1INEL 3V0AC 2FJHB 4J3WA 5IMLA 2VDLH 5GZOC 4WJ5A 2VDNH 4JANB 2C4XA 3PV6B 4LQFH 4JPWL 3CSPA 1GGIL 4RISL 3Q1SL 2ZCLL 3JWNC 2EDOA 4OKVA 3VFRB 1BVKA 5F7LB 1J11A 1V5JA 4XWGL 3D85D 5CJ8A 1HZHH 2WWKO 4EBQH 4PJFA 4I4WB 4JO1L 3KDMA 4L8SB 1QFWL 2FHBA 3IKCB 1IGYB 1SJEA 4O58L 4GKSB 4FZEH 3D2UA 3O8XB 3BPOB 4M7ZB 1ZVSB 2HH0L 4TPRL 4KK8C 4NWTL 1SJXA 2Z31B 5J9PA 4HEME 3K8LA 3PXJA 3S37X 1IQWL 1MCOL 1JCKA 4L1HA 5DHXB 1F4XL 3JVGC 4QRTB 5FDWB 2BSTA 3HE7A 3TCLB 1XIWA 4LCYB 5IF0B 5J4MA 2DM3A 4MD5A 4LIQH 3OAZH 4L8DA 4YHLH 4XPGH 1YNLH 5MEOA 5DRXA 3MNVA 1Q9WB 4DGIH 3I3BA 2FGZA 2V5MA 3ARZA 2H8PA 1MOEA 4HQQL 4U3HA 4KJPC 3F7QA 1RUPH 4JPVH 3C09B 4PJHB 3X14B 1HYSC 3KPLA 2J4WL 1R5IA 4LLQA 1I1RA 2EDJA 1KTDA 2CK2A 4WGVB 3LQZB 4NZUH 3TPUA 2MJWA 5T1LB 2ZG2A 1E6JH 3TA3A 5E2TH 5ADOL 5EOCL 4OAWB 5E5MA 2K1MA 2XN9E 2IC2A 4P46B 3ZYIA 1I7ZA 2B4CH 5LQBH 3VG9B 5C0AD 5K9QI 3L3DA 3UTTD 1MJ8H 4HIHB 1J05A 4X98A 2JJTA 3MRPA 5DD3L 3DYPA 1L0YA 2VDQL 4X0KB 4JY4A 1MLBB 5EB9A 4PRDA 1RPQA 4R0LA 2OSLB 5L88L 4JFQB 4KRLB 4DN3L 2BNQD 1DQTA 3DHMA 3JUYA 1D5IH 1MPAL 4QRUA 4L3CB 2V2TB 4QT5A 2XPGA 4Q9QL 1WBZB 4IBLT 4HCRH 1AGEA 1AC6A 2R56H 4H1LH 3OKOA 5FO7B 4Y4FD 4P5TD 1EJOH 4ZFGH 5HVHC 2X2YA 1F4AA 3ROLB 3NCCB 3X13A 4IRJD 5IHUL 5DTFA 3VFUA 4NO0B 3NN8A 4JM4L 4U1KA 3BPCB 1NFDA 4I2XE 5C0EA 3GSXB 4CMHB 3LB6D 4R8WL 1ZGLB 4OUUA 3X3GH 1QUNA 3K7UA 1R0AL 1NGYB 4U1HA 4OF8A 3BRFA 1AXTH 4GSDL 4HWZA 3HZVB 4U1NA 2Q8BL 2XKSA 5HI5C 2XFXA 4AT6B 3LAFA 3KNBB 4MWFA 3VA2C 5FIEA 3IXAB 1JTPA 2P5EE 3BGMB 2QLVB 3C2AL 4L3EE 1EX0A 4EUPB 3BH9A 2B5IB 2W91A 3RVUC 4DZBB 1SBBA 3OHXB 1ONQA 1H3VA 1PAMA 1JYWA 4OGXL 5I71C 1AJ7L 3U2SA 2HT4D 3EW3B 4UV7L 4XXDA 4QLRA 1JYXA 1B6DA 5DVKA 2EDYA 4U6YA 3X3FL 3DYOA 1IAMA 4OGAC 1JN6B 3HNSH 4Q6IA 1MCRA 2H41A 2I9LA 3EZJB 4BELD 1Q1JH 2YPLE 4YHOH 4HSQA 2HFTA 3RWJB 3IAGC 1RSFA 5C2UB 1T20A 3WNOA 5HHOB 5GZNC 1NCDL 3QRGL 2C3WA 1K4DB 4Z7UF 5I76A 2CPCA 2YZ1A 1E4WH 1TJIH 2WSKA 3L6FB 5KBNC 3HFMH 1EAPB 4P59H 2GHWB 4KQ4L 1ZLWH 3QFJE 3G6JB 2OBGA 2GK0A 5HHNA 5C0JB 4OZ4B 4RGNB 1A02N 4LMQE 1AHWB 3UZVB 3ZDXF 2VDPH 4X7SL 1ZTXL 3L7FA 2Z8RA 4JY5L 4UILH 1DCLA 1VFAA 3QUXD 4NRXA 4BZ1L 4JFED 1I9JL 4LCWE 5LKNA 3PWNB 1TZGL 5ACMA 4LVNC 4W6WB 2XQBH 4X6FB 2JB5H 3PHSA 4MVBC 5CINL 4LSUL 1TTFA 2JB6A 4F7CB 1CYGA 2V9RA 4Y5VB 4H5SB 1U8IA 1K3ZA 1BX2A 4HS3A 5AZEL 2PETA 1KXQE 3HR5B 4DKEH 3AU1A 5FA4B 5H35B 3U7YH 3G9AB 5EU4B 3GSOB 4OLWH 5C09B 5I74C 5DMGD 5TE7H 5IVXA 4KKNA 2ED8A 3V5DB 1A6AA 5C8JA 3C9NB 3KLHD 5TF1L 4WU7A 2Z9TA 1MHPH 4EIGB 2AGJL 1QFUL 3PF2A 2VTFA 3MJ6A 4ZS7H 1ZLVK 1K5NA 3QDJA 4YHIB 4XP9H 2FIRT 4J23A 4XBEL 3DO7B 1QBLH 5DUML 4URTB 5F7KC 3G6AB 4HBCH 1IZKA 2UWEB 2Y06H 1YZZA 1BQUA 3MACH 1QFWM 2XKNA 5EZLB 4Y4KB 4ODXB 3LEVH 2O5YL 1GAFH 5GGVY 1NEZB 3ILQC 1M05B 1MCHA 3FQWB 3CAFA 4HBQA 1BBDH 3GBNL 3OKMB 1FZMB 4OGYH 5DHYB 2JE8A 5IVZB 4M03A 4KPHL 5CEXA 1H8NA 5EZOL 3GSRB 1JYNA 3U0PA 1WUNT 5FECA 2HT2C 3RGVB 1VEMA 5DRNA 5I6XB 4OZIE 1OSZA 1TJHL 4PYHA 4GRWE 4Z9KB 5EBGA 2X4PA 2DQCL 3Q5OA 4YHZH 5IW1B 1FO0A 1ZT1B 3UEZA 4GBXB 4ODSH 4JFDD 5KSBA 3TYFB 3D0LB 2HJLB 1T1WB 1NCAL 1UZ6F 1YY9C 2QR0B 3KYNB 3QEQA 5BJTB 4N0UB 5CEZH 1NDGA 1HINL 3ARTA 1Q72H 4PJEE 3QNXB 5EBLB 5E2WH 3EYSH 1N59A 2PR4H 1WV7T 1YEKH 3I02A 3AC0A 3QUML 4KFZC 5SWZE 5SWSB 1S7XB 3MJ7B 3KXFB 5E94A 1LDSA 4O02L 4XNXL 2O61B 1GGYA 1KB5B 4AY0A 4JRXA 3MV8A 4ONHB 1CK0H 3NH7H 4CVZA 1IGCL 4NSKB 1SYSB 2EC8A 1DVFD 3DYMA 3U9PH 3FQNA 5IQ7L 5KG9A 5DT1H 3QDHA 3H3PL 4RDQF 1RUQH 4R3SB 4HC1A 4AIZB 3FN9A 1JWUB 3O11A 4PJFF 5FYKU 2OQJA 2W0FA 4BQBA 3QA3A 2YUXA 3INUH 4JREB 4LCIL 3ARWA 3O45A 5BZDA 3N1QC 1WLHA 2EXWD 2W07A 2Y7QA 1K2DA 3RDTA 2NNAA 1BP3B 3CXDL 4OTXL 4XMKH 4TOYL 3MFGB 5HDOA 5DLMH 5F7EH 4LAQL 1G7HA 4PJ8A 1VADA 2XXMB 1RMFH 1RV6X 3CFEB 2DTMH 3BZDA 3ZE0F 3QHFH 4ZS6C 4WEBL 1CXHA 4NZRL 4QF1B 4JDZA 1MHHB 4WY7L 1QRNB 2AJVL 4HUWB 3BVNB 2P5EB 4UT7H 3VFMA 4L3EB 3FOMA 4ZYKA 4JFOA 5D1ZD 3MA7B 1D5XB 3N85H 2ESVB 3VXNA 4OF0A 5F7WC 4ODUB 4I0PC 3RTQB 1BJMA 3U4EB 4HZAA 1A7PL 3DROA 4WV1B 1T22A 4P2CG 5FYJE 3AM8C 2P8MA 3VD4A 4KI5E 3TYGH 5HDBE 3WKNA 3QI9A 3L5XH 4PTTA 2ZG1A 1MCWM 4S2SA 3L5HA 1FDLH 5I66B 1CDUA 2W59A 5I8OL 3ARBB 3ET9F 3M8OL 4HHAA 2PKDA 5E8NB 2FB4L 3S35H 3EYQD 3FB7A 1KJMB 4KVCL 4MJIB 4U6VH 5EUOE 3C6LC 1OP3H 4OZHA 4UOW1 2XN9D 3GMMB 3MFFB 5DJYB 2YD5A 3WXWL 3LSOB 3OGCA 3K3QA 3PHQA 3ULVE 1CN4A 5E6ID 2XA3A 3MOBH 1QG3A 3I9GH 5L2KD 4HX1A 4P49A 2A9NL 2WWMD 5CBEB 1JPGA 4G8FA 4K71C 1FNHA 3LOWA 2AJSL 1X5JA 3D85A 1W72H 3V4PL 2EIZB 3QHZH 4HH9B 3VGDA 2APBA 5K9OB 2FEDD 5E2UL 2VLJE 4G3YH 4PGEB 1S9VA 5CBAB 3QPXH 1JUFB 3RVVC 2DLHA 4L9LA 3BKJH 4L4TA 4W68A 3FRPA 4PJAA 2CLVA 3RU8L 2IPTL 4QHMB 5C0DB 1S78D 4S1RL 1CXKA 3OB0H 4AQ1B 2IFGA 5ADPH 1KJ3H 5DJXA 4D0BA 3FOLA 4YK4C 1F58L 1NFDF 3HLAB 3V6OC 4PRAA 3FZUD 1CICD 2EYTB 4OV5B 2A1WL 3H7LA 3IDMA 4JR9H 2CDFA 4PR5A 5DMIH 1DP0A 1R5WA 4HV8B 1IGFL 3H2WA 4JQXC 1CQYA 1Y18B 2DQGL 5KW9H 4PJ9B 5C1MB 3GSNB 3LHPH 2DIJA 2X4NB 2Q8AL 1B0RA 1LNUA 4OCMC 5FUCC 5I1KH 1MIEL 1IC5L 1A6UL 1BVLB 3FKUS 2EH8L 4HXBH 4IS6B 3VXRE 4F7TA 2P5ED 1KFAH 3P11L 1HIMH 1N64H 4PS4H 2R2CA 4AG4L 4N9GB 3M1BA 5IR1A 3QIWD 3S88L 2NYYC 4YHMH 5GIRA 4ORGA 4L29A 3O0RH 4X9IA 2QQLL 2BOCA 4P23C 5TGBA 3HHRB 2H6PB 3MLZL 4LEOA 3D9AH 1QFWI 5EN2A 3U0WH 5C0AA 4XCFL 5CD3A 2QEJA 1BZ9A 3OKEB 3UTTA 4BH7A 1T3FA 43C9A 1EFXB 5BW7A 2AAVA 3NFNB 1XFPA 5D5MB 2YPLD 4KTYA 2DIBA 2UYLB 4IRSC 2XRAH 2DJUA 4XPAH 1INQA 1U92A 4Z95L 3Q48A 2ARWA 3D0VA 2BNQA 5DRWA 5HPMA 5GSRA 3MNVB 1R3JA 5BXFB 5EBWA 5DQJA 3LKNA 1J10A 1D9KD 1IKNA 3D39E 1NQBA 1LE9B 3HCVA 4M1DL 4XVSH 2EC9T 4OB5L 1WT5A 5CKGA 4Y4FA 3QFJD 1KCRH 3HN3A 1F45A 4JO3L 2OP4H 3WS6A 2O5ZL 3DARA 4NHCH 4Y2DA 1UVQB 2V5YA 4I8DA 1OL0A 4IRJA 5EU6E 1EZVX 4LCWD 5J11C 2XIDA 3QIBC 2HYMA 3LKSB 4JEGB 2NY6C 4XP1L 4QXGL 4NM8H 2HLFC 3SE4A 5IVXF 1FG2A 4NT6B 1X6NA 5HGBA 4EEEA 1LK2A 1NCCL 4ZTPH 2R2BB 3OPZH 1TVHB 5HPOA 2X1PA 3MRPB 4CJ0A 1CD1A 1A6TB 2BNRE 1I85C 4MXQD 3PWPB 1AD0A 2AEPL 4HUMB 3FCTB 3U4AA 5ERWB 1A1NA 2FH8A 2CDEB 1BGXH 3OSKA 5GGTL 4PJCA 5KSAB 4G6JH 2PXYD 4JG0H 5JQ6H 1W0WA 4E0RA 2XPGB 2ICEA 5BV7C 1PEWA 4UU9A 3MRGA 5TH2B 4KZDL 5HHMB 4EI5A 4NJAL 1FN4B 4HPOH 3SHSA 2D31A 3K4AA 5FO8B 3VFSB 2J8UA 3PWLB 1QLEL 1AGCA 2QADC 2BHYA 5FKAB 3DX8A 3RBGA 4QYOA 4K3JL 3X13B 2Q7YA 5CIPB 3VFUB 3QG7L 4RIRA 4HIJA 3KLAA 4I48A 5FK9B 1AI1L 2ATPB 2GAZA 1WWBX 4E9LA 3TV3L 2CRIA 1HH9A 2DJ4A 3GJEB 1K8DB 3PNWA 3K2UL 4U1HB 4K9EL 2RGSA 3BH8B 3AS1A 3KG5A 2Q6WB 1OW0A 1Z9MA 4KDWA 4NCDA 4U1NB 4WUUB 5ALBH 5KSBF 1B2WL 1U8QA 4F57L 1S7SB 2NY0B 2VH5L 3OAUH 3QZWG 4LLYA 2E9IA 1JPTH 1H3GA 1NMBH 4GT7A 2A9ML 2YHGA 2IWGA 1C8PA 3QUXA 4JFHE 4JFEA 5HYSG 4QRSA 4UINH 4RBPK 3RVTC 1AGDA 1ZSDA 4MJ2A 4OLXH 1ZEAH 3SGKA 4MLIA 1MRDH 4XXDB 5E99H 2IAMD 1HEZA 4XH2B 4ZUUB 1KIRB 2Y07L 4Z7QE 3T3PF 2XA8H 5SWZD 3O6KL 3IJSA 3MLYL 2DWEA 3CMOL 5GS0L 4Q6IB 4M7LH 1FV1A 1RIVL 2D2OA 2VISA 1DEEB 2Z8WC 4K3HA 4CU8A 1RZKL 2AI0H 1QKZL 4WNQA 1KB5L 1F3JA 4OD1L 3BYYA 4M6NL 2VXUH 1Q0XL 2B39A 4XAWL 5DJCB 1ZLSH 1NL0L 2CKBH 4RWYL 3AB0B 4P3WA 3GHEH 3IAQA 1DANU 3RPKA 3PP3H 5HDQH 4QRPB 1Q38A 1KJVB 1H5BC 2HKHL 3HPJA 3IU3B 4KY1L 1A9EB 2ARJA 4DW2L 4GH7B 3HC4H 3L7FB 5CCKH 4M93B 2DIAA 3DV6A 4X9HA 3WIFA 4J3VA 2EH7H 2F5AL 1LWRA 3RGH