5HGAA

Hla*a2402 complex with hiv nef138 y2f-8mer mutant epitope
Total Genus 77
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
77
sequence length
274
structure length
274
Chain Sequence
GSHSMRYFSTSVSRPGRGEPRFIAVGYVDDTQFVRFDSDAASQRMEPRAPWIEQEGPEYWDEETGKVKAHSQTDRENLRIALRYYNQSEAGSHTLQMMFGCDVGSDGRFLRGYHQYAYDGKDYIALKEDLRSWTAADMAAQITKRKWEAAHVAEQQRAYLEGTCVDGLRRYLENGKETLQRTDPPKTHMTHHPISDHEATLRCWALGFYPAEITLTWQRDGEDQTQDTELVETRPAGDGTFQKWAAVVVPSGEEQRYTCHVQHEGLPKPLTLRW
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HLA class I histocompatibility antigen, A-24 alpha chain
publication title Effects of a Single Escape Mutation on T Cell and HIV-1 Co-adaptation
doi rcsb
source organism Homo sapiens
molecule tags Immune system
total genus 77
structure length 274
sequence length 274
chains with identical sequence D
ec nomenclature
pdb deposition date 2016-01-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00129 MHC_I Class I Histocompatibility antigen, domains alpha 1 and 2
A PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5hgaA02
3.30.500.10 Alpha Beta 2-Layer Sandwich Murine Class I Major Histocompatibility Complex, H2-DB; Chain A, domain 1 MHC class I-like antigen recognition-like 5hgaA01
1WAAA 1NFDB 3IFNL 3I3DA 1N6QH 4DGYL 5GZOC 4WENB 4QXTA 3MRKA 4V2CB 1DCLA 1RSFA 4ZS7H 1BQLH 5D7SH 1JWSB 2AJYH 1QSED 1F3DJ 4R6UA 4BQBA 4XPFL 3IU3B 3UJJL 2BNRB 1CD8A 4F2MB 2CH8A 1ZANH 1J1OH 4IMLA 5D2LB 4XWOC 3B2VL 5DGQA 5T3XE 4R7DA 4YHYC 2AS5M 4ZMAT 1EAJA 1QBAA 4Y1AA 3HB3D 4GW4A 5EOQL 5IVZA 4FFWC 2AJSL 5D9SA 4KI1A 1FLRL 2PCPA 3U9UB 1ACYL 1EO8L 2F74B 1S5IL 4CU8A 3VG9C 2FZ3A 3SGDH 3V6FB 4AM0B 1PEWA 3ULUC 3QUZB 1MVUA 4PDCE 1GH7A 1T0MB 3ZE2E 5TDOB 4TTDD 2DB8A 1MJ7L 5B8CA 2FIKB 2ZNXA 2OJEA 2WP3O 2P24B 5MERB 2XWBB 1S5HB 5HHQB 2DRUA 1K8DB 5EORL 3GSUA 3VCLA 2VXUL 1AGDA 4MXWH 3SDAC 4NOFA 1DQMH 1BFOB 4JB9L 4H5SA 5IKCA 3OL2A 4NDMA 1YMHA 5ESVA 3ME0A 1AQDB 2BY2A 4RMSA 4A6YH 3TYFA 4Q2ZB 4H8WC 4KI5F 3BJ91 3QDGB 4HFUH 1T03L 3RDTB 5DRNA 4MXVE 3RA7L 5IMMB 1YPZB 2DQGL 4RCAA 3CMOL 2R0LL 3T8XA 2FL5A 2JB5L 2BVOB 3GHBH 5DJZA 5I6XC 1ZHNA 4X9GA 5GGSB 5HSFA 5C0CA 3GFUA 3CFEB 5JXEC 3M17B 4GMTL 2AJXL 5TF1L 1C16A 6CGTA 5KVDH 4WVRA 1FNLA 4MS8C 2CIIB 1Q9KB 3HG1D 1YNLH 4FP8H 4FZ8L 3PWJB 4Z77A 3SE4C 2JK5B 3MRIB 3P0VL 3HPJB 2ICEA 3T0VA 1I7UB 4KDWA 2IQ9H 3DWTA 3WIIL 1P7KA 3S37L 4KDTA 1CLYL 1XGRB 3ARDD 4G5ZL 4KRNA 3B8SA 3PWLB 4GXUM 4JQXA 5BCAA 4K71C 5GSRB 4CVZA 2Y7QB 3LV3B 4JO2L 4XHJC 5J12B 4J3SA 5EULV 4NO0D 3QP3A 1A6TB 1U3HC 1TZGL 3K1DA 1KBGH 4Y2OA 3STBA 5E2UL 2AJZB 3FT3B 3QHFH 3QT2A 5C0RL 1BF2A 3HCVB 1L0QA 5ICZB 1HKFA 1KN4L 4UBDD 3G6DL 4NQEE 3KXFE 3BXNA 4V3EB 4OCSL 4FZEL 1K3IA 2HJFA 4MD4B 4U1SA 5C0FB 1PFCA 2ZUSA 3CZJA 4YXLH 5SX5K 4G6JL 3STLA 1YEGH 1Z5LB 4I18B 4F7CA 3D0LA 1H8OA 1QD0A 3FB6A 1B88A 5T1MB 1ORSA 4Y4FD 3IRZA 5DD6A 2YKLH 4PRAA 1ZLSH 4RAVA 6FABL 1Q94A 1R3HB 2BX5A 3GBMH 2APXA 3ARFC 5KN5B 3QXVA 5IWLA 3B6SB 2ERJB 3TO4C 2BSRA 1BX2B 2EDQA 4OJFL 5GRWA 3W5MA 2FO1A 3MV7E 4XWGL 1WC7A 2M2DA 3ZZ1A 3RWFB 3RY4A 5EU4A 4DEPB 3RZCD 4Y16B 4S1SL 5GS2D 4GKNB 3HZYA 2VLMD 4AH2A 3K46A 1NCBH 3VW3H 2EZ0C 3L5XL 1PKOA 3MLRL 1CD9B 4NRYA 3WFCH 1JNNH 5D6DC 1JPGA 3MYZA 4R7NB 5I76A 1H3UA 2P44B 1KOAA 4RQQB 2BOBB 5IB2B 3PG2A 3WUWG 3NFNA 2HRPH 2ZCKH 3QXWA 1H0DB 4ODVL 5LWYH 4E5XA 3U7AA 4G9DA 2A9MH 3VWJC 3O2DH 4RMRA 1U58A 5HHOD 2NY0B 4O02L 5C0AA 2ATPB 2AJVH 1NL0H 1MI5A 1Q72H 1Z3GL 5IFHH 5BQ7B 5D7LB 1I7TA 1YEHH 3BKCH 3HZKB 3QZWB 5E8NA 1W72B 3AMKA 3SO5A 3P4OB 4OZHB 3MMEA 1EBPA 1WWBX 4WHYG 2A6IB 4RWYL 4LKCA 3H0TB 1KCSL 4NZRH 4EOWL 3W0WB 5K9KA 2LAGB 4F7MB 5IW3A 4FFZH 5FUOH 2ADJA 2VH5H 1UVQB 1IFHH 4GAGH 4XCYA 1BD2E 4M7JL 4U33A 1AXIB 2EH8H 5HHXH 3UTSD 2F5BH 2YC1B 3O4OC 4L8SA 4PJGE 5I8KH 2X42A 4NPYB 1MJ8L 4JDZB 4S0TD 5FOJA 5CJXA 4DVRH 4HFWB 1I3GL 3LKQB 3QHTC 2R9HD 1CR9H 2X4QB 5IHUL 2QADD 4K94L 4UILH 1JN6B 3NZHL 1QLFB 1T22B 1WQVT 4S0UC 3PIQA 1QSFA 2MHAA 1JPSL 3SDCC 1EO7A 4JFEA 3EYQD 4J2XA 3QDAA 1WBZA 3GSNH 1GZPB 4LSQH 1I7ZA 3MLYH 1CDGA 5MHSD 1WT5A 1IQWH 2X4TA 3VFWB 2PXYA 3V4VH 3UTQB 4KKAD 3V6OE 5AWNL 1BAFL 1N6UA 1PX3A 4KQ4L 1QTYT 4JFFA 1YY8B 5DZNA 3L9RA 3SKOA 4FQJH 2P7TA 2EC8A 1T1ZB 4NO3A 2ZKHH 4Y5XA 1XGYH 1NDMB 4HWZA 4QRRA 3QO1A 3U6RA 3IAPA 2PYEA 3RWJA 3V0VB 3BESR 5LGHH 3V0WL 1BLNB 4HIXH 1E4KC 4JE4B 2JJVA 4DFHA 4A6YB 1YJDL 5D5MB 1K2DA 2XG4A 3ZE1E 4HS3A 4JPWL 4WW1A 5J7CC 2VQ1B 4NJAL 5K59F 4DCQA 5B39G 1JGDA 4FOMA 5J6HB 5KVGL 1NBZB 4HQQH 3D25B 1LQSR 4P23A 3HR6A 1AHWB 4JFHE 2EC9U 1AIFA 4LFHD 4U7KA 1Q0XL 1RJLA 2HKHL 1YYLH 2VDOL 2Y5TA 4GUPB 4F8TA 4YXHL 3QIWB 1NCWL 3IJHB 3CVIH 5C07E 1R5VA 2DM4A 2W59A 4GXUN 2YBRB 2PETA 3RDTC 2C7UB 1OL0A 3QPXL 4XPAL 3DARA 4KMQA 4PJDA 3BUYA 2XA8H 3SN6N 4JFPB 5T1DL 5HYFA 4POYA 4L8BB 4X9IA 1FVCB 1GIGH 2NW2B 1H9VA 5EU6B 1T1WA 4KUCD 4G6FB 2HMID 3HUJF 5ID0A 5KTEH 5GHWL 3RPKA 4YXKH 5C2BL 3PV7A 4PP2A 3P9MB 4PJBF 4PGDA 4P2YA 4WHTA 3QEQB 4CGTA 3EHBD 5E2VH 1G9MH 1WWCA 4M61A 4W70A 3B5HA 3T1FB 2R23A 5IFAH 4I13B 4XC3H 2YSSA 2YD2A 1BM3L 1JUFB 1FL3B 4HD9A 1IGCL 4XXCA 2D7PA 5IV2A 5C2UB 3RNKB 3EJZC 5J12C 5F1IA 1EEUA 1OY3B 1NGXA 1RIHL 3S3PA 4U1HB 3SKMB 2BHUA 1T04A 3E6FB 2EYRA 1OAZH 2B4CL 4PRIA 3UZVB 4HXBL 1IL1B 4KRPB 3QEHB 1A1MB 5SWSA 3GZKA 2WLZA 5DD5L 4TVPL 3BPLB 2ZCLH 1XGTA 4UTAL 3DXAB 3F7YA 2D9QB 3PWPB 1BVZA 3BP4B 2XTJE 2FLBT 4I18C 5E6YA 5DJXB 3LDBB 4EUPA 4XNMB 1FRGH 3QG7L 3PQYE 1D5MB 1MCJA 3L3DA 5F9WB 1DFBH 3OKEB 4KJPD 1N7ML 4ZOBA 5HYIA 1UM6L 3VXSE 4RMVA 3GSWA 2ZG2A 5DHXB 4NQDE 4NQCA 4ZUUA 2XICA 2ERJC 3M45A 5D1XC 3EO9H 2QSCL 2C3GA 4ONFL 1XF4A 3OAUL 1ZT4B 4HWBH 3VFMB 4YBHA 4C58B 3P3YA 3CFCH 4DEPC 4Z7VE 2AK4E 3ZKQD 1XF1A 2A0LD 1I7RB 4P4RA 2R0ZH 5TPWH 4CUCA 4M1CD 4J8RB 5A2LH 1NCAH 3EFFB 3FONA 3GMQB 3HE7B 5HGHA 4H25B 4X7TB 2BNUB 1P1ZA 4CJ0A 3QQ9C 3BZ4A 1REIA 3VXUB 4YO0B 1XGUB 1X5JA 3MUGA 5E4IA 2OSLB 4NYLA 2GSGA 1SVZA 3DVNB 5C08D 4P2OA 4KJQD 1T1YB 4MNQB 5D2LE 3WUWA 4HG4K 2KBGA 2OZ4A 3SCMC 2NY0C 4PP1C 4ZQKA 1IZKA 4K7PL 3GIVB 2FEEI 3QRGL 2Q8AL 2R39A 3CCHB 3RWGB 1FNSH 3VD9A 1IJ9A 4NO5A 1DUZB 3H8NA 4L3EA 3TPUA 2EECA 1WBXB 4JFQB 5FV2A 1HZHL 3R06A 4HDIB 4LKXA 4APQD 1OAQL 4JM2A 4QRRD 4MCYA 2NW3A 4GXVL 4JRYE 4PR5A 4DGVL 5L9DL 4JANB 5D2NB 2PYED 2NY3C 2ZZUT 1PAMA 3DMMB 3NCJL 1BJMA 1I75A 4KTYA 1Y0LB 2GUOA 3VMPA 3EYOB 5GPRA 1QEWB 4NGHL 3CZFA 1HXYB 3OPZL 3EKCA 4NM4H 5I8EA 4GRMB 4Y4KA 3GSNB 1CGSH 3BO8B 5DD3L 4P2QA 3ZE0F 1GAFH 2WP3T 1CLOL 1ZWIB 4PJCE 3VXNB 1P7QB 4ZFOB 4KK8C 1A2YA 3JTTB 3K4ZA 3ES6B 5F9JB 3ORJA 2IPKB 4QF1A 1DLHB 5K33A 3D39A 4BQ6A 3CC5A 1KEML 5FF6A 3MOBL 3CH8A 4JG1L 2F54E 1WSST 1BQHB 1XMWA 5DRWB 2NY6B 3KNBB 5HI4C 1QFWI 1OGAA 5CSGA 1GGIL 2MKWA 3RX8A 4X4ZA 1S7WA 5BZDB 3VXRE 1KLUB 5DS8B 1JZ6A 4NN5B 1VEOA 5B22A 5E99L 1TMCB 4KK9D 3I6LD 2ZUVA 4EJ1C 4NHUB 3IFOB 2Q7NA 1UEYA 4BSVA 1A3RL 4OF7A 2X4NA 3UYRL 1MH5A 1VDGA 3G6JF 3V5HB 5LQBL 5KOVC 2NZ9D 4BK5A 4OF8A 2PW2A 3NA4A 3H3KA 4IRZL 5CD5C 3MNWA 4PV9B 3MODH 4KKBC 1IGIH 2YD1A 1NEZB 2ZUXA 3NGBC 3FFDA 5DUBA 3HS0B 3A67H 3G6AA 1KJ2A 3DROB 1JNLH 4HKBA 4JQIL 2ORBL 1UA6L 1N3NB 4PTTB 3VD4A 1HIMH 2BRRH 2QQKL 3FN9A 3ULVC 4FQ2L 4F15B 1XZ0B 2GIYA 3GB7B 2VITB 4OAWA 2DN7A 4MAYD 2VLKA 2O61A 4PRID 4QGTA 3PGDA 3SGJC 5B39A 2YK1H 2DD8L 3J8F7 3UTZA 1DBAH 5SWSD 4P2CG 3WIHA 1AHWC 4U1MB 5HDQH 1IBGH 3NCEB 1IAII 5GSVB 4Z7WB 1QSEB 3KPSA 1MRFH 4TOYH 5JHLL 2D3VA 2J88L 1FAKT 1ZSDB 4TQEL 2LU7A 3K8KA 5AZ2L 3QEUB 3TBSA 4XP6L 5JA8B 3JTSA 3IXAB 4PY7B 4XC1L 4AEIH 1CDYA 5DUPH 1V7NH 1RU9L 4JO4H 1MRDH 5DSCA 4PBVC 3SE8H 4F9PC 5HVHB 1CDBA 3QUMH 2OTWB 4LCIH 2Q7YB 3MJ7A 4GQPH 4I3SH 1A4KB 3LOWA 5T33H 2OYPA 3L3HB 2KH2B 4AT6A 5I15H 4HGWA 3O3DB 2P45B 2F8OA 4DW2L 1T5WB 4OD3H 4LVHB 5GJSL 1M7DA 4PG9B 5FHBH 3V8CA 3DRTB 2GCYA 4XPHL 3CVHH 4XCNA 1G7QA 5CIPA 5EUOA 3VXQA 3PWNB 3GGWB 1A4JB 3RVWC 3MFFA 3DV6A 5F7LB 1XIWA 1MQKL 3T2NH 5KAQG 1AO7E 1S7TA 3PWUB 2D0FA 3BGFB 4LASL 1RHFA 4OLVH 3FB7B 4LLWB 2BNQD 1JE6A 3T04D 4WW2F 3BN3B 3KLHD 3HAEG 1NAKH 4M5ZH 5KVEL 3HNTH 4V3DB 2VNCA 4PJFA 2FDBP 4YWGH 4ERSL 3K81A 3MFGB 5KJRL 3EYSH 4KRPC 4KUZL 1ZS8B 2ARJA 4MQXC 4M93B 4TSBH 2BFVH 2X9WA 3BPLC 1E6JH 4IS6A 5CD3A 4QRTA 4HF5H 4ZSOA 5DC0A 5CHNA 5L2KA 3D0VA 4L3ED 3U46A 2G2RB 3LDBC 2I60L 3AUVA 1PG7H 4NHCL 3U36B 4M48L 1JWMB 4GRLA 4LF3B 2RFXB 4UB0L 5BV7L 1DQQB 1S8DB 1W2KT 2XN9D 3PDDA 4XXDA 4PJIE 5F9WC 1D9KB 2A2QT 4JHAL 1CWVA 1MSPA 1JGVL 1C1EH 3KJ6H 4R4ND 2CDGA 2ESVA 3BZFA 4QRUB 4I48B 4QXUH 3IFPB 4NO0B 3TFKA 1KACB 4LCWB 1DQJA 3KYNA 3O41A 1WBYA 1R3IL 4P59L 3ILQC 2NYYC 4P2QD 5DQJA 3RNQA 3ZYIA 3C2SA 5GZNC 1XH3A 2VUOA 3RVTC 5J1SC 4LEOA 1U8LB 4UINL 4ZUTA 3HE7C 4G3YH 1DEEA 4PJ9A 5FA3B 4PB9L 2V9RA 4PJBE 3O45B 5HYQA 5DMIH 2UYLA 3W9EA 2KL6A 2NXZD 2QEJA 3MREB 1FIGH 5F7HA 1OLZA 1JGLH 4YIQA 1R0AH 5I1DA 1MRCL 3E2HC 3MRDA 4EKXA 4YHNA 5F89B 4R90H 4GAJL 5E8EB 4H20L 2Z31A 4HV8B 2YPVL 4OZFA 5GRJH 1JGUH 2VOTA 3WJJC 1OB1B 3NBNA 3ULVE 3I9GL 3EDFA 1JVKA 2R1XA 2B2XH 2UZIL 2XFXA 4N0UE 4WDIB 3BVNA 1B9ZA 5L7XL 1F11A 4YDJB 1T1XB 4OUOA 2X89A 4M9PA 4Q0XH 5IVOA 1DQDH 2Q3ZA 1VFMA 2X1PA 5KSVA 1A7RH 1QR4A 1CXFA 1QZ1A 5IK3B 4ALAL 5M94B 4E0RB 4KTEL 2VLKD 1EXUA 2AKRB 4RGND 3JTCA 4HGKC 1KCRL 1ADQH 2AEQL 2W38A 3G5XB 5A2JH 3BDYL 1CG9A 2Z91B 3C6SA 5HHOB 5SWQB 3OKLB 3MRRA 3P0YH 2GTZB 4L8DB 4UIMA 3O2WL 5KS9B 1H3TA 3LB6D 3F8UB 1T83C 2ICWB 3NVQA 2OQJA 3ILPB 3MBXL 3PABA 5EU3A 3WLBA 2YPLE 4LARH 5DJDB 2NY6C 3QWOB 3MCLH 3VH8B 3U0TB 3FQXB 3BGMB 5DA0B 3OWEA 4YQXH 4NN5C 4D9LL 5J56B 2B1AH 4J3OC 5HYJE 5DEFB 4WY7L 4JZOB 4OTXL 1P4LB 5IVNA 4FQCH 5FGBC 5GGUA 2J2ZA 1C5CH 4Y8DC 3AXLA 5I74B 4LPWA 1DVFA 4PJHF 3UTSB 1RMFL 3RWDA 3BHBB 2HH0L 5BS0B 2YWYA 4Z7UF 1V3MA 1P6FA 2GJJA 1XIWD 2I5YL 3RU8H 2FX9H 2J7LA 4M1DL 2X1WL 3KYMB 4QHUA 7CGTA 4MA1B 2EXYC 4HEPG 4MCZB 3BH8B 2VYRE 4HIHA 4YJZL 5HJ3A 4F15C 1PQZB 3DV4A 3CDGB 1MHEB 3ARBD 1KPVA 1CIDA 1K6QL 4ODHL 4IMKA 1TVHA 2WBJA 1I85A 1Y6NR 4QLRA 3QUMB 3X11B 4FQIL 3RUGB 1AH1A 4MGXA 1JP5A 3MGOA 3ULUF 3QFJD 3UJTL 2R2EA 1IAKB 1L0YA 1U8KA 3WL9A 4ZFGH 3FOLA 4JHWL 3LQAL 3VFGH 4F9LA 3IETB 4Y5VA 3LS5H 1KIQA 3H9HA 1HSAA 4N8CL 1G9MC 1P2CA 4FTVA 3CVHB 5HVHC 4CADA 4WEUD 3CK0L 1I9RH 1T7XA 3HB3C 4NNXA 3SE9H 1EVUA 4ORGB 1T6WA 2WMPA 3O6LL 3G04A 4PRDA 5CKGA 2EKSA 5F6IB 3VMNA 3TFKD 5KVMC 4U1NB 3VD7A 4PJXF 1MFAH 5IB3A 1H5BA 3WHE1 2QR0A 3LH2L 2ICCA 5KVFL 4UV4L 4CVXB 2IAND 3S3JA 2IALB 5F9DC 3OKDB 5BXFA 1ZHBB 3X3FH 1CFSB 4G8EA 2YUWA 3IKCB 5KANG 2JIXA 3F62A 3PWVA 4RGOH 5CILH 4PJ9D 1BVLA 2YD5A 4OZ4B 5TDNB 3ZLQC 2OL3A 3BGFC 1EEYA 5KG9A 3D2UA 3G6JE 5IQ7H 5EBWB 1WLHA 2W0LA 4ZPTA 3EOTH 4NUJA 2Q3AA 4I2XA 5E8DH 3ROLB 4U0RB 1FFQA 3QYCA 3VFTA 4K7PY 1B0WA 3NIFF 3HAEA 5INCB 5DFVD 2BVTA 4JY4B 5E94A 4TNVF 4M93C 1ZE3C 3HE6B 4JG0H 3T2OA 1NANH 3MRPA 2Z93A 4NN6C 2IBZY 1X5LA 5IBUG 5I1EL 3DHJA 5JW4Q 5I1AA 2Z31D 5DI8B 2H2SD 5IESL 3FQTB 3UPAA 3U4EB 4L29B 5JNYA 4QRSA 4RAUA 1QFPA 5EU4B 1SEBA 5LVEA 4X8JA 3FHAA 4D0BB 2R4SL 1I8KA 4NNYA 1TZIB 1R5IB 5C09A 3K3QA 1D9KC 3QUKA 2X89D 3FT4A 1LGVA 3KPQB 2G60H 5CEZE 3WCYA 5TQ0L 2IFFL 5I1CL 1E27A 1F8TL 1MCLA 4PJAA 2X6MA 2UZXB 4HC1A 1E6OL 2IPUK 2A6KA 2EDTA 4XX1E 4ZG1A 1U91A 2QBWA 5E95B 1GHFH 1FFRA 1OAUL 3OGCB 4FFVD 5ADPH 3QQ4A 1ZV5A 3ZTNL 3L5IA 3FO2B 3UXFA 1OSPL 3WFDH 1OAKH 3PXJA 1IKNC 3GSVB 2OZ4L 1KJMA 5A2FA 25C8H 2YHGA 4XMKL 2CDEA 3HKFA 1U8QA 4M1GH 5F3BA 1LEIB 3F58H 2VDLL 1MAMH 3BIAX 3Q48A 2HFEA 4LPUA 1NMBH 1Q9WA 5FYKU 1CE6A 4JRXA 1I1AA 5FEBA 3TNNB 4QWWC 4M8QA 2C4FT 1T4KB 4NO2A 3BOVA 3C5JA 3JV6B 5EO1B 1T7WA 3BP6B 1QFOA 3QNXA 1TVBB 4S11A 2H8PB 2D0HA 2ZUQB 4QHKI 4AL8H 3SBWA 2V9TA 4WFHE 1QPPA 1DVFD 2PR4H 3BIKB 1CD1B 4YBQD 3X3GL 4WI7A 1HH9B 5I1KL 1CGTA 1QRNE 1MHPH 1S9XA 4DGYH 3SGEI 2KZWA 4JGUA 3WNPA 5C6WH 2A6DA 1INQA 2DYPD 1PYWB 3QWRD 3O3UN 5EOTB 1EAPA 4HS8L 3NFSH 5DRXA 4U1IA 4UMGA 1I9JL 3C9NA 4RFNB 3KWWA 1B4JL 5C08B 3EO0B 3KR3H 2WBJD 5JHDB 1JYXA 5D7IE 1G0DA 3TVMA 1B0GA 3O9WA 2AJSH 3TA3B 1K5NA 3TNMA 1S5IH 3ISWA 2OI9A 3U7YL 4I9WE 2G9HB 3FOMB 5E6IA 4XNXH 4JZNA 1YEFL 2VMFA 3CUPB 5CMAA 3L6FA 3BKML 3I50L 4OT1H 1JFQL 3HNVH 1JCKA 3SKOB 4FTVD 5F7WC 4APQB 1IGFH 3VFSB 5K93A 5LCVL 2KZ1B 1FFNB 5CJQL 2BCKA 1RUPL 2J6EA 1MCFA 2MSPA 5L88L 2AEIT 3VFNB 3VFVB 1F13A 2VLRE 1BJ1H 4N5UA 2XRAH 5IUSA 4YHML 1S78D 1F42A 2PW1A 3T2PA 4HCRH 1MFDL 4U6YA 4MQTB 3I3EA 1I3UA 1RZKH 1T03H 1V7ML 1KJ2L 4ZUSB 3RA7H 3RJQB 3SPVA 5HY9A 3CMOH 4RNRB 1RK1A 5I74C 2JB5H 1FSKB 5H37H 2R4RL 1KJ3L 1A9BA 2JIXD 3DYPA 4MHHI 2AV1A 3UTPD 3SY0A 2R9HC 5ID1A 3QO0A 1F6LL 2KKQA 5TF1H 4MA1C 3WIHL 1MHCB 4MXQA 1IGMH 4OLUH 2Y72A 2FRGP 3PHQB 4FZ8H 4NJ9L 3LN4A 3HNSH 1UH2A 1RHHB 4J1UB 2AJUL 1YC8A 4LMQE 1MJUH 1ZOXA 3S4SA 3DECA 1JMZA 5GISH 2X9XA 5JO5B 3IF1B 4EQ2A 3S37H 3GJFH 1KB5A 3U79A 2Q1EA 4W6XB 1QFWM 3MRBB 3THML 1QFUH 3MC0A 2A73A 1CTOA 5JXAL 4XP1H 1EMTH 4LCWE 3ZYJA 3T0AA 5J6GA 2VL5B 4PJ8B 2D03H 3GKZA 4OV6F 5JQHC 1KN4H 4MD0B 2OMNA 5ICXB 4OCSH 4FZEH 3ARQA 3ZKSD 3F7RA 4BKLA 2NMSA 1Q1JH 2B8OT 4G42B 5FDWA 1IM9D 5F6IC 1CGYA 5FYJU 2E3VA 1VEPA 3LRGA 4PRHD 4G6MH 1X3DA 3L5HA 2AEPL 3FFCE 3MRMB 4ODXA 3FN3A 2SEBB 3PHSA 1T2XA 2PN5A 5JIIA 4MAYB 4KY1L 4MVBC 1SM3H 3JBG7 4HK0A 4L4VE 3MRNA 6FABH 4ETQA 2CLZB 1P4BL 2HRLA 5SWSB 1W0VA 3T0EC 1BBJA 1FAIL 2OMBA 5MEQA 4X4XA 2JJWA 1XGTB 2XWTA 3B9KA 3INUH 1GJIA 3VJ6A 5I1JH 5C9JB 3LEVL 4PLJC 1LD9B 3SDXB 3H6JA 5IB5A 1G6RL 1IAIM 2WNGA 2QHRL 5H2BB 4GT7A 4WU7A 1RUKL 2BDNL 4NNPL 3IT8D 4K3DH 4PRPD 4Z7UE 4JRXD 3L3DB 1I1AD 5C0GA 3MJ6A 3L5XH 4ZXBA 5ECJE 5JOEA 3GUTB 4Y2DA 4L8CB 3GSWB 3HE6C 4JHBA 4HUUA 2IMMA 3E3QC 2HMIC 1DZBA 5LBSH 3ZSTA 3VWKA 4HUKB 4C4KO 4M6NH 4IIQB 1M71A 3MLSL 1YYML 4HUMB 3QJFB 4J6RL 3V0AC 4P48A 2GITA 2Y06L 4CVWA 4XVTL 5IBLD 4PGBA 4ZO9A 2D7OA 3T4AB 3FO9B 1Q9LB 4O02H 3FTGB 1MIEL 2HYMA 1YY9D 2F8XC 4P5TB 3OR6A 1JHLL 1QO3A 1A6UH 5F71A 1Z3GH 1GGUA 4I0PA 4QXGH 2AXGB 2P48B 2VE6B 3CFBA 5JLZA 3EYFA 1DUYA 4PLKD 5KS9E 2BNQB 3QNZB 3DBXA 3RVXD 3NPSB 3TVMD 3O9WD 5F9OL 1KCSH 4K2UH 3TBVB 4P57A 3MRFA 1Z6JT 4FXGB 1JTOA 1IC5H 5IT2L 3CU1A 2DLHA 4IJ3B 5H94A 1SYSB 1NUFA 4PJXE 8CGTA 43CAB 3I2CH 4OIAA 3IXTB 3EFDL 3PNWA 2V7HA 4JAMA 3GJEB 4G7VL 4GJTB 2QQLH 4EDXB 1JTPA 4PLOB 3LS4L 1C7SA 4JQVC 5AYUH 3BP5B 3OXSA 4K3GA 4PRBB 2XN9B 4JPVH 4B7LA 1MJ8H 3GI9L 4KJPC 4F7EA 5BMFL 2X10A 1XGQB 4K94H 3WHXA 3Q5YA 1UB6B 2ATKA 4L4TA 5C7XH 4C55A 2ZUQC 2CK2A 3LN5B 1UH4A 3N06B 4NKIL 2BVPA 3TBWB 1JPSH 4N8VG 4XBPA 5HD8C 3QDJA 1J11A 4TUOA 2R1YA 2O5ZL 2Y25A 5FYLL 4C56B 2GJ6A 3I02A 1A6VL 3RGVA 3NZ8B 4WEBH 2J3SA 2VLJE 2PO6D 1KTDA 3QXDB 4OCRL 3EZJB 2R56H 4OD1L 3UTTA 3RUGE 3LMJL 1RJZB 5FB8A 4OGAC 1U8HA 1MCNA 4XH2A 1J9CT 5C0JB 3H9ZA 4OZHF 1TPXC 5FF6B 2R2CA 4MXQD 4NIKB 3ZKND 5HGGS 4LLVB 5A16A 1RULH 3C60C 3QSKB 2AK1L 1VGEL 3DPBA 5E5MB 2JTDA 3IDIA 2NXZB 3ZL4L 1FFPA 3O6FB 4GG6B 3OF6A 4OLWL 4WJ5A 2H32A 3UAJC 3GMPA 3OQ3B 4GLRI 1Y18A 3TA3C 3T08A 1FL5A 4FQPA 1N0XH 4UDTA 4EN3D 5I1IL 2MCPL 4PYGA 5D72L 3O4LB 3MLZL 4JJ5A 5CP7B 4BH8A 4P5KA 3EYUH 4MZ3A 1G9EA 3CNKA 1A6WL 4BUHA 1RK0B 4K3EL 5HDOA 1P4IH 1XR9A 4H1LH 1IAOB 4APQC 3F7VA 2BERA 3VRIA 2OM5A 3WE6B 4OZGF 7FABL 2HVJB 2B5IB 2VKWA 3RWIB 4ZYKA 5IR1A 2OTUB 3EO1A 3HI6L 4JPIB 3PDOB 3JSSA 3T0EE 4CN1A 5E08L 1DE4B 3RVVD 12E8H 5DQ9B 2APTA 4JKPL 1CL7L 3QNYB 5SWZA 4ZFFA 2O61B 3UPRA 1FSKC 5J0BA 1KEGL 4RGNB 1B2WH 2CMRL 3UTZB 3EDDA 1M6OA 3GJFB 3DETC 2V7NA 3DYMA 2V2XB 4D8PB 1HCFX 4XP9L 3BSZH 1KJVB 1DBJH 2EDDA 5B38A 5CZXD 5FO8B 3E3QE 4ONGL 4KQ3H 3T3ME 1F4HA 2D31A 4XNUH 2Q86A 1MCDA 4DZBA 2FB4H 2J8UF 5DSCB 4AY0A 2HN7B 3U4BL 5F7EL 4ZXBD 1ZGLM 2GI7A 3MJ7B 3VD5A 5D5MF 3BEWA 1UM5L 3DX9A 2IBBA 3TLRA 3M07A 3V5DA 4NCC2 1HK6A 1GGBL 2YR3A 2AABH 1AJ7L 4ONHA 4P5MB 1OAXH 5E9DE 2F53E 5H8DA 3CH1A 4GS7B 4PJ8C 1I1FA 1A5FL 3TCLA 5DEGB 4KTDL 4J7RA 1AFVH 2E7LC 2GAZA 1NGWB 4Y19A 2P5WE 2VC2L 3WDHA 1TQCC 4NRZB 4XCCH 5HI5D 3LQZA 3U48A 5DEZA 3GM0A 3BD5A 1MFCH 3MA9H 3H7BA 2ZP0T 4PUBH 1TTUA 4NC2B 4I0PD 1PZ5A 2HTLD 5I1LB 3V6ZA 2EE6A 3IDNA 3P0GB 1XF3B 4OQTH 4HIIB 3GIZH 2NLJA 3W9DB 3D69B 3BE1H 1URLA 1HQ4A 1AGCB 3ARBB 4MAYC 2OL3L 3P4NA 2E8YA 4IHOB 4CBPA 3KPRE 4PTUA 4JFYA 4K7FA 1HHJA 1P5VA 3RY6C 4M7LL 4DGIH 1ED3A 1A6ZA 4N0CC 1MAJA 2LU3A 3UBXA 3QFJB 2FO4A 3WKML 5C0IA 4O5LH 2NX5E 1T20A 1PBYA 4P9ML 4UU9B 1AXTH 1UXWB 4X6FB 1SJEB 4I77L 2P46B 3DIFA 5E2WH 1YNKH 4UDUA 1KIRB 4UT7L 4QRPA 3HAEH 5GRZA 1AGEB 1MY5A 35C8H 3G5VA 4PYHA 4WNQB 4NQEA 1TIUA 2A77H 5GGTA 3KS0H 4L4TD 3QDMB 2DLFH 1EDQA 2J4WL 3KYNB 3TH3T 4IIQC 4PG2C 2YN3A 2IANB 2GEEA 2GJ6D 4ZODA 2ZCHH 1ZVSA 5DQJB 3WN5B 4R2GD 1CZ8L 3P77A 1S7VA 4HC1L 2VZVA 3QUYA 1LK3H 3TN0A 1RZ8B 3OZ9H 4K7PH 4GFTB 3CPLA 4P5TC 1YQVH 5EZLB 4ZOCA 4U6HB 2Q8AH 3HA0A 4O2EA 1U8PA 2Z92A 3MV7A 1U36A 3PP4L 3L95A 4FNLH 3TYGH 5DD0L 2NZIA 3KLAA 5BRZA 3OF6D 1G7IA 1NCCL 4KMTL 4DGVH 4HPYL 5L9DH 3ZYZA 5ICYA 3P40A 4NT6B 4JN2A 3SGDI 4JM4H 4GH7B 1RUQL 3SQOL 2DL2A 5I1DB 2GFBB 5BZWA 2WUCL 1VPOH 4LPCA 4OF5A 4P9HL 4IJ3C 4JDTL 3FO0H 4PJHA 2CDFA 4NGHH 4MWFA 4LLUA 3SDYH 3DHMA 1WK0A 3B9EA 3QH3B 2VDRL 2HJLB 5C6TL 4FN0A 3MZGB 5EZJB 5CBEA 3P9WB 4G6KL 4MJ6A 2WBKA 1L7TH 1NCNA 1GZQA 2R2BA 5IFJA 3TO2B 2IG2H 2FECI 2EYTB 1EHXA 3NIDE 3MOBH 4NKQB 4GKOA 3GRWL 3GSRA 1AE6L 5SWZD 5EUKB 1SHMA 2GK0B 3MJGX 2DQFA 4N8VA 2D7NA 5JPMA 4RMUA 1NSNH 3U1SL 4Q9RH 1H3GA 4FXKB 1OT1A 3PGFL 2YPKA 3RIFK 1U8OB 1NQBA 2EH7H 1LK2B 2D7TH 1OSZA 3SDAA 3RWHB 1N59B 3L3JA 2FATL 1IT9L 3TBTA 3X14A 3TWCL 1LWRA 3UYRH 3MRJB 5LQBH 2VO5A 4H1LB 4N9GA 3VFRB 4I5BA 1AGBA 3MUJA 3O6FC 4FQQA 4UUJA 1CLZH 3T4YB 2OBGA 4LSTL 4O00A 2E7LE 4NQXB 3QQ3B 1GGCL 1QBLL 4J3UA 3VXMA 1JZ8A 4GW5A 5CJOH 2W60A 4G9FE 5IMOB 4KK5C 2EXWC 3BN9D 2NY4C 2J6EL 3LKNA 5D71L 3TV3H 3C6LC 4DN3H 4XP4H 3HI1A 1VFBA 1RZKC 2DDQH 5D6CA 5GS0D 1Q0YH 5JXEA 4L5FL 5ESQB 1A14L 2VDNL 4YE4H 4MS8A 5MENE 4WUUE 3DUHA 1MFBH 2EYSA 2I9TA 2RAMA 3AM8A 2B5IC 4WV1A 2DWEB 4I0CC 1KENH 4HXAL 4JFZL 2XWJB 2EIZA 2DYPB 4IOIB 1KXQE 2FJHB 1X5HA 3HFML 4LNVA 2R0KL 3S37X 1QFWH 4E41E 3EZ8A 5CWSA 4XP6H 2UV3A 3VD3A 4XC1H 4XBGA 3R1GH 5ETUA 1U3HA 5DT1L 2OK0L 4RGNC 1TVHB 2Q87A 4OV5A 3Q6GL 1Y6MR 3S96B 4S2SB 2EEDA 3WL9B 4BH7A 4Z76A 2ADFL 2L4OA 5JQ6H 1YEJL 1S9WB 3AS3A 1FVEB 1Z9MA 3H9HB 3LB6C 1KB5L 4DW2H 1NAMH 4HUWB 1ES0A 3NN8A 3NPZB 5GJSH 3AS1A 3PJSA 1DBBL 3U0WH 4LIQH 1X5GA 1EVTC 3QEGL 3BT2H 4U7SA 5DJCB 4L3CB 2JJSC 4S1QL 3BW9A 4NQED 3KXFD 3MRHA 4KKLC 2HG5B 2F15A 5D96C 1T0NA 1BWWA 1O5DT 1A1OA 1CFQB 1V3JA 1JF1A 2R1WA 4OGYH 4OM1L 4LASH 4M7KL 1YUHA 4CKVX 4YEEA 4AQOA 4MA8L 3ARFA 3PHOB 3DO7A 1T66D 4C4KT 4GS7C 1JK8B 5C0BE 1ETZB 1L7IH 2RB8A 5EBLA 4F33B 2VXQL 4M5YL 3MX0A 4YR6B 5B3JE 1IAIH 3MO1B 4Z7WF 5KSBF 5CSBA 2P5EA 1MLBA 3TT1H 4WUKL 5IBTL 4FQ1L 3VG0L 4L1HA 2H41A 2UWEE 2IGFH 3KPPA 2F58H 5LAXA 2JELL 2ADIB 3MV7D 4O58H 5D6DA 2IH1B 2CXGA 3UZQA 4YPGB 5FYKE 4M48H 4OZGE 2DF3A 5EU7C 3HAEB 4NWUL 3ARGB 1RZIB 4YGAB 5EIIB 1UCBL 1JGVH 3VWJA 5F7DA 3MROB 3EUUA 5EOCL 5I16B 1A64A 1U8MA 4I4WB 1HHIA 4DVBA 1IM3A 2ZUYA 1R3IH 3P2TA 5J13B 1IE5A 5GS1A 4K9EL 1I8KB 4MDJA 4A2LA 2Y9RT 1U95B 4LLYA 1GVIA 5TFSL 1NJ9A 5DUMH 3V4UL 2VERN 32C2B 3CFKA 5GGVL 3SE3C 2VXVH 1WWAX 1ZA6A 5DJYB 3GBNL 1LO4H 4FFWD 4ODTH 1J8HB 1IM9B 3TEUA 4BFIB 1ZXQA 3GNMH 1VSCA 2UUDK 4PRHB 1FZMB 4JFXB 5J4MA 2FD6H 4HX1B 3KGRA 1VACA 2PUQT 3VRJB 4DKEH 2OR9H 2J8UE 4CMHB 3WN5C 2AV7B 2ZOLB 4CMMB 1JJUA 1FO0H 4E42B 3HR5A 2CJUH 2F9BT 3IJSA 3PQYA 3MR9A 4P2RB 4DTGH 1EEZA 2V5SA 4C54A 1QPXA 4OD2A 3SDAD 3VXSA 1F3JA 4O2CA 5IROC 1BD2D 1BJ1J 2VXSL 4X80H 1UJ3B 4CN6A 1UZ8B 1N6VA 4Z7VA 2AK4A 2UZIH 4UT9L 4PRPB 3P9LB 5L7XH 1NFDA 5T5FL 4CU6A 4EI6B 1B6DA 1H15B 5EBGA 2O5YH 4K94C 4LRNH 1OTUC 4QTIL 3IRPX 5C70A 4P46B 5HHME 1XGPB 2VZ1A 1JWSA 5JXED 1WZKA 4ALAH 2AW2A 1BPVA 1FBIL 3IU3A 5I1GH 2CK0H 2BNRA 1Z0NA 4LSSH 1KCRH 2E27H 4F2MA 5D2LA 1WV7T 3BDYH 4QY8A 3TJEH 2YXFA 3PUCA 4HUXB 3GM8A 5DJAB 1FYTB 5D70H 4RZCB 4HT1L 2F74A 3HMWH 4XHJD 3MBXH 4X7DC 1E4KA 1U3HD 3V6FA 1FPTL 4U1KB 2D4FA 3T0BA 4AM0A 3TT3L 3QUZA 3S88H 2YD4A 1T0MA 5TDOA 4H26B 4FFVC 4ZOEA 2FIKA 4LLAA 4JJHA 4X6DB 5GGRB 2P24A 3T65B 3WBDA 2OI9B 2XWBA 5HHQA 4LLDB 1K8DA 3C08L 3UX9B 2VSDA 2MWCA 1BFOA 2X41A 3RL1B 1R24B 1AQDA 2IPTL 4Q2ZA 3QDGA 2VDQL 3RDTA 3ET9F 4JPKH 5IMMA 1YPZA 3N50A 4K3HA 4ZFZB 4G80B 2BVOA 1LE9B 1M4KA 4M1DH 1NBVL 1OF2B 1Z0MA 5GGSA 3ARFD 1F2XK 4X9HA 5C07D 4Q9QL 5ITBL 3KJ4B 1NKOA 3CFEA 3TO4D 3M17A 2MPAH 4XGZB 4ODHH 4YBQC 2YN5A 2CIIA 1EGJL 1Q9KA 1U8IB 3PWJA 4UIKL 2PO6B 4FQIH 3DGGB 1A9BB 2VAJA 3F65A 2HLFC 4NN7B 1BF8A 2JK5A 2IMNA 3MRIA 4NC1E 1O7VA 1NKRA 3HPJA 1I7UA 4LPYA 3FQUB 5D1QD 2DM2A 2DIBA 2DBLH 4K3JH 4YK4B 1XGRA 4PLNC 3PWLA 5GRVK 5B4MC 5CS7A 5GSRA 1NMAL 2LFGA 2Y7QA 3LV3A 5ISZE 5CINL 1NAMB 2CKBH 4HKXB 1QNZL 1A6TA 1KYOK 5T3XH 2YMXL 3CK0H 2DL9A 2AJZA 3FT3A 5DQDL 5JIHA 5DMYA 3HCVA 1BBDL 4TSAL 3VWJD 5ICZA 3O6LH 4PBWD 4LMQI 3RJDA 1LP9E 4EN3B 4GQ9H 4XP5L 4MD4A 2VDKL 5C0FA 3LH2H 5DLML 1YEKL 2QSTA 1G0XA 3MRCB 2VKXA 4NBXB 4PJEE 1BOGB 1FG2B 1BP3B 2JB6B 1Z5LA 4I18A 5HVFB 2NXYB 4XCFH 5T1MA 4QTHB 2ZJSH 5E7FA 1KLGB 1WFUA 5GS0L 4Y5YC 5C92A 4WI8A 4MA3B 3HC3L 3ZHLA 4KKCC 3FRUA 1W8OA 4QOKE 1R3HA 2HT2D 4BZ2H 1YC7A 1RZ7H 2B20A 4D2NA 2DQCL 5KN5A 2WUBH 1YMMB 2XQBL 3B6SA 1J12A 3KHQA 3V7AG 1BX2A 1HSBB 2HT3D 4PJ7B 5JORA 3RWFA 4QYOB 3PQYD 5FUCE 2FX8L 4Y16A 4GKNA 4JR9H 3QIUC 4BSJA 4TPRL 5H35A 2X4RB 3AY4C 2ZUUA 1UADC 1R3KB 3VXSD 1DLFH 3JXAA 3MRLB 4LPTA 2VZ3A 3HLAB 1TJIL 5IESH 2EE3A 4KAQL 1F5WA 1KIUA 1MCSA 3MV8E 4HWEL 5ESAB 4R7NA 4ZUWB 2PTTB 3M8OL 4RQQA 3FJTA 2BOBA 4MJIE 2AK4D 4WHCA 3SDCD 1ZTXL 3OKKB 3RWEB 3ARGC 2XZAL 1H0DA 1QQDB 3FN0L 1J87A 4GAYB 4HPOL 1KELL 4U31A 5GIRB 4HJJH 3SCMA 4LLMB 4XI5C 5I19L 1F8TH 3MXVL 9CGTA 5EPMB 2ATPA 4O9HH 2Z0BA 4JO3H 2XV6B 3BKYH 4K7PX 1FH5L 2FGZA 3NCBB 4RMQA 5BQ7A 5D7LA 1EX0A 1GC1L 4LSVL 3Q1SL 2I07B 3HZKA 3QZWA 1W72A 3D85A 5CP3H 2GITB 1JYVA 1K4CB 1X5ZA 1AXSB 1FO0B 3P4OA 3L7EB 4OZHA 2DWDB 1EZVY 4F8QA 2A6IA 3NACH 1OSPH 2CRIA 3HTLX 3FB5B 4LGSB 2YD7A 3H0TA 3W0WA 3CLEL 4HIJB 1ZLWH 1RZJH 3V4PH 1ZLUK 4I3RL 4XMKH 1UVQA 4IBLT 4YC2C 4ZUVB 1D6EB 5FGRA 5AD0B 2D9CA 2MFNA 3RGHA 4EI5B 2VDLH 4CMHC 5DZOA 3MCKB 1FDLL 5JIPA 4JRYD 4KUCF 3OB0K 5HI3C 2YC1A 2YD6A 3MV01 4PJIA 4X6CE 4M6ML 4XAWH 2OX5A 5DHVH 2AQ1A 1MEXL 3NMEA 4DUVA 4NPYA 4JDZA 4QCIB 4HFWA 1H3PH 4GMSH 3LKQA 3A6CL 2V5RA 3PNWB 3NAAH 3WFZA 1JN6A 5DK0B 3X3GH 1QLFA 1T22A 1UJ3C 1RUMH 1BQHG 3R8BB 4XCEB 3RDTD 2EDKA 5KSBE 4YFLI 4YDKL 1TJGL 4TSCL 1GZPA 5GS3A 4DQOL 3JWOH 3WHXB 4L4TB 3ZDZF 5D7JB 4P46C 3VFWA 1KG0B 4GKSB 4UTBL 3UTQA 5F8RC 2J8OA 1UENA 4HKJA 1QA9B 2YEZB 4R2GB 1K4DB 4RDQG 1YY8A 4YHOH 5D8JH 5IBLC 2VABB 1T1ZA 1NBYB 4KJYA 2ARWA 2JCCE 1NDMA 5FB8B 3U7YH 3U0PB 3ULUL 4OZIE 2AVGA 2CD0A 4RBPK 2X4PB 1YEFH 5T3ZL 3V0VA 3I50H 1JFQH 1BLNA 4PLKC 5E2TL 3IDJB 4UV7H 4A6YA 5D5MA 3RVXC 2VQ1A 4WJ5B 1RUPH 1NLBL 4W4OA 1TCRB 1PKQB 1U6AH 5J6HA 3SGJA 5ADOL 4PJ5B 5DC9B 1C5DB 4TVPE 1NBZA 1E4JA 3B9VA 3D25A 2MOVA 4OM0L 1AHWA 2FBJL 1GXEA 3SGKC 2EIBA 5J8OA 3PV6B 4GUPA 5IM7B 1HHKB 1QYGH 3SGEH 1XCQB 4LCUB 3U9PL 4XT1C 4H8WH 3SO3B 3WKNA 5FM8A 2YBRA 2C7UA 2N56A 2XZCL 5A1AA 1UACH 2X2YA 3ULSB 4F9PA 4JFPA 3HG1E 1ZGLB 4U1LB 4OLYL 2GQHA 2QQQA 4X4YB 4WI2A 1JIBA 1ZLWK 4L8BA 4GG8B 3WNNA 1FVCA 2NW2A 5EU6A 4DAGL 2P1YA 3UTOA 1DBKH 4NJ9H 5D1XD 2CKBB 1U8NB 3QHZL 4JY5L 2AXFB 5HGAB 2F5AL 5LXGL 5E0QA 1KC5L 43C9B 3QEQA 2PO6C 1FP5A 4NN7C 5HHVL 1FNEB 5DWUL 2DQJH 1IMHC 4K23L 3B3IB 4URTB 2UVFA 5IF0A 4HH9B 1JUFA 4YK4C 1FL3A 4MJ2A 5IW1B 3QQ9D 3MLWL 3DTXB 3EJJX 5DFWH 3RNKA 1IGYB 3OGOE 1S3KL 4JQXC 4MAUH 3KS0J 1T0PB 1A0QL 4OCYL 4U1HA 3SKMA 5A2KH 5IVXE 3E6FA 1NGPL 1V3LA 1U42A 3IDGB 1EERB 3SCMD 2NY0D 2EDRA 1I4FB 4PP1D 3QEHA 4EN3C 1A1MA 1AO7D 4XBEL 1G1CA 1CE1H 2DLTA 1HEZB 4RAHA 4OBSA 5D7LD 3DXAA 3PWPA 3BP4A 3D85D 4NZUH 5GGVY 1LEKB 3QCVL 2NXYC 5DJXA 3O3BB 5F96H 1HXMB 1JPTH 3GI8L 4RMWA 4XNMA 3WS6C 1MLCA 1FV1B 2DQHL 2E9IA 3BYTA 3BMVA 5DRZB 3CLFH 4NQVB 3W0WD 1D5MA 3OKEA 2NY3D 3QUXB 5A3IC 4PJDF 2DKSA 3RVVC 1A6AA 4FFEX 2FCBA 3EDKA 1A7OL 1G6RH 3MNZB 3ZDYF 3LKPB 3H3PH 1RUKH 1ZT4A 2V17L 3VFMA 4N8PA 1FGVL 1I7RA 3MACL 2BHZA 3O2DA 4J8RA 4WI4A 4RFEB 3OKNB 3BUTA 3EFFA 4YLQT 3TJHA 3DJ9A 4BQ8A 4KK8D 3GMQA 3UJIL 1WAAE 2B1HH 3HE7A 1FLTX 4H25A 4X7TA 2BNUA 5I2IB 1MCWW 4OFKA 3VXUA 1OARL 1A7QL 4J6RH 3L1OL 2APWA 5JMOC 1XGUA 4Z8FH 3BDBA 4XVTH 2OSLA 3DVNA 4R8WH 1T1YA 3KXFB 4MNQA 2FWOB 3OAYH 1D5IL 4OCNC 1TNNA 2EDNA 2R8SL 4Y1AE 3GIVA 3GMNB 3RWGA 3CCHA 4WRLA 1R3JB 5DR5L 1DUZA 4GKZB 1WBXA 4JFQA 1HDMB 2XKUA 4LAQL 4HDIA 3WJJA 4UOW0 5CZVL 5HI5C 5CD5D 4GBXB 4KKBD 1IEAB 1RD6A 4JANA 3PL6B 3IDMB 1WEJH 5DHVB 4Q74A 4AEHH 5D2NA 3FMGL 3SDXF 2HTLC 4JO1L 4LQFL 3EFDH 3DMMA 1JI1A 3MV7B 1MCHA 1Y0LA 4EI5C 1QVOB 3EYOA 3LS4H 1WCQA 3KLAB 5KSAB 5HDLA 1QEWA 3ULVD 1W0WB 3QI9D 4JFOB 1HXYA 3BWAB 4GRMA 2F19L 1U0QA 3BO8A 2XTLA 3LPGA 1ZWIA 2IAMB 5J3HC 3VXNA 1AD9A 4X99B 1G0YR 1P7QA 4ZFOA 3JTTA 3ES6A 3GSQB 5F9JA 2IPKA 5CJXC 4FMFA 1AP2B 3O2VL 3FL7A 4GRWE 3RY5A 5DGRA 2DKUA 5F7FA 1JL8A 1T83A 1CF8L 2BVQB 5C0CE 3QCTH 3LEXB 5TQ2L 4JCLA 1BQHA 3DUSB 3VH8G 1T3FB 5DRWA 4JRWA 1YECH 4OD1H 4RFOL 5EO0B 3KNBA 1IARB 1YEIH 4PREB 5IFJB 3QIBB 5BZDA 2YD9A 5D7JC 1KLUA 5DS8A 5DURB 5BVPL 4G6FD 4DKFL 3WD5H 1TMCA 4NHUA 1MF2L 3IFOA 5F6HJ 2YPLD 4BZYA 2V2WB 4G8IA 4R2GC 3VGAB 3V5HA 5FGBA 4KU1A 1MHHB 4P4KB 5I0DA 1CN4A 3VFPB 1OPGH 4PV9A 3SKJH 5K9JL 1NEZA 2NNAB 1OLLA 5D72H 5I66B 5F3HA 4Z5RB 2DLEA 3HS0A 2IC2A 5IEHB 3MOQA 3DROA 3P4LA 4OGXL 5J1AB 4F80A 1BD2B 2I26N 1N3NA 4PTTA 1RIUH 2UVEA 5TE6H 1TETH 4UUJB 4WTWA 5TE7L 7FABH 2APBA 4QHLB 1XZ0A 1UWEH 3GB7A 3CGTA 4NUGH 3UYPA 4PJGB 4KPHL 4KRPD 2FNBA 1OM3L 2OS7A 1CXKA 3M1BB 3NA9L 4MQXD 3SOBL 5E5RB 4U1MA 2WK2A 3FRPA 1YEDB 5GSVA 3VI3E 4Z7WA 1QSEA 3PWPD 4WFEE 1KEGH 4JCMA 4R3SB 1WFTA 2ITCB 2CMRH 1ZSDA 3QEUA 2X9YA 4NWTL 1KF9B 4PY7A 5DTFB 2HLAB 2W9EL 4F57H 3VE0B 2OTWA 2Q7YA 4KHTH 2E5EA 4FS0A 4K71B 1F2QA 3UO1H 1A4KA 4ONGH 3L3HA 4GG6F 3EDJA 3QPQC 1WJ3A 1UKSA 4XZUB 4GLRH 4BQ9A 1IQDB 3O3DA 1C5BH 4NKOB 3HI5L 3WEXB 4HLZH 1T5WA 2EKJA 2NYYD 1QHPA 4LEXL 4PG9A 4HHAB 2NY5H 3DRTA 3MJ9H 5GZND 1A7NL 3RVTD 1AQKL 1X5YA 1LQVA 4LSRH 4R4BB 3ZDZE 3HE7D 3P11L 4LFHG 3GGWA 1A4JA 1UG9A 1GGBH 1KCVH 3QWQB 4ZS6D 1HI6B 1CVSC 3CXDH 3PWUA 1UYWL 2CGRL 3EOYG 5C0AE 1FFOB 4KTDH 4MJ5B 1MI5E 3FB7A 3CDFA 4LLWA 3ARZA 5FCUL 3QB7C 3RWCB 1SY6H 1NDGB 5IB4B 4WIQA 3KHOA 1LO0H 1ZS8A 5C0NC 3LRSB 5DXWA 1EFXB 1OAYL 3S36L 5C07B 3C5SB 5CGYC 3TO4B 1I3RB 1L6ZA 2VZTA 3MLUL 1G6RB 3S98A 4EDWH 1UWXH 1KGCD 4B0MM 2G2RA 4OFDA 3MLVL 2R0WL 4HWBA 4NBZB 1MIML 4CDHA 3MBED 4YGVB 3U36A 1S7SB 2Z8VC 1JWMA 4LF3A 1J5OH 5C0EB 2RFXA 3I6KB 1DQQA 1JI2A 5IW6B 5D1QB 5FAAA 1D9KA 4M03A 3QUXC 1IC7H 5IG7B 4HSQA 3ARRA 2I24N 3AB0C 2Q76B 4OI7A 2EDBA 1BIIB 1RPQA 4QRUA 5DVMA 4I48A 1H8SA 4X6BB 4NO0A 4LCWA 2H9GB 2EC9T 5CUSH 1LEGA 1DEDA 4XPBL 1B6UA 1KN2L 1QSFE 3JV0A 1SBSL 3BFOA 4JFEE 3S5LB 5CEZD 2HKFL 1U8LA 4Z9KB 2NTSP 2AI0L 4XPGL 3P4MB 4OLXL 4LU5H 2J4WH 5IHZB 1BREA 1L4IA 5FA3A 1IKNA 1ZVYA 5EU5B 1P84K 3CXHJ 4BFBD 4TUKL 1BGXL 4JKWA 1F58L 3IDYB 3HC0B 4LHUD 3KYKL 3MREA 4JFFE 1OCWH 1W72L 2OXHA 4G59A 4J4PC 3TCXA 3STZA 5F7MC 2KPNA 3ARSA 1AGFB 1JRHL 1RZJC 2LVCA 4PJFF 1VGKB 4QRRE 1CLCA 2GSIB 2XTJB 5F89A 1N64H 2EDLA 3WNKA 1T66C 2C1OB 3QJHB 5E56A 5E8EA 2WAHA 5LJYH 2PYEE 2DQEL 4HV8A 5BO1H 2HWZL 5KOMC 4U6XB 2RJMA 4GOSA 5CCKL 1OB1A 2LQRA 3SQOH 5FECB 2ZG3A 1G7MB 4GBXC 4JM2C 4WDIA 1S7RB 4AIZB 5K9OB 3VXSB 1WISA 3PL6C 2GK2A 4NQDB 4YDJA 1T1XA 2P43B 1LNUA 1KCUL 4F7PB 1AR1D 5JDSB 3O6KL 1J1XH 1N6QL 4EEEA 4WFHD 2EXYD 1HINH 5KSAC 3SDCB 5IK3A 1BQLL 1QRND 2HFGH 4E0RA 3D5OF 4BJLA 4PD4J 2AJYL 4X7SH 4Q6IB 2AKRA 3I75B 5EO9B 4D0DB 3G5XA 2WV3A 1K9TA 4OFIA 2IAMC 1L0XA 3JWOC 1QRKA 2Z91A 5AUMA 5HHOA 4PJDE 1ZLVK 3V52L 1J1OL 3BWUC 1BHGA 3D3VE 5IHBA 5SWQA 3ARYA 3OKLA 1BFVH 3GRWH 4N1HB 2WWMC 4HKZB 2GTZA 4L8DA 2HJKB 3IYLW 3ZDYE 5KS9A 5I1HH 1UB5B 3D9AL 2X4SA 2ICWA 4OGZA 3ILPA 5E70A 1F6AB 1NUGA 5ACZB 2Q8BH 4QY8B 5DJDA 3QWOA 4M62H 3I6LE 2YUZA 2QSQA 1CGVA 1QUNA 4ZDHB 3U0TA 3VH8A 3V8OA 3DVFA 3FQXA 4I9WD 3QIBC 1DR9A 4X5WB 3BGMA 1DBML 4Q6YA 3RI5K 2A74B 5ACLA 3TWCH 2VQUA 3IFLL 1B90A 1C12B 1U92B 5DEFA 4JZOA 1DQTA 3S35L 5CGTA 3VGAC 1DQML 1P4LA 4KZDH 5DMKB 2RGSA 1X4ZA 3RHWK 2CUIA 4ORZC 3HMXH 4JRYB 4P4KC 3UTSA 2RBLA 2GJZB 1DQLH 3BHBA 4A6YL 1WICA 5BS0A 3ZT7A 2VLRD 3GKWH 5ERWB 4HFUL 1BFSA 4PRIE 4XVJH 3KYMA 4KZEH 4YHKH 2NY1B 2DOCA 3GHBL 2VDNH 4MCZA 3BH8A 4CDGC 2QKIB 3ULVH 5CBAB 1PQZA 3CDGA 3OKOA 3ARUA 1MHEA 3BAEH 4PJCB 3FB8B 2FBOJ 2A1WH 3QUMA 3X11A 4U1GB 3RUGA 4L9LB 1YNLL 4FP8L 3O8XD 4NOBA 2OP4H 1JPFB 3LSOB 1IAKA 2Q20A 3IETA 3R8QA 2F54B 2NR6C 1OP3K 3MRGB 3OKMB 4NQCE 3U7WH 1S9KC 2VRAA 1EHAA 1I1YB 3CVHA 3OAZK 3VXRB 1ZVHA 4Z78B 1D9KD 1KBGL 2XKNB 3V2AR 1YEJH 3QHFL 4ORGA 1GGTA 3V6OC 1N5AA 5F44A 4LCWD 1XCTB 4U1NA 5EZOH 4Y88A 1G7JB 1CXLA 2DMKA 2CUHA 4CVXA 3WNLA 2IALA 3OKDA 1ZHBA 1EHLH 4MVBA 1YEGL 2C3XA 3TIDB 1CFSA 3WSQH 3FO1B 2HT4C 3IKCA 1RFDL 1MCEA 1X4YA 1MWAH 4OZ4A 5TDNA 1U9KA 3FFCD 1PLGH 4WGWB 2YKLL 5CJBA 4FQLL 4W6WB 3QQNA 1ZLSL 5EBWA 3GBML 5SV4A 1RIVH 4XNYH 4L4VD 4M8VA 5T1KB 3ROLA 4FQXC 4L3EE 3TPUE 4FQ1H 4KHXH 5INCA 5FYJL 4JY4A 3FRUB 5EWIH 4OI9A 4QWWD 3HE6A 4OIIH 1EO5A 4YZFF 5D1XB 5DI8A 2MTPA 1NCBL 1A9EB 3FQTA 3VW3L 4BYHA 3U4EA 2X1QA 3NTCL 4L29A 4MSWB 5JORB 3GHEH 2H1PH 1P6AB 4D0BA 5H35B 2BY0A 5HHPB 1TZIA 1R5IA 5D1QC 4Q7DA 2HRPL 2ZCKL 4P2QE 3KPQA 2I27N 3LZFH 5LWYL 5T5NG 2A9ML 1S9VB 4P3CH 3O2DL 4CNIB 3QFDB 3RZWA 4X83A 1J88A 5TFSH 2AJVL 3D39E 5EB9A 5IFHL 4QT5B 4RX4D 5FCSH 4FFYL 1YEHL 3OGCA 4L4JA 5CSZB 3BKCL 3SCMB 2MKLC 3FO2A 1AO7B 1OGAE 4YPJA 3GSVA 3KLDA 4YX2H 3CSPA 5IQ9B 4NZRL 4D3CH 4HJ0D 5AG9A 3RIFF 3D85B 1PJ9A 1JYNA 4FFZL 5FUOL 2VH5L 1DANU 3IDYC 1LEIA 1IFHL 4JQVA 4GAGL 5KW9H 2W0FB 5KAQF 1A7PH 4CU7A 5BOPA 1QACA 1T2QH 1FE8L 3L7FB 2NY3B 3TNNA 2HT2C 2EH8L 5EFIA 1FC1A 5HHXL 1T4KA 2F5BL 4TTGA 3K2UL 3JV6A 5EO1A 2XTJC 2V5YA 4HJGB 4QHKJ 3BP6A 1TVBA 3N85H 2H8PA 3K7UA 1X6NA 2HT3C 1BQSA 3ARXA 2CRYA 4LLQB 1AY1L 1CR9L 3BIKA 1CD1A 4UILL 1HH9A 3FQRB 4PJIB 2K7QA 5BS0D 1ADQA 3NFPB 3DVGB 2UZYB 2R69H 1QBML 2VLKE 4U6VL 1HILB 1PYWA 3GSNL 4LSQL 4KI5C 1OTSD 5EOTA 1TZHB 3MLYL 1FBIH 3VXTB 3E8UL 2PYFB 1IQWL 3HC4H 3N9GH 1NGZB 4ELME 1JF5A 3KPSE 2ADGB 2E8ZA 3V4VL 5AZEL 1CK0H 4Q6IC 5C08A 3EO0A 2HVKB 4PJAF 5JHDA 3EAKA 3CMGA 4YHPB 4X8XA 4KROB 5CEZH 1BZ9B 3TA3A 2JLLA 4HT1H 1PY4A 4FQJL 4PJBB 2G9HA 3FOMA 2ZKHL 1XGYL 5GGSY 5MEPB 1XFPA 4HKJB 3CUPA 3TT3H 3RTQB 3BYYA 2PKDA 4Z7QE 5H37G 5LGHL 4APQA 3VFSA 3OB8A 1FC2D 1FFNA 4KJYB 4HIXL 5I18H 2XXMB 2H2PC 3VFNA 3C08H 4G8GE 1G9NH 3NGBB 2XZZA 4QNPF 3VFVA 1AD0B 3UC0H 1DL7H 5SX4I 2AQ3A 3KYOB 2DMBA 5EUOE 2VB5A 1CI5A 5EIQA 2IPTH 4OUUB 1TXKA 4JLRB 4JGMA 1IZJA 1FZKB 2VDQH 4ZUSA 3QI9B 1T21B 2J12B 5EC2B 1YYLL 4RNRA 4N0UB 3BGAA 3REVB 4MVBD 1EV2E 2ZPKL 1EHNA 3U4AA 3T0ED 4PJFE 1INEL 4YHZL 5JUEH 5CEYB 5FGSA 4Q9QH 5IMLB 2WANA 4BQCA 4W6YB 1INDH 2XA8L 4Z0XB 2NY1C 1VCAA 5C3LD 1RQ5A 1EGJH 1MHCA 2RCSH 3PHQA 4PLJD 4ZSOE 2QTEA 1GIGL 5F7YC 1RHHA 4J1UA 5L2KE 5ILTH 5TE4L 5JO5A 5KTEL 1HHHB 1CVRA 4YXKL 3IF1A 4U1GC 4L9LC 2GW5A 2H3NB 3HE6D 1G9ML 1NMAH 5E2VL 5CINH 1VADB 3GO1H 3MRBA 1HKLH 5IFAL 1F90H 2V9QA 1QNZH 4X98B 2YPLB 1KIPB 2ESVE 3HRZB 4X5XB 2VL5A 3MYJB 4PJ8A 2Z8WC 4TSAH 2NY5C 4PB0H 2FYYB 4MD0A 4YHIB 5ICXA 5IF0B 3KDMB 3ALWA 1P9MC 1F4AA 5HYJB 1YEKH 1OAZL 3Q3GB 1MWAB 4G42A 4UOJA 1FVDA 1Z2KA 5E9DD 4AMKL 4OF3A 3MRMA 3S8WA 2P4AB 4WUUA 4F58H 2SEBA 2L7JA 2P5WD 1MUJB 1NC2B 2YRZA 2ZCLL 3H42H 4MAYA 4K55A 3KPTA 1E4WL 4OFVA 3HC3H 3IS1X 2CLZA 4B5EA 3RY6A 15C8H 5F1OB 3SEPA 2DQCH 2FJFB 1J8KA 4X4MA 2XQBH 4YFEA 5JDJA 1DFBL 2E9BA 3EGSB 4KJWC 1X9QA 4DN4H 5C9JA 4W68A 4G7YL 1LD9A 3SDXA 3KPRD 2W9DH 3TIEB 1MLCB 3BPOB 2OJZH 2EDOA 1MREH 5H2BA 3EO9L 1N5YL 3PGCB 4X5LA 4LSPH 4KV5F 1Q38A 4HWBL 3B4NA 1VA9A 3GUTA 2NX5D 3CFCL 5L6YL 4L8CA 3U82B 1A6AB 5I9QC 2QL1A 4DKDC 1NCAL 1X44A 3M8OH 4R4FH 2VQTA 4KI5E 1ITBB 5FYLE 5HD8D 4IIQA 2DAVA 3RPIB 4MNGB 4HS6B 4LCCB 3QJFA 1HWHB 4HPOH 1OVZA 3RKDC 1IGTB 1PSKL 4X9FA 5TGBB 1O0VA 3T4AA 3FO9A 1Q9LA 4KC3B 1X5IA 3FTGA 3O3AB 3VGHA 5IJKC 4OGAD 4P5TA 4POZC 1MJJA 1TDQA 1CDJA 3MGTB 4R26H 2AXGA 4UNTA 2AJ3B 3WFHB 4WFGE 2VE6A 2IF7A 3C60D 2BNQA 3QNZA 5JHDD 4FHBD 1FNSL 4RSVA 3CJJA 2FHCA 3UAJD 1CBVL 3MJ8B 2J1KA 3TA3D 5ELIA 2C3HA 3TBVA 1Z9LA 4FXGA 3E2HB 1CGWA 3BI9X 1SYSA 3BEVB 1JWUB 3K0WA 3G6JB 43CAA 3L3KB 3IXTA 2Z35A 3GJEA 4KRMB 4EDXA 3MBEB 3GK8H 3BP5A 3MLTB 4PRBA 3OHXA 2XN9A 4LSUH 4LSDA 4UT6H 4NM4L 4PY8I 4LPVA 1CGSL 1XGQA 1KTLB 4RIRB 1UB6A 1P69B 4ENEC 1GAFL 4HWNA 1EZVX 3EYVB 3LN5A 4LL9A 4N0FB 4WO4D 3TBWA 2P8LB 3WDIA 1A3LH 1J05B 5I8OH 4C56A 3D18B 2UY7A 5C0DB 3NZ8A 2HTKC 4QEGA 5F21B 1IEHA 3BKJH 5I17B 1MVFA 3QXDA 1AD9B 1CFTA 3DETD 4M3KB 5FHAH 3WXWL 3ALPA 1RJZA 4CJ1A 2WINB 4XMPH 4NFBA 5C0JA 1BOYA 3EOAB 4OCLC 3QA3A 2IADB 4H1LG 5DMGC 5MP6H 4L3AA 4LLVA 3VI4F 4BZ1L 5E5MA 3BPCB 4LHUB 4ODUB 2KQMA 3O6FA 4GG6A 3DSFH 5DDHB 4PS4H 4KROC 4N5ED 4FTVE 2LTQB 4KVCH 3VRLF 5E2TH 3L3GB 3O4LA 4HCRA 5CP7A 1IGIL 4G8IB 1KT2B 3RTQC 5F6HI 1MCQA 1RK0A 4PJ8D 1NLBH 1JNLL 2LU4A 1IAOA 4Q9BA 4FG6C 3WE6A 3X13B 1H3WM 2HVJA 4OF0A 4YFDB 2BRRL 4G9FD 4OM0H 5I8CB 4F37K 5F3HB 3RWIA 2OTUA 2FBJH 4JPIA 3PDOA 4R97B 1CDIA 2YK1L 4WW2B 4KKNA 1DE4A 1DBAL 3T3PF 5DQ9A 2ENYA 3UTPE 5MEND 4WUUD 2XZCH 3QI9C 3QNYA 1IBGL 1QRNB 3T09A 3RRQA 1I8LC 1SJHB 5DJ0B 4TOYL 5FXCH 5FUZH 4G6AC 3B8YA 3GJFA 4I2XE 1GPOH 3ECBB 1IKFL 1S7QB 4N0CD 4DAGH 2V2XA 3IDUA 5DUPL 4D8PA 4RWHA 4E41D 4JO4L 1MRDL 3SE8L 1CICB 3OJ2C 3QHZH 5C3TA 2MQ0A 3ZHDA 1KJVA 4LCIL 4LP4A 5FO8A 1TJHL 3QBTB 4WWKB 5E8PB 4I3SL 5D7IB 5DWUH 4PV8B 2HN7A 3KPNB 4RISH 2CKNA 3O0RH 2JJSA 4N0YL 3ZHKA 2I9LA 2DICA 2O5XH 3CVHL 3L5WB 5C09E 4UQ2B 1UM4L 1A0QH 1UQSB 4HEME 3G5YB 1NGPH 4P5MA 2DQUH 1XF2B 1D7FA 5IOPB 4PJAE 4FABH 3MV9E 5DEGA 2EDJA 3N1QC 1NGWA 2RR3A 2VUYA 3C8KB 2VLRB 4OLVL 4NRZA 1P7HL 5FA4B 4P5TD 4XPTH 3KPLB 1NAKL 4M5ZL 3HNTL 1F4WH 4KFZC 4YWGL 4ELKA 4OI8A 3W39B 1YN6B 5I1LA 1T7ZA 2EO9A 3EYSL 2DI7A 1KB9J 5HVGB 5IB1B 1QP1A 1XF3A 1CFBA 4HIIA 3TZVB 3W9DA 3D69A 2BFVL 2CRZA 3H7LA 5DZLA 2B0SH 1E6JL 2C1PB 3ZO0A 1AGCA 3ARBA 3F6IA 3CDCA 4IHOA 5GJTH 2WY3A 3CDYA 5HPMB 1I9IH 4ODSL 1WZ1H 4WU5B 4QNPE 3CSBA 4XTRC 1J0KA 3O8XB 1PG7L 3SQBA 4ETYA 3QFJA 1Q8MA 4NN6B 4JRXE 5DC4B 1RVFH 4UU9A 4K07A 4X6FA 1UXWA 4YBLB 5M95B 1SJEA 2ZUWA 5FYKD 5K59E 2V17H 4F3FB 1YDPB 2VDPL 5KSUB 1C1EL 1X5KA 3BPOC 1FGVH 3JWDH 1KIRA 1A3QA 4K8RH 1FCGA 3FQNB 1AGEA 2YUVA 2CUMA 4WNQA 1NUDA 3RBGA 3BRGC 3MOAH 3S34L 3H9SE 3QDMA 2Q6WB 1DDHB 4EXKA 3FQWA 1A7QH 1LEGB 1XR8B 4G3YL 1SQ2N 4C56D 5GRUH 4X7FC 2IANA 4N1EA 4LCCC 4MMXC 2OTPA 3WN5A 4M7ZB 1IILE 3SHSA 1U93B 5DMIL 1RZ8A 5F72S 1D5IH 4BSWB 1IC4L 1G7PB 1JFMA 2R8SH 1AI1L 3HUJE 5EZLA 4ZS6C 4U6HA 1FIGL 3FFCB 3Q6FB 1JGLL 4U1JA 4OLZL 1R0AL 5IIEB 3EW3B 4LAQH 5IROA 4J3VA 4L4VB 1RUAH 2E7BA 3O6FD 4R90L 1NLDH 4LAJH 4KDVA 3OTTA 4NT6A 2EE2A 2VZSA 3STZB 1JGUL 2VN4A 5DJ2B 4O2FB 2GFBA 1V05A 4KK5D 2EXWD 4DFIA 2NY4D 3MUHL 3O4LD 2B2XL 3C6LD 2PF6A 3HZVB 3QH3A 3CIQA 2HJLA 2VXTH 4Z7UB 3MBEC 3AMLA 4N90E 5EZJA 2NCMA 1W8NA 3L3OB 1JZ5A 1A7RL 4FA8A 4H0HB 3O3EB 1LNUB 4R0LB 5HHMD 1TLKA 3TO2A 4GSDL 1ADQL 3O2VH 2EYTA 4TYUA 4MLIA 2XIDA 1T80A 5EUKA 5CJ8A 3QXUA 2GK0A 4RFOH 2VL4A 1MCPH 3ESVF 3LKOB 4GW1B 4FXKA 5AUMB 1QOKA 5CAYB 1U8OA 4OCXH 4V1DB 4LARL 4LDOB 1LK2A 2QQNL 3MCLL 4DKFH 3RWHA 1N59A 2XXCB 5ANMB 4XVSH 3P30H 3SJVB 2IJ0C 2X4SB 3O6MH 3A0OA 4NQTA 3MRJA 1BECA 3MRQB 4YQXL 1S7UB 3GMRB 4H1LA 1C08B 3VFRA 1AC0A 1M1SA 4S0SD 3T4YA 2MMXA 4YEFA 1E0OB 1G9NC 1HCVA 4NQXA 2LTQC 3QQ3A 4KKLD 1UKTA 3F5WB 4PJXB 1NH6A 5L2JA 5IMOA 1VFAB 3E6HB 1M7IB 1DN0B 3B9AA 1HHGB 1GRWA 3DNKA 5TE7H 3VXPA 5EZIH 2FX9L 1BZQK 3QG6B 1VENA 4P3WA 5ESQA 1VERA 4KPHH 1T2JA 5HGDB 5E2JA 2LAAA 2DWEA 2XWJA 2YUXA 2DYPA 2JE8A 4IOIA 4R97C 4P3DB 1AR1C 1PG7W 3QWRA 4WW2C 2FJHA 1F6FB 2R29H 1EFQA 3UCRA 3OKOB 5CLTA 2VLJB 4ZFGL 2N7AA 3VFGL 2W9EH 4DZ8B 3LS5L 2DM3A 4Y7MA 4XMLH 3S96A 5FK9B 4S2SA 5DO2D 1NGYB 3CFJB 5ISZD 4UAOB 4NSKB 2BJMH 1CICC 3AREB 1JPST 1S9WA 5ALBH 1I9RL 1FVEA 5D1ZD 4WWKC 4Y8AA 3SE9L 3ZKMC 2WQ8A 1WCBB 4HUWA 3ZE0E 2DQDL 4MNGE 1A7NH 5JW4N 5DJCA 1MFAL 5IGXH 4JGJA 4L3CA 5F7UA 3LVEA 2FHFA 3JUZA 4L9DA 2HG5A 2N1KA 1SEQH 1WFNA 3QDMD 4OFYA 1HOCB 1CFQA 4JFDB 1OD9A 1N5AB 1SBBA 2CGRH 3RX5A 5AG8A 3X3FL 1A22B 3LHPL 1NC4D 2QJDA 5DJ8B 3PHOA 4OQTA 2W9LA 5KZCD 4RGOL 1RURH 5EN2B 3V6BR 4U05A 1JK8A 4OSUL 2X4UB 1ETZA 3MA7B 4J3TA 4F33A 4DK6A 4YR6A 2XYCA 4ZTOH 3MO1A 5IQ7L 3T0EB 2HP4A 3AY4A 2BSED 1OAYH 5JTWA 3EOTL 3AAZB 2V6HA 5E8DL 3VRLE 3TF7C 5J1TC 1J0ZA 1KYOJ 1LDPH 2ADIA 3A6BL 3TZVC 2IH1A 3QISA 2R0WH 3EOBB 2LE9A 4KK6D 4YPGA 4JG0L 3TBYB 1KV3A 4Z95H 5EC1B 2C3VB 3ARGA 3C5ZB 1RZIA 5EIIA 4LGRB 4OCWH 3O8XC 3I6GB 4M43H 5JW5A 5JW3H 1OTUD 3MROA 4XHQA 5I16A 3MV8D 3T3PE 1WTGT 3V5KB 4YBLC 5DD1H 4I4WA 5DA4A 4NM8H 1E4XL 2G60L 5IVXA 4JDVB 4AYFA 1JF6A 2P47B 5DHYB 1U95A 1TQBB 3MPCA 3QDJE 2HKFH 32C2A 1D6VH 4OLXH 5DJYA 4U2ZA 3RL2B 2XKSA 3FCTB 3GSXB 4NFDA 1LVEA 1J8HA 1GHFL 1IM9A 4BFIA 1YEEH 5E9DB 5ADPL 3UTTE 4PRHA 2F53B 1FZMA 4JFXA 1GYAA 2Y07H 3H9YA 4HX1A 4TUKH 1QKZH 3WFDL 3VRJA 2VJXA 1OAKL 1HYSC 4YDIH 2P5WB 4IRSB 5I30H 3MLXH 2AV7A 2ZOLA 4H88L 1BMGA 4M7ZC 4CMMA 4E42A 3N0PB 2CLVB 25C8L 1TTFA 2E7MA 2X1XR 3F12B 2VIRB 4P2RA 4M1GL 2Y6SC 3F58L 4BELD 1IEBB 1MAML 2VZOA 3WNOA 1CYGA 2FEDC 1NMBL 1MPAH 5FGCE 1CT8B 2HWZH 1HWGB 3RP1A 2DQIH 5LGJB 3W5NA 1UJ3A 3KPRB 1UZ8A 4S1RH 1OGTB 4IM8A 4PRPA 3P9LA 4AL8L 4Z0BH 1X5XA 5EFIB 4EI6A 2PR4L 1H15A 2NX5B 5BVJB 2FR4A 3C09C 3O6KH 5HHNB 1MHPL 4P46A 4YHLH 1XGPA 5FYKH 1CFVH 2NQCA 3IFNH 4G8FB 5SX5H 3HRPA 1YQ2A 3NFSL 2W1NA 2HLFD 1D5BB 3V52H 5SWZE 4HUXA 4NRXB 4R0LC 5LGKA 5DJAA 3KR3L 2ED8A 1FYTA 4RZCA 5B4MD 4LRIC 4XPFH 4TRPL 1TPXB 3D9AH 3UJJH 3RQ3A 5C86A 2YZ1A 3C60B 3B2VH 1N2RA 4YDVB 2E6JA 4U1KA 4XNXL 2IPUG 1I8IB 2W07A 5FM4A 4LBEB 1BVKB 4XB8A 3W82A 5EOQH 5I71B 4H26A 3N1MC 4OT1L 1FLRH 3HNVL 4X6DA 5GGRA 1DBMH 1ACYH 1EO8H 3T65A 1IGFL 1VHPA 3IFLH 4LLDA 1G7LB 3CX5J 2XG5A 3S35H 3SGKA 4HJ0C 5F7KC 3RL1A 1R24A 1MJ7H 1VB9A 2XRAL 5JOFB 3AFLA 5BJTA 5EDXA 4HCRL 3FZUC 2IH3B 4YNYB 5EORH 4ACPA 4NZDA 2VXUH 4L1DA 4N1CA 1RZKL 4TVPD 2EICA 4ZFZA 4JB9H 4G80A 1RJYB 1LE9A 4OFYD 4KKCD 4Z7VF 4Y19E 4DOHE 3H2WA 3LKSB 1DN2A 1JGEB 1OF2A 3V79C 4JN1L 2DI8A 1L8JA 1NFDF 4WO4B 4Y4HD 4XGZA 2DQGH 3ZKXC 2R0LH 2VTFA 4HUVB 4ZPVB 1NUNB 3AVEA 1U8IA 5FDYA 1X4XA 2PO6A 3IB4A 3DGGA 1IGML 4OLUL 3QIUD 3AM8C 3HNSL 4HW6A 2XNAA 4WV1C 1MCKA 1MJUL 3FQUA 3IAGC 5GISL 1YN7B 4GMTH 2AJXH 5D2LF 1OTSC 4QRQB 3O81A 4JZJB 1NAMA 3MUZ1 4HKXA 1P5UA 3LIZL 3MLPA 5F1NB 3P0VH 1QFUL 4D0CB 3ARGD 3WIIH 5DK3A 1JZ2A 1LO5B 1CLYH 4G5ZH 3AU1B 4XP1L 4NZTL 1EMTL 1S7XB 1CIUA 2H45A 4QRPE 2D03L 4JO2H 4XI5D 5EA0L 4UAOC 4EN3A 1HH6B 2UY6A 3AREC 3WIFB 4J3XA 1TZGH 3MRCA 3BQUC 5E2UH 1OP9A 4EXPX 1BOGA 1FG2A 1Q1JL 2JB6A 5C0RH 3E0GA 4EUPG 3G6DH 1BWMA 4G6ML 4QTHA 1TQCB 3WS6A 1KLGA 4G9FB 1RFDH 4TULL 3C2AL 5JMRA 1J8HD 4MA3A 1TCMA 1FVDB 2V2TB 1SM3L 3WO4B 2KQNA 4G6JH 1YPZF 1CXEA 4FQLH 4GO6B 5FKAB 4PJCF 1YMMA 3GSOB 5MENB 4WUUB 2G5BB 4R96B 1HSBA 4PJ7A 3INUL 4QYOA 5FYJH 4P2RD 5HI3D 5I1JL 3RX7A 4FMKA 4IRJB 5BRZE 2X4RA 1R3KA 3CFIC 4MZ2A 4MNHB 3MRLA 2VAAB 3HLAA 4OJFH 4E41B 2NY2C 4K3DL 3SDDB 4XWGH 4LP5A 3NTCH 5ESAA 4ZNEA 4ZUWA 1M05A 2PTTA 4PJHE 4S1SH 3JWDC 4K8RC 1ZHKB 5LBSL 3OKKA 3RWEA 3C5ZC 4M6NL 1QQDA 3MLRH 4GAYA 3CU7A 5E1AB 3DX6B 4UNVA 4WI3A 5GIRA 3WS3B 4LLMA 4MQ7B 4P46D 5EPMA 3IJYB 2IEPA 1A6UL 4ODVH 2I07A 5HXMA 5GS1C 4BUGA 4FFYH 1K4CA 1RI8A 4QXGL 4LQ1A 1AXSA 1TQBC 1FO0A 5A43C 3L7EA 3NABL 2DWDA 1JYWA 3ULUE 3FB5A 1FYTD 4ESKA 1MJJB 3U2SB 4V1DE 4Y1AD 1LO3L 5T3ZE 1YNTB 4HIJA 4XRCA 4CN4A 4K2UL 4ZUVA 5ANME 1D6EA 5C0BB 1IC5L 5AD0A 3SJVE 4EI5A 4RWYH 4IRSC 2CO7B 3RI5F 3UZEA 3I2CL 3MCKA 3LCYA 4EOWH 5CEXB 1T89C 1FE8H 3GJFK 4B41A 2UWEB 2H6PB 2QQLL 4KXZI 3K2UH 5GRYA 1QR1B 5AYUL 3JVGC 4PGEB 4QCIA 3RHWF 4JPVL 4NZJA 3VXME 5TH2B 2JJTA 1OWRM 2Z35B 4M7JH 4AK1A 4OZGB 1AY1H 4ZOAA 5DK0A 1HE7A 3PP3H 1SYVB 5GXBB 4XCEA 1UT9A 5C7XL 4MDIB 2Z4QB 3OHXB 1QBMH 4U6VH 1I3GH 1S9YB 3D48R 5IHUH 5FO9A 4OKVB 4WEBL 3NZHH 3OV6A 1N4XL 5D7JA 1ZEAL 1EJOL 1IRAY 3E8UH 2R56L 1KG0A 5C0CD 2GT9B 4GKSA 2BMKA 5AZEH 1J86A 2BC4B 1B0RB 1FZJB 1PY9A 4CVUA 3NIFE 1K85A 1QA9A 1RZFL 3UDWC 2YEZA 1K4DA 1J7VR 4UOW1 1CL7I 1UZ6F 2D4DA 1CFTB 2VABA 1RULL 1NBYA 5FKPB 3U0PA 3LPFA 2X1OA 5AWNH 2X4PA 1U8JB 1BAFH 4KQ4H 1ORQB 3MUY1 3QA3B 5DFTA 4NQSB 4D9RE 3RVUD 3WJLC 2J8UB 2ZOKB 3TGXA 1N0XL 3IDJA 1SJXA 3U83A 2D7QA 3LQMA 4LNRB 5I71C 3EYUL 3QUZC 4CL7A 1TCRA 3FT2B 1PKQA 3OSKA 1P4IL 2E6PA 4PJ5A 1X7QB 3V0WH 1C5DA 3Q2CA 2NY4B 1YJDH 3C6LB 4JFDE 1AKJA 4JPWH 4PJIF 3PV6A 4NJAH 8FABB 3TP4A 4I8DA 5IM7A 1EJ6A 1HHKA 1XCQA 1ZA3B 4LCUA 1H3VA 2NXYD 2ZPKH 2AEWA 2FHBA 5KVGH 12E8L 3KPMB 1INEH 3ULSA 4YHZH 3ZDXF 1Q0XH 2HKHH 2VDOH 5IMKB 3D3VA 1ZGLA 1QBBA 4U1LA 5HHMB 4ODBD 4YXHH 1B2WL 1NCWH 4X4YA 5A3ID 2P5EE 5EG6C 1KPRB 3TM6A 2K9UA 4GG8A 4WFED 5DK2B 1YMMD 4WO4C 3QPXH 4XPAH 2CKBA 1U8NA 3B2UC 5TE4H 2AXFA 1ONQB 5HGAA 3BSZL 1DBJL 5T1DH 43C9A 3BH9B 4KQ3L 4KGLA 1FNEA 4XNUL 3B3IA 1MNUL 2FB4L 4WFFE 4HH9A 5GHWH 5C2BH 5IW1A 3QULB 3X12B 3DTXA 4JZJC 1IGYA 2DI9A 3HZMB 3ZT5A 4QHMB 1VKXB 2ID5A 2LABA 4MHHG 4HZLA 4NQUA 3PP3K 4MD5B 5SX4H 3IDGA 1BM3H 2DJ4A 2AABL 4N5EC 2I9LB 4G43B 1OAXL 4IOFC 3VDAA 4B7IA 1IGCH 5D96B 2X7LB 3S9DB 1LE5B 4QO1A 1I4FA 3ULVF 1OWWA 1AFVL 4AMKH 4TUJB 1RIHH 1NPUA 1HNGA 4XCCL 5C0AD 1HEZA 4ZD3L 1MI5D 4UQ3B 5L8KB 3IGAB 3MA9L 1MFCL 3S36X 3GMMA 4PUBL 1LEKA 2DQTL 2B4CH 1E4WH 3O3BA 4HXBH 1BEYL 1EUUA 1HXMA 3ZTJH 4OQTL 1F3RB 3GIZL 5DD5H 5SV3A 4TVPH 1FV1A 3BE1L 5DRZA 4NQVA 5INDB 5E00B 4ELKB 4UTAH 3K2MC 2XY1A 3WO4C 3QUXA 4NKDA 2MQCA 4DGIL 4D9QE 1MFNA 3WLWD 4G7YH 4B50A 4EI5D 2BOCB 1EPFA 3MNZA 3WYRA 4QHNB 3LKPA 4O5LL 3QG7H 1N5YH 1AXTL 1CDCA 1Y6KR 4LCYB 1N7MH 5MI0B 3S5LG 4IRJC 3WFBL 1UM6H 5L6YH 5E2WL 1YNKL 4Y16C 5F7NC 3TH4T 3VFOB 5J3HD 4RFEA 3OKNA 1FL6B 5ISZB 2QSCH 3SDDC 1NFDE 4ONFH 35C8L 3OAUH 5MEOB 5D1ZB 5I2IA 2R2HB 1B4RA 2A77L 3ARPA 5JOPD 5CP3A 2DLFL 3SKNB 1PSKH 5JIKA 1QSFD