1LK2A

1.35a crystal structure of h-2kb complexed with the gnysfyal peptide
Total Genus 80
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
80
sequence length
274
structure length
274
Chain Sequence
GPHSLRYFVTAVSRPGLGEPRYMEVGYVDDTEFVRFDSDAENPRYEPRARWMEQEGPEYWERETQKAKGNEQSFRVDLRTLLGYYNQSKGGSHTIQVISGCEVGSDGRLLRGYQQYAYDGCDYIALNEDLKTWTAADMAALITKHKWEQAGEAERLRAYLEGTCVEWLRRYLKNGNATLLRTDSPKAHVTHHSRPEDKVTLRCWALGFYPADITLTWQLNGEELIQDMELVETRPAGDGTFQKWASVVVPLGKEQYYTCHVYHQGLPEPLTLRW
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title A peptide that antagonizes TCR-mediated reactions with both syngeneic and allogeneic agonists: functional and structural aspects.
pubmed rcsb
source organism Mus musculus
molecule tags Immune system
molecule keywords H-2 CLASS I HISTOCOMPATIBILITY ANTIGEN, K-B ALPHA CHAIN
total genus 80
structure length 274
sequence length 274
ec nomenclature
pdb deposition date 2002-04-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00129 MHC_I Class I Histocompatibility antigen, domains alpha 1 and 2
A PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1lk2A02
3.30.500.10 Alpha Beta 2-Layer Sandwich Murine Class I Major Histocompatibility Complex, H2-DB; Chain A, domain 1 MHC class I-like antigen recognition-like 1lk2A01
3KPOA 5C09D 2P8PA 3ZE0E 1QOKA 2G5RA 4ENED 3NCCB 2FJFB 1IAIH 1W0WB 4LP4A 3DIFB 4HKBB 5F8QC 4HH9A 4FQQA 2YD3A 5D9SB 3KPMB 4P9HL 3IDXH 4PTTB 4UB0L 1SJVA 5I76A 5JMRA 1DBML 1IILE 3QUZB 3C08L 3KDMB 3A6CH 1OM3L 2R2HB 3LEVH 4PLKC 4DZ8A 4LCCA 4YHML 1XH3A 4LLDA 3ZTJG 3RWHB 3L3HB 4I9WE 2LE9A 3EHBC 4N8VG 3ARGD 3NFSL 1KLGB 3HG1D 3KPRB 1JFQH 4NZTH 4UNVA 4MQSB 2OP4L 3MO1A 1HQRB 4HUXA 4Q74A 4OZGF 1S3KL 1ZV5A 4Q0XL 1MCPH 4NN6B 4PJFF 5T5NG 5MEQB 3BD4A 1YN6A 4LEXH 1CICC 3UTPE 1LDPH 1R5VA 4HKBA 2XWTB 1T7YA 4NZUL 1VERA 1EUUA 1UWGH 1U6AL 3O8XB 4P5TA 3IDJB 5D7JA 5HYFA 5DO2C 4RGND 4WRLA 5JIIA 5FGCB 3CGTA 3VFUB 2PW2B 2W65B 3CVHB 2DBJA 2BNRA 1QHPA 4NBXB 4X0KB 3RI5K 1CFNA 4YFDB 4P2QB 4PBWD 1L7IL 1LO3L 2PR4L 1IKNA 3C6SA 1RHHB 3T65B 2HYMA 2DYPA 3QDMB 4R7NA 5GISL 5DJCA 1H3UA 1T0NB 5EBMB 3E3QE 1MRCL 3RJDA 3CCHA 3IDNB 3FQUB 5LBSL 1D5ZB 5DD0H 4A2MA 4A6YH 3F7VA 5HHMD 3SDAB 1UEYA 2Q76A 1F58H 1FNGB 5D93B 5FCUH 2MOVA 3KPSE 4JJHA 4D3CL 5E4EC 2WWMD 5MEOA 2YD7A 4UNTA 3QFJE 2DMKA 2FJGA 3F5WA 3RWCA 3BPLC 3QH3A 5DGQA 3IU4H 3QCVL 1NC4D 2BMKA 3KPTA 3FOMB 4HLZH 2VXSL 4H0IA 5JMOC 1AHWC 2F5BH 3PV7A 5ECJE 3ZT6A 5IEHA 4DKAA 4CU8A 3IETB 3WKML 3V4VH 1WBZB 4PLNC 3QB7C 3DO7B 5C0RL 5F7FA 3UTTE 4NZTL 2HWZL 4F9PA 2HVKB 3SKOB 4R4ND 5F71A 4ZFGL 4I4WB 1K8DA 3D2UB 3BKML 3WCYA 1MSPA 5I8OL 3DGGB 1EHLL 4APQA 1T1YA 4FA8A 3TO2B 1A7BA 4KDWA 1N4XH 1O5DT 2ZOLA 1DE4A 5AG8A 1MAKA 4OF0A 3OQ3B 1S7XB 2AP2A 3HNTH 1N7ML 3L1OL 4LSVL 1SJEA 4GRWE 5MEND 1IVLA 4IMKC 3LN9A 2EDJA 3KXFB 5C07E 3MXWH 4M1GH 2A74B 1GPOL 2VL5B 2J3SA 1AD9A 4BFBD 1F02I 4UAOC 3MRQB 1F4HA 1BFTA 3FFCD 1BOYA 1I8MB 5DJ6B 5HYSB 3KPQB 3NZHH 3EIFA 5JDSA 2ZPKH 2EECA 2UVEA 2EDRA 4NRYB 5TJWK 4FQXA 3QUML 4Y1AB 2VXVH 2BY0A 4IIQC 4O5LH 3ULVE 3L5WB 3RDTB 1A21A 3C60B 2DD8L 4XB8A 5FO7B 1UXWB 5CEZE 4GKZA 4OLVL 1PVHA 4LASL 2GTWB 2IJ0C 3IS1X 3V6FB 3BOVA 1B6UA 1A1NA 1FZMB 4BJLA 2NXZD 4ZS6D 4NYLA 5E1AB 3QDJD 3T3MF 1JTTA 1DANT 1GIGH 2GKIA 2K7QA 4JZOA 3B9KD 2FJHA 3PWPD 3NIFE 1OGTB 4FXKB 3WO3B 4OD1L 5DEGA 4Z7UF 3QIWA 3NFPA 1QSZA 5L9DH 2V5MA 2IGFH 5IJKC 4JFDE 2FATH 3A6BL 4QCIA 4JRXA 2BDNL 1HHKA 1BD2D 5E4EB 1Q0YH 3EOBB 4YHNB 4N9OB 2AJZA 4Y19E 5BRZB 5D7SL 5CP7A 5KSBE 3QDGB 4HIXH 1AGBB 4PJIF 2ADJA 3PGDB 4WWKA 3L6FB 3MJ7B 4F7EB 3FQXA 3DVNA 1I1YA 1HH6B 3U30B 3MGOB 5IMMB 5LGJA 1Y6MR 2RAMA 5GGVH 4U7MA 4KTYA 1SBBA 1ZGLB 1P1ZA 4MQ7A 2DLTA 5JZ7C 2EE2A 4PJGB 5HY9A 2EDQA 4F9LA 2Q8AL 2EIZB 25C8L 4NQVB 4C4KT 3W0WD 1RK0B 4L29B 5F7KC 1RUAL 3AY4C 3N1PC 4OB5L 5EULV 3TVMB 1ZS8A 1S9WB 4JHWH 1RZGB 5FYJD 5AZEL 3ZDYE 5IOPB 2WUBL 1VPOH 5ICXB 3BP6A 1F4AA 2ICCA 2NY5C 4MA8L 4MWFA 5D7JD 1CLZL 2XIDA 1BZQK 4K3EL 3T0DA 1C1EH 4X7SH 5HJ3B 4G9DB 5DHXB 1CD0A 1Q0XH 4L1DA 3V52H 3SE3C 1J0YA 1SEBA 3VXRA 4PV9A 4TNWF 4XBGA 2XZAH 1IQWH 4JPWL 3H9SD 4U7KA 5TDNA 1JPGA 5IB4B 1HHJA 1FYTE 5GJSL 2DQFB 3VXNA 3CXHK 3L3IB 4OD1H 5GGTH 2HTLD 4GQ9H 1FNLA 1WEJL 3RX7A 4LIQL 4LSQH 1M7DA 3ALWA 1C8PA 1AP2A 4PJEE 3RU8H 2UWEF 1H5BB 3Q6GH 4UIKH 1DQLH 3LY6A 2I9TB 1Q9OB 5F1KC 5DI8A 4KFZC 4U1NB 4WDIA 4RZCA 1KTRL 3IJSB 3FKUS 1NAMB 2V2TA 2ZZUT 3NIDF 3BQUB 4R3SB 2PO6C 4Q2ZA 3ZDYF 4PJ9B 1WZ1L 5IW6A 4I77H 3ZTNH 4C54A 4U1NA 2VDRL 4NN5B 4BSVB 5D70L 4O2FB 1K5NB 5HHNB 5A2FA 1T2XA 5TDPA 1R24B 3QWQB 3F7YA 2CH8A 4X4XB 1UJ3B 1VACA 2YK1L 4HUWA 3TBYA 5F3BB 3IVKB 3LN5B 1LILA 1OTSD 5MHSE 5EOCL 2ADGA 4ELKB 4LLMB 5KSBA 2VDQL 1AO7A 5CJQH 4JJ5B 3KYOB 3OKDA 1CU4H 4N5UA 4GBXC 3VXOA 3R0MA 32C2B 3DX7A 4NQCE 4L5FL 3VXRB 3V0VB 4MS8A 2AEQL 4NJAL 5GSVA 1EAJA 1E4XH 5TDOB 32C2A 2ATKA 1CFSA 3UDWC 5I71C 2NY0C 3CMOH 4PYGA 5MP6H 3GSNH 3GDBA 1CL7H 3TBTA 12E8L 1S7VA 4MWFB 4RGNB 4S1SH 3DURA 4RCAA 1YJDL 5DEFA 4OLWH 3LRHA 4Z95H 3DUUA 5JNYA 3F7YB 4X4XA 1ZVYA 1FZKA 3R8QA 4YEFA 1SQ2N 5HXMA 2QSCH 1IGJB 1FV1B 4H8WC 4XTRC 2XACC 1P1ZB 3BQUA 1HHHB 4OGXH 3VCLA 2VDPL 4PRHD 4R26L 3B5HA 1CN4A 3SDYL 2J4WL 4X6EA 3P11H 4ZFZB 1YUHB 3DVNB 4N1EA 2XFXA 5DFVD 2ZUVA 4YDIL 3C8KA 5DI8B 4X83A 1EBPA 2B39A 3MACL 3FQRA 3RWFB 5F8RC 3MJ9H 4KRPC 4KMQA 1T0MA 3QQ9D 3UTTD 3EOBA 5LXGH 4F58H 3SHSA 3GM0A 3LQAC 4JPKH 3CDGB 4XXDA 1HHKB 2YOCA 1SBSL 1FSKC 2Z8WC 1ZGLM 4BUHA 1P4BH 3NTCH 4LDOB 3RGVD 4RDQG 5EFIA 5JZ7D 4DEPB 1HHJB 5I66A 4LF3B 3U7YL 3HC4H 1IM9D 5E8PB 2HRPH 4HPOL 2C3GA 5CJQL 4LRNH 2EDOA 3NCBB 2GK2A 4P2YA 4K3DH 4OUOA 4WI4A 5L2JA 1RJYA 4WTWA 5ITBL 4G9DA 1M71A 5CJXC 5EIQA 4DGIL 5C0BD 3VXME 5GS3A 4XHQA 3VGHA 5JOPD 1IQDB 4F80A 3LKSA 3CMOL 3T2NL 1MJ7L 1CGTA 5L8KB 2Y07H 3FN9A 1PKOA 5KAQG 5TH2A 4MA1C 1S9WA 1Q8MA 1Y6NR 1RD6A 4JO3H 4KROB 3BMVA 4ODUB 1CGSL 4NQVA 3UJTL 4TPRH 3ZHKA 4YGVA 4Y4FD 3QEQA 1IC5H 3ESUF 2IPTL 3HCVA 2NTFA 4Q6YA 1AGDA 5CGMA 3ARTA 4I3SL 3P73B 6FABH 4R97B 5LGJB 2H26B 1GOHA 4JGJA 4K71C 3E1F1 1HH6A 1T89C 2E27L 4J8RA 4FFYL 2FGZA 2NY7L 1B9ZA 1EJ6A 3SDYH 3T4AA 1DN2A 5GRWA 3MLSL 2LQRA 4NO0D 4MMZC 3V8CA 2Z35A 2LV4A 2HMIC 1BM3L 2EKJA 1LO2L 1FIGL 3SDCD 4U3XA 5J1SC 4DJMA 1DVFA 5BS0A 1KN4L 3RZCB 4JPKL 5JORA 1R3JB 2P7TB 4WENB 2HH0H 3QIWB 2IH1B 3QG6A 3MNZB 4Q9BA 4MDJA 5T3ZL 4G8IB 1FNHA 2XTJB 3BW9B 3BH8B 3HMXH 3HUJF 1QACA 4HEME 1AGFB 1F3DJ 1C16B 5SWZD 3AB0C 5EUOB 2YC1A 3VMNA 4P5TC 4LQ1A 2MWCA 4NNYA 4K94H 1EO8L 3B9KB 3WJLA 1NL0L 1QSED 4ZUWA 3LEVL 5HVHB 4LPYA 1GYAA 4PJXA 4JO1L 1OVZA 2IWGA 2GY5A 3CIQA 1SY6A 1OCWH 3MFFB 5C0CE 3TN0D 3T2NH 3FOMA 3QFJA 2DQTH 2JTDA 1FN4A 3PWUA 2IQAA 4UQ3B 5F7NC 3RWCB 1YEJH 4XCYA 5E6YA 3EGSA 5JHDD 3AREB 5FM8A 1JK8B 3FO1B 2C1PB 1FDLH 4DKFL 4NWUH 3UZEA 1V5JA 3EO9L 2ZSWB 4UINL 1J8HD 5D6DC 2XA8L 1MFAL 3DTXA 4AIZA 3VDCA 2BX5A 4L3CB 3B9VA 5CBEA 1AD0A 3I50H 4X6CF 4RISH 3INUL 1R6VA 3EDFA 4YIQB 2XY2A 5J11B 4LGRB 2AJVL 4TN9A 1FCCA 1K8IA 3HG1E 1REIA 1UT9A 4U2YA 3C5ZB 4NO3B 4U1SA 4XP5H 2VXUL 2BFVL 1LVEA 5DFVC 4FTVD 3WFEH 2DTMH 1QFWM 2GEEA 4QOKE 4GFTB 1DBBH 3TIDB 5IV2B 1A6AA 2VZ1A 2PW2A 3BZFB 3VFUA 4OQ1A 4XPGH 1DEDA 1GPOH 2HH0L 2P8MB 3IDJA 5D7JB 4GJTB 5F7EH 1X5LA 1S7SB 4DKDC 5HVWA 2VLMD 1FFOA 2DLFL 2G2RB 3MRIA 1EJOL 1LO5A 3FB6B 5C0BE 3VXMD 3TPUB 1P4LB 5LJYH 4XNUL 2X4SA 3IDMA 5FDWA 4BSWB 3I02A 1LO4L 3BZEA 2Y9RT 2IMNA 5DMIH 3QQNA 2OXGA 4JVUA 3IETA 2B1AH 5AAWA 1P53A 3HAEA 4Q6IB 1MCKA 1VDGA 1EFXB 3AS0A 3PQYB 4JO1H 1CXHA 3C8DA 3NCFB 2ZJSL 3PDOB 1FL6A 1IAKA 3GIZL 3L3HA 2MPAH 4K2UH 5JQ6H 5GGTA 4B5EA 1E4XI 3A0OA 3FN0L 3T0BA 2W9EH 4FN0A 3I2CL 5I8OH 4UQ2A 1U8IA 4H88L 4WGVB 4R4FH 3STBA 1G6RA 1V7NH 2PW1B 4MSWA 4QRUB 3EO9H 4MA3A 1RJLB 3BP5A 2ZG2A 2ILLA 1P84J 5C0GA 1WWBX 2DQUL 4WNQB 5MEPA 2BSTA 5ID0B 4RWYH 4LSPL 3UO1H 1NLDH 5L9DL 1OT1A 2F5BL 3AB0B 3INUH 2YPKB 43C9B 2DQIL 3KPOB 5D1XB 1BOGB 4HG4J 4P4RB 5BVJB 1MFDH 4GRLB 1S5HA 5CP3H 2BNRB 4X80H 5FA3B 1HI6B 3UBXB 4N1CA 4H0HB 3CVHA 2I07A 2XN9E 3BKMH 3H42H 5BVJA 5HHMA 4LGSB 5C0BA 5GS1A 4LNVA 1YJDC 2B1AL 4HIXL 1FC2D 4KV5E 3CX5K 4M1GL 1A02N 5D96B 4Y8DC 3GI9H 3GSVB 1K6QH 3WFDH 2Q86A 2XWTA 1P6FA 3SDCA 2MPAL 4Y88A 1LDSA 4P4KB 5EC1A 4Q9CA 4LRIA 5ACMA 3S34L 2C3VB 2X7LB 3TT1H 1H5BC 4MB3A 4MJ2A 4P2QE 2VDMH 3CPLA 1XGYL 1RZKC 4UAOB 4G43B 1TJHL 1V3JA 4UT6H 3SGDH 1II4E 2VZSA 4BFIB 3GSNA 3L3GB 3KYKL 5BO1H 4DZ8B 3BD3A 4LPVA 3QXUA 4JRYD 4GW4A 1I9EA 3BEVA 4Y4KA 4HFWB 5IESH 3D39A 1MFDL 4S10A 4POYA 4X99A 3N0PB 5C3TA 3CH8A 3IDMB 4UZGA 5FDWB 3WXWL 1MRDH 2VR5A 1ZLSH 1G7JA 1I3RA 1IKFH 4ZUUA 4ZTOH 4NDMB 1TJGL 2SEBA 3AXLB 5H94B 2IFGA 3CZJA 3DXAD 4P23C 3W39B 4M61B 4D2NA 4G8GD 5FUZH 4HXAL 5IBLD 2P8MA 1JVKA 4P46D 1J1XH 3IFPA 1LO0H 3KPNA 3QXAA 2WMPA 2ERJC 1INDH 5KANG 2W9DL 5KW9L 5IFAH 5EO1A 2AJYH 5IWLC 3H0TA 1KJVB 4JAMB 3MJ9A 3E0GA 4JFHD 1QSEA 3ZZ1A 3D18A 3NN8B 3SDXF 2KKQA 2VC2L 4WFGE 4X98B 3GRWH 3GSRA 5FM4A 5CBEB 3GNMH 4MB4A 1PYWB 3UPAA 3H9HA 3H9SB 2F54B 3MRRB 2C1PA 1F13A 4NQTA 3D0VA 1ZHLB 4JZNA 3V0AC 3HZVB 4GKNA 4CMHC 3T0AA 1RUAH 3ZE1F 4PJ5E 3WFCL 5FYLL 4QRPE 4NKIH 2VIRB 1DBAH 1YQVL 4KROD 1SY6L 4OSUL 5IVXA 2DQJL 2PCPA 3RNKB 3LEXB 3Q5YA 4GMSL 4KI5D 2D7PA 4IDJH 3T77B 1NDMA 3F7QA 2YD2A 4P46C 4Q9RL 2AJYL 1IFHL 2BOCB 1ZEAH 2JB5L 2Q87A 2XWBB 1P7QD 3ARXA 3P30H 4IMLB 5E95B 3QUYC 1WTLA 3JBG7 1F8TH 4U1KA 2YD1A 3I75A 1KNOA 3FQTA 4R4NC 3W0WE 2A38A 3WHE0 5BV7B 4LCWA 4GQ9L 3ULUL 2PYEB 4TUKL 5E8DL 1CTOA 2FEDD 5T33H 4WW2C 3STZB 4JFFD 3MCKB 3BUYB 3B6SB 5FKAB 4PV8B 3CFJA 3R06A 3QNXB 1GHFL 3RZCD 1HNFA 4D9RE 2RJMA 2H2PD 1JHKH 4PBVC 4KWUA 2V6HA 4KK6C 5I1GL 2AXHA 1OQOA 1IQWL 2VC2H 3TV3L 1G9NL 2EIBA 2FRGP 1AI1L 2WK2A 5FO9B 4KROC 1H3PH 3MJ8B 4JZJC 4JPIB 3S37H 3O3AA 3HI1B 4KTDL 2X1PA 2I24N 1BFOB 5T1KB 3UAJD 1HXYA 4Z7NF 5JPMB 4BQ9A 3KYMA 5CSGA 1VEOA 4IMLA 4ZFFA 4LIQH 4HMEA 3DRQA 1JGLL 5I73C 3BZ4A 1YEFL 2ZCKH 4MAYB 5ID1B 4Z8FL 5LXGL 3W9DA 3QIBB 3QDGE 4OIAA 5SWSA 2OTWB 4NN5C 2OQJB 3NTCL 5FFLA 4WEUD 3MV7B 1A7OL 5H35B 3AAZA 4NKIL 3ZDXE 4DZBB 1SY6H 5C92A 1LK3L 4ERSL 1KCUH 3GUTB 5B39G 5KSBF 3O6FB 4JZNB 3ZT7A 5CLTA 1I7UB 4OGAC 4POUB 3BVNA 3BISA 1MCLA 1MJUL 2WW8A 1OARL 2YK1H 2HJKB 4WW2A 4AEFA 4ZS6C 5K9JH 4GG6F 4HUKB 4JRWA 3NBNA 4X98A 1TIUA 3DPBA 4U1MB 2GAZB 1JF6A 2XQBH 1CU4L 1MLBA 2D0FA 5IHLB 2ICWI 4UB0H 4Q58C 4N0CC 4OZHA 1E4XL 1X4YA 5DQ9A 5BVPL 3C8KB 2ICWB 3PNWA 5J7CC 5JHDA 5MP6L 5ANME 2QQQA 5TGBB 5AAMA 1QFUH 3W39A 2APTA 4LVEA 1U8PB 2F53D 5CZVL 2HJLB 2B4CL 1YNTA 2H32H 1J88A 2AK1H 4XWGH 4F7CB 5IB3A 4O9HL 4P3DB 1OQXA 1RZ8A 2XG5A 5JLZA 4OGAD 5DJAB 1WISA 5HHQA 5JW3L 4Z7WB 4R2GD 3WMSA 1Z9MA 1HINL 3UTPD 5D1QD 3VFVB 5FF6B 1I75A 3SJVA 1A2YA 1QYGH 3DUSA 4PRHE 4BH8A 2XQBL 2HT4D 3P11L 4I5BB 4I3GA 5DHVB 2Y6SD 3MBEC 5T3XD 3L3KA 1DL7L 1EEYA 2ZOKA 2F8OA 4FTVA 2E7BA 4Z7UB 2D2OA 5HD8D 2NY4C 5T1LA 3VFWB 1L0QA 1CDYA 5CINH 3NFNA 4NO0B 5GSVB 5C08D 5M95B 4L3AA 2FX7H 4PB0L 4KY1H 2Q86B 5CUSH 2HKHL 1L7IH 1LO3H 1FO0A 1G6RH 1AO7B 1L0XA 4G8EA 4ELKA 4PP2B 1AC6A 4NQSA 3FTGB 4LGPB 5GRVL 5J13B 2K9UA 1U8MB 4NO2A 4DTGL 1DN0A 3S3SA 3VXRE 1KEML 2VYRE 5INCA 2XTJD 4KJPD 3TLRA 1S5HB 3I6KA 5CIPA 4CAGA 3HPJA 2EDBA 3VGFA 5TDPB 4P4RA 3DRTB 1MCWM 4PGDA 2FEDC 3QEHA 4RAVA 5CP3A 1FDLL 1JN6A 4I3SH 2XA8H 1MJJB 2IQ9L 3S88L 1P6AB 5EZOH 1KCRL 3HZMB 2H2PC 5GRJL 5IB5A 4EI5A 2CKBH 4XAWH 3HR5B 2WBJD 1BQSA 4KK6D 4JO3L 3SKMA 3I6GB 4M03A 1KBGH 3VFRB 3DETC 5IM7A 1JE6A 4U1JB 4V3DB 1OSZB 3WLWC 3WFEL 2Z0BA 1DUZB 3X11A 5F9JA 2JCCB 1MNUH 5JW3H 3U4BH 1SVZA 1UZ6E 3CNKA 4V1DB 2O93L 3K4AA 4QRRD 2PYFB 4IMKA 3OAZH 3IRPX 3CFDB 5CEZH 2IADA 3THML 3FRUA 2WAHA 3ZDZE 4RX4A 3WIHL 3MLRL 3M8OH 3UMTA 5FGBC 5HI5D 1EO8H 3TPUA 3RGVA 4D0BA 2E3VA 1R3IL 2DLEA 2G2RA 4FQXC 3R8BB 5SWQA 2QHRL 2UZXB 3LD8B 3MRPB 2YUWA 2IQ9H 1BD2A 3VGBA 4KVCL 5ICXA 4TOYH 2EH7L 3F12A 4GQPH 5GS0H 1EDQA 4AM0A 1S7WA 4YC2B 3SY0B 1P5VA 3ZHLA 1WITA 1MFBH 4Q7DA 1U36A 5DQJA 4LFHD 5E9DD 4ELMF 3JTTA 4Q0XH 3MX0A 5IKCB 1NFDB 3C6LB 4NBZB 4PY8I 4DFHA 1ULVA 3QIUB 1AD0B 4PJ5D 3MLZH 4ZODA 4GW5A 1I1YB 3UTSE 2PXYB 1ZHKB 5SX5K 2YSSB 2ATPB 3QDGA 4Y5VA 1G0XA 3AS1A 2NY1B 4KZEL 4OI8A 4K23H 1JHLL 4XCYB 1G9MH 1FNEB 1WT5A 2D0HA 1Y0LB 3U0WL 1UADC 1JNLL 3QUXD 2IALA 2AXFB 2BRRH 2GTZA 1FLRH 5DS8B 2BNUB 4YPJA 1JJUA 2I9LA 3RGVC 1HHGB 2IGFL 2FJHB 3PP3K 3BH9A 2OTUA 2E6JA 4C57C 1CR9L 5D2LF 5L2KA 5ADPH 1EGJA 4FNLL 1CLOH 1I1RA 3UYOD 1FZOA 4LLUB 2JIXB 3O8XC 4YLQT 1KPRB 5D1QA 1XGYH 2VQTA 3WO4B 3FMGH 3HS0B 4O02H 5DLML 3IFLL 5F6HI 3BH9B 4HMCA 5TE6L 4P5MA 2VR9A 4YE4L 1TTGA 2ITDA 1BZ9A 1WWWX 3H3KA 5DUPH 3FAXA 3GIZH 4WUUE 3MRFA 4PUBH 4YR6B 5H2BA 3VD9A 5JORB 1XCQB 3WKMH 3SQOH 3CFCL 4FXGA 3H7BA 5F1OB 4X6DB 2ZCLH 4JFYA 2AEWA 4K23L 1HQ4B 4UTBH 1M6OB 4YHKL 5B4MD 1ORQA 2Z35B 4H26A 4ZXBD 3WXWH 3EJZC 3B8YA 5IT2L 3DX6B 1EV2E 1N0LA 3T4AB 3STLB 3IGAB 4PJGF 3KPRD 3DROA 5C0CB 4JM2C 1UXSB 4HK0B 2GJ6E 2OCFD 3JUYA 4YFLF 4RWYL 1FFPB 3LKQA 3QQ3B 4L8CA 2UVFA 4XRCA 2AQ2A 3F7RA 4ODTH 1NC2D 4OFYD 2VR4A 3MV01 3MRKB 3N06B 4TTDD 3KPSA 3MLYL 5ALCH 1FVCA 2VXQH 4YXLL 3ARFC 1NGZB 2P1YA 2IG2L 4RAUA 5D7IB 3V52L 2W9EL 5IK3B 3H42L 2EDDA 5IQ9A 2FO1A 3O8XD 1SJEB 1JHLH 3IFLH 4ODUA 3TYGL 2N1KA 1X5HA 3DETD 1GJIA 1WBXA 3GI9L 1V7NL 2YRPA 4HKJA 3MNVA 3BP4A 4HIEB 4U1GB 1G1CA 4Z7OF 5C0AB 5J06A 4LCIH 2I25N 1BF8A 3E6FB 4LSPH 4UDTB 4GKSB 4PS4H 3DLQR 2OR9H 3MSPA 5DD1L 5ELIA 1NUFA 5I6XB 1F97A 5ADPL 3X3FL 3GSOA 2VLLA 5C70A 2F19H 2J5LB 4OGZA 1E6JH 1VFAA 3SGEH 4KKCC 1CG9A 5FOBA 4M62H 4LVHB 2Z93A 2DWEB 5C0DA 4AK1A 4NNXA 4P2RE 1XF4A 5DUPL 2EDNA 5F97E 2D7TH 3TYFB 1SJHB 4OBRA 1Y6KR 5F3HA 4YXKH 1T0MB 5KS9E 1A6VL 3MLYH 1A7RH 1PDKA 1F6AB 2IANB 1XGTB 2P5WA 5D70H 4WO4D 2CRIA 4UT6L 5DMGD 2ZUTA 1EAPA 4NM8L 7FABL 4F33B 5TE4L 3NVQA 5DJXB 4G59A 1HHHA 1JWMB 5J3HD 3D2UD 1INDL 1OPGH 3K0WA 5ICZA 1CFNB 2UY6A 3D25B 4G42B 1E6JL 4XP6H 3T4YA 1D6VH 3KVQA 2JB6A 3KLHC 4D9QD 3HR6A 4R0LB 5IW3A 3GRWL 5I15L 3TYGH 2C4XA 2IC2A 2V5RA 1MCBA 4ZDHB 1H3PL 4RFNB 4NZDA 3RZWA 4Z5RB 1MF2H 1J1XL 2F74A 1JPTL 2CIIB 4I1NB 2PYED 3QUXA 4JDTH 5F6IB 5GRVK 2BVEA 5IQ7L 1G7IB 4WW1A 1HOCA 4LCCC 2P5EB 2Q8AH 1WVZA 3X13A 5FYLH 1OP9A 3C5JA 2VUOA 4WO4C 4XNXL 1OP3K 5BZDA 4W6YB 3VJ6B 4DW2L 4K9EC 4WFGD 5DT1H 3VH8B 2Y25A 4MXQA 3GNML 1F90H 4G8FA 4JY6A 3M1BA 5J3HC 4DVBB 2Q6WA 4QRSA 3BAEL 1TVBB 1JTPA 3D0LB 1RUQH 3BIKA 3OAYK 4MAUH 3RNQA 4QF1A 5AD0A 1NC2A 3IJSA 2GITB 1ND0A 3ARWA 4E0RA 4WJ5B 4FMKA 4LLWA 4P4KC 1MF2L 3TVMC 1CD8A 3QAZC 3LN4A 3TO4B 3VWKC 2C3HA 2X05A 3RPIA 5J1AA 1H5BA 2B1HH 2ESVA 3KS0H 4PPTA 3BHBB 2KDGA 3CJJA 3LPFA 1AP2B 3GMQA 2A73B 3DXAA 1XEDA 1UWEL 1GGBL 4WI6A 1F11B 4TSAL 3QAZB 3P77A 1L6ZA 3K4ZA 3ARFD 3BGFC 4NN6C 1EEZA 5I0ZA 4I48A 2E9WA 3D39D 1B2WL 1C5CL 2A83B 3HNSL 4YFLI 5BRZD 2V7HB 5F1SA 2X10A 1J9CT 1OD7A 2ZG3A 1J10A 3RWJB 1W72B 3M17B 1VENA 5DK0B 1H3WM 5J6GA 1BD2E 1F3DH 1IC5L 1FAIL 3BRGC 4MZ3A 2DBLL 3B9AA 3CFBB 3WNPA 1MHCA 3OMZA 1NMCB 5IOPA 2NY7H 2F54E 4XCCL 4PJ8A 4OLYH 2O61B 3UTSD 1DLHB 3WHE1 4NCDA 4QHLA 3D9AH 4YUEH 3TVMD 3QQ4B 4D0DB 4LU5L 2GHWB 5ID1A 2NZIA 5E7BA 2D0GA 2D9CA 1KB5A 2F53B 4M6OH 5DJDB 4PJ5B 1BJMA 1XIWB 4XCEA 4PB0H 3GMPB 3EOAB 4KJQC 3MV8D 4GRMA 3K74B 2AJSL 2OR7A 4J3OC 1ITBB 1AGBA 1CDJA 2IMMA 3SE4C 4MZ2A 1MIML 2NY1D 1Q94B 3TBWB 2G9HB 3DUHA 5B3JF 2HJFB 2BNQE 1KENL 2APBA 3QULA 4MB5A 4HG4K 5DFTA 5EU7E 1LE5A 4NO5A 4RA0C 3MLUL 4G6KL 2R69L 2ZKHH 3STZA 4LCWE 3KLAA 3GSWA 3NFPB 4OCXL 3IDYC 4XCNA 2VKXA 1U3JA 4RMUA 3GEWB 5LCVH 4XPHL 3MRDB 5T5FL 1JPFB 4ZQKA 2RQ8A 2E8YA 4EXKA 1SMOA 2KH2B 3W81A 1EX0A 2OSLA 1YN7A 3IKCB 4P57A 3T0XA 5HYJB 5T3XL 2WY3A 4XNZB 4J2XA 5I8KL 1SBSH 2XPGA 3ARDA 3CSPA 3I6LD 4ORGB 1UXWA 2MFNA 2VABA 5FM5O 5E5MA 1I8KB 4L4JA 4P3CL 3RAJL 1ES0A 3C60A 4RISL 2Z31A 4OAWA 4ZS7H 2PTTB 1MIMH 1NCBH 1S7RB 4EXPX 1B6DA 4GKNB 3VXQB 5DHVH 3EFFB 3PHSA 4LLVA 4EN3B 4PRAA 4K3DL 1NBQA 5DWUL 3VG0L 2XNAB 1I9JL 5CAYB 4PIRF 5IB1B 5F7UA 4KGJA 2DWDB 3MV7E 1N0XL 2VLJB 1XGQA 5ENWB 3RKPA 2FGWH 3GJFH 4KKLD 3W11D 2Y07L 3GSUB 1QUNA 2J8UA 3ILQD 1ZT7B 4JCLA 4Z0BH 3WUWB 1IGFH 3NN8A 4PJBF 2DRUA 2EKSA 1FNAA 3BUTA 4WIQA 2CGRH 4L1HA 1PX4A 1U8JB 2ZUYA 1RZFL 2JF1A 2M8XA 3R1GL 1ZLUH 3HE7C 4Y5XA 3K2UH 1G7PB 2FIKB 3VFGL 4OFIA 1S7UB 1BZ7B 1BJ1J 5D4QA 4ELME 4LPXA 1URLA 5GRJH 4I13B 2MQ0A 3CXHJ 4K2UL 4P2RD 5IHBA 3QP3A 2ZJSH 4NDMA 2A0LD 4C56E 3G5ZA 4ZOAA 3VRJB 3V5DB 5ETUA 1P4IL 3VGGA 1YY9D 3DYPA 4N0UB 2UWEA 3AU1B 5DZNA 2JE8A 5DRZA 1NSNH 4JG0H 3ZKSD 4R6UA 3EO0B 1X5GA 1JWUA 4AIOA 4BFIA 3WS3B 1WIPA 3BYYA 1T04A 5LQBL 1XZ0A 4E41A 3MR9B 5E8OB 3AM8A 1YYLH 1TVHA 2BJMH 3AREC 2XKUA 3IDIB 2AS5M 5E99L 3MUY1 4XVTL 4KUCD 5TE6H 1S78C 5E6IB 3ULSA 5EBMA 1JI2A 1GIGL 5IHUL 2D9QB 2DYPB 4R7NB 4PJDB 2FGWL 3TM6A 4HWNA 5CZKA 1PY9A 4GSDH 1XF5A 2R29L 5CLWA 1MWAA 3QZWA 3O6LH 4OD3L 1NMBL 2DQEH 5ISZB 4WWKC 2FZ3B 5HYIA 1HWHB 2A1WL 2AW2A 4KK9D 5CJOH 3UPRA 2NY1C 2OL3L 1YY9C 1I85C 3MZGB 1NAML 3L3OA 5FCUL 2W0KA 1AO7E 3BPCA 5D6DA 3OKMB 3BPNB 4NN7B 3VA6A 3QPXH 4Y4FB 5HYQA 3KNBA 5IJVB 4QRUA 2ZCHH 1U8NB 2LU7A 5JHLL 1JNNH 2X4QA 5I30H 2HLFD 1A9EA 1QFWH 1G9ML 2Z31C 4JG1H 3DMMA 1VB9A 2Q7NA 2ICES 5GS2D 4YHLL 3GSWB 5IMLB 5E99H 2CRYA 4Z77A 1S9VB 1U8LA 2COQA 4JQIH 3LPGA 3VD7A 5B3JE 2DQDH 4LPCA 1UCBL 5F7EL 3U9UB 2R2HA 3GM8A 2XZCL 2D4DA 1CLOL 4EDXA 4ZNEE 1NMBH 3HMXA 4LSVH 2X6MA 3D3VE 4ESKA 3FMGL 5I9QC 4MNQB 4JFZL 3MRMA 2OL3H 3GMPA 4M5ZH 4HIHA 1XF3B 2XKNB 5DMIL 2HFEB 1VEMA 2F15A 5INDB 4YBLB 3T0WA 4ZPVA 3DVIA 1R3HB 1UACL 3IAPA 2ZCHL 2X4OA 4QHMA 1LHZA 1F3JA 1AR1C 2YEZB 3KWWB 3ZT5A 5GGTL 1JNNL 4E5XB 4N5EC 2VH5L 4M43L 4NCC2 4M1DH 4X8XA 4YHKH 3MREB 2DQEL 3U4EA 3D1MC 4JG1L 3FQNB 3Q3GB 1AQDA 5DVOA 2XXCB 3ARFB 1CXEA 3U6RB 4KV5F 4PJHE 3Q6GL 3RL2A 1MREL 3E2HC 4M6AA 1JUFB 2YKLL 1NAMH 2WLZA 1HSAB 1ZLUK 1WICA 2P48B 3P3YA 1JYWA 3QPXL 3GMOB 2ZSWA 4IM8A 4FFWD 5F7HA 1RZIA 2EDKA 2JB5H 3OHXA 1N64H 3HMWL 4X80L 3QCUH 1VADB 1F11A 1QPPA 4PLJC 3FT2B 4JB9L 2BZDA 3MJ6A 3JVGC 3L7FA 2P47B 4BK5A 4ZAKA 2G75A 2BHUA 2JJVA 5CS7A 1TPXB 3MLVL 4OCYL 1HWGB 3C5ZD 4PJDF 1MHHA 1NH6A 5E8DH 5T33L 2YPLB 1U95A 4X9FA 3VFSA 1HH9A 4RFNC 3S8WA 4OLUL 4KI5F 2DM2A 2DM3A 2PUQT 1UQSA 3X3FH 5MENB 3CLFH 2EO9A 3QG7H 4HKZB 4WHYH 1RMFH 4YXLH 1KJ3L 3P4OA 1KB5H 3GJEA 2BOBA 3EOYG 5GRUL 2JJSC 1BQHA 3P4LA 1X7QA 3U0TA 4LSSH 3EJYC 2R23A 1AXTL 1K3ZA 1XGRB 3EOTH 4M4PA 3FFCB 4U2ZA 4JY6B 5BQ7A 3UTZA 3NZ8B 5KZCD 1JGLH 5I1DA 1I7ZB 5IEKB 3VH8A 1EFXD 1X5AA 4OFPA 4H5SB 3WE6A 1KIUA 4NKDB 4DK3A 4HD9A 3DX8B 3KPLB 1ZA3A 3ARBD 3FB5B 2PO6B 1B0GB 1ETZB 4O51B 1R0AL 3FT4A 3TN0A 4LKXB 5E8NA 3GHEH 1SHMA 1X9QA 4V2CB 5F1IB 3MRGB 4K3EH 1C1EL 3MCG1 4CN1A 2Z8SA 2ESVE 3QJHB 4Q6IC 5F9OL 2IF7A 3O2WH 2B0SL 4YGVB 5DQDH 4M7JH 4XNMA 4JGUA 3TGXA 2NXYD 4ODSL 5SWZA 2MMXA 3V6OC 3V5HB 4OZIF 3EYFB 1LMKA 3L95A 1LE9A 1BBJA 1A6PA 1I3GL 5JXEC 3VXUE 5ICZB 4CVZB 3OKNB 3C9NA 4ZUTB 4EN3D 5C86A 4IHOA 4M8VA 3HG1B 4IRZL 4PY7A 2O5YH 4L3EA 5D7IE 3WIHA 3HI5H 2DOCA 2VLJD 5ICYB 5KOMC 1J0HA 1T7ZA 2FX8L 5DDHB 1N6VA 4UOW0 4BQ6A 1WSST 5GGUA 1VGEH 3JZ7A 3CFEA 5F6IC 5D1XC 1IGIL 5C0IB 5DT1L 3HE6A 1J7VR 2VITA 2OBGA 4PFEA 1IEBB 2J6EL 3TPUE 1KC5H 5DK2A 1XF4B 3EZ8A 2VITB 3GKWL 4YHIB 3KJ6L 3WHXB 1P9MC 3GMNB 3RWDB 4H25B 4JRYB 3IXTB 4Y2DC 5DO2D 4N5ED 3EJZD 4X6EB 2FBJH 2W07A 4P2RB 2V9TA 2NQCA 3OGOE 4LCYB 4AYFA 4L3EB 3HG1A 1BMGA 1OWWA 1F90L 3K2MC 2ORBL 1QYGL 3CZFA 2HRLA 4PRBB 4DVRH 4WO4A 2IANE 1PLGH 3MLUH 3MRLB 3WDIA 5IBTH 1WIUA 2FO4A 1DDHB 4KKAD 4PD4J 5DJ0A 1SM3L 5CD3B 5E94B 3TWCL 1A6WL 1QTYT 4K7PH 3BSZL 3MRKA 1AI1H 2EICA 5T5FH 5JXEA 3S3JA 1YJDH 3LKOA 1A8JH 2VNCA 4PRIA 2WWMC 3UTQB 1S9XB 3U0PA 2R4RL 3DO3A 3D69A 2BNRE 3P0YL 2ZCKL 2NX5E 2QEJA 4PD4K 3QDHA 5IW1B 4YZFF 1SJXA 4P9HH 3S36X 1ZT4A 3FB5A 3QUKA 2DICA 5EUKA 5KSUA 4F7PA 1LEGB 2DYPD 3KPLA 1JZ5A 2JJUA 5CD5D 4JJ5A 3ZTJH 4I2XA 1KCSL 4EDWH 2ADGB 4RMVA 4Y16B 1R3KB 4OLYL 4NRXB 2R9HC 2CKBL 4XAWL 3BFOA 4XHJD 4JM2A 4WHTA 3UTZB 5F21B 2VZVA 4HJJH 1QVOB 4HIJB 3SE8L 1UCTA 1KCRH 3O4OC 2J4WH 1DBKH 1AKJB 1MWAH 3VFOB 4YDVB 2FLBT 4XCFL 3UPCA 1UGNA 1XFPA 1MPAL 4XC3L 1ZXQA 1TQCC 5L88L 2VSDA 4Q2ZB 5IR1A 3HI6H 5HBBA 5E24E 4K7PL 4MHHI 4P2CG 4FQCL 2JIXA 5HGDA 5CFHA 1P7QB 3G5VB 3LSOA 5IB2A 3T0VA 5ILTH 4PJCA 3SGJA 1TVDA 4JKWA 1NGYA 1U6AH 2ITCB 2HRPL 2BSED 2GJ6A 2B4CC 3LD8C 1GZPA 1W2KT 2VXUH 3NA9L 2CQVA 3QWOB 2AV1B 4LMQI 2HAZA 3L3IA 4P2OA 1N6QL 3NMEA 4HEPG 2CLRB 4EUPB 1G0YR 3HC0A 4RGNC 5GISH 4KJWD 1OAUL 2NY2C 1T21A 3V0WL 5I1JH 5B8CB 3FAWA 4UT9H 1HYSD 1IGYA 4GUPB 5EBLA 4BH7B 3PJSA 4IEFB 1LO4H 3ARFA 4MJ5A 3Q3GA 3C08H 3B3IB 5FUCC 4D3CH 1EERB 1K4DB 1JPSL 1NPUA 2NXZC 3WN5B 4MA1B 1KCSH 4NQDB 1CICA 1OP5H 1S7TA 4BYHA 1G0DA 4EI5D 3JV6A 4P2QD 4NOFA 1FORH 1FL3A 2BCKA 1F3JB 1BIHA 4PJ7A 4JO2H 1U3HB 4ZYKB 1LO2H 2XA3A 4WV1C 4FQLH 4JN1H 5CINL 4MJ5B 3V4VL 1BD2B 4MNGE 5L2KE 3PL6C 1S7QB 2IBZY 1RPQA 4JPVH 4LDEB 1TNNA 5AWNH 5FCSH 1G1YA 1XF3A 2XKNA 1CI5A 2BVUA 5D7KD 5DJ2A 3Q1SH 3NGBC 3H3PL 4J3VA 3J7HA 4OF3A 1WZLA 3QEUA 1R3LB 3WYRA 4Y2DD 1Q38A 4OZFG 3FT3B 2R1XA 5DJYA 1MH5B 2NLJA 3IDGA 3MA7B 4ODWB 1D5BB 3VI3E 1IGTB 2AV1A 4K94L 4HUMB 4AEIH 1L9NA 5CJOL 2JCCA 1NL0H 1RJZB 1KF9B 1NMCC 3Q0HA 1N3NB 3W0WB 3UTSA 4FG6C 2YPLD 3KPPA 5IMKB 1OCWL 3JV4A 4WEBL 4KDTA 1NFDF 3O4LE 1LK2B 2EDHA 3TA3D 4OKVB 2DQTL 1C08A 1YQ2A 2GK0B 3LH2H 2ENYA 4PJCB 3SQOL 5E2VH 4OM1H 4AIXA 5HGDB 3FRPA 3CSBA 3QXVA 1RZFH 3CH1A 4HGWB 3VXSE 1G84A 4DKFH 1G7LB 4LEOA 5C7XH 2V9RA 2GTWA 2QADB 1FGVH 4JFEA 3UPRB 4NNPH 1UENA 1YPZA 4Z0XA 4XC1H 3VD5A 2DTSA 4HIJA 3LKRB 2X44D 1IZJA 1A4JA 1UKQA 4JN2A 3LIZH 1F45A 4PJXF 1T1XA 3LRSB 4EKXA 3BPOC 4I2XE 4JFFA 2QV2A 2RGSA 3EFDL 5IHUH 1IM3A 3EYVA 3U0PB 3EO1A 1F4XL 4GXUM 1FO0H 4QYOA 2X1XR 4HXAH 1R5IB 2EH7H 5EO0A 1EJOH 4BH8B 2QBWA 2XTLA 2GSGA 2R4SH 2EXYC 5DZLA 2DM4A 3REVA 3VWJB 2W9DH 5T3XE 1H0DB 3H7LA 2FD6L 1FJ1B 2X70B 5FECB 4Z7NE 3P4NA 2IPUK 3MRLA 4FFVC 4NQCD 5GRYA 2XKSA 5JLZB 5J6HB 3VXTA 4I18A 5TQ0L 2VE6A 3QUYB 3PWNA 3TO2A 1WBYB 1RFDL 4IS6B 4DGVL 5KSVA 3VXPA 1U3HC 3P2TA 4P23B 4DOHE 2YMXH 2R8SL 3L5JA 2GW5A 2IBZX 1Z3GL 3O45B 5JHDB 3PNWB 3I2CH 1IE5A 3DO7A 4QY8B 3QWRD 4M3KB 2D7NA 5I9QB 1J8HB 1C5BL 4FZ8H 5ANMB 5C7XL 1DUYB 2XG4A 1FL5B 2EZ0C 3VE0A 2FIKA 5GGSB 1LGVA 2BMKB 2DQUH 3RWEB 1FO0L 4QNPF 4HZLB 3QRFM 1KLUA 2E7CA 5AZEH 4UIMB 2FJGB 1MUJB 1RAMA 5CEXA 1S9KC 4NIKB 1U8HB 2BHZA 4N0UE 5HHOA 3U46B 3L9RB 3SDAA 5GGUB 3V4PH 5FYJL 3OX8A 4M8QA 3FB7B 1P2CA 2ERJB 1D3CA 1A6TB 2AXGA 4R96A 1T0NA 5FB8A 3PL6D 5D7LB 2EH8H 1YECL 2ID5A 4PUBL 4QRRE 4YK4C 3GUTA 4R9HA 5KVEH 4HH8A 5EZJB 3OKNA 5F89B 1QFWI 1ACZA 4OV5B 4M1DL 1KT2A 3TFKA 3NIGF 2YMXL 2R8SH 4MDIA 5E8EB 4WWID 1BX2B 1JI1A 2R56H 3S34H 3HUJA 4K7PY 2H1PH 2NX5D 5GRXG 3T0EA 1GHFH 5SWSB 2WIIA 1SVCP 4YGAB 3W9DB 3PGFL 4PJDE 1DQLL 3PWLA 1D9KC 3EUUA 4JVPA 5IGXH 4KDVA 4ZUVA 5CWSA 5EDXA 3V6BR 5ISZE 4KTDH 1YMMD 4AZ8A 5E2TL 2QQLL 2VLKB 5C09A 3H9YA 3I9GH 4HUXB 4IRJD 4OFKA 5DQDL 1IKFL 1Z3GH 1ONQB 3GKZA 1PKQA 1ZWIA 1KLGA 1YEGL 3MNWA 1QLFB 4MJ4A 3AGVA 2L0DA 3JTCA 4D8PB 3TP4A 4N1HB 1TJGH 3KYNA 1JNJA 1T83A 5BQ7B 3B6SA 3GMMA 2EH8L 2PO6D 1K85A 4LCIL 5F72S 4RFOL 3QUMA 1W72H 5D72H 1X4XA 5E2JA 4Y2DA 3TESA 4OZIB 3QIUC 3QUZA 1LEIA 4KVNH 1P9MA 2YZ1A 2F19L 3GJEB 1I1FB 5CZXC 4O2CB 5D5MB 5EBGA 5IF0B 5DC4B 5FA4B 2ZUUA 5CGTA 2EYRA 3GB7B 5DJDA 3IDUA 3DV4A 1CGVA 5BZWA 3Q6FB 2J88H 1UQSB 3MLVH 4OCYH 5IGXL 4MX7B 1TCRA 3OR6A 2ARWA 5A16B 1L7TL 5FYJE 3BESR 4F8QA 4P9ML 3ES6A 3TBVB 2VIRA 2Z4QA 4QHUA 1BHGA 3E6HA 2QHLA 4OUUA 1JRHH 3CFKA 3V8OA 1SEQL 4PTUB 4LHQB 4ZFOA 5IMOA 3PIQB 1GGYA 3QIWD 2NW3A 4C56D 4GAFB 1EFQA 5JPNB 2DBLH 4NZJA 4X8JA 4HWBA 4IDJL 5FV1L 3T1FA 4G7YH 2CJUL 3GMOA 1VSCA 4FFZH 3ARQA 1ADQH 3VDBA 1PYWA 3O2VL 4YNYA 5EIIB 5LAXB 2B0SH 1EEZB 1WCBB 2YWYA 5DA4A 3O11B 5KBNC 5IBTL 4CMHB 5CEYB 4KUZH 2J8UE 3MUGB 2HLFC 1UH2A 1QSEB 5JIHA 5CZXD 4A2LA 3JTSB 2DL9A 1JYVA 3DXAB 2K1MA 2P44B 1YEGH 3MREA 1QO3B 2J88L 1JRHI 3S35L 4HGMA 3VG9B 4LPTA 3WKNA 5EOCH 4QHMB 3IU3A 2YHGA 2GJJA 3PABA 5BJTB 1H3TA 3KPNB 3CVIL 4J4PC 4NPYA 4TUKH 4ZOCA 1NCNA 5AYQA 4NUJB 3EDKA 1U8OB 5IQ7H 1EIBA 1KENH 4JANB 1ND0B 4BUGA 2KZ1B 4CMMB 3RTQA 5EBWB 4NC0B 1JRHL 2FB4L 4OTXL 3GSXB 3W2DL 1G9NH 2QJDA 2FBOJ 4PJFB 5HGHA 1TVBA 5I1GH 2VDNH 5GGRA 4NKMA 4EJ1C 2NY2B 1CTNA 2Q3AA 2CDFA 3TCLB 3GMMB 3PDGA 5C0EA 3SE9H 4XGZA 4XT1C 4KH2A 4Z8FH 4KUZL 4TPRL 4O58L 4X5WA 1IM9B 5JXAH 3OTTA 5IFJB 1VKXA 3A67L 3NAAH 1A9EB 1YMHB 1DBJL 3CPLB 3LMJL 1MQ8A 1YPZF 5GZOD 1WC7B 3ARGA 5E6ZA 1LK3H 3FFCE 4LHUA 1P7KA 4R26H 4Y4KC 4ZUVB 4L9DA 4HT1L 2OM5A 1N26A 5DTFA 4MXWL 1CE1L 1ADQL 4Z78B 1KCUL 1D9KD 4LVHC 3D48R 4ZDHA 2QADD 4Y2OA 5D5MF 1AKJD 3ZL4H 2GFBA 1U42A 1TMCB 1TJIH 4KKNA 3GMLA 2B7DT 1KCVH 4UV7L 4MCZB 4EQ3A 5KOVC 4F58L 3NGBB 1BIIB 3BSZH 1RZ7H 2IPKA 4MDIB 3D25A 5E08H 3WSQH 5D1XA 2KQNA 3D3VD 3KLSA 4X4YA 1G7MA 1JWSB 2CGRL 2I60L 1HSBB 3Q6FA 3PWJA 2YD5A 2HMID 2BSTB 2W0FB 1KPUB 2ENSA 4H0GA 1KB9J 1IAMA 3SKNB 5I1KH 3FB7A 4B53A 2DDQL 5C0JA 1U8IB 3NAAL 5K93A 1IBGH 5DRXA 3U9PL 3L9RA 3IJHB 2MCPL 4Z76A 2ADIB 1B4JH 3BMWA 5CEXB 1DQJB 3W9EA 3RBSA 2P5ED 4R4BB 4LHUG 3KYNB 5I16B 2IBGA 3WS3A 2FYYB 1QLFA 4PR5B 3QA3A 5GGSA 3SDAC 5C0DB 1FVEB 3AM8C 4HUUA 5SX5H 3RVTC 5ANMA 3QR2A 3ELAT 4MAYD 5CKAA 2R0LL 4JG0L 2EYTA 4QY8A 2XN9A 3QQ9C 4N0FB 1RIHL 5HHME 2WUCL 3KYAA 1FYTD 2WZPD 1HNGA 3EDDA 1DBJH 3HB3C 3ZLQC 3VXPB 1MFEL 2X9WA 2P24B 5C0FB 2I60H 2E27H 4UDTA 1UZ8B 3SN6N 2X4RA 1T3FA 3QIWC 5HDQH 5J6HA 3DV6B 5EPMA 1D6EA 2IH3B 4MJ6B 5C0RH 5TE7H 1AXSA 1L8JA 3LB6C 4OJFL 1NBVH 4TNWK 3RL1A 4KY1L 4A6YA 1GOGA 1MIEL 1NC4A 3T0EE 1T5WB 1EZVX 1UEMA 1DJSA 4NO3A 4QXTB 4X7CC 1K8IB 4GW1A 1J5OH 5EO0B 1YEHH 4OF6A 2DN7A 4RX4D 4X5XA 1MHEB 2UV3A 3K81A 4L3CA 4M7KH 5EU7C 3U2SB 3DTXB 5DGRA 5F44A 3OAUH 4BELD 2AKRB 5KSAA 3GBMH 5D7LD 3O3UN 1LQVA 5E1HB 5HYEA 4MHHG 1HQ4A 3EGSB 3EFFA 4LLVB 4Z7QF 4C56A 4YE4H 2MCPH 1V3KA 1BEYL 4YQXH 4JHAH 4ZAKC 3OR7A 1FN4B 3PWUB 3BRDA 3DMMC 2VQUA 4XZUB 3LKRA 2X4NB 2NX5B 1TZIB 4U6XA 1T20A 1PQZB 1L0YA 4YJZL 1DQDH 4ONHA 4QOKA 4XVSH 5HHOD 4YHLH 4WU7A 2VL4A 5D1QB 3BP7A 4XNZC 3QCTL 3U4BL 3ULVC 3ME0A 2VLKD 4JKKA 5FEBA 3DWTA 5EZIH 4OLVH 4G8IA 3MV8B 2HLAA 1OSPL 2XZCH 3KPPB 3PQYD 3IAQA 4FQJL 2NMSA 3V4UL 3W0WA 3QDME 1R3IH 3RTQD 4JPVL 5BS0B 5JOEA 1IT9L 4HQQL 4YHPB 4EZMA 2RIKA 4NO5B 1IEAB 1EA9C 1MIEH 4KKAC 5HI3C 1E4KA 3SCMA 5LG1A 4KHXH 3AFLA 5FO8A 3EHBD 1KLFA 3HPLB 4X6FB 5CGYD 4JKMA 1D5XA 2VLRD 3IXAA 4D9QE 1JGVH 4PS4L 4OZFB 3DI2B 3G6JB 4KDTC 1ZLVH 2A6KB 4PJXE 2JELH 4OLXL 3C6LA 2Q8BH 4POZC 1Q0YL 2NTFB 4HPYL 1Q9WB 3HLAA 1NCAL 1A7QL 4JN2B 2RR3A 5K9QI 1MREH 1U8QA 4WEBH 2R2EB 3NH7L 5GIRB 2DL2A 4QOKD 4ZOEA 3H9ZA 3NCJH 5F7DA 5I19H 3QEQE 4AM0B 4XMLH 1QFHA 4PJIB 3QUYD 1U93A 3B4NA 1QLEH 1MHCB 2DLIA 3G04A 4OGYL 3BYTA 3U36A 5I17B 1G7LA 2RFXA 4MGXA 5FDYA 4EUPH 2W1NA 5FUOL 5FYJU 4YFEA 3C8HA 4YBLC 3WNOA 3K1KC 4O4YH 4X6BA 4JHWL 4GRWB 3OXSB 1LK2A 1UWXK 5IVOA 3CMGA 1RUKL 3GHBL 5JW5A 5GJTL 1ITCA 5JA8B 1M05A 1QA9B 2V7NB 3HE7A 4YK4B 1NCDH 4OLUH 1NGWB 1T80A 4H1LA 3VI4F 3BDYH 2OTPA 4EUPG 5F9JB 2A73A 1IGTA 1Q0XL 2F58H 4IOFD 1DUZA 2LAAA 1GZPB 4OLEA 4QXUL 1NCWH 4PREA 1IT9H 4HQQH 4LSSL 3LKPA 2VUYA 1PJ9A 1CIUA 2E6QA 3QI9B 1AIFA 5TF1H 5I19L 3MXWL 2BNQB 3HR5A 3SKMB 3L7EB 5D1ZD 2WBJA 4KU1A 4Y1AE 5GHWH 2DAVA 1I7TA 3PHOB 3WO4C 5GSRB 4NRZA 3I3BA 3NZHL 2JCCF 2VTFA 3RU8L 2E7LC 1YNLL 5E9DB 3BIKB 1XR8A 1HYRC 5EOQH 3RHWF 4OV6F 4HAFA 1Z6JT 3L3JB 5CHNA 3V6ZA 2HFFB 3MGTA 4HGKC 1KGCD 1F4WH 4KZDH 1U41A 1C12A 4PJ7E 4QHKI 3S96A 5M7QA 4P99A 3VXSA 1YQVH 3BQUC 4G8FB 1OAXL 2AAVA 1I1CA 1RURL 4FQ2L 1ZHNB 9CGTA 1DQMH 3FONB 1WZ1H 2CDEB 5BZDB 2XOTA 4M7JL 1PG7W 4P5KA 2V2XA 3ARGC 2G60H 5L8LB 1GC1L 1CXKA 4L9LC 5IW1A 1KJMB 1MRDL 4QHNB 1QR4A 2MJWA 2Y36L 3QUXB 3MRCB 8CGTA 4HS8L 2CIIA 3V0VA 1PGRB 4PGBB 2OMNA 2H9GA 5FO8B 5FIEA 4PRIB 1VEPA 4I18C 1CQKA 3ARRA 2W0PA 4LKCB 1I3GH 3OGCA 3JV0A 1MVUB 2JKXA 3OKDB 5B39A 1T83C 3WFBL 4LLMA 5KSBB 1KTDA 3QWOA 2EC8A 4K3JH 1J8KA 5J9PA 2BC4A 2VLJE 2VXTL 1X4ZA 2FO4B 5DJ0B 3K8KA 5HHQB 1VGKA 4JFXA 4Z7OE 1CFQB 3WLBA 2MNUA 4JFPA 2VLRA 4X7TA 4BSVA 1GOFA 4JO4H 2BSRB 2CD0A 3BP7B 5E2UL 4XNQA 1U8PA 4URTB 3BEWA 3O2VH 5IROA 1ED3B 3GJFB 1QBBA 2V2WA 4HC1H 1N64L 3HMWH 4ONHB 1KC5L 3CDCA 4L8SA 1J12A 4X9BA 2XV6B 3B43A 1F6AA 2P5WB 3GMNA 5IWLA 1EXUA 5C09E 3DI3B 2EE9A 2P46B 3PGFH 2X4NA 3P9LA 4QNPE 1DR9A 3MCLL 3TFKC 3QRGH 4Y8AA 7FABH 4E42B 2NY4D 4XPAL 1SJHA 4KC3B 3UAJC 1M7DB 2VDPH 5TE4H 5J0BA 2DQJH 2AV7A 4C56B 3DGCR 3G9AB 4LLQB 4PJEA 5IBLC 1OPGL 1J87A 5I1CL 1UM4H 1YMME 5E2TH 4U1MA 1JF5A 4NQCA 5HDOA 4M6MH 1MI5B 1CG9B 4HF5L 3QG7L 3MMEA 4PV9B 1SEBB 4JM2F 3W2DH 4D0CB 1MI5A 1V05A 3GSOB 1S9XA 1ZAGA 3HE6C 3WXVH 4EOWL 4IJ3C 3MROB 4I9WD 4S11A 4PJEB 4ZSOB 4JPWH 5SV4A 4JO4L 3GBNL 1ZVHA 5EG6C 4PLOB 1TPXC 5MERA 3ZYIA 4CVZA 3MNVB 1HILB 2Y5TB 4KRMB 1FCGA 4LRNL 3RRQA 5CD3A 3JUZA 4HC1L 5HVFB 4OZGB 4M7LH 3G6AB 4K3JL 5IK3A 5IQ9B 2FSEA 1UC6A 2G5BB 4X7EC 1JHKL 4Y4HD 4V2BA 1R0AH 5D7LE 1MQKL 1M7XA 2FWOB 3PV6A 3BEWB 4QRRB 4HWZA 2P24A 3CDYA 5C0FA 3HRPA 3BT2L 3MRGA 4ZFFB 1L7TH 1DZBA 4HX1A 3WLWD 2ARJQ 3U7AA 3TH3T 1XGUA 4PJ8C 4NC2B 2NY3C 5EO9A 3WLBB 1UXSA 4HK0A 3FQXB 3G5XB 4BZYA 4HIIA 4WI2A 2PO6A 2WWKO 4HF5H 2EYTB 2AK1L 4XWGL 1ZMYA 4PG9B 4CNIB 3KAAA 4HKXB 5D1ZC 1M6OA 2AV7B 5D1ZA 5ILTL 2WBKA 3T3PE 1MVUA 5AEAA 4R4BA 4IRJA 3MRHA 5DXWA 4LKCA 4PBXA 2CJUH 2UZYB 4HS3A 2ADIA 4UUJA 3PP4L 2ITDB 4KKBD 5E0QA 2O5YL 4C83A 3MLTA 2HT2C 3KPSD 5I1KL 3P9MA 1JF1A 1MEXH 3NA9H 2B1HL 1NCTA 2L7UA 3VG0H 3I75B 4TSAH 1BVLA 1UWEH 2CDEA 2XWBA 4BKLA 3MYJA 2DI9A 4ZUTA 2HKHH 1FZMA 1UB5A 1HHGA 4RMTA 5LVEA 1QBLH 2Y6SC 3MBED 4R2GB 4S1SL 4B7IA 5I1JL 1CZ8H 5TPWL 1G7HA 2VLRE 4F3FB 3ESVF 5LKNA 2HN7B 5HHXL 4MNQE 3GMLB 2VO5A 4PJ8D 4LVNB 5CHNB 1N8ZA 3V6ZB 4WUKL 3QHZH 5JXAL 1NLBL 4XMKH 3WN5C 1FNEA 2F9BT 5AUMA 5JW4Q 5GSRA 3PHOA 2BY1A 1OTSC 4GOSA 2O5XL 1T5XA 2YSSA 3SCMC 1EH9A 3JSSA 1FORL 4OGXL 4OZHE 1ZHKA 2CXKA 3QI9A 1QP1A 2PXYA 1ETZA 4MXWH 4O51A 4UILL 1B0GA 2EDLA 5HDQL 4JFEE 5IFJA 1VKXB 1YDPA 1RULL 3GSRB 1U3ZA 3C87A 1IM9A 3TNMB 4NKDA 5IKCA 4NHUE 4PJHB 5L2KD 4O9HH 1BFVH 2D3VA 2YPVH 3RX5A 1H15B 3MJ9L 4IRJC 2HG5A 3GK8L 4NZRH 2QKIB 5I1DB 2AJSH 2CDFB 5C0EB 2DLGA 5AWNL 3HRZA 4MS8C 1JHTA 4HHAB 3LQZA 4L8SC 1ROWA 3O4LA 2JK5B 5I1AB 1XCTB 1QKZL 3BIAX 1RZJL 3ZSTA 5HHXH 1IARB 3TFKD 1CE1H 1OTTC 3BN3B 2P8LB 4M61A 3MV9D 3WIHH 4DCQB 3VXUA 4CMMA 1QPXA 4NHUA 2BJML 3WDHA 2SEBB 4N0CD 1U8OA 2WBJB 1HEZA 4MA7H 4F37F 1J1OL 4G6KH 4HUNB 1I3RB 1HH9B 1TNMA 4MLIA 5IJKA 5C0ND 5ALBL 3IU3B 3GFUA 3S7GA 4HJJL 3U9UA 4K8RH 2OI9A 5HGBA 3C09B 3FT2A 1AFVH 2C26A 3QH3B 4Y5YC 1KIQB 2UZIL 2ADFH 3GIVB 1Y18A 4H8WH 2IPTH 4N8VA 1CVSC 4OZFA 3VFRA 1E4WH 3RAJH 5I8KH 4TTDC 1YNKH 2ZP0T 2R1WB 1Q72L 5EC1B 5F7LB 1LEKA 1JPST 4Y5YB 5JPNA 3UZQA 1NCCL 4WGWB 1NEUA 2WV3A 3PIQA 3B9DA 5ESAB 4W6WB 1QHOA 5DJCB 4P2OC 3GSVA 4U31A 4PJHF 4EVNB 5KAQF 3U36B 3TZVC 5KVFL 3OKEA 1RHHA 1D5MA 4DQOL 2C4FU 3ULUF 2Y06L 5EOTA 3DRTA 4PGDB 5C9JB 1J1OH 2XQYG 1HI6A 3TF7C 3RVVC 4RGMB 5ISZA 4Z0BL 3HLAB 3HAEH 1UWGL 3C6LD 4MYWB 4YHOL 1LP9E 3UTTA 4G6ML 1AFVL 3HHRB 5IBUB 3VFGH 3ERYA 1G6VK 3IJYB 4I0PB 4FNLH 2AEIT 2XTJC 1YN6B 4DUXA 4PP1C 3N9GL 3B5GA 3TH2T 3CSGA 3VFWA 3HPLA 2HT2D 2NX5A 2WWKT 3T0ED 2YA2A 3MR9A 5E8OA 2Q7YA 4KVCH 1MRCH 3CSYB 1NQBA 4TUOB 5IVNA 1I9RH 5I74B 1PKQB 4GG6B 2CO6B 5GZNC 3HAEB 1YEJL 4Q6IA 3NACH 4Z7WA 3T2OA 4WW2F 2X4QB 5FUOH 3O81A 2L7JA 4XNYL 3WUZA 3Q1SL 2K7PA 1OP5K 2H2SC 2HJLA 3G5ZB 3RX8A 3MRJA 1DEEB 2XZZA 3IU4L 1KTKE 3LQAH 4WV1A 3PWVA 4Y4FA 5HYQB 1BQLH 1Q72H 4JR9L 1S7SA 3EYSL 4QOKB 4CW1B 5ESQB 3VFMA 3OKKB 1CK0H 5K59F 5F70A 2BVQA 2P8PB 1SYSB 2AJVH 2CIKA 4ZUSA 1AXSB 1I8IB 1CFBA 1B4RA 4XVSL 4KRPD 1IC1A 1KXQE 1YMMA 4XVTH 1YECH 2GT9B 1XR9A 5TF1L 3D3VA 5D7LA 4UNUA 3WNNA 1A6TA 2AXGB 5GHWL 1WAAA 2A6JB 3LV3A 3OF6D 1WGOA 4P59H 3JWOH 1NCUA 2Z8RA 3LV3B 1FGNL 1X5JA 2R56L 1QEWA 2XNAA 5MHSD 3ZSSA 1U8HA 4E41B 1KIPA 3NH7H 3PDDA 1B0RA 4Y5XC 4NSKA 2E7LE 1S7RA 1T5WA 1DQJA 3W9EB 3OJDB 1JWUB 1I8IA 3QI9D 1I8KA 3IJHA 3CFCH 5EPMB 2XPGB 1GC1H 2UWEB 2YD6A 5I1HH 3SDAD 3ALXA 3LS4H 2V5TA 3IJYA 4Y4FC 1SYVA 3RY6A 1NCAH 3X12B 4WCYL 1HSBA 3F6IA 3RP1A 3CVHL 3E2HA 3GRWA 1JZ6A 2IPKB 5DVMA 3BKCL 3IB4A 5C71A 1EO5A 2FD6H 2J8OA 1MCOL 3P4NB 5J1TC 2P7TA 2Y5EA 2IG2H 3QA3B 5HHVH 5CBAB 3QNXA 1X5ZA 5KN5B 4IJ3B 2LTQB 4P2OD 5FKAA 1RIVH 2BHYA 1Z9OA 4M3JA 2HJFA 2J5LC 2IAND 3MV8E 4YC2C 5IVZA 2VLJA 2AGJL 4AQOA 4N8VB 3UTOA 4OF8A 4I0PA 1H3VA 3RVXD 2H26A 2VH5H 4M43H 5I1HL 1MAML 3TT1L 5B4MC 2V17H 4LOUC 4XPFL 4ACPA 4PRAB 4NQEE 4ETQA 4EN3A 2EDXA 1AQKH 3VXQA 1AGEB 1G7MB 1D5IH 4LLYA 5JOFB 2OI9B 1A4KB 4PJ7F 3BKJH 1UYWH 1NDMB 1INEL 4ODVH 4ETYA 4PP1D 4PJAE 2AJUH 4PJ8B 1FNSH 1E27A 1J1PL 3A6OA 3ZMRA 4M6ML 1ERNA 2GFBB 2CPCA 4FFZL 4F8TA 2WP3T 4AENA 4GT7A 2AEPH 3BAEH 4M4RA 1JZ4A 1Z0NA 5ESAA 4GG8B 5EWIH 4G9FE 4JANA 5DSCB 1M71B 3UYRL 4M7ZC 2YN5A 3TJHC 3MV9A 1RIVL 1WQVT 25C8H 1I4FB 1RZJC 5FKPA 1EO7A 4JB9H 1KIRB 3ARGB 3LCYA 3EDEA 4OB5H 5GZND 3FOLB 3MRRA 3DX9A 2WIMA 3ARUA 3MRDA 4XI5D 3H9HB 3WFBH 3WFHB 4I48B 2ORBH 3GIVA 3LOWA 3BPLB 1RMFL 3KLAB 1CXFA 1RJZA 3D18B 3GO1L 1H15A 4KK8D 2XXMB 5EU4A 1MI5D 3TCLA 5K9KA 1FNFA 1MH5A 3FT3A 2YXMA 3RPIB 3JV5A 4GS7C 4NFDA 5K9JL 3BKJL 3TA3A 3PWPB 1QSFB 4R7DA 5GJSH 1T5XB 3SE9L 5E70A 3GSXA 5DSCA 3I9GL 4R0LC 5CGYC 4M5YL 4DCQA 4JKLA 4PTUA 3RNQB 5AD0B 1S7QA 1ZSDB 4ZUUB 4NPYB 1MOEA 3BD5A 3QQ4A 4P23D 5I1AA 1E27B 4HFWA 4N5EA 3O4LB 4HHAA 3WFCH 4EDWL 2XN9D 4PJCE 4F15B 3HRZB 1CF8H 4NQDA 4PG2A 1UYWL 1GC1C 1NAKL 2Y72A 3CFBA 3OB8A 2FH6A 1Z9LA 1N2RB 5F9OH 3BRFA 1J1PH 1NJ9B 1S7VB 5E9DE 3ZL4L 4XCFH 3IFNL 3NA4A 2FHBA 3B2VL 3PJSB 5DK0A 4BQ8A 4Q9RH 2E9IA 3EKCA 5EIIA 4YAQA 3I3DA 2PYEE 4MQXC 1RUQL 3QI9C 1RZ7L 2X7LA 2UYLA 4WFHD 3CXDH 4FABL 1RV6X 5B3NA 3F6LA 3HC0B 4YXHL 3VXOB 3QUMB 4WFFD 2VDQH 1INQB 3OG6B 1KUMA 5D2NA 1YEKH 1UM4L 4QKXB 4N0CA 2R0WL 2DDQH 3QHZL 1ONQA 2JB6B 2LAGB 3IVKA 2ICWJ 1UJ3A 1VACB 4J1UA 1MQKH 1NUGA 2ZUSA 3BX7C 5EO9B 4PRIE 4MX7A 5DR5L 4CN6A 4Z7VE 4KI5C 1C5DA 4LLWB 4OQTH 5SWSD 3TV3H 5CWSB 3VI4E 1IEHA 5DHYA 4JQXA 3U48A 4NQED 4NQEA 5IR1B 3V0WH 4QXWA 5LGHH 3EYOB 4OD2A 4AG4L 4OZ4A 4KHTH 4QRTA 4C83B 3NPZB 2IANA 4NZRL 4RRPG 3KR3H 3H2WA 4YDVA 4HS3B 3KGRA 4WI3A 3ET9F 5E8EA 4IRJB 5HTSA 5A1AA 2FBJL 4Y0GA 3HZYA 3FO9A 1A1OB 5I1IH 1I1AB 3VJ6A 1WZKA 5FB8B 1UVQA 1EEUA 2F5AH 4DOHB 3QO1A 1T66D 3VXNB 3BQUD 4UMGA 1T0PB 1QEWB 4TYUA 3VWKD 4YDJB 5EUKB 4F7PB 5KSUB 4HWBL 1MCDA 1JPGB 1KFAL 4M8QB 1HZHL 5C09B 1G7IA 4WW1B 1ZK9A 3RY5A 3I02B 3W5NA 2UY7A 5TFSL 3U46A 3GSQB 4OT1H 4YO0B 4OCNC 3K8MA 5DA0B 1XR9B 4ZTPH 4YHYB 2QQNL 5TPWH 4HIEA 1EBAA 3PP4H 3BZFA 4MD0B 4S0TD 3QDJB 4ZUSB 1J8HA 1RQ5A 4OZGA 3CK0H 3F62A 1EXUB 2R4RH 5FGCE 4O58H 4AEIL 1RK0A 2BVQB 1UJTA 4RRPA 3MLWH 3ZKXC 2R69H 2ZKHL 1JBJA 5ESVA 4YDKL 2VOTA 3BWUC 4WV1B 4U05A 1DEEA 2YWZA 3MROA 5HI4D 1ZGLA 2VLME 3C60D 3SE8H 1IZKA 3LKQB 2X89A 3LH2L 3QQ3A 4KGLA 4TRPL 3OX8B 1RULH 4OZGE 3S9DB 3RVUD 3VXTB 4CDGC 3P9WB 3L3DB 5JQHC 1XGTA 2NXZB 1KGCE 2C9AA 2I5YH 1FJ1A 4YHIA 3KHQA 4CADB 2DMBA 4FQCH 5DK2B 5HHOE 3NIGE 3O6ML 2IQAB 3HI6L 2B5IC 3O2DA 3RWEA 3WNKA 2JJWA 3QFJB 2GCYB 4KTEL 5H2BB 3MUHL 4G6FD 2D03H 4LNRB 1P69B 1IM3B 3EYVB 5EZIL 3MA9L 4MJIB 1CFTA 2FNBA 4P49A 3P0GB 1NBYA 2LU4A 4L4TB 4XXCA 4RGOL 2WNGA 3B9KA 4LSDA 5B38B 3UTTB 4NYLB 4PY7B 2EXWD 2FHCA 3ROLA 8FABA 3E6FA 4OFVA 3CU7A 4CN4A 3QDGD 5CUSL 3HE6D 2I9LB 2EEAA 2EDYA 1QG3A 2MHAA 4JFXB 3C60C 5DS8A 4Z0XB 2IFFH 2J7LA 1YPZB 3RGHA 2BC4B 1CR9H 5EOTB 4DKEH 5C9JA 4H1LG 5D5ME 3O6LL 2YBRA 4KJYB 1VESA 1CXIA 1FVCB 4QGTA 5E9DA 4HBQA 1RIHH 5DF0A 3RZCC 1JPSH 3RI5F 2EYSA 1LEKB 5C6PB 2H9GB 2BNQA 5KS9A 3KXFE 2OP4H 3MYZA 2HVJA 4N90D 3WJJC 3RVWC 3V79C 1BAFL 4UBDC 1ZA3B 1A7NL 4V1DE 3QIUA 3QUZC 3BGAA 1KIQA 1N3NA 2NY6C 4M6NH 3HCVB 2NR6C 3MODL 2WBWB 4X6DA 1FFNB 2Q1EA 3QNYB 1AGCB 2VDLH 3H3PH 2QR0A 1T89A 3ARZA 1RIUH 2NLJB 1T1ZA 1GGIL 1S7WB 4I8DA 4JQIL 4WI7A 1T7XA 5SX4H 3C2SA 3MGTB 1J5OL 4U33A 4PGEA 1TZHA 1PSKH 4X6BB 5KZCB 3LEYL 1K2DA 2XYCA 1QRNB 4LEOB 4QHKJ 5KJRL 3RA7H 3HC3H 1ZKAA 5ALCL 1FYHB 5J57B 5GS1C 1A5FH 2P8LA 3DSFL 5DJZA 1W8OA 3IDYB 1K8DB 1F5WA 2QHRH 1U93B 2JK5A 1KTLB 2OJEB 5F6HJ 1JHTB 4A6YL 1YEIL 2FX9L 3QNYA 1FFNA 4YHOH 3SKJL 4Y1AD 5JIPA 2A0LC 1Y0LA 5A43C 4M6NL 4HJ0D 1BGXH 2NXYB 3E3QC 1DQDL 3LRGA 2V7NA 4JE4B 4GUPA 3D87B 1Q1JL 2NR6D 5CIPH 3MOQA 5JW5B 1AHWA 2HVJB 5B8CA 5KSAC 5C08E 2CLVA 1UA6L 3IXAB 5BRZE 4NNPL 2NCMA 4Z6AT 2FCBA 3ARSA 1MELA 4LP5A 4GXVL 1CK0L 3SCMD 1OSPH 1MJJA 3QDMA 4U7SA 4JFOB 4D9RD 3SBWC 2CKBA 3BPNC 4NN7C 4OI7A 2YBRB 4KJYA 1KELL 1YY8B 5DQJB 3VRIA 2HN7A 2XTJE 3MUZ1 3ARED 4NHCH 4JHBA 1FL3B 2BCKB 3L5IA 4PJIA 5D6CA 3VD3A 4XNYH 4PJGE 1F4XH 3EFDH 4U6YA 2YEZA 1RU9L 5AYUL 5EUOE 1NGYB 4KHXL 5F1NA 4HUVB 2P43B 2BRRL 4LVOC 1UCBH 3B3IA 1GAFH 5D1QC 4HZAA 3MRPA 1UB6A 1CWVA 5FGRA 3EYQC 2A6KA 4G6AD 3RGVB 3REWB 4D0BB 5ACLA 5TDOA 3T04D 5F88A 1D6VL 3RDTC 3CDFA 3DSFH 1E6OH 3ZKMD 3C5ZC 4EDXB 1TZIA 4U6XB 1EEYB 2ZOKB 1HQRA 1AKJA 1T1ZB 2GCYA 1QVOA 4P2OB 3VFPB 3CUPA 4XP9H 1KYOK 2AJUL 3OR7B 5H37G 1B0WA 5DUML 2IEPA 4GXVH 1FVDA 2HKFL 1QLEL 2W60B 4CADA 1S9VA 2X5PA 1UZ6F 3QNZB 2OJZH 1XH3B 4LLDB 4PG9A 4CNIA 1VA9A 4O5LL 1OW0A 3JWOL 1ZT4B 1RUMH 3I6GA 5CSZA 1MHEA 4LASH 5IB5B 5FYKU 5BW7C 3RFZC 3RWGA 4DW2H 2JJTC 4HWZB 2FWOA 3EBAA 3PV6B 4QRRA 3O3BB 5I1CH 2CXGA 1KJ2H 1PEZA 2BP3A 1FG9C 5ESVB 5B38G 3MLXL 4OCSL 1JN6B 4YWGL 4UTAL 3QEHB 4RAVB 5IESL 4A6YB 3LKNA 1DDHA 1QRKA 3LS4L 2B2XH 4U6HA 4MD0A 3RVWD 1WAAE 4ZTOL 1VFMA 4MXQD 1K3IA 2UUDK 1U8MA 1T3FB 4Y16D 3ZKMC 3QISA 4Y16A 4PP2A 3HZKB 4ZSOA 1QFOA 4JY5L 1CGUA 5D8JL 4D0CA 3TNNA 2X1OA 4M1CD 4KK5D 5JR1H 2HTKC 3C6LC 4AEHH 5DD1H 3D69B 3CLFL 3PQYE 5E5RB 3U4AA 4CVWA 4NQCB 3BVNB 1T2QL 5JXED 1UVQB 4LLQA 1JMZA 4HBCL 3MUJA 4HWEH 1A1OA 1VGEL 4M7ZB 5GRUH 1MFCL 5I75C 4JLRA 2YZ8A 5IHZB 1NMAL 3TIEB 5D96C 1DVFC 3MTRA 5DD5H 3IT8D 3AAZB 4RGNE 3TJEH 2J6EH 3L3DA 4NBYB 2QQLH 3UYPA 4P3DA 5EWIL 3O41A 2D31B 5C0JB 1JCKA 2V2WB 3LAFA 1TFHA 2B2XL 4XPFH 4TUJB 1JFMA 3QBTB 3CXDL 4PLJD 1A7PH 1JWSA 3VXRD 3GMRB 4ODVL 1YEDA 2XN9B 1VGKB 3LS5H 3B83A 2H41A 1QZ1A 5J9PB 3MLXH 3QDJA 4U49A 4HUUB 4TVPL 4H1LH 1TMCA 2B20A 5JW4N 1FAKT 1DQQB 2FHFA 5D2NB 4JRXB 3SO3B 1MLBB 3NPSB 2ED9A 2B8OT 3GSUA 3GSQA 4Z76B 1QLRB 1VHPA 3QUXC 4ONGL 3GI8L 1MY7A 2GJ6D 4L4TD 5I8EA 2HJKA 5DDHA 3JWDL 4FQIH 1CZ8L 5I71B 5LGHL 1YMHA 2CSPA 4UIKL 4XP1H 3V2AR 3BN9C 1FFRA 4KQ3H 3HI5L 2C1OB 5BS0E 3DX8A 4PRPE 2V2XB 5I0DA 1HKLL 2A77H 3QO1B 3WE6B 5DMGC 3PWJB 2D7MA 4XMKL 3IF1A 3NZ8A 2MKWA 1A1NB 4ZO7A 4I77L 3VXMB 4JQXC 3PE9A 1QBML 1BJ8A 1L6XA 1BIIA 5C2BL 2F5AL 2HFFA 3U0TB 3RNKA 2VABB 1N5YL 5HGAA 1PAMA 3L5WA 4NP4H 3TJEL 2NYYD 2OZ4A 4TVPH 1KEGL 4NQEB 3QJHA 4UT7H 3KLHD 4I3RH 4BZ2H 3S4SB 3MV11 4ZO8A 4WHDA 3S35H 3FQWB 4JPIA 4PJAB 3TA3B 4N68A 4IRSB 2FEEI 4ONGH 4ZFOL 3LKPB 2VL5A 4L5FH 2QQKH 1CQYA 1QKZH 4X5WB 1I1AD 4FG6D 4XP1L 3W82A 3LS5L 1MCJA 1OHQA 3UEZA 3V95A 2AI0H 3FB8B 4GKOA 4GLRH 4J3UA 1QA9A 1M05B 1RZIB 5GGRB 1A6WH 4WI8A 2VDNL 2DQCL 2IAMB 5D1XD 2CMRL 3UJJL 2UYLB 2BVPA 2BOBB 4LSRL 1I4FA 2KQMA 4YAQB 5DUBA 4XB7A 5F96L 2NW3B 1OGAE 2CDGB 5EBWA 3OB0H 1LNUB 4M7KL 3U6RA 1IC7H 1AQDB 4AENB 3RY6C 3ZDZF 2I5YL 4GAGH 4I4WA 3E6HB 3TBVA 1WFNA 5EH1A 5IP4A 4ENEC 4YH6A 4E5XA 4Z18A 1QSFE 4P4KD 3CLEH 4GW4B 3KJ4C 4J7RA 4HULB 3NIDE 4DGYL 1NCCH 2G75B 1OL0A 1A4KA 4HT1H 3OR6B 3QFDB 1OF2B 5CILL 3T08A 1CT8B 1FRGL 3MA9H 2BSSB 2YS4A 1MEXL 3O11A 4AG4H 5FA4A 1KCVL 1IRAY 5IFHL 1QNZH 2BNRD 1JZ3A 1FNGA 4PLKD 2BVPB 2AK4E 3F7VB 4J6RH 4UV7H 3VGAC 2IAMA 1MCHA 3ARVA 1V8HA 3H9SA 4N8CL 4X7DC 4X9HA 5HSFA 4EIGB 2QLVB 2X09A 3HAEG 3WSQL 4ZFOB 1IEAA 2DJ4A 5KN5A 3FQNA 3QFJD 3TCXA 3G6DH 3G5YA 3ULUC 2E5EA 4W70A 4QHUB 1NFIA 3UJIH 5LWYL 5J12B 3KS0J 4FQJH 3MPCA 3SDDB 3DMMB 3UBXA 5FA3A 3WFHA 5J1AB 3L5HA 4GRLA 1ZLVK 4P46B 1U3HD 4QEGA 5CD5C 2Z92A 1IL1B 1X3DA 5E2WL 3O8XA 4P5TB 5HYJE 3FQWA 4NQXB 1WF5A 5MI0C 5ID0A 1NGQH 5T5NF 3OKYA 4GG8A 3BPCB 3BP5B 3ARYA 4NC1E 4OM1L 4DTGH 5IF0A 4S2SB 2R2BB 3C5SB 4NCC1 1R5WB 4L4VD 5HGAB 1LEIB 3OXRB 1EK3A 4Y2DB 1T20B 2JELL 2R0LH 4F57L 4JEGB 1A3LH 5F89A 2KPNA 3GSNB 1B0RB 4P3CH 4APQC 3E3QA 4JDVB 2C3XA 4DGYH 4Z77B 3FO0L 4ISVA 2P49B 4JFQB 3SJVE 1RZJH 3OB0K 4C59B 1MCPL 3C09C 2AKRA 2VAJA 2P5WE 4D94A 1JZ8A 4R97C 5I76B 4NZUH 4MA7L 5TE7L 4HAGA 5I8CA 1P4LA 3BE1H 4XVJL 5L7XH 1FSKB 1LO5B 3MRIB 3QDAA 2EEBA 3O6MH 1N0XH 4O4YL 3PWLB 1YEHL 4N8CH 4JM4L 5BW7A 1KN2L 4KMTL 2IFFL 1GGUA 1YMMB 2FJFA 3WNLA 1FYTA 4F2MB 1MI5E 4K8RD 3VE0B 5I1EL 2EEDA 2R4SL 4ZMAT 3EO0A 4OCMC 1OOAA 3T4YB 1HE7A 3SOBL 5CKGA 2WLYA 3OKKA 3O45A 5ESQA 3VFMB 3GMRA 1XF5B 4QXUH 4P23A 4ZSOE 1UZ8A 3G9VA 5LBSH 1BVKA 5CCKL 4MVBC 2V5YA 4J3XA 1YNKL 2PXYC 1JWMA 4R96B 3WIIL 5EN2A 5D7KE 2VDOL 1F58L 4TUJA 3SGKA 1P2CB 4LSUH 4MSWB 3QUYA 4Z7WE 2YRZA 3O41B 1YYML 5GS0L 5KVGH 3HN3A 4UINH 2N7BA 4DQOH 3OJDA 1JK8A 1FVEA 1YNLH 2DB8A 1H0DA 2FYYA 2GIYA 3VWJA 1CVRA 2GQHA 3VWJD 4WCYH 1U58B 1CFVL 2YKLH 1A9BA 1FE8L 3BDXA 3PDOA 3QPQC 3WUWA 1ZT7A 1DUYA 1WT5C 3LEYH 4FOMA 4OFYA 3BKCH 4RMRA 5FOBB 2BFVH 5LQBH 5ENWA 3HE7D 3AU1A 4W81A 3P40A 5HHVL 2FR4B 5EN2B 1MCOH 1EGJL 2A6DA 2W0FA 1I7RB 5H37H 1BVKB 1I85A 4TVPD 3K80A 3IYLW 3PL6A 4WUUA 4W6XB 1KN2H 3PXJA 4HSQA 4NM4L 5KVGL 2CIKB 4O00A 4M7LT 1CE6B 1MCSA 2X41A 3RA7L 2EDWA 1G7PA 2NNAB 3OKEB 4MCYB 3VRLE 3EYUL 3P4MB 4Z78A 3BO8A 2CRMA 3KG5A 1OAQH 3PWVB 4YIQA 2Q8BL 4OLXH 4GAJH 5F7MC 5FYLD 3O3DA 4LHUB 4GO6B 4ZQKB 3DVFA 1V7MH 5I8CB 2KZWA 4L8BA 1KXVC 4XRCB 1C08B 2FL5B 1D7FA 3QPQD 2DWDA 4ZPTA 4IOIB 4ODHL 5E2UH 5IMKA 4OCSH 1FNSL 1ACYH 5DRWA 5TF0A 1J0KA 4H88H 1RUPL 4ISVB 2A9MH 4JDVA 1ORQB 4H26B 4DAGL 3S37X 3WL9A 4BZ1L 4GH7B 1A4JB 2LTQC 4QTIH 3IDGB 3SGJC 5M94B 3OXRA 3QEUB 4YBQC 2DQDL 1E28A 4JFEB 5DC0A 4M00A 2CUIA 2N4IA 4WWKD 2X9XA 4S2SA 3REWA 4ZUWB 3GBLA 4MNGA 4NHUB 4S1QL 3O2WL 4PJ5A 2CRZA 4APQD 4NQXA 3BDYL 1RJYB 4OCLC 1NCWL 2Z92B 4ODSH 3RY4A 1RHFA 1U3HA 1LWRA 2F58L 4FFVD 3BH8A 5HPOA 4PRPA 4XP9L 2APXA 4U3CA 2O61A 5E8PA 5BV7L 5D7JC 3SDDA 1QRNE 3GBNH 3ROOA 5DD5L 4KKLC 3V9FA 3W11C 1JZ7A 3VRIB 1NFIB 3RZCA 2HG5B 3G08B 5KANI 1DVFB 2FDBP 2NW2A 3C2AL 5CEYA 3B2UD 4DAGH 5A2JH 4P9MH 1WCBA 3M17A 5LAXA 4YHZH 4Y4KD 4Y5YA 4YNYB 1PW3A 4Y5VB 1R3LA 4QTIL