1LK2A

1.35a crystal structure of h-2kb complexed with the gnysfyal peptide
Total Genus 80
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
80
sequence length
274
structure length
274
Chain Sequence
GPHSLRYFVTAVSRPGLGEPRYMEVGYVDDTEFVRFDSDAENPRYEPRARWMEQEGPEYWERETQKAKGNEQSFRVDLRTLLGYYNQSKGGSHTIQVISGCEVGSDGRLLRGYQQYAYDGCDYIALNEDLKTWTAADMAALITKHKWEQAGEAERLRAYLEGTCVEWLRRYLKNGNATLLRTDSPKAHVTHHSRPEDKVTLRCWALGFYPADITLTWQLNGEELIQDMELVETRPAGDGTFQKWASVVVPLGKEQYYTCHVYHQGLPEPLTLRW
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords H-2 CLASS I HISTOCOMPATIBILITY ANTIGEN, K-B ALPHA CHAIN
publication title A peptide that antagonizes TCR-mediated reactions with both syngeneic and allogeneic agonists: functional and structural aspects.
pubmed rcsb
source organism Mus musculus
molecule tags Immune system
total genus 80
structure length 274
sequence length 274
ec nomenclature
pdb deposition date 2002-04-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00129 MHC_I Class I Histocompatibility antigen, domains alpha 1 and 2
A PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1lk2A02
3.30.500.10 Alpha Beta 2-Layer Sandwich Murine Class I Major Histocompatibility Complex, H2-DB; Chain A, domain 1 MHC class I-like antigen recognition-like 1lk2A01
5EZJA 1KNOA 3L3HB 3LQZB 2H6PA 5HGAA 5AWNL 4AK1A 1U93A 1AGCA 2Y7QB 3MBEA 4DTGH 5ESVA 5BS0B 3HMXL 2GITB 3NBNA 4PRIA 5C09D 2M1KA 4N8CL 5J0BA 1IGJA 3OGOE 1FNLA 1DN0B 1HZHH 3ILPB 3X12B 3V6OC 3I6LD 1RIUL 4Q58C 4ZO7A 5MP6H 3QEQE 3MXVL 4TSBL 1X5AA 3QUMH 2BVOB 5I0DA 2CDFB 1H8SA 5E1AA 4RGNC 3EGSB 3FB7A 3WUWA 3I6KB 4OZ4A 5MI0B 4NKDB 7FABH 3KYAA 1BEYL 3EBAA 1H15A 4Z7UB 1Q0YH 3O41A 2VO5A 5HHME 2NY5C 1NFDB 1AY1H 5D1QC 2DM2A 3VGEA 1I1AA 5ACZB 2VQ1A 2OZ4L 1J0ZA 4OCWL 2PUQT 4M1DL 4G8IB 5FUCC 1C08A 1FVEB 4IJ3B 1X5YA 4FFYL 4XPTH 4Z95L 1G0YR 2WINB 1ZT1A 1HHIB 4NBYB 5T1DL 1CGYA 4Y5VA 1OGAE 5SWSB 4K7FA 1TFHA 4JZNB 4PRDA 3MRFB 1MWAA 2FR4A 4CU7A 1AFVH 2ADJA 5DDHA 5FV1L 3ULUE 4Q9CA 3FB6A 3QBTB 3MA7B 3NZ8B 4JM4H 1D6VL 5DC4B 5LVEA 3I85A 3G6AA 2QL1A 1JGUH 1CXFA 3U7YL 3SKMA 4PRHA 3PP4H 5L6YH 5K59F 1WT5C 2NY7L 1DZBA 3GSWB 1UXWA 3VRIA 1VHPA 5GS2H 4X6FA 3BSZH 2O93L 2QSVA 2JJTA 4DN4L 5E8DL 1CDIA 1DQLL 3FHAA 4HKZB 2J4WH 1DBML 1JHKH 1HIML 3F12A 3RWIB 1WEJH 1KPUB 5JPNA 3LN5A 4JZOB 3BFOA 4P3WA 2OTWA 2NR6D 4CAGA 1CLCA 3NPSC 4S1SH 3MNZB 2GSIA 35C8H 1LEIB 1FIGL 2NY4D 1MRCH 3BO8B 2ICWI 3U4BL 4ESKA 5A16A 4Z8FL 4FTVB 2MHAB 4R7DA 4WI6A 3WCYA 4MNHA 1YA5A 3ARDA 4D9RD 4HCRA 4UQ3B 3PXHA 4U1MB 3VMNA 3EYOB 4XCFL 4P2QD 1LQSR 3WFBL 3U7AA 3DJ9A 1HWHB 3DWTA 2B4CC 2J5LC 1F8TH 3UTPE 2L4OA 1FNGA 4PP8C 4PBWD 5CEZL 4YHZH 3ARVA 5BS0D 1W72H 5F6HJ 2VXVL 4S1DC 4IIQA 4APQD 1PSKL 1FGVH 4M48L 5BRZD 5JLZB 1FLRL 4HUNB 1RJYB 4NRXB 4UBDC 1W0WA 4BUHA 1S9VB 5L0QC 3ZKQD 4O58L 3ULUF 1KFAL 5FDWA 3H7LA 5HTSA 3V5DA 5KW9L 1QBLL 3RGVD 3OKEB 1H3VA 4HDIA 2IALA 2R0LL 1MNUH 1YC8A 5KSUB 4H20L 2A2QT 4D3CL 4V1DA 4PJIF 4S0SD 5E6IA 3JVGA 3BIKB 1T83A 1XMWA 2G5BB 5DJ0A 4PJDA 1FN4B 3PHQB 3LPWA 2FEDD 1B2WH 2A83A 1KPVA 3G04A 4F33B 2QHLA 1J1XL 1T2QH 2XNAB 5I9QC 2FGZA 4P5TA 4PJBF 2JIXA 1CXHA 1PX4A 3RZCA 4P2RD 2PO6D 3EOAB 2I60L 4LARH 3V0VB 3SGDH 4RISL 1YPZF 1KTDA 4RSVA 4IM8A 5IB3A 3H0TB 2CH8A 2CSPA 4OD2B 4HJJL 2X89D 1P9MC 4PGBA 3BRDA 4RIRA 3SO3B 1CICB 3Q3GA 3CMOH 4C59B 4ONOA 3IDJA 4X83A 5HGGS 4ONHB 3DXAA 4WHTB 3U36B 3VFMA 1R5VA 3HAEB 4UTBL 3D3VB 1A2YA 1CQYA 5CJXC 4NQXB 3SCMC 1R3IH 3UYRL 2YPKB 3ALPA 5IB1B 4M5YH 1N2RB 4JM2B 1CGUA 5JZ7C 4X4ME 5E4EC 4XVUD 4JN2B 4P9MH 5JW4N 1BLNA 3BQUB 4NN7B 3D69B 5I76A 5IT2H 2F53E 3MODH 3TO4A 1U41A 1SVZA 4XB8A 1IGFL 2YR3A 3L3OA 5I1EH 2IBGA 4F80A 2YKLH 2BSSA 4BK5A 2P5WA 2E7LC 3AU1B 1UB6B 1GYAA 2Y6SC 4AYFA 3FRUA 3G5VB 3VXPB 2FATH 3TO2A 2YMXH 3VWJB 4LRIC 4NNXB 5C0BA 5TE4H 3ARGA 3CCHB 5CHNB 4M5ZL 1LP9B 1F4XL 3SBWC 3VWKC 4LSPH 4YDVB 2YPVH 5K9KA 3L1OL 5HJ3B 1I7TB 5D2NC 1K8IA 3QQNA 5D7JC 1FE8L 2R1XB 3DMMD 4ZS6D 2DQEH 1KB5L 3HMWH 1PQZA 4X6DA 2I25N 2H41A 2BRQA 3KPSD 1YYLL 2MWCA 3P4OA 1ZEAL 4PLKC 1KNOB 1GGCL 2OK0L 5HGAB 2BNUA 1G7QA 1AGCB 1I8IA 1OAKL 3MBEB 5ESVB 4IEFB 4IRJA 4DEPC 2CQVA 1IGJB 1OP3H 5CD3A 2FDBP 3CDGA 1PAMA 2BY3A 1D5MA 1WUNT 4EZMA 5E1AB 4C83A 1S7WA 3FB7B 2F74B 4PY8I 4QTHB 3CZJA 1QSFE 3C5ZB 5F88B 4PTUA 2W0LA 5C07E 2R69L 4OD1H 1H15B 1KJ2L 5KANI 5C08B 4FMKA 4FABL 5EIVA 5DEGB 1RJZA 3O41B 5IBUB 5INDB 4NC2B 3IETA 4I4WB 4WY7L 1OM3L 5CZVH 3B2VL 3TGXA 3GSVB 2VQ1B 3UJJH 3D2UA 1LHZA 3B43A 5DRWA 3E3QE 3NH7H 4ZFOL 1C08B 4G42B 3F7QA 5T5NG 4NO2A 5DJYA 4J8RA 4NKMA 5DQ9A 1LDPH 4PYGA 4FFWD 5EBWB 3SE3C 2V2TA 2BNQD 4K7FB 2J3SA 1EEZA 2VUOA 2OX5A 1KB9K 1XR9A 4PRDB 3R8QA 3V6OA 3FMGH 1YEIH 2ADJB 4L4TA 3SE4C 5DDHB 3S9DB 2PW1A 4I0PD 3SDXB 1OAYL 1HDMB 3KG5A 5IROA 2V9RA 4HKBA 4LVEA 3TJHC 4KMQA 32C2B 3QIBD 3RX5A 3VFRA 3G6AB 5FF6A 3MV8B 3QO1A 4DJMA 3IS1X 5TDOA 2R23A 2Y72A 2XZQH 3SKMB 1E6OL 4HWEH 1RJLA 1IAIL 1WZMA 2DJUA 3DTXA 3BQUD 4QRTA 5D1QA 3U1SH 1UXWB 3X17A 1F6AA 5DHXB 4X6FB 1EFXB 5J3HD 2JCCB 4HUWA 4CJ0A 1IQWH 2XQBH 3T2QA 3MR9B 5EOCJ 4R4NC 3SDYL 5L2KD 1M7IB 1QFUH 5JOPE 1EMTL 3LN5B 4WVRA 3ULVL 4EUPB 1IZKA 4RNRA 3L5HA 2LFGA 4NQVA 4DGVL 5I19L 1NAMA 2GSIB 2BRRH 4HF5L 1DQDH 4JRXA 5AZ2H 3TN0C 3MCG1 2EDOA 3T09A 5A16B 4HC1A 1ZE3C 4P9HH 3T0AA 3JWDL 1UWEL 1E4XH 2AKRB 3OJVC 4U1KB 4MNHB 4CVZA 5DJ2B 3ARDB 3JV6A 5HI5D 1EHLL 2QQKL 4LLYA 5GGVH 4FQXD 4U1NB 5FYLL 3WLWC 2APBA 4U6TA 3X14A 3E8UL 1T2XA 4GMTL 1X4ZA 1I1FA 4ZOAA 4U3XA 4H88L 4XWGL 3TV3H 4PS4L 5FYJU 5CWSA 3I2CH 5IBTL 1UZ6F 1G6RA 2EDHA 1RY7B 4KK6C 5JW4M 1W0WB 1VKXA 2B39A 2A9ML 1NCNA 1DBKH 5F1OB 3QFJE 5CKAA 5EA0H 1KV3A 3Q1SH 4X0KB 2YD7A 5FDWB 2B1AL 4UILH 4WHCA 4GXVH 5F97E 3O3BA 5D5MB 3V5DB 1F90H 3IFNH 1SBSH 1DDHA 3HNTL 2IALB 4OJFL 1IGMH 3QJFA 5C0AB 1UWGH 1QFWH 5GHWL 4ONGL 3M17A 4NZUH 1A22B 4V1DB 1OWWA 2J7LA 3WV0A 3MO1A 5E6IB 1U3HD 4MVBC 1KC5H 1KYOJ 5DJ0B 3TPUB 1OTSD 4AEHL 4HPOH 2B5IB 2A83B 1KPVB 2UWEE 4PRBA 1TQBB 3G04B 2OL3H 5DMGD 1KELL 1OAQL 1B0GA 3RNKA 1OARH 2V7HA 2JIXB 2FB4H 2GTWB 1ZGLM 3RZCB 1H3XA 1OD7A 3B9KC 3DBXA 5FUZH 5IWLC 2IJ0C 1B4RA 3IU4L 2CXGA 3LB6C 3FAWA 1KTDB 4ZSOB 2QHRL 5IB3B 5FCUH 1BFTA 2BY1A 4PGBB 4ONFL 4RIRB 5LAXA 3MV8D 1Z9MA 1TTGA 2P8MA 1FVCA 4OCXH 4ZOEA 5I6XC 3DXAB 3VFMB 4YZFF 3MRBA 5FGRA 2C26A 2Y07L 1MAML 2NY1D 1QKZH 1LQVA 1INDH 3HE6B 1QBBA 1ZGLP 3O6ML 1CBVH 3FQWA 2HWZH 1EFXD 2KUTA 4KTEL 3BJLA 3SY0A 1BLNB 1GC1H 1P6AB 4XPFH 3UTSD 4NUGH 4LSRL 4LVNC 5LGHH 5I76B 2UY6A 2EEAA 1FNSL 4PJ7E 3TO4B 4QXGH 1DSFH 3ARFC 3L3OB 3QQ9C 2IG2L 3LQMA 4YGVA 2DL2A 2BSSB 2P5WB 4YUEL 1MHPL 2GCYA 2HG5A 2AABH 1J86A 1JGDA 4F57L 3L95A 1IAOA 5BQ7A 1P9MA 4KROD 1MF2L 1PVHA 4WFHD 3TO2B 5J56B 4G3YL 5IW6B 5EBMB 5C0BB 3ARGB 2HFTA 4P4KC 3H42H 4EEEA 4IS6A 4WFEE 2DB8A 5CJXA 5DD5L 5L7XH 5JQHC 4HG4J 3SCMA 3ZKNC 4XWOD 1R3HB 4TQEH 3WDIA 1FL6A 3C5SA 4J1UB 2ADIB 4YX2H 1UM6H 4Z7OF 2DQUL 1DQJA 3E2HC 1K8IB 1F11B 2N7AA 4ODVL 4PUBH 1ZA6B 1PQZB 1ZOXA 4QRPD 3L5WB 3GI9H 1A8JH 1L6ZA 3O4LD 2DD8H 5E2UL 5T5FH 4JLRB 5C0ND 3P4OB 1YEKH 2L7JA 4QHKJ 5DJZA 4AEIH 5IB5B 3RGHA 1HSAB 3BE1L 3O11A 1II4E 2VAAB 2BNUB 1G7QB 1YMHA 3SQOH 2E7LA 1I8IB 1QRKA 1INEL 3OAUH 4YK4C 1OSPH 4CMMB 1TETL 3DRTB 3MRNA 4XNXL 5EBGA 3WKML 4AM0A 4IRJB 4HUXA 3HHRB 4WGWB 3RVTD 3INUL 5MHSD 4KRPB 5SX4I 3CDGB 3MJ8A 5E8NA 3BPCB 1D5MB 1NLBH 1UXSA 2R56L 3P9MA 4WW2C 5C0AD 1ZSDB 1PY9A 3ALWA 4C83B 4YE4H 1S7WB 3I9GH 4JRYA 3LDBC 5LCVH 3SBWA 3VWKA 1I7RA 2BC4B 4LPUA 4WWKD 4XPAH 5F7KC 5D2NA 5D7JA 2FD6L 4UIKH 4FZEL 3RUGF 1L0XA 1RJZB 2XRAH 3NA4A 4XVSL 3DX9A 4WFGE 3IETB 1IAMA 4PP1D 1MCDA 4BK4A 4K7PH 4P4RB 4ZXBC 3UTTE 4DTGL 5DJYB 3CX5J 4J8RB 4NKMB 1XH3B 3ZDXF 2EZ0C 4H1LA 4M6MH 1RQ5A 2A6KA 1HZHL 1N6QH 2F58H 3WNKA 2VMFA 2GW5A 2O5XL 4L4TB 4KI5C 4RGNB 1A7QH 4M6OH 3GSQA 2G60H 1CI5A 1OP9A 1JZ6A 4LHJB 4OCYH 3HE6D 1R3JA 1Y6NR 5FF6B 3VFRB 3MCKB 3QO1B 2FEEL 4KMTH 1Q0YL 5TDOB 1EA9C 2R23B 5JW4R 4K3HA 3OB0K 3IS0X 4QRQA 1RJLB 1RIHH 3GNML 2VUYA 4Y4FC 2PYED 3DTXB 5D1QB 4QRTB 2UZIL 3EYQC 2A77H 2FX8L 1FNEB 3RRQA 4XPTL 3ZYOA 4HUWB 5JHDD 2XIDA 3RVWD 5J4MA 3HNSH 3ZMRA 5KOMC 1C8PA 3BXNA 2D4FA 3SE3A 3S34H 2K9UA 5BJTB 3SEPA 4MSWB 3QDGE 4PJGB 4RNRB 4NQVB 3PIQB 1V3LA 1BIHA 1NAMB 4QO1A 2W9DL 5DR5H 3TJHA 4JRXB 2H2PD 1TZIA 1JGUL 4RWYL 3PP4L 5L6YL 2BDNH 4OLVH 4CVZB 2HTKC 1B9ZA 5L9DH 5E8EA 1H0DA 3WDJA 4X6CA 1CZ8H 1V7NH 3F5WA 4JHWH 4MJIE 1RIVH 4OZIE 4XC1H 3X14B 3BD4A 2J4WL 4YFDB 1JHKL 1WBYA 3O9WA 1EX0A 1WEJL 2IANA 3KXFB 3Q48A 4M9PA 5TQ2H 3RX8A 1MFAH 2AV7A 2ICES 3TC9A 2VXQH 3QIWC 5F9OH 4S1SL 1J11A 35C8L 3VXNA 4P3CL 3U7WH 2NQCA 1KEGH 4ZAKD 2VDQH 1U9KA 4N9GB 3D39E 4YQXH 2QSQA 1YYML 4W6YB 2EDTA 5F7UA 1CD1A 1DDHB 3EYUH 3QJFB 4LSUH 2AI0H 3M17B 4PJ9D 4OGYH 4RAHA 3O4OB 4GKOA 5D9SA 1JPTH 1F8TL 4URTB 2J5LB 1Q72H 5FA4A 3QG6B 5GRZA 3STZB 1W72L 4L1DA 4KH2A 2OCFD 2V7HB 1FGVL 2YZ8A 1QRND 5FYKU 1H5BC 3DBXB 5D71H 4J3OC 5HDBF 5BRZA 5CLWA 5L0QB 3GMLA 4Y1AA 1JGEA 1EGJH 5DO2D 2QR0A 3MGOA 3B8YA 4N0YH 1T6WA 2FIRT 4OFYA 4HMDA 4RA3A 4JQXC 5I8KH 2VC2L 1MNUL 2EXYD 1INQA 4QF1A 3OHXA 3VXSE 2P8MB 3VXUA 4GG6F 1XIWD 3MRBB 2ZCHH 4JFFA 4MVBA 4PR5B 1YEEH 5K9QI 1B2WL 3FQWB 2MQCA 3ULSA 3BP4B 3RWGA 5ILTH 3JBG7 1T2QL 1UCBH 2HFFA 1ZV5A 5I9QB 3U9PH 3JTCA 2APXA 3G08A 4MAYD 4GBXB 3UMTA 4LARL 2Y5EA 1BGXH 3K2MC 5IWLA 1OW0C 1MREH 4YGVB 3FO2A 3UPRB 2R2CA 4DN3H 2GCYB 4PJHE 5IEHA 2R0ZH 1JGDB 1WICA 5HDQH 4NIKB 1TJGH 5BQ7B 4AG4L 3PL6B 2DQJH 1WCBB 3S5LA 1WSST 3CMOL 3MOQA 3UC0L 4UAOC 4LOUD 3O3EA 2Y1VA 1BVKA 5GQBA 4QRRD 5CKGA 1FZMA 1OT2A 4XXCC 4OZHA 2FCBA 4PRPA 3W0WE 1W8OA 4KUZH 3C5SB 4M5YL 4XAKD 5SX4H 1Q9LA 2K7QA 4CBPA 4H8WC 3ZT5A 4P9ML 5E4EB 1ZANH 1WGOA 2W9LA 3VFSA 4JFHE 2J6EA 3MNWA 2HMIC 1PKQA 5IT2L 3IDUA 5ICZA 4MA3A 3MODL 4LPVA 1WFOA 5JUEL 1BJ1J 2C5DC 3GSNH 2QLVB 1NUDA 3BUYA 3OKOB 3ARFA 4Y4KD 3O11B 4NCDA 3SGKC 4WU7B 4XX1G 3NCFB 1YMHB 1FZKB 3OXRA 3IB4A 5KANG 2BXZA 3UPAA 3UZEA 4AM0B 1NCWH 2FATL 2GYSA 2YMXL 4HUXB 4HKXB 2VZ1A 4F37K 3BISA 3MJ8B 5TE4L 1JV5A 1X44A 5E8NB 3ZKMD 4R4BA 4P4KA 3P9MB 3K0WA 4WW1A 2MTPA 5BVPH 5ACLA 3O8XD 2DQHH 1DQQA 4ZUVA 1NGPH 4LSPL 1XF2A 2GJJA 2R4RH 2YPVL 3E2HA 5D7JB 3O3DA 3P0VH 2B8OT 2GTZA 5ENWA 3UROR 2Z4QB 1EEQA 4QT5A 4G80A 2PNDA 3DMMA 3T0VA 4E5XA 3T65A 1AH1A 3KPSA 5EU6D 1HNGA 3DX7B 4NO5A 3MGAA 3C8HA 3MJ6A 5BCAA 2A38A 1SJVA 1G7IA 1LEKB 3BX7C 4MXQD 5DXWA 3TBYA 2VLRA 4IMLA 3QPQC 4QYOA 5DRXA 4DEPB 3LSOA 2EE3A 2A6KB 1UM4H 4YXHH 1NEZB 4MJ2A 1OP5K 1I8LC 5KZCB 4B7IA 4WW2A 2D4DA 3GSQB 4NFDA 5KSAD 4PLNC 3H9SA 1XZ0B 3BP5A 1X5XA 1R3JB 4Y2DD 2H8PA 4OGAD 1QBMH 2ZG2A 2EE9A 4J6RL 2AXHA 3GSOA 5HVFB 5CZVL 1F13A 3FO1B 1X6LA 3UJJL 1J1OH 1CF8H 3NH7L 3VFPA 4WI2A 5F6HI 2ZNXA 4GBXD 1VFAB 2XN9D 4I18C 1HOCA 3L9RA 3GIVA 5I1GH 3CC5B 1LDPL 1VGEL 3MLWH 3RJDA 3BXNB 3F7VA 5C6PB 4D9QD 3UEZA 5HYJB 4Z76B 4BZ1H 1K6QH 1MRFH 2BNQA 2FHCA 5ICXA 3PL6D 4NFCA 3FMGL 1F4WL 1UCTA 4ZOCA 4F9PA 2XY1A 2ATKA 4PG9B 4HK3N 3RL2A 3LIZH 2AGJH 2ZWLT 3BPOC 3WL9B 3VFVA 1IILE 1TZIB 1BQSA 2XZQL 4HWEL 1WZKA 1J7VR 3WHXA 1QPXA 4Y4FA 5DQJA 3U1SL 3LPFA 3HRPA 3N85H 4ODSH 4NQED 2GY7B 3BZEB 3F5WB 4Z7UE 5KVEH 2ENSA 2HRLA 4FQQA 2W0PA 2X44D 2XQBL 5SWZD 1NFDE 5BV7B 1V3JA 1WBYB 1FAKT 2DYPD 3X13A 4KI1A 4QTIH 3DGGB 2IANB 2EDJA 5C0EA 1G7PA 3NGBC 5EO0A 1ACYL 4XZUA 4UT6L 2BVPA 3T0WA 2BRRL 3GBLA 4DKEL 4UDUA 4EUPH 5TPWL 5SWSE 2ERJC 1DQDL 4M1CD 1AD9B 5AZ2L 5T33H 3ZLQC 3QZWG 1JRHI 1ZGLB 3TN0B 3HI1B 1QZ1A 1ZT7B 3CXDH 3QXTA 1E4XL 2IBBA 4H25A 5K9OA 1XGTA 3QPXH 1GOGA 4LLDB 2VWEE 2JTDA 4KRLB 2VLJE 4KK8D 1E0OB 1EERB 2WWMC 5TFSH 5CINH 2IFFH 4HIIA 1J88A 3HE7C 5D9SB 1MI5E 5FA4B 3HPLA 2BX5A 1RK1A 3P4MA 1EUTA 2X4NB 2VQTA 2EIZA 3LCYA 3TV3L 3I2CL 4HJ0C 3CFBA 3BRFA 3QIWA 1P6FA 5KSVB 4M3KB 4JY5H 3SKJH 2SEBA 2BMKB 1DBKL 3DECA 5EA0L 5GZNC 2CIKA 3OB0H 3Q1SL 4Y16D 2DOCA 3KGRA 1JGEB 5I75C 4UILL 3MGOB 4GXVL 5CGYD 4ZFFA 3VFWA 5C0FA 1AGBA 1F90L 3IFNL 4YGAB 1NGQH 4DQOH 1PEZA 1SBSL 4D0CA 1IGML 1UWGL 1INQB 1VFBB 3OHXB 3GHBH 3QDAA 4ZNEE 4CUCA 3VXUB 3QCVH 5FEBA 1G1CA 4NQDE 4HAGA 5ADOH 1J8HA 1B0RA 1KC5L 1HYSC 4NQCD 3Q0HA 5IESH 4G59A 4BQ6A 2XA3A 4HPOL 2NX5A 2V5YA 4FTVE 5IVXB 3RWGB 3CAFA 3QDMA 1MQKL 3TVMC 1XGUA 3FONA 2HFFB 1VERA 1AR1D 2DLFL 5HXMA 3VGBA 1NCBH 1OARL 5HYJD 2FB4L 1HH9A 4MAUH 2NNAA 2P5EB 3G08B 2FX9H 1H5BA 3B9KB 5FUZL 3BKJH 4NM8H 3D0LB 4CN4A 3FO2B 3LHPH 3QIUC 3EHBD 2YD3A 4PLJC 4UOW1 4JY4A 1EBAA 1BJMA 5FCUL 4HIJB 4PJ8C 2F8OA 1KYOK 3GJEA 4GMSL 4JQXA 1S5HB 5KS9A 3O3EB 5ACMA 5I6XB 1U8QA 1DN2A 4OZHB 1KGCD 4IOFD 3K8LA 1QKZL 4PRPB 1INDL 5CEYA 3C5JA 4ORGB 1FC1A 1CBVL 3ZDYF 2H2SD 1Q9LB 2HWZL 1B6DA 4K94H 4CKVX 4ODUA 4XCYB 5IW1A 1FGNH 2BOBA 3QDJE 1SY6L 1GC1L 4XPFL 3VFSB 3DVNA 3WIHA 4JAMA 4NUGL 3MNWB 2ZSVA 1RHFA 3HAEG 4LVNB 1T89C 1PKQB 3FL7A 2XXMB 4QEGA 5EFIA 2RCSL 4HIHB 1F5WA 1G1YA 4QXGL 1DSFL 1ITCA 3QWOA 4AEFA 1HXMA 3ARFB 1BWWA 4YDLC 2BOCA 1OW0A 4F8TA 1WVZA 2Z93A 3H9ZA 4NGHL 1CFTA 4PRAB 1JTPA 1QVOA 1KLUA 5ERWB 3TN0D 4KK9C 2DTMH 2HJLA 1JV5B 5DJAB 1P4LA 5IIEA 4ZOBA 4XXCA 4P4KB 5L7XL 2B1HH 4XXDB 3SDAC 4TQEL 4YX2L 3W2DH 1OAZH 4ZUVB 1UM6L 3LEXB 4DVBA 5J06A 5GIRA 3E2HB 3NCEB 2UUDH 4PUBL 3VFNB 3O3DB 5ENWB 5T1KB 3OJMB 1NBVH 3D3VE 3NFSH 1R3KB 3I6GA 1FZJB 4EXKA 4QT5B 2DD8L 4G80B 5T5FL 5C0IB 4QRPA 5ALCL 4XBPA 4AEIL 2XICA 1OQOA 3GSXA 5EUOA 1YY8A 3SGKA 1XFPA 5F9AC 5FKPA 2YRZA 5CEXB 3SQOL 1JFMA 4GAFB 4PJEF 4TPRL 4YK4B 4HG4K 3GIZH 1DBBH 3ROOA 2VLRB 4IMLB 4X4YA 1BIIB 2J8UF 3ZHDA 1GZPA 3SQBA 3OTTA 2KDGA 4X8JA 4WW2B 3KNBA 2MKLC 4JKKA 4PJ5E 3PWNB 4YE4L 3MOBH 2EC9U 2NLJB 3TFKC 3I9GL 4LASH 5LCVL 1Q0XH 2HAZA 5TF1H 4XPAL 3WFDH 3LDBB 2FECI 2EKSB 3H9SB 1KCLA 5KBNC 2R8SH 3OKMB 2X6MA 2AJZA 2H8PB 4UIKL 3BEVA 3G5YA 2XRAL 1FYHB 2R0WH 4BKLA 3GSOB 4XPBH 43C9A 1LP9E 5DJDB 1JHLH 1S7XB 4CU6A 3SJVA 3VFPB 4K7PL 4ZXBB 1HOCB 4GRLD 3GIVB 4LLMB 3B83A 1UVQA 3PWLA 3SPVA 5IBUG 1IE5A 3F7VB 3CZFB 4EDXA 3CSBA 2WBKA 3U4EB 4P5MB 2V6HA 4HV8A 2PTUA 2F58L 3LKNA 2D03H 1ONQA 3VI3F 5E0QA 3ULVF 3QI9C 3CJJA 5EH1A 5E8PA 4YHOH 3VFUB 1WITA 2G60L 1JGVH 1G7JB 4G8GA 4S1RH 4OCYL 1T21B 5ITFA 3QWQB 5D4QA 3VFVB 4KMTL 5SWQA 4ZUWA 4I3RH 3QEHA 5A3IC 1KLFA 5E94B 4MQ7B 4PJCA 1FZOA 2GFBB 1RIHL 3CX5K 1ZHNA 2KZWA 4XHJC 1ZHBB 3WHXB 2Z92B 4Y4FB 1JRHH 3HPJB 5DQJB 2A77L 1S8DA 2FJFA 2OP4H 4I77H 3RIAK 4Z5RA 4I18A 5C08E 4D0DA 3HNSL 5CAYB 3IFLL 1RZ7H 2C3WA 2I07A 2J8HA 4HK3J 3QUYB 3S34L 2O61A 1FFRA 4JQVA 3IDGA 4XB7A 3X13B 3IFOA 3C6SA 4PV8A 5C0EB 1G7PB 1Z9OA 5EO0B 3QCUH 1KIPA 5TJWK 1EEYA 2BVPB 5DR5L 4UDUB 4JZJC 2PKDA 3OR6A 1GOHA 4L9LC 1VEMA 5E9DB 1CE1H 1YEFH 3N06B 4EUPG 2BDNL 5DUBA 5FB8A 3DETC 1G7MA 2NZIA 1D5BA 2Z0BA 4H25B 2YUXA 5K9OB 1XGTB 3E6HA 3S37L 4U1HA 1T4KB 2YK1H 3QA3A 1CZ8L 1M6OA 4JHWL 2MQ0A 4OCRH 15C8H 4RRPA 1RIVL 1CQKA 4HIIB 1N0XL 5CP3A 1OP5H 2XZAH 3M1BB 1ZWIB 2MNUA 1V8HA 3F7YA 3BGFC 3HPLB 5F9WC 1RK1B 3MRGB 3P4MB 4UV7H 3DUSA 5IFHL 1QSEA 2D7QA 5TQ2L 3S35X 1VEOA 1DLFH 3FB5A 2JCCE 4RDQF 3CFBB 5F9OL 3QIWB 3TP4A 1N6VA 3AS3A 3RWEA 3VH8B 4J2XA 3UXFA 4MQXC 2IADB 2SEBB 4HEPG 2IH1B 4LLQA 2YD4A 5EB9A 3U7WL 5K9QG 1KEGL 1BOGA 1CLZH 2VDQL 1JWSA 2DQCH 3EAKA 4YQXL 2CDGA 2CIIB 4ZFFB 2CRIA 5EBLA 1AGBB 4FXKA 4D0CB 3EFFA 3VG0L 4JFYB 3EYUL 3VGHA 1K4CA 4LSUL 4GRWF 1Q9WB 1MFBH 1NUNB 3D9AH 1WFTA 4OGYL 2WP3O 1J8HB 1B0RB 1LK3H 1MOEA 5DFTA 4H0HB 1JPTL 3AB0C 3HE7A 4JDZB 5EG6C 4QHKI 2NX5B 1Q72L 2BSED 2MCPH 3CXHJ 1NFKA 3QDMB 1A3LH 2J8OA 1MVFA 1NKOA 3FONB 4HBCH 3V7AE 4H5SA 4YBQC 4OB5H 4HMCA 3F8UB 2AJXH 1HH9B 2NNAB 1X4XA 4XP1H 1PBYA 3D5OF 3DO3A 4S2SB 4ZFZA 4AIZA 5T1MA 4EOWH 5J6GB 1X5KA 2FIKA 1EGJL 1VSCA 5IVNA 3ARQA 4JY4B 2A0LD 2YUVA 4U7MA 2W9EH 1RPQA 2X1OA 5E99H 4YDKH 5I8KL 3VE0B 1TZGH 4JFPB 1RUML 5F89B 5D7IF 5KS9B 4JFQA 3EFDH 1U8QB 4HUVA 4TNWF 1XIWA 1XCQA 5ESQA 1W0YT 4FP8H 5CEYB 2X5PA 3C5JB 1YEEL 3WNMA 5ILTL 5IW1B 2NW2A 1UCBL 1LVEA 4JAMB 1SYSA 4V1DE 2ZSVB 3U9PL 1EAJA 1FDLH 4QY8A 3QUYD 5KG9B 3PV7A 4PJDE 2VQUA 3TPUE 4NSKB 3UO1H 1BGXL 1AD0A 1CWVA 5EPMB 5TQ0H 3D25B 3K4AA 1LNUA 2BOCB 4MJ5A 4DN3L 3QIUA 4MD5A 5C7XH 4QNPF 1YN7A 1CDCA 3GSRA 5HDQL 1TJGL 5SX5K 4PJ8A 1CFTB 4UNVA 1CFSA 2DQJL 3WEXA 1MLBA 4XNQA 3LQAC 3ISWA 1QVOB 1HNFA 1KLUB 4PJXF 5L8KB 4UAOB 5IF0A 2Z8WC 5E9DD 2O26U 2Q20A 1P4LB 3T3PE 5IIEB 4LSDA 4KUZL 2DLGA 5MENA 5F7EH 3H9HA 5T3ZH 3T3MF 1ZANL 5GIRB 3DXAE 3OGCA 3FQRB 4S10A 4NJAH 2ADGA 4CVUA 3S3PA 4WJ5A 4XBPB 3GSNL 1KACB 2XG5A 1YUHA 2VISB 2C7UA 2W0KA 4N90E 5EUOB 1YY8B 4Y4KA 1CLYL 3VA2C 3TM6A 2PF6A 5JA8B 1NCWL 4PJIA 5EZOH 3B9AA 4X4YB 3MUY1 1VB9A 5IQ9A 4ELMF 2WIIB 2OJEA 4CMHB 4V3EB 2P5WE 3U0TA 3KNBB 3UP1A 5BVPL 3SDAA 2D0GA 2MKWA 4PJBA 4LHUA 1NGPL 2XPGA 1RZKC 2F5AL 2R4RL 3O8XA 4JREC 4CRPA 3MYJA 3W9DA 4KWUA 5C0BE 2CMRH 2AJZB 3P0VL 5KN5A 3BEVB 2YC1B 1YPZA 3HZVA 4FQPA 1MH5A 1A6ZA 5DK3A 5T5NF 5BVJA 1KCGC 1KIRA 3LKPB 5ICYB 1FH5H 2AK4D 3MLUH 3SJVB 4JFEB 1NDMA 2GHWB 1IEBA 5EU6A 3TYFA 3MUGA 4X4XA 1WK0A 4EXPX 1OPGH 4J4PD 5GS0D 1UVQB 3PWLB 3IJSA 4JGJA 4LK4A 4EDXB 1DP0A 2DQIH 1UM4L 3VXMD 4YXHL 4HV8B 3CSPA 3LKNB 3GDBA 1ONQB 1WWWX 1T20B 1UYWL 4QLRA 3BWUC 4ODBD 3TJEH 3TFKA 3T3PF 3P0GB 1UFUA 4O5LH 4G8GB 5KSAA 2EC8A 4XNUH 5SWQB 5DSCA 4ZUWB 5BZDA 4XMPH 3QEHB 5E2VH 1PGRB 2N7BA 4I13B 1FZOB 3PQYB 1KJ3H 3J8F7 1CF8L 1OCWL 1S8DB 3HG1D 3N0PB 5AAMA 1HKFA 4G9FD 2XQYK 2W07A 4OLUH 4D0DB 5I1GL 1CTOA 1BBJA 3D0VA 3MLWL 3PDOA 2RIKA 2VJXA 2ZG3A 1AGEB 1NL0H 4BZ1L 5DC0A 1K6QL 2CUMA 2O61B 1MRFL 3MRHB 3IDGB 2IAMB 3C6SB 1JE6A 4NKIH 4KUCF 4XCEA 4QGYA 1G9MH 4DFHA 1CLOH 1KIPB 1EEYB 3GK8H 3T77A 4HWZA 3RVVC 4P2OD 4TNVK 1HXYA 4OLYH 1YMMA 3LIZL 3OR6B 4OBSA 4WV1C 2AGJL 4LLAA 5DJ6B 1QA9A 1TCRA 3BPOB 3V6OE 2YN5A 4LPYA 4L4TE 4DVRL 5FB8B 5GRJH 4RAVA 2ZCLL 1D5BB 2LAGB 3JTSA 4RGNE 3REVA 2FX7L 3CNKA 5FFLA 3N85L 4E41A 2BSRA 1M6OB 5KVEL 3VXOB 2GK0B 5GGRA 3F7YB 2ARJB 1IT9H 4QTIL 2XZCH 1QSEB 4X6DF 1OSZA 4HXAH 3FB5B 5FUCE 5BV7H 3CSYA 3P11L 3ZL4H 3NGBB 3SDDC 3RWEB 2F15A 3U2SA 3ARBC 4C56A 4LLQB 1BOGB 2ERJB 3WBDA 4L3ED 4L9LA 1RZJL 1JF1A 3CXDL 4PJGE 4J23A 2IC2A 1K4CB 2R4SH 3QPXL 3MRJB 4HGKC 3B2UD 2VL4A 4JRXE 3B4NA 5TFSL 3FN9A 1OAUH 2V2XA 2IFFL 2ZPKL 1QP1A 1QACA 2GJZA 4HCRL 3HE7B 4LCWD 3MREA 4PPTA 4XNZC 1YQVH 3V4VH 1K8DB 1IC4H 2YEZB 1O5DT 4DW2H 4BH8A 4JPWH 3CDCA 4H5SB 5FYJE 2JK5A 4QOKB 4HFWA 4JY5L 2X05A 3SKJL 1JUFA 3QDHA 4ZFZB 2KQMA 4I48A 4WUUD 5I75B 4Y16A 3C60D 3KXFE 4DQOL 3A6BH 4GUPA 1FO0A 2ICEB 4JE4B 5FGBA 3GHBL 5ADPH 1QYGL 1P7KB 4GAGH 2VL5A 3QCVL 4JFQB 4MX7B 4NO0B 4HUVB 1YEDB 2NTFB 3BH9A 3KS0J 3PQYD 5ADOL 1ZAGA 5JW5A 1UH4A 5IESL 1MIEL 4O2EB 1EFQA 4WU5A 5CSZB 1CXLA 5I8OH 5F1NA 1HHHB 5HGBA 5EOTA 3ZDZF 1NC2D 4B50A 4JGUA 2NW2B 4I1NB 3L3JA 1U8OA 1QUNA 5D96C 3TVMB 1QQDB 5FKAA 1NCBL 1SYSB 3A6OA 1MHHA 3TBVB 1UKSA 4MAUL 4UIMB 2BSTB 4M8QA 3UZQA 4ODXB 1DE4A 2FX9L 1E4KA 2HN7A 2P4AB 3BAEH 3BKJL 4NM8L 2IAMD 1AD0B 1XGPA 4LU5H 3HLAA 1BD2A 1LNUB 4JANA 3LHPL 2F8XC 1DBJH 1BM3H 3QIUB 3QJHA 4MD5B 5C3LD 2R2HB 1YN7B 2YUWA 3O6FC 3C6LC 4BFEA 4EI6B 4PJ8B 4G6AD 5HHMB 3V0WH 1MLBB 4XNQB 3LH2H 5IF0B 4FQLH 5TH2A 1P1ZB 4AMKH 2NZ9D 2DBLH 1E6JH 1CGVA 2COQA 4Z7NF 5MENB 1CVRA 1OGAB 1A9EA 4K94L 1I1YA 5TE6H 4N8VA 3NFPA 2VDMH 5DEFA 3OGCB 4KKBD 4TULH 1EEUA 2DIJA 2CK2A 3KPRA 1LO5A 3RDTB 5CGMA 1J8KA 1Y0LA 4TSCL 5H2BA 4WJ5B 4HUKB 4QCIA 5I1LA 2YUZA 2WIMA 4X98A 3VXRA 2C7UB 3HZYA 4YDLB 5MEPA 2VLKA 4F2MB 1DEEA 1Z9LA 3QULB 1REIA 2HT2C 4LL9A 5EUKA 1NBZA 1Z0MA 2B20A 4FS0A 4HIXH 3MRDA 3BN9C 4PJIB 3PWUB 3MLTB 4LPWA 3KJ6H 3T4AA 2DTML 1A6TA 2OJEB 1S9KC 5E1HB 2DWEA 3QSKB 4YBLC 2B1HL 3U0TB 3SDAB 3IFPA 1EJ6A 4PJBB 4LHUB 4JB9H 4KQ4H 5DK2B 3VRJB 3S37X 3W9DB 1RUAH 5DFVC 5KN5B 3RPIA 5KOVC 1C1EH 4OQTH 1MEXL 3HZVB 1MH5B 1A6ZB 2EDFA 5T3ZE 1J0JA 4XCNA 1L7IH 5DVMA 2DMBA 3CFKA 3KHOA 4NBZB 3EJZD 5DVNA 4LAJH 3TYFB 3MUGB 4X4XB 1N5YL 3LKQA 2D0FA 5GRVL 3GIZL 5J12C 1XAUA 4TVPE 4PTTB 3RA7L 3HC0A 4R2GD 2CLRA 3TZVC 2E7LE 3GMOB 4KQ3H 4X99A 1VCAA 3MOBL 4NO0D 3DI3B 4LASL 5TF1L 5C0JA 3WFDL 4D9LH 2BVEA 1DCLA 1M4KA 1MFEH 1NEZG 5J1AA 5BZDB 2R0WL 4F7MA 3G5XB 3MA9L 3QEQD 1R5WA 1X7QA 4JRYE 4XI5D 5KVMC 3EZ8A 5SX5H 1JZ5A 1FFQA 3WFEL 1IM9B 5D2NE 1Q9OA 4NM4H 1JNHB 1JPGB 2NXZC 4EN3A 3BT2H 3MLZL 1F4AA 3AS0A 1IJ9A 3ZT7A 1B90A 3HZKA 2N56A 5HHMD 5DD6A 2D03L 3WHE0 1WC7A 2A6DA 4BELD 3T08A 2VDPH 3TLRA 3BWAA 3QI9B 4XP9H 4YHOL 3ECBA 1JGVL 4HWZB 4GAJH 5A2LH 1YMMB 2Z9TA 4S1RL 3S3SA 5E24E 1IQDB 1G0DA 2Q87A 3S7GA 5EO1A 1OGAD 1ZA3A 3CU7A 2NYYC 1R5IA 3VD4A 1JRHL 3REVB 5ISZA 3FZUC 4G8FA 5FAAA 2IGFH 2AJSL 3RDTD 1P2CB 3ULUD 1YC7A 2BSRB 3MNVA 4Y89A 2LV4A 5GGRB 4FQIH 1RZ7L 4LHQB 3H7BA 4HT1H 3FFCA 2ZUWA 3GFUA 1BJ1H 3ZE0E 5IEKA 3CSYB 4WI7A 4FQCH 3PWVB 4KJYB 5MERA 5IJKC 5F1SA 1DVFD 3U2SB 5KTEH 4C56B 5KVGL 4AH2A 4YHNB 4JZJB 1WWBX 4WV1A 2IPTL 2BY2A 4L9LB 3EDJA 1YEJL 1JF1B 2F53B 2MQ3A 4YO0B 3OX8B 1SMAA 5HHPA 2YK1L 2QADC 3CH1B 1CIDA 5MEQB 1KF9B 3NCCB 2VDOH 1HK6A 4OCRL 2V2XB 1XR8A 1NMCB 2OI9C 1EK3A 2F54A 2GJZB 5EO9A 5FYJL 1ZS8A 2XZAL 3MREB 1SHMA 4JCMA 3GJFA 1KGCE 1U36A 3BGFB 3FCTB 5JORA 1YECH 3ZZ1A 4UV7L 4BH8B 3MOAH 4DGYH 4I0KA 5AG8A 1DLFL 2IPUG 1WAAA 5GGUA 2QKIA 5H37H 4HS3B 1GH7A 3OAYH 4NPYB 2XWTB 4XVJH 3ARBA 4Y4HC 2APVA 2GIYA 4KDTC 1CLZL 1A7PL 4I48B 3RIFF 3NZHH 3PE9A 3HR6A 2BCKA 2DQCL 4UB0L 5EZLA 2IANE 3UTPD 2ZSWA 4XNYH 4GUPB 4X6EA 3G9AB 2GKIA 5DI8A 1YDPA 2A73A 1MFBL 2RR3A 3D9AL 3CVIH 3BW9A 3BH9B 3QNYA 1LK3L 3ROLB 4WU5B 3AB0B 5F1NB 5E2TH 2IMMA 2MCPL 5EOTB 3IJHA 1AE6L 1EO5A 1A3LL 4HBCL 1F3DJ 3RWDA 2B4CL 4OB5L 4L4VA 2WBJC 2AJXL 1K5NB 4DZ8A 5FYKE 4M8QB 1DE4B 2HN7B 4XP1L 1LEGA 1EVTC 1OB1B 2DRUA 3R0NA 3HLAB 1BD2B 3PWPA 4JANB 5ELIA 4EOWL 2YPLA 4S0UC 3AREC 5F21B 4U4BA 3QJHB 1YEHH 1FNAA 4M1GH 5GS0H 4WEBH 1CFVH 5E99L 4U7SA 4YDKL 1D9KB 2Q76A 3K2UL 1TZGL 3VGFA 1F02I 3NIDE 4YNYA 1I3GH 2YA0A 3CXHK 4BFBD 3VI4E 1HHGA 5IHZA 4E0RA 4Y1AE 3DPBA 1JWUA 1ZLWH 1F6LL 4X5XA 4Y5XC 1T7ZA 5FGCE 1I1YB 2CPCA 2XTJC 4N8VB 4HWBH 3NFPB 3OWEA 5E6ZA 3NAAL 3VXUE 3UAJD 2PN5A 5DEFB 3KPRB 1MCSA 1LO5B 4JFFE 3CFDA 2PXYB 1Y0LB 5H2BB 4J3SA 3HMXH 5D1XD 3UO1L 1QLFA 1U91A 1YN6A 5I1LB 2OJZH 4X98B 1LILA 5TQ0L 5IVXE 3HZYB 4X6CF 3MX0A 1N7MH 5MEPB 5JPMB 5EWIH 5C7XL 1A1MB 3O6FA 1NBZB 3C6LA 3QWRD 2I9TA 4EDWH 1CYGA 1X5JA 4YXKL 2X4QB 3MRDB 4N0CC 2P5EE 2DDQL 1W0VB 3ARWA 5LQBH 3GUTA 3TBWA 2V7NB 2BVUA 2F53D 4OTXH 4HK0B 4POZD 3BD5A 4U0RC 3IRZA 5F7EL 2R2BB 1PZUB 2Y9RT 3MFFA 1BZ7A 1LO4H 5CD5C 3MV9A 5T3ZL 1T7VA 5DHVA 1X5FA 4M1DH 4JPKH 4OZHE 2FECL 3HA0A 4IBLT 4H8WH 4PRPE 4QHUB 2ZG1A 5GGSA 2FJHB 1U8IA 4XCNB 2DTSA 1H9VA 3CFKB 2EDQA 5J6HB 5LKNA 3LKQB 3O6KH 1PKQE 3WJLC 3H3KA 3U46A 5F93C 1ZTXH 5C0GA 4LCUB 3HC0B 3F7RA 5JXAH 1DBAH 4X99B 3BIAX 1TPXC 3GSUA 4X7SH 4MNQA 2CR3A 3LKSA 5C0JB 5J7CC 4U31A 4JREB 1RURH 1HEZA 3GB7A 3HNVH 2XTLA 3GBMH 4KKAD 5J1AB 1K9TA 4F7MB 1U8KA 1CFQA 2YWZA 4WO4B 5FHAL 1ORQB 1A6UL 1F97A 4NNPH 1X7QB 3QFJB 4JO1H 1FH5L 3MLUL 2EDWA 1A6WH 4O00A 2VSDA 5DVKA 3NCMA 1OPGL 1QSFD 5ANMA 3EIFA 5CLTA 4C4KO 4HJGA 5IG7A 5C07D 1CCZA 1CD0A 2DQIL 1QOKA 1RUQH 4EKXA 3HZKB 4YHIA 5F3HA 1EVUA 1D9KD 2V5RA 3BH8B 3O6LH 4QHNB 3VXMA 3KWWA 3TZVA 4LSSL 1IC5H 1KXVC 3BWAB 1L0YA 2R39A 1KBGH 4HXBH 3TJEL 3F65A 3NIFE 3ECBB 2E6PA 3PGDA 2VLRE 2UWEB 3S8WA 3WFHA 5F70A 1N0LA 4XNUL 5EO1B 4XMPL 3D48R 4XCFH 1AO7B 5E2VL 1A14H 1C5BL 2HJKA 2Q7YA 1R5IB 1KJ3L 4C54A 4G8FB 4HGWA 3EKCA 3H9SE 4I9WE 3FO9B 2PXYD 4YXLH 3MNVB 4OLUL 5JTWA 3M45A 4MQTB 5DZLA 3FQNA 1HWGB 4XGZA 3C9NA 3H7BB 3VXQB 1NL0L 1UT9A 2X4UB 3TNMB 3FFCB 5EC1B 4NKIL 2V9QA 5CIPA 1G9ML 5MERB 1CLOL 5DD0H 3GK8L 4FG6C 3RUGB 4AH2B 4OLYL 1KIQB 5CBEA 1T6VN 4WV1B 1U3ZA 4I5BA 3DHJA 4P2OA 5DJXA 4D3CH 5FXCH 3RVUD 4OLXH 3ARYA 3HCVA 2OZ4A 3CFEA 5GRJL 4XAWL 3HTLX 4KI5E 2I27N 3L7FB 3QCTH 5H8DA 5JOPD 1T66D 3GMMA 5HHPB 4G43B 2H9GB 3T0EC 4NT6A 4X6BB 2VZUA 2ORBH 1LK2A 1XR8B 2P46B 2F54B 5EO9B 4Y19A 1ZS8B 2H32A 4Q9RL 3DIFB 3GJFB 2YD8A 4GFTB 3ULVC 4P5KA 1ZVHA 1IT9L 5CP3H 4HXAL 5BV7L 4MZ2A 4LIQE 5GGUB 3ZL4L 3K8MA 5IJKA 3SDDB 4HJJH 3RP1A 2FZ3B 3ARBB 5GZOD 5KVDH 4WI9A 1MQ8A 3R4DA 4JO2H 5H37G 3QUXC 43CAB 5B4MD 1KPRA 5BOZG 2ZSWB 5CUSH 1FL5A 2XWJB 4X6EB 3UYRH 2R4SL 3VH8G 4NQUA 2RQ8A 5DI8B 1P4IH 1YDPB 2FYYA 1Q38A 4WO4D 3BW9B 1OAUL 3QNYB 1BX2A 2LAAA 3QFJD 4HAFA 3AM8C 2P8LA 1YQVL 2VLME 2R2EB 3GMNB 3V4VL 1OY3B 1F45A 5FYKL 3AS2A 4LCWA 4KK5C 4JPWL 3MJGX 3SGEI 4Z78A 4L4VB 5ESAA 2AV1A 4FA8A 1MIMH 3HC3H 4HUUB 4DZ8B 1IAIM 2NXYD 1T0PB 1TJIH 1P7QB 2Z31B 4XH2B 4RMSA 4Y4HA 3PWPB 5EIIA 2YPLB 3KYMB 1LD9B 2NY3C 5HI4D 5IB2A 3MRQB 2DICA 1OLZA 4M5ZH 4GAGL 1F4XH 4YNYB 1AP2B 1AO7D 4HX1B 5EIQA 3L1OH 4HHAB 5IHZB 4E0RB 5E7BA 2ESVB 4KI5F 1FE8H 5MEOA 2D7NA 3UTTB 1KB5H 1F42A 5KSBF 4ZMAT 5I8OL 3DUHA 4PV9A 5E5UB 1F3JA 1PZ5A 4M9OA 5DEZA 4R3SA 5D96B 4EI5D 4W4NA 3MLXL 3DSFH 1S78D 4TUOB 1U3YA 1NCUA 1J8HE 3CFDB 4R90H 1CXEA 3CVHB 4OKVA 4MA7H 1YN6B 4LU5L 2NX5E 3NOIA 1OD9A 2FSEA 4NQSA 4KKLC 1DBJL 3QDME 1BM3L 3AREA 4ZO8A 5DF0A 1Q94A 1ZMYA 3MRRB 4KJWC 3O6FB 3C6LB 2I9TB 2J2ZA 3EOBB 3V0WL 3NABL 3LH2L 4GKZA 4YWGH 1S9WA 1PD6A 1QO3A 4FQLL 2EIBA 3GUTB 3TBWB 4AMKL 1QR1A 4P23D 3KYOA 2DBLL 1E6JL 2DJ4A 3O2DH 5C6TL 1ED3A 3K1KC 5HYSB 4EJ1C 3U0PA 3MRKB 4OQ1A 5I8CB 4YHMH 3S6CA 4WY7H 3MFFB 4Y5XA 1BZ7B 2P44B 5TE6L 3MV9B 3B6SA 1OOAA 1I1AC 3B2VH 5A40E 5HY9B 5HYFA 2D7MA 5KS9E 2PTTA 2VDML 5ITBL 1IM3A 1RZ8B 4TULL 5DHVB 2NY6C 5BXFA 1JP5A 3B5HA 3ZE2E 2E27L 1ACZA 1RV6X 4YC2C 2J6EL 5GGSB 2MOVA 1C7SA 1U8IB 3JV5A 5I71C 4WFED 1HI6A 4OFIA 3ULUH 3T04D 2FO1A 4HBQA 4GG6B 2HKHH 1JL8A 2X4SA 1JFQH 4N0CA 3CDYA 3KJ6L 5DMIL 4S1QH 3KHQA 2DF3A 4MS8D 5I1AA 1WBZA 3BIBX 4GW1A 2VN4A 4YBLB 3X3GH 4OFPA 5JR1H 3QXAA 3FQTA 4MNQB 4KQ4L 2QSTA 3GRWH 4PJAA 3Q6FA 8FABA 1LMKA 3C87A 3GB7B 1RUAL 3JTTB 2FHBA 4MNGA 1C1EL 4LF3A 1VFOA 4OGZA 2FL5A 3EZJB 4PGDB 3RWFA 2A74A 1L7IL 5HI3C 1PYWB 1IARB 1OHQA 3IU3A 4U6VH 3RWHB 4MWFB 1P7QD 2Z31D 2PR4H 4Z7VA 2GUOA 4YH6A 1UZ8B 3WJLA 4HJGB 5D6DA 4DOHB 2VE6A 3QNXB 5J12B 4OZFH 1DTUA 5I19H 1E27A 5I1CL 4YHIB 1FCGA 4WFGD 5F3HB 5EUOE 4PYHA 1IGIH 1MY7A 4JKMA 3TZVB 3MV11 4KQ3L 1C16B 3JWDH 4JVWA 3GJFK 3SDCC 1HHJB 2ESVD 1MFEL 3UTTD 4WIQA 5D7LA 4QRSA 5BZWA 2DWDA 1CG9A 4KZDL 1Z6JT 3IXTB 1BVLB 2Q7YB 3MZTA 2NW3B 2VLLA 2X9XA 3VG9C 2RJMA 4NM4L 3LMJH 4H88H 4IIQC 1IEHA 3BT2L 4AT6A 3FQNB 4XGZB 1B6UA 3C9NB 1J05A 1KTKE 1Q8MA 3SJVE 4JFEE 1M05A 3ILQD 5CIPB 4ELKA 3S4SA 5CSGA 4XP9L 2DQGH 1YNKL 1KJ2A 3DV4B 4GAJL 5CBEB 5D72H 4U1IA 4I5BB 5DJXB 3VFGH 3OR7A 1B4JH 5C9JA 3CFEB 5C0CA 4JEGB 4PJEA 3V5HB 2XWBA 2IGFL 4PGEA 4G8GE 3QDGD 1FV1A 3BESR 2J8UA 4PJCE 4FQIL 2HTLC 2YD6A 4JKPH 4O2CB 3PQYE 4LIQL 4HT1L 2BERA 4P5KB 1RK0B 1T1XA 5D1ZD 1KXTB 1V05A 4FQCL 3GM0A 3H3BC 2QJDA 2Z91A 3BZDA 3CLEH 3MMEA 5CP7A 4MJID 1BOYA 2DN7A 4MXVF 4LCIH 1AKJB 2Y07H 1RZFH 5B21A 3CD4A 1ZLSH 4KRNA 2Y4SA 2XYCA 4ZDHA 4KVCH 1O0VA 1N59A 5D5MF 3KPNB 2QADB 3P4LA 2PW2A 4M43L 4X5LA 3T0EA 5JXEC 1BX2B 2OI9B 3V79C 2P8LB 2E8ZA 3DI2B 3MXWL 2AXFB 5ALBH 3D39D 3ES6A 5HHOB 3FQUB 3KPTA 3MOAL 4DGYL 1ETZA 4Z78B 4YUEH 4TTDD 2R9HC 4R9HA 2ZP0T 1HYRC 3V5KB 2G9HA 1MF2H 1MCNA 4XVJL 4Y4HB 2X70A 1KJMB 3W11D 5E00A 3AROA 4JR9H 4K3DH 3QUXA 1LO3H 1ITBB 1QSEE 3QUKB 1TZHA 2OTUA 1DEDA 4H0IA 4O51A 1JWMA 4FXLA 5FO8A 1ZLVK 3RJQB 4N1CA 1TMCA 4TYUA 4IOIA 2DQUH 4B41A 3CVIL 1K85A 1S7RA 5MEOB 3BJ91 3DNKA 1ZT4B 3AM8A 1R24B 2C1OA 4PV9B 4PJFF 5E2TL 4MZ3A 2ITDB 5H94A 3EDDA 1F3JB 1PZ5B 4R3SB 4JFDB 5B39A 4PJCF 2WBJB 3VXSD 2VITB 1JVKA 1CGSL 4AENA 2YD1A 5C6WH 2OXHA 1H3WM 1YEHL 5I30H 2WLZA 4M1GL 5GS0L 2ITCA 4RGOH 4KY1H 4WEBL 5FECA 1QR4A 4QOKE 3TA3C 1J12A 2VR4A 1GPOH 4GKZB 1JZ4A 3EDFA 4DZBB 1A4JA 3KYOB 1ED3B 1CT8A 5K59E 1WWAX 3U0PB 2EE2A 4DUWA 4XVSH 4PGZA 4Y5XB 1OAXH 2NY2D 2ZOLB 5J13C 4HWBL 5D93C 4R7NB 3VW3H 3MFGB 5FUOH 5BXFB 1IC1A 1CXIA 3IVKA 2A1WH 4IRZH 1PX3A 3WIHL 3F7PC 1IGYA 2OJZL 3MLYH 5T1LA 2AP2A 5D70H 1N7ML 3W0WD 5EWIL 3LRSA 1JZ7A 4U1SA 5IUSA 2O5XH 4EDWL 2X4SB 3C8DA 5IROC 2E8YA 5LQBL 4X4MA 4JFHD 4FFEX 2DMKA 4PG2C 1ADQH 3RWCA 5I1AB 1WBZB 1AKJD 1MCPH 3IAQA 1QFPA 5CCKH 2VB5A 1XGQA 2EIDA 4OTXL 3L7EA 4KTYA 4P46D 4U0RB 5F7MC 3SGJA 3DV6B 1ZHLA 3FQTB 4XBEH 3V52H 1LO4L 3GNMH 4HULB 2UZIH 5EU3A 1IEAA 4QWWD 3VJ6A 2FX8H 2EIEA 4JPKL 4MNGB 4LF3B 4KGLA 2NMSA 4H8WL 1GSMA 2XKNA 3RWFB 2A74B 2JB5H 2WBWB 5MENE 3I02A 3UTQA 1G7LA 4LHUG 3IU3B 4M8VA 2HLFD 4U1JB 2DJSA 2LU7A 4TUJB 2YD2A 1I3RA 4LKCA 5D7IA 3O6KL 3PWJA 4BSWA 3W9EB 4AZ8A 1FRGH 4IRSC 4MMXC 1E27B 1ZTXL 2W9DH 1T22B 2VLJB 1XF5A 2GT9B 5HPMA 1LO2H 1I7ZB 2EYRA 3WYRA 1S7TB 5JXAL 4NC0B 4W6XB 4HMEA 1DBAL 4KKCD 4OZFG 3T8XA 1UKQA 4X7SL 1MI5B 1TPXB 4RWYH 5E5MA 4PJIE 2EO9A 4L5FH 1RURL 1DL7H 5GGQH 5IR1B 4Q7DA 5D7LB 3HNVL 3H3PH 3GBML 1KLGB 3OXSB 5M95B 3WLBA 2DWDB 1CG9B 4XP6H 4QHLB 1QHPA 2UV3A 1N5AA 2A6IB 4WUKH 1PG7X 4NNPL 4X8XA 5HD8D 4JO1L 4PJBE 2Q6WA 4X4ZA 2VLLB 1A6WL 2ENYA 3RTQC 4PJXA 3MPCA 3FN3A 3ZYIA 4JO3H 1YPZE 4L8SB 1G9NC 3WS6A 3RKPA 4AT6B 1RUQL 4KKNA 4KJPD 5C07A 4P3CH 3O6LL 4NQDB 2OTPA 2VYRE 1XT5A 1UJ3C 1IC5L 4ELKB 4F7EA 1YYMH 3UZVB 1KBGL 4HXBL 1VACB 2VABB 3KDMB 4IMKC 3SDCA 1TJHH 4U1IB 4R97C 3HB3C 1QSVA 3OR7B 5DJCA 5C9JB 1JBJA 1A14L 5C0CB 4U6XA 2GJ6B 4M3JA 4F7TA 2XWBB 1FNHA 4HZLA 4PGEB 1FV1B 4YXLL 2J8UB 1U8PA 1WTLA 4ELMA 5E95B 4FQ1L 5JDJA 2IFGA 3QUMA 5IBLC 4JN1L 4LLWB 2P8PB 5HDOA 3FHQA 1UM5L 1DQTA 3G6DH 5DD0L 2Z91B 4MJ4A 4RX4A 5H35A 1KENH 5FDYA 4XMLH 4XP5H 2VC2H 3MMEB 3QDJB 4IDJH 1LE9A 1P5UA 1S9XA 4OLXL 3QCTL 2H3NB 4M6AA 1N59B 1YMME 2M26A 4ODTH 1JNNH 2ORBL 5SWSD 4JO4L 3FOLA 2Q7NA 3ES6B 4TN9A 4KJQD 3QUZC 5CZXD 1ETZB 3JUZA 4YPGA 4K8RC 1XF3A 1CE6A 3JSSA 3WIFA 4E41E 4UQ2A 3L6FA 3TCXA 4AG4H 4XTRC 2VLJD 2WUBH 4MHHI 5ID1B 1HQRA 5GPRA 5KVDL 1D7FA 4P9HC 2VXSH 2X70B 3UC0H 2EDXA 1JJUA 5DURB 2W92A 5E00B 4JO2L 4W4OC 3QUXB 1MI5D 2JKXA 2PCPA 3MACL 1KTRL 3O0RL 4ZYKA 5CUSL 1CFBA 1LGVA 4A6YH 2DM3A 4O51B 5FO8B 4U3CA 2DMCA 3BPNC 2CRMA 4C56E 1TMCB 3Q2CA 4IOIB 3WMSA 1P4IL 4JPIA 1BQUA 1S7RB 4BYHA 4UNUA 5JXEA 1JYWA 3GO1L 4JFXA 4NN5C 4JG1H 4ZTPH 5JUEH 4ZPTA 1FC2D 2JF1A 1P69B 5H94B 1DJSA 5B39B 3S35H 2HVKA 3EOYG 2W65B 1MIML 3GMRA 3HC3L 1KJVB 4LEOB 3VDCA 4PJ5B 1A3QA 4AENB 1TJIL 4N5ED 4GLRI 2I9LA 2FWOA 4NQDD 4LP4A 4M02A 3QQ4B 3VXTB 2VDKH 5D6CA 5E5RB 4FTVD 2NY3B 2JB6A 3PHSA 4JFOA 1BPVA 2HT4D 3CDFA 5DTFA 4RA0C 1U95B 1RJCA 4U6HB 3KLAB 3DX6B 4BQCA 2DAVA 1CT8B 3KLHD 2D9QB 2G75A 3BUTA 4ETQA 4I2XB 1OTTD 2JLLA 5J8OA 1V3KA 5DMKB 1D5IH 4KDWA 5EZJB 3DSFL 5HHVH 2H6PB 1BQHA 3IVKB 1U93B 4EI5A 3IXAA 4R90L 2E6JA 3IDMA 4MA7L 1SJEA 1D5XA 4D0BA 5T1LB 4PRIB 5J9PA 2KKQA 3CVHH 3LRSB 4N8VG 4LQFL 3IDIA 4U1SB 3G6JA 3OKNA 3TIDA 4WHDA 3TA3A 3QDJD 1E4JA 4YWGL 3WUWB 4YHYC 4OZ4B 3RWCB 1GOFA 1BD2E 3O2DL 4OLWH 1FFNA 4YHML 4DKFH 1GC1C 4J6RH 3OZ9H 1I1AB 3BDYH 3VJ6B 1A4KA 3TT1H 4UI2A 2XKNB 1ZT1B 5IMMA 1QFWM 3GZKA 4YC2B 1EXUA 1VGEH 3I02B 5L88H 4Y5VB 3UTQB 5I71B 3ULUL 1UZ6E 2BNRA 4WEUD 1KOAA 4FFVD 4I8DA 2HJFA 3DROA 1MWAB 4LKCB 5D7IB 2FR4B 2HKHL 3TEUA 3PWJB 4BSWB 1F4WH 3KPRE 1CICD 1YJDH 3VDAA 2DKUA 1JFQL 3FB6B 1VADA 4S1QL 3D6GA 4PG2A 3IGAA 3D3VD 3MRCA 1N8ZA 4G7YH 2BHUA 2C4FT 5HPMB 1XF5B 2VLKE 1V5JA 2EYRB 3X3GL 5JR1L 4JM2D 4OKDA 5I16A 1O7VA 4PRHB 3GRWL 5E5MB 1D6EA 3V4UH 2CRYA 3VRIB 3FB8A 1G9EA 1I7UA 1A0QH 4ETYA 1MAKA 1FG2A 4KFZC 3WLBB 2OR9H 3BGMA 3GKWH 5KVFH 1N5AB 3RY6A 2Q6WB 2EXWD 2XA8H 4U6VL 3F12B 4PJ5D 3O9WC 4PJXB 2PR4L 5JPNB 2DI7A 4MDJA 2OS7A 2OTWB 3VWJD 1RMFH 4YDIL 2NR6C 1ACYH 3TNNA 4UT6H 4IRSA 1M71A 4DKEH 4RBPH 1EHXA 5TPWH 2ZOKA 1IGIL 2FNBA 1T3FA 4TUKL 2NY4C 4F7EB 3IKCA 1KXQE 4YZFE 5IJVA 2XXCB 3SDCB 4R7DB 4GW4A 5C1MB 5DJCB 4XPHH 1NMAH 2ZUYA 4WI8A 4LQ1A 4S11A 4U6XB 4LCYA 1EBPA 4F7TB 4KVNH 1OF2A 3WO4C 4MGXA 2YHGA 4LGRB 4QXTA 3SKOA 1FNGB 3VG9B 3RTQA 4Y5YA 3MBED 4KAQH 1DLHA 3DVIA 3LMJL 4JHAH 1J9CT 4ELMB 4IIQB 1MUJA 3DOSA 1WIOA 4APQC 3O45A 3QUMB 2CD0A 5I66A 3V2AR 5D7KE 3LAFA 1CDHA 1A7NH 1UJ3A 1T1WA 2DQGL 2HFGH 1BF2A 3C5ZD 4DKAA 4HDIB 4IMKA 1T03L 3PABA 3AAZA 5D72L 3RGVC 5C08D 5EDXA 3VFOA 3A6CH 3VFGL 1B4JL 4HLJA 1S9XB 3L3IA 4Z7OE 4PJDB 2DI9A 4H26A 4OFDA 1R3LA 5IOPA 4LSTH 2FEDC 1MQKH 4PLOB 3WKNA 2OYPA 3FRPG 2DLFH 4P5TB 1DUYA 3FTGA 3BVNA 1AO7E 4X5WA 4JKPL 1WCQA 2B0SH 1MJJA 1KSRA 5ISZE 4PDCE 2LABA 2PO6C 5JHLH 3QFDA 1EV2E 4YPGB 2GAZA 3RNQA 5CBAA 3WIFB 3QEUA 1V7MH 4HZAA 3L6FB 3CLEL 5EORH 4GMSH 3Q3GB 3IDJB 4UT7H 1R5VB 3MV7A 3FFCE 3R0MA 4GLRH 4LCIL 4PRHD 1A2YB 4OZIA 1RZFL 2JJSA 3BZFA 2EKJA 1ZLSL 5GISH 1U2CA 3HKFA 3RUGE 4KVCL 4OF5A 3V95A 4LDLB 5BOPA 5EC2A 1SY6H 4LSVH 4XVUC 1NJ9A 1A7BA 1FPTH 4JFXB 2RCSH 5ALBL 1AGFA 3QUZA 1NC4A 3D39A 25C8H 1IC7H 3ZDXE 3PGFH 3KLDA 4NGHH 1FL3A 2F54E 2I9LB 3FRUB 2WMPA 1BECA 1IAII 4JR9L 4K3DL 2HFEA 1FAIH 4W4OA 1LO3L 4YIQA 5D6CB 3EO0A 3BP6A 4UINH 4HIEA 1AQKL 2GY5A 4ZUTA 2UY7A 3RKDD 2VTFA 2OSLA 3ARDD 5DTFB 3V7MA 3GM8A 3ARTA 1QLEH 4OV5A 2NY0C 5GRUH 2EDYA 5K9KB 1XEDA 5EU5A 5CZKA 1F4YH 1UWXK 5C92A 3K7UA 3P77A 4ETQB 4U3HA 4TNWK 3DMMC 4ZS6C 4X6DB 3WN5A 1JI2A 5ALCH 2HLAA 4F15C 4LKXA 2MFNA 2QQLH 4AJ0A 2PTVA 1BQHB 4PBXA 3IXAB 1S5IH 4XC3H 3RAJH 4TTGA 2Y5TA 4TPRH 3IDMB 1SJEB 3VXSA 1D5XB 3NPZB 5J9PB 4UOJA 1OL0A 5ECJE 5CD3B 2YBRA 5I30L 3DUUA 4RGOL 4KY1L 4L4VE 4R96A 5DS8A 5FCSH 3OKNB 4XP4H 4PP2A 3T4YA 1GPOL 3TIEA 1FYTA 3D85A 4V1DD 5DVOA 4Q97A 2AS5M 1AGDA 5E6ID 5EU4A 3HI6H 3PWPE 5F7DA 4PTUB 1SEBA 2YPLE 4CVXA 3PP3K 2OL3A 5TDPA 1A9BA 1OAXL 3HZMA 4P5TD 5J13B 3VW3L 5D93B 2JIXD 3S36X 3MLRH 3D2UB 5FUOL 4GKNA 5DRWB 1JK8A 3RZCD 2G5RA 2VH5H 2A1WL 5DZOA 2ESVE 4IRZL 5HYSG 1A6AA 3BYTA 3AMLA 4J3XA 4NO2B 3MLYL 5DQ9B 1EXUB 1Z9SA 2V2TB 5D70L 5E56A 4LNRA 4ODWA 1EEZB 4FFWC 2BNRB 5C09A 1XR9B 2HJFB 3DROB 5JOFA 4F9PC 4OZGF 6CGTA 2PW1B 2QSCL 2DQFA 3CPLA 3DXAD 3SO3C 4I0PC 1VADB 4HKBB 1ADQL 3QR2A 4YFEA 1MCPL 1OVZA 4OF0A 2EYSA 3MRCB 1N8ZB 1WAAF 5CCKL 1S3KH 4Z7QF 3T0BA 3JWNC 3QIBC 1I1RA 2IBZX 3UBXA 5I16B 4N90D 4XBEL 3V52L 4ZUSA 1J0HA 1MAJA 1D6EB 1F6AB 4YDJA 5CILH 3BQUC 1LWRA 3K80A 5DMJB 1YY9D 3TO4D 3BGMB 5J3HC 4LCCC 3ABZA 2ZUQC 2JB5L 2APFA 1Y18A 4DUXA 5LBSH 2P5WD 3IFLH 1HCVA 3MV9E 2E5EA 3MUHL 5HDBE 2LVEA 4KV5F 1FRGL 3KPPA 4P99A 1N4XH 5I1JH 5C0BD 4IRSB 1M71B 3ARGD 1LO2L 3X11A 3F6LA 3WXVL 2ZOKB 1HILA 1JMXA 2H26A 1T3FB 3IT8D 3IKCB 4GG6E 5TE7H 2EICA 4L5FL 1DL7L 5GGQL 3S37H 4OUUA 3JV6B 3H3PL 4GW4B 5HPOA 2R1YA 5J1SC 3MROA 2X7LA 1EPFA 4XP6L 5HI5C 1RZKL 4LLYB 5CFHA 1SMOA 4UTAH 4WUKL 4LCYB 3ZTNL 5J57B 1N0XH 5JOEA 4FQXC 4NYLA 3L5XL 2CLZA 1OTUD 4MNQE 4DCQA 1I1FB 3KYKH 5E03A 3RTQB 5FO9A 1DLHB 2V5SA 5IFHH 1HSBA 1A3RH 2VAJA 4JO3L 3U83A 1MCWW 4IRJD 5B22A 5CWSB 1G6RB 3NPSB 4KRPD 3O45B 1VKXB 5I66B 2VDRH 4M93C 1KEML 5GGTH 1JPSH 1MLCA 3LZFH 4MA8H 1UG9A 1DANT 2C3VA 1U8NA 2NPLX 3HUJF 2YXFA 2CRZA 3O3BB 2AJVH 1T1WB 5ANME 3OAZK 4DOHE 3VG0H 3PABB 5I1IH 3AAZB 1TJHL 3IF1A 2DBJA 5BO1H 1NANI 1JZ3A 3WS3A 3AUVA 3MO1B 1CXKA 5F7FA 4ENED 1U3HC 3K1DA 4H26B 4P2QA 1OTSC 4PRBB 3LQZA 3MLSH 4DUVA 4MHHG 5IHBA 2A6JA 1B0GB 2X41A 3TH4T 2Y7QA 4NDMA 5DMGC 3RNKB 2D7TH 5BS0A 3FTGB 4OIAA 4X5WB 4PIRF 4LVOC 1MJJB 4APQA 5HYEA 3BKCH 1DN0A 4L4TD 3B3IA 3QFDB 4GQPH 3RNQB 3TWCH 2BVOA 4RGND 2CDFA 4HSQA 4U2YA 3G6DL 4ODHH 5EULV 1KENL 4XMLL 3EGSA 3I6KA 4XP5L 1GHFH 2RGSA 4M03A 5LAXB 4NKDA 3RGVA 4CL7A 1RUMH 1FVCB 4IDJL 3MV7B 5F7LB 4UNTA 4Z7UA 2YD9A 3BZFB 5D1QD 2NY1C 2E3VA 5ACZA 2DM7A 4WCYH 3AS1A 4G8IA 4ODTL 3SY0B 5JA9A 1GGBH 1JNNL 1NJ9B 5CJOL 4UU9A 8CGTA 1HHIA 1TXKA 3RY5A 2HA1A 4FQ2H 1AGFB 1EUUA 3QUZB 1MJ8H 4OF3A 1NC4B 4P2RA 2PO6A 9CGTA 2WP3T 1CU4H 2HG5B 5JDSA 1FBIH 4HUMB 3L95B 5JO5A 1FL3B 1JYXA 1IAOB 2BXYA 3MA7A 4P49A 2WUBL 4Y19E 2W91A 4JRXD 1R6VA 2X89A 3VMPA 4KROC 2VXSL 3NIGF 1BREA 3C09C 2GI7A 3EO0B 2LVCA 3LEVH 4HIEB 4IS6B 5E08H 4A6YL 3SCMB 1BJ8A 2OSLB 1FL6B 2D2OA 3HAEH 4NKOA 5FYJD 4XWOC 3BPNB 3GSWA 3S88H 1DQJB 4K3JH 5DJ8A 4U1GC 1JYVA 4HFUL 2AQ2A 3P77B 1I3UA 3KR3H 3FN0H 4JG1L 4NN5B 1WWCA 4ZTPL 3WE6A 2HLAB 5DJZB 3HR5A 5LXGH 3QZWA 1C5DA 3KXFD 5C0NC 3S35L 1U8HA 3RWIA 1KPUA 4NZRH 1CLYH 2OQJA 3EO9H 5DA4A 3MNZA 3MRNB 5DWUH 4G6MH 3ZO0A 1BZ9A 4JPVL 4K3GA 5HHOE 3M07A 1L0QA 2WY3A 3OKDA 2VDKL 3RVTC 3BO8A 3OJDA 3WNPA 4R96B 1UXSB 5DS8B 2D7OA 2YRLA 4DKDC 4PP2B 1W2KT 1F2QA 4LVHC 3TIEB 1FYTB 2MHAA 3D85B 1JYNA 4JRYB 4PB0H 3VWKB 1I7RB 2F5AH 4J3WA 4UQ3A 4JGMA 5F9JA 4U1MA 5C0RH 3EYOA 5D2NB 4WWKC 4Y88A 1QHOA 4CVXB 4OGXL 1XF4A 3BDBA 2CGRH 2OL3B 1KCKA 1CIUA 2ED7A 5TDPB 3DX9B 4OD3H 4XBGA 2B5IC 1A9BB 5T3XH 4ISVA 1WBXA 5GJSL 1D5IL 5HHVL 4S1DD 2VXUH 2P7TA 4PP1C 4UBDD 2ZKHH 1A6AB 2VZ3A 5JLZA 1EGJA 5CEZE 1R0AH 5AEAA 5I17A 1P84J 1S9VA 4H1LB 4LNRB 3CVHL 4N0UA 4DGIH 4JFDE 2DM4A 4MCZA 4Z6AT 1UYWH 3OKEA 3CLFH 2DQFB 4NQTA 3SHSA 1MSPA 4OLWL 3U79A 2X1WL 4K94C 4PD4J 1OP3K 3IDXH 4DKFL 3UBXB 2V2WA 3T0XA 3IJYA 1FN4A 3PHQA 4QRQB 3FQXA 4RCAA 4NBXB 3OZ9L 4U6YA 4LEXH 1UJTA 1WFUA 1FFPA 4F33A 5HDLA 3BDYL 4YDJB 1OCWH 3TT1L 3P40A 3ZSSA 3FO0H 1UH3A 1A7OH 3RHWF 3RVWC 1AI1H 1Y18B 5L88L 3MCLH 1FFOA 4JQVC 2XTJE 1ES0A 3H0TA 1XGRA 2YWYA 2CKBA 1YJDL 3KPPB 3QYCA 4YAQA 3NA9H 2ZCKH 4A2MA 4I0PA 1MWAH 4ONHA 4WHTA 5KSBA 4G7YL 3X11B 5T3ZD 1HILB 3SCMD 4NQXA 3P4NA 3QIBA 1EDQA 2H2PC 2YPKA 4OIIH 5JZ7D 2QQQA 4DVRH 1N2RA 2ZCLH 1H8NA 4JM2A 3V4UL 2FX7H 4JN2A 4DWHA 4OUUB 1A0QL 2R1YB 3BQUA 3GSNA 3MROB 5E8EB 1H0DB 2X7LB 3D69A 4X6CB 2OR9L 4TVPD 3GKWL 5KVFL 4LCCA 4NJ9H 5D2LF 4WENB 2CLZB 4DCQB 2XA8L 1NANH 4LRNL 2DKMA 5FO9B 3O9WB 2Y6SD 1HSBB 3W81A 2C3HA 3AU1A 5L2KA 2AV7B 4MNGE 2RHEA 3V4PH 1RMFL 4Y0GA 1JF5A 3P11H 5KAQF 3VXPA 1UADC 4OFVA 1WF5A 4NNXA 3VXNB 1MLCB 3DX8A 2C3VB 1U8NB 4TOYH 4MB3A 4ZAKC 4E42A 4JRYD 3TYGH 3CCHA 1RZJH 2BVTA 5CHNA 3VWKD 4CW1A 3BOVA 1YNTA 2C9AA 1CD1B 1ZVYA 2OLDA 5D7JD 2YZ1A 3BI9X 3CK0L 1OGTA 1T80A 4XPHL 1NMAL 3ZDYE 2R1XA 3ZE1E 5GSVA 3PG2A 2F5BH 4PJ9C 2ZPKH 3AFLA 4PLKD 4HCRH 4KVNL 4JY6A 4P2QB 4XMKL 1VPOL 4FQXA 3WO4B 3N1QC 4P59H 3VFTA 4PB9H 2A6JB 4M7JH 4KAQL 5IGXH 5D7LE 1RUKH 4JHAL 4NDMB 4O02H 4FNLL 4Q2ZA 3TH3T 4APQB 4FZ8H 1MCHA 4NFBA 5BRZB 2WANA 5KZCD 1X5HA 5F1KC 3B3IB 3GMLB 4Y1AB 3IAPA 4F3FA 2QR0B 3JWOH 1RFDH 1A7NL 5DO2C 4CDGC 2HFGL 1MFCH 4CNIA 3QHFL 4CJ1A 1CN4A 2F74A 4QTHA 3WJJA 5FGCB 1Q1JH 4NHUA 3O3UN 3C5ZA 4QF1B 3RGVB 3BKYH 1QYGH 5F88A 5C71A 3A6CL 2WAHA 2EXYC 2XFXA 4XPGH 3H8NA 4GAYA 1I9RH 5C08A 1JI1A 1XIWC 5DEGA 1GVIA 4JFFB 5INDA 2VXTH 1MIEH 1MHEA 3CUPA 4I4WA 5DT1H 1U3HA 3PXJA 3GSVA 3ULSB 4OM0H 4LSTL 4ZUUA 4G42A 3QXWA 4UU9B 4PJAF 4U05A 5C0CE 3OB8A 3WFCH 2B0SL 5EBWA 2GJ6E 1H3UA 4KGJA 4MAYC 4PJEE 5JHLL 1CD8A 4P2RB 2PO6B 5IEHB 2C3XA 1V7ML 2OXGA 2WWKT 3JUYA 2J8UE 2MPAL 5JO5B 3SDXA 5A43C 5JDSB 1HDMA 2IBZY 2O5ZH 4WTZA 5EORL 3TJHD 3S5LB 1A02N 4UT7L 32C2A 4Z7VF 4Z7WF 1BVKB 3MV8A 4LOUC 1I9JH 2DIAA 1FZMB 3D87B 1BFOA 1I85C 3RIFK 5E70A 5GISL 4I3SH 4M7KL 4NKOB 3AY4C 4V2BA 3ZE1F 5B3JF 1HCFX 4RGMC 4GH7B 2UVFA 1YQ2A 5DJ8B 1EFXA 4LSVL 4WI5A 2JCCA 1FPTL 3VA6A 5DLMH 4F58H 5ICZB 4MA3B 3UTSA 2AXJA 1C5CL 4R4ND 3WE6B 4TSCH 3O9WD 3QXDA 2W60A 3MR9A 3HR5B 3WD5H 3BUYB 2IAND 1C5DB 3QZWB 3I3EA 1GL4B 1M7IA 1QEWA 1IC7L 25C8L 3KJ4C 4HS6A 3OAZH 1U8HB 4Y4KC 4Z0BH 3UJIH 3PGFL 2OQJB 4WHYH 4EUPA 3T0EE 5DRZA 4LDOB 2APWA 5FHBH 1MCLA 3OXRB 2B2XL 4XCCH 2XT1B 2WK2A 3VI3E 1BZ9B 3ULVE 1FAIL 3OKDB 2YXMA 4R4BB 2I5YL 3OJDB 4UINL 1JHTA 5B39G 3ZKMC 2AKRA 4WW1B 2V9TA 4U1KA 4N0RA 1DQQB 1QLEL 3O8XC 5DJ2A 5GRUL 1XF2B 2NY0B 5FYKD 5A2FA 5F9JB 1F4YL 2DL9A 5FM5M 3O4OC 2GTZB 3U30C 3WLWD 1XF4B 4U1NA 1MEXH 1ULVA 3DMMB 4XBGB 4P48A 1URLA 2EDRA 4ISVB 1WBXB 4E5XB 5F44A 3O4LA 3T65B 2QQLL 3KPSB 4KU1A 4F15B 4EBQL 1ZK9A 5FYLE 2P7TB 4NO5B 1A64A 3LY6A 3GI8H 1S5IL 4KK6D 4XC3L 3RAJL 4L8BA 3S96A 1N5YH 1G7IB 3TBYB 4X9BA 5I17B 3VMOA 4Y1AD 3BMWA 4QYOB 1E4XI 1MCIA 1TTFA 3LSOB 4MXQC 5DRXB 5A2KH 4RDQG 4X0KA 5DZNA 3B9EA 4N0UB 1JZ2A 4OFYD 3QHZL 3RA7H 2W0FA 4MCZB 4XP4L 3EYSL 5D5MA 2VZOA 5JW3L 3VXUD 4FXGA 3MJ9A 5C0AA 3HI6L 4JFFD 4MVBD 3BP5B 5KSAC 4WWKA 4PRNA 4MXWH 3BZ4A 1UH2A 4Y2DC 3TPUA 2V2WB 1IL1A 3IJYB 4OGAC 3FQXB 4I0CC 4U6YB 3MA9H 1JNJA 3L5IA 1FFPB 3WUWG 3MLRL 3FFDA 1T2JA 3WFEH 2P5ED 2VH5L 3B9KD 2W1NA 1IGCH 2BFVH 5T3XE 3TESA 2GTWA 2HT3C 3L9RB 4GBXC 5B8CC 4I2XE 3LB6D 1G6VK 2P47B 3MLZH 4HS8H 3B5GA 4C58B 5J11C 1FFOB 1ZHKA 4NRZA 4ZSOA 1WV7T 1ES0B 2BNQB 5ICXB 1QFWI 1XGRB 4EIZC 3D1MC 2ATKB 2CKBB 3PL6C 4YAQB 3GHEH 4G9DA 2NTSP 3RL2B 3VGAC 4I0PB 2P43B 2C3GA 5KSBB 4PRIE 1H8OA 4PRPD 1S3KL 4PJFA 1P53A 4GRWE 5IKCA 3P4NB 3QIBB 3HE6A 4K55A 1JTTA 4NCC1 3N1PC 3WHE1 1EAPA 5F96H 1QSZA 2PYEA 2AJSH 5CILL 5DK0A 4PGJA 3GSNB 4NC1C 2NY5H 5HHQA 5I74C 5E8OA 3ARFD 4PBVC 4LCCB 3QQ9D 2ZUQB 4FHBD 4FQQB 3WFZA 5JHDA 5LBSL 4OT1H 2Q86A 4X7DC 1L4IA 2X4RA 2EEDA 5L2KB 4UDTA 4BFGA 4Q0XL 1N4XL 3LKOA 5I1JL 1MCFA 4XZUB 5KVGH 2J1KA 3T2NH 5IW6A 2AEQH 4P4KD 5EBMA 3DX8B 1F58H 3KPMA 2IPTH 3ZKND 5IW3A 1NAMH 4M1CC 3CFCH 3UBXI 5D7IE 4E42B 5LJYH 5L8JB 1R3HA 5CJQH 4U0QB 4J1UA 1YEJH 2HH0H 2NY0D 4CW1B 1YNTB 2ADIA 5TE7L 2JELH 2OMNA 5T1KD 4HC1H 5C70A 1F11A 3LOWA 1OGTB 1ZA6A 5GSVB 4KK8C 3L5WA 4UTAL 4K07A 4JLRA 4JY6B 5FYJH 5IB5A 4FQXB 1HSAA 4PRHE 4MB5A 5JMRA 4OSUH 3LPGA 3KYKL 1AC0A 2VAAA 5E2WH 3VFTB 1A3RL 3V7AG 2EIZB 4CMMA 2VLRD 4ZQKA 3DRTA 4JG0H 4Q2ZB 3P3YA 3H2WA 4QNPE 2VDRL 4X7CC 5E2JA 2X9YA 5GGTL 1JPSL 4M93B 3LZFL 4MA8L 4ZTOL 1CL7I 2CIKB 1G6RH 4UT9H 1KG0A 1G9NH 5FM4A 1A7PH 3BPCA 4BQBA 4F3FB 4PJXE 4Y16C 3UDWC 4UB0H 1ZSDA 2GEEA 4ZAKA 2AJVL 3VFWB 4CNIB 5C0FB 4RMQA 5CGYC 3H9SD 1KULA 1CR9H 4I9WD 5I1IL 2BC4A 5FGBC 1PKOA 4NHUB 4YR6A 5C2BH 5BO1L 3QEGH 5D7SH 2XFXB 4D94A 4GAYB 2Y36H 3FAXA 4PJ9A 3T3ME 1BMGA 1MHEB 3CUPB 4K9EC 2HRPL 2YA2A 1U3HB 2VR9A 1B88A 1J0KA 1AE6H 3MLSL 4ZXBD 1I1CA 1XGUB 3EOTH 4ZUUB 4P4RA 5F8RC 2B4CH 2BJML 2D7TL 4MA1C 2AEIT 2AQ3A 1AR1C 4X7EC 1F2XK 2EZ0D 1XH3A 1E4KC 4LVOB 5INCA 1H5BB 4QXUH 1QRNA 1FORH 3ARXA 3BKCL 1G9MC 4CN1A 3TWCL 4KI5D 1X5IA 4ODHL 1NGZA 3EHBC 4ELME 2R29H 1RD6A 1GHFL 3GJEB 3K2UH 3DO7A 4X9IA 5SV3A 3MCKA 3DHMA 3ALXA 4JCLA 1BFOB 4WFFD 2WUCH 4Y4FD 3M8OH 3MLPA 3EYQD 3B8SA 4IOFC 2NY1B 4WCYL 4D8PA 2V5MA 4ODUB 1RUPH 2H2SC 2BOBB 1FHGA 3NAAH 2AERT 1FNEA 1GGBL 4X7FC 3DVNB 3WIIH 2LU4A 5GGRY 3BKMH 3DARA 5A1AA 4FQ2L 5EFIB 5FIEA 3UTSB 2IH3A 5BV7C 3QWOB 3QXDB 2W60B 1JMZA 1HXMB 1IAKA 1K2DA 4MAYA 1MJ8L 2Y25A 5BJTA 2J12B 3LKRA 1QEWB 4J3UA 4HS6B 3DRQA 1CU4L 3W5NA 2Z93B 1FBIL 5DRZB 4MSWA 4PJGA 5EOCH 5FM5O 3PIQA 4YXKH 3IKKA 4K8RH 2X10A