3RL2A

Hiv nef derived peptide nef73 complexed to hla-a*0301
Total Genus 67
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
67
sequence length
274
structure length
274
Chain Sequence
b'GSHSMRYFFTSVSRPGRGEPRFIAVGYVDDTQFVRFDSDAASQRMEPRAPWIEQEGPEYWDQETRNVKAQSQTDRVDLGTLRGYYNQSEAGSHTIQIMYGCDVGSDGRFLRGYRQDAYDGKDYIALNEDLRSWTAADMAAQITKRKWEAAHEAEQLRAYLDGTCVEWLRRYLENGKETLQRTDPPKTHMTHHPISDHEATLRCWALGFYPAEITLTWQRDGEDQTQDTELVETRPAGDGTFQKWAAVVVPSGEEQRYTCHVQHEGLPKPLTLRW'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HLA class I histocompatibility antigen, A-3 alpha chain
publication title Structural basis of cross-allele presentation by HLA-A*0301 and HLA-A*1101 revealed by two HIV-derived peptide complexes
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
total genus 67
structure length 274
sequence length 274
ec nomenclature
pdb deposition date 2011-04-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00129 MHC_I Class I Histocompatibility antigen, domains alpha 1 and 2
A PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3rl2A02
3.30.500.10 Alpha Beta 2-Layer Sandwich Murine Class I Major Histocompatibility Complex, H2-DB; Chain A, domain 1 MHC class I-like antigen recognition-like 3rl2A01
2R56H 2OR7A 5KG9A 1MCNA 4NKQB 5J1SC 3LMJL 3T0ED 2GKIA 5DMGD 3DSFH 3X13A 3CXDH 3QXTA 3H9ZA 5AWNL 1Y0LA 4JFQB 4JRXA 3CVHB 3TN0B 5GS2H 3Q5TA 5KVEH 1M05A 3LKRA 1HSBB 4JKPH 1T83C 3EYUL 1N6QL 4LKCA 4X7CC 3HMXH 1ZA6B 4YHLH 1RIUH 2DBLH 3QPQD 3RVUD 4KPHL 2GJZA 3ROOA 5DEGB 5E8PB 4MJIB 2QQKH 5MI0B 2OTWA 3BZEB 3HHRB 3BWAB 3QCUL 3T3PF 3WO3B 3WFEL 1DLFH 2EDRA 2DM7A 5DUBA 3GBLA 4G8GE 4D9RE 1D6EB 2F5BH 2XICA 3Q3GB 1XF2B 4OAWB 1GAFH 4KTEL 1N0XH 4ZNEA 1QLFB 4O4YL 3D2UD 1WWWX 1U93B 5FYLD 3UTTB 5C08E 1MCRA 1QKZH 4LCIL 2HH0L 1L8JA 1MHCB 4RISL 2C1OA 4YIQB 2OMBA 5FUCC 4UOJA 4PB0H 4FFEX 4ZAKA 1INDL 5D8JH 1E28A 4Z18A 5GRJL 3RIAF 1PKQB 7CGTA 4JGUA 4PJIB 5F3BA 2NZ9C 5E5RB 3FT3A 4CADB 3LD8C 5FO7A 1VSCA 4BK4A 5B3JE 1RK0A 1LHZA 4NZTH 5IB4B 1TVHA 2YSSB 4MB5A 2QKIA 5F96L 1OTTC 4NRYB 3CMGA 4KROD 4OF0A 3LS5L 3QZWG 3MRHA 3H9SD 5GS0H 1S7TA 3O3AA 1T1ZB 2XG5A 3HUJE 4LDOB 5E8OB 3TVMD 4QHMA 3GMRB 4QNPF 1H8OA 2OL3H 5DQ9A 1REIA 4M93C 2Q6WB 2E7BA 1JFMA 4HIHA 4JM2B 1V3JA 4JVUA 3HC0A 3CXDL 2E6PA 2F54A 2XWTA 2DQHH 2PW1A 1A7PH 2JE8A 3HG1A 1QRKA 4PUBL 3P73A 1S8DA 1KELH 5FK9A 2ZKHL 3FQRB 4GMSH 4XXCA 5J11B 4ELME 3CUPB 1FYTE 3QUYC 4XCEA 3BP4B 4X6DA 1ES0B 2EO1A 4Y4HB 3QUMB 2Y7QA 1WCBA 3ZZ1A 4LLDA 4RBPH 1JYNA 1Q38A 1U8HB 2HT2D 5BRZA 1TJHH 3IXAA 4H0GA 3DX6A 1VEOA 3RDTC 1I1AB 25C8H 3ZHLA 1TVBA 5KAQF 5IOPA 4ETYA 1GAFL 1VFMA 4HEME 1KN4L 5DK0A 1U95B 5I73C 3VU2A 1YZZA 3PP4L 3QPXH 1QKZL 2GSIB 4EN3A 4WO4B 5KSBE 1DBJH 3FCTB 3CFCH 3AXLB 2X4QA 3O6LH 1Z9MA 2CLVB 3CH1B 3G6JF 1OT1A 4PB0L 4MD4B 4C54A 1JBJA 1N26A 1H15B 2XTJB 2PTUA 4HD9A 4CJ1A 2WM0A 3PGCB 4N0FB 3D85B 5F8RC 2XXCB 2HTLC 5FDYA 4I3RH 5TPWH 3RY6C 3D39E 3WHXB 4BZ1H 2MKLC 2F15A 3F6LA 2Q8AH 2IBGA 1CD1A 4P4KB 5HHQA 5C0IA 4LBEA 5JW4Q 1BVKA 1MCKA 3RWEA 4UQ2A 4Y4KA 1ITBB 5GS0L 2I60H 1S5IL 5C0RH 5E9DA 1PZUB 4EDXA 1MQ8A 5EZOH 2OQJA 4AIZB 1OT2A 4J3WA 2XFXA 5DEZA 4ALAH 4RFNB 2OL3L 4HMEA 4BQ8A 3EOAA 4UV4L 5FUCE 5D71H 1J1PH 3RY5A 1F6AB 1NL0H 1NMBH 1P5UA 1OB1B 2NY3C 1J8HD 3BP5B 1YNTA 3MNZB 2DQHL 4I4WB 4NQED 1HH6A 4JB9L 1S9VB 4Z7VA 1ROWA 5DJDB 5I19H 5HBBA 4RGMB 2HJFA 4E42B 1RUPH 5KS9E 4DOHE 1AR1D 1PKOA 3ARBA 1T3FB 4Z7UA 3IVKB 4RMTA 4GMSL 1RZJH 3BHBB 3PIQA 3NCYP 1NLBL 3MRJA 2D4DA 4H1LH 4JQXA 3GJEA 4E41E 5K9KB 5FIEA 1MFDH 2FO4A 1QA9B 2A9ML 3L3IB 4JY4B 1CD9B 5ETUA 2KPNA 4Y0GA 3H3BC 25C8L 1P6AB 4YDIH 1MI5A 2K1MA 3LKOA 2UUDK 4LIQE 4YBQC 5ENWB 4NQTA 1PLGH 4DGYH 3DVGB 3OXSA 1LP9A 2PR4H 4RMRA 2IPUK 2EDQA 1FNEA 1IL1A 3I2CL 3QPXL 1CLCA 5CBAA 2YRLA 1S7XA 1U58A 3ARFB 4CW1A 1DBJL 5CP7B 2ZUQB 3FQWB 1RURL 3O6LL 4CGTA 4EUPA 4NKOB 4WCYH 5CBEB 1FIGH 3FZUD 1MRFL 3ESVF 3O4OC 1C5BH 2BMKA 2IAMB 3DV6A 4MA1C 4KXZH 5TPWL 3FOMA 4QXWA 1A4KA 4BZ1L 3R0MA 2G5RA 1MLCA 2Q8AL 1MRCH 2VLRB 1P69B 1RZ8A 2GHWB 4PDCE 1IGFH 4K9EC 2C3VA 3CLFH 2ZSVA 1DUZA 3MRQB 3WLWC 2YD5A 4MVBC 5CEZE 4TQEH 3NCYS 2P5WA 2GCYB 4YXHL 2WBWB 2ICWJ 5HGAA 2ICWB 4LHQB 2EKSB 3RKDC 3W5MA 3JWDH 1LDPH 1JTPA 5E8EA 1T66C 3JTTA 4M62L 2WWMC 1B88A 2R1XB 4OM0L 1OAUL 1VCAA 5D71L 4X6CF 3FRPG 1NL0L 4FHBD 4R4BB 1E6OH 4PY8J 5KG9B 4NZDA 3RZCC 4J8RA 4WHDA 4PJXF 1QR1A 3VXTA 4JRXB 4JFZH 1IJ9A 4WY7H 3GRWH 1XH3A 1RZJL 1JCKA 4UZGA 4X98A 1AH1A 1RFDH 5DYOB 1LD9A 3GZKA 3BJLA 4KRLB 4U1SA 3ARGA 1DE4B 3VCLB 5L6YH 2GJZB 3ARYA 3NN8B 1R3JA 3MRMB 4P2QB 4PLNC 5D7JB 3U9PH 1VDGA 2Y36L 2OTWB 3NOIA 3UTSE 1YEIL 5SWZA 4YDIL 2UZYB 1JPFA 5K9OB 5C8JB 1PLGL 4KRPC 4FA8A 3QBTB 3P9LA 4HUKB 2N4IA 4NRZA 4AG4H 1KIPA 5DWUH 5C0CD 1ZLVK 2FBOJ 3GIVA 4XI5D 3T1WA 2F74A 3BIKB 1WICA 1IAKA 4P3DA 4FQJH 2VZVA 3WCYA 2Y07H 3PDOB 1W2KT 3MJ8A 2HMID 2VLKB 3RPIB 2EC9U 3UYPA 1I8LA 4IHOA 5E0QA 3RGVD 3U4EA 1CLZH 4HWZA 4PRNA 1MPAL 3G5ZA 5JORA 1C5BL 5IK3B 1E28B 5TFSL 1K4CA 4JN1L 4KV5F 4N0RA 1L0QA 5L8JB 3I3DA 4C57C 5JR1H 5F3BB 4LLVA 1GGTA 2ADJA 5D7IE 1IGFL 5FO7B 1JNLH 3CLFL 4O58H 2X9WA 4YHNA 4XCYA 4HDIB 4OBSA 4MGXA 2YPVL 4N5EA 4P3WA 4UDUA 4PR5A 4OZHB 5HHOA 3BQUC 1S7TB 3JWDL 3O3AB 3S4SG 1RV6X 4OF6A 3GMNA 5EWIL 4LNRB 1KG0A 4QHMB 5EPMA 2DTML 3DRTB 3QUXC 3O3BA 2RR3A 2Q86A 2YUZA 2F54B 2H8PA 4JFZL 3RUGF 1OTSD 5HVHB 4X6EA 2P5EE 4Y2DD 4A6YH 3P73B 2GQHA 5BZDB 2VOTA 4P4RB 4GBXD 3VJ6A 3FL7A 1RFDL 1IC7H 1JL8A 5IT2H 5HI3D 5CEXA 4GW4A 3O9WA 1UB6A 5T3XE 4AEHH 5HDBE 2QADB 3U9PL 1I4FA 3KS0J 2DM4A 2VLJE 2DJ4A 1OGAE 4JO4L 4L8SB 4M1DL 1WCBB 1ZGLA 4LLDB 2JJTC 4L4TB 3QWOB 1A02N 5BRZB 3I3BA 4ZTOL 4ODWA 3VD4A 3OF6A 5ILTH 5EOCH 1DTUA 4PJCE 4W6WB 5FYKE 4RMVA 4DZBB 5ID0B 2N1KA 1NMCC 4KK5C 4WHCA 5DWUL 1LQSR 3QDJA 5C0JB 4ETQA 4YR6B 2Y07L 3JVGA 3B8YA 1TTUA 4EN3B 3NZ8B 3KYMB 5HYSA 4DQOL 3KHQA 3RY4A 4BQCA 2ZWLT 1T04A 1I1FB 5CLTA 3HR5A 4OZFH 2F53D 1JNHA 4Y89A 1U91A 1RZKL 3CFKB 1FVDA 3DGCR 5JR1L 1MCWM 3SQBA 5J4MA 1JNLL 1BEYL 1C8PA 2AJVL 4AH2B 1CD1B 1AY1H 4WFED 4LBEB 3SDXE 4RX4D 1BVKB 3BISA 3FT4A 4P5MB 3RWEB 2FL5A 2W0KA 2WQ8A 1FORH 5BOZG 4Y4KB 3OKLA 4WUKH 1CXLA 4LLWA 2APTA 5E9DB 1U8OA 2OQJB 1N8ZA 1CT8A 2XFXB 3QJFA 4G8EA 1DLHB 3OMZA 3EOAB 4X7TB 1XMWA 5CP3H 3UC0H 3OKMB 2P4AB 1I9JL 1HZHL 4Z7VB 3IFPA 4A6YL 4LRNL 4YX2L 1CDJA 1CLYL 5CSBA 5D96B 4P5TA 1EK3A 1IC7L 5DJ6B 3NACH 3KJ6L 4BH8B 3PIQB 5J89A 1XF5A 4D9QE 2CPCA 1B4RA 2AEIT 3TA3B 2C3HA 4M9PA 5EUKA 1FNLA 2EEAA 5EA0H 4XVTH 3H42L 2CKBL 3FO0H 4C56E 5CJ5A 3SBWA 3HE7C 4QY8A 2JCCB 1OM3H 4XNYH 1FNHA 4OZIA 1IARB 2LU3A 4L3CA 3DYOA 1T89A 3LRSB 3Q6FA 4MD0A 1KJ2A 1SY6H 2PXYC 3G6AA 4WI7A 1X7QB 5F89A 1MI5B 3VXUA 1QNZH 1QFPA 1FYHB 4XNZB 2F8OA 5DQJB 1LP9B 1FNEB 1IL1B 4AENA 5CBAB 3I6LE 4G5ZH 2VLME 4JM4H 1S7XB 1U58B 2ZUYA 3DOSA 1JVKA 3K1DA 5AAMA 4CW1B 2VDOL 1QRND 4QXGL 5J13C 4XAWH 4DAGL 4L8BB 5CSGA 3ZTJH 4EUPB 3KPNA 2BSTA 3GGWB 4U1MA 1JTTA 2P8PB 4IMLB 1AC6A 3KLAB 5F1NA 3HR6A 3MQIA 2VYRE 2BC4B 1NC4A 3BZFA 5D1XC 3JWNC 1GYAA 2VE6B 4Y19D 3FOMB 4V1DB 3QDMD 3V5HA 1A4KB 1WT5C 3I6KA 1WZMA 4MZ3A 4LGSB 4PV8B 1AY1L 1FZJA 3HAEG 5DHXB 4LSUH 1S78C 5DJXB 1DUZB 4XBGB 5F9WB 5HI4C 2EKJA 3RL1A 3K1KC 3EZJB 3ZYOA 5DF0A 5HGAB 1KCKA 3ZLQC 4DUVA 2FCBA 3C60D 1WISA 3QAZB 2WV3A 1CL7L 4P46A 4N0UE 3SJVB 3UTPE 2P49B 3RWIB 4LOUC 3FFCB 4HCRH 3D3VE 3X3FL 1A8JH 5D7KD 4X4YA 1CDIA 4Z76B 1QLRB 3K8KA 4HUXB 1JPST 3CVHH 3M8OH 3U1SH 4RZCA 4GLRH 2EH8H 3NACL 3INUH 1KCRH 5I66A 1V05A 2BOBA 3BN9C 4U1SB 3P3YA 3MGAA 3GSUB 4XVTL 2BHYA 2Z0BA 3FO0L 3TH2T 1R3JB 4WFGD 4YHOL 2WIIB 1OM3L 4XNYL 3DRQA 2JLLA 4YZFF 4P5KA 5CP3A 3PQYE 4DKDC 2VDKL 4JDZA 1NAMA 3QG7L 1IZKA 1YEFH 1FFPA 3RRQA 1UZ8B 1MUJA 3MV8B 3P9LB 1D5BA 5IHZB 4ZUUA 5I1HL 4G5ZL 4P3DB 1JP5A 1PD6A 4ISVA 1C08A 5T3ZH 3MREA 1C7TA 4WFHE 4YHZH 4N1HB 1BJ1H 4P3CH 1AGBA 2AK4E 4IHOB 2DWEB 3CNKA 1N3NB 3IGAA 3U4EB 4HWZB 3G5ZB 5DHVB 4URTB 5F88B 2VRAA 4PJFA 3ARDC 3WUWA 2J6EH 4DKAA 4RWHA 1FLRH 4HBCH 4Z7WA 3OKOA 4MAYD 3KWWA 5C08A 4JAMA 2QHRL 3ARXA 5M95B 1ZVYA 4JPIA 2AVGA 3QHFH 4LLVB 2ADJB 3Q48A 1CICD 2N7AA 4LSUL 3TC9A 4Z7QE 3S88L 4KXZI 1NUDA 2EE3A 3TNNA 5L2KB 4OLYH 4WHTA 3RTQC 1NFDA 5C0FB 4UDUB 5HHOB 3KLSA 1KBGL 3B9KB 2DDQH 1EIBA 1KG0B 5AZEL 3NIGF 5TGBA 4HKZA 4MXVE 4CU7A 4ZO6A 1QO3A 4GAYA 1I7ZA 3MRLA 3K80A 3ULVL 2YEZA 2H8PB 1X4ZA 3RIFK 5IF0A 3CVHL 4X6EB 1FG2B 2W0FA 3L3DA 1ZLWH 3IDXH 3VJ6B 1HYSC 2JIXD 2FZ3A 2PO6D 1NFIB 4UNTA 4MA3A 5CUSH 3PWNA 4GW4B 3WS3B 1DQML 3O9WB 4YPGA 3KPRD 2YC1B 3STZB 3VXRA 3T65B 4TUOA 3EFFA 3QUMH 1C16B 5FCUH 1IGCL 3B83A 2EXWD 1IVLA 2YBRA 4MJ5B 5JXED 1CGWA 1FAIH 2NW2A 2FR4B 4ELMA 3C6LB 1WBZA 4Y16A 3HPLA 5LXGH 4PJDB 1PDKA 2XG4A 2PYFB 1NQBA 4EI5C 2F5AH 4HLZH 4YHZL 4GJTB 1FFRA 1VEMA 1D9KC 1MNUL 1FCGA 4ZAKD 4PJ7F 1HNFA 1JFQH 5KSVA 1T04B 3NCFB 3H9HB 2BP3A 3HR5B 4LPCA 3VMPA 1QHOA 3LPFA 1JNHB 1MFBL 2J6EL 1U91B 4HBCL 15C8H 4MXQD 3LS4L 4G6JL 1T83A 3CJJA 3FTGB 4NQCD 1AE6H 3LZFL 1BJ8A 3QHFL 3WN5C 5HHVH 2UWEE 2DLTA 3WKMH 3AS2A 3H8NA 4KZEH 4XH2A 3VH8B 4OLYL 3TBTB 3RVWD 2G60H 2FL5B 4OD1H 1KIRB 1UM5H 1ONQA 3OKLB 3SKOB 3MX0A 3MV01 3DVIA 5IW1A 4M02A 1N8ZB 4NN5C 4TVPD 3QJFB 1CFBA 3QI9C 4L9DA 4G8EB 2OBGA 5I1GL 5JW4R 1TVDA 5D1QC 3RAJH 2O61B 3HG1D 3R1GL 4FQCH 1XGQB 2H41A 3IFPB 2LTQB 2DD8H 1BF8A 3VXOA 5ADPL 5BZWA 5CUSL 5MENE 5E2JA 4Y4FC 3MUZ1 1XF5B 3OKKA 4HF5H 3KLHC 2YPKA 5E6IB 2DQCH 2NPLX 3QUML 4WI9A 1OP5K 1ZMYA 3ET9F 1FAIL 3DYMA 4WW2C 3GK8H 4HXBL 4MD0B 1KJ2B 4Q9RH 1QSFA 3G6AB 2ZOKA 3VD7A 3PWVA 4ZSOA 2C4XA 3VXUB 4HJ0D 1Y6MR 1M4KA 3EDJA 5LXGL 4E41A 5F7WC 1EAPA 4GAJH 4GRWB 5DD0H 4TSAL 1X5FA 4CVZA 4LSQL 3MLPA 2D2OA 2F5AL 4JFFB 4AENB 4M7JL 5JIHA 3D0LA 4XMPL 3JXAA 4X5LA 2DQFA 4K7PY 1JFQL 1KT2A 5LBSL 4B7IA 3BOVA 3KPNB 2BSTB 3C5ZC 4S0TD 5ESVB 1ODAA 3K81A 4NO5A 6FABL 3KNBA 3L5JA 15C8L 1NC4B 3KYKH 3BZFB 5CIPA 3BZ4B 2I9LA 1K6QH 2XTLA 1AE6L 4Q6YA 5HHVL 2VZOA 2UZIH 5C92A 3WKML 1PQZA 1BBDH 1FZJB 4Y5XA 5C2BH 4KZEL 1SMOA 1EV2E 4F37F 4MB3A 4NDMB 2A9NH 2F58H 4OD1L 4OLWL 1UM5L 1U8LB 2HWZL 1AQKH 1AQDA 2AV7A 5J0BA 3T3PE 1LILA 2VL5B 1AD0A 3VWKC 3RDTA 1WBXB 5EU6B 3N85L 3B6SA 1SYSB 3P4OA 5I1EL 4NUJA 3P40A 4P46B 3BYTA 5I9QC 1XAUA 4APQA 1I1CA 2NXZD 2BNUA 3WDJA 4MMZC 5AD0A 2HVKB 1IFHH 3ARBD 4YXLH 5HYQB 4X4YB 1YQ2A 3HN3A 1DQJA 4AIXA 2P8LA 2CDEA 2DD8L 3ZE1F 3C09C 2IH1A 4RZCB 1UM4H 1MHHB 3ZE2F 5I66B 3V7AE 4HF5L 1XR9A 2ICCA 2Y5TA 1KN2H 5B38G 3PWPE 4QXTA 3ZHDA 2VN7A 1KB5A 5INCB 3RY6A 3C2SA 3G04A 3ZL4H 3FJTA 5EFIA 4P5KB 3GK8L 1D5IH 4JDZB 3S96A 1NAMB 1MOEA 2R15A 4OGYH 5DD0L 5EUOA 1PYWA 2FATH 1MUJB 3G08A 4HAFA 5IWLA 1MJUL 4QRQA 5FXCH 2Q3AA 1JMXA 4ZUUB 3CFBB 3IXTA 2VR4A 4QNPE 3IETB 2IPKA 4YAQA 5J1AA 5JMRA 4YJZL 4ODUB 4NQDD 3P77A 3S36H 4U1NB 1AGBB 3IGAB 3TBVB 3BRDA 5I6XB 1KTLA 3KYKL 1BFSA 2QL1A 2XQBH 3BMWA 2XNAB 1I8MA 4JVWA 2UZIL 5E7BA 4JAMB 5C08B 1RIVH 3B2UD 4OZGF 1K3IA 1AC0A 2GSGA 3OXRA 2NXYC 5JW5A 4BFGA 1DN2A 2A9NL 2EZ0C 5DD3L 2P5WD 1WFUA 3DUUA 5IBLC 1IQWH 5I8OH 4N9GA 3FO9B 3S3SA 1U8MA 5L0QC 2ESVA 4H0IA 2H1PH 4LCWD 4J3VA 1Q94A 3E6FA 3MXVL 1RUMH 5TGBB 4HKZB 2AJZA 3TO2A 1A6PA 5BVJA 1QO3B 1IFHL 4GAYB 1HSAA 4P9MH 2R0ZH 4HX1B 4YHYC 2OCFD 3G6JE 2E9BA 5CD5D 2BDNH 3L3DB 1AP2A 4JE4B 3ARGD 3X11B 4NIKB 4X9IA 1ZHLB 1NEZG 2Z8WC 1KF9B 3PDDA 2DIJA 3VXRB 3EFFB 5EZJA 5SWZD 3ZL4L 4PRBB 3KS0H 3U79A 2YA2A 2Z91B 3LEVH 1GGUA 1T7YA 3GMLB 2YBRB 1D5IL 1A3RH 2NW2B 4PTUA 5I8CA 2ERJC 4OUOA 5CMAB 5ESQA 4ELMB 4MVBA 4C83B 5L2JB 3ARTA 1FYTB 1I1RA 2FATL 2O5XH 1FBIH 2VLJA 1OGAA 4U1IB 2WINA 2RCSH 4PJ8C 4FXGA 1F42A 1JJUA 4PJ9B 1YEDB 3RNKA 4M03A 2BSSB 5T1KD 2R0KH 4JPWL 4AL8H 2IADB 4JN2A 4U7SA 4N0CC 4NQUA 3TIDA 4HWBA 5ERWA 4PJCA 3RZCA 1BLNA 5GRVL 2XQBL 4ZS7H 3QH3B 3UYOD 1CIDA 4BYHA 4UT7L 5CGMA 1FNAA 5KSBB 3MUY1 1HDMB 4NWUL 2ORBH 5KVDH 1G7QB 4MX7A 3UAJD 2NY4C 5CZXD 4AEFA 1HIMH 4Z0BH 1IQWL 4KQ3L 5I8OL 2XZCH 5HHMD 3HC3H 3ZDYF 5IM7A 2V7NA 1DL7H 2UVFA 5E2VH 1JK8A 1UFUA 4UTBL 4I3SL 2IQ9H 3O3EB 5C1MB 1FZKB 3M17B 3D39B 3ARSA 4GKNB 5FGBC 1QSEA 2Y5EA 1TJGL 4WWID 4LP5A 1FN4A 4G6ML 3DX7A 5IFJB 2JK5A 3RVVC 1LO4H 3SCMC 3QDGE 5TDPA 2VIRA 3DUHA 2C3WA 3HA0A 3MGTA 4P9ML 2R0ZL 1UEYA 3PDGA 1OAZH 1DBBH 2R8SL 1UCTA 3T77B 4QO1A 1IEHA 1GGBH 1KIQA 1P4LB 2CDGA 3BXNB 2PKDA 1EXUA 3MLXH 1BBJA 3HZVB 3I02B 4M4PA 4MQXC 2EYRB 1RU9H 2IAND 2PF6A 3C9NA 3SE3A 4KHTH 4WUUA 2YPKB 3LV3B 3AM8C 4ZO7A 5EN2A 4UMGA 3A0OA 1OHQA 5DRNA 3ZSSA 3LEVL 3LD8B 5KS9B 4DOHB 2JB5H 4WFFD 4YXKL 4LHUA 3DTXA 2NTFA 2ZOKB 3MBEC 3PWVB 3QDJD 4OV5A 2O5XL 4PD4K 1AJ7H 3WL9A 5ISZE 1FBIL 1BGXL 4E41B 1XCQB 4PRPA 2WP3O 4KKLD 4C56A 5FHBH 5HGHA 4CVZB 1NCTA 4X6CE 2R0KL 1WTLA 5DO2D 3D0LB 5IQ7H 2PYEA 2BRRL 4N90D 3G5VA 3FFDB 1RY7B 3MODH 4NN7C 3RGHA 5DQDH 4M93B 2PN5A 4PJXE 3LRGA 1GHFH 3C2AH 4M9OA 4NO5B 3KNBB 3SOBH 1OQXA 2I9LB 2Z31D 3KPMB 5J6GA 5DMKA 1A47A 5KAQG 4HFUH 2AV1A 2VC2H 3QCTL 2HT4C 1G9MH 3IRZA 3P9WB 3QDHA 1QFWH 4OZ4B 3QUYB 4XVUC 5DMIL 4UINH 5SWQB 1OF2B 3VFPB 1F4XL 1EH9A 4YPJA 1DL7L 4F7EA 2JJTA 3IFOA 5E2VL 1ZAGA 3EJYC 3PV6B 1SM3H 2VISA 3D69A 4XHJD 2MQ3A 1HQ4B 4YGVA 2K3TA 3RDTB 2I07B 3T0EC 4K8RH 5DMGC 1MCOH 2XKUA 4A2LA 5I73B 4I0PA 2P42B 1U3HC 35C8L 5AD0B 1OAZL 1GGBL 1M6OB 3MJ9A 1WQVT 1FL5B 5EBWA 1Q1JH 2P8LB 4IRSA 3QPQC 3RVUC 1KJMB 3F7QA 1RU9L 2FX7L 1KTKE 3LSOA 4FXLA 1XR9B 4KV5E 4KHTL 1J1XH 4ODBD 1VFAB 1NGWB 2GJ6A 2IEPA 4QXTB 4XPAL 4HZAA 1KB5B 4QRPE 4U49A 4UBDD 32C2B 3OAZH 1KCVL 5TE6H 3QQ9D 3OGCA 3G04B 2JB5L 5JW4N 5IVNA 4MLSA 1F90H 5EFIB 2DOCA 5D1ZD 4WWKD 4OTXL 3V0WH 2OSLB 3EO1B 2G5BA 1PAMA 1E4KC 3VXPA 3FO2A 4QRQB 3T0BA 4YBLC 1G9NH 5IQ7L 2IPKB 4LAJH 3GSWB 4JZJA 3UTSB 3GSXA 4UNVA 1SBBA 3CX5J 3BDYH 3TBYB 5ANME 3H7BA 2NY3B 1FE8L 3ZKMD 3WMSA 4G7YH 6CGTA 3RUGE 1V3LA 2VR9A 3SOBL 4NFCA 2NY5H 5DHVH 4HFUL 4PRID 2MOVA 2X4SB 5FM8A 3ARQA 1G9ML 4F3FA 2ZSWA 2NX5E 1C5CH 1A6AA 2GSGB 1KPUB 3AU1B 5C3TA 3TLRA 1YNLH 1TZGH 4PRDB 4KROC 1Y6KR 5DFVD 4XCNA 4LGPB 4N9GB 4FQXC 4WTXA 5EC2A 1RVFL 4IJ3C 4PV9A 4YFLI 3DV4A 2AJ3A 5HGGS 2OLDA 3ZMRA 3TVMC 3H3KA 3FMGH 3QXAA 3WD5H 2PXYA 3SE9L 1KLUA 1Q94B 2BOCB 5D7IB 3MLUL 3JBG7 4X6DF 4ZFZA 3WKNA 3SKNA 4X4XB 4X7DC 1KCLA 2AJZB 2XY1A 4XNMA 2XZAL 3IDUA 1HSAB 5HHXL 1Q1JL 3NPZB 4OF5A 5IVZA 5BJTA 1YEJL 5DT1H 4NO0A 3I3EA 5C0AA 3NGBC 4EKXA 1TJIH 1JHKH 5D1XA 3O4OB 4MA1B 2HT2C 3ZYIA 5TE6L 3VDCA 3LKQA 5I17B 1IAMA 4RBPK 4CN6A 2WBKA 2P5EB 1I7TB 4JQVC 4PRHE 1F90L 3NFSH 4X80L 4ZTPH 3SGDI 3V0WL 4O2EA 4YNYA 3E6HB 5I8CB 3T0EE 5I2IA 5ESQB 4CBPA 4XCCH 3T0XA 4GQPH 2CSPA 2VLJB 1OGAB 2WINB 4FXGB 1G7JA 3RNKB 2AJXH 4HUWB 4G9FD 4AK1A 1CDUA 1ZVSA 4G7YL 4I48A 5IFHL 5DK3A 4PJCB 4NC1C 3FHQA 3RZCB 1MY5A 4AEEA 1EO8H 1LMKA 4KDWA 1BLNB 3P30L 2IGFH 3MRFB 1NGZA 3SDYH 2VAJA 4XNQA 1X5AA 1VKXA 1BFOA 1L7IH 3BT2H 1FO0A 1ADQH 4XVJH 1C5CL 2B5IC 4XP6H 4WW1A 3GHEH 1YNLL 1TZGL 5KN5A 4BJLA 4JEGB 4Z7VF 3GO1H 5JPMB 3CIQA 1A1NB 5E2UL 2IBZY 5IM7B 4Z7UF 1PG7W 4MQTB 4YE4H 1J0IA 3L3JA 3AFLA 3ARVA 1U9KA 3WD5L 3VXQA 5IV2A 3O45A 4NO2B 3S5LG 2DMCA 4IRZL 1IE5A 3DX7B 4KRPB 3SDXB 5GHWH 5TDPB 1T5XA 2MQCA 3MGTB 5FYJH 1AR1C 4XB7A 5DJYB 1ZHNA 4FS0A 4D3CH 3S3PA 4OFYA 3DO7A 2CDGB 2E8ZA 5FKAB 3BFOA 3RP1A 1VA9A 4LLYA 1N5YH 4JZNB 1T80A 2H45A 5MEOA 3RNQB 1VFBB 3VD9A 3C9NB 4WUUB 3GB7A 3B5GA 4HLJA 1WFTA 1KCGC 1CFNA 3NFSL 2FHCA 1IAIM 2R9HD 3VFRA 3ZKQD 5SX5H 4U1GC 2GK2A 2CK2A 4ZOCA 5I1LB 3O6FD 2J8UF 4Y16D 5MENA 4JHWH 1ZS8B 4XCCL 3RTQA 2Z35A 3G5XB 5DVKA 5I1DA 2XIDA 3WL9B 3P0VH 3FQTA 3BQUB 4FQHA 4HS3A 4TSCL 4C56B 1ZKAA 2P1YA 4GRWH 4ZS6D 5HGHB 2IMMA 1NCAH 3MCKA 3UTZA 1ZXQA 2PYEB 3G5VB 4MJ6B 3FZUC 4UIKH 4HIEA 2X4PA 4MNQA 3CXHJ 1R0AH 3QUXB 2I9TA 4TULL 1EO8L 5C0DA 4YBHA 1NKRA 4PIRF 3SDYL 1A6UH 1I75A 4EJ1C 1L7IL 1GGYA 1IMHC 2XY2A 5J6GB 1H9VA 3I75A 1ADQL 5DMKB 4OLXL 4XP6L 3WXWH 3VXMA 2AV1B 1WAAA 1C5DA 2HFGH 5I0DA 4RIRA 4H8WL 4NPYA 3GO1L 5HGDA 2RHEA 5T3ZD 3UTTD 4YZFE 1MJ7H 1HOCA 4RFEA 4YE4L 4F7EB 2UZXB 3IFOB 1DSFH 1JHLL 1U0QA 1TTFA 4U1KA 3GSRA 2VISB 4YDVB 4YGVB 2BVYA 4Y1AE 5GHWL 1H3VA 2GITA 1NMCB 1L6ZA 1C1EH 4GT7A 1E4WH 2EDEA 1N6UA 2QQNH 5E2WH 5FYJL 2E27L 3WFHA 5CGTA 1E6JH 1BM3L 1I85A 4EI5A 4D3CL 2R1WB 3TJEH 5EBWB 1MCWW 1T0PB 1YEGH 1N5YL 1W0YT 3V4UH 4N0UB 3GEWB 4U6YB 2V2XA 3LSOB 2VSDA 2X44D 3F7RA 1RIHH 2NZ9D 2GJ6B 3PE9A 3D3VB 5IBTL 3TBWA 2IPTH 1QSFD 1Z3GL 5C09D 1J8HE 3S35L 1AO7A 3CC5B 3JV4A 4NQEE 1WZKA 3QG6A 5AZ2L 3MRCB 2XZZA 2OM5A 1KJ2L 1YPZE 3PGDB 3PWPA 4XI5C 4XPTH 3REVA 1ACZA 1LWRA 5FUOH 3FO2B 1W0WA 1P4IH 3QI9A 2HMIC 2KQMA 3H0TA 3NIGE 2BY2A 2UYLA 4UIKL 3PQYB 3Q5OA 3RGVC 1RZIB 5DGRA 1JGDA 5D1QA 1ZK9A 1DQQA 3DXAD 1YEEL 5IB2A 1A6UL 4BK5A 2EEBA 2A74B 4WEMB 2EIEA 4XP4L 2VDNH 4HJJL 4GO6B 4NM8H 3WXWL 3QZWA 4F7CB 5DJ8B 1BZQK 2HFGL 2EYSA 4OM1H 1I1AD 2D7NA 4F3FB 2DMBA 1TTGA 2BSRA 1A6AB 1PBYA 1J1OH 2AK4B 2NY6D 3T2NH 2DI7A 2Q7YB 1MJ7L 4PJGF 1KPRA 4OFDA 3H2WA 1DSFL 3HE7B 5EC2B 2ZCKL 1F6LL 4PV9B 3FRUA 4WW2A 3WDHA 2YZ1A 4GW1B 3TWCH 3QXAB 2PXYB 1KLUB 4APQD 2IG2L 4YDJA 3SKNB 1C1EL 1YY9D 2BX5A 1E4WL 1QZ1A 4XNMB 2NR6D 2QQNL 5E2WL 1OTSC 3QHZL 5CINL 1E6JL 4Y2DC 1A9BA 2B20A 5JHDD 3TJEL 2MMXA 3NAAH 2ZUVA 4GBXC 1JZ6A 5J13B 4PJ7E 5IVZB 4JO2H 1BAFL 3V4UL 3WO4C 2D7QA 5HI3C 3RL2A 1I3RB 2Y4SA 2XV6B 2H9GA 4M8QA 5DVOA 5I16A 3C5ZA 3O2DA 1Q9LB 1WFNA 1RIHL 3MOBL 2VAAA 5D1XB 3O4LA 2XQYG 5AG8A 4KH2A 1DN0A 2DLIA 2E7MA 4KFZC 3G6JA 4OGXL 4LF3A 4P2RA 4WGWB 1RK1A 5KSUA 4O2EB 5I8EA 4GKSA 3FN9A 4QOKA 4PTTA 2W60B 4FQQA 1CFQA 4OF8A 1A1OA 1EAJA 1NAML 2FYYA 3LEYL 4I1NB 4XPTL 2ZG1A 3FB7A 2ENSA 1AXIB 3MPCA 5HJ3B 1FP5A 4NOBA 1G7JB 3SGEH 5KZCB 5JQHC 1FGNL 3R4DA 3BWUC 2EE6A 4WGVB 4NJAL 4UI2A 3OAYH 1IEAA 3QQNA 2R1YA 2FJHB 4OF3A 5B38B 5IMKA 3NTCH 4RFOH 2VDNL 1CXKA 3HB3D 4NM8L 1TITA 1VKXB 4MHHG 1P84K 3T09A 4OM1L 1FO0B 2EDYA 1XIWD 4FZ8L 1GH7A 4WW1B 4LEOA 4NQVB 2DLFH 1J1OL 2VH5L 3T2NL 4RDQF 5JPNB 1MF2H 2D7TH 2BVTA 1YEHH 2ESVD 5J6HA 2IFGA 1Q9OA 3LEXA 4X6BA 1CBVL 3MRIA 1VEPA 3TWCL 3MACL 2FSEA 4JDVA 1BECA 1FFOA 1MVUA 2UWEB 5IV2B 5JOFA 2ZZUT 2AXFB 3BEWA 4DW2H 5IR1B 5MEPA 5DFTA 4U7MA 3L7EB 3QO1A 1FL6B 2J8HA 2ATKA 1IT9H 2NY2D 4OZIF 5IIEB 4ZFOA 1T5XB 3NAAL 3NMEA 2MHAA 1WEJH 4EXKA 4JO2L 2KZ1B 2W65A 4JY6A 4LLYB 1NBYA 3RBGA 1A7QL 2DWDB 3QDGA 1EO5A 2R39A 3ARDB 4F7TA 4OCYH 1BREA 1F3JA 3PWUA 3TO4B 1SBSH 4DJMA 1SJXA 4AJ0A 4QGTA 1CFNB 2HFFA 5F6IB 3WLWD 4MA8H 4MVBD 4CNIB 3MR9B 5LGKA 3QFJD 2BY1A 3UDWC 3SDDD 3OSKA 3O11A 5MENB 3LQAC 2XI9A 2BHUA 3RTQB 5B21A 4R3SB 5MHSD 1T66D 4PJEA 5I1DB 5F9JA 1NCWL 4Y5YC 3FQTB 2WMPA 4HS3B 3TPUE 1IGYA 1X5XA 2FD6H 3STLA 3MCKB 3QEHA 2CD0A 3MV7A 5I1AA 1FSKC 3TH3T 5D7JD 5C0DB 3NTCL 1HN1A 1NEZB 3ZE1E 4LIQH 1BD2A 3P0YH 2ADGB 1JPGA 3S36X 4X6CA 5KBNC 3ZE2E 1UC6A 2AERT 3I75B 3L9RA 3VXMB 5FGRA 1PZ5A 2MWCA 1IM9D 2J2ZA 3DUSB 4RIRB 2BVQA 1MF2L 2D7TL 2XOTA 4W4NA 1YEHL 2KBGA 3HC4H 5FUZH 3DIFA 1J8KA 4W4OC 3CFEA 5CD3A 3C60C 1QSED 2EDFA 1IAOA 4U1KB 2VB5A 3QCVH 2JJVA 3QUKA 4I18C 4B50A 3KYOA 3QWRA 4DW2L 1RUKL 2F53E 3L5WB 5B8CA 4PJIE 5E5UB 1S7RA 4OF7A 2D0HA 4BKLB 1CE1L 3BMVA 4LDEB 3X12B 5D6DC 3HTLX 5EIIA 5JDJA 1I7RA 1WEJL 5CEZH 2QR0A 4M8VA 1D9KB 1AXSA 1L4IA 1Z5LA 4WFEE 2C1PA 2AI0H 1VENA 1TIUA 1OAKH 1NBZB 4LASL 3HPJB 1GIGL 4OCYL 1WCQA 4OZGE 5E1AB 5I1JL 4IM8A 5DRWA 3WN5B 4AM0B 3NZHL 3OKEA 4FQ2H 2JTDA 3HCVA 4LHUD 2J8OA 2L4OA 5DRZA 4M00A 1V7ML 4F2MA 1SQ2N 2FWOA 3JV4B 3GMOA 3KYNB 3QG6B 4PJFF 4GOSA 4Z7WF 5TH2A 3CCHA 3PWPB 2OK0L 4G9DB 3T0DA 2DYPB 1SEQL 4G7VH 5F1OB 5JOPD 1W0WB 1R5VA 4NN5B 5FGBA 3QI9B 3H0TB 4R0LC 1IBGH 4LLQA 2VZSA 3EOYG 5IB1A 5D1QB 3V5DB 3SCMA 1NFDF 3EKCA 3KPSA 2RFXA 5DXWA 5IB2B 4DKFL 4X99B 4LIQL 4MAYC 3NFNA 3P0YL 4HC1A 4HIIA 3IFNH 2A6KA 4ELKB 4OKVB 1CICC 1U6AH 5I1IH 2EYSB 2X9YA 4Y4FB 5ANMA 2P7TA 3QULB 3HC4L 1GZPA 5FUZL 2HKHH 4Q0XL 1CE6A 2ICES 4YWGL 1MH5A 1RZGB 4PGBA 5DURD 1KPRB 1QRNE 4LPYA 4OV6F 3U0WH 2AQ1A 5D2LA 2XTJE 1F11B 3QCVL 1S7VA 4XCFH 1JGEA 3AROA 3ILQD 1KNOA 5BV7C 3UMTA 1T7VA 1XZ0A 3BP6B 1JWUB 4TRPH 4I0PD 5HHPB 1C12B 5CAYB 1MWAA 5IGXL 1TNMA 4Y19E 3VRIA 1QSZA 3VGEA 3QDME 2EC8A 5CEZL 3TZVB 1A9BB 4IRSD 4FQ1H 2RGSA 4LLUA 1RUAH 2PO6C 1ZLWK 3V79C 2AI0L 5A2LH 2W9EL 4X5WA 1OAKL 1I3GL 2H9GB 3CPLA 3C5ZB 3DX9B 4M8QB 5H37G 4GH7B 4RQQA 2VAAB 3PHQA 4DVBB 1N7ML 2BRQA 3HAEH 3O4LB 3WEXA 2EIDA 2EXWC 5JXEC 1HI6B 2ITDA 1RUQL 1KB5L 4JFXB 3G6JB 2QEJA 3TT1H 4LF3B 1A6WH 1W72B 1R5WA 3PWJA 2X42A 3LIZH 2X4NB 4H25B 2XN9D 1RK1B 5KSUB 4QOKB 4MB4A 4PTTB 3ZDYE 5F1IA 4ZFFB 4WIQA 3QT2A 4ZPTA 2DS4A 3RHWF 3MV9D 2FYYB 4PYGA 4GG6A 1GC1C 3BGFB 4G7VL 5D93C 5T3XH 5JDSB 1TNNA 3F5WB 3OKNA 3F58H 3VWKB 1R3LA 4OIAA 4ZAKC 1HHHA 1IBGL 3IT8D 1T7XA 3QSKB 5I9QB 1NH6A 5KW9L 3RU8L 3VFNA 4JR9H 1E0OB 1U3HA 4LQ1A 4MXQC 3EHBD 1KACB 4XMKL 5FYKH 9CGTA 5IMKB 3U0PB 1U6AL 3C09B 2CUHA 2D9QB 3W11D 3KXFA 1UENA 3VFGH 2WBJA 2W9LA 4LEOB 3RVWC 4MSWA 1QBMH 4NYLA 5J6HB 3LEXB 3C5JA 1CFVH 4XCFL 1HH9B 5T1LB 4LRIC 1WWBX 3V5KB 1FFOB 2R23A 4ODXB 2HKFH 4TRPL 3QQ3B 5JOFB 2HLFD 3GMPA 2D0FA 5MEPB 3VD3A 2FX8H 4D0BA 2VLRE 3QO1B 4LARH 3IDIA 2ATKB 2EDKA 3LQZB 4TYUA 4FQ1L 3TCLA 4NO0D 4XXCC 2EIBA 1K8IB 4ZFOB 4Q9QL 2MHAB 2XKSA 3HNVL 3Q1SL 5C0AD 1UCBH 5F97E 1JPTH 1MLBA 4XX1G 1RJYB 2D4FA 4IOIB 3UTQB 2W65B 2X4OA 4F33B 2HP4A 3QA3B 1NBYB 2PTVA 3QDGB 3JZ7A 4IDJL 1U8KB 4P57A 5KVGL 4KI1A 4UB0H 1F3JB 3PWUB 3TT1L 1Z2KA 1A6WL 2DQIL 2VLLA 4K8RD 2HFFB 2NXYB 5BS0A 4S1SL 2W07A 4HJ0C 1TENA 3BKMH 4K9EL 3H9SA 3FFCD 4KMLB 4HH8A 4FQXA 3EYVA 4GG8A 3VDAA 3PNWB 5T3XL 5L0QB 5F9JB 4MNGA 3F58L 4HK3J 1IGYB 3VA6A 3SGKA 2Z92A 4HGWA 2MQ0A 3IDGA 1OTUD 2ATPB 4EBQH 3V6FA 1UB5A 3ZDZF 3KPRE 4U3CA 4JR9L 1Q9KA 1HHJA 4HKJB 5I1AB 4HWBL 1XR8B 5ISZB 4G6AD 1D5ZB 3KPQA 4JO1H 3O2VH 3HLAA 4YHYB 1NBVH 1JPGB 4X6CB 4ZNEE 4XP1H 1T7WA 3R8BB 5F1KC 2NYYD 1MHPH 1X9QA 1FL3A 3D5OF 4OB5L 2DM2A 3GSNH 3QWQB 3H7LA 4Z9KB 2BVQB 3B3IA 4PJXB 2K9UA 4NCC2 1CFVL 3DIFB 2WNGA 1S5HA 3BP7A 4KQ4H 4JQVA 5CD3B 1VPOH 1KPVB 4NKDB 1QSVA 2ERJB 3K4DA 4FZEL 3KYOB 3L5XH 1AGEB 2FX8L 2NXZC 4HPYL 4KC3B 2ILLA 1TFHA 5FM4A 4OQTA 2OZ4H 4PJ8B 4F15C 4XC3H 3IAGC 2ZUWA 5EIIB 1I7RB 2Y23A 5IEHA 4J1UB 5GS1A 1UCBL 1P2CA 1MJ8H 2QR0B 5T1MB 1Z5LB 1AXSB 2NQCA 5EUOF 4P23A 5EH1A 4QCIA 4M6OH 5GRWA 4QWWD 2GTWA 3KPLA 1VFOA 2V17L 4TVPE 2OYPA 1ED3B 4UB0L 5K33A 4OI8A 1S9WA 2VMFA 4HKXB 5MERB 5DRWB 4M5YH 4DTGH 3OKEB 3TYFB 2F54E 3HCVB 3HG1E 3MLZL 3BKML 1MFEH 4PGZA 1ZA3A 2CLZB 3GMOB 3S5LB 3HI5H 1GRWA 1WWAX 3LN5B 2BNRA 3MYZA 1FNSH 3CCHB 3RI5K 1UWEH 4QHLB 2CRYA 3UX9B 4X6DE 1G7MA 1TCRA 2MKWA 1R5VB 4MNQD 4EBQL 5E4EC 1XF3A 4RGOL 1OGTA 4WVRA 3VXSA 3ROLA 4PLKD 5BRZE 3SCMB 2LQRA 4JO1L 4NHCH 3O2VL 2XZQL 5DSCA 1NBVL 1URLA 1UEMA 2VITB 3B2UC 1A1MA 4PJ5D 3QUZB 4XP1L 4HIIB 5LAXA 3WFBH 1WJ3A 1O5DT 5E56A 5BMFH 1NSNH 1EGJA 1MHPL 1A3LH 1CN4A 3N1PC 2HJLA 5ANMB 5E24E 2P7TB 4R9HA 2DQEH 3G9AB 3TIEA 1DVFA 1GZPB 3OGOE 3RUGB 1CE6B 3U6RA 4CDGC 2G9HA 3RWHA 1YNKH 2FHFA 1VPOL 4JCMA 3WNNA 5JIKA 2FJFA 1A64A 1ZGLM 1JGEB 1DQDH 5DUML 3GI9H 3L5XL 5ESAA 4N1EA 3CZJA 3MBEB 1CFTA 4X8XA 3U36A 3WFZA 1MWAB 4S1QL 2OZ4L 4DGIL 5KVMC 4XC3L 3VRIB 2M26A 4FFYL 1T6WA 3T1FA 5E70A 5CD5C 1UADC 5JW3H 3IDYC 1T0MA 3C8KB 5KANI 1NC2B 3MRGA 3MJ9L 3ARGC 4NN7B 5E9DE 3SKUD 4OIIH 3DROB 3S34H 1JRHH 4X5WB 4M6OL 5E5MB 3OBAA 3ECBB 3QJHA 1Q0YL 5IVXF 1VADB 5D7LA 1NLDH 4RQQB 3MMEA 5K93A 1FRGH 1XFPA 3QNXA 4JQIH 1GOHA 2R0WL 4M5YL 1JWSA 1PG7L 4GMTL 1MFEL 1R5WB 4Z7VE 4PJAF 3AREA 1U36A 1HXMA 4N5UA 3PL6C 2AW2A 5GGTA 5F1IB 4Z7UE 3SKJH 3RVXC 3SE8H 1FNSL 3BESR 1O0VA 5HPMA 3ZTNL 3HS0B 4YQXH 4H0HB 4UT6H 2DAVA 3MGOA 4MNHA 3OR6A 1I8LC 4NT6A 1WUNT 5DD5L 4PRHB 1NFKA 3GKZA 4AQOA 5E4IA 1HHHB 3EOTH 1A7OH 3T0EB 2AEPH 4NHCL 2BFVH 2DQGH 2YWYA 2AXHA 2AKRA 5EOQH 3QEGL 3LKPA 4NNXA 2V5TA 4R97C 5BMFL 1Z9OA 1NSNL 1U2HA 5HGBB 3UAJC 1U8JA 4XP9H 2H26A 4OCLC 5CZXC 1JZ5A 3N9GH 2DQEL 4MSWB 3H3PH 1MREH 1BZ7A 4M7KH 4JFFD 2HYMA 1MIMH 2DQJH 2FECL 2OXHA 4EVNA 1DQDL 2VXVH 4QRRD 2X09A 4P2OD 5ITFB 3GI9L 4NSKA 1CK0H 1N59B 1M7IA 2R23B 3FB8B 2Z4QB 5GRYA 3MRKA 4UILH 4HG4J 5C0CA 2ZP0T 2KH2B 3D2UB 4LCUA 2BY0A 3BRFA 3L7FB 1PFCA 3O6KL 5JW3L 1L0XA 4YBLB 5EBMA 5JQ6L 4POZD 3AB0C 1P7KA 3BDBA 2IH3A 3P9MB 2EH7L 4OIIL 3S34L 5ICZA 1J12A 1U92A 2P5WE 3MLYL 1JRHL 3PXJA 1AR2A 3B8SA 3MBXH 4WENB 5FF6B 3JWDC 2X4OB 2H32B 4H26B 2V5YA 3BD4A 3NPSC 4FFVD 3ORJA 1OAQH 1FRGL 1VGKA 4TN9A 5BOPA 1ZHBB 4JQIL 4P2RD 2A6IA 3NCMA 4P57B 4KY1H 3QP3A 4L4VA 5FHAL 5KSAD 2IC2A 2VLLB 3CDGA 5H35B 3U0TA 4MAUH 4M6NL 4KROB 5DJAA 3H9SB 1FNGB 3F7VA 4Z5RA 4KKLC 1UH4A 1QEWA 4YQXL 1V7NH 4UT6L 1TETH 2DKUA 1J7VR 5DO2C 1XGUB 4K7FA 3TVMB 2RBLA 1OP3H 2Z92B 3VWJA 4HGWB 3X14A 5EU4B 1Y6NR 1U8NA 5FOJA 1A7OL 3HRZA 4S2SA 1UB5B 2E9WA 3WIHH 4F8TA 4KMTH 2AEPL 1M7DA 5DJ2A 2HAZA 3AAZA 2C4FU 2BFVL 1HHJB 2QHLA 2DQGL 5SWZE 4Y2DA 3JV5A 2Z31C 3PXHA 1A6TA 3KPQB 5E8NA 4GBXA 1XF4A 3HLAB 5EBGA 2CDFA 4PB9H 5IROA 3NGBB 3N9GL 1FO0L 1ZT1A 5TDOB 4CN1A 1FL3B 3MO1B 1DR9A 4JHBA 2R29H 2CMRL 5CEYB 3TF7A 4OLVL 4RAVA 1MREL 4M7KL 5ELIA 4XHJC 1QVOA 2WIMA 3BP7B 1CLOH 4JDTH 3U30C 1CK0L 1J88A 1AGDA 1ACYH 4G8GD 3D18A 3P4LA 2R4RL 3T3MF 5C0ND 1K9TA 4HHAB 4H88L 1I7UA 1CG9B 1G7PB 3RWCA 2Z9TA 1T20A 3LN4B 3ZT5A 2DL9A 5DR5H 3SO3C 3MFFB 5IESH 4X9BA 5DD1L 1RZFH 4KHXH 4ZXBA 4NJ9L 4PREA 3V0VA 3MBXL 5HHOE 5HHME 3VG9C 2F53A 2J1KA 4ONFH 5T33H 3SBWC 4QCIB 4HV8B 1OAQL 1K4DA 1DFBH 1T89C 4UBDC 5CILH 2GTWB 2Y72A 3D25A 3KPLB 3QQ9C 1PEWA 4TOYH 4Z7OF 3OAZK 4YDKH 2B5IB 2AJSH 4XC1H 5D1ZC 4WWKC 5TDNB 2XT1B 3MFGB 3MJ7A 5DDHA 3U7WH 3GUTA 1A6VH 2ED8A 4PJGE 2HG5B 2LABA 1TQCC 4NGHH 3FQUA 1CFSA 1B0GA 2UY6A 4KWUA 1G7MB 1TCRB 4ONHB 5DVNA 3MV7D 2CRZA 4D0CA 3WIHL 1XF3B 1J8HB 3ZKMC 3P11H 1X5KA 4NQEB 5I15H 3K8LA 3QIWA 4OUUA 1JN6A 2YWZA 2P44B 2Z93A 5E99L 4EUPG 1BD2D 5HYJA 4U6HB 5E8DL 3VFWA 4MLIA 4PP8C 1ZLUH 1CTNA 3UPAA 5DS8A 4WFFE 5DSCB 4KZDH 1QLEH 1A1MB 5HYIA 4JJHA 4C58B 5IMMA 5FKPA 3QDJE 3QXWA 2UY7A 5L88L 2FIKB 3A6OA 4DVRH 4WV1C 2R29L 2IFFH 5DFVC 2VDLH 4M48H 3QEQA 4OD2B 1AFVH 5EC1B 4U0RC 5FB8B 3U6RB 2E6JA 2G9HB 3RWHB 4N90E 1CLOL 4JDTL 3QWRD 4U1GB 3ULUD 4RMSA 4DUWA 5K9QG 1ACYL 3V6ZA 3FB5A 4HS8H 5A43C 5IG7A 1CFTB 1I9IH 4Y5YA 5DR5L 1UJ3C 3OJVC 1RZFL 4HGKC 4JGJA 5IB5A 1WFOA 1KCUL 1MCPL 3MRGB 1LEKB 4ONFL 5DJCB 2IBBA 5T33L 2C7UA 5DLML 4NRXA 4TUJB 1Q72H 4HJGB 5BW7C 1QQDB 5DUPH 4Q7DA 5CILL 5IP4A 3QDMA 3MMEB 1G7HB 4TOYL 1CR9L 3BO8A 4U1HA 1TQBC 3D1MC 4YDKL 3QNXB 2AJSL 2NY4D 4XC1L 3VRJA 3NIFF 2R4SH 1HILB 4PJ7B 1JWSB 5DJZA 2LFGA 4YGAB 1HXMB 3MLVH 5K59F 4NGHL 1I8IA 4RAUA 4W4OA 1IGMH 1UKQA 5HPMB 1MCBA 1H3GA 3IKCA 1FJ1A 2D03H 5ICYA 4MNHB 3ARPA 3OR6B 4I18A 4OKDA 3RVVD 3LMJH 3KPSD 3P11L 1CCZA 5ACZA 1E4XI 1NCBL 4OZIE 3BH8A 1BJMA 3VFVA 1H5BC 3EFDH 2A77L 5D7SL 2ADFH 2AKRB 5IFAL 2ZCHH 4ZUVB 1S7QA 4L29B 4KZDL 4P9HH 3IJHA 5B39A 3DMMD 1G0XA 5JIPA 3E1F1 4KPHH 4V3EB 2O5YH 3RBSA 4DEPC 4DVRL 2VXQH 1G6RH 1YUHA 1BIIA 1A0QL 4M48L 3IU3A 1LE9A 4NC2B 1AFVL 3H6JA 2L0DA 3BEVA 3QCUH 5F9DC 3WFEH 4S0UC 3OG6B 3AS3A 3HI6L 1FV1A 1UWXH 1D3CA 2V6HA 1S9YA 4CVXA 2IMNA 3C8DA 4NO3B 3L6FA 1IC5L 4HPOH 2HN7B 3ILPA 1U42A 3MRKB 5C0CB 2VDMH 4C4KT 4PRIE 2A6DA 1YJDH 4MWFA 2HH0H 4RISH 5GGVY 5C07A 3ZE0F 1WIUA 5C0EB 2EDOA 5GQBA 5EBMB 2IH3B 3RGVB 5ICZB 5IMLB 1U92B 4AEIL 5FO9A 1AI1L 4JRYD 2X05A 2KQNA 4X4MA 4LPVA 4HH9B 5LQBH 3O2DL 1AKJD 1HQRB 2CJUL 2CQVA 3SDAD 2E7HA 2R9HC 3P2TA 3W39B 4D2NA 2R4SL 4PP1D 4FQLL 4OLEA 1ZOXA 3EDDA 3O6FC 4UDTA 5F96H 4Y16C 5SX5K 3BE1L 3GMMA 3U0TB 3LS5H 4MD5A 4M1CD 1W72L 3B9EA 4TNWF 2FEEL 1D5MA 3BD5A 1T0NA 1NGXA 4FTVA 1ZE3C 4ZS6C 4GUPA 4DFIA 1XGRA 2KL6A 5FECA 1WAAF 4LFHG 4K7FB 3ZDXF 1I1YA 2X89D 1D6VL 1B4JH 3MOAH 3BW9B 1OVZA 2BVEA 4XP5H 3BVNA 1U3HD 1P7HL 1LK2B 3MUGB 4PUBH 5DJ2B 3AAZB 4FFWD 5HYSG 1BFTA 3EFDL 2ADFL 2ZCHL 2ZKHH 3VI4F 4P9HL 4G8FA 1BQUA 3ES6A 3NCBB 3W82A 2X41A 4GBXB 3TPUB 3DX8B 3KXFD 2CIKA 2WBJD 2JIXA 4XPBH 5GIRB 4LCYB 2O5YL 2PO6A 3WO4B 1EEZA 4LLMB 5EOTA 2VXQL 3PJSA 1LE5A 3KPRA 1FHGA 1X5IA 1G6RL 1ZT1B 2XWJA 1NEUA 1IZJA 1VGEH 4RAVB 5IQ9B 4C59B 5JXEA 1JWMA 3VH8G 3BSZH 4G9FE 3UTSD 3V2AR 1T4KB 4HPOL 4XBPB 4GS7C 5FA4A 1KN4H 5ID1A 4PJFE 3WE6A 1IQDA 4WDIB 4Z7WE 3D18B 4OGZA 3PP4H 3T4AA 3FN0H 2VDML 1QPXA 4UIMA 1YJDL 2DQDH 1CDGA 5DGQA 4CMMB 3DGGA 1BOGA 2BXZA 1B90A 3K4ZA 4ZFOL 3RWFA 4RDQG 4HULB 1FZMA 1NFDE 2CLRA 1KTRL 2ZUSA 3V0VB 3VGHA 5SX4I 2F53B 2ZCLL 4M61A 1TMCA 4D94A 3O0RH 1JI2A 2OTPA 4MXQA 5LQBL 3CDFA 2AGJH 2ARJB 1K4DB 4NQCA 1RULL 1YYML 4LMQI 4G8IA 5DI8A 2VTFA 2VERN 2ENYA 5BS0D 1A6ZA 4JM2C 2BVPA 4MMXC 1MAKA 3MJ7B 5C7XH 1SYVB 1S5IH 1XGTB 4QYOB 5DDHB 4YHIB 1FAKT 2CXKA 4FQXD 4Y5VA 3GUTB 1MHEA 5A2JH 3K3QA 4MCZA 1F3DJ 2QQLL 1L0YA 2OS7A 3SPVA 3CDYA 4PYHA 4UV4H 4X6FA 3NCJH 4LRIA 4OZGB 1YMMD 5H2BA 1CFSB 1LK3H 1B0GB 1R6VA 4FQIH 5I71C 4JKKA 1B4JL 3MOAL 3ARUA 1ZV5A 4M7LL 4XP5L 3VXRE 4D0CB 4JB9H 4O2CB 3TNMA 4ZYKB 1WLHA 3OJDA 1N4XL 3N0PB 4FFZL 4HK0A 1R3HA 4OUUB 1JN6B 4WW2F 3AS0A 3MRPB 3VFWB 4HIJA 1CD8A 4MDJA 5JLZA 4GRLA 1OW0C 4XPBL 4Y5XC 5DS8B 2IALA 3A67L 1NLBH 1I1AC 3E8UH 1IEBA 2GTZA 5GJSL 5IMMB 5FKPB 3IFLH 1ORQA 4QTHA 2NY6C 3QIBA 4P59H 2ICEA 2A9MH 1F58L 2H6PA 5T1DL 3ZYZA 1VGEL 1WV7T 3V8CA 1P7QA 3CSPA 2R2BB 1NJ9A 1QG3A 2NY0D 3BSZL 4PGJA 4LVNB 5JO5A 4APQC 4JLRB 3V6ZB 3X3GH 5C0BA 5CSZA 2NTSP 4XXDA 3SDCA 4MYWB 3FN0L 2ZOLB 5CZKA 3I2CH 1DCLA 1YY9C 5FYKD 4E0RA 2NR6C 1S7SA 2Q7NA 2DQDL 3HMXA 3UCRA 1RURH 3UBXA 4L3EA 2OTUB 1QRNB 2X1PA 3QYCA 1GJIA 4MDIA 3L3GB 4P23D 5IB5B 4R4FL 2R69H 1MRFH 1WITA 5L8KB 1FFQA 3O0RL 1KJVA 2C7UB 3ZO0A 5BXFA 5T3ZE 1FSKB 5L8LB 3L1OL 2AGJL 3HZYA 1BPVA 3B5HA 5HY9A 2RQ8A 4Y19B 3QDMB 1M7XA 4S1DC 3SEPA 4U1HB 3GMQB 3BUTA 3I9GL 2DQUL 4QGYA 5AEAA 3WIIL 3EYFB 1Z9SA 3MLRL 4NZJA 3VRJB 2X4UB 3ZKND 3BKCL 3MA9H 5C7XL 5DJZB 1Z6JT 5IWLC 1K85A 5TQ2L 1QBBA 4R4ND 5GSRB 4YXHH 1X5JA 3M1BA 1LDSA 2BNRD 4HXAH 3T0AA 3LOWA 4JFYA 4RGMC 4Q58C 1I8IB 4R96A 3NCJL 4M62H 4RAUB 5BQ7A 4OM0H 1OAUH 1EEQA 1LK3L 1A4JA 1NUFA 1YN7A 1PX3A 3C60B 4FQIL 3A6BH 1L9NA 1FJ1B 3UTOA 3VXSD 5ICYB 1P1ZA 4I18B 1XF1A 1I9RH 3WLBB 2BERA 3LVEA 3WIFB 3OQ3B 3BH8B 1ORSA 2R2EB 3OAYK 4N8VA 3VFVB 3HB3C 2EDXA 1BQLH 1QSFE 4GAGH 1S7QB 2WZPD 4ZSOE 3E8UL 1XIWC 1YDPA 5B39B 1EFXD 1N0LA 1P53A 2YMXH 2PW2A 3IFLL 4P59L 1DVFD 4V3DB 2YKLH 2Y36H 1KEGL 3TFKA 1BIIB 3DWTA 2OL3A 4XNUH 1LE9B 1H3PH 2DQTH 3ARFC 1YEIH 2B7DT 2BNQD 4EI6B 3BEVB 5ALCL 2FGWL 3EIFA 3GKWH 3OPZH 4PY7A 5GJTH 3F7PC 3X3GL 4HK3N 3DXAE 3MLWH 4CVXB 3O8XA 4WEBL 2NY2C 1F4AA 1MWAL 4TUKH 2A6DB 4MWFB 5EO0B 2IQAA 1U8PA 2BJML 3ZDZE 2R69L 3GJFH 2J8UA 1MPAH 3IJSB 4NQDA 4HUVB 4R0LB 5TFSH 5D7LD 4JN1H 3U48A 4PJEF 1UXSA 5FO9B 4NQSA 1HEZA 1IC1A 4MAYB 2H32H 4XPFH 4HT1H 4JFOB 1A2YB 3HUJF 3GSVB 5D6CA 1B0RB 1CICB 3MA9L 3ARED 1FG9C 3L3OB 2YPVH 1FQ9C 4UDTB 3SDDC 3VXNB 2G75A 4MD5B 4HXAL 1HNGA 5BCAA 3J7HA 2W0PA 5JHDE 1NGXB 3EBAA 3QXDA 5F71A 3MRRA 4L5FH 4LCWA 5EWIH 1J11A 3KR3L 3A6BL 2NY1D 2DTMH 1I9RL 3OAUH 1I1YB 2P45B 3X13B 4NKMA 1Y0LB 4XVSH 3BVNB 5D7JC 4LCCA 1M05B 3LKRB 5F7MC 2Q8BH 4LKCB 2NLJA 1BQLL 4GAGL 1EEYA 1Z0MA 4G8FB 2R2HA 4QT5A 1S3KH 2CIKB 2YMXL 5EUOE 1KTDA 3QNYA 2JIXB 3ULUF 2PO6B 3ROOB 5A2IH 1H3UA 4JO4H 3PJSB 2VQ1A 2YKLL 4M1DH 1LE5B 3KPRB 2QLVB 4XNUL 1HHIA 1H3PL 2DQTL 3CLEL 2V5MA 2K7QA 4ZTOH 4HBQA 3BRGC 3F8UB 2J3SA 4Z78A 2DIAA 3GKWL 3OPZL 5DUBB 5GJTL 1WK0A 3MLWL 1IKNC 5ID1B 3BKJL 3PL6A 1IQDB 1OCWH 4KUZH 3T4AB 1IRAY 2GIYA 3GI8H 2CO6B 2C26A 4G6FD 4TUKL 3IDNA 5T1KA 2C1OB 4DQOH 4Z7NF 3LKSA 4H1LA 3KPOA 4ZAKB 3CU1A 5CS7A 1FZMB 3SE3C 2CLRB 4ESKA 3GDBA 1FLTX 2ESVE 2AK4D 1RZKH 4WU5A 2HRLA 2JJWA 3MJGX 2QQQA 4XPFL 2NNAA 3FT3B 1LO5A 4HT1L 3MRDA 1NGYA 2HLAA 1BEYH 4GXUM 4NQCB 2XA8L 4G8IB 2AJVH 4L4VD 4PD4J 3L3KA 5JOEA 1RK0B 2JKXA 2MCPH 1QD0A 1K2DA 1TVHB 3L95A 2QKIB 4YHKL 1UG9A 3MRHB 1EZVX 5HHMA 1UYWL 4YO0A 1U3ZA 4I5BA 3CU7A 4EDWL 3GM0A 4J23A 4L5FL 5DQ9B 3SPVB 2V9TA 4X6FB 3VWJD 2ZPKL 4LKXA 5H2BB 3O41A 4LSSH 4HIHB 5F21B 3OAUL 3HC0B 4XVSL 2XWTB 1I9JH 2W9DH 5F7UA 1HZHH 2PW1B 2DLEA 2QADC 3HG1B 4PJGA 4L8SC 1O7VA 3OJDB 1S8DB 2Q8BL 4LRNH 4YX2H 2P43B 1CLYH 4G80A 4WJ5A 5D2LF 4OGAD 2YZ8A 2C3XA 5FK9B 2GT9A 4UT9L 1CQKA 4MDJB 1S3KL 3KJ6H 4QF1A 1NAKH 3QIUA 4XCEB 4J4PA 2EE2A 4X6DB 3UJTH 2IANA 2Y7QB 5CZVL 2D9CA 2GTZB 3H42H 2CKBH 1QFWM 5MHSE 4QTHB 5GZOD 1EBPA 3IXAB 3UBXI 3RPKA 2X1WL 3DX6B 2W92A 2FB4H 1LO2H 1TVBB 5GGVL 2RAMA 3ILQC 5IOPB 3QXVA 4PJAE 1INQA 5JO5B 5DK0B 5J56B 5HD8D 4I0PC 1OCWL 1K8DA 4KUZL 5GRZA 3GRWA 1LQVA 3GI8L 1AGCA 1S7SB 2VDOH 4QXGH 2YXMA 2APFA 2FH6A 4IRSC 4DAGH 2X4QB 3UBXB 4ZXBD 2YPLD 5LG1A 1H3WM 2KUTA 4RWYH 4QTIH 1U2CA 2P48B 4GKOA 4H5SA 4I2XE 1V8HA 4PJHA 4QRSA 3VGGA 4GG6F 3QO0A 1KJVB 3D0VA 2I25N 4NNPL 4OBRA 2Z31A 1QSEE 4OT1H 5HHQB 1HINL 5C0IB 2VKXA 2MCPL 4UQ2B 1CGTA 1N5AA 3V8OA 4EDXB 1F4WH 4RA0C 2B39A 4JFYB 4P49A 4JZJC 3GBNL 1N2RA 4R96B 4KU1A 5D96C 4B53A 1CL7H 4LSSL 1YN7B 3MZGB 5EU5A 5T5FH 1RHHA 3GHBH 5MP6L 3IU4H 4WUUE 1YNTB 1P1ZB 2W9DL 3QIWD 1HH6B 4LPWA 2NXZB 3X3FH 5HYJD 4L8DA 1MCQA 1J5OH 2HJFB 3EHBC 3ARBB 4Z7UB 2VABA 4N8VB 2VR5A 4F15B 3K74B 2YK1H 3IB4A 2AXGB 3ARWA 3W0WA 1NAKL 5HDQL 3OTTA 3MRJB 3UJTL 2C9AA 3W11C 3GJEB 3K7UA 4PRPE 2EDWA 1IGJA 2FO4B 2PW2B 3QEQD 2APXA 4NBXB 4YHOH 1B0WA 5GSVA 2NMSA 3V6OA 3WNKA 5ETUB 4UUJA 2E5EA 4NHUA 2PYEE 5A40E 5JOPE 1NPUA 2AEQL 2FB4L 4ZOEA 1LO2L 2VDKH 4LSPL 5GGRA 3QG7H 1EUTA 3LKOB 5D1ZA 5BO1H 4OI7A 4WWKA 4JKMA 4JO3L 5JMOC 2HLFC 3OXSB 4A6YA 4JG0H 5I1HH 3DVNA 4I8DA 1G9MC 4RWYL 2DRUA 4QTIL 1U8PB 1RPQA 5IHLB 1Q8MA 4FMKA 5IW3A 5E4EB 2J8UB 5IHBA 3GM8A 4NQDB 5DC0A 1VFUA 2BMKB 3DV6B 2M8XA 4F7PA 2NW3A 5TE4L 4F58L 2QHRH 1OP9A 1IAIH 1MLCB 4OT1L 1FGVH 1KYOK 4PRIA 1RZ8B 2N7BA 4CDHA 3STBA 2C3VB 4K8RC 2R0LL 4LSVH 5D6CB 3T4YA 2ZSVB 3S88H 2QJDA 4RGND 5DK2A 5F72S 4AIOA 1RJCA 4WV1A 2P5WB 3QNZA 2D31A 1F4WL 2G75B 2EIZA 3K46A 5E8EB 3DI3B 4RRPA 1KBGH 3N1QC 3JTTB 3QXDB 3QFDA 3VW3L 2DM3A 3JSSA 3MRRB 5T5FL 4OZFA 3GHBL 5AZEH 1S7UA 1WIPA 3IU4L 1OTUC 1Q9WA 3D6GA 2GJ6E 3T3ME 1M71A 4ONGH 4J8RB 1QR1B 4NKMB 3ULVH 3BIBX 3VXTB 1J5OL 4NQXA 4ZD3H 4P99A 3O6MH 1UJ3A 4G6AC 2VDQL 1XH3B 2YK1L 4LVOB 4X98B 3CXHK 2XYCA 2DI8A 2C4FT 3WNPA 4H20L 4Z6AT 1LD9B 3IDYB 5H37H 1ZSDA 2XN9E 3O3DA 2APBA 2HT3D 1DQMH 2NYYC 3ARGB 5CJQL 2AABL 1KCSL 1G0YR 5BW7A 1G9NC 1IGCH 5SWZB 4Z95L 3VFOA 1J05A 3KDMA 1JPFB 1E4XL 1RI8A 5BO1L 5F3HA 1B2WH 5C70A 4NRZB 2W38A 1KIPB 2NY5C 3RFZC 4JG0L 3GIVB 2F74B 1IAKB 5F7HA 4K3GA 5C07D 3MJ8B 4JANA 4M3KB 1MNUH 3IDNB 3IS1X 2E7CA 5T1KB 3LKSB 3IF1A 4G9FA 1JZ4A 4PRNB 5JORB 3KPOB 2X9XA 1K4CB 1MFBH 3DBXA 3LS4H 4G6JH 3W9DA 1H5BA 4QWWC 3RX7A 1IAIL 1FGVL 2EDBA 3B4NA 3LZFH 1SY6A 5LKNA 2NNAB 4U3XA 1QTYT 1NGYB 3EDFA 4LQFL 4X7SH 4F8QA 4LSVL 4R97B 4YHNB 3NCCB 3RWGA 4G3YL 4XCYB 1QFHA 4PR5B 1F5WA 4FTVD 5HHMB 4YO0B 3T2OA 1UA6H 4BQ9A 1UKSA 2A6JA 3GMNB 1AGFA 5C0AE 4LHUG 5EPMB 4DZ8A 5I1GH 4IOFD 3O3BB 4ONGL 3R1GH 2Q86B 1ERNA 4PLKC 3RKPA 1YECH 4ZD3L 3O6ML 4PJGB 4FP8H 1JHTA 1UACH 5D9SA 4KK8D 2GT9B 3C5SA 3GIZH 4RCAA 1QBLL 5ADPH 5CEXB 3AB0B 1NMAH 1UB6B 2GY5A 4TSBH 3C6LC 1MCHA 3A6CL 1I4FB 2IANB 3EO0A 43C9A 1AXTH 1ZGLB 4J12A 3DPBA 2PNDA 3NPSB 4MXWH 3DNKA 4PGCA 2CGRH 4RNRA 4ODWB 3NIFE 4E9LA 5SWSA 4KKBD 4HXBH 4XNXH 1P6FA 1B2WL 5A3ID 3EYOA 4HCRA 2HTKD 4LAQH 3O6FA 5IVOA 2Q76A 1INQB 1YEKH 5K59E 1WSST 4PLOB 4TSAH 3QDJB 4GW5A 3JTSA 4JFQA 3CVHA 4LSQH 4ETQB 1I85C 5FCSH 1AGCB 4M7JH 4XMPH 1DBAH 2GK0A 2VDPH 4LGRB 2D0GA 5HYSB 5I30L 1SHMA 5LBSH 4KJYA 4Q9CA 3RJDA 2DBJA 4YHML 6FABH 3FT2A 5DEGA 4H5SB 5E8PA 1FVDB 3BZEA 4PBVC 3K2UH 2Z31B 3BWAA 4X7SL 2HFTA 3SQOH 5E95B 4BZ2L 1D6EA 1OLLA 2ITCA 3FT4B 2YD2A 4OLWH 4IRJD 1QLFA 3EAKA 1U93A 2HWZH 4LLWB 1R3KA 1U8OB 3UTTA 4N1CA 4JFHE 1UA6L 4PG2C 1CT8B 2BHZA 3N85H 3E3QA 4GSDH 2YXFA 1MHCA 4YIQA 5I1EH 1BQHA 5C86A 4FG6D 5EU5B 3RA7L 3U30B 1RHHB 1MSPA 1YN6A 4LSRH 4U6XA 1CGSL 2J6EA 1YECL 4DK6A 4FP8L 1PKQA 1UACL 2XRAH 5F8QC 3ZE0E 4P5TB 4GRLD 1JGVL 3GIZL 4CADA 3SO3B 4R8WL 3RIFF 1NMAL 5BVPL 1JF5A 3K2MC 4TSBL 4F7MA 3SE4A 3QIBD 1F4YH 2YSSA 1I3UA 5EUKB 4UV7H 3VG9B 1AXTL 4LK4A 1P7QD 1HWHB 4CN4A 4QY8B 1GZQA 1T1ZA 3DJ9A 4MXWL 4OZIB 5E6ZA 4L3CB 2CGRL 4UUJB 5E8OA 4NHUB 4OFPA 3Q6FB 5I1CH 2AAVA 3GMRA 4XNXL 4MNQE 2X1XR 4LAQL 5GS2D 5F89B 4P2OC 5C09A 5C0BD 4JM2A 3RQ3A 1KFAL 4UNUA 3SDCD 4WWKB 1YEKL 3Q2CA 2PUQT 5J9PA 1X5ZA 3MROA 1MJUH 4BSWA 1DANU 5E7FA 1DZBA 1TQCB 4L3ED 5ISZD 2WUCL 1J0YA 3VXME 1DBAL 2VDPL 3LQAL 1WAAE 4PJ5E 3ZDXE 4POZC 4U1MB 4HWUA 5F1NB 3WUZA 1OPGH 3DXAA 3BAEH 4BH7A 1ES0A 4Y4HA 3QUMA 4YFDB 3S37H 2EEDA 4F7PB 4FFVC 5FYJU 3VI4E 3V5HB 4ODHL 3K2UL 4EIZC 3I6KB 5EOCJ 3T2QA 4PRIB 3SQOL 1OW0A 3LCYA 1I1AA 1MAJA 5KSAC 5MEQA 3GNMH 5DD3H 3MUHL 4O5LH 3N06B 1F8TH 3RL1B 2JF1A 4WV1B 2D31B 4YC2C 2GSIA 4U0RB 4GSDL 3ZHKA 4MQSB 3MXVH 5JIIA 1EVUA 4LSRL 5A16A 1HYRC 5FFLA 4KK6D 1H15A 1OP3K 3PGCA 3D85A 2XRAL 4NQXB 4HWEL 1F2QA 3PABA 3BDXA 4GQ9L 4XB8A 5JHDA 1UJ3B 2E6QA 4TNVK 1AO7E 5GS0D 4P4KA 5F6HI 2BOBB 1F4YL 3WFCL 4OLUL 4UV7L 4V2CB 3ZKXC 5GS3A 3TFKD 2X5PA 3DRQB 3AY4C 4AIZA 4OSUL 5I1CL 4F9PC 4QRPD 1TQBB 2AQ3A 4W6XB 4KRMB 1F6AA 4ZUSA 3PP3H 1FFPB 3O8XD 1OB1A 5D5MA 3T2PA 3BP5A 4I4WA 1D5BB 5C0NC 1UM6H 2HFEA 2I5YL 2CXGA 3LHPL 4KKNA 1SMAA 4E42A 4ISVB 1C08B 3MREB 4JPWH 3IVKA 3VI3F 4I0CC 4JANB 3BHBA 3QUZD 5GISL 4YH6A 5SV4A 3TYGH 1OPGL 3IF1B 4FMFA 4G9FB 3BAEL 1PY4A 4ERSL 3S37L 5K9KA 4PJFB 3KJ4B 3WUWB 4M7ZB 1QA9A 4Z7WB 3OKOB 3KWWB 1CVRA 3L3IA 1KXQE 1H5BB 4JY4A 4UT7H 2MJWA 4JPIB 3W9DB 4G6KL 4NWUH 4QRRE 3O3UN 1XIWA 4AQ1B 3GNML 5GGQL 3RWGB 5M94B 4O5LL 2NX5D 4KQ3H 3TNNB 1F8TL 3DVGA 1A5FL 4WHTB 4DEPB 1NFDB 4HUMB 4ACPA 3ARFA 4IMKA 4UTBH 4I3SH 5CJXC 1CXIA 5CP7A 4ODSH 2A6JB 4KUCD 1TJGH 4NKOA 4U6VL 4G6MH 5AYQA 1BIHA 4KAQH 4FNLL 1FH5L 3DYPA 4QXUH 3O4LE 3CSYA 1I7ZB 3MRLB 2YEZB 1KC5L 5IF0B 2R8SH 2W0FB 4P2RE 1JHTB 3MRNA 2B8OT 3OB0H 5CGYD 5D9SB 4QOKE 3C5SB 2FZ3B 1ZLUK 4XWGL 4MA3B 3V52L 3PWNB 2ARWA 4YPGB 4TUOB 3VGFA 4GLRI 1I8KA 2ICWA 2EKSA 2Z8VC 3F12A 4RMWA 4YXKH 2R1XA 5F7NC 3ULUC 4Q9BA 4R26L 2Q20A 5B8CC 4NM4L 1WBZB 3PL6D 3QFJA 3O6FB 4Y16B 2Q76B 3SDDA 3HPLB 5CHNA 3RVXD 1BGXH 5IVXA 4GXVH 1UM6L 1F4HA 5KJRH 4GW5B 3JTSB 1MFCH 5J57B 2BRRH 2GK0B 1GC1L 3BPLC 3Q5YA 3TYGL 5ITBL 5DYOA 2YN3A 4KJYB 4KVNL 2BK8A 5KSVB 5GGRY 1KULA 4PJAA 1DE4A 3VCLA 3TJHA 3U83A 3NN8A 3MRMA 4P2QA 3FT2B 5D7JA 3J8F7 4PLJD 1QYGL 5JA9A 4U3HA 3QCTH 4Z8FH 3BZDA 5I74C 5K9OA 1UQSA 5L9DH 1IM9A 4XH2B 5C8JA 4YK4C 5DMIH 2ITCB 5GRUL 4I2XA 5EZIH 5I8KH 1F4XH 1ONQB 5CJOH 3GBML 5IW1B 3BIKA 4X7FC 5EO1A 1CD0A 1R3KB 1CGUA 4ODSL 3FONA 1BJ1J 3PDOA 5EB9A 3V7AG 5CFHA 2VLKA 1YY8A 3ETBF 3RPIA 3DLQR 1SVCP 4KAQL 1BQHB 1IKNA 4QXUL 4GS7B 4TVPL 1YN6B 4U6XB 5ECJE 1CZ8L 5IK3A 3I50L 2OX5A 1RZ7H 2DMKA 35C8H 5HVWA 1QHPA 3PG2A 3AVEA 3MNWA 1KGCE 3QIUD 4J4PD 3VXOB 3DMMC 1EMTH 3JV0A 3QQ4A 5BZWB 2B1AL 1HKLH 2FX7H 3OKKB 4HDIA 4F7MB 4KK9D 4PJEE 3QB7C 4XPAH 2ZNXA 2VNCA 4U31A 4OZHA 1J0HA 3NA9H 1GZQB 1KCVH 1OOAA 3R8QA 4LNRA 4OTXH 3MV7E 1QSFB 4ZSOB 5C09B 2R56L 3DRTA 1UWXK 4GXVL 4X4ZA 5J9PB 1EAPB 3DSFL 5KJRL 3MROB 1T03H 1BD2E 1MFCL 4BSWB 5KVEL 4KDTC 1EFQA 4JKPL 4O00A 5BZDA 4WTZA 3E2HC 4P4RA 2DQFB 1KT2B 3HMXL 4YHLL 1RIUL 2DBLL 5I71B 4EUPH 1FE8H 4ORGA 4PJBF 3DXAB 3KYAA 1CXFA 2JJUA 4BH7B 5CIPB 4L8SA 4UQ3A 2QQKL 4KKCD 4L8CA 4EEEA 4L4TA 3QWOA 4Z8FL 1EEUA 3OR7A 3SDAC 3ULUE 2B1HH 1PQZB 5KOMC 1DLFL 5L9DL 4Y5XB 4PP1C 2F5BL 5MEQB 1NKOA 4DZBA 5ID0A 2XWBA 1N0XL 4M1CC 5EZIL 5I8KL 5CJOL 2NY6B 1TZHA 2DTSA 2OP4H 3BYYA 5EG6C 4JFDD 2LU7A 5C0JA 1AQDB 1RVFH 2AV7B 5FGCE 4YR6A 2DJUA 3MCG1 3WNMA 1AD0B 4NBYB 3NZ8A 3KYMA 2X10A 3B6SB 3SE9H 3P4OB 5F70A 4NUJB 3MLUH 1Z9LA 1V5JA 1ZTXH 5A16B 1I1FA 1T5WA 1GVIA 4APQB 2BNUB 5D8JL 1RZ7L 2XZAH 4Y1AD 3OV6A 4FFWC 4R2GD 3CFKA 5HHXH 1DQJB 3W0WD 2CDEB 4KI5D 4Z7NE 4BSJA 3PABB 5JHDB 1YEJH 2IH1B 3MUJA 5I75C 1EMTL 4O9HH 3OJ2C 1HKLL 2WBJC 4AH2A 4NZTL 2Y5TB 4P5MA 3NCEB 3TT3H 3NA9L 1H3TA 2VQUA 2Y06H 2E7LC 2ZG3A 4I0KA 2V9QA 4X80H 1DLHA 1R3IH 3WSQH 4AMKH 4LEXH 4X7TA 3S96B 4K7PH 3CFIC 3BGAA 3KPSE 5DVLA 4ZUSB 2XN9A 5EUOB 1PYWB 3OKMA 5D5MB 3G08B 1T03L 4RMUA 3MV9A 1A7PL 4U1LA 2X40A 3IXTB 5C6PB 4KJQD 2HFEB 4LPUA 4YAQB 5TF1H 1KELL 5J1AB 4ZDHA 3V4PH 3UZEA 3LH2H 3HFMH 5DJ6A 2DKMA 1A7BA 1BP3B 3P77B 4BH8A 5IFHH 3CX2A 2EC9T 1OD9A 1KTLB 3TA3A 3P4NA 4N0YH 4CRPA 3P30H 4WU7A 2NY7H 2XPGA 3HE6D 5D2LE 1I8MB 2X1OA 2JCCA 1TJHL 5CJBA 3FQXA 1JTOA 2B1HL 2M2DA 3LRSA 4DGVH 3OXRB 5JW5B 2B4CC 4XAKD 1X7QA 1XIWB 2JB6A 5EDXA 3MXWH 3DUUB 2VL4A 1HE7A 1JPSH 5DQJA 2OP4L 5C2UB 5E2UH 5FV1L 1U8MB 4QHUA 4XRCA 2ESVB 4DN4H 1Q0XH 1D5XA 4MS8A 3SGKC 2H2SD 3CFCL 3E6FB 4HFWA 1ZTXL 4L8BA 1KJ3H 1WC7A 1OSZA 1WWCA 2VZTA 3GGWA 1YMHA 4IRZH 2P8PA 1UGNA 4IMLA 2YD3A 3KLAA 4Y88A 3TO2B 5BVJB 2MTPA 4JRYE 2BC4A 3CSYB 3B9VA 2P46B 2ICWI 2VE6A 2NY2B 4I3RL 4V1DA 5DVMA 4MCYA 3MRNB 1AP2B 4O9HL 5IB3A 4PV8A 3N50A 1W8OA 4PG9A 1A3QA 4B5EA 3B43A 3ARZA 4PY8I 5DJXA 5D2NC 4GG6E 1HCFX 1F02I 4XBGA 2QTEA 2I60L 3TT3L 5C0RL 4POYA 2Y06L 5EZJB 5EZOL 1I8KB 2WWKT 4ALAL 2NY0C 1R3IL 3VFUA 3F12B 5DRXA 4AYFA 3WSQL 4AMKL 4AZ8A 4LEXL 4PTUB 4K7PL 4OD3H 3WBDA 1J1PL 4M6MH 2VN4A 1NMBL 3SJVA 5A1AA 1KOAA 3QFJB 3RWJA 3RWIA 1H8NA 3SDDB 3FFCA 5CHNB 3LPWA 5IVXB 4MJ4A 2D3VA 1YQVH 5I19L 4TSCH 3T0WA 5TF1L 3WJLA 5GS1C 3S97C 1JYWA 1RUPL 3V4PL 1QLRA 4Z76A 4HUXA 4HGMA 3KXFE 3HFML 3LH2L 4JN2B 4IEFB 1FIEA 4A2MA 1QBAA 4Y8DC 3TIDB 5ERWB 4P23C 5C0GA 1YC7A 4N0YL 4TULH 4PJAB 1R24A 3GSUA 4LLAA 1JUFA 1MFDL 2NY7L 1LEIA 2H2PD 2WIIA 2E7LE 3AUVA 3BUYA 4JFED 4OLXH 4DGVL 1X6NA 2WANA 2F9BT 2VQTA 5C9KA 4MX7B 2Y9RT 3BPCA 2E9JA 3MV11 5J06A 3ZKNC 3MXWL 4EZMA 1UQSB 4H8WH 1IM9B 2Q1EA 2Q3ZA 5FYLE 1CVSC 4WHYG 5C6WH 1JPSL 4KTDH 1IGIH 1UZ8A 4DGYL 4CKVX 3MV8A 4R4NC 3EOBA 2PR4L 3PHSA 2V7NB 4I2XB 5IHZA 4DN4L 2IPUG 3ME0A 1Q0XL 1Z0NA 1JK8B 4JZOA 1JHLH 5EO1B 4KGLA 3UPRA 4DCQA 3FONB 1QSEB 1KJ3L 4F57H 1FN4B 4WCYL 1YY8B 1FIGL 4UOW1 1MCSA 2JK5B 4TPRH 2DWEA 1N3NA 1NDGA 4ZO9A 2VIRB 5DHVA 5F88A 2E27H 3DETD 3SY0A 1BM3H 3GSQA 1KIQB 2WY3A 4L1HA 3KPTA 4U0QB 1MRCL 5BS0E 3MNWB 3NIDF 1EXUB 1BBJB 3H9SE 3QQ4B 3TCXA 4TQEL 1DVFC 5L2KA 4MNGE 5EN2B 5C0FA 5FYKU 5DRNB 5IBTH 1CI5A 1LDPL 4HAGA 1YMME 5SWSD 3B9KA 4OD3L 1Z3GH 4M6ML 4J3UA 3S35H 3JWOH 4LHUB 3DTXB 3G5YA 2NTFB 3ULVD 5AZ2H 4OV5B 1E6OL 1KJ2H 3TN0D 4PRPB 1YQVL 3AMKA 4MA7H 5JZ7D