1ED3A

Crystal structure of rat minor histocompatibility antigen complex rt1-aa/mtf-e.
Total Genus 72
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
72
sequence length
275
structure length
275
Chain Sequence
GSHSLRYFYTAVSRPGLGEPRFIAVGYVDDTEFVRFDSDAENPRMEPRARWMEREGPEYWEQQTRIAKEWEQIYRVDLRTLRGYYNQSEGGSHTIQEMYGCDVGSDGSLLRGYRQDAYDGRDYIALNEDLKTWTAADFAAQITRNKWERARYAERLRAYLEGTCVEWLSRYLELGKETLLRSDPPEAHVTLHPRPEGDVTLRCWALGFYPADITLTWQLNGEDLTQDMELVETRPAGDGTFQKWASVVVPLGKEQNYTCRVEHEGLPKPLSQRWE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system
molecule keywords CLASS I MAJOR HISTOCOMPATIBILITY ANTIGEN RT1-AA
publication title Two different, highly exposed, bulged structures for an unusually long peptide bound to rat MHC class I RT1-Aa.
pubmed doi rcsb
source organism Rattus norvegicus
total genus 72
structure length 275
sequence length 275
chains with identical sequence D
ec nomenclature
pdb deposition date 2000-01-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00129 MHC_I Class I Histocompatibility antigen, domains alpha 1 and 2
A PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1ed3A02
3.30.500.10 Alpha Beta 2-Layer Sandwich Murine Class I Major Histocompatibility Complex, H2-DB; Chain A, domain 1 MHC class I-like antigen recognition-like 1ed3A01
5IV2B 2FRGP 4IRSD 4IRSC 1D9KB 2N7AA 4ZDHB 5HHME 3TBSA 4HZLB 4XP1H 4Z0BH 3E0GA 1A6ZA 4PGBA 1F5WA 3MOBH 4EJ1C 4Y4HB 4LCIH 4XMLL 5IMKB 5C09B 4NRXB 2F54E 1YEIH 2XZQH 1FO0L 3QB7C 4LU5L 3ARUA 4J3XA 2Y7QA 1BECA 1PZ5A 4N0CC 4N0CD 5HYJB 1ZGLM 1A9EA 1MI5D 5J9PA 1TTFA 4WHYG 4DUWA 3IDNB 1OWRM 2Q76B 5E2WL 2XWJB 4Z7UA 4ZPVA 3C6SB 3ZLQC 4YDJA 3MBXL 3GIVA 4OZIF 5HI4C 1YUHA 4FG6D 1YEEL 4FG6C 5FV1L 1I3UA 1JPST 3NFSL 4NQDD 4AG4L 2DQTL 5EOQH 4ESKA 2DQGH 4I3SL 4Y5VB 5CD5D 5CD5C 2E3VA 4KK8D 5EO0B 5TE4L 4L3ED 1EERB 2DI8A 3V7AG 3KS0J 5FM5O 4LP5A 4X4ZA 1HSBA 2HFTA 4F7TB 3PHOB 1N6VA 2EIZB 1UKSA 4PGZA 2FSEA 5I74C 3S4SA 1EAJA 3NFPB 4JANB 1T7WA 3DRTB 5ALCH 5JLZA 1S7QA 3TH2T 5GRUL 5T3XD 4JFXA 1R3IL 4HWBL 5J89A 4KI5C 4O00A 5CUSH 4LLDA 1NJ9B 2VH5L 4N8CH 4W4OA 3RPIB 4U1JA 2R8SH 2AABH 2WP3T 4Q9CA 4W68A 1IM3A 3QI9B 4L4TB 5DUML 1NBYA 4Y19A 2DQEL 4LPYA 2FJHA 4P59L 3MJ6A 3S36L 4M1GH 1FYTD 3FRPA 4YR6A 1MNUL 1V7ML 3SE4A 3JWDC 2BXYA 1A22B 1ETZB 4KKBC 4IIQA 4CVXB 3FMGL 2DQCL 5EN2A 5HHOB 3ARBA 1FLTX 4UAOB 5F9JB 3WS6A 3O2WH 2HG5A 2R0LL 5IFHL 3DV6A 5DQJA 5FB8B 3JTCA 2YPVH 5GZND 5C0AA 2VZOA 4MJ6B 2BDNL 2H2SD 4CRPA 5GZNC 2H2SC 3RZCB 2LABA 1TMCA 1IL1B 1J8HA 5DJ6A 1KCGC 5IEHA 1FN4B 1MWAA 5I0ZA 2EDQA 4P2RD 4IS6B 4XVSH 3D0VB 3RL1B 2A73B 2Z8VC 2F8VA 4MX7B 1ORQB 4QLRA 1LP9E 3ETBF 1J05B 1J1PL 2YBRB 2HVKB 3QIUC 1AHWC 2HRPL 1XCTB 2XIDA 2A6DA 5L7XL 2KQNA 5B8CA 5IQ9B 1AXSA 5CZXD 5CZXC 5AG9A 3ECBA 1BFOB 3NIGF 1YNLH 4V1DE 4FQIH 1ZHNB 3STLA 3L3IA 1FFPB 3KPLA 1JGUH 4L3CB 2EDBA 3HNVL 5KSBF 3ZTNH 1A7OH 5L2KE 3IRZA 3QDJA 3LMJH 4WHTA 2CIKB 3MRDA 4YXLH 2F8XC 4X9HA 3QAZB 5EIIB 5F72S 4YH6A 4P2QD 4NRYA 1MJJB 3SGKC 1FRGL 4HF5L 3P3YA 2WANA 1I8KA 3MO1B 3EYUH 3MRMA 5FOBA 3D2UA 4HWEL 3CFKA 5IG7A 4UNTA 2FZ3A 1P4IL 1FNHA 2UWEB 2NY4D 2XTJB 3HKFA 2NY4C 4G7VH 2ATKB 1CFTA 3LS4L 3IJSA 3GMPB 4M7LH 2N4IA 3RWGB 4ZXBD 2X4RA 1XIWA 4HFUH 5IW6B 1Q0YH 5I0DA 4YBLC 1A6VL 2EYRB 4OQTH 2FEEL 4L29B 1QFUL 1NAKL 2P46B 4JM2D 4NN7C 4JM2C 3UBXA 1RZGA 1D5IH 5C0EB 4MNGE 2YPLD 3U1SL 1G7QB 4WW2A 1XEDA 3RWFA 4GKZB 4G9FB 3Q3GB 2QSTA 2BJML 1CQYA 2Z91B 2LQRA 4JHAL 4R0LC 2R0ZL 2VN7A 3V8CA 1L4IA 3M1BB 3BT2L 4F33B 1WIPA 2Q7YB 4Z95L 3SDCA 3LZFH 3ARFA 3QXDB 1R5VA 1MFAL 4IDJL 1XH3B 1K6QL 3L1OH 5HGAA 3NCEB 4ZFOA 3DURA 1WBXA 2EH8L 3HC4H 2V2TB 4AY0A 4F9PC 5HD8C 3MNZB 1BBDL 3D1MC 4RRPG 4PYHA 5D7IB 2VR4A 4RFNC 1KJ2A 2VLKA 2FIRT 2HYMA 1BVLB 4GRWF 4ZTPL 3ZYOA 5HVHC 9CGTA 1MCHA 4K9EC 4NM4H 1JGVL 3CD4A 4G8EA 4LQ1A 4XNYL 5DMGD 3T0EA 4U1NB 1U8OA 3GMMA 1A3QA 1FORL 5LGJB 3KYNB 1MPAL 4JO2L 5F7DA 3BFOA 1K5NA 3H9HB 1SJHA 1JHKH 4PB0L 3MNWA 3OXSB 2XXCB 3LQZA 2AXFA 4Y4KB 5E99L 1BLNB 3SKOA 1I8MB 3QUXC 3O2DH 4RMWA 3LKNB 3VFSB 1UWGH 3I2CH 3MV7E 4LAQH 2PO6B 4UTBH 2P45B 3E6FA 1JNNL 3S88H 1LD9B 3NOIA 4H88H 3QFJD 1GAFL 3CFJB 5D93B 5ERWB 4XMKL 3J8F7 2JTDA 2F5BH 4LVEA 1CIUA 4PJAA 4HS8L 1NC2D 3TF7A 1T2QH 3ULUD 1H15B 3TO2B 2LE9A 4HCRL 4OCRH 1J0IA 3BKML 3MXVL 4Y1AD 4EI6B 3KPQB 4XBEL 1J7VR 5BVPL 3G5VB 5IK3B 4F58H 5I1CH 4JREC 1R0AL 2VDRH 5D1QA 5J12C 3QFDB 4PJHE 3UTTB 3G04A 2I26N 3EFFA 4V2BA 4PGJA 5GHWH 4U6YA 5IVXB 3EFDH 5EUOB 4TSBL 1KIRB 4WFFE 3F12A 4TPRL 5C7XL 3BJLA 1MVUB 2C7UB 4NSKA 4BH7B 3DMMA 1MRCL 4WTZG 2MTPA 1OWWA 3LPGA 4N0YL 3INUL 1ACZA 4Z7UE 2WK2A 1N8ZB 4MWFA 2NTFA 5DVOA 4MAYB 4RNRA 4X8XA 4BZYA 1ZVSB 4DKFH 2IFFL 4G80B 3MJ9A 5DI8A 1JRHL 2K3TA 3EJZD 3MRNB 4PJCA 5HDQH 5T1LD 4PUBL 1NGQL 1B0GA 3ARRA 1WTGT 4JPKH 1DN2A 4JGJA 1UB6A 5B39G 1OF2A 5EU3B 1T5XA 3QZWG 3L5XL 1NFDB 5D7KE 4HAGA 5HBBA 4AL8L 3KHQA 2A77H 1RQ5A 5AWNH 1RHFA 2FX8L 3GMRA 1W0WB 4ELKB 4NBXB 4U1HB 4LRIC 5MENB 4JFFD 3RTQB 1JGDA 5D7JA 4YHPB 3CIQA 2IEPA 1II4E 2EZ0D 2EZ0C 4HS6A 3F7YB 1CG9A 3QIBB 4HKXB 1HINH 4F3FB 4Y8AA 3OBAA 5GRJH 3FQNB 2FR4A 3H3KA 1F4WL 4LMQE 1BIIA 3UTZB 3GJFB 4ORZC 4QHUA 4DK3A 5IFJB 5TFSL 4PRIA 3T4YA 5B39B 1H0DB 1LMKA 1IAKB 2H32B 2UZXB 4PJBA 1JZ3A 1A2YA 3QZWB 3L3DB 5HJ3B 3RL2B 2LAGB 3MGOB 4Y5XC 1F42A 4MD0B 1A6AB 1JTOA 1T21A 3SGEI 2JE8A 3U48A 5J6HB 5A2IH 3IFNL 4QOKA 3TP4A 3VFWA 5C0AE 4IRSB 3RJQB 4ISVA 3TA3A 5IF0A 1J8HE 1NBVH 4NQCA 4QHLA 5JQHC 2ESVA 4P9HH 5CIPA 1A14L 1PSKL 2CMRL 4WIQA 3G6JB 4TUKH 3U7WH 7FABL 1Z5LB 3QG7L 5F6HJ 4K8RD 5IVZB 4K8RC 3KWWA 4U1IB 1MI5B 5BCAA 5CZVH 4R97B 1OAUL 1XR8B 2YSSB 2B5IC 3RDTD 3RDTC 1I9JH 1UA6H 2BNUB 1KYOJ 2V5RA 4X4MA 2UZYB 4WCYL 3Q48A 4X5WB 1TCRB 3X3GH 5DRNB 1IARB 3TLRA 3OXRB 4EDWH 4HXBL 3G9VA 4NQDB 3UO1L 1DUYA 1S5IL 2W9LA 2HTKC 1GOHA 2XICA 2AJSH 2JJTC 1GGBH 2IBZX 2IQ9L 4K3EH 5ISZA 2YMXL 3VFGH 3LKRA 1RY7B 2QHLA 3VXUD 2KUTA 5I74B 3DROA 1Q1JL 1V5JA 4O2CB 3CAFA 3UJTH 1WZLA 5KVFH 5I1IL 2ADFL 4C54A 2DQUH 2BOCA 2HLAA 4Z7VA 1XGPB 1J0YA 2FLRT 4OLVL 5BOPA 1NMBL 5GGQL 5FA3B 1OTTD 1OTTC 3IDUA 4F2MA 4ONHA 4WJ5B 3IU3B 2J88L 1C8PA 2VDPL 1HXYB 4L9LC 4JHZA 3ZT7A 4XTRD 5JPMB 3QNXB 4FMKA 1FYTB 1HOCA 2EICA 1PKQA 4UOW0 3F7QA 4QRSA 4Y2OA 4PY8J 5ANMB 1EH9A 3MJ7B 3UC0H 3ROOB 2CDEA 4D0BB 3M07A 1YMMA 2V7NB 1ZS8B 2FECI 1CN4A 2R2HA 2BVUA 1CTOA 3ZZ1A 3NIFF 4MGXA 4OFYA 1CGUA 1EGJH 3X3FH 2MMXA 3QRGL 1UH2A 3FOLB 5C2BL 5I1EH 2R69H 1F58H 4GRLD 4J1UA 1GZQA 2DQJL 3T2NH 1IE5A 3UDWC 4UIMA 4EN3D 1EO7A 1IC4L 1AHWB 2K9UA 3QIUB 3K8LA 4EN3C 2VLKE 3BP5B 2AK1H 1U91B 4HJJL 2E7MA 1HKLH 4G43B 4FFEX 1IC7H 3STZB 2DTMH 2G5BB 4JKKA 1DEDA 5H37G 5IBUG 3T0EE 1J0HA 5GGVY 1T1YB 2BY2A 3UAJD 3L3OA 5TDOA 4PG2A 4LF3B 4PJ5B 2G9HB 4DVBA 3GSVB 3S3PA 1YJDL 4G5ZH 3L95A 1U8PA 2DTSA 5FYLL 3HNTH 1P1ZB 1YEHL 2YD6A 3F7PC 3FKUS 5IB2B 1IGFH 1VFOA 3CDGB 5DRXB 4PREB 1VPOL 1V7NH 3ET9F 2VITA 1ZK9A 3GM0A 4P2QB 5H8DA 3V2AR 4OGAD 4OGAC 4RMRA 3NCFB 3RI5F 1U3JA 3LRSA 4XCEB 4PGDB 4U1GB 6CGTA 1ZLVH 2NY4B 3GMOA 5DK2A 5IBUB 1P4BL 1A7PL 2EE3A 3O6MH 4BK5A 1G7MA 2D9QB 1U6AH 3C6LD 4ZXBB 3CPLA 4YFLI 2OZ4H 3ZYJA 4YBLB 2CIIB 1X5YA 3LY6A 1CDCA 4RGND 1ADQH 4YFDB 4RGNC 4NN7B 4JM2B 5GPRA 1KN4L 4LCUB 1MHHB 3PG2A 1XCQB 4LPWA 5A2LH 3L3GA 1DLFH 4R90L 2YPLB 1AD0A 4RMUA 4G9DA 3CGTA 1CDJA 1DQJA 1RURH 1ACYH 3VI4E 2YEZA 2UWEF 1INEL 1WBZB 5TDPB 2E7HA 5A16A 2JB5L 3B3IA 5B22A 1QBLH 1ZV5A 1PEZA 4OF7A 1OTSD 3FO1B 4Z0XB 3V5HB 5KZCD 3ME0A 4DGYL 2VUYA 3MRJB 1R5IB 1RU9L 1RK0A 5SWZD 2P5EA 3DX7A 3QWOB 2X4TA 3V4UL 1IFHH 1ZMYA 1W0YT 3KYMA 1F2QA 5K9JL 2O61B 2EEAA 4M1DL 1LK2B 5HGDA 3KYKL 2VE6B 2XZCL 4RFNB 4RAVB 4XP5L 1YMHA 2VXVH 3CJJA 3V5KA 3TBYA 1ZVYA 4PJCE 4QF1A 3NACH 3NIDF 2CR6A 3OR7B 3T0XA 5MEQB 4WFHD 2ICES 2FX9L 2WIMA 3BHBA 3HAEG 1H5BB 3RBGA 3PGCA 3DX9B 3TV3H 1I3GH 2VO5A 3U2SA 1HDMA 3FQTB 4GRWH 2MPAH 4U3XA 1KXTB 1D5ZB 2DQFA 2HT4D 3BH9A 5KSUA 2AERT 2HT4C 5D7IF 4CDHA 4NQSB 4D0DB 4YEFA 1QA9A 2IGFH 5I1KH 5I66A 3TFKA 5LBSH 4NP4H 3RAJL 5B38G 4NGHH 3IXTA 1QACA 1Q0XH 2NY0D 3L6FB 2NY0C 2D31B 5JR1L 2DF3A 3OZ9H 3UZEA 3RIAK 3TJHA 3GGWA 1RZIA 3P9LB 5ICYB 4M00A 4BZ2L 2N7BA 3R0NA 1FNAA 3NA4A 2CK2A 3RPKA 5HY9B 3D69B 4YK4C 3O6LL 2Q6WB 2E27H 4WV1A 5DHYB 1NSNL 5BMFH 4PRIE 3QFJB 4FQQA 4PBWD 3QNYB 3HAEB 1LEIA 5KN5B 4ODHH 4MCZB 1CFSB 3O9WA 4DGIL 3DXAD 3VFMA 3QEQE 1Q8MA 1NC2B 1EZVX 4XNMA 1BOGA 5BS0D 4YXHL 1HE7A 1EPFA 2ZCLH 1BAFL 1J18A 5KANG 2D3VA 2BC4B 4YUEH 5T1KD 3LDBC 3VGDA 2IC2A 1KF9B 4LFHD 1HSAB 1RUML 1S8DA 4HD9A 1AD9A 1DFBL 4K94H 4X6DB 4ZTOL 4HUXB 1A4JB 4NQCE 3VFVB 2QQKL 2B4CH 4JREB 4J4PC 3C2SA 2R2BA 4KK6D 5J12B 4UBDC 3FFCA 4F15C 4MDIA 1ED3A 2WWMD 4F7MA 4FQCL 1KCRL 3HS0A 1LE9A 3N9GH 5CZKA 1CGYA 2ZG1A 4I3RL 4JFDA 5IROC 3QO0B 4UT6H 4NKDA 3P0YH 4ETYA 2C3HA 2QR0B 1C5CH 5FUCC 1BEYL 3EZ8A 4NQVB 2ZOLB 1DL7H 3SDAD 1U92A 1ND0B 1GGCH 4HUWA 3SDAC 1P4LB 3K3QA 4LLWB 5FGBC 3QDGD 3FN9A 2DQIH 1FYHB 1DBBL 1M7DA 4X7DC 3STBA 1MJ7L 1MWAL 5T1LB 5IVXF 2YKLH 5EUOF 4NPYB 3SDXB 3W9DA 2OTPA 2Q8AL 5E6ZA 2CO7B 4FOMA 4N0UA 4OCYH 4QXWA 4JFYB 4QY8B 4ODWA 3MBED 5E2UH 3MBEC 5LXGH 4A6YB 5D7LE 2C3VB 4Z7VE 5EIQA 3PGFH 3S36X 1GGYA 3P73A 1IGCL 4ZOEA 4JFFB 1I1YB 3OAUL 5DUBB 2X4PB 3ARTA 4TSAH 2FEDC 1L0XA 3KPPA 4YZFF 3QHFH 4MB3A 4FXGB 1HQ4A 1CFVL 4QHNB 3UTPD 4M61A 1PKQE 5ILTH 4YQXH 3QJHB 4JG0H 1U8LB 3BIKA 4H1LH 3N1QC 5JNYB 4NKIL 1U93A 1YMME 1AQKH 1ZSDA 1BD2D 1EEYB 1MJUL 3CVIH 1BJ8A 1OM3H 1XF4B 4RAUB 2C3XA 2F54D 3GO1H 2HFEA 3CFIC 4IRJC 3FRUA 3BEVA 1KG0B 1ZEAL 1LILA 4KUCD 1YC8A 3PWVA 1S9YB 2CKBL 4U1LB 3MLYH 4N5UA 2EDDA 4DVRL 2P7TA 3S35L 1SVCP 1MOEA 4OLXH 1EEUA 1NBZA 4JY5H 2OI9C 2B5IB 3RDTB 2VZVA 3Q5OA 5EA0L 3IDMA 4OF5A 4UNVA 1BREA 4UUJA 5I1LA 3HR5A 3OAZK 4S2SB 1T03L 5H2BB 3OR6A 3G6JF 3FQWB 1HIML 4N0RA 3ZKSD 1DQDL 2DLHA 3EOYG 4ZFOL 3P9MA 1ORSB 4NJAH 1PG7H 5SX4I 4KAQL 3G6AA 1IT9L 2ICEB 5HDOA 4W6XB 1SYVA 4PJ8D 2FYYA 3KLDA 2IAND 1L6ZA 3R06A 4NO2A 3GSRB 2VDQL 2W59A 1KJ2L 3MV8E 4ODBD 1N7MH 4X6BA 1S5HB 1QFHA 1QUNA 3KAAA 3R8BB 2Y36H 3VFRA 3OX8B 4FN0A 1MCPH 1G84A 4HPOH 4HLJA 3MFGB 3E6HA 3NMEA 1G7LB 5K9KB 5HGBB 1FO0B 2H41A 1VGEL 1AFVL 4RFOL 5EOTA 1D5XA 5C0CE 3FN0L 3LV3B 4OCXL 1HWGB 1CCZA 3VD9A 4L9LB 3GSNA 1FFOA 4ZYKB 4LNRA 3RQ3A 5TH2A 2FO4A 3OAYK 1L6XA 2EKSA 4GH7B 3GSQA 3LB6D 1LQVA 2IH3A 3KPSA 4J6RL 3DHJA 3NZHL 4J3TA 3TIEB 5ID1A 1T1XA 4KI5F 5JOPD 1IQDA 5DTFB 4MA7L 4JY4B 5JUEH 3MLVL 4WI9A 1MVFA 4GSDH 1AY1H 2I27N 3MCKA 4Y5YA 3RU8L 5C8JB 5IOPA 2LU7A 2OR9L 4U6VH 1HEZB 5T33L 4GRLB 1I3RB 1CL7I 2P5EE 4UDUA 1S9WA 1A1OB 3H42H 4XP9H 4HGWB 4PRHA 2PYEA 4EN3B 1UWXH 2NY5L 4ZUWB 3KPOA 4N9GA 4V1DD 3FAXA 2VLJA 3G5XB 3O3BA 4M7LT 3MCLH 2A6KA 1G7HB 3SDDA 2I24N 1RI8A 3MLWH 1J0ZA 4KTDL 2IH1B 3F5WB 3MV11 1E6JH 3PWLA 1T22A 5C0FB 3ABZA 3D0LA 3QJFA 1F6LL 4JHWH 3SDYH 1RZJH 5BW7C 4JZNB 5I1HH 1A6PA 2HKHH 4X0KB 4P46C 3O0RL 1CICA 2ZPKH 5I17B 2Z4QB 5E8OB 4NC2B 2APTA 3TO4C 2W60A 5K9OA 5MEOB 4MA8L 1QG3A 1PX4A 3MJ9L 3O45A 4KXZI 3PL6A 2W9EH 2GUOA 4O9HH 3G6DL 1L7TH 4QXGH 5KS9B 3VXQA 1KLUA 2VMFA 4AIOA 4Q6YA 5EB9A 5DJAA 2H45A 4GXVL 3AXLB 5D70H 4N90E 1JIBA 4ODTL 1UEMA 3BYYA 4PIRF 5CBAB 4CJ0A 1KIPB 4RGNB 2R0KH 3C8HA 5GRYA 3DSFH 4J3UA 4YXKH 2VDKH 2HMID 4PRPA 2HMIC 1IGYB 3GDBA 4YFLF 1YJDC 4CU8A 1HHIB 3MXWH 1T89C 5FYLD 4NRZA 4QCIB 5DWUH 3MYJB 3QXAB 2J12B 5DO2D 3FB6A 2FGWL 5DO2C 3N1MC 4ZUVB 3OKLA 1RSFA 4K2UL 4RWHA 3GJEA 1R3LA 4O51B 4JRXA 4UINL 5DVLA 5D71H 2FD6L 4JFDE 4O58L 4L8BB 4I18C 4XH2B 4JM2F 5KZCB 3PDDA 2APBA 4Z8FH 1LGVA 5GIRB 4OIAA 5SWZB 1JGLL 4XPFL 3ZDZF 5BQ7B 2ZOKB 4PGCB 2GJZB 5A3ID 5J0BA 1MREH 4NKMB 4X6FA 4OZIE 3IF1A 3LEXB 4U4BA 4Z5RA 3QPXH 3WUZA 3WJLA 4NZDA 3SPVA 4M7ZC 5GGVL 2C3GA 2YN5A 5DEFB 4KWUA 4M4PA 4NZRH 3VFNB 4M5YH 5D2NB 1YEGL 3SGJC 3IVKB 3V9FA 1ZHLA 3RA7H 2XZAL 3TBVA 1JJUA 5C6TL 2VDNH 4P5TD 4N0UE 4R8WH 4BQCA 3W11D 1C16A 3W11C 4KQ3H 4UT7L 2GTWA 2VLLB 3PHQA 5E6IC 2WBJA 3V0WL 4C4KO 4F37F 4FQJL 2Q3ZA 1NBQA 4HH9A 3MRRA 2F53A 5DFVD 1WBYB 2F15A 5GJSH 5H94B 4H0GA 4Z7WB 3WIHH 1RJLA 4JZJC 1JP5A 3WN5A 1WWBX 4LFHG 1DQQA 4ETQA 2NY0B 1A1NA 2IJ0C 2XN9A 3O3DA 4OM0L 4KVNL 2BNRA 2BY3A 4UQ3B 3EO0B 3IFOB 1U42A 3FO0L 3MLUH 1RIUL 2BFVH 3HMXL 3JTSA 4CU7A 2DI9A 5F7HA 35C8L 4HUKB 1FL6B 4XPAH 2CUHA 3MRPA 3QUKA 4NNPH 1QEWA 2V5MA 2XXMB 3HTLX 1FNGB 3BJ91 3NCYS 4JM4H 2VXQH 3DXAB 4I48A 3ZHKA 4UTAH 4OF3A 4JN1H 5BS0B 1BQHG 4FZEL 4I9WE 4FFZL 4NDMB 3T0AA 1BVZA 3ARDA 3LDBB 5T1KB 3FFDA 2C1PA 3MOAH 2CKNA 5A40E 2WBWB 5K59F 5KJRL 1EHXA 3ZL4L 4UV7H 3W9EB 1KB5B 1S7RB 4KPHL 3U30C 4WFFD 1IMHC 1UCBL 3MLZL 5D72L 4YPJA 2VDLL 2P8LB 2Q3AA 5E94A 4F15B 4BQ6A 3WFBL 1AC6A 5F70A 4E41A 1VKXA 4GMTH 2YA1A 2GIYA 3F7VA 4UILL 3GBNH 1F4XL 5BRZA 5TE7L 1JF1A 5EFIB 1S9VB 5IB3B 2VXUH 2H1PH 3LHPH 2P47B 3H9SB 2BXZA 2W07A 4XRCA 3KLAB 4MXWH 3JV5A 5KOVC 3QR2A 5CJXA 2IFGA 4X6DF 3SDAB 3T65A 3QDGB 3VXTB 4C56A 1NEZA 4OUUA 4XCFH 1HH6A 2AJYH 1IGMH 3I02A 3LVEA 4YDIL 2B1AL 3KLSA 1F4YL 4K7PY 4S1DC 4TOYL 4LASH 3I9GL 1NH6A 1A7QH 2AGJH 3L5WA 1CVSC 1MCWW 3CK0L 5F44A 4N0FB 5KAQG 5IJKA 1NCBH 4NQEE 4NUGL 4KTEH 1DBAL 2HJKA 3N06B 3BPNC 4M6NL 3RVTD 5IB5A 4PJ9A 5JW5A 3HCVA 5CGMA 3MBEB 4W4OC 3R1GH 2D4DA 1J86A 5IT2L 2H8PB 2ICWA 4Y19D 3O8XC 3TBTB 3P9WB 1HYSD 1IKFH 1HYSC 2AS5M 3SDXF 3SE4C 4J12A 1FAKT 2Y25A 2BMKA 3ARBD 4YHKL 1SY6H 3HZKA 4LEOA 3BPOC 5HYQB 3WS6C 3QUZD 1FP5A 4D3CH 2X70B 4DCQA 2I9LB 5HVFB 3VWKC 3QISA 5CCKL 4PJIA 1OW0C 4LOUC 3KPSE 5C0AD 2PNDA 1VCAA 1OGTA 1J8HD 2R4SH 1ZVHA 1RJYA 1UZ8B 4ZUTA 5JXAL 3IKKA 1BD2B 1Q94B 1FIGH 4FQ1L 1HQRB 2NYYD 2IADA 3MRQA 2I9TA 3UROR 4KHXL 2F54B 1ZA3A 5TQ0L 4GFTB 5BV7L 4AH2A 1QNZH 4XNQA 4LKCB 1BX2A 3DVIA 4MJ5A 1U8JB 4PRHE 2EYSA 3SKNB 4I2XB 3SKMB 3MZTA 3CUPB 1D5MB 4AENB 4I4WA 4YX2H 4P3DA 3MMEB 5FO7A 4H8WH 3O4LA 3CCHA 4PY7B 4H20L 1U3YA 4P9MH 3ZYZA 3SO3C 3IDGA 4HBCH 3SQOH 1K8DA 5C0IB 5INDA 3QDJD 3SGEH 3GJFH 4L8SA 4GAYA 1MCNA 5FUOH 3OKEB 2GSGB 3PP4H 1F97A 4NZTH 2H32H 1OAKH 1GC1H 4XMPH 4P5KB 3WFCH 1YA5A 4J3VA 1F6AA 3D2UD 4HC1A 1N4XH 2ORBL 4U49A 5GISL 3CLEH 1S7WB 1NMAH 3DETD 1H3PL 3OKYA 4OCLC 2E9IA 4F7EA 2ADJB 5T1DH 3VFPA 3VD4A 5I1GL 3V6BR 3MACL 4X6EA 5F96H 3AREA 4RFEB 4S1SL 12E8L 2DBJA 1XIWD 1XIWC 3BUYB 2BVYA 5FYKE 1BJMA 1A3RL 3QCUL 3FOMB 1J1XL 4QNPE 4J7RA 1CE6B 4XBPB 1A1MA 4JY6B 1R6VA 4MA3B 2Z93A 5DMYA 5K93A 4WW2C 3C8KA 4HBQA 4PV9B 1X7QB 4UV4H 3SHSA 1GOFA 3WNLA 3EUUA 2B2XH 2O5YH 2PF6A 1DEEB 3SDCD 3ARFD 3ARFC 4HSQA 1CF8H 5FEBA 1NCWL 1U8IB 3C9NA 4KK5D 5BZDB 4KK5C 4LKXB 4DUXA 2BK8A 3A67L 3CFDB 5E8PA 1M05A 4JRXE 4K3HA 1A4KA 1LP9B 4YHNB 1NDGB 1YN7A 3BZDA 3WL9A 2W9DL 4DAGL 2J2ZA 4K23L 4PFEA 3LKOB 3F6IA 3UYRL 2VLKD 2OQJB 4PJFA 1NL0L 3CDCA 4YHYB 5T3XH 3HPLB 4UDTA 4OKVA 2V9QA 2WWKT 4A2LA 3BN9C 4CBPA 2YHGA 4FZ8L 3BSZL 1AGEA 4GG8B 4V1DB 3T0EC 43C9B 1QR1B 4M4RA 1QFWM 1CXEA 2OTWB 5DJ0A 1SJEB 3ILPB 5D9SB 5EO9B 1RZ7H 3OKOB 2OX5A 3QWRA 2AXHA 3JWDH 1P5UA 1SYSA 5IHZB 4YNYB 1ZT4B 4R7NB 3JXAA 4DTGL 1MAMH 2J4WL 5FK9A 3JVGA 4P46B 2F53E 4YE4L 5C0GB 3MTRA 1E4XH 5DQ9A 3ZKMD 4OCWH 4RDQG 5C3LD 2VWEE 3ZDXF 1Q9OA 3VXOA 1VADB 2EDTA 2ZG2A 2XN9E 1I9EA 1WAAF 3GB7A 3MA7A 5ICZA 2BNRE 1IKNA 5DJZA 4QWWD 3I85A 4QWWC 3V6OC 2E9BA 2OJEA 3U0WH 1U95A 2Y5TB 1SEBB 3LEVH 4I0PD 4NJ9H 2VKXA 3LEYH 1D5BB 3TF7C 1T3FA 3EO9H 4MQ7B 3U4EB 2RCSH 5FECB 3KYOB 3OGOE 2AJZB 1U8MA 4MNGB 3TWCL 1IC5H 5D1XD 1I7UB 5F88B 1WIOA 1EJOL 5E00B 3UZQA 4M9PA 5EZLB 5D1QD 4RRPA 1JHLL 1OP3K 2WQ8A 3QCTH 3U0TB 1V3JA 3K74B 2V5YA 3BISA 4WU7A 1VFMA 1MCJA 5HI3D 5HI3C 4CMMB 5KS9F 4OD2A 1G9NC 1UM5L 1KPRA 4E41E 4HUUB 4P5MA 5I1AB 3DMMD 3DMMC 2CGRH 3T77B 5BRZE 1SMOA 3BO8B 3PABB 3VGFA 2VQ1B 4R7DA 3PWPE 4U0RC 3DX8B 3O81A 1RUAH 1TJHL 4PRNB 2UUDH 2XFXA 3TBWA 5TDNB 1XGRB 1X5FA 3BP4B 1W0VB 1L7IH 1OSZB 3BVNB 1KELH 4KMTL 5GS3A 4P57B 1MF2L 2HFGL 1T0NA 1CDGA 1KCKA 2VZSA 4C56E 4TUOA 2W0FA 3MFFA 5EUKA 3VRIA 2BVQB 2C1OB 3VFOB 2HN7B 3VWJC 1BWWA 3AU1A 1R3KB 4XC3L 3WHE0 1JFQH 3HRZA 4XPTL 4LSSL 4JO1L 1BPVA 1FJ1B 3OJMB 5HYJE 5CSBA 5KSAD 1DSFL 3OSKA 1JMZA 3ZKNC 4UIKH 1VEPA 5D7JD 4AQ1B 4JO4H 4HPYH 4PJGA 4Y2DA 3MV7B 4OD1L 4RISH 1P7QD 4NWTL 4NNXB 2WP3O 5F3HA 4JZJB 1SM3H 1F3DJ 4U6XB 5D8JL 1FC1A 2DIAA 4KJYB 4M6OH 1VFBA 1VGKB 1ZGLB 1G7PA 4PRID 1D7FA 1FNSL 3HI1A 3OKKB 1JNHA 4NHUA 3GHBH 4J8RB 2Q1EA 4TNVK 2EE6A 3CXDH 1DQLH 2R23A 1KLGA 5FO9B 3D85A 1EO8H 4G6AC 1SHMA 2DD8H 4Q6IA 2JB6A 1U0QA 3IXAB 2B1HL 3GSWA 4E0RA 4YDLC 4QOKD 1PJ9A 4PJIE 4WTZA 3MJ8A 3TA3C 3TBSB 3BPLB 1L8JA 4K9EH 2UY7A 4UB0H 2EDOA 4NQCD 4ZAKA 1A6ZB 2ESVD 5DK3A 4Z7WF 3MV9A 4PGBB 4L8DA 1H8OA 1R3JA 1CU4H 4ODSL 4Z76A 3TNNA 1FZOA 4O2FA 4XPBH 2H2PD 1BIHA 3CC5A 3U30B 3IJHA 3N1FC 4OGYL 3S35X 2GAZA 1DQTA 1QTYT 5FA4A 3R0MA 2Y7QB 1PZ5B 4B5EA 3U7YL 3V7AE 5J9PB 1TPXC 2AXGB 4GAJH 1DBJL 4XT1C 4Z7UB 3O4LE 3K80A 4YDJB 2DBLH 5DMKA 3RUGA 1CLOH 2APWA 2X1XR 4GXUM 3WXVL 1JYWA 3GIVB 1HZHL 3GMLA 4CVWA 1YUHB 4JGUA 4OGXH 2ZUQC 5CSGA 1CVRA 4AIXA 3KDMA 1W8OA 3QH3A 1J0KA 3K8KA 2W91A 3HAEH 3LAFA 2D0HA 2XQBH 5ESQA 1X5AA 5ISZD 2O93L 1HSBB 3FRPG 4BFBD 1UH3A 5TF1H 3GKWH 5CMAA 1QFPA 4LLUA 1FAIL 3AUVA 2FSEB 1EBAA 4JVPA 2IWGA 4PB9L 3V52L 3S4SB 2GQHA 5GZOC 5JLZB 5F8QC 2LU3A 1S7QB 5LKNA 3BPNB 3BE1L 1NFIA 4JFXB 3IU4H 4F80A 4LLDB 1B6UA 2J6EH 1NGXA 3ZE1E 4ELMA 4U1JB 4YPGA 2I5YL 4UNUA 4GG6A 2Y6SD 2R4RH 4X4YA 3RVUD 3RVUC 1IM3B 3BUTA 2CK0H 1NBYB 4Y19B 2FJHB 1WT5C 2IG2L 2XNAA 4YR6B 3ARGC 1ZTXH 3QCVL 1U3HD 4W6YB 5BOZG 3W2DH 1HHKA 4IIQB 2CD0A 1TJGL 5EN2B 3HRPA 3ARBB 5EBLA 3Q1SL 1YMMD 2HG5B 3WEXA 4WY7L 3DV6B 5DQJB 2PTTA 4XCYA 4MD4A 3UYPA 3FJTA 5C0AB 1MQKL 5CHNB 1TMCB 4JO3H 1J8HB 2UWEE 5CJBA 3PV6A 5DJ6B 4Q9QH 4QHMA 5IEHB 1MWAB 3CMOH 4CL7A 1RIVH 3K1KC 1F90L 4Z7OF 5FYKL 3REVA 5JHLL 2A38A 1FQ9C 4S1QL 1PQZA 4G6ML 1FDLL 3R8QA 2A6DB 5K33A 1KB9K 5KAQF 4PJFE 4A6YH 3EYSH 5CJQL 1AXSB 2XKNA 4P3WA 3VG9C 1KUMA 3ECBB 3PWNA 1FPTL 1OSPH 2Y07H 3BPCA 3P11H 4G7YL 1XR9A 3STLB 3L3IB 1N6QL 5KG9A 3TT1H 1OQOA 3I75A 3WDJA 3KXFA 4JKPL 4WHTB 5I15H 4DK6A 4K7PL 5JW4Q 4NRYB 1H3GA 5EU7E 1I8KB 3QQ4A 2DM2A 3MRMB 5FOBB 3D2UB 3DSNA 1H8SA 2APXA 3CFKB 1IGJB 2DB8A 5IG7B 1MRDL 1T2JA 3F8UB 2FZ3B 2E8ZA 4RBPH 5EDXA 3IJSB 3H7LA 3MRLA 1RUKL 2X4RB 5C3TA 5BV7C 1XIWB 3L7FA 4NO3A 4NZUL 1A0QL 3Q6FA 2NR6D 2NR6C 1LHZA 1UYWH 3QEUA 3Q6GH 3GHEH 3PP3K 1KTLA 4XVUD 3UBXB 1RZGB 1DDHA 2EC9U 5ABDE 4ORGA 4K8RH 2F58H 4XHJD 1NCDH 3CFEA 3K2UH 1EO5A 4WW2B 3RWFB 4AJ0A 5L9DL 4ZPTA 4XZUA 1MUJA 4OZFG 3WNKA 3UBXI 4EXPX 1WWWX 4X7CC 5DD3H 5C08D 4M43H 4WUKH 4FFYL 1H3TA 3SDCB 3TCLA 3ARFB 1I85A 2FHBA 1R5VB 4JFEA 2P43B 4JN2A 4KJQD 4KJQC 3VD3A 1S7SA 4DUVA 5HGAB 4XNUH 4ZFOB 3DURB 1WBXB 2NZ9D 5D1ZD 5HVWA 4OCSL 2P5ED 5GQBA 4JAMA 4HJ0D 4BQ9A 2C9AA 1U9KA 3L9RA 3NGBC 1NKRA 4KKAC 1SJXA 2DLFL 4Y0GA 1KJ2B 2VLKB 3QXWA 4V2CB 4LPXA 4RGMC 4XMLH 2BRRL 1LEKA 1CIDA 3H3PL 1J87A 4G8EB 2EECA 3HB3D 1FO0H 3HB3C 3T0EB 4NN6C 3I6LE 2XY2A 3GMMB 3CNKA 5F7DB 1VSCA 1HXMB 4KJWD 4KJWC 2CRYA 1K5NB 2P49B 3LQAL 5E2WH 1SJHB 2P8PA 3QA3A 1IBGL 3MNWB 1KTKE 1LP9F 1ZANL 3MBXH 3LQZB 3SKOB 4YFEA 3ULVL 4XPGL 2YZ8A 5EOCL 3TFKD 4HUMB 3TFKC 2DQHL 1WF5A 2AEPL 4R3SA 1KEGL 3NFSH 4AG4H 2DQTH 5I9QC 1V8HA 3TJHD 2VUOA 4AZ8A 5TE4H 1CR9L 5HGGS 1KNOA 3E6FB 5I76A 1B0WA 2X4SA 1UKQA 3E3QA 1RAMA 1GGIL 4NHUE 4N90D 2WINA 1DP0A 3O9WC 3DPBA 1U8QA 5LGHL 1FZMA 2Q8BL 2W38A 3DVGA 1NFDE 2VH5H 2SEBA 3Q5YA 3O3UN 1MCOH 3RWDA 3T04D 4PLJD 4PLJC 2CR3A 3MV9E 1S9XA 5GRXG 5DUMH 2GI7A 4KKNA 5D1QB 4CVZA 3FFCD 1T1ZA 2X5PA 3G04B 1AGCA 2G75A 1AQDA 3EFFB 1MNUH 4U6YB 2AEQL 4HK3J 2DKSA 3S3SA 2FJFA 3ALWA 3F12B 4LSUL 3FMGH 2DQCH 3ERYA 2ED8A 1FVDA 4NSKB 2GYSA 4KXZH 2D9CA 1OT1A 4JFDD 2JIXA 4HIJA 4Q2ZA 5I18H 3DMMB 4FFVD 4FFVC 2R0LH 5IFHH 1F11A 2ZNWA 1MHEA 4EOWL 4MWFB 2JCCA 2NTFB 4ZMAT 3RUGE 1BJ1J 4RNRB 1I8LA 5DGQA 1D6VL 3KGRA 3ZHLA 2CH8A 5DI8B 4RDQF 5TF0A 4Y1AA 3GRWA 4PJCB 4AYFA 5B38A 1G0XA 2DLGA 4QRTA 3HUJA 3OPZH 2HRPH 5L7XH 3TM6A 5I19L 1UB6B 1OF2B 2FNBA 5EZJA 5HHVL 4QRRA 1T5XB 2CQVA 2OL3A 2R1XA 3VI3E 4RGOL 1YEKL 1PLGH 3FQXA 2A6JA 2AXJA 1U58A 1ZHKA 5E8EA 3T2QA 2B0SL 3GMRB 4LBEA 1IAIL 3HNVH 3L5JA 1T80A 1EXUA 1T6VN 1JGDB 4QTIL 1DQML 3S3JA 3SCMA 5HYSG 4ELME 3T2PA 4XNZC 4HS6B 4GG6E 1CG9B 1K3IA 5AD0A 4JJHA 3K4DA 2FR4B 5EIVA 5M7QA 4CGTA 4L8CA 1GYAA 2I60L 5GGRY 1BIIB 5J6GB 4QHUB 4LSTL 4PRIB 3T4YB 3LOWA 4PJBB 3QXUA 1P4IH 1A2YB 3VG0L 4L3EE 2WUCH 1Y6MR 3LS4H 3QEQB 4HFWA 4MHHG 2X41A 4HC1L 1V05A 4I9WD 4POUB 1T21B 1FFQA 2YA0A 1I1CA 4TRPL 4YDLB 1U8HA 4QOKB 3VFWB 3D9AL 1X6LA 4LLVA 4ISVB 3TA3B 1A6VH 4I5BA 2OZ4A 5IF0B 4ZFFA 5CS7A 4LK4A 4NQCB 4QHLB 1ADQA 1NAKH 1QFUH 5T3XE 2AJUL 2ESVB 5CIPB 1G7JA 4MCYA 1UG9A 3U1SH 2XG5A 2HVJA 2M26A 3ARPA 5FHAL 1JPSH 3RY5A 3ULSA 2VKWA 2HP4A 2BJMH 2L4OA 3VH8A 2UVEA 2R0ZH 3KWWB 2DYPD 3BT2H 3MPCA 1TPXB 1FYTE 5JORA 3V7MA 5ANME 4IDJH 1MFNA 4U1KA 1K6QH 5CP3H 4ENED 4ENEC 4X6CA 2EH8H 1BVKA 2J5LC 1K85A 1DUYB 2ARJB 1NKOA 1BBDH 4I0CC 1T6WA 4GW5A 4P2RE 1QVOA 3QDAA 3I6GA 4BK4A 3LKRB 4G6JL 4OIIL 5I6XC 2A6IA 1JGVH 3UP1A 2KZWA 4XNYH 3DROB 4R4FL 3AMKA 4Z7UF 4LCIL 2E6PA 1T7XA 1FORH 4TNWK 2X40A 3DVNA 4JO2H 3NPSC 1KB5H 2BOCB 4TSCH 1YEIL 2HLAB 2WNGA 4Z7VB 1QLEL 2Q7NA 1EFQA 4H25A 3MLTA 4PB0H 2Y72A 3DJ9A 3DX6A 1ZHBA 1LO4H 4M5ZH 5E99H 4N68A 4ONHB 4F2MB 1OB1A 1BM3H 4P0DA 1AP2A 1KSRA 1J10A 1Q9LA 4PDCE 1T04A 1HOCB 4BFEA 1PKQB 4QRSB 2B20A 1JNNH 2CDEB 5L88L 4P2QE 2K7QA 2DM7A 5EOQL 3OTTA 1YMMB 5C6WH 2FDBP 4CU6A 4OSUL 2R2HB 3ELAT 4XMKH 4QYOA 1CBVL 3TPUA 4AEHL 4JFEE 1AXIB 5HPMA 4HS8H 4I0KA 4Y5YC 2YXFA 2NLJB 2Y5EA 4HCRH 1MCKA 4F7PA 4CW1A 4J1UB 1GZQB 3BKMH 3MXVH 3RNKB 5E56A 4XBEH 2PYED 4JCLA 4UIMB 5BVPH 3U79A 3MSPA 2VLJD 6FABL 2QV2A 2YRPA 3PJSA 2VZ3A 4XI5C 4XVJL 1ZLUK 3SDDD 5I73C 3SDDC 4FXLA 4JHBA 2NW2A 4DKEL 5I16A 2NXYD 4TPRH 5ETUB 5C7XH 5FM4A 5GGSA 3L3OB 5TDOB 3JUYA 2CLZA 4HKBA 4DVBB 1H3XA 1MRCH 3MUGA 3L95B 4MJ2A 1U8PB 1L0YA 4KRMB 3W0WA 4N0YH 3INUH 3MRCB 2Z31A 3QIWD 4M8QA 3O2WL 1B0RA 1CICD 3FB8A 1CICC 3HZVA 3VGHA 4KH2A 3B43A 2VITB 1FNFA 5DMIL 2RQ8A 5DYOA 1JRHH 2BNQA 2XPGA 1MLCA 3G08B 1QRNA 4Z78A 5DD0L 2A1WL 1NGQH 4XVTL 2V5TA 3C5ZC 3PL6D 3BWAA 3LRSB 3PL6C 5FYKD 4QRPD 3GMOB 4JDVA 5DC0A 3HC0A 5DK2B 5LCVH 1VACA 3E3QE 1JTTA 3L5XH 1YY9D 1G7MB 1WCQA 3D87B 3ROLA 3BDYL 5BV7B 3CPLB 3RWEA 1Z0MA 2B4CC 4AL8H 2BSSA 4UOJA 5IP4A 4PV8A 1MCLA 3BGFC 4M7KL 2FX8H 3C08L 1BOYA 1C7SA 1OD9A 2KDGA 4IRZL 4JFHE 3L3GB 5DRWA 4OLEA 4PRPD 4G9DB 1O7SA 5E5MA 1DQJB 3IETA 4X83A 5T5NG 5FO8A 2YEZB 4RQQA 1A7OL 1F4WH 2CDFA 1BBJA 3C09C 5TFSH 1I1AC 3QUYA 4YXLL 4IJ3C 5M94B 5A16B 3B3IB 3B9DA 1XT5A 3FO9A 1IQWL 5F1IA 5KW9L 1WLHA 3P4MA 1OLZA 2ITCA 1CXIA 1FV1A 1REIA 3BKJL 3IFNH 4CJ1A 1RK0B 2P5EB 2X9YA 3DX7B 2X4TB 3C6LA 3KYMB 4HMDA 4WW2F 2WY3A 5HGDB 4LSPL 2WSKA 3HE7C 5KVMC 3ULUE 3TNMA 2CMRH 1YMHB 4HFUL 3V5KB 4RGMB 3WJLC 3TBYB 2OXHA 3QO1A 4Y1AE 2Z8WC 4QF1B 3HUJE 1RMFL 2AEWA 5CJ8A 7FABH 4YHMH 3QG7H 4PPTA 3RWJA 4NN6B 2ITDA 1D5IL 3WE6A 1FVCA 3SE8L 3BHBB 5JMRA 5IW1A 1FL5A 3H7BA 4U33A 4Y7MA 3VW3L 4PGEA 2OP4L 4XAWH 1OAUH 1AJ7L 3IKCA 4TQEL 2WBJC 3U2SB 5FYJE 2WUBH 1HDMB 1JUFA 4W6WB 5F71A 2DQFB 3BH9B 3RWHA 5KSUB 2AJ3A 3P4OA 2X44D 5I66B 1QA9B 4YGVB 3IDIA 5I8OL 3BD5A 4HIEA 2DDQH 2CRZA 2VWEC 3IXTB 3QEHA 3L1OL 4OLYL 3LIZH 1S5IH 4LDOB 2BNRD 3GGWB 1EEZA 1RZIB 2FHFA 1S7XB 1UXWA 3DWTA 1JN6A 4JEGB 1U8KA 4APQC 2IQ9H 3CSGA 3WFHA 4HZAA 2YMXH 3TVMC 3O3EA 4F8QA 2ZUTA 4GMSL 4FQQB 2OS7A 1X4XA 1LEIB 1CDBA 5DZOA 3NBNA 1Q1JH 3O9WB 3VFMB 5I1IH 2ADFH 3D48R 4XNMB 1BOGB 1PVHA 4NM4L 3U36A 4KDWA 2QHRL 3G5YA 1XGUA 3ARDC 3MZGB 2PXYD 4OLVH 3FB7A 5GGQH 1CT8A 1G9ML 1S8DB 1AD9B 5HI5C 5EU5A 2J88H 2VDPH 2XWJA 1JHKL 2R2BB 3MRHA 4MDIB 4E41D 3QQ3A 4OKDA 1DCLA 3QHZL 1ED3B 4HDIA 5F7WC 3ULVD 4F7MB 5BRZD 2YS4A 1QLFA 1KJ3H 1M6OA 3HS0B 1LE9B 4YHZH 4LSRH 4JFDB 3K0WA 3BAEH 4LAQL 3UTQA 1V3LA 4NKDB 3HR6A 5GRZA 4MXQA 1RZFH 4HUNB 1AH1A 4ONFL 3S88L 1MIEL 1NEUA 2HTLD 2HTLC 1U92B 3BMWA 4HUWB 3UPAA 3QRGH 4KVCL 4FRWA 5C2BH 3H8NA 4NT6A 2F5BL 5AUMA 4C56D 1M7DB 4QRUA 5HHQA 2DQJH 4BUGA 3GKZA 3U9PH 1IRAY 1IEHA 1IC4H 3TH3T 2YUXA 4GKSA 1KFAH 3W9DB 5AEAA 5IJKC 3CZFB 2I25N 4PRDA 4HJJH 4N0UB 3WLWD 1JE6A 3WLWC 7CGTA 5C0DA 3ZSTA 1KYOK 5C86A 4PJ9D 4PJ9C 3VGAC 4U1MA 1JV5B 4ODWB 4C83A 2IPTL 5IEKB 1KJMA 2GJJA 1YJDH 2DI7A 3JV4B 3EFDL 1KENL 3WS3A 2DLTA 3WHXA 1BQHA 3P73B 3OKMA 4C59B 4PJCF 1DN0A 5C0ND 1Y0LA 5J3HD 5C0NC 4XNZB 3LSOA 1VPOH 2Y9RT 3KPPB 5HTSA 1OARL 4ERSH 5D2LA 2YUZA 3ALXA 1HQ4B 3JWOL 4M61B 3W82A 1YC7A 5IR1A 2QADD 1CK0L 2QADC 2A73A 1N3NA 3RL1A 1JNLH 4WI7A 3BIKB 5F3BA 3QUMA 3CX5J 1U93B 1P4BH 1A7PH 2HVKA 1ZSDB 3DUSA 4OZGA 3CU7A 3TJEL 3VXUE 4LPTA 4IEFB 2ZCHL 3JV0A 2F5AL 4XP4L 4ZO6A 5CEZE 5DXWA 2AQ2A 2ZWLT 2D03H 5DLMH 5IBLC 1LO0H 4EUPA 1IGIL 1KN4H 2HFEB 3QI9C 3FRUB 4XWGH 4OF8A 3BEVB 1OCWH 1U8NA 2FBJH 4DKDC 1JZ2A 2QKIB 2UV3A 3PWVB 4JVWA 4R2GD 5HDLA 3O4LD 1INEH 4EXKA 3EHBD 3EHBC 3NA9L 2P7TB 2WIIA 5T5FH 1IILE 2BSTA 3CDFA 4XXCA 1NBZB 2JB5H 5GRJL 5AG8A 1S78D 3WFEL 3UTSA 2LAAA 3IDMB 4L8SC 3RZCC 4K7PX 5I1LB 4UUJB 4PS4H 3HR5B 4J23A 3T09A 1RU9H 2J5LB 3MLSH 3OR6B 4HHAA 5E2VL 4ZFZA 3U9UA 3GNMH 1FL3A 2D7MA 1DANT 2IALA 4M1DH 3OGCA 5EOCJ 3P9MB 3KYKH 2H3NA 4XP5H 5HHPA 3G6AB 4F57L 1SYVB 2FYYB 1A6WL 2BNQE 3R06B 4NO2B 4ALAH 3ARED 4MJID 3AREC 3NCJL 4X6BB 1CFBA 5DFWH 4QHKI 2FX9H 3VFRB 4NHCL 2X1PA 4N5EC 5C0BD 4MAUL 3E6HB 2CUMA 3Q3GA 1D6EA 5EOTB 1D5XB 5J13C 3QEGH 5CZVL 4R4BA 2G60L 1DBKL 3S34L 3QAZC 3RAJH 4JE4B 3GSNB 1FFOB 5FUZH 3UZVB 2ADIA 3CFCL 1QR4A 4LNRB 5JR1H 5TH2B 5C0JA 2FO4B 2EKSB 1R24A 5F21B 3X3GL 3GSQB 3HE6A 5BO1H 2IH3B 3KPSB 4BZ2H 2H26A 3T3ME 2EDRA 3KG5A 5BJTA 4IOSD 4P4RA 2MKLC 4PJ8A 5ID1B 1T1XB 3H2WA 2IANA 1IQDB 4Z7VF 2ZNXA 4CNIB 2NX5D 4K3EL 4MNQA 5DJ8A 1N0XL 3VFGL 1M71A 3N85L 3MCKB 2HT2C 2VLRA 4Y5YB 1QD0A 5IOPB 3X12A 4ZNEA 1G7IA 3EYOA 4U1NA 3DOSA 4JPIA 4GOSA 4UDUB 1S9WB 2FH6A 1F3JA 4PRHB 1RUMH 2DQUL 3V6FA 4ZTOH 5JIKA 3KPOB 4N9GB 4PR5A 4MQXD 1RIHL 3H9HA 4MQXC 3O3BB 4KRNA 3BYTA 2AP2A 2A6KB 3SDDB 5ITFA 1EUUA 4O5LL 1H3UA 4FQCH 4KRPD 4Z18A 1KCRH 2NXYB 1KB9J 4AIZA 3PWLB 3ZKXB 1T22B 5DK0A 3M17B 4I3RH 3QWRD 1GJIA 2BHUA 3DUHA 5EG6C 1PY4A 1JL8A 3D0LB 3QJFB 3VFTA 3MQIA 3LPFA 4KI1A 1BEYH 2LFGA 5EU7C 4MQSB 3JVGC 1CICB 2ZUSA 1DBBH 1OP5K 4D8PA 3RFZC 2W60B 5IHUH 1EAPA 1EGJL 5K9OB 1MJ7H 1ZLWK 1MWAH 2D0FA 2EIBA 5I1EL 1IKNC 4XPHH 3O45B 4DFHA 3A6CL 3MUY1 3PL6B 2Q8AH 2GUOB 3VXQB 3GRWL 4PP1D 2CPCA 5IWLC 1KLUB 1CGTA 1EBPA 5DJAB 2MCPL 1JK8A 5J11C 3NVQA 2AK1L 1PFCA 3QFDA 3UTTA 5D2NE 3H0TA 1HKLL 1NLBL 2OTUA 1IC7L 3BGFB 4WFHE 2OL3L 1ITCA 1KIRA 5FYJL 1IGCH 2NY7H 3OAUH 2VIRA 4LCYA 2R1YA 4PRPB 4G5ZL 1OLLA 3OG6B 2PO6C 1R5WA 2WBKA 3F62A 4NRZB 1IGFL 1CFVH 3C09B 1BFVL 3FB6B 1LDPL 3OKLB 3IAPA 1V7NL 3GJEB 5D93C 1R3LB 4N8VA 1PBYA 4JRXB 1O5DT 1N64H 2DMKA 3BGAA 1YYLL 1MFEH 1VA9A 1J9CT 3QULA 1LNUA 3H9YA 5D96C 1MJUH 2Y4SA 3MX0A 5E7FA 1JPGA 4P3CH 4LQFL 1F2XK 2VQUA 3D18A 2BX5A 3HE7B 4X6FB 2O5ZL 1U6AL 3IF1B 3SE3A 4Z5RB 3I6LD 2OZ4L 3WO4B 1RK1A 3SPVB 4Q74A 4S10A 4PLNC 1ZEAH 1ADQL 1XGYL 3B6SB 3WIIL 1ZHLB 3TBVB 5CD3A 3S35H 3D39A 1C16B 3T4AA 3VD7A 3F6LA 2GTWB 2XKUA 2WBJB 1KOAA 5H35A 5EA0H 1T20A 1UENA 5IFJA 4Y2DD 4HH9B 4Y2DC 1MAJA 3MRRB 1UQSA 2F53B 2VYRE 3QYCA 4MAYC 1T03H 1MHCA 1QBLL 5E9DA 5HJ3A 3WN5B 1DQQB 3HFML 4ETQB 1A1NB 3LKPB 3ARXA 3EGSA 2XN9B 1DQDH 3O3DB 4HK0A 4XP6L 3GZKA 2BNRB 1P53A 3ILQC 5D2LE 1Z0NA 4KAQH 4V3DB 1IT9H 1V3KA 3JTSB 3D85D 4XX1G 2VTFA 4ZOCA 5CJOH 5T3ZL 4WTWA 2VDQH 4HIXL 3MRPB 4U7MA 1KJ2H 3FB5A 1QEWB 4TVPE 2RHEA 4I48B 1VENA 4HX1A 4ZAKD 4ZAKC 5INCA 3EIFA 3MV9D 3NAAL 4OZGE 4WI4A 1T66D 3ARDB 1VGEH 4G3YL 3FFDB 4QXUL 2C1PB 1AFVH 1I7RA 4NKOA 4RFOH 2P48B 8FABA 2Z8SA 5BZWA 3FN0H 2OK0L 2A0LD 4OCXH 3QIBC 5EPMA 1NEZG 2YSSA 4GUPA 5E94B 1UJ3A 4E41B 1VKXB 1K4DA 1WFNA 5DD1L 5GSVA 5LBSL 5BRZB 2CRMA 3MREA 1PD6A 1JF1B 2X4QA 3NFNA 1GC1C 3RWIB 3WV0A 4J6RH 3NZHH 4QTHB 5JQ6L 1VERA 1XF3A 1EMTL 1YEJH 3RIFK 3I50H 4XRCB 3MLVH 1N0LA 3UTSE 2IPUK 5BMFL 3W39B 1WTLA 2R39A 1P2CA 3RU8H 2K7PA 3T65B 2NY2D 2OR9H 4ODHL 5T33H 4X7TA 4C56B 4GQPH 1NEZB 1BD2E 4OUUB 5CEZL 1HH6B 5HYEA 1W72A 5AAWA 2ZCKL 3I02B 2EDWA 4HGMA 1F3RB 2NY5H 2ZCLL 5AZEH 3L5WB 2D7TL 4KQ4L 2F74A 2HJKB 4K94L 1G9MC 5IB5B 1ZLSL 4I2XE 4KTDH 4PJ9B 3VGAB 5JW5B 4R97C 4L5FL 4QRQB 3HCVB 3OKNB 3NCYP 1JWSA 5K9QI 4HUVA 4DN4H 1N59A 4DOHB 3QQNA 1MCIA 1G9NH 2G2RA 2V2XA 3MJ7A 3WNOA 2ICWB 3PQYA 5EZOL 3ROOA 2PW2A 3O0RH 1Y6KR 1WISA 3P0YL 3LKSA 4NUJA 4HAFA 4JFQA 3BKCL 4KK8C 1WK0A 3C60D 2BMKB 5IJVA 3HZKB 1DL7L 3AM8A 4BKLA 4LEOB 2IPKA 4DCQB 3DI3B 1MCSA 1GXEA 1E4WL 2QADB 2DQIL 4LLYA 4MZ2A 4PJIB 5ESAA 4OZHA 3G6DH 1OGTB 4TULH 5F1NA 1JPTL 4WENB 3L5IA 1RJYB 2YKLL 2DMBA 4ZUTB 2IANE 3S98A 3L3KA 2V5SA 1MCEA 4ODTH 1NAMA 1U91A 1P7KA 2IADB 5DJDA 1OD7A 3MRQB 2XKSA 1JWUA 4LSVL 2I9TB 4OCYL 4ZNEE 1ZA3B 5F7YC 2AEIT 4AH2B 3P0GB 4XNQB 1BX2B 4YAQA 3TYFA 3HMWL 4JRYA 2G9HA 2JJSA 3GMNA 1BP3B 2EYSB 1BQLL 3FAWA 4FS0A 4PLKD 1AGDB 1SEQL 32C2A 3FL7A 2WWKO 3PGFL 1GVIA 3CSBA 4I4WB 4P3DB 5FO7B 3O4LB 1YEDA 3CCHB 2FGWH 3QUZA 3IDGB 1T2XA 1K8DB 2ZSVA 5INDB 4UINH 4L8SB 3KXFD 4GAYB 4HIIA 2FD6H 4XC1H 4O58H 1CFNA 3JWOC 4PRAA 1S3KL 3FHQA 4S11A 5JOPE 4GT7A 4P23A 1SBSH 1JGLH 5MEPA 1F6AB 1I9IL 3OL2A 3DECA 3FT3A 4Q58C 2QQNL 3LN4A 2R29L 5SWQA 1MRFH 1QRKA 3GSUA 1A3LL 4PJXA 4JDZB 4F7EB 3VFPB 5CIPH 5GSRA 1OPGH 4X6EB 3AREB 3GO1L 3MRIA 1YEGH 4OBRA 2XZAH 5C6TH 5J1TC 5IMOA 2YR3A 4UT7H 2Z93B 4KKLD 3V0WH 4R0LA 4FQJH 3VFUA 5J13B 8CGTA 3OAZH 1KPVA 4JB9L 4QT5A 2A83A 4JY5L 3C8KB 4HH8A 4NM8L 1TQBC 1CZ8L 4OT1L 4RMSA 1KV3A 3FQRA 1K8IB 4OM0H 5GGUA 2X6MA 4QO1A 1LO3L 2K1MA 3FO0H 4JFED 4Y16A 4U1GC 3C9NB 1KCVL 5BVJA 2VE6A 5E8PB 5AZ2L 1DVFA 5AAMA 1QFWI 4NKQB 1M05B 4ZXBC 3O11A 4IM8A 1WGOA 1YN7B 4FZEH 5DA0B 3WL9B 4DEPB 4FFZH 1N7ML 3FT2A 2CKBA 4PJFB 1NQBA 5KJRH 4UDTB 3ZL4H 4KPHH 1UCBH 3MLZH 1AGEB 5D72H 5M95B 3UPRA 3PUCA 2MQ0A 4KGJA 2GT9A 3OAYH 3QUXA 4KMQA 5DJ0B 1ZGLP 1KIQA 4UILH 5E95B 1VESA 3C8DA 4KRPB 1F4XH 3I3DA 5TE7H 2OSLA 4N9OB 2D2OA 1L9MA 2D31A 4RCAA 5FYLE 3IDJA 3MJGX 4EEEA 1ONQA 4YBHA 4KGLA 3D39E 1SYSB 5JA9A 1NPUA 1CLCA 2ERJC 1I1FA 3PGDA 2Y06H 2ED9A 4U6HA 5FGRA 4TN9A 3WDIA 1O0VA 5FK9B 2YWYA 5DHYA 5GJTL 5DQ9B 4LPCA 4LSQL 5E9DE 5DR5H 1BGXH 1TTGA 1Q9OB 4HWUA 4NOFA 3VXNA 3VXOB 1HHHA 3SKJH 4GSDL 1HHJA 4OZFA 3GB7B 3E3QC 4YDIH 5ICZB 2B1AH 5DJZB 1F4YH 3I9GH 5ICXA 2OJEB 1HCVA 1U95B 5DMGC 3S5LA 3H42L 1PG7W 4XP9L 4NUGH 3E8UL 1DBAH 1T3FB 3DYPA 4M6NH 4WI8A 1NGWA 1H5BC 2WV3A 4MVBA 2HAZA 5J11B 1IEBA 4JFHD 1U8MB 1OGAD 4ZD3L 3W5MA 4KZEH 1W8NA 3KPTA 3NTCH 5FHBL 3H3BC 3S6CA 1MCBA 3NN8A 3RJDA 4ZUUA 4KUZH 4WU7B 1FFNA 5FGCB 3V8OA 4JHWL 1RZJL 4OD2B 3WXWL 4YHKH 2H6PA 1KPRB 2HKHL 4L3AA 2JIXD 4Q0XH 4P5MB 1P4LA 4QNPF 3ZHDA 2V6HA 3B2VL 1T7ZA 5CCKH 1G0YR 4LRNL 3EYQD 1I8LC 2XYCA 4I0PA 2EO1A 3TIDA 3ULUC 1UM6L 4TVPL 5D96B 5DEGA 3QUML 2XFXB 4FQ1H 3TBWB 2H9GA 1OT2A 1S7UA 5TQ2L 3L7EA 1TZIA 5D1XA 4KHXH 5E08H 5TQ0H 1T0NB 5BV7H 1ZKAA 2L7UA 2IBZY 4TUOB 2W0FB 3MFFB 5EUKB 3VRIB 4WU5A 2X1WL 2R0KL 3N1PC 4QRRD 4NC1E 3AU1B 4BYHA 2UYLA 2OR7A 4YXKL 3HRZB 3VU2A 5FYJD 5ACZA 4M6AA 4JFOA 3FHAA 3AY4A 3T1WA 1JNJA 1Z2KA 2G5RA 3SCMD 2VR5A 3PIQA 4PJGB 3SOBL 4Y2DB 4RX4A 4Z77A 2PCPA 5IFAL 3DGGA 3RVVD 5F3HB 4WRLA 4Y5XA 3PQYE 4QGYA 4C58B 1VFBB 3VE0A 4LHUA 3U7AA 1CD1A 1G7PB 3EJZC 1F00I 3HI1B 1JNHB 2ORBH 5GISH 4NHUB 4Z8FL 4KZDL 5EC1A 2R23B 3D85B 4PJEA 1C08B 3D3VA 4Q6IB 1YYMH 2JB6B 1UFUA 3GSWB 4L4VA 4B41A 1MREL 2EDJA 3WD5L 4E0RB 3DV4A 2BOBA 4NBZB 12E8H 4OZHE 3MJ8B 1A3RH 3QCUH 1JZ7A 2QSCL 1CS6A 1J1XH 1RZKL 4ZAKB 3B8SA 5DUPL 3MV9B 4L8DB 4NO0A 5KSAA 5MERB 1R3JB 4BFIA 4Z76B 4ONGH 1A8JH 3NZ8A 4LGPB 3TNNB 1FZOB 5AYQA 4KKCD 1P7QA 3CC5B 3IJHB 4X98A 3BEWA 4X99A 2GAZB 2CJUL 5FA4B 3O4OC 1EEQA 2HWZL 4Y19E 5F9DC 1I3VA 4TTDD 4TTDC 5DMKB 3RUGB 3GMLB 4PD4K 4P2YA 3A67H 2JJTA 2AAVA 3MLRL 2R9HD 4JJ5A 1UEYA 3KDMB 3QH3B 2NCMA 5T3ZD 4DAGH 2W9DH 4K23H 5HYSA 3UYRH 5ESQB 1X5IA 1Q38A 4FXKA 1NL0H 3OX8A 5E0QA 4UTAL 1TJIL 5CMAB 4YDVA 3AFLA 4LLUB 3LN9A 3I3BA 1XGTA 4FZ8H 3BSZH 3DO7A 1QLRA 1KCSH 4XCNB 2A9NL 1NFIB 3RVWD 4U7SA 3RVWC 2PR4L 1HNGA 3IAGC 3WKMH 2XZZA 1IEAA 1NGXB 5JHDA 4ELMB 4I8DA 4M3JA 4YPGB 4GG6B 4GMTL 2GITA 2A9ML 4X4YB 2J8OA 3HI6L 5F1OB 5JZ7D 5JZ7C 4PP2A 1KBGH 1JI1A 2VXUL 2J4WH 1DZBA 2XNAB 2H1PL 3QDJE 3LHPL 3HMXA 3G5ZA 2R0WL 4RA0C 4ZS6D 2DKUA 1HHKB 4ZS6C 4L3EB 2ZJSL 5EBLB 5CEYA 3WEXB 4AMKH 4WI3A 4AEFA 4JZOA 2PTTB 4DGVL 4XCYB 1U2CA 4MD4B 2HT3D 2HT3C 1TQCB 1A1OA 2AJYL 2JKXA 1IGML 5CEZD 3FZUD 2A74A 3FZUC 3PV6B 4HEPG 2GK0A 4QHMB 2WW8A 2GTZA 4PRBA 2AGJL 4Y89A 4JVUA 3REVB 3TWCH 4KTEL 2P44B 2XWBA 5FDWA 1PQZB 4KK9D 5DZLA 4KK9C 4X9GA 5F7LB 1JHLH 4XTRC 2XKNB 5IVOA 1MCWM 4AEEA 3KJ4B 4G8GA 3PWNB 4PJIF 3BPCB 1XR9B 3BN3B 1U3HA 3TZVA 1UM5H 5EC2A 5ID0A 4C55A 5KG9B 5F9WB 3I75B 3W0WD 1AGFA 1PGRB 5E4IA 1J5OL 3D6GA 3VXRA 1SY6L 3B9KD 2Z31D 2Z31C 3IJYA 4PTUA 1KN2L 3KXFB 1A7RL 2LTQB 1TJHH 4P99A 4KDVA 4P2RB 2YN3A 4H0IA 4GRLC 2BNQD 2R4SL 3QQ4B 1QRND 1E4XI 4KMTH 3LKQA 5IW3A 2BSED 1MF2H 3HG1A 2HFGH 2E7LC 3T0VA 3EO1A 1FIEA 1FBIH 4ZOAA 3JV6A 3MRLB 4XC3H 4OLZH 5CWSA 5DVMA 4LLMA 5F89A 4LSSH 4JO1H 3L7FB 4NO3B 3UAJC 1EHNA 5IIEA 3Q6FB 1EZVY 3OF6D 3QEUB 1KTLB 1DDHB 3ES6A 2GK2A 3OV6A 4ORGB 3CFEB 4OD1H 4NWTH 4N1CA 2V7HA 4ZPTB 4HBCL 4XZUB 1MUJB 5D8JH 1TQBB 3X11A 2OCFD 3SGDI 2AK4A 4BSVA 1C5BL 2DKMA 1N2RA 3QUYD 4NZTL 3QUYC 1FNSH 4OLWH 4ZS7L 4HIHA 3A6BL 3TCLB 1X5KA 1KACB 2ZUXA 3ZE1F 1XF5A 1MFCL 4JFEB 3RNQA 4JN2B 4PGCA 1S7SB 4M03A 1EIBA 2B1HH 3CLEL 2EXYD 3S37L 1NMAL 2EXYC 4KJPD 1X5JA 3DVFA 4E5XA 3AMLA 3C6LC 4JAMB 2HH0L 1KCUH 4PJAE 3GEWB 4AQOA 3VGGA 3RVXD 4ODSH 1OTUD 1WC7A 1LEKB 2APVA 5IMLA 1MHPL 3ESVF 1G6RA 3P4NA 4OGYH 3VGEA 3WNPA 1M1SA 1HILA 1M7IA 4WFGD 5C08A 3GSNH 4GW4A 1DBJH 4UV4L 3QA3B 1DBML 1ODAA 1QKZL 4HT1H 1HZHH 1OTSC 1UADC 1XF2A 1E6OH 2R2EA 3KPRA 1HYRC 4R3SB 3RKDD 2ERJB 3M8OL 3HLAA 5JA8B 4PJFF 3VXMD 5D1ZA 4BZ1L 4CVUA 2YC1A 4HKZA 1ZA6A 3WIFA 1KNOB 5FYKU 1D9KD 4M48L 5I76B 4Z7QE 2X4SB 3KVQA 1ZWIA 3EDDA 2WQRA 1A6TA 4PB9H 3V52H 1AXTH 2WINB 3NCCB 1W72L 4PJEE 5D2NC 3IS1X 3D3VE 4EI5A 1U8QB 2VAAA 2HJLA 2VERN 1FZMB 3BE1H 4L4VE 4ODXA 2RFXA 4J4PA 1ZE3C 3PDOA 3DVGB 4LPUA 1IZKA 3V0VA 2SEBB 5F1KC 3BOVA 4MSWA 3RWDB 2I5YH 1FNEA 1S9XB 1RZ7L 1CGWA 2FECL 4CVZB 1T1ZB 4BFGA 1AGCB 2IG2H 2G75B 1AQDB 3QCVH 3S96A 3H9SA 2FJFB 3H9ZA 4WW1A 5EU6A 3NCBB 1TJGH 3FONA 2ZKHH 4FQLH 3NPZB 1FVDB 3RKPA 3WSQH 2JIXB 4HIJB 4Q2ZB 1YEFL 2MJWA 1T1WA 4MXQD 4WY7H 4MXQC 2R15A 3KPNA 1F11B 4P4KA 4PJBE 3AAZA 1MHEB 1UZ6E 4OLUH 2JCCB 1MJ8L 2Q86A 5E6YA 2OJZH 1F90H 5FYKH 4QOKE 5HDBE 5JHLH 1EUTA 4NJ9L 4S1QH 4Y1AB 5B38B 4QRTB 4G6MH 1FDLH 3EO9L 3HUJB 2ZSWA 2FX7L 2CDGA 1WEJH 2ESVE 1NAML 1N6UA 1OP3H 4P2OA 5SX5K 2YZ1A 4K3GA 5MI0B 1QSFA 4KK6C 5EZJB 1WCBA 1INDL 4QRRB 3GK8L 2OL3B 4JCMA 1FPTH 4L4TD 5A2KH 2WWMC 2R1XB 3ARVA 4G7YH 4GAGH 3FQXB 4OUOA 1AE6L 2A6JB 3BZEA 1U58B 1ZHKB 1N6QH 2NY1D 2NY1C 1VEOA 4LBEB 4NCDA 4YWGL 3MLPA 5JDJA 1EXUB 1HWHB 3SCMB 5JHDE 4XBGA 4JKPH 4X4ME 3Q0HA 4JR9L 5AD0B 5DRZA 4WHDA 1AO7A 4L8CB 2DWDA 5HHMA 1WWAX 4OM1L 2YK1H 5KANI 4YHLL 1MRDH 4XNXL 3VH8G 4TVPD 4NBYB 5F9OL 5J56B 5ISZE 1L7IL 3D25B 4HFWB 3DNKA 5EZIH 1U8HB 2FATL 4CKVX 1RUKH 3PV7A 4IRJA 2Z92A 4LLVB 4PJGF 4I5BB 4NZUH 4ZFFB 1OQXA 4F9LA 4JPWL 3RZWA 1PZUB 3VRLE 1G7JB 2OLDA 4G6KH 4MCYB 3QHTC 2R1WA 2HVJB 4PY8I 4YC2C 3VA6A 5L9DH 1OL0A 3ULSB 5GXBB 2OI9A 5E03A 4CN4A 4WUUA 1XMWA 3VH8B 4JO4L 3O4OB 5F97E 1I7TA 4LP4A 4RISL 3KYAA 4FFYH 4XXCC 4GAFB 1F6FB 1NFDF 3TN0A 4OF0A 5JORB 3UTSD 5KTEH 3O6KL 1QBAA 4U1KB 1URLA 4X5XA 2PW1A 4W4NA 5DHVA 3ZYIA 3LH2L 4X6CB 1BVKB 2KBGA 2V17L 4OCSH 3VXRE 2P24A 3P30L 4OI8A 1X9QA 5E2TL 4GW5B 1QVOB 1QHOA 4JFPA 3I6GB 2BRRH 2A6IB 3H3PH 1NGYA 1RZKC 3HG1E 1JHTA 1FZKA 4MA3A 1CU4L 4X4XA 1EV2E 4OI7A 5CKAA 3RUGF 3DVNB 1PYWA 1FSKC 4O02L 4FNLL 2DYPA 4WHCA 4PV9A 4H25B 3MLTB 1IBGH 1U3ZA 3DX6B 1ZHBB 1ZANH 1OB1B 4XPGH 2OBGA 2AEPH 1AP2B 1Q9LB 2DBLL 4TNWF 5B3JE 5EBWA 1T04B 3ORJA 1MCCA 1IGTA 4CN6A 3HE6D 1CR9H 1HH9A 3AB0C 3HE6C 3VI3F 4M62L 3BKYL 1Q72L 2BZDA 1KTDA 4KDTA 4PJ8C 2VAJA 1E28A 3BESR 4I77L 4HW6A 4HEME 1GGIH 4QYOB 5IBTL 1YDPA 4MNQD 3TPUB 3VXUB 4RMTA 4ELMF 1WICA 5TF1L 3U0PA 5HPMB 3DTXA 3GKWL 1N5AA 4R9HA 4GG6F 1S9KC 2VLRD 3A0OA 5LGHH 2Q8BH 4F7PB 4JQVA 4CW1B 2EDYA 3GBMH 3VCLA 1J1OL 5E24E 5C6PB 1NMCC 4GQ9L 5CILH 1ZT7B 3FQUA 3QNZB 5L2KA 4FP8L 3PJSB 4Y4KD 4H5SA 5MP6L 3OJVC 1NUNB 2AEQH 2NW2B 5I16B 3VRJA 2CK0L 5BW7A 3LB6C 4LSUH 5GGSB 4MDJA 4P46A 4LDLB 2CLZB 4HKBB 1NGZA 4AEIL 3MUGB 5TGBA 3ZKQD 5C08E 3W0WB 3TO4A 1KJVB 1NGPH 4EOWH 2EYTA 1VADA 1X44A 2Z31B 4M8QB 4QXTA 5LJYH 1B0RB 3FB8B 3HZVB 3OG4B 5IM7A 3HZMA 5DYOB 4WHYH 4JO3L 2LU4A 2BNQB 2ENSA 2XPGB 4Z78B 4YHYC 4TUJA 1QSEA 3BWAB 3C5SA 4MXVF 4MNGA 5I19H 4JDVB 3HC0B 3V4VL 1IM9A 5HHVH 5I2IA 1VACB 1TITA 3KHOA 2WMPA 5KVEH 3ROLB 4RGOH 5CP7A 5DZNA 1YEKH 3RWEB 4PJ7A 3UTTD 1FE8L 2BSSB 2VB5A 1BFTA 4PV8B 3PWUA 5CINL 1FZJA 5TJWK 2B0SH 1CDHA 1IAIH 5KBNC 3EYFA 4QTIH 1DQMH 4JQIH 5DRWB 1F13A 2XT1B 3QIWA 5E5MB 3FCTA 3IETB 3UJJL 4AM0A 4CUCA 5C9KA 5FO8B 4RQQB 2CDFB 1Q9WA 1BBJB 2I60H 5IKCA 4LSTH 3QXTA 4DQOL 1OAQL 3QUYB 4I18A 1X4YA 2LVCA 3UPCA 3FO9B 2X4OA 4R4ND 4FHBD 4LHJB 5EU6E 5F1IB 3V79C 1AGBA 3P4MB 2ITCB 3DYMA 2BHZA 2DRUA 1FV1B 4HC1H 4QRPA 4M6ML 4IHOA 3OB0K 4TRPH 5C07A 1HCFX 4W70A 3IAQA 3P0VL 3KNBA 3C6LB 4KRLB 1G1YA 5E5RB 3GBLA 5L8LB 3PP3H 4GO6B 3TNMB 3SE3C 5ADOL 3KLHD 3E2HA 3KLHC 4D0CA 3QO1B 1JZ4A 5FKAB 3VXSA 1RZ8A 5FHAH 1FGVH 1X5ZA 3Q6GL 3RWJB 5E6IA 1MIML 1CDYA 4OAWA 2ITDB 3WE6B 2F58L 1VFAB 1NCDL 1Z9SA 1FVCB 3IS0X 1QSFE 1T7YA 3FFCE 2P5WA 4WDIA 1FL5B 5IW1B 3D39D 3H7BB 1P7HL 4FQHA 4UMGA 2XWTA 5IGXH 4Q9RL 4JZJA 4PGEB 2FL5A 2X42A 2BHYA 3IKCB 5LWYH 3C2AH 1JUFB 1QFWH 5DD3L 3RWHB 4WUKL 2AJ3B 2W65A 3P4OB 2VL5A 3UYOD 2CLRA 4LIQE 5E9DD 3IDIB 1TZGL 3GM8A 1J12A 5FO9A 1UXSA 4JQXA 3QEHB 2X89A 3RWCA 5LQBL 1EEZB 4XNUL 1UXWB 3KR3L 5A3IC 1JN6B 3MA9L 2AJVH 1U8KB 1P5VA 3WFHB 1AO7E 4FTVA 4G6JH 3O3EB 4OB5L 4OIIH 5DGRA 5I75C 1YECL 5F7EL 4OQ1A 1AI1L 4R4FH 4G42A 2IPUG 4PJHA 3QXVA 2Z8RA 5DSCA 4NQXA 3B9AA 3U36B 4B7LA 4P5TC 3G5YB 1XGUB 1QLEH 3FB7B 5GRVK 2COQA 2FEEI 1CT8B 4HQQH 5EU5B 5DFVC 2AXGA 1LEGA 1TVHA 1CQKA 4JG1L 3MRHB 5J4MA 1UJ3C 1C1EL 4G8IA 5KVDH 1GHFL 3QQ3B 5HI4D 3NH7L 1VHPA 1TZHA 4HDIB 2KPNA 4IOIA 5EU4A 5ADPL 5EORL 1QLFB 1M6OB 3BWUC 4WUUE 3GSOA 5DJXA 1U36A 5L88H 2QQLL 2NNAA 4ZQKA 4OSUH 1CL7L 3UTQB 4JFZH 2R56H 3VDBA 1CBVH 4XXDA 4LLQA 4AEHH 2YD4A 1RUPL 2JK5A 1FLRL 1A6UL 3BPLC 1MH5A 4B0MM 4NT6B 5AUMB 2EDXA 4QRUB 5E1HB 1DR9A 5HHQB 3EYVA 2PXYA 2AJXL 4JPVL 4RZCA 4KI5D 4NC1C 4GKSB 1KC5L 3QG6A 1E0OB 5J7CC 6FABH 4WEUD 4XVJH 1MCOL 1CLZL 1C5DA 4PRDB 2Q87A 5I1DB 1QBML 5C0DB 3MOQA 1UWEH 4DKEH 4U1MB 25C8H 1MY7A 2JCCF 3O8XA 1ZOXA 4C83B 4FABH 1KJMB 3ULUF 2NY1B 3WS3B 3WHXB 4G59A 4JRWA 4KKBD 3PQYD 1BQHB 4LHQB 5DJCA 2KZ1B 3OKMB 1CI5A 1DN0B 5E2JA 1Y0LB 5I18L 4EUPG 1SQ2N 3LSOB 3HUJF 5FAAA 5T1MA 3VWKA 1OW0A 2DM4A 5D2LB 5DMIH 1B4JL 5CHNA 3AM8C 1RJZA 5DD0H 2A1WH 2DQDH 5IR1B 4XVTH 4UT9L 1I8IA 2FWOA 1N3NB 2QSVA 2D0GA 5F3BB 3QUMB 4PBVC 1UM4L 2ZUVA 1TTUA 3F58L 3FT4A 3QIUD 3OPZL 3DUSB 4D9LH 1EFXA 4OZGB 3RVTC 1U2HA 4E42A 3BDYH 4LVOC 1KULA 2X7LA 4M7KH 4K3JH 1FG2A 4EUPB 3C08H 1A02N 3EOTL 5JXEA 4IRZH 4IMKA 2C4XA 1PLGL 2YWZA 3KS0H 4PJ5D 4JRYD 4R26L 1WWCA 2AQ3A 2JJSC 1U8NB 2Z35A 4YC2B 5TE6H 4K71B 1LDSA 5I71C 5JIHA 2VXSL 4PJDA 4IIQC 4NYLA 5DD6A 3MRKB 5GS0L 4U2YA 3ARBC 2WIIB 2BSTB 3EZJB 3QUZC 3HC3L 2P8MA 1IQWH 5KW9H 3UTSB 2DM3A 2BCKA 5EULV 2DS4A 3B4NA 1IGJA 3BKJH 5J1SC 4P23D 5DD5L 4P23C 5J57B 4HHAB 2WUCL 1B88A 1YY8A 4ZFZB 3U9UB 1FL3B 1EVUA 2NYYC 2NY3D 4PD4J 1NLDL 2NY3C 1X5GA 2AI0L 2IALB 4LEXH 4LSPH 3OGCB 4XAKD 2H3NB 1JRHI 2RJMA 5ALBL 5HHPB 2YUWA 4GRMA 1RMFH 1QSEE 1L9NA 2PYEE 3ZDYE 5B8CC 1FFRA 1TFHA 2MQCA 3V4PH 2VLJE 1AIFA 1EVTC 3SE8H 5AYUL 1FSKB 3WKNA 3VW3H 1G6RL 1JPSL 4X6CF 2OP4H 1AJ7H 4TQEH 4I3GA 1D6EB 3GI8L 4ZO8A 2EIEA 4PJ7E 1X3DA 2YOCA 4R4BB 1BF2A 4WI5A 3EJJX 4DN3L 5I8OH 2EH7H 3BZ4A 1MFBL 2JJUA 2ADIB 4BJLA 4OLYH 4YO0A 5C0JB 3N50A 1R24B 3OHXA 1WZKA 3CLFH 3AB0B 3HE6B 2JF1A 2H26B 4Y16D 1A7BA 4Y16C 5HD8D 3DETC 5BJTB 3S37X 2NTSP 4P4RB 5IESL 4GMSH 4PJ8B 3BDXA 1I7ZA 2ED7A 3GSXA 2IANB 4OFVA 5L6YL 1K3ZA 1DVFD 2GHWB 1DVFC 3L3JA 4MNQB 1IAIM 4MJIA 5DJ8B 1KEML 4K3DH 1M71B 1RFDL 2VLRB 4QRPE 3CVHA 3X12B 2QHRH 5C07E 1YPZA 1G7IB 5C0BA 3EYOB 4JPIB 4JKMA 5GRVL 2BVPA 3BQUA 5CEXA 1F3JB 1G9MH 1QQDA 1NMCB 3V6FB 1KB5L 4TSCL 1HXMA 5FCUL 1BQSA 5GGTA 1BZ7A 3FO2A 4PR5B 4MNHA 4HWZA 1UVQA 1LO4L 4M5ZL 2Q20A 3QUXD 5ITFB 3VXSE 3P2TA 1BM3L 3QHZH 5IMMA 4PRPE 5DURD 1S7VA 3NCMA 5FF6A 3S8WA 3SDCC 4B53A 1NANH 4AIZB 1T4KA 4U6TA 5DK0B 3EAKA 2P5WE 2PTUA 3TT3L 1FGNL 3VFTB 4ONFH 1JI2A 1MIEH 3CMGA 4CMHB 1T5WA 2NX5A 4KC3B 4KVCH 4OJFL 2VABA 1EHLH 2VDOL 2YPKA 4HK3N 3V6OA 1R3HA 3GI9L 1NC4A 4D8PB 2O26U 1EAPB 3UTOA 2E9WA 4AK1A 3T8XA 4WO4A 1ZLUH 4FTVE 5EWIL 1LE5A 1P84K 3U4AA 4OCMC 3CSYA 2LV4A 3DHMA 3V6ZA 4N8VG 5ENWA 4MVBD 3MGTB 3DRQA 4MVBC 1JK8B 5SV4A 1GIGL 2IPTH 4UZGA 4XWOD 3H0TB 4XWOC 1ITBB 2OTUB 4CADA 3U4BH 1KENH 1WVZA 1TCMA 5HHXL 3HI5L 2VIRB 4LCYB 2R1YB 4BH8A 3WLBA 4YDKH 4LIQL 1OARH 1WFOA 4LVNC 1R5WB 1FH5L 3ZKMC 3LCYA 2CUIA 3T2OA 5JOFA 3JWOH 1KT2A 1N5YL 3PDGA 1CK0H 1F8TL 4N8VB 3WMSA 4XCCH 4GW1A 3L5HA 4I0PC 3QULB 3HPJA 1LNUB 4F8TA 2UY6A 3TJEH 2NY5C 3HNSL 3OB8A 2ZCHH 4XP4H 1JPGB 2F5AH 5LCVL 4HKJA 3VWJA 5ELIA 5D1XC 3D18B 5A2JH 2FB4L 2VDML 2KH2B 1IGIH 3T3MF 5I8KL 4PTTA 1RK1B 5D1QC 2ZP0T 4EDXA 1HI6A 5FKPA 2MSPA 1KLFA 3SGDH 4NN5C 3LN5A 1MQ8A 3PXJA 3AROA 5L2JA 1YNTA 4HWNA 4WNQA 1HNFA 2IAMA 3NA9H 5CD3B 3AY4C 3D39B 3T4AB 4MD5A 4XX1E 5JPNA 3K4ZA 1JGEA 3ULVE 3WFEH 5H35B 5J6GA 1T20B 4J2XA 4RX4D 2NW3A 1UQSB 2MQ3A 2D4FA 2J1KA 1JYXA 1MHCB 3CDYA 3VXPA 5E9DB 5FFLA 2XA8L 1MFDL 2EC8A 5E2VH 5H37H 2DLIA 2GW5A 3QEQA 3EGSB 4LHUD 4G8FA 4HK0B 3S97C 2VISA 4X7FC 4YHOL 4LL9A 5I8EA 5ITBH 4F57H 2VJXA 3D3VD 1A6WH 5JIPA 5LGKA 1YNKH 5I75B 2NXZD 4L4VD 2NXZC 3BW9A 5E8NA 1X5HA 3VGBA 2HKFH 3FB5B 4XGZA 2D7QA 3NCJH 2GSIA 5E70A 2VXTH 4NHCH 4M8VA 4HX1B 4DZBA 5INCB 4P5TB 1XGQA 2BY1A 4MAUH 4YHML 4NO0D 5JW3L 5KSAC 4FMFA 3JZ7A 5HSFA 1I7RB 4NKOB 2C4FT 3GIZL 5D7JC 8FABB 2G60H 1DBKH 5BZWB 4D9RE