5HGAA

Hla*a2402 complex with hiv nef138 y2f-8mer mutant epitope
Total Genus 77
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
77
sequence length
274
structure length
274
Chain Sequence
GSHSMRYFSTSVSRPGRGEPRFIAVGYVDDTQFVRFDSDAASQRMEPRAPWIEQEGPEYWDEETGKVKAHSQTDRENLRIALRYYNQSEAGSHTLQMMFGCDVGSDGRFLRGYHQYAYDGKDYIALKEDLRSWTAADMAAQITKRKWEAAHVAEQQRAYLEGTCVDGLRRYLENGKETLQRTDPPKTHMTHHPISDHEATLRCWALGFYPAEITLTWQRDGEDQTQDTELVETRPAGDGTFQKWAAVVVPSGEEQRYTCHVQHEGLPKPLTLRW
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Effects of a Single Escape Mutation on T Cell and HIV-1 Co-adaptation
doi rcsb
source organism Homo sapiens
molecule tags Immune system
molecule keywords HLA class I histocompatibility antigen, A-24 alpha chain
total genus 77
structure length 274
sequence length 274
chains with identical sequence D
ec nomenclature
pdb deposition date 2016-01-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00129 MHC_I Class I Histocompatibility antigen, domains alpha 1 and 2
A PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5hgaA02
3.30.500.10 Alpha Beta 2-Layer Sandwich Murine Class I Major Histocompatibility Complex, H2-DB; Chain A, domain 1 MHC class I-like antigen recognition-like 5hgaA01
5K9KB 4A2MA 1Q94B 3NFSH 2ICES 5I74B 4CGTA 2FLBT 3PWNB 4P46A 4TVPH 1NC2B 4M9OA 4XCEA 4H0HB 4X6DA 4BFIB 4PJGE 4CDGC 2EDDA 3FT4B 4QRPA 2I60H 3HG1E 3UXFA 1F8TH 4KUCD 3JTSA 5IVXE 3C8HA 4IM8A 4CN6A 3RWFB 4ELKA 2ZOLA 5CEYB 2G60L 1FBIH 2FBJL 2X4TB 1MRCL 1KPRB 5HYSB 3MLZL 3B6SA 4DEPC 5JW4M 1FG2A 4GKZB 1RVFH 3IFLH 3RWHA 5D93B 5DJAB 3Q6FB 5BXFB 5IMMB 1YMMA 2VTFA 5DRWA 4DUVA 1AJ7L 1X4YA 2OLDA 4R2GD 4IRSA 1OARH 3JWOL 4JY5L 3SKNB 4Q9RH 5SX4I 4Y16D 4R7DB 5EU6D 4EI5B 2H3NA 2AAVA 5MEOA 4YFEA 1P69B 2FJHB 4Y4HA 3AXLB 4N8CH 4R96A 3HHRB 2UY6A 2DWDA 4MD5A 1YC7A 5IHZB 3INUH 2PXYA 4LCIL 4ONHB 3VI4E 2BSRB 5C0JA 1BP3B 3WS3B 5EU3A 5HHQA 3SGJA 4QXWA 3CLEL 2IH1A 4HUVA 4HJ0C 3CFJA 1ONQA 1KCVH 2IPUK 4X80L 2H6PB 3CNKA 1P4BH 3HNSL 3D39A 4I2XE 3DXAB 1FL3A 4QTHB 3KPOB 4OAWA 4F7CB 4WI5A 5I2IB 2HT4C 3DWTA 5E8EA 1XH3A 5GGSB 4GW4A 1YEFH 1CICB 5EBMA 4LSUH 1RFDL 3MOQA 1IL1A 2XZZA 1A21A 5E5UB 3IDNA 4YX2H 1SM3L 5L8KB 2Z8SA 1UZ6E 3C8KB 3SDAA 1V3KA 2I60L 3VXME 4JFZH 3FB8B 1IBGL 2DWDB 2X1QA 4MD5B 3U46A 1M7IB 1JGUH 2R9HC 3DURA 3QXDA 5I73C 2CRMA 4LLYB 4JO1L 4MA1C 3S98A 2DQIH 1KTLB 1WISA 3GSVB 1Z9OA 1INQB 1JNLL 3MCLL 3T0ED 1DL7H 3QG6B 4U49A 5ADOH 2LVCA 3S5LG 5I76B 3CK0L 5EZJA 2RFXB 1NCUA 3KXFE 1MSPA 1HDMB 4FOMA 1SYSB 5L6YH 5DFVD 3ARZA 5HYIA 4KDVA 4M6NL 3UC0H 4MHHI 1IZJA 1MCBA 1NDMB 3IFPB 4XRCB 4YIQB 2X1XR 4P5TD 1JPST 3SDCB 3OJDA 3ARBB 2FHFA 5BV7L 1J5OL 3MRCA 1IC1A 3QRGH 3HCVA 2E9BA 1GGCH 3BEWA 2LABA 5I73B 1OWWA 4F37K 2DD8H 2F74A 5F1NA 3O9WC 3IXTA 1WFOA 5C0FA 4AMKH 3S4SB 5FF6A 2IPTL 4K3JL 5FUZL 4KUZH 1JZ7A 2BHZA 3L3IB 5IQ7L 1M05B 1BF2A 4GT7A 2DQDH 3CH1A 4WUUB 1K6QH 4G7YL 3LEVH 5DMKA 2V2TB 4PJ8C 3VGHA 5SX5H 5CUSL 5E7BA 3CUPA 4OCRL 3MOBH 2DQEH 1L0YA 1ZANH 5GS0C 1M71A 1TQBB 4DOHB 4OD3L 3PXHA 3PP4L 4YUEL 3GO1H 2W0FB 3SHSA 4PRDB 4YDLC 3JWDL 1NSNL 1UCBL 5IBTL 3X17A 1FL3B 3QUYB 4Z7QF 4LSUL 3ZE2F 1W8OA 4R4BA 4XC3H 2JJVA 4TSAL 1AC0A 3EYQD 3QUXB 4NJ9H 3ZE1F 4HXBL 5J11C 4K8RD 4J23A 2XKNA 1B4RA 1C12A 3ULUL 1IGJA 1FH5H 1RURH 4QXUH 2I07A 3MRHA 3O11B 2JCCE 4ZYKA 4JFXA 1KENL 2H2SD 3T0AA 3LQZB 5T33H 4I4WA 4MDIA 4K3EL 3S37H 5E5MB 1FNLA 1XF5A 4FXGB 2NXYD 3TH3T 4BH8B 2BMKB 3O3DB 3HAEH 4WI6A 3DO7A 5DGQA 2P44B 3RIAK 4QXTB 4RISL 1MQ8A 5A3IC 4WEBL 2NY7H 3H7BA 4GOSA 1T89C 1T0PB 4OFYD 4ZAKC 5JXAL 2F8XC 2WAHA 1S5IH 3CMOL 3ARBD 1R3LB 3PQYE 1KYOJ 2A6IA 4Y5XA 2AKRA 3RVXC 3QZWB 2D0FA 1UWGL 4NNXA 3RWFA 2VDRH 4J8RB 5AZEH 2VZ3A 4D0BA 4HWEH 3WL9B 1KENH 3G5XA 2ZG1A 4Q9QH 4P23A 4Y19B 3LN4A 3MV01 1FRGH 1JF1A 2AERT 3I75B 1IEHA 3ZL4L 3BQUA 1JZ3A 2BFVL 2XFXB 3TC9A 1SBBA 3G9VA 1ED3A 5B4MD 2KDGA 5I17B 1A7RH 3KPOA 3EHBC 4P4RB 4P5TA 3BZFA 4FS0A 3QCUH 4MD4A 3GO1L 2XI9A 2V7NA 1QA9A 1A3LH 1V7NH 4FQXB 1T20B 12E8H 3ARPA 4D8PA 3EOTH 3C87A 5DURD 3QIWB 1AXSA 3MROA 4Z7WA 3TZVB 3PUCA 1OF2B 1BREA 5B39A 1O0VA 3JTTA 3VXQA 2H45A 2P5EB 3EZJB 1JWUB 4KUZL 4MA3A 4U6VH 1FFRA 4MNGB 5K9OB 1XGRB 4NQSA 2DMKA 1T3FA 2VZ1A 1BVZA 3HC0A 1ZGLB 5MERB 5GRUH 1D6EA 5MEND 5CBAB 4IRZL 4WNQB 2UZIL 3CU1A 3QA3A 1B0RA 3S9DB 1HNFA 2FH6A 1V3LA 3EDEA 2ICEA 3WCYA 2BNQE 2ZSWA 4P4KB 3BKML 3RWJB 3L1OH 3TCLB 4BKLB 2OI9B 1UACH 3GHBL 2WY3A 3UTSE 4FQXA 1S9KC 3OKLA 2PR4H 1DE4A 2R0KH 1JNJA 4JO4L 3GNML 5M95B 2CMRH 2F9BT 4WHYG 3O3AA 4LRIC 3HMXA 1BLNA 3R06A 4JZOA 2GFBA 2V2XA 2OTWB 4PJHF 5IHBA 4JM4L 4JCLA 1MHEA 4YHYB 4MA7L 2NY3C 1ZLUH 3TA3D 5FXCH 2C7UA 2PUQT 2GTZB 1MPAL 5H94B 3BISA 3QNZA 4CJ0A 5HHPA 4I2XA 3V4PL 1RIHH 3QULA 4DGVH 3R1GH 1FGNL 4J8RA 3DSFH 3QXTA 2VABB 4OZ4B 1RK0A 5E1AA 1HOCB 4HQQH 4FRWA 4YHPA 1A4JA 1QBAA 4HLZH 4P5TC 3S37L 5B38B 2CDGB 3WFBH 4UOW0 3VE0A 3CXDL 3RZCC 2HTKC 2X4QB 1NAKL 1OCWL 5AZEL 3RWGB 3GMPA 4ETYA 4X6FB 1A1NB 2IH3A 2P24A 2JJWA 3ME0A 1TTFA 2R1XA 1T0NA 1C5BL 2GK0B 4LBEA 4HIXL 1CFNB 5E56A 4HFWA 4ZYKB 3DROB 1FJ1A 1NCTA 1AXSB 3MROB 1C5DA 4NYLB 3CUPB 1WZ1H 4F7PB 1WLHA 1LDPL 5T1LD 2V5SA 5TE6H 3KWWA 1S7QA 3MV7B 1KEGL 1T66D 4P57B 1HQRB 1Z3GL 2WBJB 4J3WA 4LGSB 3BPCB 4JEGB 2VLRD 1IC5H 1RZFL 2IPKA 4PREA 2BRRL 1J0YA 3HI5L 4X7SH 3T2OA 3D3VB 1CXEA 2P8LB 5IWLA 5FA3A 4CMMA 1MCJA 5FO8B 2X41A 1LD9B 3LKSB 5DF0A 5HGDA 2XG5A 1EAJA 4OB5H 2R0ZL 4OZFH 4P3CH 3ZHKA 2F19H 1G9NH 3VRJB 4L1HA 4PRIA 4XNXH 1ZK9A 3LEXA 3PQYA 2LV4A 1U6AL 1KTDB 3MA7B 3VDBA 1U8KA 5C07E 4G59A 4PRIE 4D9LH 4PDCE 3MREB 3BT2H 1K8DA 1DP0A 4TSBH 2VDKL 1CXLA 1TQCC 3MLXL 4U1SA 1RJLA 1TNNA 1TENA 3WE6A 3P2TA 2F8OA 5KN5A 4ZAKD 4MNGA 1F3DJ 4JO3L 4X4YB 3DXAD 2YK1H 3MOAH 3NFNB 4OB5L 3BIBX 4AM0A 2R9HD 3VXMB 4R26L 3P40A 3VGDA 2ICCA 2DWEB 4X6DE 1YEDA 2BERA 2HJFA 2VZSA 3BD4A 4OD1H 3TA3A 3KPPA 4I0PD 1S9WA 3TVMD 2VJXA 1DVFA 4HMCA 4OT1L 4NN6C 2YEZB 2QKIB 5F9OL 1S7RA 1B0GB 2WIMA 3KVQA 3O3UN 4OLUH 1OLZA 4G8EB 5E6IC 1V3MA 2CKBB 1XCQB 5D72H 3A6BH 4R8WH 4NQCA 1C7SA 4OLEA 5INDA 3PIQA 2J4WL 4WI8A 1IQWL 1KXVC 1VCAA 1JK8B 1CD1B 4ZMAT 4FQHA 5I1LA 1RJYB 4FP8H 1FGVH 3TIDB 4EKXA 2IH1B 3AC0A 4AZ8A 1P84J 1A7OL 2VISA 3VGAB 4FQIH 1G1CA 4MJ2A 4R3SA 3TBVB 1BBJB 5LGKA 3V6BR 5F9DC 5EUKB 3MRGA 1UA6H 2MKWA 3HC3H 4OZFG 1BJMA 3A6CL 2BRRH 4KQ3L 2DN7A 1Q0XL 2DTML 5JNYB 4CW1A 1JV5A 1JZ4A 1MIMH 2BC4A 3J7HA 5JLZB 1L8JA 4YHOL 1RU9L 4IRJB 2VQTA 3AREA 3TESA 2D7PA 4NDMB 3U9PL 1LDPH 4JG0H 1ZWIB 4MA8H 4D0BB 2N56A 1EFXB 3T65A 4P9MH 3RL2B 3VFMB 1IGCL 3UPCA 4NQDE 3WNKA 3EOBB 1XF2B 1I9EA 3VG0H 3ZYOA 5TDPB 3RGVA 3WUWG 3BKCL 4KKBD 3O8XD 3KPMA 4S1RL 5DJ0B 4BK4A 5BW7C 2V7HA 4DTGH 1L4IA 1NBZA 1RJLB 4EUPG 1NC4D 4IOFD 1ZHBA 1VENA 4BZ2H 1FZOB 1C5CL 4S2SA 1S7UB 5JLZA 2YD9A 3OPZL 4JJHA 2OR9L 5EO0B 4IMLB 3QFJE 3OGOE 5C07D 5EO1B 1NGZB 1J05A 3LQZA 3QXWA 1VADB 2AJSH 5GRVK 2UUDK 1B90A 4WV1C 3PXJA 2YSSB 1T20A 3WMSA 4K3EH 1HKLH 1QVOA 2Z31A 1BBDL 5GGRY 3I6LD 4BH7B 1CCZA 4PLOB 2DQGH 2WMPA 1A5FH 5I2IA 1XEDA 3BP4B 4G7VH 4JGJA 1P9MC 2G5RA 4GMSL 5ITFA 2YKLL 3LKOB 5HYQA 3MGOA 3SDYH 3WJJA 1MCRA 3IRPX 1IM9B 2XTLA 1Q1JH 2HFGL 3OWEA 3RJDA 4NZUH 2D7TL 4DN3H 4RNRB 1PKOA 4UINH 4J1UB 3X14B 3MA9H 1EEZB 2VERN 2QR0B 4YBHA 3IYLW 4OI9A 4XX1E 3NFNA 5ISZA 3IDXL 4NSKB 2Z0BA 1X7QA 3KLHC 4ISVB 2H3NB 2YBRA 3RWGA 4TSCH 4PP2B 2IFFH 2XTJE 5ICXA 3BZFB 1JHKH 1AXTL 3VGFA 2OYPA 2AEQL 4WFFE 4WW2F 5HBBA 5F7HA 4OM0L 2NR6C 5ETUB 1D6VH 4FXGA 4HKXB 3PP3H 4XHJD 5CEZH 2E27L 12E8L 4GS7C 4NQED 2A0LC 3IVKB 5F7EH 3FN0L 1OVZA 4PRPD 1J1XH 5E8OB 2KH2B 2OXGA 3TNMA 2XTJB 4DCQA 2FZ3B 4Z7WF 4EVNB 1EEYB 2V9TA 3IKCB 3IDXH 4KPHL 4G9FD 4HBCH 1S5IL 3KNBB 4QRPB 4APQA 1KLUB 2H1PH 4Q9RL 2XWTB 3GIVA 3MYZA 3DGCR 1CGYA 4UILH 3KLHD 1MIML 1JHLH 2XWBA 3L3HA 3S34L 2J2ZA 1ZLVK 1T83A 4WHCA 2DQGL 1DUZA 5I18L 1U3ZA 2UZXB 4NN7C 1MCOL 1I7UB 4H0IA 3KHOA 1NDGB 4PY8I 3LKRA 2FIKB 1IGYB 3MRQA 4K55A 1R3HB 3BKCH 2E7HA 1MH5B 1ITBB 1SM3H 1WFNA 2APFA 4L8SB 5F7WC 5E5RB 1G0YR 1Z0NA 4LAQL 1WK0A 4L4TA 2A6DB 1A1OB 3U2SA 3IRZA 4R4BB 3MQIA 5LXGH 3TBWA 5ACZB 4ZSOB 2V7HB 2AI0H 1MWAH 4PTUB 3V0AC 2NY1B 4B50A 1V7MH 5DO2D 1OF2A 3MRBA 3IFPA 4P0DA 1KFAH 4XRCA 3LSOB 2WBJD 5SWSA 4ZNEE 2AK1H 3MBEB 4WWKC 2GJ6E 5EO9A 3CPLA 1VDGA 4PJIB 3V2AR 1KTDA 2WSKA 3LPFA 4HCRL 2J88L 1K6QL 1VEMA 1U8JA 2IF7A 3UO1H 2HH0L 4PB9H 5SWZD 3QQ9D 3TJEL 5EPMB 2OP4H 5INCA 2AEQH 4IHOB 5KANG 3SKOB 5H2BB 4ZFOB 4HJGB 1A6PA 4KRMB 1SJXA 5E6ZA 5F93C 5E6IA 1KTLA 3F7VA 3JWNC 4LLWA 3C5ZB 4NO2A 2A2QT 1ACZA 4KKAD 4ZO8A 1BFOA 5LQBL 2BXYA 1U8KB 3T08A 3O6FB 5FDYA 4Z7WE 5D7JC 1CVSC 2UVEA 1XZ0B 2C3WA 1A6WL 5GSRA 3C5ZC 2W65B 2V5TA 1BOYA 4HK3N 2KZWA 3QFDA 3G5VA 4HZAA 3U7WH 2ZKHL 4E41A 4XPTH 3E8UL 4BSVA 3S35L 5D9SB 2EDQA 1LO0H 3ROLA 5E4EB 5I1HL 1CBVH 1OB1B 2MTPA 1RIUL 4YHKL 4KU1A 2XQYK 2HYMA 4QHUB 2CLZA 4HC1H 4WWKB 1UWEH 5IMLB 3LQMA 2X2YA 5CHNA 4JN2A 4G9FA 5J1AA 1A7PH 4U7MA 3K3QA 3RKDD 1WIPA 5CD5C 1NEZA 4X5XB 3GJEB 4HF5L 2CXKA 1QR1B 1U8OA 2X4NA 5T1DL 3N1QC 4N8VB 2AJ3B 2HG5B 4G8FA 3VMOA 4H8WH 2RHEA 5C6TH 3QUZB 1A1NA 4G8GA 4V2BA 2L0DA 3DMMB 3KJ6H 1FRGL 3BJ91 5CEZE 3P77A 4X7TB 2FX9L 4ZUUB 1DQTA 5D9SA 5F7MC 3TV3H 2NX5E 5DR5H 4MXQA 4K8RL 4V1DE 4JKMA 4PJ8D 3TP4A 1GH7A 1ZLVH 4LHUD 2XQYG 2MKLC 3T1WA 2COQA 3SCMA 5CIPH 4HPOH 4LLVA 3CFEB 2VN4A 2Q76A 2PXYB 4ONHA 5D6CB 1JN6A 1GPOL 4LEXH 2O5ZL 5I66A 4HZLB 1Y0LA 4KTYA 3EYUL 5DEGB 4PP1D 1I3RA 1RUML 1UH2A 5A2FA 2B1HL 3LD8C 1OARL 1KCLA 1PX3A 2NY2B 3VFOA 4K23H 2IQ9H 4IOIA 3TVMB 3RY4A 3OR6A 2AK4A 3DUSA 3VXRB 1CXFA 1HH6A 2NW2B 1RK1A 1MWAL 2IANA 1K4CB 4P5MA 1U2CA 5CCKH 4PBXA 2FBJH 2BMKA 5I8KH 3ARDC 4XCYB 5D2NB 2P5EA 4Z77A 4MA8L 4D0DA 3RZCA 4PJHB 2I9LA 1U0QA 2OM5A 4RAUB 5FYJD 2I9TA 1JN6B 1AY1L 4OV6F 2LU4A 1AKJA 4ODVL 1JTPA 4MMXC 3T0EE 2B0SL 2NY6D 5DJ8A 5AG8A 4X4ME 3VW3L 3KDMB 1RSFA 4KV5F 5E8NB 2CGRH 5SWZB 1KACB 3EO0B 4HIHA 4YDKL 4CN4A 3QAZC 4HIXH 4LLUB 1IVLA 3A67H 4XVSL 2VITB 1RUKL 1UT9A 3RY6A 1P4LB 5IEKB 3P9LA 5CGYD 4BQ8A 3OL2A 2W0PA 3I75A 5JOPD 1QRKA 1KEMH 2CRYA 1U8NA 1CG9B 3O6FD 1PLGL 2NMSA 1PSKH 4OGAC 2AV1A 4KWUA 1FLTX 3FFDA 4Y2DB 4XPFH 1P2CB 2FEEI 5GRZA 5CBEB 4UAOB 1AC6A 1KN4L 3BE1L 1PX4A 1TMCB 1GGUA 3F7PC 3MJ8B 1G7HA 5I8EA 2FHBA 2R2HA 3MNZA 1W0WB 2OJEB 4DN3L 1ZSDA 4Z7NE 4IRSD 3WKNA 1FE8H 4YHMH 1UFUA 4K2UH 1I7TB 3ZDXF 1RZKC 3MV8D 1X5GA 1F3JA 3LMJL 5HD8D 2VWEC 2NTSP 3DLQR 5C9KA 4HUNB 4NRXA 4WRLA 5B22A 4L3AA 35C8L 4ONGL 2JLLA 5JXEA 2F8VA 5F6IB 3KS0J 1OSZA 1LEKA 4PGEA 4UNTA 5GS3A 3KPRE 2CR3A 2J8HA 1BBDH 5EU6E 2JE8A 1U8LA 3S6CA 2EH7L 1PAMA 1R5IA 5KSAA 1KIRB 1YEKH 4D9QD 3MFFB 5D1ZD 4AENA 1YC8A 1JI1A 4AL8L 1BFOB 4R0LC 3VH8G 1BJ8A 4QTIL 1KSRA 2X4OB 4LHQB 1WV7T 5JORB 4Q6IC 2XG4A 4LCYA 3N1MC 1U8MA 4OCWH 5SWSE 4AEHL 5CZXC 4U1GC 2PCPA 4UV7L 1FNHA 5JPNA 1EZVY 5JDJA 2DM7A 1JRHL 5CGMA 3IDJA 4G8FB 3I02A 4GW4B 1IGFH 4B41A 4NJ9L 1AGBB 3VDCA 1Q72H 2P8LA 3RAJL 3BQUD 3C2AL 4NC2B 2IC2A 2FEEL 2X9WA 4ERSL 4PRBB 1GGIL 2VLKD 5B8CB 3D18A 3IB4A 1MVUB 2GJZB 5DVNA 3SDAC 2BSTB 1TCRA 2ED8A 3O2VL 4MWFA 3U79A 2K7QA 3VRLF 1IEBB 1EJOL 4KJQC 4O9HL 4NQEE 4F7EA 4ZDHA 5LJYH 4O2EA 3ZYJA 3QUZC 4JFFB 2VKXA 3RKDC 3G04B 4PD4J 3UPAA 3GJEA 4X5WA 1AI1L 2MHAB 3BKYH 5B38G 5BRZB 3EYOA 1HYSD 5FOBA 4XGZA 4QHNB 5BZDA 1CLYL 3VU2A 4KFZC 4LPVA 3TFKC 3BUYB 5LG1A 3F8UB 2EH8H 3P0YH 4NQEB 1WFUA 3VWJD 3G9AB 5D2NA 2YXMA 5D71L 4JDZA 1CIUA 3MBED 4Y8DC 3SGJC 3UYOD 3VGGA 1TZGL 4JVPA 4HWEL 4XPAL 1VFAA 3QBTB 4OQ1A 3RIFK 3P73A 3O6FA 4ODUA 2HJLA 3OR6B 1DANU 5J1TC 1L6ZA 5E4EC 3RVTD 4MB3A 4PR5B 4NO2B 1OTSC 3UJIH 4BH8A 4AIZA 3W9EA 3D5OF 3B8SA 1KPUB 5ID0A 4GXVL 3B2UC 2BVYA 5DUBB 5F7UA 5D6CA 5EZLA 4FQXD 3PG2A 4ZO7A 3H2WA 4LARH 4U6YB 5T33L 1VGKA 3WFEH 2G5BB 1F4AA 4ETQB 5CJBA 2ADJB 2ZUTA 2P8PB 3REWA 2IALA 3OG6B 2OK0L 1V5JA 1K5NB 4Z95H 1INDL 2ZCLH 5F7FA 4G6FB 5F6IC 3BWAA 1YEJL 2VLMD 2YXFA 1ZTXH 3SDXB 3I6GB 2HJLB 3MUGA 1UZ8B 3U48A 1AD0B 1QYGH 4J3XA 3RVTC 3RWEB 4W68A 2WK2A 4Q58C 3OKLB 5A3ID 3CZFB 4LU5L 3RJQB 4H5SA 4LLDA 5DK2B 3ALWA 2QSVA 3ZT6A 2I9TB 4PLJC 2BCKA 2A6KA 2BXZA 3LS5H 4P2QB 3QEHA 1NC2D 3GK8L 2AJXH 2X89A 4X98A 3MRHB 3O11A 1J0HA 4QRQB 2BJMH 4UIMB 4E9LA 3D6GA 3IDGA 5IJKA 4QRSB 1HSAA 3HZYA 1JGLH 2KL6A 3H9ZA 2ZKHH 5EUOE 2Z93B 3U0WH 3STZA 2Y07H 5KTEL 2ZCLL 3MRPB 5IROA 3T2QA 4JN1H 1FL5B 4RZCB 4BQ9A 2NX5A 4OFYA 3GJFB 2VNCA 3FO1B 1EGJA 4QHLB 5D7JA 3ARBA 3FO0H 3GEWB 2VC2H 1YNLH 4PJDB 4MDJB 2ADFH 4DEPB 5EB9A 3EYSH 1KBGL 5DSCB 3T4AA 4NP4L 1A4JB 4I9WD 3L3OA 1JPTH 4UDTB 1CL7L 1AQDA 5J6HB 3DVFA 2VAAA 5T1LA 3ILPB 1YEIL 4XP9H 3ELAT 3L9RB 3MACH 4XP4L 4XMPH 1T1ZB 2EIZA 3EO9L 3QNXA 4LSTL 4M48L 5T3ZL 2FLRT 1FVDB 5CINH 4DKFL 1K8IA 1MAKA 1S9VB 3N9GH 3L6FB 3QDJE 4YHLH 3BFOA 4PFEA 3BQUB 3VFWB 3LPWA 4HCRH 3L3GB 3MA7A 1XR8A 5BMFL 3RBGA 15C8L 5HHMB 2UVFA 1FNAA 4W6WB 3NCJH 4IHOA 3VFNA 2UWEF 2UYLB 5FGSA 4GW5A 3UTSA 3QUZA 4RDQF 3RGVB 1MAML 4TSAH 5F70A 3IT8D 3MNWA 1U3YA 2W0LA 1VERA 1SYSA 5CILH 2CQVA 1P7HL 4JM2F 3Q0HA 4W4NA 4I48B 3BPCA 2CSPA 1QBBA 4BM7A 3ULUF 4NKMA 5IW1B 5I9QC 1J87A 3T1FA 2Y06H 2XZQL 4GRWB 1IFHH 2AJUH 5K9OA 4ZFZA 2EE6A 1O7VA 1KUMA 5I1DA 5K59F 4ZUTB 5CUSH 3EUUA 4NM8L 3KYNB 1RV6X 3EYOB 5GZNC 2AEPL 5DK2A 2VO5A 4XWGL 1QLEL 4GSDL 1LK3H 1G7PB 4H88H 2W92A 2ESVE 3T0EB 4NKDA 3P3YA 1QHOA 3FQTA 1IQDA 1ZGLM 4MLIA 3HPLB 3U4BH 1CL7H 5DZOA 1HWHB 2NYYD 4K7FA 1S7WA 3MACL 2E6JA 3OX8A 5D2NE 5I1CH 4PGBA 2GFBB 1BVKB 5TQ2H 2AVGA 2DBLH 2R2CA 4RRPA 3IJYB 1PEZA 3KJ6L 5F44A 3GBNH 4XPHL 4OQTH 5GRJL 1G1YA 2G5BA 1TNMA 4J4PD 5DK3A 3FTGA 4OCSH 5CEZL 3D39E 5FGRA 5DWUL 4JZJA 2RBLA 4R90L 3HZMB 4NJAL 5HI5D 5TF0A 3MLVL 3MV11 3RUGF 3U0WL 4Q9CA 2A0LD 2VB5A 3QEQA 1G6VK 3D3VD 1MHCA 2DRUA 4P46C 1HHGA 3SE3C 2EYRB 2LU7A 4OIIL 2AABL 1CGSL 3KLDA 3SE9H 4GAGH 5DQDL 4B7IA 4YBQD 4XNXL 4IIQC 3AROA 4YJZL 4ISVA 5DMJB 4ZODA 1P2CA 2F19L 1OGAD 3FONA 5BS0A 1IGIH 4P2QA 3MGAA 3O2DL 1YN7B 3QDMA 3O2WH 4JPIA 3C8KA 1BZ7A 1EBPA 1I1RA 4ZSOA 4JDVA 2JB6A 5DMGD 1ZSDB 3CFCH 1X5AA 1NC4A 5DHVB 1R24B 4G43A 4D94A 5DD0H 4U1KA 2OBGA 1UJ3B 3GM0A 1MF2L 1T21B 3BKJL 3NACL 2AABH 5KS9E 2AXFA 3F12B 1LQVA 4HIIA 2GIYA 1A14L 5FM5O 5C0AE 3UBXI 2P8MB 4LLDB 3E2HA 2IEPA 2FGZA 3NCFB 3JWDC 1CDCA 1BAFL 4PPTA 2VMFA 4HIJB 4Z18A 5DYOB 3WD5L 5EO1A 3S4SA 4JFFD 2P47B 3ZZ1A 4PYGA 1QSEE 3QFJA 4ZOBA 5F6HI 4XPHH 5EO0A 5C2BL 2ADGA 1IKNC 2R15A 1MLBB 5DC9B 3MO1B 5C7XH 1EV2E 1AI1H 3MGTB 1A2YB 4G5ZH 5FUOH 4KMLB 4QXTA 2HRPH 4WFGE 3WL9A 4I13B 4PP2A 1EZVX 5LQBH 3QDGD 1R3KB 3MLRL 3PV6A 3UTQA 4OLVH 1O5DT 2FECI 5GRWA 4UTAH 3M8OL 3O3EB 5E9DE 3HB3C 4XNZC 1NGXB 3KPRB 4X9BA 4QRRE 1JJUA 3TT1H 4PTUA 1EFXA 3BVNA 1E6JL 1FL5A 3TVMA 3WFDL 2XKNB 1ZGLP 1PKQA 4JKKA 4I3GA 5DJDA 3O4LB 4XNQB 2FJFB 1UM5H 1D5ZA 5DURB 5AZ2H 1QHPA 5K33A 4FZEH 4NZJA 1DFBL 3NBNA 1H3TA 2BCKB 4J1UA 3U9UB 1BECA 4JFEB 4M62L 2X70A 4ODXA 1VACB 4YR6A 3CDCA 3CZFA 1A7PL 3ARRA 2V7NB 2WWMC 4PJBB 4LEXL 1N4XH 3V5DA 5FM8A 3TT3H 5DEFA 3RNQA 1L0XA 1X3DA 5HI4C 1OTSD 5C0EB 3IDIB 1JZ5A 2W0FA 1UKTA 4FTVB 3B2VH 3QQ3B 4P2QD 4PJDE 4D2NA 2IQ9L 3VFSA 3QCTL 4A6YH 4MA7H 3MRPA 3OAYK 4QF1B 2C1PA 2MPAL 2VIRA 1TTGA 3STZB 4Q7DA 4POZC 2ZG2A 3X12B 1U8HB 4OGXL 1UXWB 4YFDB 3VXSA 2FD6L 5E8OA 4MD0B 4AEIL 4HFUL 2CPCA 1C16A 1FAIH 3RI5F 1B2WH 1AO7B 2ICWB 2Y07L 2YWZA 3U30C 5I30H 3ULUD 4HS3B 4LKCB 5EU7C 4PV9A 5TFSH 3D87B 2DMCA 1BPVA 3OKEB 3UTOA 3QEGH 2AJXL 5EFIA 2GJ6B 3GSXA 4M61B 4DVBA 4P5MB 3H9SD 1HXMA 3MUGB 2C7UB 1I7TA 2X1WL 4NRZB 4OIAA 3D2UA 4GMSH 3LB6D 5C07A 3VFRB 5DVOA 1C7TA 2ZWLT 4HH8A 1OTTC 2NPLX 2NY5H 1T5WB 4I5BB 3RPIA 4FHBD 1XF1A 5DD3H 2Q76B 5E99L 4OUOA 4HGWA 4PG2A 5C71A 1GZQB 3QNZB 3QXUA 5HHPB 4K71C 4TYUA 5I18H 3GK8H 2GK2A 5DS8A 4WO4B 5EO9B 2AKRB 2DKMA 3K2MC 1P4LA 3ZTJG 3PL6B 5E6ID 4YGVA 3R0MA 3CXHK 5AEAA 3SDXE 5I8KL 4XNMB 3HC0B 2YD5A 3BPNC 1I8IB 4XBEL 1AQDB 4B5EA 1T1WB 3I02B 4YR6B 1G7PA 2B20A 4Y19D 3LKPA 4Z95L 4BKLA 3QHZL 5DD3L 2NTFB 5EC2A 4ZS6C 5I74C 4ZS6D 1UM5L 4CDHA 1EIBA 4ZOAA 3RVUC 4S1DC 4U05A 4XXDA 1FO0B 4G9FB 4QRPD 3BPNB 1YJDL 3D85D 4QOKD 3TO4A 4LIQE 4TVSa 5JO5B 5CSZB 1U8IB 4HWUA 2IBGA 5JHLH 2FDBP 3C5JA 2GKIA 2CR6A 4M6ML 1FZMA 3NOIA 5IFHH 2Z91B 3ZDYF 3IU3A 4N5EC 4HKBB 4OKVB 1HK6A 1MH5A 1T5XA 2VXUL 4FFZH 5DJ0A 3QEHB 2CUMA 3UZEA 4XPGH 4P2OA 2CDGA 5CJXC 2DJ4A 3H9SB 4RISH 5FYKD 4NUJB 4PGZA 3MNWB 3LY6A 5DRZA 3WLWD 4JM4H 3A6CH 4KQ3H 1R3JB 2BOCA 3VWKB 5GS1A 1KNOA 1YN6A 2UWEA 3CH8A 4PRPA 4JRXE 1W0VA 4JM2D 1MPAH 3GBML 5CGYC 1L7IH 4OTXH 2EE9A 5DFWH 3IVKA 4MB5A 3QHTC 3WNPA 1QRND 1OWRM 1HHGB 3U7YL 1HIMH 2V17L 1LILA 4YFLI 4Y4HD 4NKIH 2HLFD 2R2HB 3MNZB 3T4YB 2EDKA 3R06B 4LSVH 3VXMD 4JRXB 2OTWA 3HE6D 2CJUL 1U8PA 3RWDA 1EJOH 1H8OA 2UUDH 3N1GC 5HYJE 3TA3C 4AY0A 2GEEA 3MBXH 1WZKA 3SGKA 3SE4A 5FEBA 1FVEA 4PRPE 1GOGA 1F8TL 4RA3A 2O5XL 2VDLH 1NFDB 5FYKU 3GI9H 3OJ2C 2JIXA 4RQQB 2J5LC 3AB0B 4LEOB 5GS1B 1SEQH 1C5DB 3DYOA 3CVHH 3QISA 4S1QH 5F7YC 5FO8A 1XF2A 2NY2C 2FYYA 2JTDA 6CGTA 4JM2C 3F6IA 5F1IA 1KYOK 5CD3A 3PWNA 3ILQD 2VAJA 3LZFL 1TCMA 5L0QC 4H8WL 4QF1A 3QR2A 3IS1X 3NIGF 4GRWE 2VWEE 1JE6A 1S9WB 5C0AB 3WIFB 1DBAL 4ODSL 5IW6A 3KR3H 3CXHJ 3FMGH 2PTUA 5L8LB 2DBLL 2YMXL 2P5ED 4LHUB 3HB3D 3ZLQC 4Z7OF 4G8IB 5I8CB 1SVZA 4YZFF 4X4MA 5GGTA 4XPGL 1U92B 5CZXD 4CKVX 2P8MA 1BM3H 3W9DA 4A6YA 1YYML 3VRIB 4P23C 3PGCB 5L9DL 3EAKA 4U1IB 1KCUL 2D2OA 1ZVYA 3RUGA 1IT9H 4M1GH 1RMFH 3RTQC 5DD1L 1QPPA 4U1JA 1Q9OB 1OAZH 3PL6D 5E6IB 3S3SA 1HINH 4EVNA 1H3VA 4UDUA 2VH5L 4POUB 3RWCA 1EFQA 5HSFA 4M8QB 2Y9RT 2EDEA 3EJZD 3L9RA 2VKWA 4JRXD 5DFVC 4X6BB 2ESVA 1AH1A 3O3EA 2VUOA 1ZHNB 5HVHC 3OKKB 1LD9A 3LKSA 2PW1B 4Y89A 1KJVB 4HWBH 4IMLA 1HXYA 4P3DB 1D5ZB 2OMBA 3DV6A 4F58L 2EC9T 4NRZA 2E7LA 2PTVA 4U6HA 4WI4A 2ZJSL 3PABA 4RFNC 5D6DC 1JPSH 1QLFB 1WQVT 5D1XB 4FMKA 3E3QA 1QRNA 3JSSA 5DMIH 4M6OL 4M4RA 3MJ8A 4JDZB 2PYEB 4S1QL 4QRSA 2YS4A 4E5XB 3FFCD 1FP5A 5DVLA 1S7XA 1J7VR 2OK0H 4N0CC 1KIUA 1WT5A 4F33A 1JF5A 3N0PB 3WD5H 1G7IB 4RAVA 3I6KB 1T1XB 1NAML 2H9GB 2KQNA 2X9YA 4P5KA 4WW1B 5T5FH 1BQLH 4RMVA 1CFBA 5K9QI 5E2UL 4XCCL 3MGOB 3NIDE 2OZ4H 5D1ZA 3AB0C 4OI8A 1WCBA 2CUIA 1QFOA 4MXQD 4BH7A 4F2MA 1QLRA 4DN4L 3V7AE 5I17A 1EMTL 1OW0C 2EDTA 3IDIA 1HEZA 1X5JA 4LIQL 4F7MA 3HI1A 4RFNB 4NFCA 5FK9A 5SWQA 2GCYB 4QNPE 4G80A 2IQAA 3BGFC 3DX6A 5IUSA 4WUKL 4OM0H 1AGFA 3QH3A 4U1NA 4CU7A 1HHJA 4LCYB 5INDB 1NMCC 1WTGT 1SQ2N 4KK8C 2ZPKL 1XR8B 5AUMB 1FSKB 4RSVA 4HKZB 2DQFB 5F8QC 3RDTB 4S0SD 3HZVA 3PWUA 4M7LT 1RIVH 3GKWH 2CLRB 1FQ9C 4O2FB 2AQ2A 2JJSC 2WWKO 1XF4A 1ZLSL 5CD3B 1H5BC 2YD3A 2CKNA 3AM8A 2Y1VA 5B39G 1IC7L 3KPSD 1U95B 5CZKA 2XZCL 4NNXB 1PZ5A 1I9IH 4XWGH 5BZWB 1TJHL 4FQIL 2BHUA 1F3JB 5E08L 1IGJB 2YZ1A 4UQ3B 4UT6H 5HYEA 3CFDA 3UDWC 2X4RA 3ARFD 4M00A 4JY6B 1FN4A 2HA1A 3BAEH 4JRXA 1OAYL 3E6FA 4LQFH 5F3BB 1EO8L 4GBXA 4Z7UE 1GGBH 4C4KO 4EJ1C 2YPVL 1J0JA 4RMWA 2GSGA 4OIBA 4DGIH 4QHNA 5EOCH 5BZDB 4WJ5B 4L8CA 4CMHB 2GTWB 4YHZH 4UOW1 1JHTA 2EH7H 4I18B 3ZKSD 4MJ6B 4FQ1H 5ILTH 1UM6H 4YAQB 2YSSA 3IDNB 2YUWA 2UY7A 1FAIL 3LS4H 5CJQL 1HHHB 1R3IH 1TFHA 3FFCA 4QWWD 4QWWC 2BSED 2GJ6D 5CP3H 2J8UF 5MERA 1KCVL 3D9AH 3UYRH 1AGBA 1JF1B 4YEEA 3FQNA 1A1OA 2EXWD 2QQNH 3U36B 2OCFD 3QDME 3MUJA 1T04A 1GZQA 5T5FL 4MZ3A 4G8IA 2DWEA 3QNYA 5I1KH 2XXMB 5EULV 2LE9A 5J1AB 1MFBH 4IRJD 1CLOH 1Y6KR 3BXNB 4PRAB 3ALPA 1RAMA 4U3CA 4YXHH 1J18A 5C86A 4OZIB 4MAYC 3WSQL 2F74B 1SJEA 2PO6C 4ERSH 4PJAA 5MP6L 3E3QE 1AQKL 4DZBA 4PLKC 3QRFM 3BH8B 2DI9A 4V2CB 3LOWA 3C8DA 5IFAL 4WU7B 4YDIL 2XKUA 5FYLE 4QKXB 1B88A 4MZ2A 4JFFE 2H32H 5KJRH 1FG9C 2RB8A 1WWAX 1BX2B 1A3RL 1I3VA 2VSDA 5IT2L 5I1KL 1UWEL 3CGTA 4ZXBC 3B83A 1QFPA 1I9JL 4RMUA 1QYGL 1LK2B 3K7UA 1H3GA 3MCG1 9CGTA 5A1AA 4MSWA 4HXAL 1UWXK 4OD2B 5T3XL 1MHPL 5IQ7H 3UMTA 5LWYH 5JIPA 1INEL 3FO1A 5K9QG 1NH6A 1Q9WA 1RHFA 4G7YH 1MI5E 4KRNA 2Q8BH 1RZ7H 1KCKA 1A0QL 2EKSA 2ITDB 4NBZB 4BQBA 4PRPB 1BJ1H 2AJ3A 4LCWE 2C26A 3ZKMD 2WINB 4AMKL 1JFQL 3FL7A 3UTSD 1JHTB 1HQ4B 5E5MA 3RTQA 3CPLB 5EORL 4NIKB 1N3NA 3VH8A 4ZUSA 4YUEH 3KPSB 3VA6A 3VXPA 1K3IA 4LF3A 1EGJH 1F2QA 4YXKH 4QTHA 4WFEE 5MEPB 4OCRH 4W6XB 4ZUVB 4K71B 5DHVA 5KSBB 2A6DA 4YLQT 1DZBA 5D70H 2YN3A 5DMGC 2DIJA 1KBGH 2Q8BL 4XXDB 1D5XA 2B5IC 2JJTC 4XNUL 1DBAH 5GISH 1CE1H 2D9CA 3UAJC 1CE6B 1KJ2H 2AXGA 3MODL 3SJVD 1I3GL 2WINA 3D39D 1G6RL 4GRLA 2NLJA 2EDJA 4ZAKA 2BRQA 4NWUH 1G7MB 1JZ2A 2R4SH 1TIUA 1BZ9A 5DRXB 4EBQL 3KS0H 3C60B 4LCCB 1ULVA 1MREL 5HHOA 3I2CH 3MRKA 1G7JB 2DM2A 4XHQA 3PJSA 1MLBA 3VFRA 5F9JA 2X7LB 4LLMA 4LPWA 1NMAL 1TMCA 4CAGA 3QIUA 3NGBB 1A3RH 3RAJH 4HIJA 4MXWL 2WBJA 3DRQB 1IQDB 4I3RH 4ZFOA 4NBXB 4HGWB 5HGBB 1ZA6B 3ARUA 1RURL 4QXUL 2DAVA 4YDKH 3GMLB 3PV7A 1MHPH 1QFWI 4PGBB 3UJTH 1J8KA 4PG9A 4MVBD 3BSZH 3D69A 1ZGLA 3BKYL 3X12A 3O4LD 1KCGC 3P77B 1WEJL 5FYJE 2BVQB 4PGCB 4XVTH 5DJ8B 3ECBB 4X8JA 1CR9L 4HEPG 4Q6IB 4KHTH 1F3RB 1DBKH 3UBXB 1HH9A 2W9DL 4XPAH 2AXJA 4UNVA 4HG4J 3QNYB 2HLAB 1R0AL 2MQ0A 5FKAA 4LBEB 2NQCA 1DEEA 5IESL 4ZFZB 1GXEA 1II4E 5GISL 5IMLA 3BUTA 1WBXB 5C0CE 4R7DA 3BDXA 5DJZA 3PABB 2O5YH 3D25B 4KTDL 1KG0B 4WCYH 5HXMA 2XWBB 2YPLE 3LAFA 3K4AA 3V4UL 5GGTL 2YUXA 3TGXA 5IK3B 3L1OL 3L7FA 4EXKA 4MSWB 3BGMB 2J6EA 3O8XA 1LEIA 3FT3B 2V2XB 1WTLA 2IAMD 3GSNH 4OD2A 4ZPTA 2AJZA 1DSFH 1K2DA 2QSCL 4GW1B 4IRZH 1HOCA 4M6NH 3G6DH 1UG9A 4JPIB 3QUZD 1YMME 4OIIH 4AT6A 4DWHA 2AK4E 2NLJB 1MHHB 1NJ9B 3DMMD 3S8WA 1ERNA 3T2PA 5IB1B 5KVEL 1TTUA 4H1LG 3MJ6A 3E6FB 3UTTD 4PREB 4W4OC 4PJBF 4L4VA 2AXHA 2R1YA 1JTOA 3L5XH 2XWJB 1IGIL 3K74B 4L3EB 4N0UE 4U6VL 1F90L 4JO1H 2X6MA 3LDBB 2DYPD 3U7WL 2CIKA 2CRIA 3GBNL 2Z31D 4KJWC 4UT9L 4L29A 2R2BB 1FIGH 4U2ZA 4UIKL 1VKXA 1WBZA 1I8MB 5CSGA 3QUMH 4X8XA 2ZUQB 3GMMA 4JHWL 4K3GA 4GG8B 4M6AA 3G6DL 5DYOA 4JPKH 3V6ZB 5CFHA 3HKFA 3MRGB 5I1HH 1CBVL 3VD5A 4QHLA 2XN9A 2DQHL 1U6AH 1Q1JL 3GB7A 2CLRA 3DV4B 1BHGA 3MRFB 4RGOL 1JTTA 1J0ZA 5FA3B 4K23L 1G7HB 3CSYB 5KSAC 2YA1A 2NR6D 1GHFL 4YE4L 3DARA 3EDFA 3T0DA 1DUYB 3L3HB 1WFTA 1E28B 1RUMH 1RHHA 4DQOH 1DDHB 5HVWA 3GGWA 1HQ4A 5IB3B 4L8BB 3NGBC 2BY2A 2BJML 5HYSG 3TA3B 1DEEB 2WV3A 3P4NB 1RJYA 2NY6B 3AMKA 3GSNL 3KPNA 1NGZA 3BESR 3HZKB 1QUNA 4XCFH 1X5IA 4WW2A 5JA9A 4O51A 2R1WA 1U8PB 4R9HA 3LDBC 1H9VA 2DKUA 1QPXA 4O2CA 4ODTH 4YDVA 3HLAB 4LVOC 5HI3C 2ZSVA 1MAMH 4PYHA 4ZFOL 2R0ZH 3ULVF 3STLA 2GY7B 5HTSA 2D4FA 2OJZH 5L2KD 4YQXL 3BZ4A 3SJVE 4RWYL 3WHXB 4I48A 1RUKH 1S3KH 4XH2B 3Q6FA 4YWGH 5BXFA 5IMMA 2EDRA 2ZCKL 4FP8L 3FAXA 3GBMH 4LVOB 4HGKC 1FYTD 4XZUA 4K7PH 4L4TE 3RL2A 4N1CA 4FABL 2IAMA 2J1KA 1SJHB 1CLOL 1SY6A 2AV7A 2OTPA 3DSNA 1H0DB 3TCXA 2O26U 5D1QD 4Q97A 3DVIA 2K9UA 4O00A 3QI9B 1UQSB 2Y6SD 3FQNB 2VL5B 1RJZB 5C0ND 4KAQH 3QIBB 3CMGA 1AGCA 2R0WL 1DBJH 1NBYB 3IFNH 3F7VB 4OF3A 4PV9B 1J1XL 2J8UA 5HYJD 3WLWC 4ZPVA 5DI8A 4MDIB 4QRUA 4OV5B 2A6KB 1Z6JT 1J86A 2ICWI 2Q7YB 3W9DB 1S5HB 1IAMA 4JO3H 2F5AH 3OAZH 3IGAA 1E6JH 4JN1L 1HHIB 1GZPA 1EHNA 5IQ9A 1JHLL 1MFBL 3RWEA 4URTB 4KTEH 3Q1SL 3IJHB 4RGNE 3MLWH 4XMPL 1XH3B 4XB7A 5DD6B 4CVXA 1CD0A 3GMOB 4PJ7A 3IETB 3IF1B 5I9QB 5JQ6L 2HKHH 1Q8MA 3CSYA 1RPQA 1YEKL 2ZUXA 5ESAB 4NCDA 3QJFB 4PRDA 3V0WH 5TFSL 4UQ2A 3CDFA 4NRYB 3ECBA 2VDMH 4X8JB 1JWSA 5D1QC 1UXSB 4ALAH 4C56B 3BE1H 5F7DB 4HC1L 1JCKA 4NKOB 4OLXH 4KMTH 3B9KB 4G3YH 4WUKH 3L5HA 4M62H 2FO1A 4YZFE 4ZUWB 3PWPD 4FFYH 4YO0A 3T3ME 3B43A 4RGOH 2N4IA 4N9OB 1ORSA 5FV2A 4ZUTA 1IGFL 1Q9LB 5HPOA 5E94A 1VKXB 1S78D 3T0WA 3B2VL 1KCRH 5D70L 2B7DT 1T1WA 1JNLH 1EFXD 4OZHB 2BVQA 4PGCA 2Q8AL 1S7UA 5D1XA 3BN9C 1ZXQA 3LQAC 4P49A 4XNMA 3BIKB 1VFAB 3AS2A 4KJYA 3BVNB 3LRHA 2PYFB 5MI0C 1FL6B 2OQJB 1FIEA 1G7JA 3LEXB 1MQKH 5E95B 2QHRL 1LO0L 5BZWA 4XZUB 4EBQH 3B6SB 4YDJB 5DWUH 1BF8A 5J57B 4UOJA 3EFDL 2OL3L 4JPVL 2XTJC 3MBEC 4U0RB 1NCAH 4L9LA 4HS6B 5HYJB 4BFEA 3FJTA 4OCWL 4LSDA 4JANB 4PJAE 3RGHA 4V1DA 2HJKA 1S8DA 4NUJA 1HEZB 1R3LA 4MAUL 5F96H 3FT3A 4ONFH 4TUKH 5FIEA 1JIBA 3WHE1 5IIEB 1FFPA 1P5VA 4NM4H 2YD1A 3NZ8A 5SX4H 2NY5C 2R1WB 4WTZG 4LCCC 3PQYD 5DD5L 2FATH 1Q94A 4MXVF 3RX7A 3V6FB 5HYFA 3BPLB 1ITCA 2Y4SA 4Y4FA 3BDBA 4OLYL 5EWIL 3IGAB 4PJIE 5EOQL 3T2NH 3WS3A 2XA3A 5L2KB 5EIVA 4FFZL 2V2WA 2P7TA 3BD3A 3QIWA 4Q6YA 1QFUH 3MJ9L 3S35X 1C16B 1OTTD 1CF8H 4JM2B 3AS3A 2VDQH 1MWAA 2DLFH 3DXAA 2LAGB 1I4FB 1QRNB 3OB0K 5DQ9A 5KSBE 3PWPB 5L2JB 4R4NC 2VR9A 1UXSA 3CXDH 3MRDA 3C60D 2FJGA 2GJJA 4WI3A 4G9DA 5FKPA 3TVMC 3G5YB 2RIKA 5D96C 1DANT 4I0PA 1ZOXA 3DVNB 1CICC 4FQQB 4KKCC 4LCUA 4UNUA 5HDBE 3BPLC 2X9XA 4NZUL 2FEDC 3V4PH 4AT6B 5C0RL 2Q7YA 3UJTL 5F6HJ 1HE7A 2IG2H 2A73B 5DA4A 3QG6A 2QADD 4KVNH 1E6OH 1XGQB 3BHBA 1S7VB 4JAMA 1AHWA 4S1SH 1KLUA 3MR9B 3JBG7 3MLUH 3O2DA 2NX5D 4FG6C 1I3GH 4KKBC 4FG6D 3S36L 3OKKA 4JZNB 4L9LC 2EZ0C 5KOVC 4JPWL 5ENWA 1A4KA 1AKJD 1A6TA 3KPLB 3QQ4B 5FO9B 2B0SH 1G7MA 3QEUA 4U1NB 4Z0BH 1KJ3L 3O6LL 5DK0A 3DGGB 4R6UA 4KPHH 4N5ED 3ULVH 4QEGA 5BV7B 3BRGC 2P5WD 3BPOC 4N8VA 1KC5L 2HFFB 1Q9OA 4QRRD 4OT1H 3FN0H 3FT4A 5FGCE 4WUUE 4Z7VE 2D7NA 5DD5H 1CL7I 4PB0L 2WP3T 3WUWB 4WCYL 1N2RA 4ZNCD 3V4VL 1D6EB 2EXYD 1F4XH 5J8OA 3I3DA 2AJYL 2L7UA 5F88A 3IFLL 4P2OD 4RMTA 2DDQH 2H2PD 4CMHC 1M71B 1ZEAL 3KYNA 5HJ3B 1CI5A 2AV1B 2ED9A 1NAMA 3WFCH 1WCQA 5JPNB 1TPXB 3GRWA 5ITFB 4L3CB 2FR4A 3C2SA 4RIRA 4XXCC 2GSGB 5ESAA 3ZE2E 1GGYA 3VFOB 4ZPVB 4PJDF 1EVUA 3QDGB 5C0AD 1EPFA 2LU3A 1VPOL 4X83A 5IVXF 1IAII 3FO9A 4G6KL 4YAQA 1ZT7A 2K3TA 5EZOL 1H8SA 1E4JA 2WZPD 4NUGL 3H6JA 4X6CF 3QEQE 1Y6NR 1BMGA 1MIEL 4PJEE 4POZD 1T03L 2RJMA 3VXSE 1A7OH 4J6RL 2KZ1B 3L3IA 3NIDF 1R5WA 2H2PC 5IHLB 2PO6A 3REVA 5DMIL 1JYVA 1WUNT 2E7LE 3AMLA 3TN0A 3N1FC 3SQOL 4P2YA 5TH2A 4M1DH 3L5JA 3QIBA 4AH2A 4FMFA 3UP1A 4S2SB 1IGTB 5ERWB 3CMOH 1MY7A 1JP5A 4ZXBA 4LVHB 3BO8B 3SGKC 5CBAA 5J9PA 1NAMH 5KAQG 3BDYH 25C8L 2AV7B 4N9GB 4HMDA 1XMWA 3P73B 3QEQB 4ODUB 5FCUL 2OX5A 5D1QB 5DQ9B 1DLHA 2CDFB 1WBYB 4P9HC 4MJIE 1Q9LA 1CLZH 1BIIA 4EDXB 4JQXC 5EN2A 3MMEA 2NY1D 3F7QA 1S78C 3KAAA 4OF5A 5TPWL 4JKLA 3UO1L 1FC1A 3GHEL 1XF4B 1MNUH 4X5LA 3WO3B 1QSFE 1CQYA 2E7LC 1U58A 5I16A 5D2NC 2V6HA 3KPQA 1O7SA 4HBQA 2VIRB 4KK6C 3FRPG 3ULVD 1UEYA 3NH7H 1KCSH 1G9MH 2GJZA 3TFKA 4J3VA 4XCFL 3D3VA 1QO3A 3ARGA 4ZUUA 3B2UD 4O4YL 3U30B 5FCUH 3PL6A 4K94H 1Y18B 4APQD 4W6YB 4YBLC 5F9AC 1IM3B 4JFQA 5C08A 3NABH 2CDEA 2FWOB 4G9FE 4GBXC 5E1AB 5EBLA 3Q5OA 1YJDH 2R23B 1AKJB 4LASH 4PGJA 1IC4L 3TZVD 1TQBC 3VGEA 1W72B 3UZQA 3BP5B 4YFLF 5CEXB 5IMKA 1J8HB 5TGBB 2WBWB 3WIIH 3B9KD 4NQCB 3NZ8B 3E8UH 2YD2A 4OCXH 4E41E 3ULVE 1RK1B 5TE4L 3NA9L 2UV3A 2DI8A 3KPTA 5I1GH 1KELL 2F58L 4UZGA 1CZ8H 1RUPL 3L5WB 4LVNB 4PJAB 2ID5A 1LQSR 1YEFL 2Q6WB 3BAEL 3RU8L 2HFGH 5C0NC 2DI7A 3EOBA 1DQML 4I1NB 4APQC 2N1KA 3OB0H 4MJID 4P2OB 3IXAA 4UT6L 4UMGA 2VLJB 1NFDF 1C5BH 5GS0H 1D9KB 1JZ6A 1UXWA 3PDDA 3TM6A 3KYKH 1IKFH 1LDSA 5DRNB 5IVOA 1ZLWK 1TZHA 1MNUL 4K3JH 2X7LA 4R26H 1GC1L 1H3UA 1NC2A 1BGXH 1FNEA 5DT1H 2XKSA 1PKQE 1ORSB 2ZUVA 1EHXA 3PGCA 1I1CA 4EOWL 2QSCH 2FIKA 3VRJA 4OGYL 3CFEA 2B2XL 3MZTA 5EUOA 4AQ1B 3W5MA 5JXAH 5TE6L 1KCSL 3BDYL 1OT1A 1QD0A 5FK9B 4YXLH 1RZJH 2OI9A 1CICA 4L3EE 3ARXA 5EBMB 1N6QH 1F11B 3JV6B 3WIHH 3AAZB 4HFUH 3PWVB 4IDLA 2BVPA 5CLWA 2OMNA 2VXQH 3AS1A 2MCG1 1G7QB 1N64H 3V95A 3GDBA 1MRCH 1YEJH 3JV4B 1PG7W 1OQXA 3V5DB 1VEPA 3ZO0A 1F6LL 1IFHL 1TPXC 3TNMB 1W0YT 4JLRA 4N1EA 5F3HB 5EZLB 3OJDB 2GT9B 4P99A 4YXHL 3EOAB 3JTCA 4Q74A 1N5AB 3EYFA 1WBYA 5DZLA 5TJWK 5IJVB 1BIIB 4EDXA 4YPGB 4CVUA 5GS2D 1U3HB 2XXCB 5IT2H 2A74B 1KTKE 1WT5C 4H1LH 4PV8B 5ICXB 2ARJQ 1HXMB 3M45A 5KVGL 1MEXL 4NO0B 1HI6A 1MUJA 4PJFA 4GRLC 4LSQL 3LV3A 5E24E 4PRHA 3H8NA 4JAMB 2NW3A 5HHOB 4PJ5A 4QCIA 5FECA 4X80H 4JFHD 1BQHG 4RGMB 3TT1L 4WDIA 4NO3B 4DKFH 4F3FB 5D7IF 1EAPA 4P2QE 3ZKND 4I77H 2J4WH 1QFUL 3MJ9H 2PF6A 3SO3C 3F7YA 1VEOA 3T4AB 3M17B 3SCMD 4F7MB 4OLUL 3H9SA 4ZPTB 2ICEB 3DMMC 3EO9H 3I3BA 5CJOH 1UACL 4NHUB 5HHNB 1LE5A 1YDPB 3MLYL 4OSUH 5I30L 2X44D 5C3TA 3HMXH 3TYFA 4KRPD 1FZMB 5JTWA 1HHJB 3QZWG 3JWOH 4JY5H 4MCZB 5K9KA 1F6AB 4HUVB 4Z0BL 4RA0C 1XF5B 1IJ9A 2HG5A 3L5IA 3U1SH 3WEXA 4P3WA 3RL1B 1A6ZA 2XRAL 3DHJA 1L0QA 3FT2A 4PBWD 3MRQB 2AS5M 1WSST 4F7CA 3MRLA 5FDWA 5GS0L 4MJIB 1E6OL 4MX7A 2H32B 2R2BA 3QDJA 1FLRH 3PWPE 5HVFB 2VLJD 4OGYH 3C5JB 2UZIH 4PB0H 3HCVB 4HDIB 43C9B 1YJDC 4WW1A 4AL8H 5K9JL 5ABDE 1FO0A 5EORH 4YDLB 4U7KA 3MA9L 4P2RA 4H88L 1ND0B 4WFGD 3GMLA 1QFWM 4ETQA 4TNVK 2AEPH 4O58L 3MV7E 1KJ3H 3O6LH 4IOSD 3L95A 3VFPB 3HI6L 4XAWH 4C4KT 3G6JA 4DTGL 4KZEH 4TPRL 3WUZA 2GSIA 3FCTA 1UWXH 4L8DB 5HHVL 5J9PB 4NDMA 4QXGL 1A3LL 2FBOJ 1XT5A 4MCYB 5JDSA 4GAJH 1KXQE 5ICYA 4YDVB 4LNRA 3C5ZA 4NC1C 4ZD3L 2FZ3A 1P7QA 4LCCA 5C0RH 3QWQB 5CJOL 4MYWB 3T04D 1W72A 2VR5A 5HI3D 3VRIA 3MV7A 4XVTL 4NO3A 2FX7H 5JQHC 4Y4KA 3GUTB 4HPOL 3S3PA 4DKDC 1MCWM 4GLRI 1JI2A 1PY4A 2Y5EA 2L7JA 3T8XA 5KVDL 3NFPA 3IJSA 4HW6A 1JK8A 1B6UA 1TVBA 4L9DA 4CMMB 2EH8L 5FA4B 3K81A 1L7IL 4LIQH 4OTXL 4WGWB 2AQ3A 3SOBH 1R0AH 3UTPD 4M5ZL 1A3QA 3ILQC 3WFDH 5C09E 1BWWA 3NN8B 3RVWD 5JXED 2I5YH 3E3QC 5JW5A 1VHPA 5TF1L 5EWIH 4L8SA 5JUEL 3V0WL 3N85H 2VR4A 1DTUA 3OGCA 3BJLA 4NGHH 2GT9A 4E41B 1AR1D 2P45B 1AGDA 4E0RB 4NQCE 3QYCA 4PJ9D 1T0NB 2FSEA 1SMAA 4FFWD 2R23A 3MUY1 3ISWA 2GTWA 1IEBA 2FX9H 4X7EC 4K3DL 3OJMB 1OQOA 4K07A 4O58H 4ONFL 4TUKL 1KFAL 2XFXA 3VWKD 5FOJA 4QGTA 2XZQH 5D7KD 1MJUL 1BAFH 4OFIA 4JZOB 3ZTNH 1CVRA 4J2XA 3VXUB 2VLKA 5IEHB 3B4NA 2Y5TA 4F3FA 4GAYB 3I84A 4HPYL 2MQ3A 2DBJA 5IBTH 1CFTA 3C9NA 3BYYA 1FIGL 1WWCA 3VD3A 4TSBL 4U1JB 2YRZA 3CZJA 1T6VN 5F3BA 2VE6B 4IRJC 2YZ8A 2ZUSA 1NGYB 2XZAH 2YMXH 3H9YA 4PS4H 4JG1L 1LNUA 2NY1C 3O4LA 4U1MA 4XWOD 4OCXL 3R8BB 1VFOA 3A0OA 4LHUG 5E2VL 4EIZC 4KJYB 2W1NA 4UQ3A 2E27H 4IOIB 1D9KA 3W0WB 5M94B 4KY1L 2ICWJ 1CTNA 1WICA 3VWJA 4YHLL 4PLKD 1CDYA 3GI8H 1ZLWH 1HXYB 3EBAA 8FABA 2DQFA 5GHWH 5DRZB 5H35B 2D7QA 5IJVA 1FYTE 5JPMA 4X0KA 1C8PA 1KCUH 5ISZE 3HZKA 2ZSWB 5J3HD 4HBCL 2HT3D 4YHIB 2QTEA 4LVNC 3GMNB 2XQBL 3RUGE 5KVFH 3ZKNC 5FYKL 5CAYB 5FKPB 1C12B 1CFQA 5DVMA 3CC5B 3ABZA 4FQXC 4BQCA 1PLGH 2FL5B 4HUMB 2R29H 2ZSVB 3ARWA 5KSUB 1TCRB 1AD0A 1YMMD 2VDKH 3FQRA 3IDMA 4MWFB 3MLVH 2R0LL 3RDTA 1I1FA 3RNKA 3TO2B 4KVCL 5F7NC 1G7QA 3AAZA 4WENB 4KY1H 3FFCB 4U1KB 1HQRA 3X13A 1LO5B 5F1OB 2YEZA 5JA8B 3DV4A 5C0IB 1KPVA 5BVPL 3C6SB 4FZEL 3FOLA 1MFDH 2YPLD 3MTRA 4NQDA 4GW5B 4DAGL 5GJSL 1BZ7B 1PQZA 3E6HA 5JOFA 4WU5B 1N7ML 1FORL 1YY9C 1ACYL 1R6VA 2CRZA 4Q9BA 4OFVA 5LXGL 3U9UA 4JDTH 2X4OA 5CP7B 4M03A 3NCCB 2AJVL 3NAAL 4JKPL 4FABH 1NBYA 5D4QA 1WAAE 3NPSC 5KSUA 4WWKA 1T4KA 4FQLL 2DYPA 1I9JH 3DYPA 3NFSL 5LGJB 4JY6A 2X89D 1AGEB 2R56H 2ZCKH 2I26N 3IS0X 2A74A 4FXKA 5BCAA 2BFVH 3KLSA 3WIIL 1UEMA 1J12A 1JGDA 5BVPH 1A5FL 3CVIH 1OT2A 4M7KL 2RCSH 4LKXA 3W11D 1WBZB 1LP9E 4PJXE 4KVNL 3ULUE 5KVGH 3VA2C 3H9HB 4GQPH 4JHAH 4OJFH 5I8OL 2XN9D 3MV9B 2ZUUA 4XH2A 2IBZX 1QKZL 2QADB 5EZIL 5D1XD 2GTZA 3TIEB 1OGAB 1A2YA 4PLNC 5B3NA 3NAAH 1LGVA 3AU1A 1YMHA 5FYKH 3UTTE 3MR9A 1GGCL 2PR4L 3WXVL 4X6DB 5CMAA 1FO0L 3T4YA 3MUHL 4X7FC 5ISZB 3D85A 4XP6L 3TO4D 3BUYA 3TO4C 3AS0A 2PYEE 3EOAA 3KPSA 4P2RE 5EUKA 3ZSSA 1M7DB 1WIOA 4L3CA 4Y5YC 2FR4B 4M6MH 1YNKL 1RIHL 2EE2A 3CJJA 2DOCA 3VCLB 3P11H 5IBUB 2LTQC 3P4MB 3IDJB 4I18A 3V6FA 3KGRA 4CVWA 3CSBA 5I6XB 1JYNA 4TULL 4CU8A 3ARFA 4JRYE 1IGCH 2EICA 2JELH 1DBKL 4PRBA 3V5HA 1J9CT 3IDYB 4DK6A 1NGPH 4IBLT 4HUXB 2HKFH 5D1XC 1OP5H 4QYOB 4BFBD 1CFVH 5DJXB 4RX4A 1QSFA 3M1BB 2H32A 3QDJB 4PJFF 1OAKH 4WTWA 1DCLA 4NZDA 1EO7A 4HWZA 1FAKT 3KPPB 1DLFH 1AGDB 3BGAA 1GL4B 4E0RA 1N59A 4U6XB 2Z4QB 3RDTD 2NXZB 3AXLA 2JB5H 1KCRL 4PGEB 1FLRL 1JMZA 3VXMA 1RFDH 1EO8H 2ADIB 4WFED 3HE6A 5D7IA 4GKOA 4UT9H 4NNPL 5J12B 3VG9C 3MCLH 1I8MA 3NN8A 5C08E 4KDWA 3NPZB 5D1QA 3G08B 1UB6A 4TULH 1UZ8A 3QDHA 2YPLA 1J1PH 1A22B 1A47A 2W60B 4LCWD 4BSVB 1ROWA 5GZND 5B38A 1A6VH 2EDBA 1HHKB 3IU4L 3QCTH 4OF7A 1YMMB 1JRHI 4HUUB 1NGWA 2XOTA 2J5LB 3PJSB 5GS1C 3PQYB 4OLXL 3OTTA 1FFNB 4OF8A 2ZOLB 3QWRD 5CEYA 4N0UB 5DMYA 2EXWC 1DN2A 4P59H 3N06B 2DMBA 1CFTB 3U7AA 5E70A 1CR9H 3SDAB 1G9NL 1K2DB 1A6TB 3KPLA 4LSVL 5FO9A 4MS8C 4WO4C 4MS8D 3IDYC 4PJAF 2DJUA 4LPXA 3Q48A 1ZT7B 2OJEA 3QO1B 4RGMC 1Y18A 4AIZB 1P9MA 5IVZB 5C2BH 2EE3A 4J4PA 2HTLD 1AQKH 4CW1B 2HRLA 2W9EH 5C0EA 5IF0A 3UROR 4XVSH 3MC0A 3D0VB 4P9HL 1EUUA 4DW2H 4Z5RB 4TUOB 2A83B 3F6LA 4MAYA 3BP5A 3FAWA 5CEXA 2VAAB 5T1LB 4M7LH 1JPSL 3ETBF 5F72S 3WNNA 5F71A 2ATPB 4QHMA 4NQDB 4H1LA 2BK8A 1TJIL 1U91B 1NSNH 4GAFB 1UCBH 4QRRA 1I85C 5FF6B 4M5YH 4D8PB 1FNSL 5H37H 1F97A 3DX7A 3LIZH 3QJHA 5CILL 4PTTA 2CDFA 5DUPL 5KJRL 1BQSA 1AO7D 3KPRD 2P1YA 3DJ9A 5MHSD 3EGSB 1I8KB 4NWUL 1FH5L 2YPKB 5JMRA 3QDMD 1H15A 4LF3B 1SJHA 4OD1L 4H25B 4P9HH 5DRWB 4DW2L 5FGBC 1PG7X 3V6OE 5I15H 1UYWH 4KQ4L 3H0TB 3FQXA 3LVEA 2DF3A 3H42L 2FB4L 3I6LE 4RX4D 4Y2DD 3DI2B 4GG6F 1A7QL 4YXLL 3HUJF 2CIKB 2BNRA 4JJ5B 4PJXA 4TQEL 4YDIH 3SN6N 3MRKB 2HJKB 1AR1C 4YWGL 2A9MH 1RU9H 4ELMF 3TN0B 3WNMA 2ADJA 3VD9A 1HILB 1OAXH 4QLRA 3CIQA 1CE1L 3L3JA 3QFJD 1PQZB 4XNUH 2GSIB 3FCTB 5DJZB 1KV3A 2QADC 2YBRB 1DR9A 4AEIH 2K1MA 2Y7QA 3F58L 3ET9F 5T1KB 1I1YA 3GSQA 1A9EA 4LCWA 4YBLB 1JZ8A 4KK8D 1T0MB 3F5WA 5FKAB 2HLFC 3RIAF 2OZ4A 3ES6A 2WQRA 3KYOB 1D5MB 4DZ8A 1NBVL 1FHGA 5T1MB 3QDGA 3RNKB 3TO2A 4HF5H 3L5WA 5ACZA 5BQ7A 3TJHD 4DZBB 3QRGL 3D25A 2X05A 2NX5B 4JQVC 4O9HH 2KUTA 2OSLA 2XY2A 1JPGB 1TZIB 4EN3C 2ZPKH 4UIMA 3ROLB 5KS9B 5DO2C 3PGFH 32C2B 3RL1A 4H26B 4IJ3B 3AGVA 2Z4QA 4EI5C 1J1OL 5EU6B 4EI5D 2J6EL 5C6TL 4E42B 1H3XA 1NCWL 3FB6A 1I1YB 1VFBA 4D9RE 5I15L 43CAB 1SEQL 4L8BA 5EZOH 2WWKT 1HKLL 2QHRH 2BVTA 1YZZA 4JFZL 1DN0A 4P2OC 5CJXA 5ESVA 4U6HB 3SJVB 3SO3B 3S4SG 3I6GA 3NZHH 2R1YB 2XWJA 4LLAA 3SY0B 3ARGD 5BS0E 3D39B 4ZQKB 3GSWA 2W59A 3BEWB 2FB4H 2V9RA 1S8DB 4NZRH 3GB7B 1FVDA 3M8OH 3GBLA 3SDDC 3S88L 3QPQD 7FABH 2EDWA 4LQ1A 5AD0A 1G9EA 4XCNA 3IJYA 2GITA 3U7YH 3T3PE 5IESH 3A67L 3U0PB 2FH8A 1ETZA 4OFDA 2OI9C 3MRIB 3RZWA 2DTSA 1P53A 2BNUA 5C07B 1AGCB 2MOVA 4DUWA 4U1LA 4MJ5B 4Z9KB 1MCIA 2Y72A 1A6AB 3TNNA 3FFCE 3ARFC 2R0LH 2VDML 2W60A 3GJFA 4JREB 4IDJL 4NO0D 5F1SA 4ODVH 3MV9A 2IGFH 3GKWL 4BK5A 1AE6H 3HZVB 3PWUB 3L3OB 4AIOA 3P0GB 2EDOA 1ADQH 2PNDA 3BSZL 4HK0B 1FJ1B 1J8HA 1KLFA 7CGTA 3DRTB 3KPSE 4PRID 2GITB 3DUHA 3GRWL 3UCRA 1RZGA 1OAYH 1ACYH 2QQNL 3G04A 4H0GA 4WEUD 3DX9A 4C56D 2BOBA 2OTUB 4HMEA 1VGEH 1X5FA 2DYPB 4OJFL 5I8OH 3W5NA 4JHZA 4EDWL 4G6FD 3CVHA 4P5TB 3SKMA 5KBNC 2X4SB 4PJ7B 3V5HB 3V5KB 3AUVA 4U1IA 3W11C 3ARFB 3HNTL 5LKNA 2BVPB 3A6BL 4I3SH 4R8WL 5IB4B 4ODTL 3KPQB 4WY7L 5DJYB 4GLRH 3S36X 4H1LB 4JDVB 1IQWH 1V7NL 1H8NA 4XVJH 4FQHB 2YUZA 1A7NL 2AGJL 4WVRA 2SEBB 1F4HA 1FNEB 2HWZH 3HUJE 4NNYA 1DVFD 1OSPL 4QRUB 4OV5A 5IBUG 4JFDD 1I75A 1SYVA 3VMPA 3HG1B 3HPJA 2IANB 4UV7H 5CKGA 1NCAL 1EEYA 4YE4H 1F13A 3VFTB 5IJKC 1UH4A 1RULL 5DJ6B 2BVOB 1RMFL 5IBLC 3BOVA 4S1DD 1W72L 1DE4B 2XT1B 2DQTL 4X6DF 4PJGF 3WN5C 3MXWL 4ZO9A 1Q0YL 3T65B 5CINL 4KGLA 1PZ5B 4UTBH 2XNAB 5HHOE 4DQOL 1NBQA 1JFQH 4FXKB 3TNNB 3CCHA 2DS4A 1QSFB 3M1BA 5F1KC 2J8UE 1SYVB 4UT7L 3R4DA 4NN6B 1KJMA 3QG7L 3SOBL 3EJYC 4WWID 3LD8B 5DC0A 5BO1H 1S7VA 3AFLA 4HS3A 1S7SA 3MLTA 1CD8A 2X5PA 2F54A 2NTFA 5EC2B 3QH3B 1U93B 2KQMA 1Q9KA 3OG4B 4HSQA 3RGVD 3TBVA 2ITCA 4JFQB 1QRNE 4XI5D 2OZ4L 4MCZA 4M7ZC 3VD7A 3R8QA 4HWNA 4N8PA 3G5ZA 5DJ2A 3OHXA 4EQ3A 1PYWB 3SJVA 1WVZA 4LGPB 2WUBH 4HKBA 4OKVA 2X4SA 1S7QB 2UWEE 4JPWH 3EGSA 4HJJH 4J3SA 3IJHA 4EQ2A 5C1MB 3UX9B 4PTTB 3GIZH 4DOHE 1DVFB 3QUMB 2F53E 5D6DA 3SDCC 4CNIB 1PD6A 4XT1C 5HHOD 3FONB 1CGWA 2F54B 1OSPH 3QDMB 1NGXA 4XXCA 3LQAL 4PJ9B 3QIUC 4PJEF 2HVJB 4CVZB 4PJHA 3QCVH 1XCTB 4PGDA 2VABA 4V3EB 5JW5B 2CLVA 2UYLA 3UTSB 4NRXB 2GAZA 4HC1A 1F6AA 1L9NA 2OSLB 1T7VA 3MXVL 1FN4B 2AJSL 4XNQA 1UVQA 2D4DA 3MV8E 2A83A 1NBZB 3LIZL 3SGDH 1MJ8H 4EN3D 5C9JB 4MGXA 3T0BA 4PJ5E 5GRYA 5J12C 2E8YA 4RGNB 3C6LD 2D0GA 5BVJA 3MRMB 2DQDL 3UC0L 1JV5B 1A9EB 5E7FA 3OAYH 3VI4F 1BOGA 2VZVA 2PW1A 3NH7L 1CFSA 2QQQA 3HA0A 4A2LA 4YC2C 4XCNB 1NANH 1FZJB 1I3UA 4XWOC 1Z9LA 2B1AL 4X9HA 5GHWL 3TPKA 3TYGH 3OKMB 3WDIA 1ZVHA 3QUYD 5K93A 3QUYC 1U8QA 3NVQA 3P4OB 5JOPE 4NOFA 3MO1A 3HLAA 2BC4B 4H25A 4BFIA 2PW2B 3OKDB 3W0WD 1NCBH 4P57A 5C9JA 4DFHA 4U33A 5TGBA 1B0GA 1P7QD 4WU5A 3TPUB 1FZKA 1SY6L 3ZDXE 1SVCP 5FB8A 4Y4KD 4KK9C 4Y4KC 1QFHA 4NQEA 5C0JB 2HLAA 2VLLB 4GMTL 4LPUA 4KXZI 2RCSL 1A1MB 3ARED 5EU6A 4XMKH 4LRNH 4ZS7L 4H26A 5CZVH 5EN2B 5JW4Q 4JE4B 4GJTB 5KTEH 2C4XA 1UJ3A 5E08H 3K1DA 3KG5A 2D03L 1I8IA 3FQRB 3IDMB 1CWVA 3VW3H 1UJ3C 3LKNA 1MCWW 4ZUVA 3X3GL 2AQ1A 3LKQA 4OCYL 1EERB 3IDGB 4Y2DC 2CK2A 2PXYD 4XNYH 1BD2D 1F4YL 2VL4A 1AY1H 2VRAA 1I1AD 4PUBL 4FTVE 4U1HA 1X44A 5IM7B 4Y4FD 4ZUSB 1GOFA 5IMOA 3I9GH 3CDYA 1YEIH 2GY5A 2P8PA 3REWB 1MCSA 4OZHF 4PJBA 4KZDL 1PDKA 5IQ9B 3QEGL 2KPNA 2ZG3A 1F3DH 3C6LB 4GQ9L 5IG7B 4WDIB 5K59E 5DUBA 3VXUE 2W0KA 2MWCA 2QLVB 4YGVB 1F45A 4L3EA 2XWTA 4MJ5A 1A7BA 3LRSA 1KJMB 1XGQA 3BHBB 1RVFL 1CDHA 1UCTA 4XMLL 2NXYC 1HZHH 1YPZF 4N8CL 2A73A 3ARYA 2VLRB 5KVDH 4YGAB 4EN3A 3PDOB 4ORZC 3DYMA 4OUUA 5I1LB 2IBBA 2LTQB 5HJ3A 5ETUA 5E2UH 4C59B 3B9AA 2FD6H 4ZD3H 1J0KA 1A0QH 1OM3H 2X42A 2G2RA 4BYHA 2GQHA 2VXSH 1G0XA 6FABH 3IU3B 2D9QB 2MPAH 1LK3L 3H9SE 2GAZB 4WFHE 5IBLD 3QUYA 4MNQE 1Z2KA 1F42A 3TO4B 2R0WH 2Z93A 2ADIA 1UC6A 4M7ZB 2QQLH 4LOUC 3DHMA 3O0RL 3U4AA 2G9HA 3KYOA 4U4BA 4DZ8B 2FO4B 1HHHA 2SEBA 4QRRB 1MEXH 5HDBF 4MNHA 4AG4L 2KKQA 2R39A 1YEGL 1QSED 3P4MA 2R69L 1T6WA 1YA5A 5JR1L 4GXVH 4TVPL 1DQQA 1N6UA 1NCDH 3KXFB 3C2AH 1GIGL 1UH3A 1WC7A 1ZV5A 2PTTA 5HI4D 3D48R 1OAZL 1Q0XH 2DTMH 5HGAB 3MODH 1BGXL 5GSVA 5HGHA 1JPFB 4HGMA 1ZHBB 3WLBA 4F15B 2FL5A 3M17A 4NHUE 1Q38A 4NFBA 3QP3A 1J05B 1J5OH 4F8TA 3VG9B 2NZ9D 4O02L 4JO4H 1EGJL 2A9NH 1JGDB 5E0QA 4WU7A 1SHMA 1W2KT 3HN3A 2OR8A 3QA3B 3HC4L 5IVXA 5D5ME 2APVA 3FB7B 3LCYA 1IEAA 3BEVA 1AO7E 5MHSE 4X6CA 1NGYA 5TH2B 4UU9A 2HVJA 2BNUB 5DD0L 3W81A 2DQIL 4PJ7F 1F4XL 2EIBA 4X5XA 3VFMA 4I4WB 3QDGE 3WNLA 1MCNA 1Z0MA 4JG1H 5J6GA 5ADOL 3BZ4B 1JGUL 5BOZG 1TJHH 4ZTPH 5IW6B 3WKMH 5I1EL 5KVEH 1IARB 1MRFH 3DOSA 3JVGA 3MLYH 3FQWB 4OM1H 4TUJA 3RA7H 1OAUL 5D1ZC 4LASL 2ERJB 3ULVC 4MD4B 3QJFA 3BGMA 3O8XB 3C08L 4JFDB 2EEBA 3PWVA 4NQVB 1RD6A 4NWTL 4ZTOL 2IAND 5E8NA 5SWZA 4NHUA 1IZKA 2AP2A 1NC4B 4KTEL 4ODHL 4JREC 5C09A 2H9GA 4P5KB 1U8QB 1VFBB 1UZ6F 5I1GL 5GSRB 4RAHA 1DDHA 2FNBA 3P9LB 5D93C 4KTDH 4PJGA 3O2DH 4X6EA 3WSQH 3D85B 2JCCA 1HIML 3V5KA 3D0VA 1YQVL 2E3VA 1IC5L 1RZFH 4Z6AT 2DKSA 2P24B 2VDLL 4PRHB 2VL5A 1X6NA 4G3YL 4YH6A 1KEGH 2VXSL 2XY1A 3O41A 2A38A 1DSFL 4APQB 1QSEA 3O45A 1TZHB 4M02A 1QSFD 4F8QA 4U1MB 2CK0L 4DGVL 1FYHB 4KHTL 4AK1A 2YC1B 1UB6B 1W0VB 5C08D 1LP9A 1UKSA 4KDTA 1BX2A 2ARJB 3WXVH 2A6JA 4NQXA 5EU5A 3PP3K 1BOGB 5JIKA 5MENE 2AW2A 3PL6C 5EZIH 1NGWB 3NIFE 4F9LC 5CWSB 4GAJL 2YD7A 4JQIH 4Y2OA 4BSWB 3I85A 5E2TH 5BW7A 1YQVH 3LKQB 1FFQA 3STLB 2YUVA 1NFKA 4FQ1L 5ILTL 2E9JA 4GH7B 4XX1G 5DJXA 3HFML 1MLCA 4FQLH 5DJCB 5C0GB 3LS4L 5CJQH 5SV3A 5DEGA 3CLFH 4GKNA 4G8GD 5ACMA 2HT4D 4PJCA 3FN3A 5JIIA 2EYSA 3FT2B 2QQKH 1N3NB 3VH8B 2A77L 1MQKL 4R3SB 4ZUWA 5MI0B 4LLVB 2X4UA 2ZOKA 1QKZH 5LBSH 4ENED 5K9JH 5AYUH 1OAKL 4IS6A 3QHFH 4MJ6A 3L3DB 1DBMH 3MRRB 4MS8A 1YNLL 4MXQC 5FM5M 3EOYG 4PJ8A 2AEIT 1JL8A 4OZGB 5DSCA 1M7DA 1NGPL 2EDLA 1QOKA 2R1XB 1YNTB 3S35H 4ONGH 4CBPA 1MCHA 1AR2A 3GIVB 4NNPH 3IETA 4D0CB 2IBZY 1FGVL 3UTTB 3HI6H 4XAWL 3GSUA 2Y06L 4PRNA 1WJ3A 5MP6H 3T0EC 2IG2L 3TJHC 1J1OH 3WJLA 3QJHB 5E8DH 3BW9B 3N9GL 1PGRB 5DHVH 3ARBC 2EDNA 3H3PH 3O3BA 5EOCJ 2R4SL 4KI5F 1QFWH 5HVGB 3VJ6B 2P46B 1TETH 3STBA 2R2EB 3QCUL 5DHYB 4QGYA 4BZ2L 4U6TA 2X4QA 1FYTB 1A7RL 1A6VL 3MFFA 4Z5RA 3FB7A 3QIUB 4M8VA 2P5WA 2FYYB 4N0FA 4GSDH 4XP1H 1FG2B 4GKZA 1HYSC 3ZHDA 3W2DH 5ICYB 1IKFL 3NFPB 3P30H 2DQJH 4LLYA 2NXZD 2VLME 1P1ZB 4OSUL 2HN7A 5DQJA 2VLRA 1NPUA 1AGFB 4AQOA 1MJJB 2XZAL 1MJ8L 1BQLL 5JZ7C 5JZ7D 3QXAA 1FFNA 2NW3B 3C6SA 5KAQF 4YX2L 5A2LH 1JPFA 5I6XC 1B2WL 3D18B 5MEQA 4M1CD 1H15B 5EDXA 4NQVA 4TN9A 4G9DB 3ULVL 3QPQC 1AD9B 4X7TA 5D71H 3QPXH 3CFKA 2PYED 2V17H 2NNAB 2JB6B 1XR9B 4L4VD 1S3KL 5TDOB 2ZOKB 1T1XA 4NBYB 3RPKA 3OKYA 4OLWH 3EFDH 1UADC 2NZ9C 3V52H 1I7ZA 4WV1A 4HKJA 2PXYC 1T89A 4HX1A 4ZFGH 3L3KA 5GS0D 1VFUA 3RKPA 1BD2E 5JPMB 4MD0A 1IC7H 32C2A 3MBXL 1XCQA 4X7CC 2ATPA 4QHMB 4Y5XC 4RCAA 3QT2A 4QRTB 3GMQA 1PVHA 1SY6H 3QO0A 3EZ8A 2NCMA 5JW3L 4BSJA 4TRPL 1QG3A 3CC5A 4LK4A 1KF9B 4JVUA 3QI9D 4ESKA 2CD0A 3TN0D 4N1HB 5T1MA 5BQ7B 3KXFD 3LH2L 1YPZA 3QIBD 4XVUD 5F7EL 4K8RH 1RJCA 4Z7QE 1XR9A 5IB1A 5I1JH 1HHIA 1GZPB 4I3RL 3CDGB 1VACA 5ITBH 5I76A 1XGUB 5FUZH 3IKKA 1IAOA 5D96B 5BRZE 4M3JA 4I5BA 3TLRA 5IVXB 2VDQL 1CLZL 2D7MA 4LSSL 1ZS8B 4JFOB 3C5SB 5IKCA 2DLGA 4MCYA 3WNOA 5IFHL 4N0FB 5KVFL 5CP7A 4WO4A 4LNRB 1NBVH 3QUKA 1AHWB 1LK2A 2DQTH 4MAYD 5IGXL 4RIRB 5E03A 1DN0B 3ESUF 3LEVL 2WLZA 4MHHG 5EFIB 3V8CA 3SQOH 1X7QB 1DVFC 3BXNA 1DQJA 4F9PA 4IIQA 3B9KC 3KR3L 3LQAH 4AEEA 2ICWA 2OL3H 1BWMA 4KRPB 1QNZH 2Y36L 3PIQB 3HUJB 2VDPL 5HGAA 2IJ0C 1DQDL 1I9RL 1RQ5A 1GIGH 4TTDC 5F97E 4R2GC 4DGIL 3RVWC 3DX7B 5JXEC 4M7JH 1QR4A 4UILL 4CN1A 4M43L 1L7TH 2FX8L 4NO5A 2ORBH 3UTPE 2WUBL 1MVUA 3LS5L 4OFPA 5I1EH 2V5MA 4Y5VB 1NUDA 3CX5J 1ZT1B 1FSKC 2X4PB 2W91A 2O61A 4NHCH 3NTCH 1DLHB 1JRHH 2Y23A 3SGEH 4C56A 5DJYA 2BNQA 2CKBH 2Z92B 2VDPH 2GYSA 5DLMH 3Q5YA 4GKNB 5C0FB 1SBSH 1FC2D 3N1PC 1DLFL 5CGTA 2XPGA 5LAXB 4YEFA 2HT2D 2IANE 3B3IB 1S9XA 4RGNC 3OKMA 2X4TA 1NFDA 1JWMA 1NQBA 4NGHL 3S3JA 1JYXA 2XN9B 4LGRB 5LGHH 3VXRE 3GSNA 3IFOA 5FHBL 2IGFL 1RZGB 1SEBA 2BVEA 5CJ8A 1MJJA 3L3JB 2I5YL 3RWCB 1QLEH 4IEFB 1QQDB 5C6PB 4P4KC 2HH0H 1BFSA 3L7FB 5DUML 5DJCA 5L7XL 3QHZH 1R5VB 3P11L 2P5WB 2BY1A 4JFED 4JFYB 4NQCD 4BSWA 1MCLA 5EUOF 1INQA 1E4WH 1D5BA 3QO0B 2HFTA 4LSQH 4NZRL 3ARDA 4G6MH 1NFDE 2HP4A 2CLVB 4HKZA 2RQ8A 5J3HC 3L3KB 5HI5C 1KB5L 1URLA 3BN9D 5DTFB 1XGYH 4FN0A 3LKRB 3X3FH 3UBXA 4O2FA 5D7JD 4H5SB 4PY8J 3ULSB 4IDJH 1VESA 3EW3B 1IM9A 4XTRC 5J56B 4D0CA 2MNUA 2FHCA 5GJSH 1XIWD 5KANI 4PRNB 3MFGB 3HR5A 4JCMA 3CSGA 4M7LL 1AD9A 3HZYB 1D9KD 4U3XA 1YDPA 5IVNA 3HNSH 3OV6A 3FB8A 1M7XA 1H3PL 4V1DD 5EU7E 1R3HA 2AJUL 3NTCL 4TOYL 4WGVB 3FQWA 3FN9A 1LP9F 3QXAB 3GGWB 5IB3A 1IM3A 5C08B 1EK3A 1I85A 4LNVA 3PGDA 3C08H 4WUUA 5I1AB 1HILA 5FO7A 3SE3A 1MREH 3ORJA 5EBGA 3LEYH 5HGGS 2R29L