5HGAA

Hla*a2402 complex with hiv nef138 y2f-8mer mutant epitope
Total Genus 77
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
77
sequence length
274
structure length
274
Chain Sequence
GSHSMRYFSTSVSRPGRGEPRFIAVGYVDDTQFVRFDSDAASQRMEPRAPWIEQEGPEYWDEETGKVKAHSQTDRENLRIALRYYNQSEAGSHTLQMMFGCDVGSDGRFLRGYHQYAYDGKDYIALKEDLRSWTAADMAAQITKRKWEAAHVAEQQRAYLEGTCVDGLRRYLENGKETLQRTDPPKTHMTHHPISDHEATLRCWALGFYPAEITLTWQRDGEDQTQDTELVETRPAGDGTFQKWAAVVVPSGEEQRYTCHVQHEGLPKPLTLRW
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system
molecule keywords HLA class I histocompatibility antigen, A-24 alpha chain
publication title Effects of a Single Escape Mutation on T Cell and HIV-1 Co-adaptation
doi rcsb
source organism Homo sapiens
total genus 77
structure length 274
sequence length 274
chains with identical sequence D
ec nomenclature
pdb deposition date 2016-01-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00129 MHC_I Class I Histocompatibility antigen, domains alpha 1 and 2
A PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5hgaA02
3.30.500.10 Alpha Beta 2-Layer Sandwich Murine Class I Major Histocompatibility Complex, H2-DB; Chain A, domain 1 MHC class I-like antigen recognition-like 5hgaA01
5E03A 5GRVK 4OZGF 1OGAB 5CJOL 4FNLH 3E3QC 4IRSC 4Z7WE 5BW7A 3OG6B 4KK5D 3QEHA 5FYLH 1GJIA 4HQQL 4OCWH 1N8ZB 1MRDL 1T2XA 4YDVA 3WFDL 5IMLA 5L9DH 4ONOA 5I1DA 2O5XH 3BP6A 3T1FA 3BH8A 4PJIB 4HV8A 5C8JA 1QO3A 4YHMH 4AIXA 1FCCA 4R4FH 5FKPB 3DTXB 5DRWB 3OWEA 1HIML 1WZLA 4JQXC 3IDMA 1S7VB 1MRCL 2BSTA 4Y88A 4P57A 3WLBB 1YEKH 3QHFH 5EZJA 4I0KA 1ZGLP 4PFEA 1ZA3A 1JNLH 1IAOB 4OZ4A 3RUGB 5FCUL 5C6TH 3O3DA 3E6FB 4IHOA 4UQ2A 1VADB 4YC2B 5I76A 1A2YA 3FB7B 4M00A 1J0IA 4A6YA 4BQ8A 3UTQA 1JF1A 3HS0A 1D9KC 2OCFD 1AGCA 1UB6A 1TFHA 3RZCD 5FDYA 2GK2A 2YPLD 5C6PB 2X09A 1I8MB 1D5BB 4I4WB 4Y5XC 5L6YH 3BEWB 3CFIC 3PDOB 3UYRH 2WBJC 1A4JA 4GO6B 5F8RC 4G6ML 5DMIH 5F9AC 5ID0B 2EDWA 2Q7YB 3UTSD 1MAMH 2PKDA 3HMXH 5GS1C 5HBBA 1MY5A 1CL7H 2GAZB 1WIPA 3BD4A 1FDLH 1AP2B 5E0QA 4YNYA 3LKQA 3HE6B 2YD4A 4QTIH 4FFVD 4JDTH 3O8XB 1XCQA 4L8SC 4PJ5B 4ZPTB 3GIVB 1XGPB 4XXDA 4O51A 1UFUA 2J8UE 3UJJH 4LPXA 4G6AD 5EN2A 4Z76B 5I8CB 3K4AA 2C3HA 4C57C 4MXQD 1A7NL 3P9LB 4Y4FD 5JZ7D 3CSGA 1R24A 4KZDL 3ARPA 1MCKA 2XZAH 4RGOH 5IFJB 2R2EA 3QCUH 4KK8C 2DIBA 1TVHA 5DDHB 3RKDC 1EAPA 2YPKA 3VG0H 3PNWA 5A2LH 3NN8B 4W6YB 2AK4E 1QBLL 3P0GB 2Z31D 4Y4KA 3TPKA 1GPOH 3O41B 4K3EL 1IGIL 3KVQA 3LEVL 4HD9A 4M9OA 2HP4A 9CGTA 3DUUB 3GI9H 5HYQA 1C5DA 3B9AA 1T21B 3HTLX 4KVCL 4LMQE 1SYSA 2AW2A 2FHCA 1MPAH 2R0LL 2YMXH 3MJ7B 1OD7A 2AVGA 3ZL4L 4JRXA 5HVFB 1RUQH 3NZHH 3CDCA 3B3IB 3ES6B 3C9NA 3D0LB 4X6CB 4ZXBC 3X12B 4I3SH 5AG9A 4XT1C 3VXQA 5HGBA 4JFXA 4TNVK 1QLEL 4R7NB 4CVZB 3PL6A 12E8L 5C0AB 2FATL 1IGJB 4IRZH 1KIPB 4K3DH 3ZDZE 1OVZA 2VKWA 4PJCB 2V5YA 5D5MF 3WBDA 5CIPA 4GG6B 2PYED 5DS8B 1N0LA 3E8UH 3GSRA 4KXZH 1A1NB 4NGHH 1EHXA 5J06A 4LSVH 3QCVL 1J8HB 3IFLL 4DGVL 5IFHH 3I50L 1ZT4A 2GCYB 1QFWL 1A1MA 4LU5H 2WQ8A 4WHTB 1H0DA 2R1XB 5IEHB 1VFBA 1BVLB 1CFVL 1OP9A 1EH9A 2P48B 4KKLD 3SKNB 2XV6B 3CK0H 5E6IC 4JHAL 1KN4L 4Z7VB 4KROD 3NIDE 2V7HB 1KGCE 3O4LA 4Q9BA 3ZYIA 5JW3L 1KB5L 1H3PH 4KAQH 2FIRT 4FFWC 1HE7A 1JN6B 2EIZB 2IG2H 4PR5A 1T66C 4FFYH 5LJYH 3I3EA 5D1QC 3U4BL 3TA3B 3U9UA 4YBQD 4GS7B 3IKCA 2CLRA 1S5IL 1N64H 5DUBA 1BEYL 3CFDB 4ZO6A 5EWIL 1QOKA 4R96A 3T65B 5E8NA 5HYSA 4H20H 1NCCL 1Z9MA 4HCRH 4LCUA 3N50A 3TBTA 3QXAA 4QRPB 3MLXH 4E5XA 1HH9B 5E2JA 4K7PH 3RIAK 2P5WD 3IKKA 4X7TA 2C3XA 2XG4A 2WNGA 2ZCKH 4FZ8L 4NKDB 3DWTA 4NUJA 1CE6A 5E8PB 4GG6E 1CLZL 4XWOC 2X9XA 2Z8VC 3N06B 1IAKA 4M1CD 4TOYH 1YDPB 4QYOA 4Q2ZA 3TO4D 5IVXA 2RJMA 1J8HE 3ZYJA 1S9WA 3RKPA 2F9BT 5E5UB 4HKZA 2P24B 5KSVB 2IAMD 4LVOC 3I3BA 1OTUD 1T22B 3LN5A 1AD0B 3QRFM 3QIUB 4U6XA 2EDLA 4WI4A 3QZWG 2BHUA 4R7DA 3PV6B 1N2RA 1MJ8H 2BC4A 1FAKT 1D6VL 2D03L 5EOQH 1GAFH 2B4CL 4OZFA 4L4TB 4OD3L 5SWZE 2AJXH 4U1JA 3VGAB 3HPLA 1U8QB 1G0YR 4K7PX 1IGFH 3VDAA 1G7PA 3DX8A 1PG7L 4LF3B 5J13B 1T89C 1BWWA 2FO4A 5BVJA 1D6EA 1RI8A 5I1JH 5IB1B 5CSZB 3BH9A 3V8CA 3L3DA 1RZ8A 3IDJA 1NDMA 3WHE1 4F58L 1QPXA 3S5LG 2I9LB 4QRPE 3BQUC 4GBXB 1ZS8A 3AGVA 3CPLB 4FG6C 4G8FA 3RGVA 5I2IB 3G5XA 4OCSH 1QZ1A 1WT5A 1I7UA 4HFUL 3C8KB 5BS0D 4J8RB 1H8OA 5D1ZD 3ULUE 3FB6A 4I5BB 2DI9A 2CD0A 2K9UA 5E9DD 2HG5A 3GSOB 5IIEB 4V1DB 3PWNB 3D18A 1MHHA 4KRPB 3VFGH 2PO6A 4ODBD 4PJAB 3WMSA 2YWYA 2QTEA 1KLUA 4JO1H 4Y5VA 5JHDA 4CNIB 4H25B 1I3GL 2AXFB 4L4TE 4NZRH 3S88L 2QHRL 2OJZH 2KQMA 3PHOA 1OGAD 5DR5L 4M1DH 5C2BH 1TPXB 2CLVB 5IBUG 3PWPD 1NDGB 4PGBA 4PRBA 1YY9C 2B8OT 1L4IA 4YHIB 3H42H 4S0UC 1KNOA 5DTFA 3ZT5A 4KFZC 1LGVA 3MOAH 5GSRB 2R0WH 3T1WA 2VH5H 1MF2H 4MA3B 1DUZA 5CP7A 2F54A 4P23B 1FV1A 2ADGA 5KTEH 2IANB 4NO0B 3QXDA 5KANG 3ROOB 3EBAA 2BOBA 3HC0A 3PGCA 5CGTA 5FUCC 3TJHC 1A5FL 5DJ2A 2ZKHL 1OTSD 1U8JB 1JBJA 4Z0XB 3KDMA 4JPVL 4IJ3B 1FLTX 3HFMH 2H26B 1ZA6B 3O11B 5TDPA 2BRRL 3IJSB 3VXPA 1YJDL 4U1MB 1T4KA 1YEDB 3WEXA 1IGTA 4U3CA 5FHBL 1QKZH 4AQ1B 1ULVA 1HINH 2O5YH 1GVIA 3VFOB 1MIMH 1RHFA 4ZQKB 1PD6A 1HQRB 3WFHA 2DIAA 3W39A 4PJAE 1MHCB 5GS2H 3LQMA 4RDQF 4UDUA 3CLEH 1HCVA 2V7NB 1J0KA 4YWGL 5BZDB 5KSBA 1K8IB 4MAYC 1X3DA 1P4BH 4N9GB 2KZWA 2DLHA 4JGJA 3BDYL 1KB5A 2EYTA 4FQXD 3O8XD 5D7JA 4HGMA 3FRPG 3BKYH 4PJ5D 3HAEH 3HI6L 4LCYB 4NQDA 1HHIA 1LK2B 1CVSC 2Q86B 1J7VR 2CH8A 2BVYA 4UNTA 4I1NB 4OLXH 1ZLSL 3S36H 2CK2A 4KMQA 4BQ6A 4LCCC 4ONFL 3OB0K 1Y18B 2VLLB 3PDGA 3F58L 1AI1L 1EZVX 1CK0L 3DETC 4CBPA 3MLYH 4Z5RA 4NFCA 1G7QA 4XP9H 2G5BB 4HIXL 3LQAH 5CGMA 2QQNL 1V7MH 1CDYA 2HN7B 3V5KA 2VB5A 1JPGB 2JJSA 4I2XA 1D3CA 1JV5B 4PJDF 3L5WB 3RDTA 2NXZB 2AJZB 3DBXB 4Y4HA 5SWSB 1IL1A 1TJGH 5CEXA 3MA9L 3VXRE 4CUCA 4NQEB 3IJHA 3IFNH 3GO1L 2H9GA 3TH2T 1H3VA 2W9EL 4HMEA 1LO4H 1CGVA 4C54A 4WENB 1K3IA 3BXNB 5AZ2L 4JRYE 4LSQH 3EYQC 5HGDB 3RPIA 3O2WH 1U36A 1HXYB 2PXYB 4PJ7F 2VWEE 5EU4B 3S36X 2GFBB 1E4WL 4UTBL 5DEFA 3K2UL 5C0AD 1XH3B 4KHTH 4NQCB 1ES0B 5F93C 2QJDA 1ACYL 4M93B 4EKXA 5MI0B 5EO1B 3QEQA 1JPSL 1FL5A 4X9IA 5D2NC 1M7DA 1JFQL 1F58L 1WZ1L 1A7RH 3JBG7 2ITDA 1FC1A 1W0VA 1ZAGA 3SQOH 1KSRA 4HDIA 5D2LA 1KELH 3AMKA 1UZ8B 4GMTL 3FO2B 4P5MB 4ONHA 4N8VG 1RIVL 3MNWB 1TZGH 3TC9A 4P5KA 2OLDA 4NKMB 4NZUL 5D6DC 4G43A 5ADOL 5IMMB 4MXWH 5EC1A 4DVBB 4HZLB 4IMLB 7FABL 2LE9A 3OKNA 1XZ0B 3PP3H 5IF0A 1BZ7A 3UTPD 5F7YC 3UTTB 4MX7A 1J1OH 1RK0B 2YPVL 1L7IL 4E41B 1NCBL 2H3NB 3BKML 4WWKA 4JPWH 5B4MC 1DR9A 1U3YA 3LH2H 4G42A 5I1KH 4G8EB 2AAVA 5FM4A 2MNUA 3KPLA 5F96H 2YD3A 1FPTL 1OSZA 5C0FB 4NHUA 3TA3D 3RA7L 3MC0A 1DZBA 4RMUA 2IADB 1B6UA 3T2NL 3HNTL 4G9FA 3NZ8B 4ZUUB 3IDGA 2CDEB 4ZYKB 1K5NA 4NQCE 3D39B 4FQ1H 4JM4H 2XWTA 5K9QI 4WI6A 1LILA 1KTDA 3BE1H 2J5LB 5DD1H 5TGBA 1AY1H 1U9KA 1WBYB 2DYPD 4Y19A 4XAKD 1RZJH 3LVEA 1VEMA 1I4FA 3JWDL 2ESVA 4JFED 3QNXA 1PEWA 1FYTA 3P4LA 5D96C 2CUMA 5F3BB 2ZUUA 5DC4B 1MCWW 1HI6A 3QG6A 4KDVA 3CH1B 5JXEA 3TFKC 3KJ4C 2EDYA 2EYRA 2UYLB 5ANME 3MPCA 4YHLL 4PB0H 4DEPC 1WWWX 2RFXA 4FQHB 1QLFA 1QSFA 3WIIL 5T3XD 3SDDB 4EI6A 3VXNA 4HUWB 4KGLA 3QIUD 4PJ8B 5CBAA 4G8IA 3UJIH 4AEEA 1MEXL 2MWCA 4RGND 1JE6A 4HFWA 1FJ1A 1PBYA 1N26A 3GSNH 4QXWA 1VESA 5DT1H 3MRBA 5ICZB 1NFDF 4E41E 4XC1L 1BX2A 3H3BC 2VABA 3MLPA 1NGZA 1JUFA 4JJ5B 4GW4A 1MLCB 3JWOC 3NAAL 5LGKA 2R9HD 4PGDB 4QRRE 3B9KA 1CLCA 4LBEB 2KKQA 1LE9A 2DQTL 2FCBA 4EIZC 5I1LA 1S8DB 2GJZB 4NP4L 3A67L 4G6KL 5JR1L 5FM5M 4W6WB 5T1LA 3D2UA 1AQKL 1F11B 2M26A 1KJMB 4Y5XB 2EIBA 4X6DF 4O58L 3QPXL 5ESVA 1YN7A 1KLGA 3MV9A 5HDBF 4MDIB 5JIHA 5B38B 3REVA 1IC4H 3D39E 5CBEB 1RJYA 5BXFA 4GBXD 3TN0B 1CFTB 4HH9B 3THMH 5IBTL 4PJEE 4Q58C 3RVWD 1MQKL 5ADPL 1BAFH 5KS9E 4TVSa 3V52L 3BPLB 4MMXC 3L3OB 3I02B 3KPOB 1VHPA 4AEIH 3SDCD 1QSZA 4YDLC 4UTAL 1R3IL 3RWHB 2Z35B 3B9EA 3TBYA 4U1KA 3RAJH 4WNQB 4V1DD 4LLAA 1YUHA 1A3RH 3L3JB 3WXVL 2OR8A 5AZEH 3DGCR 5CCKH 4RAVA 5DUPH 1Z3GH 2GSGA 4X7CC 4XWGL 2HJFB 3ZTJH 4XVJH 4YZFE 1KUMA 5FO7A 3WNPA 1WGOA 1FN4A 3HUJB 1U41A 3PIQB 5HHVH 1DLFH 4GRLA 1Z5LB 4QNPE 3MBEC 5DJCB 5D70L 4UIMB 3QRGL 2E8YA 5DVMA 2OK0L 1O5DT 1WEJL 2V2XA 4XPAH 1NGXB 3EYSL 4Z7NF 1FZJA 5ITFB 3HZYA 5E6YA 3M17A 43CAB 1I9RH 3T0EC 2OM5A 4P23D 3L5HA 4HHAB 2BVEA 4K9EL 2IAND 1P84K 5T3ZH 3OXRB 4DCQB 4WV1A 5E8OB 4I18A 1F4WL 1UCBH 4AL8H 1NSNL 1T5XA 1UCTA 5EPMA 1U95A 3FO1B 5E1HB 1XGRA 1RU9H 3P3YA 3WUZA 4YAQA 1JYWA 4LSPL 1YPZF 3QUMB 5FO9A 4H1LG 2YEZB 2ICCA 4PYHA 5DHYA 1NMCB 4UBDC 3B2VH 4JM2A 4OM1H 2E3VA 1PQZA 4Z78A 5F7FA 5DZNA 2AXGA 4U31A 1DVFB 4QRSA 2G75A 1FZOB 4PJFF 3ZT7A 1RURL 3B9DA 3TM6A 4P3CL 4JKMA 3RY6A 2LU7A 2DTSA 5FAAA 4JLRB 4ZPVA 2BZDA 3HE7B 1XIWB 4KPHH 4LOUD 2CO6B 3O6LL 1ZVHA 5ICYB 1IEBA 5D7IF 4JAMA 5KAQF 3WCYA 2XKSA 3MRPA 4Z7UF 3BVNB 4BSWA 5DRZB 4K8RH 5E4EB 1P1ZB 4JFFE 3Q1SL 3CDGA 4Y16B 5ENWA 2R29H 1LK3L 3WFCL 3PHQA 4M7LH 5D1XA 1CE1L 1ORQA 2J2ZA 1WT5C 1NLDH 5F7EH 1CTNA 4YXKL 1I1AD 5IVOA 2PYFA 5EUOB 2Z0BA 5IMKA 4XCNB 4PJGA 4I0PA 1U3ZA 4GKSB 2CK0L 1FORH 3LIZH 3GB7A 4LVNC 3SE8L 3TIDA 1DDHB 3RNKB 2VZSA 1RULH 3QA3B 3ZKXC 5A2FA 3RX7A 2NXZD 2V6HA 3HHRB 4NC1E 4ODHL 5SWSD 2PO6C 4J1UA 4ETQA 4NNPL 4NQED 3V0VB 3RNQB 5E1AA 3FQRA 5TE7H 4B7IA 1YQVH 2HT2C 3G6JF 2WANA 4GQ9L 4FXGB 2XKNB 4LVEA 4C59B 4YGVB 1ZVSA 2YOCA 4FN0A 3ULVF 4X80H 4WW1B 2PXYD 4OGZA 5F7WC 5E99H 3W0WB 2R2BB 4WO4B 1FO0B 3P30L 2F53B 3O45B 5FYKL 3GMPB 3O9WB 4OCRH 1HILA 4WJ5B 3HLAA 4QOKB 1KFAH 3K4DA 5DA0B 2WY3A 2WLZA 3IJYB 3MA7B 1S9XB 4XPFH 1LQVA 3Q5OA 2AJSL 3PQYA 2R4RH 1OP3K 3KPNA 1Z0NA 3FB8B 5IW3A 1YMHB 2BNUB 5SWZA 5IJKA 5I74C 4YDJA 4UT6H 5CIPH 2VDKH 1TETH 2FD6L 2GI7A 3GMMB 3OF6A 4HXBL 5EUOE 3SN6N 2FZ3A 1PKQA 3Q3GB 2DM4A 2X40A 4HWZB 3QH3A 2E7BA 3MLZH 4CADB 4RBPH 5DZLA 2ZUTA 1MNUL 3UTTD 2XY1A 2NR6C 5GS0C 1YNKL 3DRTB 4XVSL 1MCQA 4EUPA 4AENB 3KR3H 4L9DA 4RMTA 4Z95L 3HG1B 7CGTA 3BEVA 3QUYB 1IQDB 1TMCB 1HHGA 5KVGL 3VXME 2ZUSA 5C0CA 2XOTA 1I85A 4ZD3L 5L2KE 5ILTH 4LRNL 3HMWL 3C5JB 1DQJB 1MJUL 5EU6A 5J8OA 3MV8D 4LFHG 4HIHA 1BVZA 1BZQK 5GIRA 3W0WE 1Q94A 4MA1B 1LO3H 3JV6A 3CMOL 3MLVH 4J2XA 2J7LA 3MRDA 3B2UD 5JXAL 1B9ZA 2GTWA 2EICA 1JWUB 4IRSD 4R26H 3CLFL 4XNQA 2JCCF 5CJOH 5FB8A 2F5AL 4ZTOL 3BZFA 2XTJE 5SX5H 3JXAA 4HQQH 2ZWLT 1MRDH 3WFDH 4N0RA 1F4YL 4PJBA 1YEIL 1HQ4A 2C3VB 1C5BL 1BD2D 4YHNB 5FM8A 4ZFZB 4GT7A 1HIMH 1P2CB 4U4BA 1BIIB 3ZE1F 3MRCA 5AG8A 1MRCH 4OF3A 4LPUA 4L4VD 5HDLA 5EBLA 4H5SA 1QTYT 1TDQA 5CZXC 5FCUH 1UWGL 1R3KB 3V95A 1F97A 4MA7L 1D9KD 1KJ2A 3VD5A 3GBML 4OZFH 2Y5EA 4C83B 1KXTB 5D7LE 3OKEB 3KXFE 2XWJB 3MV7A 2WBJD 1JGUL 1I8LA 3LV3B 2X4RA 2Y23A 3ZT6A 2AJVL 1KJ3H 4G6MH 5AUMB 2YA1A 1NAMB 4OZHA 1F90L 1T1WA 3TN0D 5C2UB 3K81A 1DQML 1LEIA 2CDFA 3MXWL 4X4YA 1TVBA 4X8JA 3P40A 1KLFA 3BW9A 3SDAC 3UJTL 3KPSD 2XPGA 4C4KT 5D93C 1I8KA 1J11A 1QEWB 3UC0L 1HDMA 2X4QA 1A7NH 4D3CL 4K2UL 4KK8D 4WWKC 1EXUB 3QI9A 3U4EB 2W91A 3RKDD 2Y6SC 2DKSA 4QT5B 1TNNA 2DLTA 2OL3A 4GKNB 3GHEL 1U8HB 4ODTL 5CSBA 3WJLA 4EEEA 1X7QB 3GMOA 3H0TA 3WIFB 3STBA 3KS0J 1QBLH 2VLJB 4LPWA 3V4PL 3GSUB 3QULA 3C8DA 4K3EH 4ESKA 1IGIH 5DHVH 1MCRA 3LEVH 5INCA 1VFOA 1WZMA 1NMAL 5C86A 5I6XC 1KIRB 1M7XA 5F88B 4JREC 5KSAB 4Z7OE 4MS8C 1GL4B 3KYMB 4KVCH 4ZXBD 5C08B 2R0LH 3ZL4H 4JVPA 4NOBA 4OIAA 1ZT7B 2P8PB 2LVCA 3QIBC 4X6FA 2DJ4A 1QLEH 2QADB 1GXEA 4FHBD 2DTML 12E8H 2FATH 3A6BL 3TF7A 2FJFA 4XVTL 1TZIA 3BT2L 5GRJL 5LGJB 1T0MB 3I85A 1BFOB 1GGYA 5C70A 3ETBF 4H0HB 4MCYA 3SJVD 3WNKA 4HKXB 4NO2A 3GMLB 3QCVH 4MSWA 3UAJC 5ERWB 3V4UL 5AEAA 4DGVH 3I50H 1DVFD 1QFWH 3Q5YA 5CHNB 4M7ZB 3FT4B 4XNUL 5GS0H 3BP5B 3L3IA 3K0WA 5C0GA 3RVUC 1UWXH 4XBGA 2YZ1A 1MWAL 1DUYA 1CFVH 3HE7D 5C0RL 3IU3B 4NDMA 43C9B 3WSQL 4EDXA 2IWGA 4JHAH 3QDGA 1F4XL 4WI9A 1KN4H 2BX5A 3FMGL 4W81A 3VGHA 3DRQB 3MFFB 1LMKA 4MJIB 1MFDL 5JW3H 1KB5H 3VFVB 5C0BB 4DQOL 3GSQB 5D1QD 3FAWA 2D31B 5DFVC 4HSQA 3X3FL 5C08E 3MNZB 4PTTA 5K9OB 4UU9B 3U4BH 5DO2D 3SGKA 2BERA 1QRKA 2K7PA 4CVWA 1S5IH 5CJXC 5EWIH 3U0PA 3EIFA 1AGEA 4OGAD 1D5ZB 1NCCH 3WO4C 4ODSL 1UC6A 5CILL 1F4HA 4HBCL 5D5MB 4YDIL 1T1ZA 2Q7NA 4XWOD 4P2QA 3FTGB 5BS0E 1KTKE 4PLJC 1BF8A 4FZ8H 1B0RB 4MNHA 2VR9A 3RWIA 4P4KB 1CLZH 3C2AL 1UZ6E 3LKPB 4L3EE 2H2PC 4NRZB 2VDNL 5DA4A 4N0CA 4DEPB 1SJHB 1HN1A 1XR8A 1YEHL 2HTLC 2AXJA 2BVQB 4GRLC 4JZOB 5T1MA 3ARSA 1A6TB 4WO4D 2EDRA 3AAZB 1R5IA 5A40E 5HHMA 1N3NA 3E2HA 4QOKD 3MRFB 1CXKA 5EZOL 3DV4A 1D6VH 2D03H 5H94B 4KK6D 4OD3H 3TO2A 3VXOB 5I1EL 3MFGB 3QDHA 4WV1C 3R06B 2HYMA 1PG7H 4K55A 4JVWA 3WO3B 3QDMB 4NFBA 4OJFL 5JW4Q 4WFFD 1G6RB 2A9ML 2XKUA 1ND0A 4WUUD 3BQUD 4UT7L 2DBLH 2UVEA 4JHBA 3VG9C 4HJGA 4F58H 4FG6D 2P46B 4F33B 1IMHC 3DARA 5KN5B 1XF1A 4RWYL 5J4MA 1V3LA 3VFPB 3SKMB 5A2IH 1OM3L 4YEFA 1FFQA 2C4FT 4RAUA 4R4BB 2Y9RT 3OJDB 2AJUH 3CC5A 1WTGT 1SM3L 2ENYA 3FCTA 5F1KC 4KDWA 4K71B 1DLHA 3BZEA 4MQ7A 1PG7X 4G8GB 2B39A 1VFAA 5HYEA 2HJKB 3NFSL 2EDOA 4L8DB 4Y2DC 4YFLF 5IB4A 2XA3A 1J1XH 1HKFA 1LQSR 2YD1A 4RIRA 5CJ8A 5D1XC 3RX5A 2VLRE 2DQFA 3S88H 1YY9D 2QHRH 5DD3L 3K8KA 5DR5H 4I0PC 4RFOL 1Q9OB 3IVKB 2Q1EA 4HIJB 4IIQA 1LO0L 3O4OC 2HTKC 5TQ0L 1V7NL 3MJ8A 3SE9L 5DWUL 4PGCA 1ZMYA 5GGRA 1WWAX 3LKOA 1QBML 4JFOB 3OSKA 2YD6A 2CRIA 5ALBL 3TJHD 4NT6A 4PRID 5JMOC 3B6SA 4R2GB 1NC4B 1A5FH 1DE4B 2ZKHH 5HPOA 5BZWB 4GXUM 2H1PL 3WKML 4JPVH 1MFNA 4ODWB 2D7NA 3FZUC 3ARGA 4PGJA 3VXSD 1YJDH 2HFEA 2VIRB 2DWDA 4URTB 4NZJA 1S9YB 5FHBH 2P8MA 1OOAA 1MWAA 1X5AA 3D3VE 4I9WE 1O0VA 3PDDA 1PEZA 1DL7L 1WAAE 2CO7B 1EX0A 3H9ZA 2R4SL 3OX8B 3U36B 2IH1A 1NC2D 5INDA 3VFMB 4QTHB 5HGHB 3GBNL 5IJKC 2H45A 1H3UA 1IKNA 1TCRA 2B7DT 3H3PL 4JFPB 3BDYH 1LO5B 1ACZA 3U6RA 4HC1L 3HI6H 1F8TH 1XGYL 3X3GL 5HHNB 1BQHB 4ZSOB 4GUPB 2C4FU 1ZLSH 3U0TA 4UV4L 3DETD 4TUOA 3L3GA 1AXSA 4ONFH 4HWEL 1PYWA 2ATPB 3F58H 4YQXL 1AI1H 1CK0H 3MREA 3I9GL 4HIXH 2WZPD 3AB0B 2QQNH 1UH4A 1I85C 1SJVA 2FGZA 3DMMB 4FQCL 2VLJD 2Z8WC 4M6NL 5FGRA 3VGEA 3MA9H 5B21A 1R5VA 4NQSA 1NGYA 3PABB 2Z93A 4JKPL 2X4NA 5KSAD 2VL4A 5E8EB 2W9EH 3EYQD 3AROA 1WF5A 2C7UA 2H32B 1OW0C 5AZ2H 3R0MA 1E27A 3SDXF 1FH5H 5DJ0A 5K59F 4E42B 3QUXC 5DJXA 4QWWC 3MROB 2WINA 4Q9CA 4N8CL 5CEZE 2AEWA 1E4WH 4M7LT 4UTBH 3K2UH 3VMOA 1P9MA 1DN0B 5KJRL 4MHHG 1ACYH 4LNRB 3PGFL 1NH6A 3AREA 5E70A 1JPSH 1NUDA 4NBZB 2UZYB 1MI5B 3HZVA 5CD5D 1JFQH 4XCYB 1F58H 1WZ1H 4MNGA 5J6GB 5EBGA 3CX2A 5KVDH 2NW3A 2DQUL 1WZKA 1U58A 5IM7A 1TITA 3MRMB 4GMTH 4KI5E 4YIQB 4LCWB 1HHJB 1RIVH 3B8SA 1NEZG 4E0RA 5ADOH 4NZUH 4IOFC 2CUIA 5CWSA 7FABH 4PJDB 5C9JB 2R39A 5BVPL 3EYVA 3MRIB 3OKMA 1I1FB 2P4AB 5B4MD 5KANI 1U3JA 5F9JB 4LLUB 1WFOA 3G6DL 2YPVH 1YECL 3LN4A 4GG8A 1NCBH 3BKMH 4MXVE 4DUXA 1P4LB 3ALPA 1MUJA 3CSBA 5I66A 5C0BD 2YUVA 4EBQL 4YK4C 4NCC1 1RIHL 4WGWB 5C07B 2ZUQC 5IB3A 1FPTH 5EFIB 4OIBA 4ZOCA 1NANI 3RA7H 3IDXL 4PJ7B 5HY9A 4N0UE 2GSIA 1I9EA 2AABL 4OI7A 3HNTH 3TNNB 3VH8B 3IGAA 5GSVA 3BGMB 5IFAL 3RZCA 2W0FA 2YPLA 4PGEB 3DIFA 2QQLL 3L9RB 3QQNA 2ED7A 4F7TB 1FQ9C 1FFPA 1S7QB 2JKXA 3QI9C 2EDNA 1REIA 4OSUH 3UTSA 3BHBA 3JWDH 4P4KD 3TFKD 3Q48A 1A6UH 2LU4A 3RGHA 1TQCB 3WJLC 3TJEL 4V2BA 4F9PC 4YHLH 3RL2B 3OKDA 4LCWE 2PETA 5F7DA 1N5AB 3ZE0F 1TIUA 3CXHK 3WIIH 3S3PA 3SBWA 5MEOA 1NBVL 4L3CB 4MXQA 3I6LE 4X5XA 3BN9C 1MEXH 4Y4FA 3EGSB 3RWCB 1CICB 4RGMB 3ZDYF 3RVTC 3WXWL 4JG1L 3ZKQD 3MSPA 2ADFL 5IV2B 2WV3A 4XC1H 1JYVA 4LL9A 2ERJC 1S78D 3NAAH 2Z4QA 3LHPL 5IJVB 3SCMB 4M6MH 4DGIL 4Z77B 4L8CB 2N7BA 4IEFB 5DD6B 3OKLB 5ACZA 5FYLE 4GH7B 2Z31A 3QDMD 1CFSA 4NP4H 4F7PB 3A67H 3GK8L 2BVOA 4G6KH 3RIAF 5JR1H 1BOGA 1KB9J 1AQKH 5ICXA 1CDCA 3VWJC 4O58H 3QPXH 1UB5A 3FOLB 3WN5C 2D7MA 1XAUA 3SE4A 1KCRL 3LB6D 1M05B 5CJQL 1EFXD 3LZFL 1B4RA 5E94A 1QVOB 3BSZL 3BO8A 4NYLA 5EU5B 4OD2A 2VDQL 4FFEX 3P11L 1KTLB 2UVFA 4HX1A 5IBTH 1ZTXL 1C08B 4HC1A 4KKNA 1EDQA 5LBSH 1A22B 1MQKH 4XMPL 4CDHA 5D72L 5DRNA 5ADPH 2BVPA 3V52H 2HVJA 4JZNB 1HHKB 5HJ3B 3B5HA 4UTAH 1R3IH 4EUPH 4WFGE 1V3KA 1DN2A 1CD8A 4FQQA 4NO5A 4HWBL 4OUOA 4MDJB 4OZIA 4G8GD 1P7KA 1YEGL 2PYEA 3WXVH 4UNVA 1FBIL 1BQHG 1H3GA 1Y0LB 3FQNA 1U8KA 5EORL 1F6AA 1NFDB 4P2OC 4F7MB 4WY7L 5JOFA 3EJJX 3VXTB 4XWGH 4XC3L 1SQ2N 3MBED 3ARBB 3JV4B 4N5UA 5D70H 5JO5B 1WWCA 2KDGA 3QRGH 4U1SB 2OK0H 4PTUB 4KY1L 1WEJH 3TBVB 1LNUA 4GRWF 1A6AA 1NCNA 2FBJL 3EYSH 2VXUL 3T0ED 3KPPB 4GMSL 2X1WL 1X4ZA 2MJWA 1E4XL 3ESVF 4KZEL 2B1AL 1TENA 1N7ML 1SHMA 4K9EH 2GHWB 3GMNA 5HHPA 4XZUA 4PB9L 3SO3C 2X1OA 1SYVB 1UJ3B 4N0CC 1F4WH 5L0QB 1NSNH 3IDIB 2L4OA 4APQC 1ZHBB 4JFHD 5C3TA 1Q9WA 1T83C 1XR9B 2P5EB 4B5EA 5IW1B 3KPQA 4WW2F 3S35X 3DJ9A 4UBDD 1T7WA 2P5WA 2PCPA 1U8NA 1DBBL 4YR6A 3E2HC 5F7MC 1C1EL 2BNRE 4B50A 1FRGL 1YMMD 5C0DB 2OR9L 4J3XA 5LGHL 2EYSB 3STZB 2BY1A 1E4KA 3TO4A 3RTQB 5IW6B 1RURH 4WTXA 1I3RA 4TVPE 4M61B 4P3CH 4OV6F 2IAMA 3U7AA 4L29B 1AC6A 4RMVA 2YRPA 5EUKA 3O6LH 1ZE3C 3WUWB 3W11C 3PP4L 2RHEA 3QJHB 2OI9A 1INEL 1L0QA 5C09D 1ZHKB 2O61B 2ICES 3DX6A 1UG9A 3Q1SH 3TNMA 2A38A 2I24N 2CKBL 1X6NA 1WBXB 2VITB 1S9VB 5FDWB 1LK3H 3WFCH 3P9WB 1HEZA 2OSLA 4JN2A 3BPNB 1GGUA 4LLQA 4NQXA 1DCLA 3VW3L 4O02L 1CE1H 2AEIT 1RJLB 1KPVA 3BMWA 4KTYA 4YXKH 4LKXB 3L5XL 2AXHA 5TDOB 2NY3B 4PJHF 2IGFL 2YK1L 5C7XL 2CK0H 5HXMA 4BH7A 1U93A 4F7CB 3SE8H 1YPZB 2P5EE 4ZFFB 2JIXB 1CLOL 4WIQA 4IMKC 5F7LB 2FIKB 3G08B 2OL3H 2NY1C 4ODHH 1ZANL 3QQ4B 4G7VL 3CIQA 5IR1B 3QXUA 3T08A 3RY4A 2HT2D 4DUWA 1QQDB 3V9FA 4GAJL 1JNHA 4NQVA 2CGRL 5AD0B 5BS0A 5L2JB 2DI7A 4PJFB 4AM0B 4KKAC 4OQ1A 4WFED 4PG9B 4MWFA 3TCLB 1MHEA 4C56B 4KKBD 2ICWA 2NZ9C 4GQ9H 3G5YB 4X0KA 5D1ZA 5KSUB 1GYAA 3NMEA 3U30C 5E9DA 3V4VL 1TZHB 1IGML 1FL3B 3MYJA 5D7IB 3P30H 4MB3A 4Y1AE 3VFSB 4Z7UB 3DVNB 3JTCA 5FYKH 1CDBA 4UQ3A 1CDHA 3RQ3A 2CIKA 3E3QE 4BELD 4OM0L 2P47B 3MGOA 3SKOB 4HJ0C 3Q5TA 3GMRA 5JOPE 3MRGB 2QSQA 4Z7WF 1UM4L 1ZGLB 5FHAL 5FYJD 4LK4A 5MEQB 1T04B 1MI5D 2OTWA 4OF0A 3P73A 2AJSH 5T1KB 4ACPA 5FGBC 1OGAA 1NGQL 3ECBB 3MUY1 3LY6A 3PWPA 3PWLA 5CAYB 1T2JA 1N8ZA 1T0NA 2FD6H 1LD9B 4RZCB 1I9JL 4HXBH 5D6CA 3ARGC 3P4NB 1BPVA 1RFDL 2NR6D 2I9TB 4PJIA 5CKGA 4Y5YC 1YNKH 3DTXA 4U1HB 5DRWA 2I60L 3EYFA 4ZDHB 1X9QA 4XVSH 5T3XL 3HCVA 3TVMB 4FQ2L 4NKOB 4Z95H 3RVXC 3VFRB 4G7YL 1T1XB 2ARJB 3JUYA 5C07D 3RUGA 3NCMA 2GY5A 3SKJL 1J10A 3CH8A 4R4NC 1VADA 1BVKB 5KVGH 2F8VA 1JHKL 4CMHC 1IKNC 4ZD3H 5BRZE 3UYOD 5E6ZA 4LRNH 3HMWH 3B9VA 3O3BA 1MJUH 3NGBC 5ISZD 5KZCB 4AEFA 3CAFA 4QRTB 3S5LA 3ZE2E 5HYJB 3CMOH 1BBJB 1I8MA 4I4WA 3BPOC 1NGPL 3BEWA 5C71A 15C8L 2NQCA 4M8QB 2A74B 3VJ6B 2Q7YA 1OCWL 3DECA 3QQ9C 2BXYA 4QXGL 1DFBL 4R3SB 3CLFH 4PJXA 3UZEA 5KVMC 2J8UF 5K9JH 2F5AH 5DC0A 1FVDB 3ARTA 1ED3B 5E5RB 4FQXA 5IHBA 3O8XA 3HB3C 3C6LB 4PJ5A 1OF2B 1F4YH 1AHWC 2AP2A 3LS4L 1XGPA 1YEIH 2HT4D 1VKXB 4BH8B 3NCYS 1C5BH 1ZWIB 5I8CA 3U9PL 4FTVB 4TTGA 3MRJA 4ZUVB 3OZ9L 3P9LA 1T03L 4TSCL 5IFJA 3FT3B 5DMJB 2ZSVB 5CZXD 5IKCA 2A73B 2IQ9L 3N9GL 3VWKB 1NCDL 5B8CA 1NCUA 3GZKA 2AKRB 1UWGH 3SCMD 3W9DA 2VZ1A 2DLGA 4PJ9B 4MA7H 3C5ZB 3HAEB 3GBMH 5KG9B 4MJ5B 4WI2A 2GTZA 3K1DA 4X9FA 3O41A 5CUSL 5IWLC 2ZUYA 3AREC 1VERA 1JGUH 4UDTB 3DUUA 2DOCA 5GRXG 4OF6A 1JHTA 2AJVH 4YPJA 5FV2A 1E6JL 2UWEE 3MJ7A 4JG0L 1F90H 3D69B 1YC7A 4XPHL 1DQMH 1YN6A 3ES6A 1AGDB 4X6CA 3ZDZF 2JCCB 2E8ZA 3SDAD 1SJEB 4KK5C 3BGFC 3MXWH 2O5XL 2CKBA 5C0AA 2VDRL 4TRPH 3UJTH 1KIPA 1T3FA 2GJ6B 4LSRL 1F3JA 3SJVE 1G9EA 3WS3A 3BKJL 5DQ9A 2OMBA 3TH3T 4S1QL 3UO1L 1KCUL 3UC0H 3EOAB 2Y6SD 4OLWL 3CSPA 3WHXA 4D3CH 1A1NA 5C6TL 3M1BB 3QFDB 1EO5A 4CRPA 2K3TA 1CFQB 1R3JB 2GCYA 3TZVB 1YY8A 5JUEL 4KQ4L 4LQFL 4ODTH 4WHTA 3QWOB 5HYFA 3NIDF 1V05A 4OV5B 2H2SC 3AS2A 5GGSB 3UYRL 2YXMA 4P9HL 3RZCC 4Z7VA 4X6BA 5DMIL 2SEBB 4MS8D 2V7HA 3MLSL 4Y0GA 3QAZB 1NMAH 4U33A 2L7JA 3F7VB 3QIBD 3BRFA 5BV7C 2CDGA 2DJSA 4JDTL 3UPRB 5GGQL 3TA3A 1JK8B 2HFFB 4OF8A 3KPRB 1P4IL 3FO9B 3IXTB 2DTMH 2X4SB 4JPIB 4PBWD 2DBJA 3A6BH 5FXCH 1MCSA 3O3AB 4XVTH 5JPMB 3BT2H 5GRJH 3LKRA 2A6KA 1JHLL 5H8DA 4XNZC 5KAQG 4GG6F 4Q6IA 3SBWC 1HH9A 3KWWB 3FFCD 1NGWB 2CIIB 2NY5C 3QCUL 2DYPA 1VACB 5SV4A 1LP9B 1U92A 4JFEA 4XP6L 2NTFA 1KG0B 3V4UH 3RTQD 2NY2C 3R0NA 1XGTB 2QR0A 1MWAH 4OQTL 5KSVA 2Z31C 5ESQA 5F89A 1KPUB 1K2DA 1EEZB 3LQZB 3MOBL 5C0RH 4WFHD 1AD0A 5K9KB 3QIUA 2YA2A 3D0VA 1F4XH 4ODUA 1RUAL 3FMGH 3CFBB 1BLNA 4UAOB 2YMXL 3KG5A 5FM5O 4XHJD 3SE4C 3PV6A 1J1PL 1T6WA 1MFDH 4HWNA 3C08H 4DQOH 4TVPL 1JRHI 3FN0L 5FA3A 4WTWA 3X3FH 5I8OL 1JPST 1KPRB 3OAZK 1DTUA 3VFUB 3VXUD 5T33L 1XF3B 3H7LA 4EOWL 1IRAY 1P7QB 5IB1A 1K4CB 1MCFA 3KPRE 1HYRC 2NY3D 4GW1A 3IDUA 3JTTB 3D6GA 4QCIB 3KGRA 4MCZB 1S7RB 4MVBC 5DXWA 2ADJB 4HUUA 1A1OB 4ODSH 2MFNA 5CILH 4PLJD 3GSNB 4HBCH 4YDIH 2I9LA 4GBXA 4PY8I 4WW2C 1XF4B 2RGSA 2B1HL 2NNAB 3V6OC 4BUHA 3ULUF 1QSEB 5I2IA 2WIMA 1LP9E 4LLMA 2P45B 3C2AH 4BFIB 1H15B 2HTLD 3C8KA 2E6PA 4GKOA 2LQRA 4J8RA 1EVTC 5D71L 4C56D 3U1SL 1YEHH 3SDCA 2Z92B 4OFVA 1L0XA 3GSOA 3O6FB 4B0MM 4V1DA 2EH7L 4HAGA 3PWNA 1AO7E 4KROC 3MRHB 4CW1B 1DQQB 5EZOH 1QA9A 4JFDD 3L6FB 1CD9B 4H25A 3DSFL 5I1EH 4U7SA 4KJPD 5T1KD 1LDPL 2FWOB 3C60C 3P4MB 1AE6L 4YBQC 4MNQB 4PV8B 2A6DA 1G7JB 2G2RA 3WN5B 1ZGLM 1KV3A 3QXWA 2HJLB 4HGWB 4OJFH 2XACC 2FYYB 1GIGH 4HUVA 5I73B 5B39G 5DJYB 2F8OA 2A9MH 4P5TB 5CFHA 5FUCE 5TQ2L 5EC2B 4PP1C 1O7VA 4UT7H 1NFKA 4X8XA 4KMLB 4P23A 3BIBX 3OV6A 2IANA 4XNYL 4Y8DC 3L3HB 4RWYH 4PRPE 4JRWA 4BSVB 5E08L 3TPUB 4M1CC 2QL1A 1MLBA 5IP4A 3TVMD 2VL5B 3BYYA 3F7YA 3QFJB 4IRJB 1OM3H 1QSEE 4PS4L 1E4KC 1EEYA 3TO4C 2VMFA 4P9ML 4KUCD 3VA2C 4X7SL 1EBPA 3T2PA 3MLUL 1U8JA 4G6JL 2HH0L 2X4PB 1OB1B 2HRLA 2ILLA 4Z0XA 4QHNB 3ULVD 1S7XB 1ZA6A 1OTUC 1SM3H 2HLFC 3EOBA 3IJSA 4U1MA 4PJAF 1YEDA 2OI9C 3QEHB 4FA8A 4Y2DD 3VFOA 5KVFL 4ZQKA 4D94A 5HYJD 2Y5TA 3NFSH 4R97C 2EDJA 4YDVB 4WU7A 3QHTC 3DYOA 4DOHB 3BP6B 1WICA 2NZIA 3OGCB 3T1FB 3BH8B 4HV8B 1QO3B 2V7NA 4CN4A 3UMTA 1FVEB 4N9GA 2BSTB 4RFOH 2HTKD 4P57B 5GJSL 1I3UA 1LO0H 4OZ4B 4BQ9A 4LCYA 4I3RH 3O3DB 4IHOB 4UQ2B 5TQ0H 5I76B 1V7NH 1A2YB 1LK2A 2APBA 5DWUH 3SE9H 3PF2A 3V5DB 2VDPL 4OCSL 4FTVD 2A9NL 1QBMH 2ICEA 4LRIA 4UILH 2E7LE 2E9BA 1AGCB 5ALBH 1UB6B 3RI5F 4CU7A 2V2TA 4W70A 2VLLA 2WUCL 2F74A 1I1AA 2AEQL 3IYLW 2MPAL 1KIQA 3QFJE 4EXKA 2H1PH 4AG4L 4LPYA 3C5ZD 1U3HB 2ZCLL 2Q8BL 4EN3C 3L5WA 1MREH 5SWSA 1Y6KR 1XCQB 4QHKI 3IF1B 4OQTA 4NQEA 5ETUA 1YEJL 1E28B 1M71A 4XXDB 5TE6L 5EN2B 1DL7H 4LAQL 2R4SH 1P5UA 1FLRL 3BXNA 4EQ2A 3VFWA 4EJ1C 3HC4L 2NW2A 5HGDA 3ARDB 1A21A 1R24B 2YBRA 1CXHA 3GBNH 3LEYL 1HXYA 2PXYA 5EU4A 3ILPB 3U4AA 3H3PH 4AJ0A 2UY6A 2WP3O 3OR6B 4DVRL 2GFBA 2R2EB 5HI5D 3MOAL 1XH3A 3HNVL 2VH5L 3JTSA 1ES0A 2YPKB 3PNWB 4HC1H 5EO1A 4MJ4A 1UXWA 1XGYH 3X3GH 5F6HI 2AQ1A 3MCLL 3QPQD 1OLZA 2QSTA 2X4UA 2P7TA 1PJ9A 4Y4KB 4D9QE 3CSYA 4UV4H 1B3JA 4QO1A 4HWEH 1U8IA 3EYUL 1RZ7L 2LTQB 4YQXH 3HFML 1UZ8A 1C5DB 3FO2A 3I9GH 4YPGA 3S4SG 3NFNA 1SYSB 3MNWA 4YC2C 5JQ6H 4JRXB 4YHOL 1A02N 4FQCH 4HZLA 4IMLA 2O5ZL 1XZ0A 3VXQB 4M6NH 2V17H 4JFXB 3WS6C 3UTTA 1IKFL 2R15A 4UINL 3PL6B 1RK0A 3EDJA 3MV11 3GHBL 3AS1A 3EO1A 5K9QG 4JPKH 3RHWF 4G8EA 3HRZA 4JKPH 2R1YA 4RMRA 2J12B 4NRYB 3QUXD 3SGJA 1WIUA 4QWWD 4ZS7L 3TT1L 3IRZA 3CFEB 5CIPB 1QG3A 5F6IB 3OAUL 2ID5A 3GSRB 4M1GL 3HE6C 4N8CH 1FNSL 3O8XC 4BQBA 3MV8A 1ZT4B 2YRLA 2EDBA 5A16B 1A1MB 4ZYKA 4Z7QE 1CGTA 4L9LB 5GGUB 4R0LB 4QRQA 1WBYA 1JTPA 1OP5K 4IRSA 4TN9A 4KC3B 5IQ9A 2XN9D 5JNYA 2DQUH 4ODVL 1G7LA 2YUZA 4DFHA 5TDNB 1MFCL 4QHMA 5ECJE 3CH1A 3WDJA 4UOW1 3RL1A 5LWYL 4FQHA 4I48B 3MTRA 3U9UB 2JJUA 3OKKA 4JRXE 1BD2A 1UJTA 4HUWA 2EDTA 3IFNL 3IKCB 1K9TA 1L7TL 2YC1A 1JTTA 3G6DH 1YECH 1QHPA 4PP2B 1CXFA 4Q9RL 3S3JA 5HHOB 4L4VA 3QXAB 3EDFA 3H9SD 3MX0A 4PRHD 4E5XB 4EBQH 1V5JA 1RIHH 4CMHB 3LN9A 2C9AA 4X7TB 3ESUF 3SDXB 1CT8A 1QRNB 1JVKA 3MUJA 3IDXH 1D9KA 1I7ZB 1S8DA 3UTOA 1FNFA 2EEDA 3FRUB 1IAKB 4F15B 2GKIA 3DURB 1EPFA 2XICA 2AABH 2OMNA 4BZ1L 4QYOB 3OB0H 1KJMA 3A6OA 4Q2ZB 4U6YB 4Y5XA 5HI3C 5IVXB 1S9WB 3V7AG 1CIUA 2E6JA 2VLKD 2WBJA 5IFAH 4PLOB 4PJEF 4MDIA 5B38A 2UUDH 1I7RB 4LSDA 5GS1A 5CBEA 5I1HL 5KS9F 3LN5B 4HUNB 4DKFL 3TN0A 1CFTA 4HH9A 3BJ91 2A6JB 3F12A 1CFBA 3IS1X 3QB7C 1OL0A 5DVKA 1GOGA 3RWDB 5CS7A 4YHYB 4HJJL 3RBGA 5F9OL 2BC4B 3NPSB 3JV0A 2DIJA 2EDDA 3O4LE 1IAII 4H0IA 4OZFB 5F1OB 1XGUB 4NNXA 3KPOA 2F19L 4NN7B 3KPSA 4U1JB 3HPLB 3TJEH 3UZQA 1RZFL 1RPQA 4K94C 2Z35A 2XFXA 3BN9D 3DX8B 1W72L 3O6FD 1IE5A 2OTUA 1NBVH 1PY4A 3RVTD 5BVJB 1PGRB 1D6EB 3BP4A 3DVFA 4YZFF 4UZGA 3WXWH 3IXAA 3L3DB 2ADFH 4QNPF 1BZ9A 1F4AA 3AC0A 5GPRA 3UXFA 3LHPH 3TA3C 1BECA 3FFDA 3NTCH 1F00I 1ZS8B 3HUJA 4BKLA 4GS7C 4G8FB 3RGVB 4PG2C 4MNQD 3VWJD 5DJCA 3GK8H 4UIMA 3MJ9L 2VQ1A 4GLRI 2P1YA 1FE8L 1NGXA 5IGXH 4HWUA 5ITFA 4P5TD 1G7IB 3M8OL 5IVXE 2J6EL 3QEUA 4G9DB 1KCRH 3P4OA 2HG5B 1ZLVK 1J0HA 4ZXBA 3LZFH 3QDJB 3CXDH 3BSZH 2VDQH 4WEUD 3P11H 3OXRA 1ZTXH 1DEEA 1MHHB 4P46B 4GKZA 4U2YA 4XMPH 5D72H 4IRJD 3ULUC 5MHSE 1D5IH 4Y5VB 5JHDB 1FG2A 4JHWL 2ZJSL 1JGVL 5DHVB 3PP3K 5EOTA 1J88A 3FN3A 3RWEA 3PHOB 4HWBH 3QIUC 5FYKU 3V6BR 2YEZA 4PRBB 4RMQA 1MCOL 1YEGH 3SJVA 1B6DA 2EO1A 4P2OD 1FBIH 2WUBL 2Z8RA 5IMOA 5EORH 1KNOB 3NIFE 4JY4B 4NQUA 4WY7H 3VGAC 2XYCA 1DVFA 1Q72L 2EDXA 1UVQB 3DUHA 3CFCH 4HW6A 1OQXA 1F2XK 3QXDB 5C09E 3DGGB 3HE7A 5AYQA 1V3JA 1G9MC 2OQJB 5FF6B 3PGCB 1P53A 3U7WL 2ZCHL 4KY1H 3BWAB 5DJ2B 3X17A 1S7WB 2PF6A 2FBJH 1IZKA 5JQHC 5ID1B 1JIBA 2VXUH 4M5YH 4P3DB 5DRZA 1P1ZA 4U1IB 3THML 3FQXB 5E5MA 5TDPB 4GBXC 5D1QA 3VXPB 4KZEH 2B1AH 5LG1A 1N7MH 3WEXB 1IGTB 4GOSA 1K8DB 1L6XA 3RVWC 2FL5A 3GSWB 4MAUL 4D0CA 4PB9H 4APQD 4AEIL 8FABA 2YD8A 4DTGL 3W39B 1IT9L 1N0XL 1YNLL 1JFMA 1Q0XL 5EBMA 4ELKA 5I16A 5JHDE 1WIOA 4GKSA 3RY5A 1GGCL 5LKNA 1FAIL 1U3HD 4RFNB 5CCKL 2D0HA 3RNKA 1SBBA 3QA3A 4K8RD 1MJ7L 5DUML 3ZTNL 5DUPL 3I6KA 4NSKA 4KRPC 2EYTB 3ARWA 3F8UB 1TTFA 5D7JB 1C1EH 3M07A 3V0VA 1FRGH 1HHIB 2X1QA 3RNQA 2OR9H 5HHVL 2G5RA 4AIZB 1Z2KA 2APFA 1WCQA 4FXGA 3MQIA 4BK4A 3ARDD 4YGVA 1TPXC 1F3DH 1CVRA 3MCG1 1I9IL 4EI5B 1G0XA 2F54E 4H8WC 2WK2A 3MLTA 4WO4A 3VD7A 5EZLB 2R1WB 4W6XB 3PP4H 3ZKNC 4GRMB 2BNQD 5H2BA 2JB6A 1G7QB 3O45A 1INEH 3D85D 3T0AA 4ZNEA 2NX5D 2MTPA 4WJ5A 1A0QL 2YD7A 4QOKA 3V5KB 4I2XB 4MD4A 4WVRA 2CKBH 3LSOB 3IJYA 5DJZA 4P23C 3RDTB 5HTSA 1IM9D 5I15H 4Y4HB 5EUOF 2A0LD 3CFKB 3FB8A 3VW3H 4O02H 1IL1B 4U1LA 2NMSA 2FH6A 4M3KB 3IJHB 3JZ7A 4P2RD 3L5XH 4X98B 2F5BL 4HK3N 4WHYG 1XT5A 2IGFH 2YK1H 5T5NG 1UXSB 2NY1D 3F7RA 5C7XH 4M48L 4WUUA 3BQUA 4HWZA 2X9WA 1H8SA 1CLOH 2JLLA 1CIDA 1A6VL 3FQUA 3MNVA 4O2EA 3DXAB 5KSBE 3SPVA 1ZANH 32C2A 3DRTA 4HKBB 4O5LL 4A6YL 4G7VH 3ZMRA 4JHZA 4FQPA 1M6OB 4KKAD 3QEQB 2NZ9D 4GAJH 1W72A 2CGRH 1FL5B 4NQDE 3T77A 4Z0BH 1PSKL 4IDLA 1IQDA 5C6WH 1TMCA 1G9NC 5GJTL 4GW5A 5FECB 5ISZE 3ORJA 3V4VH 1W0VB 4DN4L 2VLMD 1IGMH 4Q6YA 2NY4C 3C5JA 4ORZC 5D2LB 5CSGA 2WSKA 2C4XA 1RMFL 4G43B 4HXAL 3DV6B 5DMYA 5EC1B 3QEGL 1RJCA 4LRIC 1JJUA 3OKNB 5FHAH 3BISA 3MJ9A 5IF0B 1IM3A 4I2XE 4ALAL 2ZNXA 1JWUA 4MX7B 4XCFL 1OAYL 2EDQA 2WBWB 1EERB 1NGQH 1MCWM 4FP8L 2J6EA 1G7MB 3LIZL 3ROLA 3HC3L 2XT1B 5EULV 1VDGA 1KTRL 4OBSA 3EJZD 3UBXB 3KPLB 1JL8A 1I9JH 3BRDA 1XF2B 3ARRA 1OSZB 1I1CA 2PN5A 1RFDH 4NHUB 2NXZC 2DM3A 1B2WL 3CZFB 1MCDA 3KAAA 5TFSL 2O93L 4ZFZA 2I60H 3RVXD 4G9FB 1P2CA 1RZGB 3TJHA 1BIIA 4PRIA 1N59A 1BJMA 5T3XH 5HHOD 4OFYD 3CCHA 3S37L 4FQ2H 4R4ND 4G7YH 3TCXA 3QEQE 1S3KH 5TGBB 5A2JH 3SKJH 3PGDB 4Y19B 5C3LD 1F2QA 1QRND 1JHKH 1I4FB 2PXYC 3JWOL 3MLRL 2ESVB 3QNXB 3VXSA 1FYTB 4C83A 3BFOA 1HI6B 2AV7A 3QG6B 4M93C 5MI0C 2XWJA 5EBWB 3FONA 5D2LE 2EYRB 3H7BB 3QQ9D 4WEMB 2W65A 1QSFB 15C8H 4NPYB 3PV7A 3VXNB 4EI6B 4NN6B 1NAMA 1OCWH 2D3VA 1NC2A 1F13A 4OZGA 1FJ1B 3KHQA 3LOWA 2IFFH 2MSPA 4EIGB 3MRBB 2YN5A 3EZJB 3OGOE 2VABB 3EO9H 3T0DA 5C0JB 2AJ3A 2BY3A 3LS4H 3B9KB 5IOPB 4NC0B 1LE9B 5DK0A 1AH1A 1UT9A 3V79C 4DZ8A 5I1LB 3U9PH 4YE4L 1A3LH 3OB8A 2XXCB 4NHUE 3AS3A 4NM8H 4N1HB 5T1LB 3EFFA 1J0JA 2W0LA 1EXUA 2BFVL 2R2CA 3U4EA 2EO9A 1KLGB 4G9FE 3GJFB 2IQ9H 3N9GH 3SGJC 2Q3AA 4ZODA 1NCDH 3REVB 5J0BA 4JY5L 1RJYB 3WD5L 1U8HA 1Q9LA 3TWCL 1OHQA 1VPOL 1YC8A 3NCYP 2IQAB 2VLJA 4OKVA 1FFNB 3GSUA 4LIQL 3MLVL 5CJBA 4Z7OF 1Q38A 2ESVE 1YNTA 4FZEL 1FYTE 5CUSH 2G60L 4LCIL 3AVEA 5KW9L 4JY6B 1FFOA 1KIRA 5CZKA 2J5LC 4R26L 3B2UC 5KSAA 3VRLE 1A14L 3IAPA 3DYPA 1BP3B 3KYMA 3QDJD 2Q76A 1R3LB 4KKCC 1E6JH 4JG0H 4U1KB 1JYNA 3B4NA 1QSFE 3T4AA 4XPHH 4NO3B 2FR4B 4P46D 2ZPKL 5C92A 4TYUA 2J8UB 1M1SA 4FQIL 1TXKA 2VDRH 5F71A 4MA8L 4LSRH 3HA0A 1JWMB 3SDDC 5LGJA 5D2NA 5FO7B 2DQJL 5GZOD 3BKJH 1T0MA 1FN4B 1CCZA 4S1QH 4PJ8C 3UO1H 1CL7I 1KCUH 4NKIL 4NN5B 3FN9A 4LHUB 2L0DA 4CJ1A 2AV1B 5HPMA 1PZ5B 4HS8L 3HR5B 3X13B 4OLWH 4HKXA 2V2XB 3QSKB 1KXQE 2AK4B 1FZJB 2IBZY 5ERWA 3M17B 3MRNA 4U1NB 5D6DA 3MV9E 4OB5H 1DBAL 5JUEH 3FT4A 4KQ4H 2Z91A 4J3UA 3K80A 3BP5A 4LQFH 2H2SD 4P48A 2ICWJ 3OJ2C 4ENED 2NY0B 1EMTH 3IU3A 4I18B 2A1WL 1A6ZA 3DX9A 4P9HH 1KJ3L 1VFUA 4F80A 3MFFA 5EPMB 1U95B 3MLSH 4AEHL 4DGYL 5D7KD 3VU2A 5JLZB 1Q1JL 4LGRB 3VD3A 1NCAL 3VFVA 2APVA 1QHOA 3PWUB 5C0BA 3TN0C 5B3JE 1XMWA 1KYOJ 5DHYB 5K9OA 5GGQH 4D9RE 3O2VL 4LPVA 5SX5K 1UYWL 3BD3A 4JM2B 2B5IB 2P43B 3K2MC 4Z78B 1P4IH 3BPLC 2AXGB 3NACL 4N90D 8CGTA 2G75B 2K1MA 2ENSA 5GGVY 1LWRA 1JHLH 2FEEI 4HLZG 1KENL 1UZ6F 5D5MA 4JO4L 5I1CH 1IEBB 5TPWL 4JAMB 1B0RA 1RZKC 3MRPB 4XP6H 1UKQA 2V5TA 3TFKA 1KXVC 2NY2D 1CG9B 4OCXL 5ENWB 2BCKA 5IB5A 4OQTH 2BVQA 2J8HA 1AGFA 4EI5D 4M7JL 1ORQB 3MOBH 1PAMA 3FKUS 2PYFB 3S6CA 5IMKB 4KV5E 3LDBB 5JORB 5SX4H 1RUAH 5T5FL 3MRFA 1J1PH 3U2SB 2W60B 3DLQR 3GB7B 5FUZL 5H94A 3TIDB 4TVPH 1RHHA 2XWBA 4QY8B 3VXOA 3GUTA 3FN0H 3DROB 4NNYA 5I8OH 4H1LH 1HHHB 3R06A 5JDSB 4ETQB 4HPOL 5T33H 1U8MA 4U6TA 3QDMA 2GK0A 4EOWH 1NEZA 3CDYA 4MVBD 5FYJL 5E1AB 25C8L 4OLYL 4HT1L 2VXVL 2CR6A 1RVFL 2FB4L 1CGWA 3NVQA 4NC1C 5I18L 4FQLL 3VD4A 2VXTL 2XZCL 1ZVSB 1RK1B 1EFXA 3DXAD 3ARXA 1NMCC 1MAKA 2I5YL 1YEFL 4QF1A 2B1HH 5GS0L 1HILB 3HLAB 1DVFC 5I17B 1BHGA 4WEBH 5D71H 3KHOA 3U1SH 4HUMB 4RAHA 3HE7C 1IAMA 1XIWC 2EKJA 2HVKB 5F8QC 1U2CA 3BOVA 5CP3H 4D2NA 4JFQB 1D7FA 2EH7H 5SWZB 4GAGL 4PBXA 4G8GA 1MQ8A 1Z9OA 4FABL 1QSVA 2QV2A 2HJKA 5E4EC 1RSFA 4JJHA 4RNRA 2X70A 4PJGE 1NBZA 2FZ3B 4POZD 4Y16C 4O9HH 1F3DJ 1EFQA 3C60D 4N8PA 1UWEL 3DSFH 3MBEA 1LDPH 1I7TB 5DO2C 5J9PA 2W38A 4S0TD 1AE6H 3T4YB 4EUPB 5JW4N 1X5ZA 5FK9B 1Q9OA 4HIJA 4OGAC 2XA8L 4M6AA 4PP1D 4YHPB 3T0EA 2IPTL 1QBBA 4U6HB 1HHGB 1CLYL 5TQ2H 1CDIA 4OLZH 5FFLA 5EU6B 1CF8L 4XNYH 1WC7A 1MCHA 5E08H 1JGLL 4CMMB 3JV6B 4X6EA 5EZIL 3O6KL 4PS4H 4P9MH 1UADC 5HHXH 4X7SH 1DE4A 2W0KA 3MRDB 3MLUH 1SVZA 2HLFD 4G6JH 2HH0H 3VRJA 1HXMA 3QIWB 3GMQA 1EBAA 4XNQB 1HYSD 3PQYE 4WO4C 5KOMC 5FB8B 2VIRA 1WAAF 3BZFB 3CFJA 3O9WC 3N1PC 4BYHA 4JR9H 1P7HL 1KB9K 5KVFH 3F6IA 1BMGA 4LEOB 1DBKL 4KK6C 3RWJA 1YMMA 1KULA 1J18A 1PKQE 3TH4T 3QR2A 3U36A 4K3JH 4MQXC 3ARVA 1UENA 5HGHA 2OBGA 4WI3A 3C09B 4PRAA 2W59A 3MRCB 4AK1A 2WIIA 5GJSH 3DI2B 3JUZA 4H5SB 2DBLL 5F7KC 1OAZL 1Z0MA 5C09A 3QNYB 2EIDA 4LGPB 2EEBA 4WGVB 5HHNA 1BQHA 2VDPH 3MO1A 3IDNA 4ZSOA 4GUPA 2A9NH 5C0CE 4LPCA 4MZ3A 1Q8MA 2EE2A 2CQVA 3IDYB 3UDWC 4LNVA 3BIAX 5EU3B 1XEDA 1C7TA 5EU6E 5MEND 2WUCH 2ATPA 2AEQH 1FG9C 2AJUL 3QUYC 1QFPA 2MPAH 3QQ3A 4MJ6B 2Q6WA 4O00A 1T1WB 2IF7A 3SGEI 4XNMA 4EN3D 4AG4H 1FL6A 3P0YL 2FEEL 1NUNB 5DD5L 6FABL 4LP4A 1MVUA 1WUNT 2ZCLH 2Q8BH 4S2SB 1ITCA 3HKFA 4X4YB 5E8DL 1TVBB 4X8JB 1OAUL 4MA1C 5F9WB 4XB8A 1J1XL 3BW9B 2DWEB 5ESAA 2DQEL 1N4XL 5DD0H 4LLYA 3NIGE 2IALA 2W1NA 1EIBA 1YEJH 2BHYA 2XPGB 2X4TB 4HUXB 5TE6H 3GKWL 4BFGA 4PJBE 4POUB 4LAQH 1FLRH 2H32A 1HDMB 1NBYA 1RIUL 4E9LA 4E42A 3HC4H 3LEYH 3UPCA 2A77L 4DVRH 5CD3A 2VO5A 1IEAB 1DN0A 3HNVH 5EA0L 4LNRA 4O2FB 2EDKA 3OHXA 3MODH 3H0TB 3RU8H 1JZ7A 1I3VA 2XNAB 3MCLH 3T04D 1YQ2A 5DI8A 4LHUD 4KI5F 4HK0B 1MI5A 4RSVA 5J6GA 4KRMB 2AK4D 4J3WA 1CS6A 3EYUH 1RZ7H 1OD9A 3MRMA 3MV7E 2DQCL 3QXVA 4ONGL 4YIQA 4XCCL 1HHJA 4JO2L 3O2DA 2CXGA 1ROWA 2QEJA 3VXRB 3EZ8A 4YHOH 3VE0A 4MXVF 2YZ8A 4OZHE 2NY0D 4X6FB 4X4MA 2O5ZH 4PJDA 4TSAH 5C9JA 5LAXA 2BY0A 1A9BB 1IKFH 1C12B 4UINH 5AYUL 4LLUA 5DJDA 4JRYB 3GHBH 4G5ZL 1GZQB 2VTFA 5DJ6A 3VI3E 1P4LA 2BVTA 3NABL 3TT1H 4ZS7H 3HE6D 5C07A 1OLLA 4U6VL 4MCYB 5EFIA 3OAUH 4OLUL 2NY4B 4M1GH 1VB9A 4HEPG 4ODXB 4PJ7A 5CMAA 4B7LA 2FX7L 3VGBA 1F8TL 2HLAB 1FNSH 3LKNB 3I6GB 1WQVT 1S5HA 2UV3A 5ISZA 5LCVL 3MR9B 2B0SL 1LEKA 4JFZL 1DUYB 2VZUA 5FKAA 4OLVL 1S7QA 4XX1E 1JZ2A 3P77A 4EDXB 3QDGB 5ALCL 1F42A 3S98A 5FO8B 4ODVH 1VGEL 3KLDA 1MFCH 2RR3A 3JVGA 1KGCD 3RL2A 5LWYH 2WWMD 5C0EA 1PX4A 3WNMA 4L3CA 5FYKE 4ZFGL 4N0FB 2L7UA 3U79A 1L7TH 2FRGP 3KNBA 1MY7A 4K23L 1X5GA 4D0DB 4Q9RH 1FH5L 4F57L 5KSAC 1NBQA 5IV2A 6CGTA 5FOJA 3HZKA 3GJFK 2LV4A 4MZ2A 3SCMA 4Z77A 4L8CA 5DD6A 4MNHB 5GRUL 2QADC 3RWIB 5HI3D 4ORGB 4XP4L 5EDXA 4BZ1H 3ARFB 2EXYD 2HKFL 5TH2A 1XR8B 3QO0A 4RX4D 5EIIB 5KVDL 1M05A 3AU1A 5CD5C 5I1HH 2X05A 1J8HD 4LAJH 4F7EB 4DKFH 1QVOA 1L6ZA 5ANMB 3SEPA 1BM3L 1R5IB 5HHMB 1N3NB 1T2QL 1WBZA 3SDAA 4AZ8A 3DO3A 3QDGE 4HJJH 3B8YA 4I8DA 5F9OH 3DV4B 4M7ZC 4QRUB 3IS0X 4BJLA 4RFEB 3V7AE 4X99B 4JZNA 4KK9C 1HHKA 3TO2B 2F19H 5CINL 5HJ3A 1RZFH 1HH6B 5M7QA 4JFYA 3VCLA 1W72H 3MRRB 2BSRB 4MDJA 2NXYB 3RJQB 3WL9A 2ZSWA 4QRRB 3ULVL 3IFOA 1UA6L 4QXTB 1INQA 3H9HA 4U3XA 3L95A 5I8KL 1NFDA 3R4DA 1BWMA 4F7MA 3HZMB 3DOSA 2ED9A 4HJGB 2WW8A 1J86A 4B53A 1CZ8L 3OXSB 1IARB 3ZHKA 3JV4A 4P2QE 4BZYA 3PG2A 5JO5A 2NPLX 3MJ9H 4L8BA 4M5ZL 4QRPD 4X6DA 4QKXB 1FE8H 1BREA 3TBVA 4MS8A 2XQYG 4PJEB 3M8OH 3SGDI 4HS6A 2J6EH 3L3KA 4OSUL 3KJ6L 4CDGC 3CC5B 5D9SA 3ARYA 2OS7A 5KS9B 1K4DA 3QIBA 4QLRA 1U8OA 1DLHB 4MQ7B 4CKVX 1A6UL 4CJ0A 3ULUD 5JA8B 4P4KC 1VFAB 3BAEL 5I8EB 1H3WM 1NLBH 3TBWB 1Z6JT 5HHME 5IB4B 3GNML 1ZHBA 4BSJA 4RIRB 3QIWD 4ZAKB 4JHWH 4Y7MA 2ZJSH 1JGVH 3MGAA 3OAYK 4GSDL 3FFCA 1G0DA 4QGYA 5CZVH 3RWFA 3T0WA 3GJEA 5BMFL 5JW5B 1MCOH 4ZUTA 1VSCA 4L4TD 1H9VA 5AWNL 2WUBH 4YGAB 4IIQB 5JA9A 1T5WA 2DI8A 4M6ML 3CU1A 5EO9B 1KEGL 1S78C 4PGCB 3STZA 4EVNB 1QUNA 3K1KC 1Q72H 2KPNA 3LKOB 5GGRB 3RTQA 3DO7A 5BJTA 2I07B 2BNQE 4ZFOB 3WFZA 4NT6B 3JV5A 4HCRA 2R0KL 1CU4L 1SEBA 3OQ3B 3U7WH 2ZCHH 3MCKB 1PFCA 2ZUXA 3V6ZB 4HGKC 3LB6C 4AH2B 1GC1C 5LBSL 1WBXA 3MUZ1 5FDWA 2HFEB 4HG4J 4NJ9L 4P2RE 2DWDB 1FZKB 3ERYA 2VQUA 2P8MB 2X4OB 1BFVL 4MAUH 4KJWD 2BP3A 3MUGB 3VXUA 5CJXA 4HIEB 1ZLWH 1FIEA 4OTXL 1MWAB 4PD4J 3VMNA 4DTGH 4J3SA 4XNXL 1IT9H 1N0XH 1YNLH 1GGIH 1PVHA 1Q0XH 5TDOA 2C1PB 3GSXB 1GGCH 1FAIH 3DPBA 3FHAA 3MRLB 4F7CA 5INDB 1YPZA 4K71C 4ZFFA 4KRPD 2FIKA 3G08A 3HPJB 4UIKL 5DUMH 1MJ7H 1TCRB 3ZTNH 2Y36L 1X5IA 1SVCP 1BJ1H 4F3FA 5EOCL 5EU7E 1U8PA 3U6RB 4IOIB 3STLB 3S35L 1EA9C 1RUKL 3OG4B 4PJFA 2G9HB 1U42A 4PG9A 4C56A 4MGXA 3ALXA 3NBNA 3U0TB 3ZKND 2DQDL 1I9IH 4JFFB 1A9EB 1AXSB 1FL3A 1PYWB 5D7IA 3MREB 4WTZG 3DVGA 3H6JA 3VFSA 4KQ3L 3DVNA 3NCBB 4YO0A 1EUTA 5MEPA 1A0QH 3GIZL 3P2TA 4NO0D 1QFUH 1FSKB 4JFDA 3MRGA 4JVUA 1ZGLA 4DUVA 5MEQA 1T04A 3DYMA 4N5ED 1MCJA 3HRPA 5T1KA 3BKCL 4X5WA 3ECBA 4R2GC 2YSSA 4NQSB 1NGYB 3TESA 4NWUL 2NY6B 2J8OA 2Z93B 3IRPX 2XRAL 2X4NB 3D1MC 2GW5A 1E0OB 2F5BH 3LRGA 1JF6A 4XMKL 2C7UB 3VXRD 3P4NA 1E27B 4M48H 5DJ0B 1BFTA 4X7EC 2I9TA 4YFLI 1A6VH 1KJ2L 1ZLUK 1MH5A 4O5LH 4U1HA 4A6YH 4JRYD 4O2CB 4XHQA 3TVMA 4XCEA 5FOBB 2CJUL 3VFRA 5B22A 3TV3L 2ARJA 4DK6A 3G6JA 4NWTL 1PSKH 3HZVB 4IS6A 5GJTH 4MNGB 2NY4D 3ZE2F 2NW3B 2WP3T 4DN4H 4W68A 4HF5L 1B0WA 3I75B 5IM7B 1JMZA 1BGXL 4UT9H 3VI4E 4Y2DA 3T3PE 3T8XB 5HYJA 1TQBB 4E0RB 1RMFH 1G7HB 4HXAH 4C55A 5CWSB 1EJ6A 3QEGH 3EYVB 5DSCA 3OKMB 3V6FA 4AMKL 4UOJA 1A6WL 4ALAH 4XCFH 1OAYH 4R3SA 3LN4B 4GG8B 4FP8H 2B20A 1ED3A 3HC3H 2BHZA 3AB0C 2OL3L 3DMMC 1F5WA 5IB3B 2HWZH 1VKXA 3WJJA 3Q6FA 1CGSL 2QQKL 3T3ME 3BRGC 3WNLA 1B2WH 2ZOLB 4FTVA 4ZUVA 4OUUA 5TFSH 1IZJA 4NKQB 3VXMB 5L2KB 3FT3A 5GS3A 2ZSVA 4RRPA 1GZPA 2YPLB 3S37H 1ZHLA 2A73A 1HWHB 3CVIL 3O3EA 4PREA 2Y07L 4KKBC 2AKRA 2V5MA 4LSTL 4DW2L 4NQCD 3MLRH 3JWOH 5JW4M 3C5ZA 5KG9A 4MNGE 3BDBA 5B39A 5BQ7A 4J12A 2AK1L 3ELAT 4ZO7A 3ARFD 2UWEF 4XPGL 2XQYK 2FHFA 3G5VB 1X5XA 3HI1B 3UZVB 3OKDB 4O4YL 3E6HB 2QLVB 2XTJB 4OT1L 1U6AL 2UZIL 2IJ0C 3D69A 4PRDA 2E6QA 2ZUVA 1AGDA 4Y4FB 2JCCA 1M7IA 3W5NA 2PW1B 1J05A 2NLJB 1INDL 3U0WL 4H26A 3S37X 2A6IB 5DC9B 1ITBB 3VD9A 1QBAA 4KTEL 5B38G 4E41D 1IVLA 2R2HA 5ACZB 4JANB 4HS3B 5IT2L 2PW2A 4YE4H 2NXYD 1CFSB 3EOAA 3OTTA 1QLRB 2BVOB 1BOGB 4QRRD 4PLKC 2BFVH 3D87B 3ZKMC 3AM8A 2GUOB 1CGUA 3RI5K 3M1BA 1VEOA 3N1GC 1ZSDA 1CFQA 4JY5H 2YPLE 5D7LB 3KXFB 3WD5H 4D0BB 3TWCH 2C3WA 1PG7W 3QWOA 3BO8B 5I1AA 2BJML 4NYLB 1VPOH 4OD2B 4HX1B 2CKNA 1QR4A 3UTSE 4LLDA 4LIQH 1Q9KB 3D39D 5DRNB 4JGMA 4M4RA 4FZEH 4HKJB 2BVPB 2G60H 4LCIH 3N1MC 4KKCD 2EXWD 5IB2A 5KW9H 4NCC2 1OW0A 2W0PA 1F3RB 4FQQB 1A14H 5AAMA 3F7VA 3QUXA 5K9JL 5D7SL 5J1SC 4N90E 3MMEB 5GHWL 2PYEB 5J3HD 2ZPKH 2HFFA 3INUL 1UH2A 2IEPA 1U8KB 3FQNB 1HZHL 3FO9A 3NH7L 1NCTA 1TQCC 1R3HA 3IXTA 4FQIH 4J7RA 5HVWA 4JPIA 3SDDD 3EDEA 3JVGC 5IROC 4U0RC 3MGTA 3O3AA 4PJ8D 2HT4C 1PDKA 2OXGA 2VSDA 4MA8H 4ZAKD 4U2ZA 2XQBL 2R56L 1MJJA 1PX3A 4JEGB 4A2MA 2DQJH 3U83A 2ADIA 3KWWA 1NGWA 4NKIH 2CIIA 3L7EA 4HS8H 4OF5A 1CICC 4M6OL 4RGMC 5F3HA 3WE6B 2JJWA 2XN9A 1ZHNB 1LNUB 1A6AB 2HFTA 1W8OA 1KG0A 1AJ7L 1DBAH 4NHCL 3S96A 3G6AA 3SCMC 4RMWA 3BN3B 1UKTA 3WDIA 5HHPB 1KPUA 3J8F7 3LQZA 3PE9A 5K9KA 2A1WH 4JN1L 4ELME 4X9BA 1A4KA 3PWVA 5DJAA 3BESR 1Q9WB 4AEHH 1Z9LA 3K3QA 3NA4A 1AIFB 1QYGL 2JJTC 3TYFA 4DGYH 3UEZA 1Q1JH 1NCAH 4PRHA 3H9SA 3RHWK 3KPQB 3TLRA 2MOVA 2R23B 2P5WB 3KYOA 5C0IA 1U8NB 4XBPA 4YR6B 1KPRA 2JF1A 2IH3A 3O2VH 4TRPL 3FO0L 3S4SA 3VFUA 4OZIE 1UYWH 2LFGA 1XF3A 2PYEE 3CUPA 4DN3L 1H8NA 3NACH 1ORSA 3JTTA 2DRUA 4MCZA 2AGJH 2VLKA 3LEXB 3SDYL 1C5CL 3ZDXE 2ADJA 3QISA 2IAMB 1LP9F 2FO1A 3GSNA 1KENH 5EUKB 4JO4H 1FNGB 2BMKA 3C2SA 1JWSB 5TPWH 4B41A 5DK2B 4OFDA 3CJJA 4LSSL 4TPRL 2RBLA 4JE4B 2I26N 5EIQA 1F6LL 4EDWL 2V9RA 4F9PA 2J88L 2NY7L 4OCXH 3ARBC 5GRVL 2HRPH 2OSLB 2Z92A 1JZ3A 4ZTPL 3QT2A 3PJSA 3MOQA 4JFFD 4M7JH 3O6FA 4OCLC 2AERT 4QGTA 2AS5M 2EKSA 1BQSA 4CW1A 4CN6A 3WKNA 1QFWI 3QUZB 5T5FH 2FX8L 4ZNCD 1DQQA 2E5EA 1RUPL 3B83A 4BH7B 1U93B 4U3HA 3BUYA 5FUZH 1N6VA 5L88L 4F2MA 1CFNA 2FWOA 5J11B 5FGSA 1UJ3C 2P5WE 4QXUL 3A0OA 3C5SA 5I71C 4HPOH 5HVGB 3VWJA 4MNQA 4PV8A 5L0QC 2NY6D 4R8WL 3WN5A 5FYJH 5BCAA 25C8H 4OLYH 4HT1H 2VXVH 4HGWA 1HOCA 1HSBB 5BS0B 5I30H 1RVFH 2FB4H 2FYYA 4MWFB 3DNKA 2ICWB 4P5TA 2PUQT 4X0KB 5D1ZB 4FQLH 5I18H 2VXTH 2XZCH 4L3EB 5GQBA 2P8LB 3VFNB 5JOEA 5EH1A 1A7OL 2I5YH 2UZXB 1YEFH 3L3HA 3G5ZA 4BSVA 4UQ3B 3TPUA 2VL5A 1WSST 4IRJA 3QNZA 3RTQC 1JPFA 3GMRB 4XGZA 1XIWD 3G04B 1OB1A 2OTWB 3P73B 4I3GA 4P99A 4QHNA 1S7XA 3ALWA 1BJ1J 1OAQL 5HHQA 1DQTA 3PWPB 4GAGH 3PWLB 3C08L 4P2OA 4XHJC 4Y16D 2GITB 4FABH 1T0NB 1WFNA 5D6CB 3ME0A 3OGCA 1OGTA 1UWEH 3QZWB 3BPNC 4TQEL 1T1YB 4N9OB 3EYFB 2VSCA 1FVEA 3IU4L 4ISVA 3HCVB 1NUGA 2NY3C 5A3IC 4ZO8A 2XA8H 3P9MB 3QWQB 5GZND 2FEDC 1MCIA 3GFUA 2IPTH 3FB5A 1K3ZA 1CLYH 4U05A 5MERB 3V5DA 5IESL 2J3SA 1T7XA 5MENE 1URLA 2DQIL 5J7CC 5L8KB 5E9DE 3O3BB 1CF8H 1KN2L 4L3AA 3EO0A 3W2DL 5HGAB 5BO1L 3VXMD 5L2KD 1JGLH 4APQA 3S5LB 5EZIH 3O6KH 1T83A 5JPNB 3SE3A 1C16A 4QHLB 2RCSL 2ITCA 2VZ3A 3W0WD 4EQ3A 1GCFA 1FNEB 5DEGB 2F53D 1FVCA 3ZYOA 1RZIB 3O9WD 1U3HA 4PJXB 4XB7A 3V8OA 1JI1A 3OAZH 1AR2A 5IG7B 1OGAE 4FQXB 2VLRB 3QJFA 2BY2A 3PWPE 3IF1A 4FRWA 3VRIB 1VGKA 1KEML 3VDCA 1DBKH 1E28A 4MQXD 3I2CL 5E56A 4HMCA 2XTJD 3OL2A 4KJPC 4GXVH 3UBXI 3MRJB 4K7PY 3H2WA 4PJIE 3ARDA 4MD0A 1GIGL 1OTTC 3BP7B 1OAXL 3ILPA 3OR6A 1I1YB 5IKCB 5DQJA 2BNQA 5B8CB 4S0SD 1OAZH 3D85A 2NX5A 5IBUB 3W9DB 3RUGE 3BPCB 1NEUA 1FZMA 2GTZB 4BA8A 1QR1A 1IM9A 4MB4A 1Q0YH 3HG1D 4G59A 3UCRA 2J4WL 3GRWL 3TVMC 3QUYD 3S3SA 3UYPA 2YR3A 2CLZA 3VFTA 5C1MB 4JDZB 1JHTB 4P2RA 4Q9QL 1WITA 5D7LD 1A64A 3KXFD 3ULVC 4IMKA 4XH2B 4AT6B 1KBGL 4K3HA 5GXBB 3D3VB 3P0YH 1YN6B 1JI2A 5DD5H 6FABH 1J0YA 2ZG2A 4HUKB 4PJXE 2CKBB 5E8DH 1OAUH 1T7ZA 2W9DL 2DQEH 3V5HA 1N4XH 1T3FB 4XXCA 2R8SL 1BFSA 1F3JB 5DJ8A 4M62L 2DD8L 3TBSB 3WS3B 5DQ9B 4PJ5E 4NRYA 3GKWH 3QWRD 4U1GB 1RIUH 3CFEA 1S7TB 4PIRF 5E00A 3WHXB 4Z7QF 5BV7L 2A77H 3BWUC 4I3RL 5I1IL 4S1DC 1OPGH 3C6LC 4UV7L 1YY8B 4N1CA 1UQSB 5A16A 3WJJC 5EA0H 1L9NA 1A7QL 4WCYL 5I19L 4UILL 4L9LA 2ZZUT 2X9YA 3MRQA 5GGUA 4R0LA 5FGBA 1S7SA 2NCMA 5IBLC 2C1OB 4AY0A 5ACLA 2NY5L 4JCMA 4X6BB 2D0GA 3VWKC 5TDNA 1AQDB 2BSED 4LKCA 2DQCH 4Q7DA 4ONGH 3QUKA 2X89D 3KLAA 1JPTH 3RP1A 4XVUC 4XCCH 4JO2H 3OJVC 1GH7A 5E4IA 4PJ9C 1MREL 3C5ZC 5H35A 2CDGB 3WHE0 4Y5YA 4I48A 2X1PA 3S8WA 4OAWA 4CAGA 1CD1B 3EDKA 3ZO0A 4X6CE 1UGNA 3OKYA 5AYUH 1KJVA 4G5ZH 2X41A 4PP2A 4QHUA 5C0AE 5JIPA 3LKRB 2A6KB 5HHOA 4OFYA 4Q6IB 5F44A 2ATKA 4HBQA 3WYRA 3NABH 3RIFF 3REWA 3FOMB 3SDXA 4U6VH 3LQAC 2DYPB 4PJCE 1MCEA 1U92B 1QRNA 4OLUH 5D8JL 4JFEB 1I7ZA 3KPMA 2NTFB 5FA4A 3FRUA 2FX7H 3EYOB 5HI5C 5FUOL 1FNHA 3DURA 4U6YA 2E7MA 4K07A 5LCVH 3ZKSD 2B0SH 2QR0B 4JFZH 3QPQC 5ESQB 5J6HB 5F89B 1I7RA 5IUSA 2MKWA 1K2DB 4OLVH 4P59L 5TE4L 1D5XA 5SWQB 3CMGA 3SHSA 1D5MB 2A6JA 3AM8C 3D0VB 4RGNB 2VJXA 4ODUB 5ALCH 5JQ6L 3RWDA 1BLNB 3UTPE 1AXTL 4YBHA 4F8TA 1VGEH 1EZVY 4Z7VE 3TZVC 1AHWA 1CGXA 4LMQI 4JZJB 1LE5A 1XGUA 2CRZA 2V17L 1P6FA 5FA3B 2FJHB 2ORBL 3BIKB 5IHLB 1B4JL 4UMGA 4HLJA 4N8VB 4JPKL 4DKAA 4OFIA 4ZFGH 1IGYA 1AKJB 4MD5B 1HKLL 3B5TA 3KYNB 3FT2B 5C08D 3AY4C 3OKOB 2JTDA 4GW1B 3QUZD 3QAZC 1RJZB 4K23H 4F57H 4N0UB 3LRSB 2QKIB 1OWWA 4HUUB 4LLWA 3BZ4B 2GQHA 2QADD 4YLQT 5JHLL 4PY7A 4P0DA 4PUBL 5GRUH 5IVXF 3X11A 3F5WB 5IWLA 4XAKE 4XP4H 4LLMB 2H8PA 4JFEE 4XPTL 2X5PA 1EHNA 3AXLB 3CVHL 2MCPL 1G7IA 2HKFH 1IC5L 3SDCB 1NKRA 3AMLA 4G9DA 4L3ED 4XTRD 2F15A 4FMKA 4XBEL 3QDJA 2E9JA 2X7LA 4DKDC 1WFUA 2VISB 3MXVL 5T3XE 1T80A 1BM3H 35C8L 3Q6GH 4P46A 2UY7A 1T2QH 2OXHA 4KK9D 4NZTH 4RGNE 2FGWL 1JTOA 3RWGA 1QA9B 2WM0A 1UEYA 4JO3L 4J3TA 4K7FA 4IOSD 5I75B 5CINH 1FP5A 1U8LB 5DHVA 3GRWA 3DX7A 3NIFF 3MBXL 1JGEA 2A6DB 2G2RB 4MJID 4UAOC 1GOFA 1BIHA 2PR4L 3ULVH 3WNNA 1RZJC 3MACL 1IAIM 1UA6H 4HUVB 3AFLA 4P4RA 1WFTA 5I8KH 1II4E 1MFAH 4JY4A 4OFPA 3P0VL 5CEYB 1H5BB 4NRXB 4PLNC 3SGEH 1UVQA 5GGSY 3HNSH 3PWJA 2PTTA 3QG7L 1CZ8H 1QNZL 1AXIB 3DGGA 2XZZA 1MLBB 1OP5H 2OQJA 4XP5L 5FF6A 3F7YB 4M5ZH 3LKSA 2K7QA 1EEYB 3BWAA 1B88A 2GT9B 1S7WA 4M4PA 1KT2B 5ID1A 4P3DA 1NMBL 4U1IA 3KJ6H 2A83B 3FQXA 1AD9A 1WISA 3EOBB 1J9CT 1YEEL 1K8DA 4FXKA 3GSWA 2EE9A