1LK2A

1.35a crystal structure of h-2kb complexed with the gnysfyal peptide
Total Genus 80
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
80
sequence length
274
structure length
274
Chain Sequence
GPHSLRYFVTAVSRPGLGEPRYMEVGYVDDTEFVRFDSDAENPRYEPRARWMEQEGPEYWERETQKAKGNEQSFRVDLRTLLGYYNQSKGGSHTIQVISGCEVGSDGRLLRGYQQYAYDGCDYIALNEDLKTWTAADMAALITKHKWEQAGEAERLRAYLEGTCVEWLRRYLKNGNATLLRTDSPKAHVTHHSRPEDKVTLRCWALGFYPADITLTWQLNGEELIQDMELVETRPAGDGTFQKWASVVVPLGKEQYYTCHVYHQGLPEPLTLRW
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system
molecule keywords H-2 CLASS I HISTOCOMPATIBILITY ANTIGEN, K-B ALPHA CHAIN
publication title A peptide that antagonizes TCR-mediated reactions with both syngeneic and allogeneic agonists: functional and structural aspects.
pubmed rcsb
source organism Mus musculus
total genus 80
structure length 274
sequence length 274
ec nomenclature
pdb deposition date 2002-04-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00129 MHC_I Class I Histocompatibility antigen, domains alpha 1 and 2
A PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1lk2A02
3.30.500.10 Alpha Beta 2-Layer Sandwich Murine Class I Major Histocompatibility Complex, H2-DB; Chain A, domain 1 MHC class I-like antigen recognition-like 1lk2A01
2HT4D 5CZXC 1LMKA 1C5CL 4QRRB 1K3IA 4TOYL 3ME0A 3CXHK 4LLUA 1KENL 2P1YA 1MNUL 3FCTA 1RUMH 1CZ8L 1ZHLB 2FGZA 3Q5YA 1CLYL 4N0UB 1KTDA 2ATKA 43CAA 3WDHA 5BOZG 5D9SA 4KTEH 4U7SA 3WIIL 5FFLA 3UTTD 3VXSD 1FVCB 2X44D 3GK8L 3VXPA 4D0DB 3I50H 1FGVL 5C0ND 4MCZA 4H8WL 3GIVA 2HLFC 4LEXH 1K8IB 1U8JB 1X9QA 5C0BB 2VABB 3FT3B 3QNXA 1UM5H 3LQAH 1FFQA 3CVHB 3KPRE 3VXNA 4OZHF 1S5HA 5DEGA 2AK4E 1JGLH 1CTNA 4YLQT 4JR9L 2ZSVA 2X09A 1TFHA 4PPTA 3QAZB 4F33A 3FMGH 4WUKH 5KW9H 4M8QB 3MJ6A 4UILH 5HHOB 5I6XC 4KUCF 1F4YL 4FABH 5DJZA 1UWEH 1P1ZB 2D4FA 5EPMA 1YEKH 3SJVD 3STLA 3VW3L 3CXHJ 2GCYB 4KDWA 2JK5B 1FVDB 3C08L 1HQRB 2JJWA 3UO1H 3IFOA 4PBXA 2AERT 4HC1A 2ZUQB 2N56A 2C3XA 5FCUH 1MFDH 2NY1B 2V17H 3CSBA 4JLRB 3BGFC 1X6NA 1GYAA 4R97C 1B4JL 1G1YA 2J4WH 5DJAB 3QIBC 3EFFB 4G7YH 3O81A 5D1ZD 1RJCA 1T89C 3LEXA 1YMHA 2QQKH 4TRPH 1G7PA 2HRPL 1IBGL 2EDKA 2YR3A 1K5NA 4P5TD 4NKMA 2X4QB 1RUAH 4IHOA 3OKMA 1RJYB 3F7RA 4X7DC 4Z7NE 2EC8A 4G8IA 2H9GB 1GOFA 4WI5A 4YPGB 3D39A 5J6GA 3QDMB 1RV6X 5IFAH 1O7VA 3CGTA 3QQ9D 5E24E 2G60H 2G5BB 1JF6A 3JUYA 3QHZL 3PGFH 4JFPB 4LU5L 4JFFE 4XP1L 3RDTA 3VFRA 4LDLB 4KRPD 1I85C 4Z9KB 1P69B 4ZQKB 4KKCD 5TE7H 4NSKB 4X7TB 3MXWL 2P4AB 4K23H 5TF1L 4CVXA 1U8KB 3EYOA 1HZHH 1YNTA 1GIGH 5FGCB 4BQCA 3SKOA 2EYTA 4JFYA 1FFRA 1RUQH 2BRQA 4ZNEE 4WIQA 4GKZB 1UCBL 1SJEB 5IF0B 1CD8A 1NAKH 1A6AB 1O0VA 1T04B 2FECL 2NY2D 2CKBL 5KZCB 3HUJE 5AUMA 1JWSA 1NCWH 4XXCC 1HI6B 3ERYA 3MYJA 1DQLL 3JXAA 1JNNH 4JO3H 3TJEH 4OFVA 3UX9B 3BAEH 1S78D 3GEWB 1BAFH 1EBPA 1XR8B 1YA5A 3SGEI 3EOTL 2X42A 1JHTB 2AJUL 5FDYA 5J12B 3GI8H 4PGEA 4YIQB 4MX7A 5CINH 4UTBL 1MCIA 3AS2A 1RJZB 2IFGA 4GW4B 4TSCH 2FYYB 3FQWB 3WL9B 3QWQB 3QWOB 1QO3B 3QUYA 2YSSB 3OZ9H 3VWKC 1Z9OA 1A7QH 1FORL 3C09C 3DECA 1TTUA 4GLRI 2PXYC 4LVOB 4O5LL 1UACH 2CJUH 4BSVA 5C0BE 5FGSA 4RCAA 3MLXL 1NC4A 1DBKL 4AM0A 2Y4SA 3BYTA 5E70A 5IK3A 1XGYL 3BPOC 1VGEL 5HI3D 4E41B 4U05A 4HF5H 1OWRM 5JMRA 1NSNL 1NFIB 2F53D 2GSIB 3GSRB 2DLTA 5IMOA 3PWPB 4PV8B 4GKSA 5BW7C 4TPRH 3VG9B 1JRHI 1I3RB 1DQDL 1XF5A 1QFOA 4KJYA 4UDUB 3O4LD 1AGBB 5D1QD 5AG8A 3LKNB 3BOVA 5E2WL 3QPQC 2HFGH 4N0YL 4DKDC 4APQA 4Y5VC 1FNAA 4HG4K 3JV6A 5HGBA 5D6CB 2FX7L 3FQRB 4KJPD 3MBEA 1XGPB 5C0GA 3PP4H 1T7VA 2OR8A 1KPVA 2LTQC 4W4OC 5B3JF 4QHLB 2C3VB 4PGDA 3TZVB 2WQ8A 5D71L 4U1KA 3ARDD 2PF6A 3FQUB 3AS1A 5FO9A 3TA3D 1KCRH 5ALBL 5L9DH 2CGRL 3ARGA 3KVQA 4MNGB 5H94A 5F1NA 4QHUA 1HK6A 4CNIA 1TTFA 2C1OB 4R0LC 2R0WL 2DAVA 4NO2B 5GS2D 2Y07H 4W81A 4ZUTA 1I9IL 4KTYA 2HG5B 2BFVH 4XTRD 1CLZH 5LXGH 4XBPB 3U9UA 5F9WC 1C5BH 4DOHE 4AK1A 1E6JH 5CILH 2B8OT 4R4NC 1I7UB 4FXGA 2VXSL 2Z31A 5B39G 1PY4A 4MDJA 5ITBH 4P49A 5KAQF 2B1HL 2CH8A 3QIWA 5EN2B 5BZDA 5CEZH 1ONQA 4ZUSA 1F6LL 3C8KB 5DWUL 1RI8A 4PJFA 5C0AA 1YQVH 2BDNH 3BEWB 1MFAL 4BZYA 4WFED 2E8YA 4H25A 3IU3B 3L3OB 4S10A 3FONA 1Q8MA 3GM8A 2RQ8A 3PWVB 4PB0L 5E2VH 4GFTB 5DMGD 5E03A 3S4SA 5F7HA 4PJBF 3NFPB 3WS6C 1CXEA 4L8SC 5H37H 4BQ9A 4PJEE 4UU9A 1QR1A 1VGKA 2JJSA 5IW6B 1SJHA 1U95B 1JN6A 4UQ3B 4N0CA 3SKMA 2ZUTA 3H0TA 4KVCL 1T66D 4O4YH 2YD8A 4LFHG 4UAOB 2F5BL 3F7QA 3RU8H 2OTWA 4JHAH 2DWDA 1JTTA 4KROD 1UJ3B 1NFDB 4WU7A 4YDJB 1TQBC 3PE9A 5HHPA 1BBJA 4HIXH 2VSCA 6CGTA 2ZKHH 4XH2B 1H0DA 4E5XB 3AY4C 5I16A 1BJMA 2YEZA 4YFDB 2HKFH 5GRJH 4PJ9A 1UM6H 5DD3L 3FOLA 4PJIF 1XCQB 1BBDH 1QSFB 2DQCL 1G9NH 2B20A 3P77B 3SQOH 4BFIA 3O41A 4R7DA 3TO4C 1S7TB 1T22A 4KHTL 2VERN 5D2NE 2CIKA 3W0WB 3RVWC 4JO1H 4EI6B 3S37L 1RIUH 1U8MB 2NXYC 3UC0L 4YHZL 1A1OB 2G75A 2YRLA 5EOCL 3JSSA 4XNUH 1YUHB 3IDMB 4XBGA 5GRZA 4E41E 2HAZA 5MHSD 2VDLH 5E6IA 1F02I 5HHVH 2D31A 4CL7A 5HYJD 5EBWA 2NW2B 5ELIA 5C0RH 2HP4A 1LEKB 1FVEB 2VZUA 1BEYH 4HHAA 5K9JL 3VRJB 3B9KD 1E6OH 2FGWH 1J05B 35C8H 4RFNC 1IQDA 2DLFL 4RBPH 3RUGB 3NABH 4GXUN 3MOAH 1MI5D 1G7MB 3JWDC 4G43B 4QRRA 5T3XH 3QCTL 2Y7QB 1X5YA 4YXHL 5KVEL 4NUJB 3V95A 3VA6A 5E4EB 4QRPE 2F8OA 3LPFA 1ZHLA 1REIA 4M7LL 3BKMH 3X11B 5D7IB 3K8LA 3HC0B 5H2BB 5HY9B 4N0UA 1YMMD 5IHBA 2YPKB 1PGRB 1FYTE 1JHKL 4HJJL 5CSGA 2H3NB 1EFQA 3F7PC 4JM2A 3LV3B 1FVCA 4D0DA 4NBXB 5GS0D 4FQPA 1U8JA 3I9GL 5AWNH 5C0BA 4CVZB 5BVPL 2VABA 3FT3A 3VXMB 2V9TA 1KJMB 4TQEH 4Y16B 1CDIA 2XA8H 4MNGE 5HDBF 3CVHA 2R2BB 5FUCE 3VGDA 4LCCB 4RGNE 1N0XL 1RUKH 5GZNC 3AMKA 4PJ5E 4EBQL 4Z7WE 3EO0B 5HHOA 5C6WH 1VCAA 2NY5C 5ESAB 4UBDC 3WFBH 1QRNE 3NZHH 1P1ZA 4O58H 2VTFA 4N90D 3O6FC 5IGXL 3VFMB 2GCYA 2A83B 4HCRA 2JK5A 2QSVA 4O02H 2E7LE 3FB6B 1HQRA 3NCEB 4LVEA 5ETUB 2Q1EA 1QFPA 3MCKB 5DJDB 1JPSH 4GSDL 3MROB 4JLRA 1ZWIB 4ODHL 3BKYH 1JZ6A 1LEGB 3L3GB 5DJAA 2NY4D 3EFFA 3VGEA 3U1SL 1FYHB 4KJQC 3HR5B 4OZFB 4YHMH 2H26B 1SEQH 4RFEB 2X4QA 4JCLA 3PGDB 2PO6B 3H42L 3U7AA 1RJYA 3NPSB 1U41A 2H9GA 4U6XB 1WBXB 4YPGA 3FO9B 4FFVD 4PY8J 3UTTE 3QDMA 4FA8A 1F13A 1KIQB 1EXUA 4L4TB 5FOBB 3GHBL 2G5BA 5E7FA 3KWWB 4M00A 3FFCE 1J1OL 4PJDB 4PTUA 4NNPL 4JFPA 4OQTH 2GSGB 3B9EA 1IC7H 4ZQKA 2MKLC 4NSKA 4X7TA 3ZHLA 5L2KE 4LASL 3RIAF 1U8KA 3INUL 5J1SC 1FIEA 5I1LB 2I5YH 3BMVA 3W0WE 5JPNB 2CRZA 1SJEA 2QJDA 5IF0A 3W81A 1A6AA 4G7VL 1T04A 3BN3B 2K7PA 1MHPH 1RFDH 1HI6A 4ZO6A 3DI3B 1ACZA 1AXTH 2FB4H 4PY7B 4K2UH 1IEBB 3IJHB 4BQ8A 2YKLH 1XR8A 3KYAA 5CIPH 1JHTA 2AJSL 1RZFL 4G8EB 4YIQA 4FFYH 5FYKL 4MAYD 4W6XB 1G7JA 2APWA 2WZPD 1RJZA 4IIQC 3CFKB 4GW4A 4JN1L 5HHQB 4R4BB 2FYYA 3EJZD 4PJXE 5D4QA 5HGGS 3FQWA 1AH1A 2H8PB 4IRZL 5F70A 3B5TA 3WL9A 5TGBB 3QWOA 5JHLL 1QO3A 2N4IA 4OFPA 3RGHA 2YSSA 4IOFD 2KQNA 3O0RL 1P4IH 3K46A 2QHLA 1OGAD 2X7LB 4XBEH 4ODVH 4R2GB 5GGSY 5DT1H 3FQXB 1OOAA 1KTLB 4E41A 5LVEA 4BSWA 4ONOA 4YE4H 3ALWA 1LP9B 1ND0B 1NFIA 2GSIA 2W0KA 3GSRA 4MB3A 1OAUL 3FN0L 4K3DH 2P5ED 3PWPA 3TH2T 3G5XB 5FIEA 4PV8A 4APQD 2HT4C 2R4SL 3TT3L 1UC6A 3GSNH 1I3RA 5CS7A 5ALCL 1BD2E 1RZKL 4UDUA 2NX5D 1AGBA 4LSQL 4QCIB 3LKNA 3SDYL 3V0WL 3D6GA 4HPYH 4WFFD 5EORH 4NKIL 4YEEA 4Z7VF 2J3SA 5D6CA 4PJ8A 3FQRA 1MSPA 1XGPA 5MEPB 4YBQD 1BQLH 3PXJA 4JQXA 4MMZC 2R0LH 1A0QL 5J1AB 3HZYB 1QRKA 3M07A 3UTZB 1KTKE 5C0NC 3IDNB 3ILPB 3B3IB 4QHLA 5T1DL 2H41A 4JQVA 4X99B 2C3GA 3TZVA 4M3KB 5D7SL 5DD1L 2DKMA 1EEYB 3FQUA 3VDCA 4MNGA 5IJVB 5JQ6H 4CU7A 1AC0A 3BUTA 4XI5D 1W72L 4MXWH 4U2YA 2PKDA 3U48A 4FTVD 2C1OA 1S7SB 5K59E 4NO2A 4XCEB 2X1XR 4PJ5A 1CFNB 1EGJL 5HDOA 3T77B 1KB5B 2HG5A 3VH8G 3P2TA 1DQML 4XBPA 2I24N 5CJOL 2ESVB 2KL6A 5KVDH 2F54B 4X4YB 1I7UA 4DCQB 3U6RB 4M6OH 2HT2D 2E7LA 3FJTA 5GJSL 1JGUH 4CU8A 5C0FB 2WWMC 1CS6A 5C0AD 2UVEA 1JFQH 2LE9A 3D2UB 2B2XH 2F53E 5F44A 5EN2A 4NRYB 4ODTL 3OX8B 3MJGX 3O3BB 3HI5L 1UFUA 5D1ZC 1XGUB 3C8KA 3I3EA 4OM0L 1AD0B 2NY7L 4WI7A 4PP2B 4YHLH 2BERA 3BEWA 4RDQG 3IU3A 2ADJB 1CLOL 3PQYE 3L3OA 1ZANL 4TVPH 2WINB 3UROR 3PWVA 5FF6A 4JO2L 2LQRA 3NFPA 1N7MH 2VSDA 4S0SD 4D0CB 3FZUD 3EDDA 4UV7L 5IW6A 5DEFB 4OAWB 1U95A 4YDIL 4UQ3A 3QQ9C 3MLTB 4L1HA 1I9RH 5EZOH 3S5LG 1OLLA 1UM4H 5SWZE 2P7TB 4BA8A 5HXMA 4KRPC 1CVRA 3GMLB 4K71B 1UJ3A 2DQUL 1NFDA 32C2B 3HPLB 4YDJA 5FV2A 5KTEH 1S8DA 3NCJL 1FN4A 1F4AA 1TITA 4XH2A 4E5XA 3MV9B 2AQ3A 3RX8A 5C9KA 1EUTA 2NYYC 4P57B 5KOVC 5L2KA 1XCQA 1YEJH 1NPUA 3P77A 3WIHL 1DR9A 4KUZL 1S7TA 1OPGH 1WWCA 1G9MH 1KEML 2NY2C 1JNLL 3W0WA 2DBLL 3QDGD 4EI6A 2DOCA 4KMLB 3X3GH 4G6FB 5EU4B 2YXMA 4YXLH 3MLWH 2XV6B 1A1OA 2ICEA 1S78C 3SO5A 3O4OC 4LPVA 1YUHA 3IDMA 1DL7L 3CSYB 4Y4KC 3T2NH 4JREB 1KC5L 2NW2A 4Z7QF 4OCRH 5T1LB 2YMXL 4NN5C 5ISZD 5A2IH 1LEKA 1FVEA 1FZKB 1M7IB 3WHE0 3VRJA 1J05A 2XACC 1YNKH 3TBSA 3RUGA 2VDOH 1G7MA 4G43A 2DICA 2Y7QA 1R6VA 4U31A 5BJTB 2QBWA 5KSVA 1RZ8B 3V0VB 3VDAA 1INEL 3X11A 5I18L 5D7IA 3HC0A 5H2BA 5HY9A 2YPKA 1ZLSL 5AD0B 4N68A 5CD5C 4WW2F 2H3NA 3LV3A 3QUMB 4HK3N 1JZ7A 2B0SL 1VPOH 1WBZA 2VZSA 3C5ZD 3QUZD 1S7VB 4EI5B 4EN3B 1WAAA 1TETH 3VXMA 1KJMA 2YD9A 4Y16A 12E8L 5HHOD 2DMKA 2R2BA 1J8HB 1UWXH 5FUOH 3WFCL 2A77H 1N59B 4R8WL 3A6CL 4LCCA 1CE1H 4CVUA 1N2RB 3EO0A 3MCG1 5HHMB 5ESAA 5D1QC 3O2VH 4RGOL 1MLCA 1BD2A 5GS3A 3VFMA 1MUJA 2A83A 5JOPD 4KJPC 1FNGB 3FB6A 4LNRB 5E8NB 5IT2H 2AEPL 4OCWH 5ETUA 5MHSE 3MCKA 4MXVE 4NZDA 1WCBA 5D2LF 4UZGA 5DJDA 2UZIH 3QRFM 1FO0B 3IJYB 3U4BH 3MROA 2UZYB 1ZWIA 1T0NB 5E99H 1LEGA 2OJZH 1BM3L 3HHRB 3OR6A 5E7BA 3GI9H 4LSRL 1MI5E 2AEQL 5HTSA 1JPST 3STBA 3D85A 1VFBB 5HVFB 3HR5A 4OZFA 4N0RA 2H26A 1ADQL 1V3MA 4RFEA 4ZPVB 4DGYL 2D0HA 3PGDA 2PO6A 4RAHA 1AR1C 5F3HB 4Q58C 4XTRC 3LN9A 3O8XB 4U6HB 4U6XA 1WBXA 1ZLVH 5CUSH 1KIQA 5T33H 3A67H 5FOBA 4L4TA 4KQ3L 2E8ZA 1BOYA 4AMKH 3LVEA 4O51A 2VLLB 3QP3A 4FN0A 4JGJA 3KWWA 1DZBA 4PJDA 1NCCL 1PSKL 3DO3A 2XQBL 2GSGA 2D7OA 4HULB 1H3VA 1U93B 3OJ2C 1KBGL 3EDKA 4UIKH 2VB5A 3O2WL 2OZ4L 1T5WB 1Q0YH 1VSCA 1F90L 4RBPK 4YX2H 4HX1A 5I1LA 4GXUM 4DQOH 4L3ED 3Q5OA 4N90E 1MF2L 3QO0B 5JPNA 5BO1L 3HE6B 2CO6B 3PQYA 1YEIH 5DMGC 1OSZB 5IVXE 1RZJC 3MPCA 1DBML 1CG9B 4MA8L 4XPGL 3SGJC 4NPYB 2CUMA 1EHLH 3C6LB 3MCLL 4YFLI 1IEBA 3IJHA 4GXVH 1P7HL 3EUUA 1CWVA 1T66C 2D0GA 1MRFL 2IEPA 3REWB 3DRQB 1OGTB 3WKML 1S5IH 2VDRH 4KROC 4G8EA 1BREA 1P84K 5LGJB 1IM9B 1DSFH 1IGMH 1JHLH 1QFWL 2W38A 1MWAH 3RL2B 4NZUL 3NFNB 1DN0B 1RVFH 2VR4A 3KYKH 1SYSB 2B5IC 3CFKA 4JO4H 3ECBB 5HHQA 4R4BA 4AQ1B 1MVFA 3NIGF 3LMJH 3DURB 4NGHL 4ONFL 5TGBA 1WFTA 3TN0B 1L7TL 3MJ9A 1LE9B 5ICZB 5D72L 4YBLB 4AY0A 4CAGA 3K3QA 2X7LA 4CMHC 4HT1L 4LPUA 2O93L 3VI3F 5LGHH 5I30H 4LNVA 1YEEH 4XVUD 1ZHBB 3FQXA 1KTLA 1BMGA 3H2WA 5BV7C 4U1NB 1LP9A 3H3PL 3ZKXC 2CRYA 1FFNB 1OL0A 5F1OB 3V0AC 3G5XA 3RX7A 2NY3B 4HIIB 3UZEA 1BVZA 3MA9H 1I7TB 2IJ0C 2EDOA 1ZT4B 2EKJA 4QCIA 1R5IB 4ZFFB 4U1GB 5K9QI 1FCGA 3BPNC 1C5CH 3GSOB 2APVA 5MEPA 4TOYH 1KENH 1MNUH 4PLNC 3O11B 3KPPA 1EO5A 2QSTA 3HZYA 5J1AA 5GS0C 3UTZA 1CZ8H 4B5EA 3IDNA 3ILPA 4J6RL 5I8OH 3B3IA 5HPMB 5CEYB 1K4CB 4X99A 3I75B 4LLVB 3NIFF 4X6EB 3WIIH 1WSST 1EEYA 3GIZL 3GK8H 3MRHB 2XYCA 1FGVH 3QZWG 4NFDA 4H8WH 5A1AA 2F5AL 2Q87A 5IJVA 4X83A 3EZJB 3SKJL 1Q9LB 3RKDD 5ADPL 1S7SA 4V2CB 2UYLB 2BX5A 1LK2B 4XCEA 1J5OL 2QHRL 1HE7A 3MRRB 1JF5A 1CFNA 3T77A 4PJHE 1KB5A 2DQJL 1Z3GH 5C08B 5A16B 2ESVA 5CP3A 3CU1A 4LOUD 4X4YA 4GJTB 4Z0XB 4DCQA 3U6RA 3M17B 4KI5D 3RWCB 5IB3B 4G6KH 5C0FA 3K4ZA 4LARL 4DZBB 4YDLB 3D2UA 2V5MA 3WO3B 1EZVX 1CBVL 4HWBA 5HBBA 4NRYA 3OX8A 2GJZB 2P5EE 5ILTH 3O3BA 1XGUA 4GRWF 1AD0A 4F57L 4PP2A 2NY0B 5KSAD 5L8LB 2NX5E 5INCB 2ADJA 2O5YL 1MAJA 5E00B 4WFFE 3G5YB 2WINA 4GW5B 1TQCB 3BKJH 1RZIB 1OWWA 4Q9BA 2JLLA 3BGMB 4BELD 3RDTC 3NIDF 2R56H 4FFVC 3T65B 4D0CA 3I3DA 4M03A 5DEFA 4OAWA 2VDQL 3MLTA 1X4YA 3KYOB 2P7TA 5INDB 3GMLA 1IC5L 3UTPD 3HPLA 32C2A 1QSFD 3TNNB 1B6DA 5DK3A 4N8VG 4OM1L 4HDIB 5FEBA 3MV9A 1O5DT 3IXTB 4CADB 3QHZH 4FTVE 4U0RC 4LU5H 2WP3O 3BD5A 4P57A 1T4KB 1JYXA 5BXFB 4N1CA 1A9BB 1NL0L 1X5LA 2FECI 2IAMA 3UAJD 3CFCL 2ADIB 2COQA 5FUZH 1U2CA 5TF1H 2QTEA 1K4DB 1MREL 1A14L 3ULUD 1CTOA 1ZT7B 2A6KB 5EU4A 4F2MA 1IT9L 4EOWL 5TDOB 5BRZE 2BXZA 1UCBH 4OGXL 5ECJE 2CKBH 4LLWB 1EO8L 3DV6B 3CSYA 1BVLA 3VGAB 3G5VB 3SE4A 4GMSL 2E9BA 1HNGA 4MAYC 4Y2DB 1FZKA 1M7IA 3DMMD 1NAML 3QUYC 3EOTH 1JYNA 4M5YL 4D3CH 2IANB 4MHHI 2RR3A 1IGJB 2HH0H 4LSSL 1H5BB 4UTBH 3QA3B 5BJTA 5C0CB 3GO1L 1RZ8A 3V0VA 4HH8A 1H3WM 1L4IA 4YGAB 3VXMD 4OV6F 4OLWL 4HK0B 4GO6B 4N8CH 4FQCL 3EBAA 2CUHA 2ZCLH 3QUMA 4JFEE 3ZE1F 2O5XH 1TZHB 5I1JL 1S7VA 4EI5A 4EN3A 2RJMA 1T1WA 1BFVL 4NYLB 1KIPB 4I18B 3R8BB 3RWHB 3BP4B 2R4RH 3CXDL 1N59A 4R4FL 4PD4K 2XQYK 3DARA 4APQC 1XGYH 1N0LA 3MBEC 1N2RA 5HHMA 1NSNH 3DETC 2VUYA 4HJGB 4LLMB 4HV8B 3QDGE 3RIFF 2JCCF 4Q9RL 4LQFL 3BX7C 1DQDH 1FNGA 4YBQC 4LNRA 3MLUL 5E8NA 4XCFH 3GSQB 4RA3A 3NZ8B 1VESA 4X9BA 3MRBB 4NHUE 3BPLC 4R7NB 1HSAB 4PRHB 5ANMB 1FO0A 5ISZE 4G3YH 2FX7H 3AREB 1B0RB 1T0NA 2LU7A 2W07A 1ZVSB 1Q38A 4WFHD 1QHOA 4OCSL 1MFBH 1M1SA 2WIIB 1B0GB 1VFBA 3KYNB 5D71H 3KPQA 4RA0C 4PD4J 1S7QB 4ZPVA 2ZG3A 4L4TD 5ALBH 1CD1B 2CGRH 4I5BB 4MJIE 1HIML 1LQVA 5F3HA 5SWSB 1JI1A 2FO1A 3RIFK 4U6HA 3SOBL 3H7LA 1RULL 3QIWC 1A3RL 1CFVH 2VNCA 2QL1A 1I9IH 2VLLA 5KS9B 3GUTB 3E3QA 4DTGL 5DK2B 3KGRA 5DC9B 1PZ5B 2DI8A 2EDLA 2R0KL 1CR9L 1UEMA 2D4DA 4X7SL 4JRWA 5HD8D 3WDIA 1U93A 3KPOB 1JPFB 1IAIM 1CICB 3QXAB 1MAML 1HYSD 3MLSL 4LHUG 2VLJE 3UTSD 3TIEB 1T5WA 5K9QG 2B1HH 2DYPB 4NZRL 4GW1B 3WIHA 3VFTB 4JDZB 5I66B 2JJSC 5SX4I 4TUKL 1KCUH 3QO0A 4N0CC 3HE6A 5DWUH 4P9HL 5IESH 4X9FA 5I0ZA 1OSZA 5DVOA 1MFAH 1CG9A 3LH2L 2VLRE 5DJYB 3RZCB 4NPYA 4ZFOL 2VH5L 3L5IA 4ZO9A 2OK0H 4DZ8B 3C6LA 2AAVA 4M5ZH 4PRPB 1QA9B 2YA0A 1DP0A 4PB0H 3BH8B 5SX4H 1EA9C 4OFDA 5B22A 3DRQA 4PJ9C 3REWA 3WFDL 4NHCH 2H32B 5LGJA 1IM9A 5IVNA 1L8JA 5I1GL 1KYOK 1V7ML 2WK2A 2IANE 3RL2A 3BRFA 4KVCH 2RIKA 1DN0A 3NFNA 5BOPA 3G6JE 4FQHB 2F5BH 1SYSA 3ECBA 1CDJA 5TJWK 4NKDB 3BDYL 3L3HB 2ED8A 1NMCB 4XMKL 5C0CE 3SDDA 4DN3H 3DURA 2ZJSL 5DQ9B 1SJVA 4I2XB 1LE9A 1FPTH 4XPAH 4NBYB 3IS1X 5I1HL 4R2GD 4JPIB 5DD3H 4HSQA 2BY1A 5E8OB 2YUZA 3LAFA 4U6YB 1KN4L 4WFGD 1MCWW 5SX5H 4OTXL 3W2DL 1DEDA 4KHTH 4P4KD 4OCNC 4FZEL 2XPGB 5BRZA 2OXGA 3BZ4B 1ZHBA 3S37H 4WW1B 3UC0H 4YHZH 3H9SB 5IQ9B 1IAOB 4TULL 3B8YA 2YN5A 3OF6D 3C5JB 2XY1A 4GAJL 4UIMB 4HIIA 1Q0XH 4L3EE 1I7TA 3D48R 1ZT4A 3ELAT 5C0IA 1R5IA 4Y5XB 4ZFFA 4HS6A 4YQXL 3W9EA 3GSOA 1T0PB 4FQXD 5F9OL 3QCTH 3N85L 4HS8H 4YXHH 5BQ7B 3D9AH 2PR4H 4M7LH 4LLQB 2A0LD 3C5ZC 5CEYA 4LVNC 3E8UL 3QAZC 5GS2H 3I75A 1KJ2L 4S1SL 4X6EA 2YPLD 1JHKH 4EVNB 4GOSA 3VG0H 3QXDB 2C4XA 3F65A 3MRHA 4X6CE 3S88L 2PN5A 4OZIB 4DGVL 4GAGH 5DHVH 4OFYA 4JFQB 5LWYH 1NBYB 1Q9LA 2ESVD 1U8OB 2UYLA 4YWGL 2F54D 2DD8L 1LK2A 1GHFH 3O45A 1T6VN 3G5ZA 3MRRA 2ZUQC 1FDLL 1VEMA 3T0BA 1N0XH 2NY1C 4DKFH 4I0CC 5JNYB 4EBQH 5C08A 5A16A 2NZ9D 2X4TB 3D2UD 4ELMF 3BISA 2R69L 5KS9E 4YDKL 4Z0XA 2WBKA 3M17A 1E4JA 2X10A 4OD1L 4ZTOL 3RWCA 5A2FA 5IB3A 5AYUL 1G1CA 2CDFB 4MHHG 4DZBA 5C7XH 1R0AL 3QEQD 1RZJH 2GJZA 1JWUB 2OZ4A 3A0OA 3IF1B 3CH1B 5GJTL 1N64L 3VWJB 4TUJB 1MELA 1P53A 4PJEF 2WNGA 5HDQH 1AKJB 4ODHH 5INCA 4RMTA 3IS0X 5EIIB 3VXRB 4Z78A 5E00A 3G5YA 4GW5A 4BH8B 1RZIA 5EH1A 1FV1B 2ZG1A 3BGMA 4PJ7E 5KSUA 4PRPE 3U1SH 3BSZL 3RPIB 2ED9A 3T65A 2WY3A 3SCMB 4GG6E 5GGQL 1QBMH 4AEIL 4MB5A 3KYOA 1ED3B 4KK9D 1KLFA 5INDA 3TNNA 1U8IB 1LO0L 4HDIA 4P2OB 3IXTA 1J1OH 2QQNL 4I2XE 5BXFA 3TNMB 1A9BA 4HXAL 5EUOE 3DGGB 4JHWL 2ADIA 3PNWB 4ZFZB 2WWKO 4LASH 1K4DA 4HGKC 3INUH 2J5LB 2N1KA 1ZT7A 2A6KA 4L8BB 5J12C 4HUUB 2ENSA 5T1LD 1YY9D 5TDOA 1IL1B 5DUML 2XKNB 5GRYA 3MRMB 1UEYA 4MNQB 4LLWA 2VYRE 3DV6A 4NOFA 3KLHD 2C9AA 4OD3L 4LSDA 4M6NH 4NNXB 4WHTB 4YHIB 4Y2DA 1U42A 2HLAB 3SN6N 2XN9B 4UT7H 3P9MB 3V2AR 1PAMA 2IANA 3BESR 2AJSH 1RZFH 3GBMH 4LVOC 4K9EC 5J3HD 1IGJA 1Q9KB 4X8XA 1H5BA 1OARH 4OIBA 3QA3A 4MMXC 3K2UL 5C0CA 1MJ8L 3ORJA 3LKQB 2CMRL 2LVCA 2MJWA 4JN1H 4WWKD 1MIMH 5J4MA 2E7MA 4HK0A 2IGFH 2EEBA 4P9ML 4NOBA 4OB5H 3C5SB 1J8HD 5JHLH 2HMID 4RMQA 1TZHA 1G6RB 2FX8H 1A6ZB 4XVUC 3WFEL 5DUBA 3VG9C 1FZJB 1QLEL 4NYLA 4ZXBB 1KIPA 4I18A 3O3AB 4MS8A 3RWHA 4Y88A 1MHCB 3BP4A 4L5FH 3RTQD 4M6AA 4Y4HD 2FLBT 2J6EA 3V5KB 5GGRB 2X1PA 1JL8A 3AXLB 3HG1D 4OZHE 2DIJA 4HWZB 4JQXC 3RNKB 4QTHA 4HJGA 1NC2B 4LLMA 1KULA 4HV8A 2W0PA 2FDBP 5EIVA 1JZ3A 4PRID 4JQVC 3TT3H 4Y4FD 3TZVC 1Y6NR 5ALCH 1N3NA 2BCKB 1RZKH 2YUVA 3GSQA 5MEOB 3SDYH 3QWRA 1T2JA 4OLYL 1S7UB 1W0VB 5EUKA 1K85A 3MRBA 3KXFB 4R7NA 1SVCP 3P11L 1HSAA 5ANMA 3IGAB 4HQQL 3AREA 4GMTH 3VD3A 1B0RA 2GJ6B 3QB7C 4WNQB 2GK0B 4X80L 2EYRB 1ZVSA 3UXFA 3FAXA 3M8OL 1OP5K 2JB6B 5JDJA 3N9GL 3S34L 2E3VA 2B4CL 4PLJC 5T1DH 3Q6FB 2WIIA 4G6MH 3O8XD 5JXED 3RHWF 1B0GA 4K94H 3HMXL 3KYNA 3OXRB 5D7SH 4LCUB 1MFEL 4ODBD 5F1KC 3ZKND 3NCMA 1CD1A 4I5BA 3ZYIA 5DR5L 2E7LC 1R3IH 3VMNA 1CGWA 1W72H 5SWSA 4PUBH 2NTFB 3ZSTA 4PTTB 1ITCA 5EWIL 3MXVL 5IHUL 2GAZB 2X9WA 3VRLF 5C3TA 2BVEA 1EGJH 5KS9A 3GUTA 1DQMH 1MCPL 1YEDB 4GRLB 4KPHH 5DK2A 1TENA 2ATPB 1PZ5A 2AQ1A 3N1FC 4NBZB 1T03H 3LQMA 5CLWA 4RWHA 3KPOA 4U0QB 1CICA 3QXAA 3HE6D 5KG9B 5GJSH 3TIEA 3GJFH 4YH6A 2K1MA 2DYPA 4Y1AB 3RHWK 3VFTA 4JDZA 5I66A 3Q3GB 5DEZA 1IGIL 2EZ0C 3C6LD 1BZQK 1B9ZA 4OM0H 2NY7H 4NZTH 4UAOC 3SKNA 1MHEB 3LKPB 5DJYA 2JTDA 4FFZH 1JWMB 1UJ3C 1CLOH 3UTOA 3EFDH 1ZANH 4DZ8A 4PRPA 3KS0H 1QA9A 4PREB 5D7LB 3T04D 1HNFA 4JO2H 3BH8A 1AR2A 3I6KB 1U8QB 1WEJL 2XN9E 2VLKB 4U1IA 2H32A 4ERSL 4L1DA 1R3JB 3TN0D 5F6IB 4KTEL 4KMTL 3H6JA 4FQHA 5C6TL 4NP4H 5TQ2L 2D9QB 4PJGF 4NKDA 3L3HA 2DQUH 2KH2B 4LEXL 5F8RC 3NCJH 3UAJC 1BJ8A 5DQ9A 3NACH 3ROOB 4M61B 4I2XA 2Z91B 3ULUC 2QQQA 1VERA 1Q94B 3PXHA 3EHBD 2XZCL 3WSQL 5E8OA 4U6YA 1UJTA 3GSWB 1UXSB 4KV5F 3QXTA 3FMGL 4KUZH 1YEFL 2XXCB 3BZ4A 2DBLH 4FABL 2V2TB 4F7TB 4M1GL 4WW1A 1V05A 1NGQH 3H9SA 5IQ9A 1IAOA 1RD6A 3HN3A 3MYZA 3W82A 5E4EC 5F7EL 3C5JA 5D5ME 3KPTA 3X14B 4UIMA 1BX2B 1KC5H 3DWTA 2YMXH 3RRQA 2OP4H 5FCUL 3M1BB 3VGBA 3U4EB 4GRMB 2GY5A 4X5WB 4LPYA 4K3GA 3B5HA 4Y5XA 4AJ0A 3N1PC 5A3ID 1YJDL 2J4WL 4G7YL 2NR6D 3HS0B 4Y16C 4HUMB 3MODH 2R0ZL 1JP5A 2QQKL 3HFMH 3TFKA 4TRPL 1AGDB 5JW4R 5JHDB 2HTLD 3TEUA 3WHE1 4LLQA 4LL9A 1RUAL 4LCCC 2PYED 4DN4H 5I73B 1RY7B 4OFYD 4EVNA 2ICWB 4F7EB 5B3JE 3QXDA 3OPZL 4HW6A 1N4XL 4OZIA 1JCKA 4M7LT 4OJFL 2IALB 1JVKA 2DLIA 12E8H 4JFQA 1NBYA 3W9DB 2G60L 1TNNA 1U8OA 4C56B 1GGBL 4MZ3A 3N1GC 2YD4A 2AW2A 4NC2B 4R8WH 2JJTA 5C2BH 5JNYA 2BP3A 4Z7UF 4J23A 2X4TA 1BQHG 1GZQA 2LABA 4NQSB 1BF8A 4RGOH 2PW1B 3T0EB 5HHXL 2CDFA 5L6YL 3IVKB 1E4XL 3L3IB 1TLKA 2GI7A 2AEPH 3O3DB 5FYKU 5KVFL 5ICXB 1JWUA 4V1DB 2PO6C 3KR3L 1NCWL 4G6JL 3IF1A 1PFCA 4Y1AE 3CH1A 1CVSC 3NPSC 3BO8A 1A02N 4JO3L 4IBLT 3TJEL 5IVZB 1AKJA 4OF5A 1BAFL 2Y06L 4UDTB 3VXRA 5EIIA 2FIRT 3LCYA 4P2CG 1J0HA 3GI8L 2I25N 4BH8A 4LSRH 4I3RL 2AEQH 1FV1A 2APFA 3RPIA 3FHQA 1ADQH 3GMRA 4DGYH 2GK2A 2AJYH 3UYRH 1OTTC 2GUOB 4TSCL 4WO4B 3BJ91 2BXYA 4PJBE 1GGIL 5SX5K 5M94B 2BVPB 2YPLE 5CSZB 2D7QA 2BOBB 1JPTL 1E28B 3MA7B 5T5NF 5HD8C 4JKWA 1KOAA 4OZ4B 1A7QL 1PQZB 4KQ3H 1DANU 1U8IA 2VDNL 5B39B 2KUTA 3UTQB 1I8LA 5K93A 4P2OA 5HGHB 1OCWL 1CU4H 1PSKH 2E9IA 4FFWC 1JZ8A 4HIJB 4KJWD 3TNMA 3PHSA 2J8HA 3DGGA 2FWOB 4K3EL 3PNWA 1KBGH 2YD3A 2WLZA 1MEXL 2Z8VC 4QEGA 3TWCL 4PJIE 2FO4B 2HVKB 4HF5L 1DQQB 1C5DB 1F90H 4L8BA 4HUUA 1DVFD 2JKXA 1FBIL 3CMOL 1MF2H 3FTGB 1G9EA 3ZZ1A 4Y2DD 4TPRL 4M7ZB 1NCDL 3E6FA 3LKOB 2EIZB 2XKNA 5D1XD 3MRMA 4NQVB 4MNQA 4JPWL 2IMMA 1RIHL 1DBMH 1QFWI 4U3CA 1D9KD 4MA8H 5I71B 3I6LD 2NCMA 2H2PD 2HFGL 1HWGB 4WHTA 4NQEE 2AV7B 1N26A 4GQPH 2HLAA 4EXPX 2XN9A 1MRFH 1YECL 3P9MA 3Q0HA 2H6PB 5KBNC 4MWFB 4MDIB 4HZLB 4V3DB 1Q9KA 3I6GB 1HHKB 4CVWA 2Q3AA 4NZUH 4MJ5B 3WEXB 3LKQA 4R2GC 1OAXL 4Q9QL 4NT6B 3C5SA 4GBXA 4NGHH 4NO5B 3GGWB 5D72H 3BYYA 1G6RA 5F7MC 2Y07L 1FZJA 3ESUF 1FIGL 3PV7A 4NQCB 4ZXBA 1H15B 2VC2H 3O3AA 4X5LA 1MHCA 2BFVL 4HT1H 4KY1H 5T3ZL 3OAZH 4H5SB 1KCVH 4DKAA 1E6JL 4CDGC 2BNQD 5HDBE 3V5KA 1U8HB 3AXLA 1A7BA 2HN7B 3T4YB 4L9LB 4HWZA 3RNKA 2P5WB 4S1DC 3H3PH 3H3BC 1F45A 5ITBL 1NC2A 3DYPA 3QWRD 5CEZL 3CVIH 4PRHD 2VZOA 1A21A 2BCKA 2AJZB 5GZOD 5MEOA 2UWEB 4K8RC 1YQVL 4UOJA 1S7UA 1PX4A 3BMWA 2A0LC 2EDXA 3KXFA 2ADFL 4GAFB 4MLSA 3V4UH 3IGAA 4PG2A 2GJ6A 4WNQA 3W39B 1AO7E 2EYRA 2NXZD 1HXYB 2JB6A 1DUYB 1QG3A 1PW3A 3BPCB 2QADD 2X4UB 2BY2A 3OXRA 4BZ2L 4LCUA 1CGTA 5BS0B 1MJJB 4K7PY 1KIUA 3RU8L 5L7XL 2R1WB 2X41A 3MLZL 4PBWD 3P0YL 3SKJH 5HI4D 3RPKA 5ADPH 3Q1SL 3BQUD 1XMWA 3BUYB 4PTTA 5AEAA 2HKFL 1WZLA 2GAZA 2QHRH 1CICD 5JLZB 4L29B 5FAAA 1YEDA 4GRLA 2B1AL 2ATPA 2EDHA 2J88L 4L4JA 1C7TA 1QKZL 4HAGA 5EU7E 3CFDB 4G5ZL 1A3LH 1AXSB 4KDTA 3HG1E 5TE6L 4LARH 4F9LA 3MC0A 4Y1AA 4QXGL 4XNUL 1CBVH 3RZCD 1FNSL 4LPTA 5HHVL 1RAMA 3Q3GA 5H8DA 3RBGA 1QLFB 3ALPA 2N7BA 3O3EB 4TYUA 4PRIE 2XTJB 2VXTH 3FO1B 4P3WA 5C0RL 1EFXD 4ALAL 2Q8AH 3FKUS 5FECB 1MHEA 3QIUD 1E6OL 3LKPA 35C8L 4K71C 4WUUB 1JWMA 3OB8A 3WMSA 3JTCA 1U0QA 1XGQB 2OR7A 3NABL 4PREA 1SY6H 4K9EH 5D7LA 3FRUB 3WUZA 5T3XL 3JZ7A 3KDMB 4OIIL 1EEQA 4OF0A 3T1FB 1U8QA 5B3NA 1DQJB 5KVGH 2VLKA 3PWLB 3BKML 3TYGH 3WCYA 2HTKC 5CZXD 1R3JA 5MEQB 3D69B 1IQWL 2K7QA 4JHBA 4URTB 3EO9L 1Q9OB 3ZKSD 2K9UA 4JPKL 2XOTA 5AZ2L 3QEUB 5F72S 1IC5H 4QRSB 4J4PD 4U7KA 5AWNL 3MV8D 4X7FC 3ROOA 2BRRL 4LBEB 4M61A 2XA8L 1HOCB 2VISB 2Z91A 4X9HA 2MWCA 3IKKA 2GITB 5A2KH 1Q94A 2KDGA 4JREC 5FYJL 3PP3K 3SE4C 1D6EB 3F5WA 1YY9C 1NL0H 2HLFD 3GSWA 4R90H 4X6DF 3WJJA 1PKQE 1WGOA 1UXSA 2XXMB 3H9SD 3K74B 3NTCL 2YD5A 3QULB 4HIHB 3D3VD 1X4ZA 3RX5A 5CBEB 1A14H 3EOBB 4U33A 5HYFA 2V2TA 1KNOB 1JJUA 3KLHC 2C1PA 4F7TA 2NQCA 1X5XA 4I3SL 4QKXB 3JV5A 1SJXA 3VCLB 3ZKMD 4ZMAT 4O02L 5MP6L 5CJBA 4RAVB 3X14A 1EO8H 1SM3L 2P5WE 1BX2A 4EXKA 1PBYA 3GMNB 2IH3B 3JTSA 1NUGA 4GMSH 4DW2H 3M1BA 4J3TA 4UMGA 4GRMA 1NAMH 4KXZH 4X5WA 1T6WA 5BMFL 5GGVY 2VXVH 3QFJB 4M5YH 4EI5C 4EN3C 3K1KC 1HXMB 3GHEH 4LSSH 1A3QA 3HS0A 4N1HB 4ZS6D 2HMIC 1AGDA 4Z7VE 5JHDA 3GO1H 4YHML 1SEQL 5GHWH 1GJIA 5DFVD 2FEDD 3NH7H 5F9JB 4FQCH 4F7EA 3L9RB 3BIBX 3R4DA 1WIOA 1QLRB 1ZS8B 5I1JH 1HN1A 4ZD3L 2Q7YB 2HVJB 2IALA 3B83A 4YXKH 5GIRB 1BFVH 1UQSB 3OHXB 3W9DA 1VHPA 1HHHB 1I3UA 4C56A 4RSVA 4K3HA 4R4FH 2V6HA 4D9QD 1YN6B 4ORZC 1T7XA 3QUKB 2BZDA 1T20B 2GIYA 1PY9A 5HPOA 4JZOB 4Y0GA 2BNUB 5DJ0B 4ZUVB 2I5YL 2PW1A 3VWJD 3T0EA 4LQFH 3FN9A 1QACA 4IRSB 4PGJA 3IVKA 3E2HB 4BQBA 2J7LA 3L3IA 3MX0A 3MLUH 2ARJA 3EKCA 5C09E 3O3DA 4MB4A 4P59H 5FHBL 3VXRD 5ICXA 4V1DA 1ZE3C 3QDJB 4P2QE 4OKDA 1MHPL 1AO7A 1CXFA 4H1LH 3O8XC 2XY2A 5IVZA 2CSPA 4UDTA 1KCLA 4FXKB 3VFWA 3SCMD 4M93B 5EU6D 3U30B 5J7CC 4OCSH 4XXDB 2DRUA 3E3QC 4WUUE 2VXUH 4FFYL 1Z9SA 4JFDE 2GUOA 2JIXD 3NFSL 1T1ZB 1HIMH 4WO4A 4KU1A 2AP2A 4HUNB 2PYEE 3BDBA 2BVPA 3MNVB 4WVRA 3SOBH 2BOBA 1RULH 4NQDB 1E28A 3MA7A 3CMGA 4M02A 1A3RH 4OZ4A 5C6PB 1P4IL 1PQZA 4XCCL 3V6OA 5B39A 4PS4L 3NBNA 5F3BB 3U0PB 1OP3K 2EDYA 3HE6C 5F89A 4GQ9H 3RVUD 1WWBX 3U7WL 4DTGH 2VKWA 5HGHA 2XIDA 3K1DA 2X9XA 2R0KH 4XBEL 3VXUD 4ODVL 4X7SH 4N5UA 5TF0A 3O3UN 4OGAC 3CLFH 4PJFF 5JOEA 1AD9B 3C6LC 4KKLD 2FWOA 3JWOH 1MAMH 3WYRA 4A6YL 3MLSH 4UT9L 5F1IB 1DTUA 2FO4A 2HVKA 4MNQD 1BZ7B 4YE4L 4LRIC 5J13B 1C5DA 4NZRH 3SPVB 4E9LA 1KIRB 3EYSH 4MJ6B 4J2XA 4TUKH 2FH8A 5IB5A 3I3BA 5KSBB 3LKOA 2EIZA 5EIQA 1ETZB 5T3ZE 1D6VL 4LGSB 2VH5H 4HPYL 3MFFB 4PJAF 4NC1E 5EORL 2AV7A 3S5LB 5C92A 3TN0C 4KGLA 3D1MC 1QZ1A 1BQLL 4YBLC 4Z7QE 1FQ9C 2H6PA 3LS4H 3WUWG 4B53A 5CEZE 2O26U 2QSCL 3WFDH 2CKNA 4MWFA 4MDIA 1BECA 2VLMD 3QPQD 4HZLA 3I6GA 5I1GH 1HHKA 1V7MH 3PGCB 5K33A 2ATKB 4MJ5A 3WEXA 4PRNB 5KANI 1NLBL 3FQNB 1GGTA 4V2BA 2RBLA 3BDYH 4NT6A 3EHBC 1RUPL 2CDGB 1KJVB 4NO5A 5HYQB 2ZG2A 3GGWA 2X6MA 2NY3C 2YPVL 3P73B 4X7CC 1F4WH 4O2EB 4NQCA 3MRLB 1TZIA 1KN4H 2IBZX 2X4PB 3W2DH 1HQ4B 1NC2D 4H5SA 5I75B 3UMTA 3IDXH 5KVDL 1Z0MA 2P44B 1U8HA 4M6OL 2HN7A 3T4YA 1FC2D 3RJQB 4L9LA 3HNSL 1JGUL 2P5WA 2OTUB 4LGRB 1GC1H 1JFQL 4TULH 3CC5B 2B2XL 2EH8H 2DM3A 1NLDL 4KKBD 2GJJA 5HYSG 2QLVB 3CNKA 2AJZA 1A1NB 2GJ6D 3UZVB 4UT6H 2UWEA 5TDPB 4YHLL 1LVEA 3VRIB 4QTIH 3MV7D 1MFNA 3GKZA 3LHPL 1EEZB 4TVPL 1JGDB 3N85H 3W39A 5D2LE 5L2JB 2XG5A 1HXYA 2R9HD 3B43A 4J8RB 1DBJH 1DUYA 4JKKA 4Z8FH 3BPCA 2F74B 3E8UH 5IMMB 4IHOB 4S1SH 1KJ2H 2X4UA 5CIPB 1EEUA 1CDCA 1ORSB 5BS0A 3MLVL 4XAKD 2VMFA 5EZOL 1MJJA 3HB3C 4LKXB 2R1WA 3P3YA 3S88H 5ADOH 4QWWC 2X4SB 4KAQL 2VWEE 4GRLD 5T3XE 3GSVB 3H3KA 4YDLC 3BUYA 1P6FA 4YWGH 5IFJA 1CGXA 3RGVB 5CFHA 3SDXB 1PVHA 1YEJL 5JLZA 4L29A 4G8GE 4Q7DA 4NM4H 4FOMA 3G6DL 2NY0C 4HWEL 4XP9H 3QRGL 2DDQH 1OPGL 2A1WH 1TDQA 4RX4A 4YDKH 3CFDA 4E0RB 3MACH 1J1PL 2BNQE 1TQCC 4JFYB 3X3GL 1Y18B 5ESQB 5AYUH 2VL4A 4EQ3A 3HR6A 2EDQA 1X5FA 3W11D 3KJ6H 1BOGB 4PDCE 5FYJE 3RVWD 4UNVA 4Z7OF 5DXWA 3BZEB 1QLFA 3O3EA 5D7LD 4OCRL 4ZOAA 4NQTA 2NXYD 3FO1A 1RU9L 1L0XA 1ZGLB 4N9GB 5FECA 1DDHB 4WUUA 4J7RA 3GSNB 5DQJB 5AAMA 3WJLA 1OAYH 1XGQA 5JORB 3VD5A 5E2JA 1C8PA 4JZJB 4OCLC 3FRUA 3KDMA 4QOKB 1NBQA 1NEZG 3RWEB 3T1FA 5DC4B 4YFLF 1CQYA 3PWLA 1EBAA 3QI9B 3RBSA 4AEIH 3OKOA 3D69A 5EZIH 3OAZK 4FFEX 4EQ2A 4LCYB 1H3XA 3PDDA 1S7WB 4QRSA 3DHMA 4H1LG 1LO0H 5FB8B 4Q6IB 3TPKA 2LU3A 4LBEA 1HOCA 2VISA 4GKOA 2FEEL 3NIGE 4C83B 2GITA 5FUOL 2VAJA 3VGAC 1D6EA 4HXAH 4Y2DC 1GGYA 5FM5M 3QULA 4HIHA 5CBEA 3WIFB 2JELL 1OT1A 1NMBL 4JRYB 1KNOA 3RFZC 1F4XL 3F7VB 3U9PH 4U6VL 5EOQL 1H5BC 3VI3E 1AGCB 1OAKL 5DUMH 2EDJA 5GZND 5HYEA 4GKNB 3VCLA 3OKLB 2ITCB 4IMLB 4RAVA 2R1YB 1G0XA 1MQKL 4OCWL 3CX5K 3L7FB 3HZVA 3GMNA 3GBLA 2IH3A 2BNRE 2DMBA 2YXFA 2EICA 2C26A 3AUVA 5DA0B 5AZEL 2UZIL 4M3JA 4ZOBA 3C87A 3KLAB 1MRCH 5JHDD 3WN5A 3QFJA 4MGXA 1HXMA 4ZAKB 8CGTA 2E9JA 4I18C 4QRQA 2DN7A 1ULVA 2WMPA 4V3EB 4M1CC 1Y6KR 3K2UH 1MJ8H 3BI9X 4M6ML 3ARGB 1I7RB 2MQCA 1VENA 4AYFA 5F9JA 3KPRB 4FQ2L 3WS3B 3L9RA 1OTUC 5A2LH 2AK4B 5IHLB 1QLRA 5C2UB 4KJQD 1ZS8A 3NIFE 5CUSL 3A67L 2Q7YA 3ZKQD 5L8KB 2HVJA 2EXWD 1GGCL 1QLEH 5GIRA 5C07D 3MV8E 5DZOA 1UQSA 3OHXA 4ZUTB 4LVHC 1HHHA 2FBJH 4ZPTB 4YHOH 3CX5J 2X1QA 1BFSA 3ARYA 1YN6A 4WY7L 3MZGB 1J10A 3QUKA 4I48B 2XZAH 1DLFL 3AREC 4UIKL 2Z31B 1T20A 3K80A 3N50A 1LNUB 3WNMA 4JZOA 4LSTH 4PY8I 4V1DD 4DUWA 4A2MA 4YX2L 1KXQE 5DJ0A 4ZUVA 3HNVH 1PX3A 4F8TA 2IWGA 4IRSA 4ZUSB 3E2HA 1LGVA 3MQIA 2HJLB 2E7CA 3QDJA 3FOMB 4OLYH 5KANG 2W9LA 4RAUB 3S37X 2I07A 2O5ZH 4HQQH 3FONB 3JWDL 2FX9L 4LMQE 4JAMB 1CFTB 1I9EA 2XI9A 3QZWB 4HLZH 3M8OH 2DM2A 4FXKA 2DTML 4GRWE 3T3MF 4WO4D 2B4CH 2VDRL 4XXDA 4PJCF 1AE6H 5C3LD 1DSFL 3EYQC 3BIKB 4JKPL 3HMXH 1MFEH 2DM4A 4CUCA 1J87A 1RVFL 3KYKL 2L0DA 2OL3L 4D8PB 3DPBA 1T1ZA 5DR5H 1JYVA 5F71A 1CICC 3NIDE 3LMJL 4J1UB 1BBJB 1FLRH 3MNVA 4JFFB 4NQDA 2GEEA 3OJMB 4G8GA 2VE6A 5EWIH 4P3DB 5IHUH 4H20H 4JQIH 5DVNA 2V9QA 1R5WB 5F3BA 3U0PA 2BY3A 4P2YA 1MCPH 3CLEH 3O41B 4R7DB 4KI5F 1EERB 1QSED 4WI4A 3RZCC 2NY5L 5LGHL 3MNWB 2LAAA 5I30L 1L9MA 4D9QE 1AD9A 3BP7B 2FATL 4GS7B 4BFBD 5JW4Q 3NA9H 3R8QA 1VACB 5F1IA 2AK1L 5JIHA 3HUJB 3LEVL 1BZ7A 1A6VH 3SPVA 1HEZB 4P4RB 1KIRA 5E6IB 4MJ6A 1IGIH 1WTGT 2J8OA 1HINL 4LFHD 1P2CB 3V52H 5KSBA 3I84A 3MA9L 4M43L 3ZDYF 1ACYL 1X5KA 1Z6JT 2XFXB 3MFFA 1NMCC 5FK9B 3S5LA 2DQGH 2QSQA 1OT2A 2EO9A 3BP5B 2YHGA 5IEHB 2VUOA 4GH7B 1NFDF 3ARFB 1MCEA 2EEDA 5LJYH 5JPMB 3TYFB 1WEJH 4L4VD 4N8VB 1Q9WB 1P9MA 4J4PC 3MJ8B 5EU6E 4ERSH 5I8OL 3PGCA 1A7NH 5ACMA 5FA3B 4PRNA 3CFBB 1T0MB 3FQNA 4KMTH 2XG4A 5C6TH 3KPMB 4JM2B 2Z93B 3KPSD 2W9DH 5TQ2H 5D8JL 2CDGA 4NQCD 1KJVA 4TVPE 4JB9L 4XNYH 1UENA 2BSED 3SY0B 5HYQA 4KDVA 2Q76B 1DQTA 2RCSH 3QBTB 1CFQB 3P73A 2XZCH 4YUEL 3L6FB 3WSQH 4O2EA 3MRLA 2X1OA 4UTAL 3ZE1E 3ULUF 2X4PA 2WW8A 2YBRA 5EC2B 3VD7A 1X5AA 1Z3GL 1YEFH 3ZKMC 1TJGL 1HQ4A 1ROWA 4Y5XC 4F8QA 3VXUE 3H9YA 1U8LB 3TBWB 1SYVB 4M1GH 2ZUUA 4I9WD 3B4NA 3MRFB 2O61B 1L7IH 4OQTA 3DTXB 4G6KL 5IMKB 3TFKC 2OTUA 4JFHE 3RUGF 5IG7B 3CC5A 5F7EH 3DXAE 3MREB 5IW1B 3L7EB 5ILTL 2PUQT 3QISA 4JY6A 1J8KA 4ZS6C 1A1NA 2WWMD 1VFAB 4Y19D 5TDPA 5E9DD 2JCCE 4U3XA 1FNFA 5CLTA 3VRIA 3Q2CA 4AIOA 2IPUK 1JTPA 1PG7W 2MQ0A 1YJDH 4A2LA 1NGXA 1EJOL 5DFVC 2FEDC 5DURB 5KAQG 1EEZA 4MLIA 2RGSA 2ZSWB 1JGDA 2R0ZH 3BKJL 1OQOA 2ZCHL 5L2JA 1WAAF 1RHFA 4J8RA 2R56L 1YDPB 2NNAB 2JJTC 4UINL 2VKXA 4P2RD 2F74A 5IMMA 4XP5L 1A22B 2FL5B 2VLME 1TJIL 4J3OC 5CIPA 1ORSA 4X5XB 4PP8C 3OPZH 3TIDB 4P23B 3LZFL 4LKXA 1N4XH 3IDYB 3VFPA 1LK3L 1MWAB 1KXTB 1EXUB 2X4SA 4OJFH 3GSVA 4DOHB 1GGBH 4L3CB 4PTUB 5E6YA 2ZUYA 3RGVA 3SDXA 3VWJC 5HYIA 3NCYS 1DUZB 5FUZL 4ELMB 1WV7T 4P9HC 4E0RA 1WFOA 2NYYD 4HWNA 2X89A 2Y23A 5GRWA 1Y18A 5ESQA 7FABL 3PWUB 2AXHA 5HHXH 5L6YH 4W6YB 3CD4A 1E4XH 1MJ7H 1IAIH 5I0DA 1BOGA 5KVFH 3SCMC 3BZEA 1P7QD 2X5PA 3KR3H 4G6JH 1A9EB 4G42B 2W59A 3RVTD 4IJ3B 3V8OA 3TESA 1F00I 1ZGLA 4LPWA 4N9GA 4PJEB 2FJHA 1DDHA 2Y06H 4YAQB 2GTWB 3OR7B 3GSNA 2XA3A 4LSUL 1MHHB 1F3DH 1YNLH 3CDYA 5DQJA 5I8CB 4D3CL 4Y4KD 5JORA 3MV7E 4I13B 1I8LC 3ZT5A 1QNZL 4JZJA 4HIEB 2HH0L 4I3RH 4P2OC 5DRWB 4TTGA 4QOKA 1UG9A 3RWEA 1G7JB 3QIBA 5DGQA 3CZFB 1NJ9B 3SDCD 4KK8C 1BWMA 4PJDF 2UY6A 4FG6C 1MCHA 3QI9A 4HH9B 1GGIH 3B9VA 3RVUC 2DQIL 2Z8WC 1ZGLP 4N8CL 5CJQH 4I4WB 2J5LC 4LCYA 1JPTH 1S7WA 1ZT1B 3QCVH 4XAKE 2ZCLL 4ORGB 2DQHH 5EG6C 3QDAA 1ZHNA 2O5XL 3ZE2F 4G9FD 2VDNH 4LHUB 1E4WL 4KKLC 5FB8A 5DMIH 4Q6IA 1S9YB 5D2NB 5CD5D 1OCWH 4HLZG 2R4RL 4JFOB 4C83A 5IBTH 3OKDB 2H2SC 1V5JA 3QNZB 5T1KD 4K3EH 5D5MF 5LBSL 1MEXH 3TWCH 4BSWB 5D7KE 3WIFA 1I85A 3RY5A 3VI4F 4JRYA 1D5IH 4WHDA 3F7VA 1FBIH 4XPHL 5FKAB 3CMOH 1AGCA 2WANA 4XPTL 1NCDH 4GKNA 3OKLA 1J1XH 5MEND 4XCFL 2ITCA 4IMLA 4JPWH 4XP6H 2R1YA 1RIHH 5HGAB 3L7FA 5D70L 1LDPL 4QRUA 1XAUA 5B8CB 3HC3H 1G6VK 2VDPL 3HI6L 3V4VL 4G3YL 3KLAA 4PJ8B 3QXUA 4QRPB 5HGDB 2MHAB 4L8DA 1YECH 3OL2A 1FYTB 5GRXG 4IDLA 4ZAKA 4XHJC 1MFBL 4ZXBC 5F6HJ 1F2XK 3QJHB 1C16B 3S8WA 4JEGB 5JTWA 4UB0L 2YZ1A 4WTXA 4J3SA 4FQ1H 1OAXH 3V4PH 4QGYA 4Q9QH 1GAFL 1I7RA 3KPRA 3V9FA 3WS3A 4HXBL 2R2HB 2AK4A 3CIQA 5J56B 5L0QB 4I77L 15C8L 1VEOA 4RGNB 5DA4A 3B9AA 1CFVL 1TZGH 1LP9F 4PJ5B 4Z7WB 1AR1D 1FIGH 4NQXB 1VKXA 3C6SB 4ZPTA 3VWKA 1QRNB 1N6VA 1OP9A 2J1KA 4ETQB 5T3ZH 5GPRA 5I1IL 1P6AB 4MSWB 4KKBC 2FIKB 3OAUL 2L7UA 5DRXB 5BZWB 4I48A 4HG4J 5E2TL 1ES0B 4PG2C 4NUGH 3U0WL 1LNUA 3D5OF 3QDJD 4ZUUB 5HVGB 4JVUA 1B90A 2BJML 4OLVL 3HAEH 4ELME 3MLPA 5JXAH 3T08A 1KCUL 3WXWL 4BQ6A 4P3CL 5IESL 2R9HC 1VADB 2ENYA 2HJLA 5IHZB 3FOMA 4RAUA 4HKJB 2ADFH 2OK0L 1KCSL 3T1WA 4M5ZL 2CKBB 1RIVH 4JAMA 1CFTA 5FF6B 4H88H 3QZWA 2DLGA 4PLOB 1EIBA 1AQKL 2EH7L 4NHCL 2QR0B 3BIKA 4GRLC 4NWUL 3UTTB 4BZ2H 4EDXB 4CN4A 2AS5M 3RQ3A 4P0DA 4M8VA 4EUPH 4D8PA 3C9NB 5L7XH 3E1F1 3MLZH 4KDTC 4Y8DC 3FFCB 1UKSA 3P0YH 1S8DB 3OJVC 4DN3L 4J1UA 4JFFA 5IEKB 1FN4B 2XRAL 3Q1SH 1CDGA 2D7TL 1FPTL 3AVEA 4XPAL 3L5JA 5FM4A 4P3DA 1RZGB 5L2KB 1R5WA 2KBGA 2DLEA 1U92B 2Q8BL 2EC9T 5C07E 2B1AH 4KK5C 5IMLB 1BVKA 3DSFH 3W11C 3DX8B 2J88H 4LLDB 1QKZH 3S96B 3IAGC 3MNWA 3ZHKA 4G5ZH 4ZNEA 4IRJB 2Y6SD 1F4HA 3BP7A 1VACA 3ARUA 5TE6H 3K2MC 3HUJA 4JRXD 3QXWA 4LCWE 2ICEB 4JY4B 1A4KB 4QXGH 1FNSH 1HEZA 4P4RA 4EZMA 4B0MM 4WCYL 2VZVA 4G9DB 4R6UA 5IB4B 1Q0XL 1P2CA 1LO5A 3AC0A 5F6IC 4ALAH 1WITA 3EOAB 1V7NH 2ADGB 5TPWL 2XFXA 5D96B 3TBSB 4ZNCD 1T83C 5FK9A 2YA2A 4NN6B 3BP5A 4NO0B 5IEHA 4OIIH 4P5TB 3ARFA 4HS8L 5JPMA 4AIXA 4PJXB 3TYFA 5DJ6A 3D9AL 3G6AB 3WO4B 2PR4L 4N8VA 1Q9WA 5KSVB 3MJ8A 3WJJC 4YZFF 3MRQB 4FQLL 5FA3A 1IQWH 4ZUWB 3EO9H 1WK0A 3CFBA 1T0MA 3KAAA 3PG2A 4JPKH 4L9DA 4XNZB 3KPMA 3VG0L 2Z93A 5AZ2H 5IBLC 1WBZB 5IBUG 4S2SB 4AL8H 3RA7L 4GAGL 5DRNB 2BRRH 3SY0A 5LWYL 1J12A 1XH3B 2Q76A 4EDWL 5FYJH 1GHFL 1CFQA 1NDGB 1ZLUK 3L6FA 3NTCH 4DKFL 1FE8H 5DZLA 5EC2A 3EYFB 4FQJL 1QSEE 1U8LA 3TBWA 1SYVA 5FYLD 1MLCB 3MRFA 2O61A 1BD2B 1WQVT 4MQTB 3DTXA 1MUJB 4I3SH 5IMKA 3FB5B 2ARJQ 2KZ1B 5C7XL 5IG7A 5MP6H 1SM3H 3MREA 1ZEAH 1RZJL 5IW1A 1QD0A 3L7EA 4NWTL 5I73C 3MV11 1WCBB 3MBXL 4XPFL 1VFAA 3LPGA 1JMXA 5HDQL 1U6AL 1CK0H 5BMFH 4ODSL 5CZVH 3OR6B 5FHAL 4F15B 2ZSWA 3GSXB 4HUXB 1EO7A 1JGVL 3D85B 1IZKA 3O2DL 1ZMYA 3D39D 4L8CB 3BVNB 3DVGB 1YDPA 1LD9B 3NPZB 2NNAA 1EVUA 4HAFA 2P46B 2ZCKL 4H0IA 4L4VE 2FL5A 1V8HA 2EXWC 1QBML 1WBYB 2EECA 1T21A 3ULVC 2YWYA 4X5XA 4U7MA 3ARQA 3TIDA 4P23A 3BRGC 3RDTD 4D2NA 4N5EA 3VXSE 3KPSE 1K3ZA 1MWAA 2JE8A 4ZD3H 3T0EC 3RVVD 3P9LB 2W60B 4KTDH 2B39A 4KZEH 4O51B 4MXQA 4L3CA 3KPNB 4B7LA 3WHXB 4XRCB 2IQ9H 2F53B 1DUZA 2IG2H 4ELMA 3VRLE 4BH7B 3BWUC 3OKKB 2DWEB 25C8L 1JNJA 1XR9B 4F9PA 4HX1B 3R06A 4I9WE 3PWUA 2E6JA 3SJVE 3DSNA 4U1HB 4AIZB 3PQYB 1DEEB 4M9PA 4U1SB 5FHBH 1KGCD 4XP4L 5GGRY 4RIRB 3LSOB 4WO4C 4M6NL 1A9EA 4G42A 3NMEA 1U91B 2Y5EA 4BKLB 3QNYB 4PJEA 3P0GB 4B50A 5E9DE 4YAQA 2GTWA 4UT7L 3OR7A 1MHHA 3V6OC 5I8CA 3O6KL 3L3KB 5GS0L 3GBML 4HIEA 4W70A 3CSPA 5DRWA 5SWZB 1OARL 3ARDB 3UBXG 1T7YA 4NFBA 1N6QL 3TA3B 3QUYD 3HAEG 3CZFA 1NJ9A 3RWIB 2YUXA 4YNYB 5E1HB 3NFSH 3LQAC 3LDBB 1D5ZB 5I1EL 1I1FB 4HH9A 1MIML 2MTPA 3SO3B 9CGTA 1F3JB 2IGFL 4OB5L 1K6QH 4I4WA 4CMMB 1ZT1A 1JGEB 4ORGA 1NC4D 4X98B 3P9WB 4XCCH 4LHUA 2FX8L 4PS4H 1S9YA 4M7ZC 4P5KB 3U7WH 4HC1L 3O6LH 5D2NA 2P42B 5EBLB 4PJGE 3K4DA 4L5FL 2FJFB 1GL4B 4JFOA 5E8PB 1DCLA 1UWGL 4GT7A 2CD0A 4JRYD 4QHMB 5H37G 5I71C 3OKDA 3QNZA 1IGTB 5FCSH 4XPBL 4OGYL 2EE9A 4A6YH 4UT9H 3MO1B 4EUPG 4OZGF 4KV5E 4GRWH 4C57C 5FKAA 1YEHH 4ZS7L 3ARWA 4U1MB 3OAYK 4NRZA 3MBED 3SGKC 1D6VH 2PETA 3ZT6A 3AMLA 1DBBH 1EZVY 1OHQA 3DETD 5HGAA 4GUPB 2AGJL 4X4ME 4ZAKD 3JVGA 1AGEB 2XWBB 5B8CA 3PABB 1QBLL 4QRPA 5HGDA 2MHAA 4GMTL 3OBAA 4XC1H 3KPPB 2QSCH 1FYTA 3ARGD 4YHNB 4MYWB 5B38G 3KPRD 3SBWA 3QJHA 4G6ML 2BSRB 3QG7L 1C16A 3MLYL 4K94L 2HFFB 1NLBH 2ZOLB 1DLHA 3GMQB 1RUPH 1R3IL 1W8OA 4L9LC 5M7QA 4PUBL 2R2HA 4JDTL 2AXFB 2J2ZA 3BP6B 2LAGB 1X5HA 1KXVC 3BD3A 2H1PH 3V5DB 2YPVH 1IVLA 1ZSDB 4Z7WA 3KLSA 5LAXB 4NQXA 1NGYB 2Z31D 3C6SA 2WBJB 4DFIA 3L3DA 4OUUB 1QRNA 4ETQA 4KPHL 3RAJH 4MSWA 3B8SA 3QIWD 5FO8B 1T03L 4HEPG 2CLZB 2FIKA 5BZWA 5DRXA 4Q74A 3UPRB 1ES0A 3HNSH 3K8KA 2FHBA 3IKCB 4ZUUA 1NLDH 1KLGB 4Z7UE 3HNTL 3HE7B 2ZUXA 4FQQB 1IKNA 3T2QA 3B9KB 4X7EC 1KJ3H 3ETBF 4NZTL 4S0TD 1VADA 5IHZA 5MENE 5E08H 4HKXB 3O4LE 4OSUL 5CJXA 1MI5B 3CSGA 4FFZL 4HKJA 3LHPH 3EFDL 2CKBA 4N0CD 4ETYA 2VITB 1K8DB 3D0LB 3AS0A 1YMMB 3LRSB 1XGRB 2P24A 4QXUL 4JM4L 1KLUA 2QR0A 4JFFD 5EU5B 1GPOL 3UTTA 4EDXA 3MLVH 5GISH 1FAIH 2DQTL 4Y5YB 5JOFB 3C9NA 4PJ9D 4NP4L 4JFZL 2R2EB 1JZ2A 4B41A 2M26A 3FFCA 4P5MB 2ED7A 4MA1B 4KRNA 4KAQH 1BQHB 5IEKA 4PB9H 1E0OB 3NACL 1F3DJ 1HH9A 1JTOA 1FL3B 5JA8B 1RZGA 3BE1H 3MUJA 2XNAB 3SE8H 2XTJC 1U92A 5MI0B 2IAMB 2AJ3B 1OAQL 3G6DH 4HWEH 3QRGH 5IMLA 4Z18A 1ZLWK 1U58B 4RISL 3DX8A 4HK3J 4LLDA 5MERB 3S96A 5E6ID 3V6BR 2OJEB 3SJVA 5F7WC 4IRJA 1J1PH 1IJ9A 3RVTC 4F2MB 5IVXB 2YK1H 1NGQL 5CGYC 4JY4A 1A4KA 1Y0LB 3DUSB 2NZIA 4CN6A 2OLDA 1A7PL 1BVLB 4G9DA 5IB4A 5HI5C 3ZMRA 4QRRD 3VGGA 1CD0A 1H3PH 2OP4L 1RU9H 3IXAB 1WUNT 2FD6H 5C71A 3NAAL 3EOAA 2C4FT 2NY4B 2ADGA 4QYOB 3SDCC 3SGDH 3IFLH 3FT4B 1MCOL 4WFEE 1CXLA 3L3JB 3OG6B 4NO0A 3MODL 4HGMA 4P5TA 4W6WB 2XZQL 3HFML 4JM2D 4PJXA 2NPLX 3G6AA 1YPZE 3QPXH 3GBNL 5IR1B 5C0BD 1KEGH 4YHKL 3MRQA 4DN4L 1A6WL 4ZUWA 1KTRL 5HJ3B 1KPRB 2Z35B 4S2SA 3A6OA 3KPLB 1UXWB 3OQ3B 1EHNA 5DRNA 5C0EB 1T1WB 5DMKB 4G59A 1KG0B 1XH3A 1W72B 5I1AB 1NDGA 3MJ7B 2DJUA 5C2BL 4YHYB 4DVRH 1OLZA 4X6DB 3WNPA 1BGXH 1OY3B 3EYFA 2I9TA 2JELH 3BT2L 1NMBH 4AEFA 3WE6B 1F4XH 1T2QL 4YO0B 5JA9A 4U6VH 5EOQH 3SE3A 2A6JB 1EAJA 1QTYT 2NY1D 1OAKH 1MCSA 1U3YA 3U4AA 1NGZB 2IFFH 3FB5A 1BWWA 4JRXE 4JY5L 1ZA6B 5DGRA 1MQKH 1OVZA 2HKHL 5HYJE 1GH7A 3WLBB 5DURD 4Q97A 3GJFB 5C1MB 5AZEH 1QSZA 3OKNB 4ISVB 1X3DA 3RWFB 3EYUL 4WI8A 3MGOB 2FHFA 4Z77B 3GSXA 4PP1D 4HUXA 5F1SA 3F58H 1DFBL 4XCYB 1BQUA 3PWNB 4P23D 1LO2L 4L8CA 1T1YB 3KPQB 3BVNA 3DVGA 3L1OL 4CGTA 1LD9A 1IC4L 3QDMD 2DQDL 2AJYL 4HMCA 4M6MH 3UYRL 1WBYA 3CFEB 4AEHL 1NBVL 4FQ2H 3UYOD 1OTSC 1YMME 2QEJA 1G9NC 4CKVX 4PJHB 1OD9A 5E5MB 5GS1B 3P9LA 1GGCH 5GGTH 4IRSC 2W60A 3E2HC 4XMLH 2ZNWA 3KPNA 1CU4L 3F62A 3WHXA 4XRCA 4WY7H 4OT1H 4OGZA 5IROC 4QNPF 3H9HB 1KPUB 2Z8RA 1DLFH 4JCMA 4XVTL 2F53A 5HVHB 1JZ4A 2P5EB 4BH7A 4R96B 2IF7A 5KZCD 3OKKA 4M93C 2DWEA 3U30C 1XR9A 3HZMB 3ET9F 1ORQB 2NX5B 3O4LA 4U1HA 5D1QA 5DTFB 4XC3L 4AIZA 1L0QA 1DEEA 4U1SA 5SWQB 4RIRA 3LSOA 1WVZA 2MMXA 3GRWH 4R26H 3EDEA 3GM0A 4PG9B 1U91A 3JWDH 2FX9H 3QNYA 3QYCA 4BKLA 4L3AA 2DTMH 3WBDA 4S1QL 3L3KA 3ZDZE 5SWZA 3ARDA 4JKPH 4EEEA 4YBHA 3TA3A 2OL3H 3D39E 2GQHA 3RWIA 2Y9RT 4MQXD 4PYHA 4YNYA 4KZDH 1FRGL 4LHUD 3IDJB 1D5ZA 3CDCA 1I1FA 2XQYG 3P30L 1F3JA 4GG8B 3SDDB 4FTVB 4CMMA 1RHHA 3RVXC 1JGEA 2I27N 4ZDHB 4X98A 2VIRB 2Y6SC 3BIAX 1YY8B 5C0DA 2CQVA 5IM7B 4I8DA 4P5KA 4E41D 3QFDB 5EBLA 2VC2L 4XMPH 3PWJB 3MSPA 4U6TA 1ZTXH 2FJFA 4KY1L 5E8PA 4QHMA 5DHVA 4JKMA 2NY5H 1KCVL 5CEXB 5I1DB 3PWPD 5BRZB 3QH3B 1IGTA 2FATH 3HKFA 3OWEA 1FL5B 2AK1H 3K8MA 2LV4A 1FFPB 3LEVH 3KJ4B 3FO0H 3MO1A 4BSJA 5ACZB 4X6DE 4OI8A 1L6ZA 5CJ5A 1Z9MA 3NCBB 3RWGB 1P84J 1P9MC 3O6MH 4U1MA 1HINH 3CVIL 4ACPA 4XHQA 4PJ8D 2OX5A 4M43H 1ACYH 4GUPA 4TVSa 1U2HA 3RKPA 4NNYB 1KGCE 2UUDK 5C0IB 3K81A 4BYHA 4WI3A 2APXA 1ZVHA 1AGEA 1NDMB 3GMOB 2XWBA 4HS6B 3PABA 1AP2B 3W9EB 3TZVD 3V4UL 5E5UB 4JANA 3EW3B 5E1AB 2PYFB 2YS4A 5I19L 5J89A 4YHNA 4XT1C 4ZSOE 4NO3B 2BSRA 2Y36H 4Q0XH 4JFEB 1B6UA 2HFFA 2WSKA 5E8EB 3TVMB 2ZOLA 5I75C 3IU4H 4RGND 4JJ5B 1I1AB 3MMEB 3HTLX 5D8JH 4PJ5D 3GMQA 5F9DC 5DVMA 4PLJD 1TIUA 4AZ8A 4JB9H 1K9TA 2AXFA 3BP6A 3QSKB 4KVNL 1Z5LB 2QKIB 1KELH 1QEWB 3V5DA 1Q72L 3O45B 4YUEH 1ZSDA 3G5ZB 5LAXA 1JI2A 1NGYA 4UTAH 2WBJA 3TPUB 4OUUA 3WKNA 3DI2B 1OGAE 1TJGH 3QDGB 3MOBH 4J12A 4HPOH 5FO8A 2CLZA 4FS0A 1A3LL 3UPRA 5F21B 1QFHA 4I0KA 4KRLB 1FH5H 3WNLA 3ARPA 2EDEA 3IKCA 1LHZA 5TE4L 1WIPA 4NHUB 1KLGA 4X4ZA 5ISZB 3HE7A 4KHXH 3S35L 4FQQA 1FZOB 1W0YT 3B9KA 4MJ4A 1I7ZB 2Q86A 2VXTL 3TJHA 2Q8AL 1MLBB 4HKXA 1WCQA 1MI5A 2FBOJ 5CSBA 1EJOH 3PL6B 4Z78B 2EZ0D 2ITDB 1X5IA 1NGWB 1SY6L 4K9EL 4I0PB 3VXTB 1D5BB 2ZCHH 2VITA 4G8FB 4OZIF 3RGVC 4MJIB 5KSUB 4K3JH 5JO5B 1K8DA 3D0LA 5KVGL 1YMMA 3LRSA 1XGRA 4UINH 5I74B 3FFCD 4XP5H 1FNEB 3UPCA 3RVVC 3TYGL 1TJIH 5EU5A 4OV5B 2YN3A 5FGBA 4Y5YA 5JOFA 2ID5A 3M45A 3LZFH 3C5ZB 3QUZB 3DX9B 4LVNB 2R2EA 3NA4A 5L2KD 1LK3H 3DROB 4P5MA 1OP5H 4NJ9L 4Z0BH 1BQHA 3DNKA 5FA4B 4N9OB 1FL3A 4Z5RA 3W0WD 4IRJD 4JPVL 4IDJL 3DX6B 1IGYB 3IAQA 2VLJB 2XNAA 1I3GH 4R90L 2AJ3A 1F6FB 2UY7A 5JR1L 1U58A 3BKCL 3N0PB 5MERA 1IC1A 2OJEA 1NANI 1WWWX 1S7XA 1OAZL 1GOHA 4JZJC 2V9RA 7FABH 5IVXA 4MAUL 5DQDH 2FHCA 1G7QB 2VLRB 1J0IA 4PJFE 3PIQB 1Y0LA 2DL9A 1J0JA 5C0AE 3TM6A 3DUSA 2EXYC 2YD2A 2ICES 2KZWA 3QI9C 4NO0D 4DW2L 2HYMA 4DVBB 1MVUB 5FDWB 1NANH 4IOIB 3IXAA 3DVIA 2SEBB 4LCIH 2R1XB 4LHQB 4QYOA 4LSUH 3FT4A 2HWZH 2VXVL 4XWGH 4Q6IC 4JFXB 2CPCA 1WC7B 1QNZH 3L3JA 3GHEL 3G6JB 1P5VA 1Q1JH 5JMOC 5IQ7H 3U7YH 4Q9CA 4PJAE 1WZMA 5EZJB 3VD4A 3ZO0A 2W92A 4KWUA 1RZ7H 5GHWL 5IR1A 4F3FB 3HMWL 5I2IB 1UA6L 3NH7L 1J88A 1JE6A 3QQNA 2DQIH 4Y16D 5JDSB 2VQUA 1AHWB 1A5FL 2EE3A 3SHSA 5HJ3A 3ZE0E 4EJ1C 1KPRA 2ORBH 2Z35A 3TP4A 3KPLA 1KN2H 1UXWA 4JGUA 1E4WH 3DUUB 5JW4N 2IQAB 1XIWB 1NUDA 5DMKA 5DUBB 4YXKL 5C0EA 1KG0A 4MNHB 1W72A 5I1AA 3MJ7A 1BD2D 4JHZA 3FT2B 3W5NA 4X6DA 5LBSH 4QLRA 2DLHA 1QR4A 4QTHB 1IEHA 1EGJA 3TPUE 4L3EB 5BVJB 3WE6A 4YO0A 4XPHH 4NZJA 4ZAKC 2MCG1 1N5AB 2A6JA 4WEBH 4IOSD 4XPTH 4HZAA 1NGZA 4ZFGL 3WUWB 5IOPB 1ZA6A 1S3KL 1N3NB 4JVPA 4LDOB 4P59L 2GHWB 3WLBA 1CI5A 3ARGC 5D70H 3GJFA 1LDPH 1RQ5A 5EUKB 2RFXB 3EO1B 2CXGA 2WV3A 2VDPH 3HI6H 4QRRE 3OKNA 3V4VH 4OCXH 4XVSL 3D85D 4ISVA 4ODUB 2W1NA 1IILE 3RWFA 3Q48A 4ZSOA 1MCBA 3SGEH 3CK0L 1BIHA 2AV1B 2PO6D 4MAYA 5KVMC 4DKEH 3MGOA 1T1XB 4BUGA 5T5FL 3MFGB 4Z77A 4N0UE 2VXUL 4N8PA 2VZ3A 3GJEB 4XCYA 4X6CB 3PWNA 3ZYZA 4UB0H 2DQFB 1T1YA 1UZ6F 1UVQB 4LQ1A 3JV4B 2YRZA 3DRTB 1GAFH 2H45A 5CKAA 3RWJB 1DBAL 4XNXL 5C70A 3IETB 3LB6D 1U3JA 3CFEA 3ARSA 2Z31C 4HXBH 3S7GA 5CWSB 3DBXB 1K2DB 43C9B 3B2UD 3P0VL 4I77H 15C8H 3HC4H 4PJHA 5D93B 5E5MA 3ULUL 1G9MC 1OTTD 1AY1L 4FQIL 5GS1A 1OGAA 4GLRH 3BH9B 3MUGB 4GQ9L 4NCC1 1HWHB 2J8UF 5HHOE 3KLDA 1INQB 5E6ZA 3QCUL 3T8XB 3UJIL 5EU3B 5I1IH 1CGVA 1H3GA 1MY7A 4NCDA 4DAGH 5HYSB 3OAUH 4F7CB 3CLFL 2D0FA 5E2TH 3H9HA 1KPUA 3JWOL 4NM8L 4KRMB 3V6ZB 4K7PL 5J57B 3U0WH 3PQYD 2P5EA 4R96A 4FFWD 2BJMH 4OLVH 3WD5L 2WP3T 3EYSL 3BDXA 3HZMA 3WXWH 4KKAD 1ORQA 2NX5A 1OQXA 4P3CH 1NCAL 5DTFA 1JRHH 5TFSL 5JOPE 3PHQA 5SWQA 5J6HB 3SKNB 1URLA 1YC8A 1P5UA 4PJ7B 1KCSH 4PG9A 5SWZD 5CCKL 2JB5L 3UJTH 2LFGA 2BSSB 2CRMA 1I4FA 4Z7OE 1UADC 3Q6GL 3NOIA 4GG6B 3LS4L 4WI6A 1AQKH 3EIFA 2EH7H 4Z95L 3MRPB 5GQBA 3MLRH 4U1IB 1NAMB 3RI5F 4PJCB 1IZJA 2DI7A 4NWUH 4CBPA 1V3KA 3T09A 3WNKA 1FGNL 3F6LA 4UUJB 1NGPL 5TDNB 2IPTH 2OI9B 3QDME 2XKSA 3IDJA 4GS7C 4KQ4L 1G7LB 4OI9A 4GG8A 4C4KT 1LO4H 4FTVA 1PG7L 2XRAH 3QJFB 4P46B 2D7TH 3DX7A 1LILA 4ZDHA 5E6IC 5EUOB 3EJJX 5FO7B 2VIRA 4ZODA 1YY8A 2Z8SA 5IM7A 1U3HB 1F4WL 3BHBB 2Q8BH 3QFDA 3DIFB 3PWJA 4K7FB 3DJ9A 2OMBA 4HS3B 1ZVYA 5CEXA 5I1DA 3WXVL 3QH3A 3IDXL 1EVTC 1YEGL 5FGCE 3J7HA 1FSKB 2EDBA 1FL5A 5JZ7D 1CGUA 1FFPA 3T0DA 1MH5B 1QUNA 5DD6B 3RI5K 3ARFC 5LQBH 5ACZA 4OF8A 2W0LA 4RGMB 1GC1L 2A2QT 2EH8L 3RWGA 3HLAB 4WCYH 2BSTB 1KYOJ 4X0KB 5KSAB 1NEZB 2JJUA 3WFZA 1I1YB 4X9GA 4QHKJ 4S1DD 4UT6L 4JM2C 4NNYA 1CGYA 5TPWH 4QTIL 1NDMA 3GMOA 3LKSB 1UB6B 5ENWB 4PJAA 1AP2A 1EPFA 1M71A 3U0TB 5I8EB 5E1AA 4K8RD 2PYFA 4H1LB 1DBJL 4MD5B 2PTTB 4Z8FL 2WUBH 3REVA 4NO3A 3T0VA 3A6BL 4FQLH 2I60H 4WHCA 4JFEA 3HRZB 5E8EA 3TVMA 1L6XA 5DUPH 4ZYKB 4JJ5A 1I1AA 3MMEA 5CAYB 5DO2C 5ADOL 3RA7H 2WBJD 1KSRA 1ADQA 5GGVL 1Z5LA 1UT9A 4EDWH 2QKIA 5DD5L 1QEWA 5CP7B 4OZHB 1DJSA 1F8TH 2NLJB 3AM8A 3NN8A 3TPUA 4YR6B 3I02B 4NM4L 3ZL4H 2X2YA 4XP9L 2DDQL 3QDGA 2A1WL 4WTZG 4FQJH 1F58L 1GZQB 2ERJB 3HE7D 3PWPE 3IRPX 3MACL 1MIEH 3E6HB 1U9KA 3TJHD 4AG4L 4H0GA 1QFWM 1I8IB 2EIBA 3KJ6L 4NHUA 5GRVK 5ISZA 4NWTH 1FZOA 3DMMB 4PP1C 1IM3B 1I7ZA 3BO8B 3MBXH 2DKUA 4XPFH 1RK0B 5B21A 1U6AH 1MLBA 4P23C 4C54A 4CJ1A 4N5EC 3MJ9L 3IDYC 3PL6A 4ODSH 2ITDA 1OAYL 1NGWA 5FHAH 4LRNH 4I0PA 3NCCB 4MXQC 3VXTA 3DUHA 1D5BA 1JGVH 2VJXA 4G8FA 2XWJB 4ZFOB 3O2DH 4MJIA 1K8IA 5FYKD 4PLKC 3FO2B 5JO5A 3GMRB 5I8KL 2EKSB 1M4KA 5IIEB 2ZCKH 2WUCH 1FNEA 4OV5A 3OB0K 4JG1L 5EZIL 3T3ME 3MV9D 1HHGB 4PJCE 1EDQA 3SEPA 3C5ZA 3QUZA 1YQ2A 3DX9A 3WDJA 2EIDA