1S7VA

Crystal structures of the murine class i major histocompatibility complex h-2db in complex with lcmv-derived gp33 index peptide and three of its escape variants
Total Genus 67
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
67
sequence length
276
structure length
276
Chain Sequence
b'GPHSMRYFETAVSRPGLEEPRYISVGYVDNKEFVRFDSDAENPRYEPRAPWMEQEGPEYWERETQKAKGQEQWFRVSLRNLLGYYNQSAGGSHTLQQMSGCDLGSDWRLLRGYLQFAYEGRDYIALNEDLKTWTAADMAAQITRRKWEQSGAAEHYKAYLEGECVEWLHRYLKNGNATLLRTDSPKAHVTHHPRSKGEVTLRCWALGFYPADITLTWQLNGEELTQDMELVETRPAGDGTFQKWASVVVPLGKEQNYTCRVYHEGLPEPLTLRWEP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords H-2 class I histocompatibility antigen, D-B alpha chain
publication title Determination of structural principles underlying three different modes of lymphocytic choriomeningitis virus escape from CTL recognition.
pubmed rcsb
source organism Mus musculus
molecule tags Immune system
total genus 67
structure length 276
sequence length 276
chains with identical sequence D
ec nomenclature
pdb deposition date 2004-01-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00129 MHC_I Class I Histocompatibility antigen, domains alpha 1 and 2
A PF06623 MHC_I_C MHC_I C-terminus
A PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1s7vA02
3.30.500.10 Alpha Beta 2-Layer Sandwich Murine Class I Major Histocompatibility Complex, H2-DB; Chain A, domain 1 MHC class I-like antigen recognition-like 1s7vA01
5ITFB 3ARBC 5EIVA 5F1KC 4MMZC 1NCUA 2B1AH 2AJYH 1CE6A 5DT1H 1CFTA 3CFEB 2DRUA 3PNWB 4FXGA 2HTLD 5DMGC 3UPRA 5IW1A 3PIQB 1GGBH 3FB6A 4PTUB 3RVVD 1WC7B 4JFHD 4AEFA 2E9IA 2P5EB 5I19H 4NKQB 5GRJL 1I9EA 4DKDC 1MFDL 5DD1H 3O6LH 3C8KB 5L8LB 2CO7B 4EI6A 4LSDA 3UDWC 4NKIH 3WFCL 5JW4M 3MLPA 2DYPB 4DQOH 5DGQA 3KLAB 1S9XB 2Q8AL 5JXAL 1LK2B 5FIEA 3WV0A 4O2CA 3MROB 5CEZH 3LB6D 5HHMA 2DDQH 1R24B 4Z7UB 3WNMA 3G6JE 1R5VB 4XNQB 2VWEE 1M05B 1WTGT 1QD0A 3MJGX 3WXVH 3UBXG 3TIDA 2CIKB 4GS7C 5ESVB 2XIDA 3VGAB 5LAXB 1FAKT 1NH6A 2P47B 4HUKB 3MNWA 3RWFA 1HK6A 2WUCH 5IVXF 2XTJC 2NTSP 3LSOA 1RFDH 4XWOC 1KCUL 3ZHKA 4LEOB 4MD4A 1H5BB 2A6JB 1E4XH 2ADJA 5DS8A 3RWIA 5L88L 1WIUA 4NSKB 1PVHA 3LKRA 5FYJD 1MJJA 4LLYA 1NQBA 3QFDA 4DTGL 2ZKHL 2K7QA 2W60A 3IFNL 4ODUB 4JFPB 1CICC 3D87B 2DJSA 1BJ1J 3EYSL 4QXWA 3EYUH 1OB1B 2GK2A 2XQYK 1YQ2A 4OF7A 3KPOB 1YYMH 3KYMB 4JJ5B 5A2JH 4L3ED 2ESVD 1FJ1A 1S9WB 1MNUH 4Q9QH 1HHJB 4ZS6C 4Q58C 3RTQC 4KUCF 1FL3B 3K1KC 4S1DC 3S96B 3BSZL 5IBUG 4NQCD 4D3CL 1MH5B 3G5ZB 2D9QB 4PGBB 4NZUL 2HTKD 3ARDC 2ED9A 2FJFA 5I75B 1UACL 1L8JA 2C26A 5JHLH 3UTSA 1F3JB 5L2KE 1IGYA 2Z93A 3OXRB 4P23C 1GGIH 3MR9A 4G42B 5BJTB 4OZHF 2AQ3A 2CUIA 4X80H 3SEPA 5FB8A 2PW1A 4GQ9H 2Z8VC 2P8MA 3OF6D 3UP1A 2FBOJ 1FZKB 2F5AL 4JG0H 4FTVD 2WIMA 2XN9B 2IAMB 1GC1H 3VWJB 4RFOH 1WFNA 4XCYB 1I1AD 4IRJA 2CKBB 3BD3A 4UTAL 1KJ3H 1E27B 1VPOH 2EE2A 2KL6A 4K7PL 3DVFA 4XP1L 1Y0LB 4S2SA 4GUPB 5JW5A 1AC6A 4OV5B 5HYSG 4PV8B 5BW7C 5SV3A 1AE6H 4Y5XA 5GRUH 1TFHA 4QGTA 2DKSA 1G7LB 4QHMB 1VFUA 2HT4C 2HG5B 3ARZA 2X4TA 3MCKA 1AO7B 1JRHL 2CRZA 1CL7H 3D85B 4JPKH 3B8SA 4JFFE 2D7OA 4HWEL 3ZE0E 1J8HA 4OKVA 5EU6D 4OLZH 3QUMB 1T6WA 3P0YH 5HGAB 4N5EA 3LZFH 1ROWA 3KPQB 1QSFA 3BO8B 5BV7B 2D7QA 3VXTB 1AGDB 1TVDA 1NDGA 1PX3A 2XRAH 4HIXL 4J3SA 4QRSB 1GXEA 5C0AB 1Q9KA 1NANI 5DUPL 1ZA3A 1CIDA 5CKGA 2ZSWA 2NY0D 3MRCB 4XVJL 3TF7C 4IOIA 2W59A 1WBYB 4JKPH 5F72S 4A6YH 1OM3H 2K1MA 4CVWA 5A2IH 5IMKB 4MA8H 4Y4KB 3MLVH 1NGYA 2BSSA 1IBGL 1I1FB 1EERB 3IKCB 4HSQA 5I1DA 2DTML 3DRQA 2LV4A 4JANB 4NQVA 2IJ0C 1OD7A 4C83A 4HXAL 3L95B 1F4WH 5SV4A 2P45B 3QWOB 5SWQA 1GIGL 3T0EE 4BZ1L 5D8JL 5FK9B 5C0DA 3W81A 2FLBT 3UAJC 5KSUB 2VDML 4Y16B 1RZ7L 3TFKC 3TP4A 1UM4L 2KUTA 4KC3B 2QADB 2FYYB 2ZUVA 4HBQA 1RZJH 3BIKB 3GJFB 4KRLB 4I1NB 4XCNB 4P59L 3BJLA 2HN7A 2DTSA 4NNYA 2FCBA 3OKLB 1JMZA 2AVGA 4NZDA 3ECBA 3PGCA 3IFOB 1OF2A 2AV7A 2I60L 3K3QA 1MVUA 1O0VA 1MAML 4MXQA 4OF3A 4HFWA 5ITBH 4XBEH 4L4VB 1F8TL 3A6OA 2E7CA 1KTLB 5E6IC 4FP8L 3W9EA 4LHUA 3OGCA 1FE8H 1L6XA 5L9DH 3WO4B 5HHXL 4ALAL 3HAEH 4WI6A 4UOW0 5DFTA 3ZT5A 2VDQH 1FFOA 1WAAA 3C6SA 2X7LB 3SDDB 3GIZL 4Y19B 3O3EB 4WI3A 5DZOA 3T09A 1G6RL 2R4RL 4DKEL 4NP4H 4PJAB 4JZOA 5EZJA 3ESVF 4NO2B 5BRZA 2IANA 4UOJA 2YPVL 1WCQA 3VU2A 3GZKA 3Q6FA 3FRUB 3TA3C 4LPXA 1XGYH 5DD3H 3MJ9A 1HYSD 3TV3H 2QQNH 3UTQB 3LS4L 2GHWB 4G8GB 1IQWL 5I16A 5ISZE 2ZPKL 3SDXE 4PDCE 4P46B 3ARTA 4YGVA 1NCTA 3BXNB 3HE6C 5T5FH 4M62L 3IT8D 3GKWL 4OJFL 3VFNA 4UB0L 5BVJB 1KB5H 2V17L 2IQAA 2EEBA 4NUJA 1H0DB 3BRDA 2R2EA 2VDPH 4ZNCD 4Z76B 1X7QB 5B3JF 3GSWA 4WY7L 1M7IB 5C0EB 2A77L 1L7IH 1AGCB 1AHWB 3O0RL 3ZDZE 1CGSH 1P7QA 3DJ9A 4HLZG 1LO3L 1U6AL 4KK5D 3OKEB 3W2DH 4XZUB 3DXAA 5F3BB 5HVHB 2FO1A 1E4WH 3JWNC 3QT2A 4EVNA 3G6JB 1KJ2L 1OT1A 3L3IA 1KC5H 4JDZA 4U1KA 3ZT7A 1FG2A 5KSBF 4HS8L 3C5ZB 4MJ2A 1UADC 7FABL 3CX2A 1FNEB 2BRRH 3TN0D 3TT1L 3QRGL 4JM4L 2NZ9C 2XV6B 1XF2B 7CGTA 3O9WA 5E4EC 1FO0H 5KS9A 5FA4B 4JY4A 1CE6B 1HILB 3ZSTA 3FB6B 1CI5A 3SJVD 4P3CL 4L9LC 1PG7X 2J88H 1ORQA 1ZS8B 2BY0A 5CGMA 4M61B 1JZ7A 4EI6B 5EO1B 4HXBH 4W4OA 1BFVH 3TESA 2CDEA 3CLEH 3L1OH 4RQQA 2PW2A 3HG1E 1N3NA 1T5WB 4N8CH 2FIRT 4LF3A 3QNXA 3GUTB 4O2CB 3QIWB 1SY6L 3TO4B 2IMNA 2Q7YA 1F4HA 5LWYH 5DQJA 1P1ZA 1XGTB 1S9YA 1U8OA 2HRPH 4E9LA 3T77B 5H37H 3SGEH 3TIDB 1HSBA 3IETB 3OAZK 3MODL 3SE3A 5FO8A 3F6LA 2ZG3A 1FV1A 2HMID 5HVGB 4X4MA 5CS7A 2OLDA 2FWOB 1FN4B 4MAYB 5EO0A 3PWPE 5L2KB 2AJ3B 3KPPA 4MD4B 4RRPA 3OBAA 4WV1A 5JOFA 3RL2B 2C7UB 3SQBA 2P5WA 3QG7H 1K6QH 5JORA 1MJJB 1YN7A 4LLYB 1F4YH 3I6LE 3QFDB 4FRWA 3LQZA 4XX1G 3DIFA 3EDJA 4XXCC 5KZCB 4EI5C 3IB4A 5E8EA 2KQMA 4BSVA 4IMLB 1CD9B 3HR6A 1AXSA 1F6FB 1A14L 2HVKB 2IQ9H 3D3VD 1Z2KA 4QRPE 5B8CC 4OCSH 4KDVA 1J1XH 1T5XB 1HKFA 5GS2H 4FQIL 2WZPD 4AEHH 5E8PA 2AEPH 5C09E 3GSNL 3HAEG 3FB5B 1NBZA 1J11A 2NY2D 2X44D 1HHIB 1BECA 3EO0B 3X17A 3W39A 3GFUA 1CIUA 3NN8B 2O5XH 5EBMB 4JFFB 5I8OL 2O5YH 4LQ1A 4HPYL 4X4ME 3TC9A 3CMGA 4P2RD 2YMXL 4JDTH 5EZIL 2COQA 4UV7L 3ULSB 1QKZH 3AS1A 5FUZH 4PJ5A 1BBJA 1A1MA 1MCOH 1OAQL 2FNBA 4Y1AD 1SBBA 3SPVA 5JPNA 25C8L 1OWRM 4IIQB 1TQCC 4AG4H 2VABA 2NW3B 2P8MB 1TZIB 2R0WH 1P4IL 3DARA 1PQZB 4KI5D 3DX8B 2DQCL 2OSLA 1Y18A 1MIMH 2ZG1A 3EYQC 3L3OB 1A9EB 2BSRA 4F15C 4CJ1A 2V5TA 4LBEA 2YR3A 4ELME 1YEHH 1DUZB 3P30H 2X42A 3HC3H 5GPRA 2DQFA 3GHEH 1N2RA 1WWBX 4APQC 1AD0B 4U6YB 4WIQA 4HUUA 5KVEL 5HDOA 2IPTL 4UINL 3L3HB 4JY5H 4WCYH 2P5ED 4KUZL 4X5XA 1MFBL 3V6ZA 2FEDC 1A6UL 1CZ8H 4XNXH 4N0CA 4PRDA 2QL1A 4AJ0A 5EIIA 3T0EB 2X4TB 4J3VA 4MSWA 1CE1L 4GAGH 2X1XR 3B3IB 3D18B 3QA3B 4G6KL 4OI7A 3U30B 3PHQA 1K85A 4PJCF 5C0GA 1M7XA 5D7JB 2E7MA 3H3PH 1VGKA 3TZVA 3E6FB 2RCSL 3KG5A 3NPZB 3V6OA 4JFQB 3QCTL 2R8SH 3T0WA 2FJGA 1Q0XH 1VFOA 1A0QL 2UWEF 4MJ4A 5JIHA 4ZPTB 1NMAH 1SVZA 3QEHA 2B1HH 2DQGH 3VI4E 4CW1B 4K3EH 3TH2T 5F6IC 3KR3L 3W0WD 4RX4D 5DJAA 5IB1B 5ADPH 3NA4A 2BSSB 4I3RL 4YWGL 1G7PA 4HDIB 5I1DB 4NQVB 5CLTA 5L0QC 5E8NA 3QULB 3V7MA 4H25A 5CUSL 1CDUA 4C83B 1T6VN 2NY7L 1TLKA 1XIWB 3GSOB 3V5DA 5LGHH 5GGSB 2VUOA 4X98B 5SWQB 2R1YB 5C0DB 3CU1A 3TCXA 5E03A 4FZ8H 5DMYA 3CH1A 3DVNB 4DN3H 5KOVC 4P4KC 4JG1H 4LSRH 2Y36H 5ENWB 4JM2B 4XVSL 5IOPB 4J23A 4XB7A 1MHCB 2DI7A 3QDAA 3B9KB 3H3BC 2YHGA 5H37G 4PGEB 1P2CA 5DD6B 5DEZA 1TJIH 5DK0A 2L7UA 4K8RC 5ISZB 4GKSB 3PGCB 3ARSA 3SDXB 4OZFH 1OF2B 1DQML 5F44A 5EORL 1ZT1B 1G0DA 3HC0B 3SKNA 1KLGA 5FYJH 5CINH 2CQVA 3D69A 4LHUB 4ONHB 4JO3H 1S5HA 2ED8A 4UT7L 3MRLA 4OGYL 3FQWA 4H88L 3RX8A 3RVVC 3PP3K 1MJ8H 1BZ7A 2WQRA 4L4TA 4OCMC 2ICWA 4E41E 4EBQH 2ZUSA 4R4FH 1XGPB 4CADA 1YNLH 1RZGA 2XN9D 1FZMA 2IAMD 1G6RB 3KNBB 2QQLH 4L5FL 3MFFA 1ZSDA 3QUZB 4G8IA 2YK1H 2J7LA 3OKMA 2H2SD 5GSRA 4Y4FD 5MHSE 1QTYT 1YJDH 3LB6C 4FFWD 1UEMA 3GSQB 2IANB 3U7YL 1KFAL 3P77A 3Q6GL 1ZEAL 4OLUH 3MRHA 3BPLC 4QRQA 5EU7C 3JWDC 1XCTA 2WLZA 1QBLL 2BVUA 3OX8B 1NUNB 1MHEA 3TJEH 2V5YA 4NZRL 3T65B 1AO7D 2R39A 2OZ4L 5I16B 2PN5A 3D85D 5I74C 3BMWA 4HC1A 3VGEA 1WBZA 1JHTB 3PDDA 4XPGH 5GGTA 1PBYA 4IJ3B 3LMJL 4XGZA 2IQAB 4NUJB 5FYLL 4N90E 3U4AA 4PS4L 4MAUH 3GSWB 4L4TE 1U8KA 4GXVH 2FR4A 4W70A 4NO0A 3KPSA 2O61A 4U6HA 1P7QB 4G8EB 1WK0A 5F89B 4FQCL 4DFHA 3HG1B 4ZFOA 5J11C 4PJEA 4LFHG 4XNUH 2J4WH 3IS0X 4AM0B 5FGCE 1KJ2B 1G9NC 5D96B 1T66D 2MCG1 1MRCH 4WFGD 1QVOA 5D5MF 2MQ3A 3L3IB 3VWKA 1CLOL 1NL0H 1YJDC 4I3GA 3OR6A 4XC1H 2D9CA 1LK3L 5MI0C 4OD2A 4NRZA 5CHNA 4HWZA 4KHXL 4P5MA 5F96L 3GMQA 1A3LH 1JPGA 1A6VL 4U1SB 2X70A 3PWPB 3BOVA 3H9SE 4XPTL 1RZFH 1AH1A 2VZSA 4Y16D 3MTRA 3I9GL 1YPZE 1YUHA 2NY1D 3CFCL 4X6EA 5TH2A 4DUWA 4JRYE 1LD9A 4WEUD 3LRGA 4TQEH 5FYLE 4UAOB 3MRFA 3HZKA 4F7MA 3FCTB 3ARGB 1JZ2A 1CFNA 2X4RA 5IJKC 1ORQB 3U0PA 1DQJA 2YUWA 3QWRD 3L3JA 1ES0A 2CDEB 3FO0L 3RWGB 3WIFB 2X4QA 4QRPB 2PW2B 4RQQB 1N3NB 3IU3A 5I1EL 1G7MA 3QNXB 1I1AC 3CVHH 5MEPB 1S9KC 2C1PA 1BX2A 3HMXH 3EOTL 5C09B 2Q7YB 1AR2A 3OB0K 2DICA 5GRZA 1P1ZB 3O8XD 1U8OB 2C3GA 3NFNA 5JTWA 3KWWA 5IR1B 4I8DA 2A9MH 1FAIH 4X99A 2B20A 1HSBB 3QUYB 5C0FB 4R96B 1FV1B 4LNRA 3MRRA 3U4BH 3UJTH 5DDHB 4ZTPH 3JVGC 3G5VB 1I7ZB 2C4XA 2Y5TB 4HPOL 3KPPB 4WV1B 3EHBC 4KK6C 5JORB 1LO4L 4Z7WA 4TUKL 4NQDA 4BK5A 1FVEB 2Q76B 3TBYA 1CD1B 3WN5B 1A5FL 1HWHB 2Q20A 3MNZA 3U7AA 4RNRB 3GEWB 1EXUA 3DTXA 2V9TA 4G8GD 2BVPA 5C86A 5BCAA 4OZFG 4ELMB 4P57A 3V4UH 1JF1A 3IJYA 4M5ZL 3S88H 4ENED 4XNMA 3IXTA 4F2MA 3KLHD 1MEXL 2NY0C 3V5KB 2D0GA 4MGXA 2VDLL 1RK1B 1KTDB 2FBJL 1UJ3C 3GSNB 4NNPL 3VG0H 2DS4A 4LSSH 5E8PB 3ARVA 1RUMH 5HHPB 2DBJA 2IADA 5HI5C 2VYRE 5B38B 4AMKL 1ETZA 3E0GA 1P84K 3QG6A 3C9NB 5SWSA 2O93L 4O00A 4NBZB 1AFVL 3NCEB 3FOMB 4GMSH 1CXLA 4AENA 5D7IF 1Z9MA 4Q2ZA 1F00I 4OFVA 5EBWA 1R5WA 4FG6C 1E4KC 4X6FA 2VSDA 3FQRA 4XBPB 4O9HL 2F5BH 2IPKA 4MA1C 1CLYH 3ZMRA 3H9HA 5JUEH 3IU4H 5E2TL 2PO6C 4MJIA 1U8HB 3P11H 4PRPD 3SPVB 1WT5A 1E4XI 5K59E 1I8KB 2VABB 3C5ZD 2VITA 1F11B 3GJFK 3MRIB 4DEPB 5IESL 2OSLB 4P5TD 5DUML 2N56A 5F7UA 3U7WL 3GDBA 1DLFH 3IJSB 4G9FD 1HDMA 5CWSA 5DJCB 1MCQA 2DQFB 5L7XL 4OLYH 4I18A 3V95A 3JV0A 5MEOB 4X5XB 2MPAL 1QBMH 3VFOB 1RU9H 4PB0L 1H3TA 5EN2A 3MV7E 2AXGA 3DV6B 5IB2A 3K46A 4QRUA 5F88B 5JQ6L 3VFPA 1FH5L 3BWAA 1TCRB 2XZQH 3VXMD 1W72L 1AY1L 1FYTD 1T83A 2H9GA 4K2UH 4BKLA 1O7SA 1H3XA 4CL7A 2FSEB 3VI3E 1HXMB 5MP6L 4JHAH 3PHQB 4K71C 3TO4D 4OLEA 1PLGL 4GBXA 1TJHH 1SM3L 4UT6H 2Z31A 3BQUB 3IRZA 2VXUL 3LPFA 1I8LC 1HYSC 4Z7NF 3LD8B 1HXYA 3ARRA 4FQPA 5SWZE 5T1LB 5IQ9B 3IXAA 3DRTB 4CKVX 4MAYD 5BO1L 1N26A 3HA0A 4HCRA 5L2KD 3I2CL 3MV9E 5KTEL 2G5BB 2DQTL 1HSAB 3VFVA 3WS6A 3PV7A 5DJAB 4PUBL 1T21A 4M3KB 1S7WB 4PJBF 4N0UE 3LDBB 3QWQB 4OSUH 3VCLA 2XZAH 3GI8H 4QTIL 4E41B 1YNTA 5KZCD 1MCCA 1A2YA 5E8NB 1RIVH 3G04A 3SGKC 4H25B 2DB8A 3EYFB 3P2TA 2Z35A 3V5DB 3CFKB 4DW2H 2P42B 5MERA 1YEIH 3BUYA 3MLXL 4XB8A 4K7FA 1Q9OA 3VMNA 4OLWL 1BQSA 2R56H 3AAZA 3PWJB 4AQ1B 1DQLH 1V05A 4EUPH 3CH1B 4U0QB 1CCZA 3ARFC 2V2TA 1XGRA 3KPMA 2IBZY 1NC4B 4K7PX 4M6NL 3VXNA 5K9OA 1JGUH 4KJQD 4M7KL 3BZ4B 4NM8H 2A6IA 3B5GA 4L4JA 1BQLL 4U1JB 2HA1A 1AIFA 1ZTXH 5DK0B 3LEXA 2AEWA 1NCBH 4JFFD 5HY9B 4CU7A 1C1EL 1MWAA 3IS1X 4QOKE 2PCPA 4V2CB 4G6ML 4P3DB 5D1XB 2WBWB 1TDQA 4YK4B 3D39E 4MWFA 3O4LA 1S5HB 3U36B 3MRLB 1U58A 3FQWB 3S35H 2VLJE 4L4TB 3RY5A 1VACB 1KCRH 2ICWB 1J1PL 5HI4D 3CAFA 3RVWD 2ATPA 4CADB 4TULL 3IDJA 1FZMB 1GSMA 5FO9A 1F42A 3GO1H 3NPSC 3X13A 5FGCB 4PY7A 3MFFB 1ZSDB 4KQ4L 3BN3B 4GAJL 5E6ZA 3VRIB 3C60B 5CSZB 4JPWH 3OKMB 1QSEA 3R0MA 1EGJH 4HKZB 5ECJE 3UROR 1FGVL 1I3RA 4KZDL 4NRXB 4F58L 1U8MA 4LARL 4LCYA 4QXGH 5LQBL 4YR6A 1XZ0B 1R0AH 5KAQF 4QRQB 3KLSA 3E3QC 1MIEL 1EBAA 3ZZ1A 1Y6NR 3DX6B 4M7JH 4DZBB 4ZD3H 5IF0A 3VDBA 5DJ0B 3T0ED 43C9B 3FTGA 3H9SB 3QXVA 3SN6N 3BZEB 5TPWL 1YPZB 1MCPL 4R8WH 2EICA 4R2GB 1FPTL 4LLWA 5FHAL 4PP2B 5IM7A 4JRYB 5FHBL 4JN1H 5D7JD 1WBZB 2EIEA 2NTFB 5F7DA 4NFBA 1IKFL 4M1CD 2E27H 3EJJX 2YXMA 1BLNA 1Q0YL 4HK0B 2KQNA 1Z5LA 2FR4B 3O3AA 2O61B 2FHCA 4DCQA 4PJHE 4ELKA 1ULVA 1S5IL 2OI9B 4MCZA 2ZUQB 4ZUTB 3BYYA 1G9EA 3R1GH 1O5DT 3QEUB 4KI5F 3PP3H 3ZE1F 5EDXA 1FNGB 1KIQA 1U41A 5IHLB 3RNQB 5I1KL 2AJXH 3DGGA 3GMMB 5E94A 2I9LA 1IKNA 4BA8A 4GRLA 4QGYA 1WLHA 1Q1JL 5J6HB 1MAKA 4YHMH 1GRWA 1JNNH 4PJFF 4RFNB 4OD2B 1MLCA 4NRZB 3LH2L 4YLQT 4HWZB 5DD5L 4P5MB 3OJDA 1YEJH 5FYJU 3G6DH 5AUMA 5IK3A 2X70B 5DHYA 5SX4H 3V0WL 3RWHB 2B5IB 4YZFF 2AJSL 3AU1A 4QY8B 1V7NH 1K2DB 1EBPA 4RGNE 3X14B 4HUNB 2ZUTA 4CJ0A 5TH2B 3O45B 4JM2D 1XGQA 3F8UB 3ZTNL 4X5WA 3VXSE 3FRPG 3BPNC 3MRFB 3O2DA 4F7MB 1MCDA 3B9KD 3LKSB 2BCKB 2X4RB 5CFHA 3TWCL 4Z7UF 4FQ2L 1DQJB 5ISZD 2CUMA 1XH3A 3L3JB 5JMOC 4KI5C 1S7TB 5HJ3A 2AXHA 3SDCB 1C5CH 2AK4A 1ZLUH 4OTXL 3JV6B 3IDUA 4LSPL 1G7MB 3MUZ1 1I9RL 4DAGL 2DJ4A 1IC7L 1ORSA 5C3LD 2HYMA 1QR4A 5ANME 3UDWA 3KWWB 5ADOH 5FGRA 3P4NA 4ZXBB 2OQJA 4Z78B 1MCWM 1QLEH 4KTDH 1FZJB 1DFBL 2CDGA 1LO0L 5DO2D 5ETUA 4EUPG 4NC1C 3C5JA 5JR1L 3WUWB 1MCNA 4U0RB 2VAAB 3MRDA 4HG4K 2P7TB 1UZ8A 5AWNL 3C6LB 2X4SB 4NQDB 5IB5A 3TBYB 1UVQA 4H8WC 4OQTH 3TNMB 1DQDH 1RURH 5T1DL 2OBGA 3AMLA 1II4E 3RL1A 1WCBA 1EXUB 4I0CC 4O58H 2R0LH 3VGAC 2CXGA 4N1EA 1RUKH 3KYNB 4OCYH 1FBIH 2ZSVB 1U92A 1IEAB 4XNMB 1LO2H 4XAWH 4MVBA 1QFPA 2X1WL 3NZHH 5DHVB 3U1SH 1R3IH 2AK4E 4KXZI 3RGVA 1OOAA 1INDL 2B1AL 2AJYL 3F7VB 4WI5A 4HUVB 1GOHA 1KYOK 1DVFB 3K2UH 3MV7B 2IADB 3HMWH 5JW3L 3MLZL 3WXWH 1A1NA 5I19L 4HWBH 4ERSL 1T80A 5SWSB 3S36L 4OCNC 4UV4H 4NKMA 3S9DB 4LP4A 3LIZH 3WSQH 3O6LL 1U93A 3HG1D 4WI7A 2CKBH 2Y23A 1HYRC 1MCWW 4U1LA 3SGEI 2ERJB 5EBWB 4IRSC 5TDOB 4DQOL 4P9HH 1EO8H 3V6FB 1SJXA 5CEZL 3RTQA 1JWSB 2VQTA 5IVXA 4RAVA 2XYCA 5ID0A 1NFIB 4LRIC 4K9EH 4PJDE 2VITB 3STZA 4X4ZA 3NCMA 5CMAA 5T5NG 4UBDD 5F9WB 5SWZB 3WXVL 2DQIH 4JDVB 1LEIB 1CBVL 3L3DA 3PWPD 2JK5B 4P23A 2DM2A 3MV9B 1UT9A 2BNQA 5I75C 1NCDH 3MACH 4OLXH 4WHTB 1RFDL 2H32B 5I6XC 5ID1A 3I6LD 3UPCA 5JW4N 4N0UB 3DVIA 2ORBH 1YY9D 1U2HA 5IV2A 3F7YA 1TQBC 3TVMB 5BV7H 4LLDB 5EN2B 1W72B 2J3SA 1L7TL 4GOSA 4TUJA 3SCMD 5AEAA 5A16B 3TEUA 2CDFA 2H9GB 2F74A 1GGUA 1ZAGA 3P4OB 3G5XB 1VFBA 1YC7A 2IAMC 3IDMA 5EOTB 5DEGA 3SOBH 1FRGH 3VWJC 4KGJA 3AM8A 3EYUL 3QQ4A 5CEZE 4Y2DD 1ADQH 1YYML 4FQXD 5C09D 5BW7A 4PIRF 1MHHA 3OKOB 3VDAA 1MNUL 2OM5A 2NNAB 2L0DA 4Q9QL 2Z31B 3RU8L 4ODSL 3QBTB 5F6HI 4TRPH 1T89C 4YNYB 1AI1H 3LRSA 4KVNH 3JTSA 3QUYD 2IF7A 4YXHH 4QOKB 2NW2B 1KJMB 4HH9A 4XPBH 2PXYB 2D4FA 4NOFA 2ED7A 4XCFH 1IM3B 2BNQE 3D39B 2E9WA 3QQ3A 3ZT6A 3T0AA 4RMTA 1I1YB 4FQQA 3FFCD 1DZBA 2VLJB 4TNWK 3VCLB 3BD4A 3KYOA 1YNTB 2PYED 5ESQB 4X80L 1U3HB 2IEPA 3FOLB 4OLVL 1AXIB 5BV7C 4CAGA 4M1DL 1RJCA 3HHRB 4NGHH 3U0WH 1ZWIA 3ALWA 2Z35B 4JG0L 1JZ3A 3TF7A 5MERB 2NXZB 4C58B 5D2LA 1R5IA 5HDLA 4K7FB 1A6PA 3WDIA 1YNKL 3NIFE 4YHKH 5EWIH 3EO9L 1TETH 4KRMB 2HH0L 5TF1L 4G7YH 4PV9A 3ULVL 4RBPK 4WDIA 3K81A 2VLLB 4Y4KC 3VXNB 2G75A 3VFSA 3EYOB 5HHOD 5D72L 5I76A 3SDAC 2XPGB 3I50H 1NLBH 4ZUSA 1ZHNA 3S5LA 4ZFZA 2AGJL 2RHEA 4K7PY 5D1ZB 1AIFB 1AE6L 2ZOLA 4LASH 5IVNA 3RVXD 5CJ5A 1UCBL 5EU4B 3TFKA 1MWAB 5CBEA 1QYGH 2K7PA 2QR0A 1CL7L 1YQVL 4C4KT 2EDFA 1U91A 1CXHA 2ZP0T 4Y16C 4GRWH 2GYSA 1BOYA 4MWFB 4IS6A 3QRFM 2QADC 5EG6C 3P9WB 1H8SA 4DN4H 4PP8C 4NQSB 1U58B 1IGIH 3P9MB 3VH8A 1KPVA 1DBBH 2ZOKB 3ZYIA 5C07D 1FCGA 3BAEH 3ZDYF 3EFFA 4PJHB 1WEJH 2OL3H 4YQXH 3L3KA 2EYSB 1G9MH 3WNNA 3X13B 4JR9L 2DMCA 2HFEA 3BDXA 4PY7B 5D2LE 5D9SB 1B88A 2JCCA 4XMKH 5E6IA 4S1QH 2GI7A 3DI2B 2OK0H 5I1LA 2YD6A 3ULVE 3C08H 4HZAA 4JKPL 4JHZA 4A6YL 5AG8A 1OM3L 3DUHA 1JN6B 5C08E 5IB3B 4IDJH 3H0TA 4JY6B 3WIIL 3L7FB 3WO4C 1ONQB 1A7OH 2DIJA 2ZUWA 2GSIA 3UBXB 4GW5B 3HLAA 5IF0B 5GS0D 1BREA 4EJ1C 3RGHA 4NBXB 3SDDC 5JHDA 1T4KA 1MFEH 3FTGB 1M1SA 4AYFA 2IG2H 3RDTB 1A6WH 4RGNB 5D1QA 1SMOA 4ZSOA 1OQXA 2EDDA 1IC5L 2EH7L 2LAGB 2YD3A 2GTWA 4MZ3A 3RHWK 2AKRB 3RWJB 4NO5A 3MRMA 5EUKA 5GGSY 2AK1L 4KKLD 4PRNA 1GGCH 3H3KA 4RISH 5ERWB 3G6JF 1DEDA 3WFHB 3JUZA 1GZPA 2H6PA 2CGRH 3O3AB 5ALCL 2VR4A 5T1LD 3S37L 3BFOA 2VLME 1MCKA 3HE6A 5F6HJ 5C6PB 4ELKB 5IGXL 1A4JB 1H15A 1NEUA 4P46C 5TDNA 4L8SA 5CZXD 3KLHC 5K9JH 1V3MA 2JIXB 5GRJH 5ITBL 1D5BA 2W0FA 4Z77B 5E2WL 1MFDH 3F58L 5ANMB 1MQKH 3WFCH 1I7TA 3OL2A 1JZ6A 3VXRA 4LGRB 3QFJE 2Q8AH 3TYFB 5JXAH 1QR1B 4GG8B 2EKJA 5IBUB 1AHWC 2X9YA 5DEFB 3GMNB 1OTTC 5J9PB 1CTNA 3P4MB 2E3VA 4WHYH 4NJ9L 3FQXA 5MHSD 2NX5A 4KDTA 5HVHC 3VW3H 1ZMYA 4HF5L 1NC4D 3MXVL 1XGQB 2P49B 1NJ9B 1DBAL 4MX7B 3VFMA 2KZ1B 1EAPA 5CP7A 4U6XA 2VWEC 2JKXA 1IGCH 2X9WA 1G7HB 1RK0A 3QAZB 4XX1E 5FDYA 5SX5K 3EOAA 3C5ZC 1KN4L 1KCUH 5DD3L 1XH3B 5F9DC 1VFAA 4WTZG 4JVPA 4PREB 5L88H 4OZGE 2YOCA 2AK4B 5GSVB 1QBAA 4YC2B 3RKDD 2ZKHH 4DVBB 4PJ7A 4TTDC 5D1XD 3IFNH 3V7AG 3RBSA 4PJ9D 1KB5A 3QNYA 1RUQH 4KVCH 4N90D 1ZA6B 3FO9A 2YRPA 5HYSB 3QEGL 4FFZL 2VDPL 5FYKL 4WFHE 4POZD 2YA0A 3NIGE 1L7IL 5AAWA 3BI9X 1ND0B 2OQJB 3WKNA 4H1LG 4QNPE 1CGSL 4E0RA 5KSBA 2YKLL 1I8IB 1J7VR 5E2JA 2DKMA 2NR6D 3C5JB 4P5KB 4FN0A 5DYOB 3VG9B 3QIWC 4IMKC 1E28A 3IDYB 1C16A 4P2OB 4XH2B 5CGYD 5EFIA 3TO4C 5C9KA 1N8ZA 3BSZH 1HWGB 4LOUC 3UZVB 3FN0L 5IB5B 4PJDB 2EO1A 3UC0H 2FEEI 2DLGA 3LKOB 1J0JA 4NZUH 1UACH 3T2QA 1ZVSA 5J1SC 1QNZH 5GRXG 4GRMB 3ROOB 3FT2A 4LCWD 3JV5A 4OD1H 1U92B 4ZUUA 1G7IB 4MAYC 5IEKA 5DC0A 1FO0A 3GSXA 4JRYD 2DM4A 1PD6A 5FYLD 5HYJE 4WW2B 3RGVB 3A0OA 1UCTA 4XXCA 3O3UN 1UXSB 5GIRB 4KQ3L 2UZYB 3UCRA 3WLWD 3NCJL 4V1DE 5CEXB 4UIKH 1CGXA 4BUHA 1AQDA 1WZ1H 4UMGA 2NY4B 4PYGA 1WUNT 3QO0A 4NKMB 1NAMA 1IAIM 5B8CA 1U93B 4POUB 4K7PH 4U1LB 3L1OL 12E8L 3L3GA 5C9JA 2NZIA 4HIJB 3U2SB 3EZ8A 1IM9B 3IDNB 5DHXB 2H41A 2YBRA 5ID0B 1RVFL 2AJUL 3TPUA 1C12A 4BFIA 3VJ6B 3LKNA 4YHNB 1JNHA 3DURB 5IW3A 3D9AL 4E5XA 1OAZH 4HWEH 1FGNH 4LPWA 1ZLVH 2FZ3B 5TQ2H 1KCGC 1CGYA 1QEWB 4LCIL 2NY3B 4J1UB 4NYLA 2BNQB 4PG9A 5KG9A 1WITA 5E1AA 1XF3B 2ID5A 5C8JB 3P73B 4ODXB 3GB7A 1OW0C 5INDB 2YXFA 3QDJD 3QG7L 4HIXH 3A6CL 4YDIH 1JWUA 1F4YL 4U1GB 2Z92A 5DUPH 4IIQC 1RZKL 5HI4C 3MLTA 4XVJH 3RVWC 3MUGA 4MQ7B 2UYLB 2W92A 1HH6A 1NBYA 3SDCD 5F3HB 4APQA 3ROLA 5DD0L 2OX5A 4IRJC 3RY6A 2IQ9L 4C54A 5IEHA 4KK8D 5GZND 3D25A 3WS3A 1ODAA 4AEHL 3VD9A 4NQEA 4JFDD 2AEPL 3HN3A 3TPUE 4H26A 1GIGH 1T0PB 4BZ1H 4OIBA 3UYPA 3QPXL 3PGDA 1WGOA 3F12A 2VDMH 5FDWB 1F6LL 2FECI 1LP9A 1UM4H 1JK8A 3T0EC 1KULA 5E7FA 3GGWA 1YMMA 4WHYG 5TE7L 3SBWC 4WU5A 5CILL 2O5YL 2CD0A 3F7PC 3PWNA 3QQ3B 1H3GA 3GSRB 4Q9BA 3U30C 1EDQA 2NQCA 3ZKSD 2XXMB 3R06B 1J86A 5FUZL 1J0HA 1T03H 2B0SH 4N5EC 1MCOL 1FL6B 2Z91A 2I60H 5HHQB 4PR5A 4JM2F 3P0VL 1G7JA 2YD1A 5MENE 4EN3B 2R0WL 4WUUD 3HE7B 1F8TH 4U3XA 5D2LB 1GCFA 4UTBL 4FP8H 4I9WE 1YEHL 4H5SB 4ALAH 3P30L 1OY3B 3EJYC 3HC3L 4S0TD 1U3JA 3B9DA 5C08B 3SDXF 5KSAB 1EJOH 1DVFD 3MV7D 4NKDA 4Y4HD 4MCYB 2BOBB 4PJCA 2EDHA 4PJGA 3CSYA 3TLRA 1KG0A 2NY6B 4XNXL 3ILPB 2BOCB 4DKEH 3O6FB 1XIWC 4OGXH 1IFHH 5DK3A 4A2LA 4P4KA 3T1FA 3RQ3A 1G7QB 4HGMA 1R6VA 3CMOH 2PYFA 4GAGL 2UWEA 1OAKH 2C5DC 2UVEA 4JM2C 4C55A 3LS4H 1IQWH 2F54E 3MGOA 4GKNB 3MGTB 1DTUA 4PLNC 3B9KC 3GMPB 4FQJH 5C0ND 3OV6A 1Q0XL 1R3KA 2X4UA 4OJFH 3MV9D 5CSBA 2V17H 4A6YB 2ITDB 1T20A 2DQGL 5C70A 5I1LB 1EZVY 4WUKH 3M8OL 5FA3A 2WIIB 4WY7H 5E9DE 2A77H 3T3PE 3O0RH 1BQUA 3TVMD 5EZLA 5M94B 1U6AH 3OB8A 1D9KB 3G6AB 2GT9A 2YWZA 3QFJB 1A9BA 4TNWF 2HJLB 1CG9B 4KKBC 2YA1A 4C56D 4PJGE 4X8XA 5FKPB 5GS3A 4RAUB 2W07A 5LGHL 3FO1A 1FVCB 2X89D 3KPNA 3H7BB 3QUZC 1F4AA 5D1QB 4RWYL 4HUWA 3HRPA 2E8YA 2HAZA 1IJ9A 3H7LA 4RGMB 3THML 3V8CA 4HS8H 7FABH 5DXWA 4JG1L 5IHZB 2Y36L 1TMCB 3MRMB 1AJ7H 3VXPA 3TT1H 4JFED 5TDPA 3QRGH 4JM4H 3DX7A 2Y7QA 4I13B 2Z9TA 1D6VH 1GZPB 2H6PB 2BNRA 4L8DB 4OM0L 4OZFA 4OZGB 2VKXA 4I0PB 4PD4K 3L6FA 4YHIA 1H15B 3Q48A 5TDNB 4L8SB 1MF2L 3D39D 3CXDL 4P3CH 4G80B 1D5BB 4IJ3C 2WUBL 3HAEB 5H35B 4F7PA 1ZGLM 4YGAB 1I7TB 2VZTA 4YPGB 1KV3A 3RPKA 2BSTA 4HS3A 4LEXL 1CF8L 3EYVA 2NXZD 3VFGL 5GGQH 4M8QB 3MRJA 2YD9A 1NEZA 3FFDA 1U42A 4HV8B 2QQLL 3CFJA 5D96C 5F71A 2UV3A 1T04B 5CP7B 2YD2A 5CIPB 5AD0A 2C1OA 1RK0B 1Z9OA 5IB4A 1U8JB 2EIDA 5D1ZD 4ZUVB 1X5JA 3EOAB 1B3JA 2CR6A 4OLUL 4Q6IB 2I24N 5F7WC 2R0ZL 3MBXL 2F53D 4UBDC 2Q6WA 3ZTJH 3HCVA 2JJWA 2X4OA 1JIBA 2MCPL 5HYJB 4WVRA 4L3CA 3OR7A 4J4PC 3VA6A 1FLRH 3I6KA 3FO9B 4UAOC 1F3DH 3OF6A 3OZ9L 1YY9C 3DBXA 3RHWF 1XGUA 4YHOH 4B53A 3ARGC 4FTVA 5C0IB 2GTZB 4HX1B 4JFXA 4ZO8A 3WFBL 4M00A 2ICEA 5D5MA 4GG6A 3MA7B 1I1AA 4OBSA 4AIZB 3BEVB 4FQIH 4E0RB 4J2XA 3UO1L 4F80A 2F9BT 3GSNH 2DQJL 4L3EE 1WTLA 2ESVE 4XNUL 2UY6A 1CS6A 3F7RA 3M17A 5DQ9B 5SX4I 1E28B 5EFIB 1MRCL 3BKML 1N8ZB 1QRNE 4B5EA 4HW6A 4QHUB 2PETA 2AJZB 1NL0L 5I8OH 3B43A 4XI5C 2ZZUT 4HPYH 5C2UB 4XC1L 2YMXH 1U3ZA 4NQCE 4WW1A 5EZIH 4G43A 3SE3C 1YDPA 4UV7H 2H1PL 2J8HA 4J12A 4O2EA 3X12A 1OAQH 2HJFA 1ZLWK 1RZFL 4ONGL 3VXSD 25C8H 4XHQA 3G5YA 4WV1C 5SX5H 5I73B 1BJ8A 3SO5A 2QQQA 4QXTB 4YBLB 3DECA 3NFSL 2DQCH 4TQEL 3WN5C 3RVUC 3H2WA 4FTVE 1BHGA 3D0LA 5DJ2B 2VN7A 5HGHA 3GRWA 4GG6E 2XWJB 5KVEH 4UINH 4NHUE 35C8L 1UJ3A 3QI9B 1B4JH 2HKFL 1MFBH 1JCKA 2BZDA 2JIXD 1A6UH 1O7VA 3L3GB 3HMXA 3CVHL 5IHBA 3VI4F 4LP5A 5CJXA 4WGVB 1AKJD 2FD6H 4J3XA 3TPUB 1F3RB 5IW6B 2FX7L 1Z9SA 1C12B 1DE4A 3L5HA 3LKNB 5DF0A 5GS0H 1CE1H 2WP3O 4XTRC 4Q9RH 2X1PA 4F37K 4LPYA 3FB7A 2A9ML 1FAIL 1E4KA 1FFPB 3Q2CA 3CSGA 5GXBB 5LXGL 4JFZL 2YUVA 4NYLB 4PG9B 2MTPA 5KG9B 2RCSH 4ESKA 2PO6A 5EU6E 3QCTH 3K8LA 4PRIE 4LSQH 3ZKND 2B7DT 2O26U 4UI2A 1RUPL 1D5MB 5ILTH 1LMKA 2CRYA 3HPJB 2YEZA 5TE4L 1WBXB 5MENB 2E8ZA 4DEPC 5GJSL 3MLTB 3KR3H 1KACB 2GFBA 3ROLB 4PGZA 2A83B 3GSVB 4YWGH 1Z0NA 3CC5A 2YPLE 5CZVL 5T1KA 5IEHB 1OVZA 4WU7B 3I75A 5D7IA 1BVLB 1DEEA 1DN0A 5FO7A 1J1OH 1D5XB 1BP3B 1N5AA 2CUHA 1J05A 5DRWA 4H26B 4N0CC 4GH7B 3SO3B 3S36X 1F2XK 3PGDB 1NLDH 1PX4A 3MGAA 5E8OB 2LTQB 5DI8A 1JK8B 3MYZA 3GGWB 2OXGA 5DLML 3NAAL 3PWNB 5JPMA 5CJQH 3HZYA 4YO0B 2YC1B 1QA9B 2F5BL 3FZUC 3MRBB 5JUEL 3PWVA 2F54B 1I8LA 3IU4L 1TTGA 2Z91B 2A6KA 3BQUC 5EORH 4GKZB 3P11L 3O6ML 2HWZH 1OWWA 5JLZB 1G7JB 1OP3H 5I8CA 1P4LB 3LD8C 4JQVA 3ZTJG 3EGSA 1QLFA 3DPBA 2C3VB 5L6YH 3WDJA 4I4WB 1S78D 1CD8A 2DWDB 4UT7H 1MCJA 4W68A 4WWKB 5F8RC 5I8EA 5CZXC 4X9BA 1X5HA 5ALBL 5E9DB 4LLMA 2VKWA 4CU6A 1KTRL 1I9JL 5TFSL 1KB9K 4NKDB 1T7VA 3LDBC 5IKCB 4JZNA 4R3SA 1QBML 4G9DA 3ET9F 2J2ZA 4PJGB 2NY4D 1KG0B 2B8OT 3QXAA 5IMOB 3FB8A 4MXVE 2NXYB 3ARFA 3CFBB 4HIIA 1UEYA 5CEZD 4NC0B 2XKUA 3U7YH 1KFAH 3Q6GH 3PXHA 1ZEAH 3ELAT 3MZTA 2OR9L 3RUGA 4NWTH 4FZEH 1KNOA 1N0LA 1LE5B 1BEYL 1QBLH 4TUOB 1B0RB 5AAMA 4ORZC 2EYRA 4NZRH 5M95B 2OZ4H 2WBJB 3TN0A 3H6JA 1MVFA 4WWID 4AIOA 2WY3A 4H20L 4MQSB 1UQSB 1ZGLP 3QQ9D 1LEGA 1U8LB 2NY3D 3MLRH 3QHFL 1NCCL 3LMJH 1DL7L 5FYLH 2ZNWA 2EDYA 3EKCA 4ZOBA 2Z8SA 4P48A 5D1XC 4YK4C 3SJVA 5CD5D 5E95B 2SEBA 4ZAKB 1YPZF 4D0CB 1SJEA 1DDHB 4MHHI 3MOAL 3MRKB 4FQCH 2GT9B 3UTZA 2XZAL 3GI8L 2GW5A 4XPAL 1RIVL 2EDWA 4POZC 1CFQA 1MJ7L 1H9VA 3DI3B 3IFPB 3ETBF 5EC1A 4MJ6A 3RVTD 2CXKA 4HIEB 1YEIL 1JZ4A 3MPCA 3KPNB 4EUPA 1CLOH 3C60C 5J1AA 4NWUH 1RJYB 2H3NA 2NR6C 1LK3H 3RUGE 1KIPB 4KHXH 2XG4A 5F96H 5CGYC 1U8NA 4X7CC 1A6VH 5TDPB 4MXQD 2Y7QB 4XPTH 4EDWH 2R9HD 3I9GH 4LRNH 3D48R 1ZTXL 4OZFB 3CFCH 4PTTA 1YECL 4JHWH 4ZOAA 5BXFA 3GIVA 1I7UA 4R2GC 1EO7A 1J0KA 4U33A 4MDJA 5EPMA 1G84A 1T22A 2V2WB 4K3HA 3QIUB 2KBGA 3QPQD 1PJ9A 1I9IL 3GBNL 1CFVL 2I9TA 3FO0H 3F6IA 2XWBA 2MWCA 4WEMB 4EN3D 5I1EH 5JIIA 5BRZD 1P7KB 4LSUH 3MRJB 1SEBB 3LPGA 1NEZB 3D3VA 5FM4A 3LV3B 2RGSA 3EOTH 3ULVD 4L3EB 2ESVB 3FFDB 1W0YT 2OI9C 2ZUQC 1RJZB 1IGFH 1UKQA 5C08D 3QYCA 3MOQA 1EGJA 3BZFB 1QRNB 4K3JH 5FV2A 1YN6A 5F9JA 2C1OB 3E6HA 5IB4B 1DR9A 2HLAA 1TENA 1P9MC 2EDQA 2VE6A 3P9LA 4NQCB 4RFNC 3O6FD 2QKIA 4GW4B 1DANU 3SKMA 4UIMA 1D6EB 2Q6WB 4LVNB 1NGWA 3GKZA 3OG4B 1P84J 2B5IC 3CPLB 4TUKH 3RWDA 1JPTH 5B39G 1A5FH 1OGAE 1FFRA 4L3CB 4Y1AA 1S7UB 3PF2A 5J3HD 5IIEB 1CQKA 1OTSC 5BZDA 1CU4H 2I07B 1BAFH 4S10A 4M5ZH 4RDQF 4FTVB 2IH3B 3MJ8A 2VLMD 3HB3D 4PGDB 4GG6B 2OCFD 4XMLL 3S37X 5K59F 4YX2L 1OCWL 4NHUB 3A67H 2FBJH 5DMKB 2Q3AA 1NUFA 4PJIA 4NNPH 4XHJD 4JKKA 3BVNB 3CFEA 3SDCC 3DYOA 3DSNA 2EYTA 2P1YA 3PIQA 4PTUA 2BC4B 1WC7A 4UT9H 1LVEA 3MO1A 2P5EA 4AMKH 3R1GL 2BDNL 1IT9L 1XF4B 1J0ZA 3UZQA 3C8KA 5D6CB 2EIBA 4YHML 1ZV5A 2DYPA 4WW1B 4ZXBC 3KLAA 2LVCA 4O9HH 1LK2A 1T1YA 3MROA 1UWGH 2EE3A 4O2EB 4P2RE 1R24A 4XCCL 3X12B 5E2TH 5EU6B 4Z7UA 2HJFB 2ADGB 3ARWA 4PRIB 1R5VA 1JPSL 4LNVA 1ZT4B 5D2NA 2R2CA 3MOBL 5E2VL 1M05A 3JBG7 4U0RC 1C08B 3VI3F 3C6LC 2CIKA 3WKMH 5ESVA 3MFGB 5H8DA 5LAXA 4X9GA 3FQTB 1EFXD 3EO1B 3VFRB 3D0LB 3KJ6L 4I0PD 4R0LB 3UX9B 3CSBA 1MREH 4LEOA 1H5BA 2P43B 2A6JA 1QFWM 3BGMB 4IOFD 1HNFA 3W0WA 4NSKA 5TQ0L 4PJIE 4RX4A 3CVHB 1MCEA 3D2UB 4PB0H 1RHHB 3N9GH 3NIDE 4MD5B 5JQ6H 1FH5H 4ODUA 4JFPA 2QHRL 5C0BE 1W72H 1AY1H 1QBBA 5L8JB 1DVFC 4WFHD 3CGTA 2JB6B 1DE4B 3T2NL 1OB1A 1KELL 4BFGA 2P5WD 2VSCA 1Q8MA 4MNQD 1S8DB 1PLGH 4HUXB 3KYMA 4JJ5A 5DRXA 3ILQD 1S9WA 2ERJC 4KTDL 1SM3H 3PGFL 4LRIA 2VXUH 1HHJA 2XFXA 4KMTH 5T1MB 1L9NA 4OQTA 3S96A 4LSTH 1YEGL 2D7PA 3KXFE 1MH5A 3G5ZA 2YEZB 4OCRL 2GITA 4GQPH 2EO9A 5F9WC 5KTEH 2DQTH 4OCLC 5C0NC 5EULV 4JREB 3OXRA 1RUKL 4OCYL 1FBIL 5HYJD 4LU5H 3DUUB 5BJTA 4XAWL 3W0WE 5JNYB 3NZHL 1R3IL 1BQHG 5JIKA 4XCEB 4V1DD 5FYKD 4OZHE 5FO7B 1FZKA 3JWOL 1N5AB 3MLXH 3TVMC 4HWBA 3K2UL 4OLWH 2XN9A 2IAMA 3T0BA 1S7QB 3VWJA 3U83A 2CKBA 2NLJA 2Z4QB 4K3GA 2LAAA 4U6TA 1JRHI 1E27A 1Y6MR 4M7KH 1Y0LA 4BH7B 4N8VG 4GUPA 4OV5A 5E08L 3GM8A 4PV8A 4JPVL 1K8DB 4BSWA 1GOFA 1G7LA 2Z31C 4QHMA 2A73B 4K9EL 2HG5A 4MA3A 1AO7A 3FO2A 3D85A 4G6MH 1HQRB 4M7LL 2CK2A 3EGSB 1QLFB 3KJ4B 5IVOA 4YEFA 4F37F 3IDIB 3TBSB 2PXYC 5JW4Q 4J3WA 5HGAA 1QRKA 3WS6C 1NCDL 5D7KE 3B5TA 3KPQA 5J13B 1DCLA 2DN7A 4XP9L 2CLZA 3BO8A 4TULH 3WE6B 3VXTA 1AGDA 1NGXA 2ORBL 2YZ8A 1U3HC 3BMVA 4QRSA 1HHKB 5C0AA 5DJXA 3REWB 4GAJH 1RJLB 3QXAB 4U1NB 4X9FA 4J3TA 3TO2A 3MRCA 1CVRA 1WBYA 2NXZC 3QI9D 4HIIB 5IMKA 1M7DB 2EZ0C 2R2HB 1FGVH 3B2VL 3MLSL 4Y4KA 4KZDH 1FRGL 2Y6SC 4F58H 1VSCA 1W0WB 1I1FA 1ADQA 4LARH 5LQBH 3RUGB 1SBSL 2DLIA 3PP4L 4FA8A 1MIEH 3S6CA 2CJUL 3NGBB 3WIHA 2ARJB 4KKCD 5ACZB 2NYYC 3L7EA 3L95A 5F70A 3CUPA 4OF6A 3TN0B 5TPWH 1MCPH 5D1ZC 4IEFB 1QPXA 1FPTH 4UQ2B 2RB8A 4L29B 5FK9A 5FHAH 5FHBH 4KVNL 4OFPA 5KSUA 4XP6H 4Y16A 2APFA 2CH8A 3IYLW 4N0YH 4MNHA 4PGCB 4XPBL 2QSQA 1Q0YH 3BIKA 1FQ9C 3GJFA 1A64A 4XCNA 5GRVL 4KROB 3IF1A 4HBCH 2SEBB 1AXTL 1CR9L 2GY5A 1NMBL 3OKLA 3UTZB 4NNXB 1JGLL 1LNUB 4JGUA 4F7EB 3QWRA 5MEND 1S5IH 3IFOA 4WHDA 3REVB 5KANI 1CFQB 1VEPA 4NGHL 3CDGB 4L4VA 4EUPB 1KTLA 3BH9A 4MNGA 4YHKL 1Q1JH 4RMRA 4WFGE 4PY8J 1OSZB 1TPXB 2H3NB 3ZHLA 1PY4A 2JTDA 3PABB 2V5MA 5I66B 3O8XA 1U8NB 4Z0BH 2X7LA 3SDDA 3V2AR 3V0WH 2R1WA 2EIZB 3VE0B 2AJSH 2C4FU 3O3EA 3K7UA 4AEIL 5CD3B 4YXLL 3FKUS 3W9DB 1PKOA 1U3YA 4PJAA 4XRCB 3OAYH 3RDTC 4K23L 4RGNC 1CWVA 5BXFB 4NZTL 4NO2A 4WFFD 1OGAB 5CZKA 1NDMB 1QP1A 5C0RL 5F7FA 4LKXA 4PLOB 3V7AE 3O4OB 3PWLB 3TWCH 4PLJD 1HINL 1T22B 2F54D 3FRUA 4FQ2H 4DZ8B 4OFDA 2RJMA 4EQ3A 5L2JB 4HG4J 4G8GA 2OTUB 1DBBL 1INQA 1E6JH 4RGOL 4OTXH 4S1RH 4LSPH 4P46A 1DQQB 4KHTH 1I9RH 2OJZH 1IC7H 1QSZA 2OL3L 1JV5A 5GGRB 4K94L 1G9ML 4WWKD 2WM0A 3W11D 5H94B 1LGVA 5BVJA 3QZWG 5E9DD 2P46B 4MNGE 4MQXC 3LY6A 3C08L 1V3JA 5C0EA 1M7IA 2NY2B 5CBAB 1IKNC 4IDJL 1YN6B 4LAJH 1AGCA 1AHWA 5F9JB 4S1SL 2HLAB 1AGFB 4PJ8B 3VGHA 4AEEA 3P9LB 2VE6B 1DFBH 3OKEA 1LO0H 3O6KL 5A1AA 1KYOJ 1EHXA 2WBKA 3SKMB 4XZUA 3MXWH 3BHBB 5F3BA 4P2RB 2VQ1B 1MFEL 4JHBA 3G6JA 3QUXD 5AWNH 4D0BA 4L8CA 3JXAA 1TVBB 4GT7A 3R8QA 3RWDB 1QO3B 4GRWE 3MLYL 1CDGA 4FFVC 4WEBL 2EDLA 1HH9B 4X6BA 5HD8D 2VNCA 3C5ZA 1T1ZA 3E8UL 2WBJD 1FNEA 3QAZC 1UJTA 4NPYB 4P5TA 3CXHK 3BDYH 3VWKD 2CGRL 1VFMA 4HJ0C 4PJDF 2R1XB 5FA4A 1INDH 2EDRA 5IVZB 4PJIB 3K8KA 1HILA 2EYTB 3DMMB 4YC2C 1W8OA 4DKAA 1GHFL 5A40E 3MLZH 5JW3H 4YIQB 3MO1B 5K9JL 4ERSH 5C0BB 3S36H 4NCDA 1UH3A 4ZAKD 1E6OL 1ZS8A 5K93A 3RIAK 2NY5H 4M61A 4NZJA 4JZJB 3ARED 3OKNA 1MQKL 1IEBB 5EO1A 1N59A 4U05A 3RIFK 4HWUA 2CRIA 3MBED 1T5WA 2W0PA 1UB5A 3GUTA 1T1YB 2DMBA 3QIWA 4LHJB 4IMKA 4N0FB 3TO4A 4MA7L 4YE4L 5D2NB 3EUUA 1I1RA 3VG9C 1XGTA 3VW3L 4JAMB 3IDYC 4X0KA 4P2OC 3BX7C 1F5WA 3T77A 3X3GL 4PRPE 1NGZB 3WNPA 1CBVH 2WINB 1BBDL 3IETA 3KXFB 2DOCA 2FX8L 5F7MC 1IGCL 5FEBA 1Q94B 2EXYD 1DBML 3MJ6A 2FWOA 1FN4A 4LIQL 4MAYA 1L0QA 5L2KA 3T0XA 2AJ3A 2PTUA 1ITBB 4G9FE 3RL2A 4C57C 2DWEA 3V5HB 3W0WB 4MVBC 2C7UA 1ZANH 5JQHC 1JZ8A 3TBTB 1BFTA 1S78C 1EA9C 1UWXH 1YA5A 4AZ8A 4Z95L 1L7TH 1SYVB 4WW2C 3RGVC 3U0TA 4OZHB 4U31A 4B50A 3QIUD 4WJ5B 1S7XB 2EXWC 4OI8A 5DK2B 4KVCL 1RUQL 4TVSa 4IMLA 5E6YA 3SE4A 3VXME 2NY4C 1FYTE 2V5RA 3MC0A 3LN4B 1X44A 2V9QA 2HVKA 4XP4L 3RWCA 5HPMB 2OTPA 4TSCL 5DRXB 1T5XA 4LDOB 4LLQB 3N1FC 3RU8H 4ODSH 1QRND 1JHKL 1QFWH 3FB5A 2XFXB 1C5BL 3NIFF 1VKXA 3N1MC 4BH8B 1TNMA 5TE6L 1OP5H 4B7IA 1HHIA 4KMLB 3EO0A 2VH5L 2VMFA 5DJDB 3UC0L 3NN8A 4LIQE 2HFFA 5EBMA 2GITB 4JFFA 1HHHB 1CVSC 2BY3A 4PLKD 1QPPA 3VFUA 1QNZL 3MLUL 4HHAA 5I30L 1BZ9A 3ULSA 2E9BA 2NY3C 1MHPL 4G6JL 1OW0A 1S7RB 3LKPB 4OD1L 1JNJA 4NDMB 4LHQB 4MXWH 3WLBB 1IL1B 3DETD 3NA9L 4IIQA 4OLVH 4ONOA 2NW3A 1R3LA 4M1DH 1TZIA 3U9PL 3MYJA 1PQZA 3JV4B 4NT6B 3DX8A 4U1GC 2P44B 3N0PB 3L3OA 1A9EA 4HLZH 1YNKH 2J8UE 1S7VA 4UIKL 1WZ1L 3EO9H 2HFGH 3QDGD 1DUZA 1W0VB 3HTLX 2HH0H 5TF1H 2NLJB 3ULVH 3I6GB 1PKQE 4JPIA 4M43L 3RVTC 2EDKA 1AD0A 4U6YA 2CLRA 4Y4FB 2H8PB 5D72H 3TYGH 3AM8C 3L3HA 3K0WA 2A9NL 2V7NB 1N0XL 1FC1A 2AGJH 5D2LF 3VD5A 4M7ZB 3PHSA 4TVPL 4BSWB 1JYWA 1BJ1H 2RBLA 1MOEA 1ERNA 4K3DL 1UCBH 5FXCH 3T0EA 4MA3B 3FO2B 3SBWA 1YQVH 2R9HC 3DO3A 3B3IA 3D18A 1OAZL 3ME0A 5EU3B 1X5XA 3QA3A 1FGNL 1EX0A 3ULUL 5TQ2L 5D7JA 4I77H 4LQFH 4PRID 2XICA 2GK0B 1H3PL 3E6FA 3BP6A 4ETYA 2EEDA 3QH3B 4XNZB 3ARUA 4JFQA 5IG7B 3U6RA 1RAMA 2X1OA 3UJJL 2CLZB 1IVLA 1YYLH 2FIKB 1NGXB 3K74B 2PNDA 4XC3L 4YDIL 3BKCL 4ZPTA 3AS0A 2EEAA 4JR9H 5DJXB 4G7VH 5C0CE 5B22A 4CW1A 4GBXD 4Z7OE 3TO2B 4YAQB 3HE7C 1GC1C 2YSSB 1NPUA 5EBLB 2YPLD 2Q86B 5IB1A 3WIIH 4D9RD 3D2UD 3C5SA 5E5MB 4HDIA 4U7MA 2HJKA 5KSAC 1T1XB 4TVPE 3QULA 2JCCF 1XIWA 3L7EB 3GSOA 3CUPB 4EQ2A 4ZPVA 5GGSA 3JUYA 4X98A 2R1YA 2NY6C 3Q0HA 4KJWD 1IC5H 4DK6A 2EH7H 3ULUE 3DVNA 4Y2OA 3WEXB 1CTOA 2NY1B 3CIQA 4MNHB 1TIUA 5ENWA 4JM2A 5IOPA 5IFJB 1H3UA 2AK1H 2YRLA 1NGPH 1MHCA 2GQHA 3FMGH 4KTYA 5GRWA 1U36A 3IF1B 3B9KA 5ALCH 3BP5B 2M26A 5DD6A 4FS0A 3S37H 4PGEA 3T4AA 3TCLB 3G9AB 5ISZA 1T03L 4GKSA 2B0SL 5IGXH 4NO3B 3SDXA 3L5WB 1OAUL 3AS3A 5IMLB 1ZT1A 2ICWI 3HB3C 1NMCB 1CQYA 4X6CE 5I1AB 1A02N 4H1LB 1HI6B 4JO1L 1MFCH 4DUVA 3HC0A 5E2WH 5EU7E 3F58H 1NAKH 1ZHBB 4Y8DC 3BH9B 4MNGB 4ONHA 1NC2D 4OZGF 1BZQK 3O8XB 3SGDH 4NC2B 1EJOL 3IKKA 1XGPA 3B2UD 5HVWA 3T8XB 1D9KC 1CFBA 3AMKA 2R1WB 1LQVA 1G6RA 3KNBA 1PYWB 2ICES 4NJ9H 1AD9B 4KJPD 2AERT 3QUZA 4HF5H 1BFOB 5DSCA 5IJVB 3MXVH 3UYOD 4OGXL 3NTCL 1IFHL 1DBAH 5D1QC 2L7JA 4GRWB 3GSQA 4M1GL 2AJVH 3DSFL 4QNPF 4J3UA 4R4NC 1WWCA 1AR1C 3CMOL 4LKXB 4RGMC 5GGVL 1OAKL 5CIPH 1BOGB 1Q9WB 2NPLX 1RZJC 1KN4H 2ARJQ 5HGBB 4LPUA 4F33B 4J6RL 3OX8A 1IAMA 2XZCH 5DQDL 1IAOB 3VRJB 3T65A 2Y5EA 1INQB 2YN3A 2OL3B 3HNVL 5INCB 4FQJL 5JDSA 4I0PC 3T4YB 1JV5B 5IMMB 1JHTA 4DGVH 4IOFC 3AGVA 4L8SC 1ZLSL 3HZMB 3MCG1 3QEGH 4FFZH 2FL5A 5FYKH 4WUKL 3B6SB 4CVXB 1LO5B 4O51B 4PJ7F 5J6GB 3GSUB 1MY7A 4UU9B 4G8EA 5ACLA 2WNGA 5F89A 2QJDA 5D93B 2VISA 3HG1A 2YKLH 5TF0A 3IGAA 4KAQL 2HT2C 2EC9U 2FEEL 3S4SG 4AM0A 3BPCB 1KJ2A 4FQLH 4D0BB 3ILQC 4L8CB 3FN0H 4X7EC 2X10A 3V4PH 3B9AA 5KJRL 4PRAB 4KDTC 4RFEA 3AB0B 4P2QE 4UNUA 4PRPB 4X6BB 4CBPA 2A1WL 3AXLB 1T1ZB 4LLAA 2VDNL 4PBVC 1AJ7L 4OI9A 5BZWB 3VFTB 4P5TB 4M6ML 4U1SA 3PWPA 2HT3D 1D6VL 1FORH 3BYTA 4G9FB 5GHWL 2W9LA 4YFLF 2KH2B 4KQ3H 5AZ2H 4J4PA 4BSJA 3QXDB 3G08B 3NCJH 3EAKA 5DUBB 5I1JH 3FCTA 4KROD 3ARGA 1MFNA 1RZ8A 5DTFB 2VXVL 1M71B 5FV1L 1ZVHA 3OKNB 3HC4H 3VXMB 1FYTB 1N59B 2ZCKL 3Q5OA 3S35X 2ZCLL 3RWGA 3B5HA 12E8H 3LEYL 4QRPA 3VFWA 1SY6A 3WIFA 1CFSB 5KVDL 1UB5B 3FHQA 3SQOL 4EIZC 5GGQL 4ZNEE 5MEPA 5D6DC 4Y2DA 3NOIA 2ICWJ 3MA9L 1RVFH 2AJUH 5C09A 5C7XL 1QLRB 1BD2E 3ARBD 4R26H 3D9AH 4X0KB 4X6DE 4PRHE 1FNSL 1PW3A 5IR1A 3AC0A 4PJXA 3QUYA 5C0FA 1RULL 1OP9A 4R96A 4LCIH 3MV11 2Q8BL 1T1WB 4AK1A 5DDHA 1J12A 3G5VA 1EJ6A 2V6HA 1I7ZA 2Y5TA 1NANH 1E0OB 2BVQB 5AYUL 2DWEB 2H2PC 1OGAD 2JB5L 3A6CH 5DJYB 5EU5A 5BS0E 1FVEA 2Q76A 3WN5A 1CD1A 2VOTA 5I73C 3U0TB 1QOKA 1RZKH 3P4LA 1CK0H 2PYEA 4YBLC 2V7HB 4KGLA 4RNRA 1FLRL 3EIFA 2ZUUA 2J8UB 4JGMA 2Y07H 1YC8A 4ELMA 5DD0H 4YHOL 4NN6B 3MX0A 1FSKB 4QRRD 1SYSB 5A3IC 5LGJB 1YZZA 1PKQB 3RWCB 5DZLA 2YUXA 3V5KA 4N9GA 2BP3A 4W4NA 1XF5B 1WIOA 1RK1A 3CH8A 4UDTB 1KTDA 3GSNA 3QI9C 3AFLA 3MLWL 5I15H 2XTJD 5HHPA 4XWOD 1VKXB 2AEQH 5B38A 3QPXH 1BGXL 3C9NA 4OCWH 3VXQB 4KFZC 3V0AC 2I26N 1WZKA 4KKCC 1FG9C 4PJ8D 3QDMD 4PJXE 2LVEA 4KV5E 3FOMA 3RIAF 5TE7H 2HFFB 2LU7A 5CCKL 5CILH 1X5ZA 4KKAC 4M9OA 4G59A 1TNNA 2QSVA 5L0QB 1CICD 3RIFF 4XBPA 3VFUB 4HHAB 1BZ9B 3C8HA 3BP4B 3QHZL 2VC2L 4IRZL 1LP9F 4Y5YB 2DLTA 1U8HA 4JFOA 1V3LA 3F5WB 3MV8D 4KDWA 3FFCE 1I8KA 3P0VH 1R3LB 1F11A 3MRIA 5C07A 4LCUB 1AGEB 2PYEE 3MYJB 1HNGA 4WENB 5F7EL 2VN4A 4UTBH 5C0CB 1S7VB 3OTTA 3BN9C 3RTQD 3IJSA 3KGRA 1K8IB 5DJCA 4ZUWB 4JPIB 5C6TH 1KEGL 2CLRB 3DMMD 4XPFL 5HHNA 3CZFA 1F02I 1A7NH 2CRMA 5MEOA 1B4JL 3RY6C 1QFUL 2P8LB 3VFOA 2Z8RA 5C0BD 3ARDD 2VZOA 5CJ8A 3HRZA 5HHOE 3DV6A 5F88A 1TCRA 3LOWA 2FD6L 3EW3B 2GY7B 4QHLB 3SO3C 2VLKE 5GS0L 2VZ1A 1GAFH 1OSPH 2FSEA 2J6EL 3KPLB 4QYOA 4UILL 4Q9RL 1HXMA 2LTQC 2ZWLT 4MQTB 4PJGF 1YEEL 4LLVB 4J3OC 3BP6B 1IAIL 3U6RB 3ARXA 3BQUA 1BIIA 3OKDB 3DVGB 4OZIA 4LSQL 4PLJC 4O02L 3KXFD 3RP1A 1X5LA 4MYWB 5C07E 1N4XH 5T1LA 5IQ9A 5ILTL 3DRTA 4X6CB 4X5LA 4UDUB 3OJVC 5I2IB 2DLFH 3M8OH 4GSDL 2G5BA 1HSAA 4OFYD 2I25N 1I7RA 3C5SB 3UMTA 1S7WA 4WWKC 4PD4J 3W11C 4AL8L 2HJKB 4E41A 2W9EL 3FAWA 5F7KC 3EYFA 1NSNL 1J1OL 3CFKA 4Z7VA 4ZPVB 4WNQA 2IBZX 1Z3GH 4RWYH 2AABL 4OCXL 3W82A 4WFEE 3PWJA 3THMH 1PEWA 1NLDL 2NXYC 3CZJA 4GFTB 1TXKA 5J12B 5JXEC 4WTWA 1NC4A 4UUJA 1S3KH 1J88A 2RAMA 3BZ4A 5CJQL 1T2QH 4I2XA 4OM0H 3S98A 2V5SA 4U1JA 5HD8C 3T4AB 4OZIE 1A3RL 2BMKB 2WBJC 3BP7A 5HY9A 4OUUB 1MF2H 4HJGA 3CXDH 2HWZL 2EC9T 4P3DA 4G5ZL 5D1XA 4I3SL 3BKJH 5L6YL 2WUBH 3RFZC 1FL5A 4XAKE 5D7KD 1PFCA 2HTLC 2UZIL 3U36A 1EUTA 3B9VA 1VACA 4LEXH 1CXIA 1CF8H 3TFKD 2XTLA 4ZAKC 2B2XH 5EC2A 3VFGH 1SHMA 4NN5B 1S7SA 4JCLA 1F2QA 3KPTA 3N85H 4Z7VE 4NKOB 3MMEB 3UBXI 4QHNB 3VRIA 4TNVK 3C60A 5CSZA 1QACA 2BVYA 3BEWA 3TBVB 5DSCB 4EIGB 3DYPA 3RZWA 3OXSB 1UM6H 4HKZA 5HSFA 2CLVA 2DF3A 4P2QB 2RR3A 3H42H 4NRXA 4EOWL 3WBDA 5AYQA 1Q72L 1XZ0A 4LVEA 4NWTL 4FZEL 1NCAL 2R0ZH 4DZBA 3DX6A 3MBXH 2YA2A 4I2XE 4XNYL 2OZ4A 3AROA 5DJ0A 43C9A 1TZHB 2W91A 2A74A 4M9PA 3H9SA 2R4SL 3BZEA 2EXYC 4LCWA 2MCPH 1UKTA 1YPZA 3HNSL 5JDSB 3ZKMD 3J8F7 4R7NB 4PP2A 1WISA 4JRYA 5EUOA 8CGTA 2NTFA 4J8RB 3MLRL 2CIIB 1NBQA 3OZ9H 3PDGA 1FP5A 1ZLUK 5EOQH 2FL5B 2PF6A 3WFBH 1TZGH 4HK0A 1EEZB 2AV1B 2GAZB 2UZXB 3QIUC 1JFQH 5BQ7B 4HGWB 1C7SA 5IWLC 3N50A 3QEQE 3UO1H 1QHOA 4ZOEA 4V3EB 2VISB 3BPOB 3X11B 2DQJH 3IGAB 5I1HH 2OI9A 4GAYB 3TA3D 4ZUTA 4G8FB 3QEUA 4P2YA 5T3XL 1MY5A 4H8WL 3BKMH 1FNGA 5KOMC 3RNQA 3GMMA 3MRGB 4GG6F 2M2DA 4RFEB 4X6DB 4PRHB 4NWUL 5J6HA 4MMXC 3OHXB 4DFIA 3D0VA 1P9MA 5IBLD 5H2BA 1NUGA 5FCUL 4LKCB 5B4MD 4L1HA 2H1PH 3OSKA 2DQUL 4PJFE 3N1GC 3SE8L 3RWHA 5LG1A 4QY8A 3CJJA 1JE6A 4LDEB 2PTTA 2Q3ZA 5DURD 1DBJL 4ONGH 1K2DA 3ZE2F 4LCWE 4EDWL 3X14A 4LVNC 1F58L 2HTKC 4LRNL 2E7LE 1TVHB 4YZFE 3O45A 2RQ8A 5BS0B 4JHWL 3VXRD 3NFSH 3T04D 5EUOE 3WUZA 2L4OA 1VB9A 3QDJA 3LKSA 5C92A 2BCKA 1RZ8B 4F9LC 4OZ4B 3SCMB 4ORGB 4XPHL 4FMFA 2B4CH 4HZLA 4ZYKB 1S7TA 35C8H 2HKFH 2ZUYA 3STBA 3SDCA 3U9UB 3VFWB 2FX9H 1RI8A 3JV6A 4NRYA 5F9OL 3ZDXE 5T3XE 3EJZD 1DJSA 1XMWA 5E2UL 4LSUL 4Y2DB 1PDKA 1URLA 4FQXB 4N8VA 2NZ9D 2FX7H 1HCFX 2W1NA 4FQ1H 1IGFL 5T3ZL 1FFQA 4JFDA 5DJ6B 4PJXB 1CT8A 4K3JL 4ZXBA 1MELA 5GGRY 4ZTOL 1UH4A 5DA0B 5LXGH 4JFZH 5F1IB 4Z78A 1FZJA 4Y0GA 2BY1A 2D0HA 5FYKU 2VDRL 1BVKB 1P5UA 1JTTA 2ADIB 5FKAB 3WUWA 1LE9B 3BT2H 2EECA 2VAAA 4LAQL 4YHLL 4KZEH 3EBAA 1RUPH 2P7TA 5I0ZA 5EU5B 3C6LA 2X4SA 2ENYA 3FFCB 1DUYB 2G2RA 1JPTL 5TE4H 3ARPA 2IH1B 3TNMA 5I71B 3N1QC 2HFTA 5GJSH 3QDJE 2PYEB 2Y1VA 4HK3N 4WO4B 2V2XA 1A7RL 1CU4L 1BAFL 2MMXA 2VERN 3KYNA 4WUUA 2ZSVA 1A4KA 4CRPA 1IEAA 5EA0H 5CZVH 4R0LC 1J0YA 4K07A 5DHVA 3JTTB 3VDCA 4N9GB 1NFDE 3A67L 3F7VA 5A2KH 4HUVA 2NMSA 3MRQB 3UTTE 5F1NB 1KT2A 5T3ZE 1DVFA 2XI9A 3MV7A 4U4BA 5HHOB 4MS8D 4UT9L 3RRQA 3IDGB 4Y4HA 4Y5VA 5CJXC 4JFDE 3U79A 4RDQG 1MCLA 2VLKB 1KB9J 2GSGA 5DLMH 3PJSB 4YXKL 3NAAH 5DVMA 4TTGA 1F6AB 3QUML 5GGUA 2X4NA 5TDOA 4EI5D 5DVOA 2N7BA 2RFXB 4ODBD 4JO4L 3V6FA 1JWSA 1UWGL 1OD9A 4KRNA 4KY1L 4MXVF 3BUTA 2Q87A 1NFIA 1HZHH 2M1KA 3O6MH 4JFOB 3I84A 5C07B 3HI1B 1A1OA 1OAYL 4X4YB 5SWZA 3QISA 1X6NA 4GO6B 4JDVA 1LEIA 3WKML 1FLTX 1SEQL 3RX5A 4O4YH 2CKNA 2JK5A 3U82B 3MV9A 2Q1EA 1CLCA 4WUUE 4JLRA 3RNKB 5ALBH 1JPFB 3ALPA 4BJLA 1F13A 5BOPA 4WHTA 1GJIA 4JREC 2H32A 1I9JH 1MREL 5TFSH 3M1BA 2R2BB 1BWMA 5HHNB 3CZFB 3PL6B 4N0UA 1IE5A 1UYWL 1B0GB 3TVMA 5FECA 1J5OL 3HRZB 4LLDA 1W72A 3N9GL 2GJ6E 5A16A 3L9RB 3B2UC 3FQUA 3P4OA 1CXEA 3G5XA 4LDLB 4NJAL 4HAFA 32C2B 5EOTA 3IAQA 3K2MC 4QYOB 4N1HB 2B39A 4KJPC 3FT3A 3QXTA 2OR9H 3LN5B 1DBKH 1YMHB 2DM7A 3EYQD 1BEYH 5DRNA 3OKOA 4ONFH 2NNAA 1IQDA 4JFEA 1BIIB 4OZIB 4KMTL 4YNYA 1CDJA 4H20H 1KLUA 4X8JB 2VLRE 2FATH 3RUGF 3WFEL 3QHFH 4LSTL 4QOKA 1NCCH 4U3CA 2FEDD 1KJMA 2NW2A 4ODWB 5FUCC 1DL7H 2PXYA 2DQDL 4X7SH 1TJGH 3QNZB 4JQVC 1IM3A 5CAYB 3D39A 3LAFA 3KJ4C 4JQXA 4NQED 2APVA 1I7RB 1I1YA 4U49A 3MOAH 2VLJA 4LU5L 2FHBA 1X5YA 4XPAH 5ESQA 1IILE 1U3HA 5J13C 3VD4A 1MJ7H 1YMMD 1MI5E 3FOLA 4LK4A 3RZCB 4GLRH 4JQIH 4C56E 4Z7VB 4WNQB 3GBLA 3TJHD 4KK5C 1WF5A 3O2DH 4K55A 1XR8B 1BM3H 2MQCA 3QXWA 3S97C 4UUJB 1UXWA 1CL7I 2VLLA 5B39B 3TBWA 3EYOA 4QTHB 1TTFA 4KMQA 2XPGA 3B9EA 5TJWK 4HJJL 4I2XB 4X4XA 2AXFB 3NGBC 5F7LB 5D1ZA 4JFEE 4ZS7H 1T7YA 4D2NA 1YECH 2Y06H 3BP7B 3TN0C 5CLWA 4TN9A 1GZQB 2YRZA 5EU4A 3P3YA 4HJGB 1YEDA 2GJZA 5CP3H 3KDMA 5FOBA 4PJ9B 1BIHA 1FL5B 5I17B 4AT6B 4OF0A 1I9IH 3GBNH 5K9QG 5B3NA 4NQSA 5IBTH 1CFVH 1V7ML 3P9MA 2E6JA 4YDJB 2ZOKA 3SDYH 2EC8A 5EC2B 1ACYL 1PSKH 3QEQB 4PJHA 5C0CD 5JA9A 1B6DA 2EYSA 1S7SB 1R3JB 2ZG2A 4B0MM 5D9SA 4OT1H 1G1YA 3BEWB 4J7RA 5IQ7H 4XVUD 4K8RD 2Y72A 1GVIA 1JN6A 5IB3A 2CLVB 1KCVL 1GPOH 1UC6A 4JY6A 3L7FA 3Q1SH 4TVPD 4DVRH 3C09B 1ONQA 1TPXC 1FZOB 3UTOA 3UBXA 4GW5A 3GHBH 3O2WL 4KTEL 3K4ZA 4PJFB 2ATKB 2A74B 3PHOA 3RDTA 1KXQE 3NCBB 2R69H 4LCWB 4CNIB 2F53E 3ULUD 3DLQR 2HMIC 1AQKL 1LILA 1XT5A 3FONA 1JVKA 4S0SD 5EUOB 4XP6L 3VXSA 5T5NF 4W6WB 2X4PA 3A6BH 4N0YL 2AKRA 3RWJA 2YD8A 2VB5A 1AP2A 4HIHB 4NIKB 3O4OC 3BWUC 4MDIB 5ERWA 3SKOA 3WFHA 3EDDA 4U1HB 4XMLH 4HBCL 4YX2H 1OCWH 4QCIB 2X09A 1QG3A 3SGDI 1A4JA 4XMPH 3ZL4H 2VUYA 2BDNH 2JIXA 5ESAB 1IT9H 3R4DA 1J10A 3CK0L 4Z77A 4XWGL 1C5DB 4OQ1A 2FB4L 1KENH 2BNRD 5ANMA 1AKJA 3O81A 4PJIF 3D0VB 4YHZL 1IGJB 4U1MB 5BOZG 5H2BB 2I5YH 1MRDL 2NY2C 3DNKA 3TYFA 1QR1A 4GG8A 3NIDF 4Z0BL 1UFUA 4PJ8C 3GMNA 5DEFA 4XCCH 5J9PA 1KPRB 3WFDL 3P4MA 2PTTB 1JPSH 4OGAD 4R7DB 3C87A 3MOBH 5E2VH 1EEQA 3X3FL 4TNVF 4N68A 4BQBA 2D2OA 2WP3T 1NJ9A 3NH7H 4MX7A 2Q7NA 5IROC 3NFPA 5BVPL 4KRPB 1BQHB 1G7HA 3QDJB 4IRSB 5HYQB 1D7FA 1XR9B 4YHYB 1OLLA 3Q5YA 1NUDA 3KJ6H 2BVOB 2DLEA 3QP3A 3VXUD 4Z0XB 4HZLB 4QXUH 5HHME 4PREA 1FFNB 5TQ0H 3SY0A 1G0XA 4PRBB 1L6ZA 5GSVA 1E6JL 4S1RL 4NRYB 4DVBA 2VRAA 1S9VB 4XXDB 1NFDB 4KHTL 3O3BA 4JO2L 3DROA 2OJZL 2QHRH 3UTTB 5E24E 1MCHA 4N8VB 4P4RA 4D8PB 1LWRA 3DMMC 1ZA6A 2DIBA 5HYSA 3T2NH 2OTWA 1IGML 4JFDB 3TNNB 1KELH 5I6XB 1CT8B 1U95A 2MFNA 2VL5B 4JZJC 1L9MA 3BH8B 1A7BA 1ZGLB 1ND0A 3GJEB 5FM5M 4YFLI 3PGFH 1TQBB 4LLUB 4XVTL 4DOHE 1I8IA 1LEKB 4P5KA 1ZLVK 3MXWL 1MLBB 3KPRD 5DYOA 5LCVL 3QIBB 2FJHB 2VZVA 4U7KA 4XH2A 4P2OA 3C2AL 2GJJA 4P2QD 5GS1B 1VHPA 1YEGH 4PJDA 2G2RB 5D2NC 1P53A 4OCRH 4RZCB 2DL2A 3LKOA 4Z8FL 1JWMB 4MD0B 2V2XB 4GRMA 3ROOA 4WUUB 1A4KB 2Y9RT 1G7IA 5GISL 4Z7QF 3BDYL 3CX5K 2VXQH 5EOCL 1CDYA 1EEUA 3SHSA 1H5BC 2A2QT 1JGVH 4WW2A 2W38A 2J1KA 5E1HB 3JWOH 2DJUA 1UXSA 2JELL 5GIRA 1KT2B 1ZKAA 4JRXD 5LVEA 4LCCA 1JGEB 5CEXA 2GJ6B 1IZJA 4JN2B 2OR8A 4Y4HB 3QCUL 4Y5VB 3EHBD 5IT2L 1HHGA 3FQNB 4KK6D 3DUSA 1QQDB 2NY5L 3UTSE 2DM3A 2GSGB 3K4DA 1KN2L 1REIA 4WHCA 1T7WA 5GGUB 2X4NB 3T0VA 5E08H 5IFAL 1GH7A 4JPVH 4L8BB 4H0HB 4ZQKB 1IC4H 2VXTL 4HIJA 3U2SA 1RIUL 4NQXB 3IVKB 5D7LD 1IM9A 2YPKA 3IDNA 1BD2D 5MEQB 4PRHD 4ISVB 2ZCHH 3VJ6A 3U46B 4YHNA 5KVGH 43CAB 3DURA 3LCYA 1A1OB 2VLRB 4M7LH 3VRLF 1AC0A 1KJVB 2FZ3A 5DJ8A 3TT3L 1QEWA 5HI5D 3SDAB 4J1UA 5FGBA 2YD7A 4JLRB 5EO9B 2BNUA 5FFLA 2FGWH 5FF6A 1RSFA 1XF3A 4U7SA 5C8JA 3P73A 4ODXA 5BS0D 4XP9H 3M1BB 2XY1A 4R4BB 4NQTA 3IAPA 5INDA 1OAXH 1ZANL 4FG6D 5FECB 3JWOC 3PQYD 4PG2A 1MI5B 4HD9A 3NABH 4C56B 1U8QB 2UYLA 4HS6A 4MQ7A 5GZOD 1J8HE 3FQUB 2PO6D 5F3HA 1NCWL 4HT1L 3MRNA 3B2VH 3GMOB 3MLSH 1UM5L 3FT3B 1SBSH 2IFGA 3PP4H 3BJ91 3OKKB 1QSFE 2CJUH 2H2SC 4Y4FC 2OS7A 4P9HC 5DRNB 4FFWC 4BFBD 5KVMC 1X6LA 1IQDB 2EE9A 1FNFA 4JFEB 1QFWL 2X2YA 1M6OB 4M7ZC 1KLUB 1XCQB 4K9EC 1ZXQA 5FDWA 3STLB 1HEZA 3DV4B 2J8OA 5T1KD 1JGDA 1HQ4B 2W9DH 3GSRA 1Z0MA 3ZKMC 3BRFA 1AXTH 3R06A 5D7SL 1CR9H 4OD3H 4BQCA 3QZWB 1NMBH 2ZJSL 5HI3D 4Z6AT 2AXJA 1JGLH 1FL6A 4MXWL 4XNZC 3NCFB 3NMEA 5HHQA 1FVDB 4WO4D 4GMTL 1OT2A 4EN3A 3O11B 3GMLB 3HE7A 4YHPA 4KU1A 1JHLH 4H1LH 1P5VA 4RWHA 2A6DA 3S4SA 3OMZA 2HFGL 4H5SA 4QT5B 9CGTA 1GL4B 3WL9B 2WMPA 5C08A 5JO5B 4MJ5B 1T66C 5KSAA 1T0MB 3IJHB 1UXWB 2XACC 3MJ9L 1A6AA 2CSPA 3TBWB 2A38A 3TYGL 5A2FA 2ITCB 4S11A 4MCYA 2BOBA 4HGKC 4X4XB 4AEIH 1GGYA 5HHVL 3ILPA 2BOCA 4YXLH 5IBLC 3O6FA 4U6VH 4Z5RB 5B4MC 2VLKD 4K23H 2F53B 3D5OF 4KJYA 4NZTH 3HPLA 1G7QA 1YEDB 2VIRA 2GJZB 5C0RH 3KDMB 5DMIH 1HINH 4HFUH 5FOBB 1KOAA 2NY1C 1D5ZA 4HWNA 2ENSA 4YDKL 1WAAE 4I77L 4LQFL 3OPZH 4GKNA 1T2JA 3MGTA 4PJAF 4RGOH 4RIRA 3ARFD 3GMPA 5KSVA 5JZ7D 4GRWF 5JOPD 2VDOL 4YUEH 1KIRA 5DZNA 1EZVX 1YYLL 2E6PA 4K94H 5F97E 4X7FC 5BRZE 2H26B 2IANE 4G7VL 1NMCC 4A6YA 3MUY1 2ITDA 1MRFL 3S5LG 1I4FB 2G9HB 3CXHJ 3EJZC 3BESR 2WIIA 3PL6D 1ZT7B 3HS0A 3RPIA 5DC9B 3QCVL 2VZ3A 2X5PA 2F15A 1CDIA 4S1SH 5T33H 1WVZA 1D9KA 3G6AA 3O6KH 3QFJA 1B90A 3O8XC 2HJLA 1CG9A 3K80A 1CFTB 1I1CA 1UZ6E 4FXGB 5FKPA 4RAUA 3UPRB 4WFED 5IW1B 4ETQA 3PHOB 4X83A 3WHE1 1FVCA 4Y8AA 3H7BA 3FONB 3MLYH 3VH8G 1KEMH 4WEBH 1UWEH 4JEGB 3VXSB 3LPWA 1NAMH 2AW2A 1YY8A