1S7VA

Crystal structures of the murine class i major histocompatibility complex h-2db in complex with lcmv-derived gp33 index peptide and three of its escape variants
Total Genus 67
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
67
sequence length
276
structure length
276
Chain Sequence
GPHSMRYFETAVSRPGLEEPRYISVGYVDNKEFVRFDSDAENPRYEPRAPWMEQEGPEYWERETQKAKGQEQWFRVSLRNLLGYYNQSAGGSHTLQQMSGCDLGSDWRLLRGYLQFAYEGRDYIALNEDLKTWTAADMAAQITRRKWEQSGAAEHYKAYLEGECVEWLHRYLKNGNATLLRTDSPKAHVTHHPRSKGEVTLRCWALGFYPADITLTWQLNGEELTQDMELVETRPAGDGTFQKWASVVVPLGKEQNYTCRVYHEGLPEPLTLRWEP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords H-2 class I histocompatibility antigen, D-B alpha chain
publication title Determination of structural principles underlying three different modes of lymphocytic choriomeningitis virus escape from CTL recognition.
pubmed rcsb
source organism Mus musculus
molecule tags Immune system
total genus 67
structure length 276
sequence length 276
chains with identical sequence D
ec nomenclature
pdb deposition date 2004-01-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00129 MHC_I Class I Histocompatibility antigen, domains alpha 1 and 2
A PF06623 MHC_I_C MHC_I C-terminus
A PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1s7vA02
3.30.500.10 Alpha Beta 2-Layer Sandwich Murine Class I Major Histocompatibility Complex, H2-DB; Chain A, domain 1 MHC class I-like antigen recognition-like 1s7vA01
4NKMB 3RVUC 4U1HA 2R0WL 4GW4A 3BP4B 5MENB 4X9IA 1T83C 3T2OA 1U8QB 3MJ8B 3BE1H 4TVPL 4OCXH 4MQ7B 4XZUB 1MFEH 5F3HA 3VGGA 5EZIH 1PKQB 3D2UA 4I48A 1P2CB 5BO1L 3CCHB 4PGDA 3WKNA 25C8H 5EOCL 5EU5B 4ODBD 3LY6A 1UM6H 3HUJB 2EDNA 4OZGF 3WDHA 1BHGA 1O0VA 1DN0A 5F9DC 1TJGL 5KVGH 1PLGH 2ZUQC 3UAJD 1R3HA 4F57H 4PJGF 1A6WH 5C2BH 3V5HB 4N90D 3NIDE 1INEL 5HVFB 32C2A 3RRQA 5TDPA 2NW2A 5DUBB 4I2XE 2XI9A 1U93B 5B38A 1A6UL 2ESVE 4JKPL 3LIZH 4JRYB 1NFDF 2HFGL 2ZOKB 3X14A 3BKMH 1JZ6A 1FNSL 4KKBC 4KJQC 4O58H 5KTEH 4YLQT 1W0VA 2BDNL 5KSAC 5I1AA 4Y19D 2UZYB 3DSNA 1B6UA 3Q3GB 1G7PA 1AFVH 1A7RH 2XKUA 4OCLC 2PN5A 3AREB 2VL5B 3SDXA 3TBSA 4XBEH 1Q0XL 4NQCD 4G8GD 3U7AA 2FGZA 2HT3D 1M6OB 4OUUB 4DGIL 3WIHH 1NCWL 1K6QL 1NPUA 1FL6B 3CPLB 5DTFA 4CAGA 4XPGL 3PWPD 4DVRH 2A74A 4FFVC 5AZ2H 2GY7B 5BXFA 1KJ3H 3NIFE 3MLRH 1KCSH 4XXCA 2R23A 2FB4H 1JYVA 4KKBD 4ZFOL 1AD9B 3P77B 4Q9QL 3JV5A 3SE4C 1TCRB 5D70L 3AB0B 5M94B 1OL0A 4MA8H 2A73B 5CINH 3TPUB 4NO0B 1G7LA 3FQRB 4YHZL 2VZ1A 4LPXA 4NQDE 3UBXA 1N3NA 2FHFA 5EPMA 1HH9B 4HBCH 1KTRL 2Q6WA 1KTKE 2BP3A 3TN0B 4TRPL 3U1SH 5HPMB 3MCLH 4OAWB 4X5WA 1MVFA 5L2JB 1YEFL 2LTQC 5T33H 4KHXL 4PGCA 3H9ZA 3WJLA 3BP5A 2JCCF 1G9NC 4HKZA 4OIAA 1QPPA 5I8CB 5JW4N 4V1DD 3O4LB 2R1YB 1MLCB 3U9PL 5FYKD 1YJDC 2RB8A 3QXUA 2BSSB 2AJSH 2OK0H 4AH2B 2Z93A 1Q72L 2VC2H 4XHJD 1NAMA 2IALA 2CSPA 2ADJA 3TJHA 4HX1B 1BLNA 3CK0H 2E6PA 3P4OB 1FG2B 2YWZA 4OSUH 3QQ9D 1JFMA 5T1LA 2HWZL 3QULB 4R7NA 5HDBF 4UV7H 4H0HB 1A7QL 4APQB 4W70A 1KN2H 2AJ3A 2DF3A 5FIEA 1S7XA 5CD5C 2AK1L 2XQBH 1NC2A 3TT3L 2NNAB 4D0BA 3NZHH 5CEYA 5CP3H 1TQBB 2NX5E 4N0RA 3S5LB 4M7KH 4YXKH 2X7LB 4KTYA 4IDJL 1U36A 4LPTA 5IB3A 4IDLA 1BVKA 3DI3B 3EOBA 2EXYC 3F5WA 3VRIB 3E0GA 2X70B 3SCMC 43CAB 1T1YA 4O02H 1MCNA 2NZIA 3AC0A 1CGWA 4M1GH 4XH2B 2XPGA 2VLLB 3CMOL 4AEIH 5DQJA 4K55A 1OTSD 3GBNH 3QUKB 1J88A 3CXDL 5JDSA 4OKVB 4W81A 4GMTL 4JAMB 3W81A 4PJHB 5JA9A 2GJZA 2XZCL 5CD5D 3JZ7A 1KTDA 1R5VB 3NGBC 3QXDA 4KKCC 4RA0C 4RNRA 5JQ6H 3DURA 1N2RA 1R3KB 4ZSOB 4LCIL 4ZG1A 1INQA 5GZOC 1PZ5A 1CLCA 1YY8A 3K8MA 2IF7A 4JKLA 5T3ZE 2PCPA 3IFOB 4D8PB 4I4WB 1I9JL 4J3TA 3NFSH 1J0HA 1EHNA 2AK4D 4EI5B 1AQDA 2EXYD 1BBDH 5DHVB 2IC2A 3RKDC 4LF3B 3IFNH 1ZLVK 5C86A 2RJMA 4GAGH 1ZS8B 3QIBD 4JQVC 4KI5F 4KUZH 5I1DA 4WI7A 4C57C 4MNGA 2EDHA 1FNHA 3MACH 3N1GC 1IE5A 5HVHC 4KRLB 4ONGH 3AXLB 1I7UB 4Y4KA 3ULUE 4PJXF 2RFXA 4DW2H 1WEJL 4ZTPL 2CJUL 1JTTA 3RWGA 4KKCD 3VA6A 2E8ZA 3BI9X 4QRTA 5IGXH 2YPLB 5GZOD 1PG7H 1BJ1H 5LGJB 1TLKA 4HUXA 4P48A 4KVNH 3B5TA 1CD0A 1MRFH 2GW5A 4LLMB 5F1NA 2J6EL 4WI5A 1IZJA 3BP6B 1DANT 2A2QT 2FJGA 3NA4A 1ZSDB 3L5XL 3RKDD 3L3IA 1NANI 1WISA 3IDXH 4KMTH 4IOFC 5LCVL 5I1LA 1A3RH 2UWEB 3UTSD 3NABH 1QRND 2NMSA 2O5ZH 1ZEAL 4HJ0D 4ZOAA 1H5BA 5SX5K 1V7NH 5IG7A 4I3SL 4PJIA 5E8EB 2O5YH 3RGVA 4HJGB 3TT1L 2PYFB 4HUUA 3D85D 1P4BH 5C09A 1BZ9A 5H2BA 5E2TL 3QDGD 4V3DB 3VI3F 3LEXA 1ES0B 5TQ0L 5C0NC 4LCCC 3PJSA 1UXSB 1MRDH 5L8LB 5J7CC 5SWQB 2E5EA 1PY4A 2MKLC 4ZNEA 1JP5A 5I1EL 2DICA 2A9NL 3HI5L 2DJUA 3CX5J 4J23A 3LRHA 1RUMH 4S1RH 4G6MH 1RZKC 1ZHBB 5SWZD 4EN3C 2CIIB 2CUHA 1BP3B 3OWEA 4Y1AE 4OBSA 3BPOC 5DHYB 2R2BB 3RNQB 2H8PA 4JM2A 1P5VA 4E41B 4M1CC 5E00A 1I9IL 1C08A 1D5MB 3KPSB 3F8UB 5JHDE 2K9UA 4LQFH 1TPXC 4MAYC 4RISH 3TZVD 5L0QC 3QEHB 3N85L 1LGVA 4XNZC 5L7XH 3UP1A 1ZLSH 3KPLB 2SEBA 5AAWA 5E6IB 1GZPA 3KPPA 3TH3T 5EB9A 2JB6B 3H3BC 3M07A 4JFEA 4CRPA 5GRJH 3TEUA 2QQLH 3PXHA 4OQTL 4OLVL 2Y72A 4NDMB 3CVHB 3TBVB 3QYCA 1UZ8B 3VWKC 4C83B 1P84K 2BNUB 5DRXA 3KDMB 4D9QD 4OCMC 3DBXA 1JWMA 1TVBB 1OAZL 1KJ2L 4DEPC 3PL6A 3S88L 3SBWC 3BISA 3IU3B 4TUJA 1QFWL 2R2HB 4JM4L 6CGTA 5L8KB 3SE8H 1MPAL 2NPLX 3HC4H 2HYMA 4PB0L 4ZODA 3WN5A 1HWGB 4JY5H 4QXTA 4WFEE 2XTJD 4R2GC 3C2AL 5H94A 5TE6H 3W9DB 4LU5H 3P9LB 3RJQB 3NZ8B 1ORQA 4X4XB 2EC8A 3DWTA 4OTXL 4ACPA 4K3EH 4PJBF 4PJEB 5DD3L 1SYSA 3Q6FA 5GSRA 4WVRA 5TF0A 3DOSA 2WW8A 4U2YA 4Z7VF 5E8NA 1QEWA 2VLJB 3MRBB 4Y5YC 1I1AB 1JGEA 4OLYH 1PGRB 1YEDB 2YD9A 4PREB 1UEMA 4M00A 1OP9A 1FVEA 3O3DA 5GRUL 5CP3A 4M6MH 3VWKD 4L4VE 4PTUA 3SDCA 4ZUTB 3VRJB 5J13C 2XZAL 1HHKA 4M4RA 1HXYB 4IRSD 4CU6A 2YD4A 5FOBA 3BMVA 4OZFG 1FLTX 4KZEL 4PRIB 3W0WD 1UA6H 2HVKA 1MFAH 2E7MA 3P4NA 4NZRH 3T3PF 3LSOB 4DTGH 3KPRB 4WO4B 5D7SL 5HD8D 5GGSA 3SPVB 1T1WB 1L4IA 4U1JA 1LDSA 5GQBA 5F6HJ 2ID5A 2V5MA 1KYOJ 3CFEA 3HB3D 4FQIH 2YRZA 1PAMA 4GT7A 5JIPA 1RJCA 4F15B 4BQ8A 5IB4B 4R90L 1TXKA 3DECA 3FQTA 1X7QB 4DGVL 4PRNB 4PUBL 1TZHB 4WV1C 2VB5A 3QZWB 1SEQL 1NLBH 3D48R 2I5YH 2CMRH 3IKCA 4U0QB 1IEBB 3AS2A 1H15A 4XTRC 3TYFA 2DQCH 3OL2A 4KTEL 3E3QE 4ZFFA 3ZO0A 2DAVA 1E6OL 4M7ZB 5IB1A 1CQYA 1PDKA 5CILH 4UOW1 3LQAC 4QRSA 2NTFB 2IANB 4BA8A 1FCCA 1LILA 3RWCA 4HF5H 1ADQL 4HMCA 1A0QH 5J12B 5DZNA 1JCKA 1Q1JH 4GRLD 1CFSA 2G60H 3O2VL 2BOCB 3MRIB 5TE7L 4Z8FH 4B7LA 2X4TB 5F9WC 5HHMB 1AY1L 2QQKL 4KI1A 3VFOB 3BZEB 4P9HL 5J56B 4X5LA 4JPKL 1Q9LB 4JRXE 1TQCC 2H9GB 1FH5L 3BH8B 4QXUH 4QRPB 5DYOB 1MLBA 4MSWA 3RX8A 3OTTA 1K5NA 4YHIB 3JWOC 1ZGLP 5JPNA 1KCLA 4LAQH 1Z9SA 4R8WL 5D7JA 3SN6N 4ONFH 5F9OL 2X4SB 5MEPA 4KUCD 4NQEE 1VHPA 3GB7B 4N0YL 3SJVA 4Y4FA 4FXKA 3C2SA 2AXGB 2GY5A 5E94A 4EQ2A 3GUTB 4XXCC 1MSPA 1NLDH 1MWAL 1RU9L 3NA9H 4EOWL 4F33A 5I1GH 2GITA 3RWHB 1KBGL 3QFJA 3C9NA 2XWJB 2OP4L 5F1SA 3QDMB 2AV1A 4I0CC 4Z77B 1TTGA 2EH7H 2FATH 1XGRB 4KU1A 3UTQA 5AD0A 2NY1C 4MA3B 2CPCA 1T3FB 4YAQB 2VZUA 1EEZB 4LASL 4NO5B 4IS6A 4XWOC 5BCAA 3RPKA 3Q6GH 3B6SA 4HKXB 5EFIA 4L3EE 4P9MH 4AG4L 1I3UA 3RP1A 4MVBA 4ISVA 4MX7B 5D6CB 1MFBH 4P2RB 2YSSB 1D5IL 4RX4A 3NN8B 4OZGE 1HHHA 4UBDC 2C3GA 3D3VA 3G5XB 5F8QC 1NEZG 4C56A 1SEBB 2GKIA 3JTSA 2EKSB 4ETYA 4YBHA 4PJGE 5DJ0A 3CDGA 1IGIH 3M45A 3TF7C 1RPQA 2AJYH 2FBOJ 5HGAA 2D0GA 2FR4A 4HCRH 1V3JA 2X44D 2X41A 1TJIH 5F7LB 5EO9A 3WFEH 4AT6A 3TJHC 3MJGX 3OJDA 2DWDA 5D8JH 4LARH 1D6VH 2F54A 4KRNA 2BY0A 1NFDE 5EWIL 1RK0A 35C8H 5IMOA 1W72B 4JG0L 5E99L 1F4WL 3JVGA 3ULVF 4NKDB 4ODWA 3RA7H 4JY6A 4JN2B 5LG1A 1JPSH 3H9SB 3WO3B 3Q2CA 4WW2B 4XNYH 3KVQA 5DDHA 2NX5D 1WVZA 4HWBA 3EDFA 4EXKA 4TUOB 5J0BA 1F4XH 1FVDA 3KYKL 3F6LA 3ZKNC 4GW1B 2R69H 3T2PA 3MV7A 1JWSA 4WNQB 4OZ4A 2D0HA 4MXVF 4GH7B 4NRXA 2QHLA 4X7EC 5HGBB 1U8IB 3RTQC 5FO8A 1ZA3A 2DLTA 4LNVA 3PWUA 4X9HA 3DPBA 2VXTL 4Y19B 2BFVL 3UYRH 3S97C 3U46A 1UG9A 4UQ3A 4WUKH 5T1LD 4L29B 3ZLQC 4CVZB 5DK0A 1WV7T 4GLRI 1W8OA 4FG6C 2ZUQB 4G8GB 2H41A 1HQRB 5DMGC 4HMDA 3QWQB 2VITB 1J12A 1KGCD 4BJLA 2PYEB 2IWGA 2WV3A 3ARTA 3BW9A 4IMLB 4XP4L 4NJAH 3TYGL 4YEEA 3MV8A 1IMHC 1A6VL 1FLRH 3PWPB 4MJIE 3U0TB 3W9EA 4JDVB 5AAMA 3B4NA 3EOAA 1KSRA 5I0DA 1N5AB 5C08A 2AI0L 2X1OA 1GC1L 3VH8A 5I2IA 4LVHC 4HFUH 2E7BA 2M26A 1K8DA 5I74C 1CXFA 3U6RA 4YR6B 5CLWA 3ZE0F 1EMTH 4Z7WF 3N0PB 2JCCE 5CBAB 2I25N 3VFPB 1MFCH 1NQBA 1RJZB 3MGTA 5K9JH 3AROA 1HYSD 4JHWL 5CEZD 4JFYB 1ZXQA 3D69A 2VLKA 5E4EB 4CW1A 1DLFH 3C60A 4NBYB 1RUKL 1FP5A 5HDBE 1NSNH 3DARA 1BVLB 5BQ7A 1BQSA 4PJ5E 4TSAH 1BIIA 2GCYA 4K23H 3O6FD 1DANU 1J0KA 4V1DB 4G42B 1LK3H 4QRRE 2AVGA 5IR1B 4ZD3L 4HT1L 3H3KA 3C87A 4LOUC 3LV3A 1I8IA 1WBXA 5GJTL 3DXAE 3T09A 3R0NA 1E27A 1I85A 1R3IL 1D9KC 2Q8AH 1KFAH 2ZKHL 5TFSH 1YUHA 3BEWA 1T4KA 4LCWA 3QUXC 1HHIA 4OF6A 4Z0XA 5C7XL 4P4KA 1H5BC 4Y4KD 4HKBB 2A77L 2AS5M 2ZCKL 5FHBH 3F6IA 3H0TB 1JHKL 1J1XL 3GSQA 4YBLC 3HZVB 4JHAL 4YHYB 1DBKH 2ERJC 5HYJB 4GFTB 4UQ2B 2VSCA 1FV1B 3QCVL 5C0AA 2LTQB 3CSYA 1RULL 4BSWA 4JFOA 1T89A 3HMXH 1NCCL 3QWOA 1J1PH 1YNTA 1HCFX 5F7YC 5C0CE 4MMXC 1K4CB 4PV8B 1FC2D 2GJJA 5GGQH 1C1EH 4YUEH 3PABA 1BZQK 1LP9A 4Y1AD 1CLYL 3MLZH 4KMQA 2E3VA 1Q0YH 3BZ4A 5FDYA 3VFMB 2VE6A 4RAUA 3RVXC 1E4XI 5EU7C 3PDGA 3U9UB 2ICWA 1CF8H 1QKZL 5HYEA 4Z9KB 5EORH 1NAKH 1GZQA 2WBWB 4JGUA 4JM2C 2OZ4L 4FQXA 3RGVD 5DFVD 3DUSB 4BFEA 1KLGB 4KI5E 4KKLC 1AXTH 4K7PL 3AAZB 5C09D 3X3GL 4N1CA 5TJWK 3VE0A 1EUUA 1NCBH 4IOIB 1FYHB 3EOYG 1SQ2N 2NY5L 4YFLI 1AI1H 3WMSA 1FFNA 1MQ8A 3GSRB 1PEZA 1YMMB 2CGRL 1A7NL 2A6DA 4NBZB 5C0BE 3MLVH 1JPTH 4NM8L 1CD9B 1WC7B 2J8UF 3SCMB 3WIIH 3QUML 3QIBB 4DKEH 4UU9B 1X5LA 3H42L 5J6GB 1IM3A 5E1AB 1X6LA 1RHFA 2HTLC 2W60B 4JO4H 5GISH 4PRAB 2KZ1B 3NGBB 1LWRA 3VFNA 5HHOE 4ELKA 1FZJA 1LEKA 4G8IA 1F90H 3RUGF 1QG3A 1T5WB 5L2KA 2R0LL 4YE4H 2ICES 1CG9A 4GG6A 1EV2E 4YDVA 1SMOA 1LO2H 4LL9A 2WNGA 4QXWA 2JK5B 4N5UA 5KW9H 2CQVA 2X1QA 3RZWA 2GSGB 1RK1A 4RBPK 4BZYA 4LHJB 4TVPH 4JFED 4WJ5B 3VI3E 3HG1A 4K9EH 1G6RL 4HUKB 5BO1H 1A9BB 3PWLA 2MHAB 5EOCH 4XNUH 1FIGH 3SDCC 1KLFA 4HUWB 1FDLL 5HVHB 4YPJA 3X13A 1QRNB 1CDBA 4S10A 3C5SB 1KOAA 3PL6D 4MXQA 2HTLD 3R1GL 3FN0H 5MERA 5CFHA 3PIQB 3P4LA 1T03L 1DUYA 2MNUA 3DGCR 4JHBA 5FGCB 1INEH 3S98A 4BFBD 1RZ8A 4DAGL 3GMQB 3BPCB 3IXAA 3EZJB 2XA3A 5KVDL 4W4NA 3HR6A 3WHXB 1XIWA 1T5XA 2OMNA 3FTGA 1A6UH 2EYTA 4ZYKA 3HC3L 5INDB 5EBGA 1QSEE 2BDNH 3H7BA 4JE4B 3BQUD 3BKYL 4KJYA 5KS9A 3PHSA 1GAFH 1UEYA 3SDCD 4F80A 4EIGB 1Y6KR 2VQ1A 1TJHH 3KYMB 5EU3B 3STLA 4XPBL 1MJ8L 4UILH 1EPFA 3EJYC 4H26B 3OF6D 1IBGL 1OGAE 2VDPL 3WDJA 1G7HA 2WANA 4Y8AA 2Z0BA 4DGIH 1CIUA 2OJZL 1K6QH 1L7TL 3C5ZC 4WHCA 2Q86B 3OPZL 1K2DB 4JRXD 4XPGH 4LCCB 5ISZB 4YHPB 3MRKA 1UYWL 5CJBA 5FK9A 4LCYA 1S9XB 1WCBA 1UFUA 4ODHL 1DBJL 1Z6JT 5D1ZA 3AM8C 3PGDB 3OMZA 1A6TB 3MNWA 4LVOC 5CMAA 5D7JC 3QO1A 1NL0L 4PJBE 1RI8A 3CVHL 4XBGB 5IF0A 4EN3B 1J11A 5D70H 4Z7VE 1VFBB 3JV4B 3MYJA 4X4ME 3BPOB 3G6JF 2VABB 1D5BA 3OR6B 1FFPA 3GMOB 4YHZH 1IL1B 1KCVL 4HC1L 2VDOL 4K94H 1M7DA 2QKIA 4OCWL 4OT1L 4H1LH 4TRPH 2VH5H 1OLZA 1V3LA 2CDFB 1OF2B 2J5LC 2FBJL 2BZDA 5E2WL 3PWVA 3KXFE 1TPXB 4KMLB 4MAYB 4O2EA 1W0WA 5L0QB 4XNZB 1BMGA 3CD4A 4K7FA 4ZO8A 3EYFB 4KWUA 3BWUC 1DLHB 5MHSE 3LS5L 4JFDA 4MVBC 3T3PE 4BQCA 5DWUH 4HGMA 5IT2L 3E6FA 3SE3A 1BOGB 5T3ZH 4HDIA 2Z9TA 3WSQL 5IQ7L 3CDFA 4NKOA 3G04A 3VWKB 1Q94A 1EAPB 4UUJA 1YN7A 4Y4FD 5FDWA 2MFNA 3T0BA 1S7UA 4DEPB 5C8JB 1N0LA 4WFFE 3I6GA 3W0WB 2AK1H 3JUZA 4NZUL 5GS0D 2NY0D 4NN5C 3QHFL 4R2GB 1FNGB 4QLRA 3RVVD 5EN2B 2Y4SA 3PQYE 1ORSB 3ZYJA 1RZGB 1RIUL 4MZ3A 5FM5O 1FAIH 2XY1A 3ULUH 1KV3A 4ZUVA 1ZHNB 3JVGC 5EIIB 1Q9WA 4MNHA 4IDJH 4D3CH 4MVBD 4Y5YB 1S3KL 3LH2H 5SWSA 2HFFA 3FQWB 4F7CA 1XH3A 3IFPB 4QTIL 4LSVH 4RX4D 4JDZA 5E8DH 4J8RA 2NLJB 4GXVL 3D3VD 1DL7L 1MIEL 2DQJL 3ZHLA 4HGWA 1SJVA 3LZFH 3K2UL 3CMOH 4U1HB 4PJDB 4GW4B 1XF1A 4WI4A 5J13B 2V2WA 4X80H 5F3HB 5JW5A 1XGYL 4FTVA 1KCUH 4I2XA 3D2UB 4I48B 1QFOA 3GSVA 4PGDB 5AG9A 1LE5A 1T0PB 3NTCL 2F54D 4XVTL 2NY3C 1R3LB 1F3RB 3BSZL 5KSBF 2BY1A 4NHUE 1F13A 4FZEH 1R3HB 1A1OA 2A6IA 3DETC 2FHBA 1RIHL 1E6JL 3QEQE 3FB8A 4MJID 1FZMA 1U2HA 3FT2A 3NVQA 2NW2B 4ZAKD 4Y2DA 4TPRL 1YEHL 1GGCL 2ATKA 2ZJSL 3FFCE 3MV7D 3X14B 5B3JF 1SM3L 4MCZA 3QCUL 4K8RL 1WGOA 3TLRA 3ZTJH 1W0VB 5ESVA 1U8JA 2CJUH 4U33A 4XC1L 5I1AB 1EJOL 4GRMB 4WHYG 4J3XA 4M7LH 2FWOA 4NNPH 2AV7B 2HT2C 4JVPA 5F9WB 2PTTA 1G7PB 2Q76A 1T66D 5T1KA 1NUFA 3TBSB 3VXRE 1TQCB 4PYHA 1MQKH 1KCRL 5FV2A 2J6EH 3MRHA 5J1TC 3C60C 4PJCF 4I77H 5LGHL 2AERT 3L5XH 5DTFB 3MV8D 3UTTA 3EO1B 3ULVE 1WWAX 5A2IH 2ITDA 2X4UA 5BXFB 4P2QB 1KB5L 3IJHA 1ZEAH 2R23B 2WQRA 2XFXA 3JSSA 3RDTC 4IM8A 3BRFA 1J8HE 5D71L 3DUHA 1I85C 3MLXL 2XNAA 1QBLL 1JNJA 4R97B 1KUMA 2NY1B 2CO7B 5FECA 4NC1E 5E2TH 1X5YA 1QBBA 5F7DB 4MXVE 4GRWE 5GS2D 3NACL 3KR3H 4MJ5B 1FNLA 1G7LB 4P4KC 1PQZB 1W72L 4X83A 2APWA 3KG5A 1CLZH 3UBXB 1N3NB 3VXUB 4BZ1L 1Z9MA 5EPMB 1JZ2A 2Q6WB 3G5YA 2VLKD 4P3DA 4U1NA 1NUNB 3HLAA 4Z7OF 3C60D 4X5WB 2A9NH 1S7QA 5BZDA 5BS0A 1ROWA 4PGCB 1SMAA 2V5YA 4HK3J 4D0CA 2VDML 3BP5B 1T89C 1NGYA 1CXHA 2C1OA 4HKZB 4Y4HA 3UYPA 5JTWA 5T5NF 4CMHC 4X98A 5JW4R 3MV9A 4TUKL 3GMNA 2ENYA 3RL2A 2Z93B 4ZFOA 5LQBL 2YK1H 4PLKC 1NAMB 1BGXH 2IALB 4MHHG 2ADJB 4V3EB 2OTUA 1I9EA 4WIQA 2FSEA 2KH2B 4CUCA 5T1LB 5CEXA 4LCWD 4R7NB 1T2JA 2R4SL 2AJ3B 4YEFA 3QDAA 1S7XB 3U2SA 4FQXC 4KI5D 5IMKA 3SGKA 3ZE0E 1NC2B 3CFBA 4Z7WE 4MD0A 5TQ2L 1OM3H 4H1LA 4GOSA 2AJXH 2R29H 1IVLA 4D0BB 3NBNA 4NWUL 5EUOA 1FGNH 4X7FC 3T0EE 4HJJL 5C0AD 1N64L 5H35A 2ZWLT 3F7YB 2WWMD 1FJ1A 4P99A 3R0MA 3IDMA 1UH4A 4WW1B 2EIEA 3BWAA 1OAZH 1BVKB 2YEZB 3OKLA 4RAHA 4JM4H 3EOBB 3F5WB 4PLKD 1T1YB 4JPWH 1M1SA 5D9SA 4TTDC 3OG4B 2XPGB 4MB3A 1U3JA 2F74A 5DQJB 4U1SA 4XC3H 1CFQA 3DRQB 2BY3A 4PB9L 1DVFA 3L1OL 1FL3A 5JDSB 1F4AA 4WUUA 2GJZB 3HA0A 3ESUF 4D9RD 5JXEC 4MQXC 4BSJA 4UT6L 1TZIB 1KTDB 4HS3A 4RNRB 1I1YB 2YD2A 3QXDB 4OLUL 4QHUA 3DURB 1N2RB 3MBEC 1B4JL 3W5MA 1PZ5B 3OJVC 1YY8B 4LSRL 3FCTA 5JIKA 1X5ZA 3IAQA 1JTPA 1EFQA 3U4EA 1ZA6A 5JORA 2NY4D 2XZAH 3MROB 3PWNA 3BT2L 4LVHB 3IJYA 4ODTL 2DI8A 3ARDA 3LRSA 4P0DA 4WWKA 2KDGA 3TH2T 2AQ2A 1FFOA 2BJMH 2H26A 4MNGB 1DE4A 5D7SH 3RGHA 2HFTA 4OBRA 5ENWA 4PD4K 2IQ9H 3HZMB 4R6UA 4QKXB 2E6QA 1F3DJ 3V0VA 3VMOA 4LNRA 3O4OC 3TWCL 1CFVH 3O3BA 3RWGB 3F7RA 2F53A 2LV4A 4QRTB 1P6AB 2HT4D 3QT2A 4DGVH 4HUXB 4MNQE 5L2KD 4PUBH 1YNLH 1S8DA 2O5XL 1G9NL 2DQEL 3DV4A 4MHHI 4XMKL 4GXUM 3MJ7A 4RFEA 5F1NB 1C12A 3H9HB 3U7YL 1NANH 1YJDL 5CZVH 3WIFA 4XI5D 5T5NG 4F9LC 3WXVL 1WAAA 2FJGB 3HG1D 3QI9C 3FRUA 2H6PA 3L3IB 2VOTA 1LE9A 1LO4H 3UX9B 1HKFA 5EBWA 1D9KB 4AEHL 1JTOA 1QQDB 5I1LB 4JANA 2QQKH 1H5BB 4JPKH 4MXQD 5IG7B 2J8UE 1FH5H 4PJIB 1OTTD 2NZ9C 3LAFA 3RGVB 2E6JA 4RMTA 4YBLB 5HI4C 1JF5A 1C5DA 4HUUB 1GOGA 2ERJB 3QJHA 4LLVA 1G84A 5H2BB 2XG5A 3LEXB 3UJIL 1TDQA 5ANME 3ILQD 5F9OH 3PJSB 5FHAH 1AO7B 1BD2A 1XIWD 4LHUA 5HHQA 5F21B 1RMFH 4BELD 2J6EA 1RU9H 1KBGH 2VXUL 3RUGE 1A7BA 2OP4H 5DA4A 1AGBA 4HIIA 4I9WD 3O8XD 1WWBX 1SVZA 4P23A 3TIDB 5GRVL 3I2CL 4PJHF 4XBPA 4PJAA 2VXVL 3FAWA 1NGPH 4MYWB 1CCZA 2HFEB 3DUUB 2VRAA 2H8PB 3HKFA 3O6ML 4ODUA 4AG4H 1KB9K 4JM2B 4KV5E 3CLFH 4HZLB 5E00B 5BV7H 1C08B 2MQ3A 4X9FA 1D5IH 3DX9A 4S1QH 5IQ9A 1I1RA 2ZUXA 2FX9H 3MRQB 1X5JA 1RIVH 1KN4L 3BUYA 5JDJA 3QPQD 2SEBB 5F7HA 4ZUWA 4A6YH 3HNSL 3L5JA 3KPPB 3GSUA 4OLWH 5D1ZD 4JFEB 4JKKA 4KJWC 3SE3C 5HVWA 1I7RA 5JOPE 3TBWA 2CUMA 4XP5L 5HDQH 3FT4A 4MZ2A 5DRXB 5FUCE 4UOJA 3RFZC 5FXCH 3DBXB 1JWMB 4WFFD 3RI5F 3RPIA 1FIEA 1AGFA 5DJ6B 1QLFA 4TUJB 2DD8H 1O7VA 3WN5B 1UCBL 4QXTB 4CU8A 2Q1EA 1IGYA 5H94B 4L3CA 5GRVK 1RZFL 4O9HH 2W9EH 5HI3D 1ORQB 4ORGA 1ZAGA 4U1MA 3BZFA 5A16A 4JKMA 4ZOEA 3Q6FB 5GSRB 1NKOA 4LSQL 3B9AA 5E8NB 1QEWB 4JFDD 4XPAH 1D5ZA 5TF1H 1VGEL 1KPRA 2XRAL 3FRPA 1FVEB 2UWEF 4QRQB 3O3DB 4OQTA 1A7OL 1CGVA 1JGDB 3VFGL 4GKSA 5I9QC 1MUJA 2VXTH 1JPFA 1CWVA 3OGOE 4PTUB 3SDCB 2A9MH 5D1QC 1HHKB 1PY9A 4JO2L 1ZHLA 3W2DH 1KJ2A 2NY6C 5FOBB 4TULL 3GM8A 2DLIA 4LEXL 1L6ZA 3QDJE 2D7PA 2HVKB 1S7SA 3P4NB 4LLUA 5J3HC 2W38A 5EU6E 3SO5A 2NW3A 4GQPH 3S5LG 2NYYD 5GGSB 3TYGH 3CMGA 4U1JB 3T1WA 3TCLA 1A6VH 2DQFA 5EZJA 4OCNC 4HH9A 5ALCH 5IW6A 1RUPL 3CFEB 2AI0H 1TZGL 2EZ0D 2X09A 5FA4A 1GC1H 3MTRA 1R24A 5D7KE 5CJ5A 4XCNA 5LXGH 3MA7A 3EJJX 3MLSL 2EIZA 4WU7A 3FQTB 1QRKA 5JLZB 4X6EA 1MCHA 2R0ZL 3K8KA 5C6TL 5DRWA 3IKCB 4Y2DC 1QSFB 5ADPL 3GNML 4I18C 4ZFFB 4K2UH 1XAUA 4EVNA 4EKXA 4F3FA 1GGIH 1QO3A 3TO4C 1LO5A 1WZ1H 4QRSB 1N0XL 4FTVD 2DDQL 2AEPL 4K9EC 1WIUA 1CFSB 2XXMB 3DX7A 3BN3B 1G7MA 3TNMA 2I9TA 5CGYC 1RUKH 2G9HB 3QISA 3D0LA 2H2PC 2CRMA 5IHLB 4ODVL 5C07B 2DMKA 1MCPH 3P0VL 5CCKH 4NN7C 1MLBB 4MSWB 4GKZA 5JPNB 5DO2D 1A14L 2V17L 5IVXA 3R8BB 3T0WA 4WTZA 2PXYA 4LVOB 5D7JB 3ULVD 3CH8A 4U6VH 5MEPB 3WDIA 4KC3B 1R3IH 4LPVA 3SJVB 4FXKB 1EHAA 4H0IA 5E94B 1I7TA 4NFCA 2OX5A 3STZA 2HJLA 4WWID 3WFBH 5C7XH 4F33B 2GITB 2L4OA 5K33A 3QFJB 3F58H 4TVPD 3V79C 4GSDL 3C9NB 2ZPKH 2AV1B 2ZCKH 4JFHD 4KY1H 5EO0A 1JHKH 1J1XH 1IAII 1ADQA 2FEDC 5AWNH 2NY0B 3WEXB 1JIBA 4JHAH 4G6FD 3SDDA 2LAGB 4QY8A 3UTQB 5AD0B 2AQ1A 1A5FL 1LD9A 2VLMD 4I5BA 5E4IA 5EH1A 5GGTH 1CDHA 4IS6B 3TVMD 4QWWC 3B6SB 4Y8DC 3LHPL 4EI6A 1XCTB 2VUYA 2IAMC 4ERSH 4DFHA 4P46D 4ISVB 4Q0XH 4GUPB 5CKGA 4OZFH 5D2NE 5DZLA 5EBMA 1HHHB 3EYOA 4G7YL 3D3VB 1UWGL 1U92A 5KSBE 2F5BL 2V5RA 4Q9RL 4C56B 4Y4HC 3WUWA 4U0RC 2GAZA 3K2MC 4HLZG 5DJ0B 5IFAH 5FUOH 3OJ2C 1N7MH 2DMCA 5HGAB 4LRNL 4CVUA 2FR4B 2OZ4H 4MQTB 1CU4H 3WS6A 4RBPH 3R06B 4NFDA 5EO9B 4AT6B 3OJDB 2DWDB 3SGEI 2F54B 3X3GH 5B3JE 4H88H 3C6LC 2AJVL 4LPUA 1RK0B 3QRFM 5IMOB 4QRUA 2CD0A 3ZL4L 1IILE 4ODWB 4K94C 3SGKC 5IB5A 2LQRA 4DKFL 1ZTXH 2CGRH 5GXBB 1OAKH 5DDHB 3BFOA 5BS0D 5JHLH 3QUMH 4XMLL 1FVDB 2DM2A 3ME0A 1V05A 4LDOB 4N0FB 5I16B 3H42H 1G0YR 3QUZA 3MV7B 1EGJL 1JWSB 1VSCA 1BX2A 4A6YA 5E9DE 4OZ4B 4CL7A 2LFGA 1T04A 3QXVA 3L5HA 3MV9D 3CZJA 5EA0L 1ZA3B 3PWUB 1MI5E 2VO5A 2V9TA 2VDNL 1OAUH 1MHPL 4L3AA 5EU5A 3U46B 4UQ3B 4GLRH 5GSVA 2NY3B 3HUJA 1DVFC 1NGXA 2D4DA 2R0LH 3ARFA 2MCPL 2R39A 2LVEA 1RQ5A 4PRDA 5GRYA 4KZDL 5AZEL 3JWOL 4KDWA 2Y06L 3V5HA 1S9KC 4CN4A 1G6RH 3MV8B 3LS4H 4W4OA 2UYLB 4XVSL 5DEGB 3W9EB 3ULUC 2AABL 3EOAB 5D5MA 1HHJB 5C08B 1FPTL 3GJEA 4JRYA 3VH8B 4S0TD 4J1UA 4Z7OE 3G9AB 2DTML 5EO1A 5MENE 5DUML 1K8DB 3U6RB 1YPZA 5F72S 1T03H 5EZLA 4TTGA 4D0DA 1PKQE 2ZOLA 4MD5B 3FZUC 1XR8A 2L7UA 4DAGH 4LFHD 4EDWL 1DVFD 3MGTB 4S2SA 5KVDH 3AREA 3EDDA 2ZZUT 2ITCA 3HC3H 4FFYL 3D69B 4UNVA 4AIZB 2VLKB 7FABH 4CW1B 3C60B 1GYAA 1CXIA 1JRHI 4PRHA 5KSVA 2OXHA 4DVBA 5BQ7B 1T2QH 3CPLA 5ADOL 1FO0H 3BKYH 5C0JA 4JB9L 1OWRM 3INUH 1BIIB 3MXVL 3MLUH 4XP9L 2FO1A 2GCYB 3QH3A 5BJTA 4IMKC 1KCKA 4XPBH 1C5BL 2C3XA 1JGVL 4JQIL 2CKBH 2FEEL 3RDTB 3ARDD 3LV3B 3MBXL 5BVJA 1I8IB 1IBGH 1WBXB 4WWKD 3BN9D 3P77A 2JJWA 2VDPH 1E27B 1QVOB 2X4OA 3EGSA 1YUHB 3BEWB 1T4KB 4LCWB 1HHIB 4Z0XB 4R9HA 1IAIL 4P4KB 1S7TA 1X4XA 4G5ZL 4O51A 4MDIA 5I19H 3HMWL 4G9FA 2DQDL 4JG1L 3L7FA 4TNWF 1Z5LA 3BPNC 3TA3A 2OL3H 2F53D 3DX6A 2ICEB 3B2VL 5C0AB 1IGCL 3CSYB 5L2JA 4BSWB 4JFOB 1ZLUK 1MCKA 5T3XL 1OLLA 3QWOB 2G5RA 5F6HI 1YNTB 4CMHB 4KKNA 3WXWL 2P8PA 3O4LA 5FYLE 3STBA 3SGDI 2APXA 4ZO9A 5J9PB 2D7OA 2AEQL 4OCWH 4OT1H 1E4XH 3P2TA 1WT5C 2HKHL 1LP9B 2G75A 1IQWL 4BSVA 3BZ4B 2FBJH 2P43B 3P4OA 4J6RL 5FKAB 4HS8L 4OV6F 2ENSA 4H20H 4Y5VA 3TJEH 1P4IH 5IEKA 1C7SA 4ONHB 2ICWB 5C0BA 4F37F 5B8CA 1H3PL 4APQA 4CBPA 3TPUE 5IFHL 4FQXB 3VXQA 5E5UB 2C9AA 3MRNB 1IT9L 5IT2H 3UXFA 3VE0B 5T1DH 3VU2A 1UXWA 1Z3GH 1BD2D 2OLDA 4G6JL 1FFNB 2L7JA 4GS7C 4FXLA 2A6DB 1A64A 2DIAA 3V6ZA 5JOPD 3FT3A 3OKDA 1YQ2A 3QIWC 4JN1H 2AJUL 4DKDC 1ETZA 1ZT4A 3VRIA 2X70A 1G7IA 5JOFB 3MLWL 2VDQH 4P23D 5HYQA 2E9IA 3QHFH 5JXAL 3OBAA 4GQ9L 4LLYA 1IM3B 5DSCA 4XPHH 1MCIA 4O2CA 4BQ6A 2ZUYA 4KK8D 5HI5D 3BE1L 5FGBA 1Q9OB 3S34L 4OCXL 2DN7A 1MFEL 4OGAC 2OZ4A 3EOTL 1FFRA 1S3KH 1N4XL 5CJXC 5E8OA 4ELKB 3VFNB 25C8L 1FZJB 3MBEB 1LEKB 4G8IB 1R3KA 5INCA 1UM6L 2OXGA 4PJ9A 3EKCA 5L2KB 4JZJA 4GXVH 4X6CA 1CG9B 3DGGB 1EEQA 2DM7A 3QA3A 4GG6B 1MIEH 4YDVB 4L8CB 2DQJH 3K2UH 1PLGL 4MLIA 1YY9C 4KK9D 1U3HC 1HKLH 1RK1B 4EI5A 1A6WL 5C2BL 3ARZA 3HG1B 1JZ7A 1IGJA 1R0AL 2DYPA 3MSPA 3BIBX 3PWLB 3B9VA 3QUMA 1D7FA 4N8VA 3NTCH 1BREA 1U8NA 3LIZL 3BGAA 2IBBA 3X13B 1T6VN 4RSVA 4R4BA 2WIMA 3VGHA 1I7UA 4Q6YA 4OD1H 5MERB 3ARGC 2JJUA 4O58L 4F7PA 5KTEL 3O4OB 3LKNA 1DUYB 2QLVB 2MTPA 4PJHE 4RZCA 4M5ZL 1RIHH 1E6JH 4GRWH 4ESKA 1HK6A 1KF9B 1IM9D 4ZSOE 1WFUA 3T65B 2WIIA 1A7RL 1XIWB 3CX5K 3PG2A 3V5KA 3FTGB 2EYTB 1JRHL 1OGAA 1YEHH 4YHOH 4ZYKB 1ZHKA 1YY9D 2ZJSH 3G08A 2OBGA 1B3JA 2F5AH 3WIHL 3H7BB 5J89A 1MFDL 1G6RA 5FYJE 1L9NA 2NQCA 1NBQA 5KS9B 3CX2A 4G9DA 1UWXK 3H9YA 2EE3A 3CH1B 5AZ2L 2VQ1B 1FL5A 5DMJB 3MLRL 5BW7A 1KCSL 1MVUA 2OI9A 3HCVA 3BX7C 3U83A 5JZ7C 2LU3A 5C0IA 5E8EA 3VMNA 1AHWA 3ALXA 1G7HB 1T1ZA 1RJLA 2IADA 5LGHH 5E24E 1KLUA 4MA8L 3C8KA 1ES0A 5CINL 2Z4QA 4M62L 1UXSA 4RRPA 5FK9B 4LCYB 1WCBB 1KB5H 4Q6IA 2R4RH 4AK1A 1X5FA 3LVEA 3U1SL 3MCLL 1URLA 1WF5A 3MNWB 3W11D 5CMAB 5JO5A 3QO1B 3GBLA 5IF0B 3MLXH 2W0FA 1QBLH 4JDTH 4KDVA 2I07A 4FHBD 4UIMB 3WKML 3MYJB 1CFBA 5GIRA 2Y36H 4M6OH 2MCG1 1D5BB 1FFPB 2UWEE 2BSED 2R2BA 4BZ1H 2OK0L 1M7DB 2QKIB 5JNYA 3VD7A 5F3BA 1K8IB 2Y7QA 3SDDC 4KDTA 4P3WA 3CK0L 4M9PA 4OSUL 2XQYK 4O2EB 4OF8A 4NOBA 2VDMH 4K7FB 1G7QA 3O2DL 4OGXH 2LU7A 1T0MA 3V8OA 2EDYA 5E6IA 5JMOC 3SGJC 1VESA 2BC4A 2OL3A 3E6FB 3MRMA 1A9EB 3NZHL 4KRPD 4FMKA 4HDIB 2PXYD 2Z91A 3FO9A 3EYQD 4NKOB 3G04B 3TBVA 1Q94B 2HTKC 3PGCB 4YXKL 3BD3A 4C83A 4UUJB 1S9VA 1YN7B 3KPNA 2PTVA 1QHOA 2BNUA 5FDWB 4WENB 4XNMA 1S7UB 1HN1A 3C09B 1U0QA 3IU3A 1CBVH 3UC0H 4HC1A 3M1BA 4WHDA 4YHNA 2FO4A 4O02L 1KYOK 4NWUH 4E41E 3L9RA 4AEIL 3WCYA 3KPSE 4HJJH 3ZYIA 1N64H 1MREH 1TVHA 1ZANL 5ALBL 3NCYP 4XXDB 1BWWA 4ZUVB 4PJEA 4NBXB 4YDLC 4QYOA 3MPCA 1Q9WB 1AD0A 4MNHB 5F9JA 2P5EE 4YDKH 1RFDL 3MRBA 5SWSB 4N0CA 4PFEA 5BV7C 4Y7MA 2Z31C 3EZ8A 4UINH 2HFFB 1MIMH 1YEDA 3V6BR 5JQ6L 4YH6A 1XH3B 4F7CB 4JDZB 2ZSWA 2BRQA 5I9QB 2HAZA 1ULVA 1CQKA 2DB8A 1BIHA 4M8VA 2E7LE 3QUZC 1G1YA 2D03H 3NFSL 2V2WB 4EBQL 1JE6A 3VFRA 3PHOA 3UZVB 2NY6B 4R26H 4FTVB 1BBDL 4Q9CA 5I1CH 4I2XB 1YC8A 3GSVB 3RIAK 4OLUH 1LE5B 4GAGL 3S4SA 9CGTA 4KUZL 1B4JH 5CP7A 5KVMC 2B5IB 2J1KA 3L3JB 4DGYH 3MACL 4LSRH 4KVCH 4RGND 2ZCLH 1G6VK 1WCQA 1UCTA 3UTPD 4B41A 3FB7A 4R4FH 4DW2L 1CZ8H 4H25B 1OT2A 3RX5A 1A1OB 2A6IB 4U6TA 2VLJE 4HBQA 4L4TD 3FB8B 1FZMB 1PG7L 3FT2B 1XGQA 2CR6A 4W4OC 1TZHA 3VXRA 3QBTB 3QZWA 4Y2DB 2V2TA 1J18A 2I26N 1MRFL 4I18B 3HN3A 4KK5D 3QUZD 1UH2A 2YPVH 5MEND 4MCZB 3TO4B 5ESVB 3TWCH 3Q5OA 3IDXL 4G6FB 4XPTH 2YUZA 4PRIE 4E5XA 2Q87A 2FWOB 1SJEB 2Q3ZA 2PTTB 4JZNA 2Q76B 3ARFD 3KPRE 5T1KB 3L3HA 3GBMH 2DQEH 3OGCA 1V7NL 2GTWA 4XMKH 5IWLA 4ZO7A 5BRZE 1J8HA 2EDQA 3I75A 4NN7B 4QRPA 5BZWB 3MRHB 3WXVH 1P4BL 4JO3L 4M02A 3K4ZA 1T7ZA 3UTTB 2R2EA 2CO6B 1MRDL 2ARJA 2ITDB 4PP1C 2X4UB 4AEHH 3FQNA 4EUPH 1R3JA 3QXTA 2NXZC 2D4FA 5I17A 1J5OL 3HC0A 4JRYD 1GC1C 2C4FT 3IJHB 4P5MA 1R5WA 2XFXB 4OLZH 5IHUL 2IH3A 2FX8L 1RUML 5K9KA 3S96A 5I8OH 2IANE 3MLPA 5FECB 4OZHE 1YEKL 3M8OH 5GZNC 4MD4A 1GHFH 1TVDA 4JFZL 1WFOA 1GIGL 3WL9A 2WWKT 5IUSA 4NO5A 3WO4C 4WFHE 2XOTA 3ARED 3IF1A 2KKQA 5DI8A 5HHME 3T2QA 4P3DB 4U1NB 4QHMA 3HLAB 3RIFF 2IH1A 1I1CA 3D39A 3V52L 1S7QB 1HNFA 4P2RA 3TV3H 5BZDB 2O61A 3NN8A 5BS0B 4LQFL 4RISL 1U9KA 4KKAC 5GS1C 3TIEA 3S3JA 4D0CB 1NGYB 2C1OB 4Y4HB 2XWBA 4PP1D 4U0RB 4JFPA 2EKSA 2NXZD 1KB5A 4X98B 1W8NA 4LMQI 3MV9B 2VLRE 3GMNB 4OD3H 3Q5YA 3RL2B 1MEXH 3O6MH 5GRJL 3GGWB 4NSKB 4X7TA 2QQLL 4ZFOB 4JGMA 1WK0A 1U41A 2OTUB 3ILPA 3MLTA 1QBAA 4FQJH 3QDME 1ZT7A 5FM5M 1XF4A 3VD3A 4Y16A 5CEXB 1HOCA 4Y5VC 4PP8C 2E8YA 5B8CC 3VFWA 4OF5A 1W72A 1B2WH 2HLAA 4NKDA 3U2SB 3SE8L 5IMKB 4N1EA 4RGMC 4G9FD 3CFBB 5C9KA 4MD0B 4H1LB 1KEGH 4JY5L 3TA3D 3TN0D 5EUOB 1EK3A 2AXFB 4WW2A 5TE6L 5DGRA 5IIEA 5L9DL 3MQIA 3I50L 2P44B 4HWNA 5CUSL 5H35B 3VDAA 2IFFH 1FJ1B 1Z9OA 3DX8A 3IDMB 4G3YL 5F89A 4GW1A 5J8OA 2Q7YA 1PW3A 2E7HA 3BWAB 3O4LD 4ZDHA 1T83A 4OLYL 4L5FH 5GHWL 3V6OA 1OAQL 1AKJA 2D9CA 3NAAL 1CDJA 1U8IA 1UCBH 3SDXF 5D9SB 4PG2A 1B88A 1RZFH 1JV5A 2F74B 4U1SB 4MMZC 1DVFB 3H2WA 1G9MC 4M93C 5CJ8A 2BNQA 2Z8RA 5FGBC 4WUUB 3WFCL 4APQD 2Y23A 5HGDA 1QACA 5HHVH 4HS3B 1HQRA 4PJ8C 1MFAL 1B0GA 1KXTB 4QHUB 4NZRL 1CGUA 2XRAH 4LSDA 5CJOH 3FO0L 4PJ9C 3H9SE 1OB1A 4NNXA 4JZJC 3FCTB 4TNVF 3VGBA 3U4EB 3K1DA 4JDVA 1ZA6B 5JORB 3U48A 5CBEB 1E4WH 1XF5A 3PWNB 1UKSA 4PIRF 1ITBB 4KTDH 2VN7A 4JO2H 3IJYB 5SV3A 5B39A 1U8MB 4TULH 2ADFL 1LO3L 2WBKA 3ARDB 2YWYA 3LRSB 2D31A 4FRWA 4OCSH 5KSAA 4WWKB 1VACA 1FFOB 5D4QA 2H26B 3PP4H 2QADC 1NLBL 3N1FC 1A47A 1DE4B 4Y19E 1OQXA 1NMBH 2DQCL 5ENWB 2X9XA 5FYKL 2EE9A 5T5FH 4JFYA 1F2XK 4LNRB 1TZGH 4HF5L 1A0QL 3O3BB 4NQCE 1Q1JL 4G8GE 2F53B 2G60L 1I3RA 4NC0B 4Z8FL 2PYEE 1S8DB 1J05B 3B3IA 1F3JB 4ODSL 3DV4B 3GNMH 4RFEB 1K3IA 2NXYD 4QXUL 3PWPE 1C12B 1BQLL 3WIFB 4EI5D 3T0AA 2ZNXA 3FRUB 2H6PB 4XT1C 5I30H 2DYPD 1LE9B 4ONFL 3VXMA 4QOKA 4NWTL 4LAJH 2QADD 4OI8A 5CZXC 4P2OA 3F7PC 1J0YA 4JANB 4TSCH 4M9OA 5FA3A 1CXEA 4ZXBA 4GAFB 1NLDL 2OI9C 3NA9L 3ORJA 5I1IH 4Z0BL 5I1GL 1GCFA 4PJFA 3P0VH 3V95A 4LLQB 4GBXC 4DUVA 3S37X 1AHWC 2EH7L 1C5DB 3BPNB 4YDJA 1A14H 3QJHB 4LLVB 1VEMA 5HYJA 4OQ1A 3BVNA 2NY2C 4UQ2A 2EEBA 4NKQB 2YPLD 3MC0A 2UVEA 3S3PA 3HZYA 5F9AC 5HHQB 4LHUB 5IVOA 3Q6GL 2C3WA 1EERB 4P9ML 5TGBB 4MB5A 4NZTL 4L1DA 4V1DE 3X12B 4AIOA 3BOVA 1MFBL 3P9WB 1PVHA 1AGBB 4HIIB 3LPFA 4P23B 3GSNL 1PJ9A 3TCXA 3OAUH 4XBPB 4W6YB 1HIML 4PJAB 5CZXD 2CDEA 5C3LD 5LKNA 4EUPA 3BDYH 5DJCB 3UJTL 1IGIL 3HFML 4ODUB 4B0MM 4QHLA 5GGRY 4HCRL 5KANG 4LPWA 4CNIA 1TJIL 1IGML 3WFEL 4KDTC 4U7MA 5K93A 4LARL 4M8QA 4X9GA 3B5GA 3DX9B 4WI3A 1UWGH 3SKMA 3BUYB 3RWEA 2D3VA 3O2WH 1P6FA 4Q9RH 3ARUA 4ZUWB 4IJ3C 1Y0LA 3QSKB 3GSUB 3EJZD 3AFLA 4GS7B 1JPSL 3WLWC 1YMMA 1I7RB 2IFGA 3NH7H 3TBWB 1ZGLA 3RY5A 3FT4B 4QGYA 3B9EA 4NUGH 3SDAA 3ZMRA 4UU9A 5F6IC 2R69L 3KLAA 2XTLA 3UBXG 2Y5TA 2L0DA 3RPIB 1AGFB 1GJIA 1QLFB 3EUUA 1J87A 5JW4Q 5K9OA 1YEGH 4U6XA 4DKFH 2BX5A 1IGYB 3UYRL 4L3CB 2F8VA 1KIPA 3LKQB 4ORGB 3I6KB 1QLRA 4U1MB 2P4AB 1U8PA 3GMPA 1CFNA 5KOMC 2EDTA 3QDJA 3WLBA 1D5ZB 2HRLA 5E6ID 1KPRB 4XNXH 1A4KA 5EA0H 2VDLL 3L6FA 1X5GA 4GKSB 4Y5XA 4NJAL 1MUJB 1OVZA 1MHCA 1JPFB 1FLRL 3UZEA 2MHAA 4PJIF 4Z6AT 1L6XA 2HJKA 5KG9A 3RBGA 1ZHLB 4DZ8B 5F88A 1KJ2B 2MCPH 3C5SA 2XV6B 4HFUL 4HAFA 2P8LA 3ABZA 4KZDH 5AZEH 1S7SB 1EMTL 4LLUB 5CIPH 2Y06H 3DV6A 2YS4A 1XGPA 3RHWF 2EKJA 1MFCL 2X4PA 5I1HH 1FGVH 3IJSA 3TCLB 4XVSH 5EZJB 5IW6B 2AABH 4HH9B 1FPTH 5C0EA 2Y6SD 3QIUC 3S35X 4N0CD 1I1AD 2EDDA 1R24B 2YR3A 1SY6H 4XCNB 2DTMH 2VWEC 3MA7B 5DUMH 4LCUA 1CI5A 2EIZB 4WU7B 5DURB 1JPST 2A6KA 4X6EB 3GJFK 4K3DH 5DRWB 1QYGL 4L9LA 4JM2F 4K23L 1KULA 5FYLH 3LB6C 5CGTA 4PGEA 4EVNB 4F3FB 2F19L 1QO3B 3P73A 3I9GL 1LO5B 4HUMB 5IBLD 4OCRH 3L95A 1QRNE 5AYUH 5F96L 1OGTB 4FFYH 3BH9A 4PRID 1ZVSA 2GK0A 5D2LA 2HP4A 4PR5A 3TNMB 3DX7B 1G7MB 2Q8AL 2A0LD 4X6DE 1KFAL 2I9TB 4NO3A 3D0LB 5TFSL 1CT8A 5FGCE 3MYZA 3QDGE 4JB9H 5HJ3A 1MHEA 3IDJB 4LCCA 4WU5B 4NIKB 1S9XA 4TQEH 4JFFA 4GKZB 4NC1C 3QWRA 3FAXA 1DBKL 1C5BH 3FB6A 4C59B 5IVXB 1SVCP 1JGVH 1PX3A 4AM0A 1MRCL 2C4FU 2GJ6A 4L3EB 1ZWIA 3A6BH 4ZPVA 3HMXL 1J1PL 1CICC 1I7TB 3LB6D 3HNTH 3VFSA 3STZB 2HJLB 2R1XA 1IAIH 2VABA 3IXTA 3OR6A 4O00A 1J0IA 4OZGB 1IL1A 1C1EL 3S36X 3WYRA 5DJ8A 3HMWH 1P53A 2DQDH 3DMMA 5EO0B 4XCYA 4X7SH 3T2NH 3SDDB 4EJ1C 4QY8B 2J88L 1LD9B 1BFSA 1Q0YL 2CDFA 5D1XC 1IGCH 2R9HD 4ALAH 4I5BB 1G7JB 4YNYA 3BRDA 2IEPA 5T3XH 1CF8L 4EI6B 1IC4H 3V4PL 3FL7A 5FGRA 4LKXA 1NAKL 5IP4A 3EIFA 5ISZE 4QRPD 5HGHA 3X11B 4CVXA 2YC1A 5E2UL 7CGTA 5JIHA 1IC5H 4LVEA 2AEQH 3E8UL 3EYOB 3LPWA 3VD9A 1U92B 3GIVB 3VA2C 4LGRB 3WUWB 1EAPA 1IQWH 2AQ3A 3UO1H 2GAZB 4J6RH 1AI1L 4P57A 3OKOB 4D9QE 2WBJA 3SGEH 5C8JA 4K8RD 3T0VA 4CMMB 5IFHH 1JPTL 3J7HA 4MJ4A 1F8TL 2ORBL 1IT9H 3QB7C 4DKEL 1QLEL 4QEGA 4Y16C 4HIJA 2XTJE 3NCCB 2FD6H 2QHRL 5FUZH 4QRUB 1INDH 1LDPH 4G6JH 5IB5B 1YEEH 3PDOA 5BV7B 5TDOB 5ELIA 4Q58C 1GGBH 4P2RD 2H1PH 3T0DA 1F90L 4KGJA 4HW6A 4YE4L 3VG0H 1AXSA 2XA8H 12E8H 1N26A 5A3ID 1LO2L 1TTUA 4NRZA 3QUZB 5D7IA 4A6YB 1BX2B 4PJDA 5KW9L 1T04B 2LU4A 4GMSL 3V6OC 4J2XA 2VXQL 3S34H 3QO0A 5CSBA 2GSIA 4OGYL 1OSZA 4K9EL 3F12B 3EOTH 3ZKXC 1OW0A 1N4XH 1HXMA 3W0WE 4XNUL 1GH7A 4PG2C 5FM4A 1FIGL 3V7AG 5GSVB 1DQJA 4Y16D 4MLSA 1NGXB 1IARB 3ARFB 1R3LA 1UWXH 1TFHA 5B22A 3V4UL 3IU4H 3O0RL 2FYYA 4FN0A 3FN0L 4PRDB 3HRZA 5ID1A 4IEFB 2CLRB 3H9SD 4QF1A 2YA1A 3O6KL 1S7VB 1Z2KA 2D7TH 2WUBL 3IVKB 1MAMH 1R0AH 3UJJL 3ZSSA 4WV1A 1BFOA 1H3VA 2HMIC 5D5MB 5E6YA 3RVUD 3GJEB 1EGJA 2X1PA 3RWFA 4J1UB 5C1MB 1PD6A 5EO1B 3A0OA 4NN6C 1YPZB 5KJRL 1BEYH 2OR7A 5EZLB 1CXKA 4D0DB 4M5ZH 4GRMA 2ZOLB 5DD0H 1XR8B 1GAFL 2AV7A 1RUQH 4S2SB 1TJHL 2BNQD 1SJXA 2NR6C 4UILL 2ITCB 1JRHH 3IRZA 1QFHA 2YHGA 5GPRA 3T4YA 1Z9LA 3RWIA 4IIQA 5CIPA 4PRHB 5KSVB 2PYED 5DHXB 4DVBB 1KIQA 1MFDH 5C0JB 3EO1A 5MI0C 1IGTA 3O3UN 3PUCA 3QH3B 5BJTB 3JUYA 3F7QA 2NXZB 4P2QA 2YD5A 3MRGA 3N1PC 4PRBB 4KJQD 5BVJB 2PR4H 5KSAD 4KK6C 1AH1A 2X4OB 3HI1A 5C0CB 1QR4A 3EGSB 3MX0A 4P2OC 2DQGH 3OAYK 5F7DA 3DVGA 2HH0L 5CAYB 1VDGA 3OKMB 4JY4A 4M62H 1MF2L 4ZXBC 4NKIH 4MJ5A 1S7TB 1PQZA 3WO4B 4UOW0 3ARBC 4O51B 4MDIB 4K94L 4Q2ZA 3VXUA 1I75A 3GIZL 4G9FB 1P1ZA 2W9LA 3L7FB 3QQ3A 3SDXE 5I73C 1Z5LB 3TA3B 2VH5L 3DX6B 2HA1A 3UZQA 3A67L 5DK2A 3DYMA 3SGDH 3OKYA 1QOKA 3LKRA 3KHOA 4FFVD 3B9KA 3WKMH 2F58L 2P8PB 5E1HB 4L8DA 4C58B 5EBLA 1QA9A 3OV6A 3TF7A 2OR9H 5DWUL 5C0FA 4KFZC 4WY7H 5T3ZL 4I0KA 5MEOA 1SYVA 3VXMD 1FNAA 4MDJA 2G75B 3VD5A 4BSVB 4P2YA 5ABDE 4Y5VB 4PRPA 5IEKB 1NBYA 5B8CB 5C0BB 3O2DH 5J11B 3VXQB 4RGMB 2WM0A 1WTLA 2MPAH 5E03A 4XAWL 4NT6B 5HYJD 2FX7L 4RMRA 4BFIA 3F7YA 4N0UE 3HE6A 1FAIL 3ULUL 3UPCA 1UXWB 2RBLA 5DR5L 3RL1A 2C4XA 4R0LA 4WW1A 1OAXH 5KN5A 4D3CL 3REWB 1S5IL 3LH2L 3V6ZB 2YEZA 2IPUG 3FT3B 3OKDB 2FECI 3BXNA 4XVJH 4PLNC 1M7IA 1ETZB 2N7AA 4LSVL 1ZT4B 5E8DL 3RTQA 1G7IB 1OPGL 4YX2L 5HYQB 4UAOC 3SDAC 2JLLA 4LLYB 5A40E 5DSCB 3LZFL 4FNLH 2YXFA 2BVPA 4LPYA 4O2CB 2EICA 4L1HA 5ICYA 3OXRA 3DRQA 1ZANH 5ALBH 4X80L 1FAKT 2Q3AA 1CFTA 1KCUL 3T04D 1RFDH 2B1AL 4X7DC 5E8OB 1TZIA 1I1YA 3RWJA 5T1MB 1AIFA 3P0YH 2PETA 4NNYA 5INCB 5AEAA 4PJ9B 4AMKH 1QHPA 1KGCE 4JZJB 4X6CB 3QA3B 3PV7A 4U1GB 2NXYB 5DF0A 1SBSL 4FZEL 3LDBB 3MROA 4EBQH 3WE6A 1YMMD 3B8YA 4F7EB 1IGJB 4Y5XC 2DYPB 5DQDH 3SCMD 5F1IA 3QUMB 3UDWA 4N8VB 4TOYH 2QADB 3SDAD 3DVNA 1U8NB 2VMFA 3MFGB 2OR8A 3LPGA 1IC7H 2DMBA 4R4BB 1REIA 3HZMA 1H9VA 4PY8J 4F7PB 2WSKA 3LKNB 5CEZE 5AUMA 1DQDH 1CE1H 3NOIA 4PS4H 4L8SA 4RZCB 3VMPA 4M7LL 3FB5B 3ARVA 4KH2A 4NNPL 2R1WA 2WIIB 3MNVA 5GS3A 3V5KB 3UTZA 1S5HA 4RWHA 3QR2A 1OGAB 3HNVL 5DRNA 1MQKL 1ZHKB 3G08B 2QTEA 1UACL 3H9HA 3QDHA 1LP9F 1MHHA 1OY3B 1OT1A 4I77L 1IAOB 4DN4H 1G6RB 3ROLB 4GW5A 1CR9L 4G9DB 3TFKA 4ZUSA 4L9LC 4M6AA 1D9KA 1OSPH 2DWEB 1QQDA 1FL5B 2W07A 3QUXA 1CE6A 4HHAA 4MNGE 1I1FA 1MVUB 2OI9B 5E8PA 3HCVB 1F02I 5FCSH 2HG5A 3G6DH 4GBXB 5C0IB 1OQOA 1AHWB 1K85A 4MS8A 1M05A 3CVIL 1T1ZB 1RJLB 2IADB 2NY2B 3E1F1 2J7LA 4JO3H 1KLUB 3C8KB 4ZFGH 4X5XA 1W0YT 2Z4QB 3KR3L 1P4LA 2N4IA 3VH8G 5H37G 1AO7A 3ESVF 1CLZL 3VJ6A 3BRGC 4Q6IB 1J5OH 1IEHA 3NCFB 3V6FA 3KHQA 3I85A 2BCKB 5IW3A 5IHUH 5JO5B 3WIHA 2FX8H 2W0FB 4RDQG 3TIDA 4XP6L 1YEKH 2I07B 4IOFD 4JREB 1VPOH 4WFGD 3JTCA 5GIRB 2V5SA 4JFZH 3VGEA 1NGZB 2HFEA 1GIGH 3DUUA 4XCEA 5HTSA 2D9QB 5GGVY 2EDWA 3Q0HA 2CKBB 5CWSA 3DMMC 3ZDYF 4L4JA 2YK1L 4HZLA 5JNYB 4GG6F 1BGXL 1H3TA 5F3BB 2ATPA 2Y7QB 4PV9A 3GMMA 4PJIE 1ITCA 1S78C 3JV6B 1DBMH 3V52H 4RA3A 3IAGC 5I6XB 5C09E 3VD4A 2HN7A 5C0ND 4M7LT 3MRQA 1G7QB 3HAEH 5ISZD 1T0MB 5HYSA 4IJ3B 2IPTL 3Q5TA 1MAKA 3HPJA 3DI2B 1OM3L 2AJXL 2BC4B 2R29L 2OL3B 3MRMB 4KHTL 1CDGA 1FGNL 3ARWA 2Z91B 5K9QG 1D6EA 4ZNEE 3FO9B 5IM7A 1KIUA 2GJ6D 3W82A 4EN3D 1S9VB 3KPNB 5F6IB 2XY2A 2DM3A 4XNMB 1BJMA 3TBTA 2R56H 2WBJC 5DJ6A 4XGZA 5EU7E 4JFQA 4FFWC 5JPMA 3M1BB 1AR1C 3DMMD 4F58H 3LKSA 1F58L 4YHNB 2FO4B 2BK8A 4JPWL 4M1CD 1A2YA 4X4ZA 4AEFA 3L9RB 5L9DH 4U1IA 3I50H 4XC3L 5CUSH 4MAYD 1TVHB 2YPKA 3VGFA 3EDEA 4G3YH 4HIHA 4QYOB 4HWEH 1AD0B 3EFDL 3O2DA 5F9JB 3V7AE 5KS9F 4IRJC 5GHWH 4YXLL 1OAQH 2ZSWB 3NAAH 4QRQA 4O5LL 1JGDA 4JFEE 5ACMA 4GAYA 2X6MA 1OCWH 5E5MA 3OX8A 2GEEA 5SX4H 2VYRE 2YMXL 3VFRB 3PHOB 4ELMA 3WFCH 2WBJD 15C8H 3PP3K 1OW0C 2BNRA 1BPVA 5C0DB 4OM1L 2BJML 2BSRA 3S4SB 4P3CH 4JLRA 3BIAX 5CP7B 3HE7C 3FO0H 4R2GD 4FQ2L 1YN6A 4ZOCA 1O5DT 4U3HA 2I24N 1FFQA 1NDMB 5BOPA 2IQ9L 3FB7B 5KAQF 3T77A 1JFQL 4I3GA 1CFVL 1B0WA 1RUAH 3QAZC 2ADFH 1LO3H 2IPKA 1A6AA 1XGQB 5JLZA 3NIGF 1RVFL 1YNLL 3VXRB 4NYLA 2V2TB 3QRGH 1QSFA 4ZMAT 2VZTA 3MRFA 4QT5A 2V9RA 4I0PC 5I71B 3V7MA 4WEMB 1R5IB 1JN6A 1WBZB 5FYKH 5CZVL 2P7TA 3PHQA 4FQ1L 2X4NA 3MRPA 3D2UD 1LO4L 2GHWB 4E5XB 5IJVA 4YHML 5IW1A 3KPOB 4YGVA 2G9HA 3C5ZA 4JZNB 1AC6A 1HNGA 3L3HB 4ODSH 3OGCB 2GTWB 3HS0A 5C07A 1J8HB 3I75B 1LHZA 1BQLH 4IIQC 4OZHA 1E28A 5HDOA 2YRLA 3AM8A 4GRWB 3H3PL 1FYTA 1F6AA 2R2EB 5JW4M 4HXBH 2OYPA 4NWTH 3MREB 5FHAL 2ARJB 4DN3H 1YYML 3FQNB 3N9GL 1R3JB 5I17B 4XTRD 1CICB 4V2BA 3HC0B 3EYUH 1RMFL 4P5MB 3KPMA 2EXWC 5J06A 1R5WB 4Z0BH 5LGKA 2IH3B 2WLZA 3VWJA 5K9KB 3S96B 3WEXA 4X6FA 2ED9A 4MD4B 4UTAL 1NGPL 2VLRA 3WL9B 1D3CA 3IF1B 5DI8B 4OZIA 1XCTA 3CLFL 4QHMB 5BV7L 2IH1B 2OTPA 4NZTH 2ICWI 3QXAA 4GUPA 3D39B 2O61B 3D0VB 3K0WA 4S1QL 4S1DC 2FX9L 3GSNH 3TIEB 1WITA 1RIVL 4CN6A 2XWBB 1HIMH 2FL5A 4ENEC 4JFPB 4N1HB 3B9KC 1KB5B 4P2QD 4A6YL 5C92A 4Q7DA 5TE4L 3SJVE 3UJTH 3E6HA 4M6NH 4OLWL 1EO7A 3HFMH 5HHXL 2OCFD 4X7TB 2PW2A 3CIQA 2BXYA 3R06A 3QFJE 5ESQA 1IGMH 3ILPB 3MLTB 1OP5H 5HDQL 1ZT7B 1NUDA 2DS4A 4FQHA 3C8HA 1XF4B 2NY1D 1BJ8A 4Y16B 1HOCB 4PGJA 1L9MA 3IDIA 5GRXG 2AJZA 1JGLH 4ZS6C 4XWOD 3VFWB 2N56A 2HLAB 3VXUD 2DD8L 3IDGA 2V2XA 5IEHB 5KAQG 4JQXA 2P47B 3QNZB 3FHAA 5IIEB 4O9HL 2W9EL 1SBBA 4UBDD 3HE6C 3DX8B 1FC1A 4N0FA 5CLTA 5F89B 3D3VE 3HAEA 5I16A 3ROOB 2Q7YB 5C6PB 4R0LC 4AENA 4U4BA 4XPAL 4ZDHB 1HYRC 5TF1L 1F5WA 1AKJB 5IOPB 2QR0B 1CLOL 3VXNA 3DROB 1JBJA 5AG8A 2ZUSA 3ZKXB 3TJHD 1JV5B 1S9YA 3GJFH 2FGWL 3K3QA 4YQXH 2A9ML 4N5EC 4JR9H 4U3XA 4PRPD 2F54E 2BNQB 3W2DL 1X5HA 4J3VA 5HGDB 1YEIL 5DD6A 1NC2D 1B0GB 2APBA 1P5UA 2VDLH 4HQQH 4NNXB 1OB1B 5I8KL 2B4CC 1AGDA 2FNBA 2J2ZA 1EIBA 1M7XA 3SKNA 3HE6D 1UM5L 2UYLA 5DEGA 4OV5B 5ALCL 4ZPTB 2HLFC 5EIVA 4G7VH 3ZKND 1HHJA 1XF5B 4FZ8H 4NQCA 5KVEH 5B39B 5LXGL 3MV7E 3O9WA 4NN6B 3T8XA 2D31B 3RTQD 5KSAB 1VACB 2YZ1A 2Y1VA 4XNQB 3UDWC 1MCCA 4MD5A 1EBAA 4K2UL 1GGIL 2V5TA 1WZ1L 3MRJB 1A02N 1F45A 4FG6D 5M7QA 4JVWA 4AIZA 5DMGD 4CVWA 4L8SC 5I1KH 2YRPA 2B7DT 1I3RB 3VW3L 4HD9A 3VXSA 3S7GA 2KQNA 3B3IB 1QYGH 4EZMA 3MV8E 1GGYA 1MCPL 1HE7A 2Y25A 5CCKL 4R3SA 1HEZA 2F19H 3B5HA 3LEVL 1G9EA 3I9GH 5C08E 5F96H 1UJ3C 3RDTA 4U6VL 3TFKC 4QOKB 3VXMB 1MCRA 1QVOA 2VZOA 4P2OB 4MAUH 2VQTA 1MJ7H 5FA3B 4M3JA 5EUOF 4ZXBB 3WFBL 1NGWA 4PJFB 8CGTA 3ARBB 5BVPH 3F58L 2ZPKL 4KY1L 5I73B 2KZWA 3OB8A 4YDJB 4Z95L 5AWNL 3RU8L 4MS8C 4RIRA 3RVWC 1DUZA 2VLKE 3BVNB 2ICEA 1UB5A 4NQTA 1MRCH 3HZYB 5GGTL 4UT7H 4JPIA 4ERSL 5KSUA 1V3KA 3WNKA 1FCGA 2R15A 4Q0XL 1YQVL 5J9PA 2EYSA 2I9LA 3CFJA 1F4HA 4LOUD 4PD4J 4YXHL 4RMVA 4NQSB 3BYYA 3MR9A 1YNKH 2J88H 1D9KD 2CDEB 3LQMA 4EUPB 5FKAA 4WI6A 1WWCA 3QUXD 5DJZB 1G9ML 1CYGA 3DO7A 4ONHA 5IFAL 5FUOL 4LCWE 3HPLA 2Z92A 4MXWH 2UZXB 1PEWA 1N7ML 4QHLB 3V4PH 5ESAB 4PPTA 3MXWL 4CNIB 1CU4L 2DLHA 4PLJC 2QBWA 2X4RB 1U6AH 3MRNA 4MS8D 2H2SC 3OG6B 4M8QB 5E2UH 2IBZX 4H88L 4PP2A 1XZ0A 3E8UH 2V7NB 5KZCB 3SKMB 3JTTA 3RWEB 3WFDL 5C0AE 4Z76A 4PJXE 1AO7D 1BFTA 4OFYA 4O4YH 2XN9A 1Y0LB 1OTUC 1ZTXL 2P5WA 2X4QA 2FDBP 1OAKL 2BOBB 4HIXH 4YK4C 4G59A 3CSGA 1F8TH 2ORBH 1ZGLB 2XXCB 5JHLL 5JOFA 3GM0A 3GSNA 1JUFA 4UAOB 1OARH 4Z7UA 3SDAB 4LP4A 3AU1A 4YFEA 5LJYH 1QLEH 3KLAB 1LP9E 2Y5TB 3RVXD 2QHRH 2GT9B 2AK4A 5K9OB 4U6XB 1H8SA 3K80A 1Q9OA 4X7CC 3MRDB 4JM2D 5JXEA 4HCRA 1EJ6A 3DYPA 2E7LC 4D9RE 5D7LA 4KKLD 1OAUL 3MBEA 1N8ZA 1KIPB 1QLRB 4HXAH 4LIQE 5ITFA 1U8PB 3GMPB 3IFLL 3T3MF 1N6QH 4PJ7A 1WAAF 3DGGA 4M1DH 3RWDA 4QNPF 1CFNB 1UZ6F 4L8CA 2JELH 3NFPA 3QDJB 3WLBB 1U8HA 1AP2A 1ZKAA 4M4PA 3GFUA 5HYIA 2G5BA 1BQHA 2PTUA 4GMSH 2VXQH 4XVUC 1A4KB 3RAJL 5ICZA 3GK8H 3L6FB 5H8DA 1UC6A 1WUNT 4YPGB 4OGYH 4Y5XB 3ZT5A 5F97E 3LS4L 1MHCB 1P7QA 3I6LD 2C3HA 4CADA 2QJDA 1PX4A 5DVKA 3PE9A 2HJKB 5KG9B 5DVMA 5F88B 4DOHB 1NDGA 1B0RA 4KJPC 3V4UH 3O0RH 2W59A 4H1LG 1MCWM 2P8LB 3GHBL 3ZT7A 1MCFA 2D0FA 4YWGH 5E08H 3DV6B 3O6KH 3T4AA 4NCC1 1XGPB 4YC2C 2WUBH 5DA0B 2X4PB 3GJFA 3LKPA 3IJSB 1V7MH 3UJJH 3UTSA 2DLFL 2BVEA 3T65A 2QL1A 1EHLL 2I27N 4B50A 5L2KE 4QHKJ 3OAYH 5C0EB 4GG6E 2A1WH 1OD9A 1A1MA 1ONQA 1FZOA 2YA2A 3T08A 7FABL 4X6DA 4PJAF 4F9LA 4HG4J 4LCUB 3O6LH 3D85A 2VISA 4JJHA 5KJRH 2A6KB 3KNBA 3QDGA 3QI9A 4WO4C 1T2QL 4YBQC 1FO0L 2JJSA 3S37L 4LFHG 3LEYH 3HG1E 3INUL 4L9LB 1SJHA 3MLUL 3CH1A 4NGHL 3PXJA 4OF7A 4PGEB 1FRGL 3P73B 4N68A 4NOFA 2FLRT 3L95B 1H0DB 2DQIH 5TDNB 2CKBL 3BH9B 4P49A 3NCBB 1XEDA 1ZVSB 2GK0B 5D2LB 2BNRD 1IAMA 4PR5B 5SWZA 3ES6A 4NO3B 2KUTA 2C1PA 4MA7H 1CT8B 5JOEA 1NEUA 5HJ3B 1EO5A 1MHEB 4M7ZC 3MGOA 5I19L 2LAAA 3BGFC 1YMHA 3PF2A 1EEYA 4JFFB 1CK0H 1L7IL 5J12C 3FB6B 2OL3L 3BPLC 3B83A 1DDHB 1CL7I 4AM0B 2GJ6B 3PWJA 3BMWA 3GRWL 1ZWIB 4I9WE 4ZPVB 3G6AA 1QSFD 5KS9E 3VFSB 4UIMA 2R1XB 2HH0H 1MF2H 3IXTB 3OZ9L 1JYWA 5DJ8B 3GIZH 3EJYD 1T21A 4JO1L 1I4FA 1EZVX 3DMMB 4RMWA 4XCYB 5EOTA 4UDUA 3VWJC 2VDKL 1E4XL 2FLBT 4U7KA 1K8IA 3MOAH 1JGUL 4S0SD 1UGNA 4LSTH 4JHZA 2M2DA 3C5ZD 1F3DH 4H20L 5C70A 1OHQA 3TJEL 4YNYB 1P4IL 3SHSA 3IDUA 4U1KA 3A67H 4HEPG 1HSAA 5GGRA 3D1MC 4LKXB 5C07D 4U6HA 2F58H 4DUWA 5HGHB 4OJFH 4CVXB 2HKFH 1JF6A 2YC1B 2M8XA 1XCQA 3C8DA 1A9EA 2W92A 5D7JD 5T1DL 5C0GA 1EEUA 4IOSD 3V0AC 3PGCA 1Z3GL 5HYFA 3MUJA 5JR1L 5DT1H 3SJVD 4WDIA 4P57B 3HMXA 1ZT1B 5F7EL 1CGSL 3ZTJG 4S11A 3REVA 1S7WA 4OCYH 2WBJB 4JN1L 5I1JL 4NFBA 3QG7H 3QFJD 4J4PC 3NIGE 4CDGC 3DIFA 4XAWH 3ARYA 1N59A 2VDQL 5I76A 4P5TC 5TH2A 3SY0B 4HIJB 4LHUG 4XPHL 2FX7H 3PNWA 2H45A 1XGUA 4XAKD 4XXDA 4IRSA 5CEZH 1UQSB 3ARQA 1MNUL 4LLWA 5DR5H 3PDOB 5HXMA 1S5IH 4ETQA 1KJMA 4UT9L 4JFDE 4JQXC 2R8SH 2AGJH 1OPGH 4YX2H 3I3EA 5GJSH 5JUEL 1AXSB 1YECH 5I8EA 4C56D 4NRZB 5D7IB 1EA9C 1HKLL 3EFFA 3WS3A 5D1QA 3UAJC 2VKWA 3RNKA 4HS6B 3QO0B 2GSIB 4HV8A 1OSZB 4CN1A 5A2FA 3ULVL 3S35L 1HXMB 2B1AH 2ESVA 4FFZH 2ZCHH 1A3LH 1MCOH 1DQJB 1QD0A 3ECBA 1A6ZA 3L3JA 1NCAH 1U91A 1CGXA 5IVXF 3A6CH 2QEJA 2FYYB 4OD1L 4PGBA 1SBSH 3HRZB 5ID1B 4H25A 2APFA 4ZTOH 4QF1B 3QAZB 3UEZA 4GRLA 5D6DC 2BXZA 1XT5A 5SWSE 4NRYA 2DOCA 4WV1B 2G2RA 2WQ8A 1BFOB 3Q1SL 1MCWW 3ISWA 4I18A 4YHOL 4I0PB 3RWFB 2HT3C 2YBRA 3TO4A 1H8NA 5MP6H 5KVFL 3O9WC 1PFCA 3MFFA 2ED8A 2GUOB 3LD8C 2F5AL 2VR9A 3AUVA 4FTVE 2RR3A 1V3MA 4XP1H 2FZ3A 1SJEA 2NY3D 2QSCH 1I3GL 2XZQL 3ZTNL 3D5OF 1LO0L 3U30C 3HNVH 1A22B 5CSGA 3T4YB 3KGRA 3FRPG 3P4MA 3RWIB 1UACH 2JF1A 2VERN 3BJLA 4IIQB 5BZWA 3DETD 5CIPB 3S36L 3VXOA 1KPVB 1KIQB 1EVTC 1XF3A 3E2HA 1IQDA 1OAYL 1CR9H 4NQDA 4K3JL 1IGTB 2OSLA 3CFCL 2W65A 5C08D 5IMLB 3WJJC 1CL7L 2R4RL 4HIEA 3MUZ1 3F7VA 3MRGB 5E4EC 3O9WD 1AJ7H 2B20A 4TVPE 5EULV 5CHNA 3U82B 5C71A 4RCAA 4JFHE 1D5XA 4JDTL 3HI1B 3CVIH 2EO1A 1C5CL 2EC9T 2HT2D 3DVGB 2Y36L 4M6OL 4JY4B 2VLME 4I1NB 1EO8L 4Q2ZB 2QQQA 1P1ZB 3QQ3B 2IAMA 5E70A 4XCFH 4XHJC 2H3NB 3MA9H 3QQ9C 4ZOBA 3VXSD 4NQUA 2EO9A 5DK2B 2RCSL 4XP6H 2YZ8A 4OGXL 3LKRB 3B9KB 3UTTE 4X0KA 4L8DB 2AEWA 1QA9B 5EBLB 4HK0A 2A6JA 1I9RL 5C0FB 1TENA 1QUNA 4YHYC 1EHXA 3HUJF 1NBVH 1EXUA 3GGWA 4NSKA 4N0UA 3RDTD 2NX5A 4XCCL 5MEOB 3SO3C 1SYVB 4X6BA 4MDJB 1RZ7L 1KC5L 1CDYA 4PRPB 1ERNA 5LWYL 3C6LA 1MCQA 1NBYB 1T7YA 3LMJL 4KROC 3V0WH 3X3FL 4OLXH 4P4KD 4MB4A 1CBVL 3UC0L 1II4E 2CIKA 5IESH 2IPTH 4WTZG 4RWYL 2Q7NA 1E0OB 1LMKA 5D5MF 4KHTH 3PP3H 2AXFA 2B2XH 1JZ4A 2DL9A 5FFLA 4BFIB 1NJ9A 1OTSC 3HE6B 3MV01 1MREL 4AL8H 4XPFH 3ARRA 5BS0E 1YPZF 2VQUA 4LSPH 3RL1B 4R0LB 2YUWA 3QQ4A 4YDKL 5KN5B 2P48B 2I60H 1WJ3A 5E2JA 2DKUA 1CGTA 4UINL 1MIML 2Z8SA 3BXNB 1M7IB 2OTWB 3CFDA 3RTQB 2CDGB 4D9LH 3S9DB 3MV9E 1F4YL 1F58H 4LSSH 2JIXA 4NCDA 5J57B 4W6XB 2BVPB 3PDDA 4WGWB 5ICYB 3OXRB 3NCMA 2D03L 4KQ3H 4MCYA 2DQTH 1TITA 4KROD 2OQJB 5CSZA 4X4YA 3EFDH 4R26L 1CFTB 4K3HA 3IRPX 5I1CL 4U6YA 3OJMB 1RY7B 4FQXD 1YYLL 3MO1A 5DC4B 3KS0J 1RD6A 3QHZL 2V7HA 4YXLH 3RWJB 1AIFB 3EBAA 1H3WM 3QIBC 1QFWI 4NNYB 1GPOH 4DGYL 4O5LH 3WUWG 2KPNA 5IV2B 5EUOE 4KVCL 2ZCLL 3AS1A 1K4DA 4R4FL 4OFYD 4Z78A 2XN9D 5IROA 5CBEA 2YMXH 1LVEA 1CZ8L 4NUJA 5EC2A 3QG6A 3WE6B 2P5WD 2EEAA 3W39A 1F97A 4LPCA 1KENL 5FF6A 1U8MA 5I74B 4HZAA 5F1IB 3K81A 1Z0MA 3MCKA 4OM1H 1IGFL 3N1MC 4TTDD 3DVNB 2N7BA 5DS8A 5TPWH 3O6FA 4FQ2H 5EU4A 2YPVL 4HMEA 2QV2A 1Y18A 4EDXA 2FIKA 5JA8B 5JXED 5AUMB 1JFQH 4MQXD 3GHEL 4WUUE 3KYOA 4L8SB 5D7LD 4XPTL 1NUGA 1A21A 2F15A 3MBED 3MV11 2R1WB 1RVFH 2PKDA 5DJDA 3MNVB 5LAXB 1ZOXA 1J05A 5FB8A 3UTZB 1S5HB 3AVEA 1F3JA 4HJ0C 3GBML 2VAAA 5DRNB 4IMKA 1MHHB 1PYWA 4FQ1H 5A2LH 1UJ3B 1T2XA 3WFHB 1NFIA 2JJSC 4GW5B 1P7QD 4ZUSB 4QHNA 3VFUA 4RFOH 3H8NA 4YHMH 4CKVX 1LNUA 2EEDA 3CZFB 3BHBA 3QUXB 3B8SA 1CE6B 3BKJL 3CFKB 2IJ0C 3IT8D 4HHAB 1P9MC 1I1FB 3TH4T 5GGVH 5E8PB 4OLZL 2HG5B 3MRRB 4LLQA 2IQAB 3L3GA 3RX7A 5GS0H 5I8OL 1M05B 2X89A 4G8EA 2J4WL 2WAHA 1DQML 4Y1AA 5MEQA 3M8OL 1DBAL 3H3PH 2F53E 1GHFL 1X6NA 4X5XB 1P4LB 3OR7A 3VJ6B 1YYMH 4DQOL 3ERYA 3N9GH 4N9OB 5EC1B 5TGBA 3V6FB 2B1HH 3IS0X 5JHDA 1VB9A 3X12A 3VXTA 3TV3L 3OAZK 1N5YH 3FMGH 3QI9D 3T3ME 1WAAE 4QNPE 1UZ6E 1WT5A 3TZVC 4LSUH 3O3EA 4OI9A 1J9CT 1CVRA 1ED3A 2R0KL 2BMKA 4UTAH 4HK3N 4ZUUB 4OIIH 5ERWA 2QQNH 5F44A 2A83A 5DJCA 4XCEB 4OD3L 1YC7A 1V5JA 3L3DA 2LABA 1MEXL 4M48L 5CWSB 4X6CF 4X99A 3P30L 2NZ9D 4WEBL 2ATPB 4PV9B 3BO8A 3GMMB 5HI4D 2Z8WC 4JJ5A 2VXSH 3MJ9H 3NCEB 4FQJL 1PG7W 4H5SA 5BOZG 2EH8L 3R8QA 43C9B 3O11B 2BHZA 2HN7B 1CDIA 1LK2A 4NZDA 5HYSB 1B2WL 1MAJA 4YJZL 5E7FA 1BD2E 3LQZA 5B3NA 5TE4H 3HPJB 4BKLA 1KEGL 1LQVA 1X5IA 2UV3A 5DMKA 5HHXH 2XTJC 3QIWA 3NCYS 1D6EB 4YK4B 3GI8L 3NPSC 4OFIA 3KLSA 5IM7B 4GKOA 4HWBH 2DBLH 2IFFL 4LRIC 2P5EB 3NCJH 1DBBL 3JXAA 5A2JH 1MCEA 1I8LA 4PJAE 3TBTB 4L5FL 4XGZB 4JFQB 5JPMB 1A4JA 4KRMB 3LKSB 4L4VA 5CJXA 3GMRA 1FNEB 1A2YB 4I3RL 3DNKA 3FO2B 4WCYL 4U1IB 1TMCA 3LKQA 3I6KA 2YPKB 5CGMA 4QO1A 1FZKA 3MLYL 4D94A 2MMXA 4HIHB 4IRSC 4CJ1A 3HZKA 5FO7A 1U3HA 5DXWA 5HHVL 1UADC 1QFUH 5CJOL 4KJWD 1TNMA 1CLOH 5IMMA 3OKKA 4XB7A 5HD8C 3VCLA