1S7VA

Crystal structures of the murine class i major histocompatibility complex h-2db in complex with lcmv-derived gp33 index peptide and three of its escape variants
Total Genus 67
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
67
sequence length
276
structure length
276
Chain Sequence
GPHSMRYFETAVSRPGLEEPRYISVGYVDNKEFVRFDSDAENPRYEPRAPWMEQEGPEYWERETQKAKGQEQWFRVSLRNLLGYYNQSAGGSHTLQQMSGCDLGSDWRLLRGYLQFAYEGRDYIALNEDLKTWTAADMAAQITRRKWEQSGAAEHYKAYLEGECVEWLHRYLKNGNATLLRTDSPKAHVTHHPRSKGEVTLRCWALGFYPADITLTWQLNGEELTQDMELVETRPAGDGTFQKWASVVVPLGKEQNYTCRVYHEGLPEPLTLRWEP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords H-2 class I histocompatibility antigen, D-B alpha chain
publication title Determination of structural principles underlying three different modes of lymphocytic choriomeningitis virus escape from CTL recognition.
pubmed rcsb
source organism Mus musculus
molecule tags Immune system
total genus 67
structure length 276
sequence length 276
chains with identical sequence D
ec nomenclature
pdb deposition date 2004-01-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00129 MHC_I Class I Histocompatibility antigen, domains alpha 1 and 2
A PF06623 MHC_I_C MHC_I C-terminus
A PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1s7vA02
3.30.500.10 Alpha Beta 2-Layer Sandwich Murine Class I Major Histocompatibility Complex, H2-DB; Chain A, domain 1 MHC class I-like antigen recognition-like 1s7vA01
3IDMB 4BQCA 3BW9A 5KVEH 4HIIB 5CD3A 4RIRA 2ADFH 2AAVA 2AK4D 4HS6A 1FAIL 1EJOH 2R1WB 1Q94A 3LS4H 5JR1L 1KIPB 1Y6MR 4QRPA 3GSUB 3QCTH 3D0VA 2AV1B 2DQGL 1ADQA 1S5IH 4V1DD 2J4WL 3I2CL 3L3DB 2XKNA 1M7IB 2D7OA 2XWJA 2AJXH 5TPWL 8CGTA 2ESVE 1ZHNA 1F5WA 1U8LB 4FQXB 1U3YA 4X6EA 4HIJA 3DV4A 1UVQB 2B0SL 1VACB 2FEEI 2ZCKH 4L4TD 5CWSA 1MI5E 5ISZB 4S1DC 5DMKA 5I15H 1SYVA 2J8OA 1KXTB 3LMJL 1E4XI 1IGTA 5J6HA 4G9DA 2AXJA 5IB4B 2QSCL 5DMIH 5DVMA 1U8JB 1TJIL 3QUKB 3TCLA 2DTML 1UKSA 5ALCH 5E6ZA 2FJGB 4EBQL 5AAWA 1W2KT 5C0BA 1MJUL 4RMTA 1LE5B 1TVHB 4JG0H 2OL3L 1UCBL 5MEOA 4ODXB 1LILA 2P4AB 2VN4A 4X5XA 1EVTC 4Z7VA 3MLUL 3QEUB 5E2WH 1ZLSL 3WV0A 5KS9F 2JJTC 4NOFA 4YBQD 3SDCB 3SGDH 4UOW1 5F70A 3KHOA 3SQOH 2VIRB 5HYJE 3IETB 3W9DB 5BS0E 1AO7D 3U36A 3OB8A 4DVBA 4BSVB 5BXFA 2VO5A 3RWGA 4JQVC 2W0PA 3BMVA 3PHOB 3LEYH 4N9GA 1A7NH 3RWFA 5IJVB 5FHBH 2YOCA 4K3JL 4RZCA 1YNLL 3MFGB 1WFTA 3BMWA 3VCLA 4XZUB 4WI8A 1MCDA 2B2XL 3PQYA 4JG1H 5IG7B 4JM4H 5DA0B 1OAUH 3WNNA 4ZPVA 2XG4A 3V0VA 4PTUB 2AI0H 3HZVB 4WV1C 4XNQB 1M7XA 3C8KB 4FQCH 4O9HL 1GXEA 4QYOB 4I18A 2XTLA 2PTTA 5BQ7B 4Y19B 1GGUA 2VL5A 2I5YH 1S7XA 1D5MA 1LK2A 1QSFD 1WITA 2FL5B 5DUPH 3GJFK 4AG4L 4QRQB 4KV5F 3O2DL 2A1WH 3Q1SH 3IU4L 4UT7L 3BUYB 1K4CA 5L7XH 4PJAA 2GEEA 4NJAH 2R0LH 4UIMB 2W65B 1GZQB 4LVNC 4KJYB 4L8SB 4PJ5B 2UVFA 5CFHA 5FGSA 5ADPH 3G5VB 4OZHA 5IQ7H 1A6ZB 3STZB 5FYKH 1A6AB 4UTAH 5C08A 4GS7C 4MA7H 4R8WH 2WW8A 1NFKA 3DHJA 2LVEA 2VXUL 3WFEL 2YD9A 4Z7UE 3T1FA 1YN7A 2GW5A 5CS7A 4WY7L 4U6YA 3MV8B 5EO1A 4NNXB 4QEGA 1CXEA 4JJ5B 4E41B 4YHKL 2DM4A 3K8MA 5E0QA 3TT3H 3DXAD 5IOPA 3RAJL 3CSPA 3TIEB 2LV4A 3DLQR 1MJJB 5JO5A 1A1OA 2PXYA 2Q8AL 4F33A 1J1PH 3FB7A 3P9WB 5KANI 4AMKL 1JGUL 3QO1B 2OI9A 2JJSC 4F9LA 1WVZA 3ARFA 3STLA 5EBLA 4Y5VA 2NY5H 4M6OH 4GJTB 4N5ED 5DQDL 5TJWK 4NZUH 2VZ3A 3HZMA 4L3EA 1QNZL 3RX5A 4V2BA 2V2XB 4G80B 3WJJA 1JGDA 1C12A 4WFEE 3R8QA 4TNVK 3W11D 2JJVA 1HHIB 4JY6B 4Z76A 3EUUA 1JMZA 4MNGB 2VXSL 3V4PH 1SJEA 2VKWA 5M7QA 3H7LA 1YC7A 3HE6C 5TH2B 3H2WA 3L7EB 3RX8A 2V7HB 2YD1A 1G7LB 4QXGL 3ARDA 3OG4B 1YEIH 5FM8A 1OGTB 1A64A 1NDGB 5DEFB 1LQVA 4BH8A 3HZKA 2W9DH 2VLMD 5BVJB 2YRLA 3P4MB 4DGYH 1NDMA 1K5NA 1T0NA 1U9KA 2HFFA 3OKMB 5K9QI 5A43C 4H1LB 4JR9L 4OI7A 3QHTC 2EKSB 3S36X 3I84A 1ZT1B 3L5WA 1UM4H 2OSLA 2OM5A 4M03A 4MXWL 3DIFA 3P9MB 4YFDB 5ENWB 1R5IA 3VE0B 3QULB 4O2FB 3IFPA 4U1LA 4CJ1A 1CD0A 1WBZA 5H37G 4S1RH 4X6FB 2MCPL 3CDYA 4MQSB 4M00A 3WJLA 4PJGF 4NBYB 1P2CB 4U7SA 3VI4F 1MWAB 2XPGA 1XZ0A 2MQ3A 1CFNA 3AY4C 4RNRB 5IB1A 1S7SB 4JKKA 3U6RB 3MRDA 4LOUD 3NFPB 3O4LD 5F6HJ 1NFDE 1T7ZA 2X7LB 1U8IB 1Q72L 2VWEC 5DD1L 2IQ9L 4X7EC 3C5ZA 4QHUB 2UVEA 2ADJA 3IDYB 3QAZC 4MD5B 3MRNB 5CKGA 5I8KH 3F7RA 5T1LB 2HFGL 4XH2B 4U1HB 3T77B 3GBMH 1NFIA 2Z4QB 2NY6B 5DJDB 1SY6H 5C3TA 2R8SH 3UTZB 3PWLA 1LP9F 2DICA 2J5LB 4M8QB 2YA1A 1NGXA 1S9KC 4DUVA 3PGDB 1INEL 3BHBB 3JTTB 4S11A 5JDSA 4XCYB 4WDIA 4WFGE 2W9EH 3MRLB 1MFCH 4HWEL 5D2LA 3D3VD 3HLAB 3J8F7 2Y4SA 1S5HB 5M95B 2A0LD 1R3LA 1H15B 4PJBF 3QEHB 2X4UB 3LSOB 2LTQC 1WZ1H 4WW2F 3TVMA 1NMAH 2F8VA 4C57C 3T1WA 3I3DA 4Y0GA 4Q9QH 4YZFF 1I1YA 5KTEL 4EJ1C 3T0DA 1CLYH 3MMEB 5E8NA 4PBXA 1CGYA 1FP5A 5GRJH 4MCZB 3L3IB 1JFQL 4PRHE 2C4FU 4C4KO 1JZ5A 2FH8A 4WFHE 2D0GA 1XF5A 3H9HA 3SGKA 3ARVA 1RZJL 1QLEL 2HN7B 3NCJL 1WT5C 3OKEB 3PJSA 4PJCF 2X2YA 3MJ9A 2A9NL 3QDHA 4F7PA 3S5LG 3VRIB 1EHLH 3RTQC 2YXFA 2ZUUA 1CDHA 3GNML 4U1IA 1OSZA 1R24B 5J06A 1MQ8A 2EDDA 3FQUB 4HXAL 2N7AA 4N0FB 4OF8A 2P44B 2G5BA 2GQHA 4L29B 4G6MH 2RCSL 3V9FA 2X4RB 3NIFF 4HLJA 3RL2A 4C56E 3OZ9L 2WV3A 5DJ0A 1T4KA 4EI5C 3GO1H 4N5EC 5HI3D 3WFBL 3AAZA 3EBAA 1QRNA 5IHBA 1G6RB 4XVJH 2YKLL 4LSRH 2DL2A 4FRWA 4WIQA 5I19L 2MTPA 5L8JB 3KYKH 1MHPH 1Z6JT 3SKNB 4LPTA 2VLRD 1PG7L 3T2NH 4QRRA 4HKBB 4DEPB 2LE9A 1DDHA 1VFUA 4XWGL 2NY3D 1HWHB 4TVPH 4HKXA 4IOSD 4P2QE 2DIAA 1IAKB 1Q9LA 2BNUA 2MOVA 4OLEA 5EU5B 2XV6B 2Z8SA 5HVGB 1F00I 3WEXB 5C6PB 1C5CL 4O5LH 2GCYB 1S9XA 3C6LD 2Q6WA 4HIHB 1BHGA 5D5MA 1DN0B 1S7UB 2FX8H 3VFRB 1Y0LA 3MRPB 1XF2A 2C3VB 2V5YA 2P5WA 5IVNA 5DFVD 1HN1A 2YD2A 4ORGB 3WLBB 1KPUA 1J05A 4MGXA 4D0BA 3EO1A 5EU6B 1T83C 2HYMA 1NUDA 1FCCA 3R1GL 2NMSA 2YUXA 4CNIB 2LU3A 5MEND 3S88L 2BSTA 4J12A 5T5FH 4DQOL 5E1AB 2Z31D 3QPQD 4DZ8A 1H8SA 1KTDB 2UWEF 3ZE1E 5F88B 4Q0XH 5DD5H 4HKZA 5C0JB 5GRUL 3GSNA 3RA7L 1FYTD 3NMEA 3PWUA 1HWGB 4KDTC 4XP9H 4RFNB 1FE8H 4MMXC 4F7MB 2VERN 1JWMA 3TH4T 1G7QA 4TUOA 4ELMF 5CUSH 2ICWI 3VXQB 5CHNB 2Z8RA 5SWZE 3MUGA 2LAAA 3OAYH 4PJ9B 4PJ7B 1A5FL 4PGCA 1HKLH 1J0KA 2A73B 3L5XL 2X70B 1VSCA 1FFQA 5CSGA 3Q0HA 4HIEA 3ROLA 4RGOL 3SPVB 3TPUE 4S1QH 5EU7C 5FUOL 4K3EL 2CXGA 5JXAH 4RMWA 4U1JA 1UH2A 3P3YA 1FIEA 4PJDE 3CFIC 4UV7H 4NQCE 3HMXH 3NBNA 4M48L 1ZT4A 1S7QB 2A38A 5CP3A 2AJYL 3F12B 1I1FB 4KI5F 4HH8A 2NY2B 1TMCB 1YEEL 1MLBB 2AK4A 1OB1B 2DMKA 1Z0NA 4ZMAT 3PDOA 3NH7L 2CJUL 1D5XB 1UA6L 1WISA 4LQFL 4EOWL 2D7PA 4LSPH 5HVHC 3IFOB 1INDH 1U2CA 2ED7A 4C83A 5A2JH 4ZG1A 3ARZA 3U0PB 1C16B 4Z78A 4HDIA 3U7WH 2VDLH 3QIUB 3VFWB 1RU9H 3FTGB 1J10A 3MLSL 1ZE3C 5I74B 5CEXA 4LBEB 3T4YB 3V7AG 1MH5B 5ESQB 4PUBL 3MRIA 2AKRB 4PDCE 1FIGL 3KWWA 3D69B 2IALB 1AGBB 4RFEB 3QDAA 1I7ZB 1JZ6A 3DMMA 3CFDA 4MAYD 5H8DA 5IF0A 1JHLH 3ZDYE 2Q3AA 2BDNH 5FIEA 1VGEL 2DAVA 5IK3A 1F6LL 1GAFH 4QHLB 1AKJA 3P77B 4JLRB 4LHUG 1T22B 5JQHC 3EDKA 4I5BB 1HH6A 2AK1H 4N5UA 5FA3A 4QOKE 1CXLA 2IPKB 3HCVB 3OTTA 5C0CD 2E7LE 3GGWB 1KCLA 5BRZE 3U2SB 4B7LA 2GJZB 2R39A 2ID5A 4ODHH 5CBEA 1X4YA 5GJSL 4I48A 3O3EA 4L9LB 4R4BB 3KPRE 3LN5A 1VFAB 1JZ3A 3RVWC 3AB0B 4JREB 1KJ2A 1AR2A 5HI3C 4ZUUA 5IHZA 1OT2A 3NABL 5L2KD 4N0YH 4BFBD 5HHME 5IM7A 5ACMA 5D7LE 1IQDB 2XZQL 1DEDA 1AR1D 4XTRC 1A4JA 4ZSOB 3QUZA 3UC0H 2YEZB 3UTSD 2DKUA 3ULUH 1MY7A 1NGZA 3IFNH 5JW4Q 1E27B 1T2XA 5MERA 4FOMA 4U6TA 4EDWL 3EDFA 1W72A 3DX6A 4G6AC 1OAZL 4P4KB 4PJFF 2R0KH 1B88A 3ILPB 3L5JA 4P2RB 5A16B 4ZAKB 2EDXA 2YPLB 3C6LC 3MA7B 2WWMD 1EO5A 5T1DL 1IGCH 1L9NA 4LDLB 4JHBA 4YE4L 5DRNA 1P1ZA 4C58B 3ARBC 5IB3A 4JO3H 3P0YH 5DFVC 3D39D 1WUNT 2YD7A 3TO4D 5K9JH 3Q3GB 5AD0B 3IAPA 4PR5B 1TPXC 3SO3B 4A6YH 1KIUA 4FQ1L 5AUMA 1U8OA 1TJGH 3LDBC 3I6GA 5E9DB 5ITBL 1MFEL 3A0OA 4NN5B 2R4SH 3C2SA 5B38B 1EA9C 5IP4A 3HRZB 4MS8A 3QPQC 3V4VL 2VR9A 1RJYB 5D4QA 3V5KA 2XTJE 4R96B 2GITA 2IFGA 1UKQA 3VMPA 3BKYH 1K8IA 4WGWB 1J18A 3HTLX 4KVNL 5SWZD 4XVTH 2EDBA 1Q9OB 3TBVB 3AROA 5GS2H 2DLHA 1I8MB 1GYAA 5F7FA 2EDQA 3QFJA 5E5MA 2OYPA 43C9B 1ZA6A 1BFSA 1NGWA 4OD1L 5E00A 3MNZA 5ALBL 3RDTD 3DUHA 5ID1B 3GJFH 5CINH 2XWBB 1GH7A 3H9SE 4NP4L 2CKBB 2XQBL 2IAMB 3SE4C 3QUYD 3RHWF 1QFPA 5E56A 3SOBH 3VG0L 3QRFM 4AY0A 3B2VL 3PGFH 1AE6L 5JW5B 2OL3A 3IF1A 4FTVE 4LLUB 1EFXD 5C86A 2RGSA 1AGCA 4KJPC 3G5XA 4JVPA 4DCQA 5FYLE 4APQC 2ZUQC 4ODTL 1HILA 3N0PB 2QEJA 3WD5L 2JELL 3SHSA 2KDGA 1IM9B 3LQAH 1VKXB 4NQVB 4CVUA 3FT3A 4LRNL 1T1XA 4JQXA 4H8WH 4BSWB 3PWPB 4NWUH 3IYLW 1YEHH 5CEYB 1XGRA 4U1NB 3RGVB 1G1YA 3O11A 4WI4A 4D0CB 4N0UB 5C07D 2K1MA 1LO5A 3F58H 4Z77B 3C60D 3V95A 1UXWA 4ZDHA 2V6HA 5HI4D 4U33A 4PGEB 1DFBH 2FDBP 4DN3L 1U42A 3VXSB 3UO1H 1MI5A 2D03L 4RA0C 2HH0H 3WUWG 4UAOC 4NO0D 2AJZA 3ISWA 1SBSH 2HVKA 1I9RL 1P4IL 1T1WB 3HMWL 4HW6A 4L4VD 1RJZA 4W70A 5FKPA 2P49B 5KSBF 4GT7A 3C08L 3BX7C 5CZVH 1O5DT 3ARRA 3CSYB 1UGNA 4G8FA 3ZHLA 5C0RL 4JN1H 1RURH 3LY6A 2W92A 1I8KB 1WCBA 1I1CA 2ZKHH 5C0FA 3O2DA 4PB9H 5FYLL 3O4LA 3IXTB 3AREA 1F90H 3HUJF 5HYJA 4HJGB 3OX8B 2GJ6D 2OJZL 1NCWH 1CF8H 4NBZB 2BJML 3QQ4A 3UPRB 4K94C 1F4AA 3K74B 4IS6A 4MLIA 3VXUD 1KCSH 4LF3B 1NQBA 1U95A 4J7RA 3CFJB 1RUKH 1EBPA 3BN9D 2YUVA 5L6YL 4TN9A 2BK8A 5ECJE 2V5SA 1IAII 3KPLA 1QOKA 1G9NC 2FX9H 1EMTL 2Y06L 3UXFA 2FR4A 1YEGH 5C2UB 3PXHA 3BYYA 1QP1A 1P69B 3C2AL 3IJYA 3UP1A 4NFBA 5JHDD 3O9WA 4HV8B 1D9KB 5KVDH 3BH8B 5LGKA 3K46A 1W8NA 5DJ6A 1REIA 3E6HB 1TJHL 1P5UA 2P8PB 4G59A 3CK0H 1YQVL 5IMKA 5JLZB 5JQ6L 4U7MA 3JXAA 3HZYA 2B4CL 5F7KC 2O61B 1CVSC 2PCPB 2F53B 2ZP0T 1U91A 5GGTL 3QXAA 4WTZG 4QXWA 1FLTX 5IEHB 2PO6D 4ZXBC 4ZQKA 3KPPA 1CG9B 1CE6A 4NFCA 1QFUL 1BVKA 4GRWB 5DJCA 2QQKL 3MLVH 4Y5XA 3TN0A 1S7WA 4UQ3B 4ZUVA 3MRHB 3Q5YA 3VXNA 4DN4L 1BLNB 2HJFB 4BZ2H 2CDEA 1L7IH 4LLQB 2DD8H 5FCUH 3MGAA 4PLOB 5AYQA 4P59H 4G9FB 4GW5B 5C2BL 3EZ8A 2NX5B 4Z7UA 5FHAH 4JFDB 3CFKB 4JFOB 2CGRH 4MZ3A 2ZUWA 5B39G 2YC1B 4OF7A 3KPSD 2ICWA 3BZEA 4U1KB 4Y5YB 1PW3A 2AGJL 4K7PY 4ZYKA 4AT6A 5JNYB 1N6UA 3V0WL 2FIKA 5HY9B 3KXFD 3MNVA 3L1OH 3TJEH 1ZVSA 4JDVA 1ORQB 5LQBL 4P57A 4OCXH 5DJZA 5I1KH 2A74A 3QWRD 5CJQH 5JUEL 3VFSA 1F6AB 4EN3D 2X9YA 1IM3A 3AM8A 5L2JA 2DQHH 4NGHH 2BVQA 2F54D 2J2ZA 3RNQB 1R3HB 5GIRB 1RZFH 5CILH 1CFVL 3QUYC 4ZFOB 5SWQA 3WNMA 3G6AA 4F3FB 1TCRA 5C7XH 3ARWA 1CLCA 4PRIE 5GZOD 4QLRA 1RSFA 1AD0B 3AXLA 2R29H 3CPLA 3VWJB 3SE9H 4Z9KB 2IADB 5DEZA 1DQLH 4UDTA 4M1CD 4B41A 1ONQA 2BNQD 4Y16A 4YHNA 1IZKA 3WFHA 1WBYB 3S4SB 3AS1A 5DHYA 2IAND 1RUMH 5LGJB 4WUUB 4ODUB 4ZPTB 5EWIL 3WSQH 3D0LA 1EHAA 2NW3B 1U8QA 1DBJL 4HWBL 4JM2F 2V5RA 4PP1D 4DWHA 3MCG1 3BQUB 1LO4H 1R5WB 2QLVB 3BI9X 3M07A 5I1JH 4Z7QF 3VFVB 3S35H 3W9EA 3C60C 3QEQE 3BO8B 2NY4B 5CMAA 3ARQA 1TNMA 1JNHA 2XG5A 5ICYA 3RI5F 3QQ3B 5DS8B 4ODBD 1KN4H 3VW3H 3OJDA 3VG9B 4M62L 1SMAA 4NQED 3SKMA 5F1NA 3LOWA 4G3YH 5AZEL 1SM3L 3ET9F 5I6XC 5F9WB 4JFHE 5MENA 4GXVH 5J89A 4U2ZA 3MBEC 4YFLI 4HZAA 1VESA 1RIHH 1NFDA 1IC4H 3D9AH 5C6WH 3SDAD 3MRCA 3LKSA 2FLRT 5HPMA 2EH8H 1NBQA 1VGKB 3ILQD 2VISA 1IQWL 3WL9B 3TF7C 4FXGB 1HNFA 4LNRB 4FQIL 3O6LH 1UQSA 4MJ6B 3WN5A 3IJSB 1I1AA 3MRKB 4NKIH 4KPHH 1NLBH 3T2QA 2ED8A 3CC5B 5HGBA 2YSSB 1DQJA 1A6UL 4XNMA 4X80L 4URTB 1P4LB 2VABA 3BN9C 3HG1D 3UBXG 5IFAH 2Z9TA 5E95B 7CGTA 4GKZA 3DRTB 4KRLB 4LSQH 3R06B 3RUGB 4JB9H 3TT1H 5CCKL 5DYOA 2BY0A 3SJVB 5DTFB 2VZ1A 5F89A 4OCNC 4KC3B 3GI9H 4NHCL 3BSZH 1DCLA 5HDOA 2NR6D 1UZ8B 5IVXE 1T03L 5BV7H 1EBAA 1NMBL 3K2UL 5HDQL 1CU4H 5ELIA 1KEGL 5I1EH 1PLGH 4OJFL 4IMLB 5IUSA 3MBXH 3UX9B 3V79C 1J87A 3QUXD 1WIUA 3KR3L 4PB0L 2B1AH 3MROB 5E6IB 4PJEB 4XPBL 2JJUA 3KYMB 5D1XC 2VDMH 4B7IA 5GHWL 2PO6C 4P23B 4PRHA 2AXFA 3BUTA 3NA4A 4HUVA 3L7FB 3QFDB 3QI9A 1OAXH 3PNWB 2J88H 3DOSA 4ISVA 4EVNB 2AEWA 4L9DA 2XZAL 2D31A 4RGNB 3OPZL 1UYWH 4HJJH 3SKOB 4LLYA 4IMKC 4OZIE 2VLJD 2AJ3B 5ERWB 1BJMA 1NC2D 2LQRA 4B50A 1D5IL 4NQDB 1K8DB 5C0DB 4MX7B 5E03A 4MAYA 4ONFL 1OM3H 5CEZD 1MOEA 1PBYA 4OZGB 1PQZB 3TZVC 4IRJA 3P4NA 1Z0MA 1LO3L 2R69L 2XY1A 4P48A 1ZHKA 2EC8A 1B2WH 4NM8L 5CGTA 1UH3A 4C56A 4XNZB 1CGVA 2X4QA 1U3HC 3DVFA 5ACLA 4HGWA 3MV9B 3RIFF 5GS1C 1OTSD 1R3JA 4EN3C 1P7KA 5CJOL 4LSUL 1Q94B 3C8DA 4I0KA 2E9WA 3D0VB 4MAUH 3LEVL 3CFEB 4XP4H 2XWJB 4F7TA 3NAAL 1X5AA 5FO9B 1N4XL 4FFVC 4LMQE 1HCFX 1ZANL 2WBWB 5L2KA 3DARA 2VYRE 2EDNA 3LHPL 2M1KA 1QBBA 1Q0XL 2DQIH 2NY1D 3I50H 4P2QA 4UV4H 3BAEH 3QDJD 4ZOAA 1H3UA 5DMKB 4M1CC 4M5YL 3K81A 5EDXA 5T3ZH 1GCFA 2EEDA 5ADOH 1YYLL 1IGTB 4RMUA 4HUUA 1MCPL 1KPVB 3DI2B 1VEOA 4E0RA 5J6GB 3L9RA 3P11H 5HHXH 1JL8A 4PP1C 3QHFL 5F9DC 1T80A 5D7IE 3QIBA 4JVUA 1FORH 1RULH 5MEOB 4CW1B 4Z7VB 4QXUL 2J6EL 3IVKA 3RX7A 3VH8B 1A22B 2MSPA 3HNTH 4GAYB 5LGHH 1ZHBA 1J8HD 3MA9H 2HT2D 4NDMB 3SDDB 4MVBD 1LD9B 5EUOE 5EFIA 1IBGH 4Q9BA 3U36B 5BXFB 5KZCB 1D6VH 1RUQH 3QO0B 3RL1A 5ILTL 1UWGH 4PY8J 4OUOA 2EDYA 5F9JB 4S0UC 1RZKH 1IJ9A 3K3QA 5C92A 4JPWL 5FECA 4LEXH 4HZLA 4QGYA 3SDAC 3BYTA 1QZ1A 1HYRC 2ERJB 3AS3A 5EU7E 4Q2ZB 4IHOB 3QPXH 3ILQC 5SWZA 3PQYB 5D72L 4MXQA 4XPAL 4Y4KD 4YDKH 1XIWD 2FIRT 4R6UA 1B4RA 3T0EC 3RDTA 1KB5B 2F8XC 5TQ2H 4N0CA 4BH7B 4M4RA 4TOYH 4F8TA 4I18B 2OZ4L 5J3HD 5DT1L 1A9BA 1YEKH 1LK2B 4YK4B 1AJ7H 2WBJA 3VFGH 3TPUA 3M17B 4KQ4H 3V5DB 1IFHL 5E2UH 3L3KB 2IBZX 2L7UA 5DD0H 4LKCB 1E4XH 2E27H 3U0WL 4PJDA 3DUSB 3WE6B 1MHHA 4NQCA 4Y4FC 3S96B 3LS5H 1EFXA 1KC5L 5DJYA 3CVIL 5A3ID 1DVFD 3M1BB 3ZKXC 1M7DB 1U8KA 3LCYA 2ATKA 4KI5D 3PV7A 3S37L 2JCCE 4XBEL 2Q76B 1B90A 4BUHA 3JVGC 2KQNA 1NGYB 4KKCD 4RDQG 4WW2C 3T1FB 4PJHF 5IW6A 1BZ9A 1YN7B 3E6FA 1PSKL 3EGSA 1T21B 2WQ8A 2DQEH 1IKFL 3I02A 5HHNA 1RQ5A 2KZWA 1MLCB 4NM4H 4PJ8D 4KROB 3GBLA 3QUXC 5GISH 1KB9K 5IV2A 1FSKC 4JFFB 3FQWA 3VWKA 3HHRB 4NO0A 5JO5B 4Z7WA 4P9HH 4HMEA 5GZNC 3O2WL 4YPGA 32C2A 4J3VA 2OR9H 3EYSH 4YIQA 5I8OL 4OV5B 2XA8H 3B8SA 5ESVA 5EBLB 5F7HA 1QFWM 4M1DL 5LJYH 4JDZB 3HZMB 4OBSA 2VR4A 3NZ8A 2YK1L 2Y9RT 4EUPH 1EXUB 3MUHL 2YD6A 4PG9A 5FKAA 1RUPL 1PJ9A 1C12B 4GRWF 2J8UF 3CLFH 2YMXH 4QOKA 3SCMA 2AEQH 4NPYA 4NUGL 2E7LA 5BRZA 2HJKA 4IIQB 4XBPA 3FFCB 2NZ9D 3S3JA 4KUZL 2FJHA 2HWZH 2PYED 3FFDA 4P2OA 4RAVA 2AW2A 4XP1L 3TBSA 2GJ6A 4M7ZC 2QKIB 3ARDB 4QGTA 3A6BL 3KPRA 2VQ1A 1T04A 4X6DB 3T4AA 3VXUA 2RFXB 3G04A 4C4KT 4KZEL 4E41D 3P40A 3B6SA 3BP7A 1G7JB 4J8RB 1P84K 4BA8A 2Y5TA 5DD3L 3M45A 5HHMA 1OWRM 2JK5A 2FWOA 5D7LA 1RFDH 3BT2H 1NCBL 3IJHA 4ACPA 4I3SL 3E2HA 2O5ZH 2NQCA 5JHDA 2YD5A 1JNLH 3BIKB 1EGJL 3IDXH 1EAPB 4GAFB 5KVEL 2ADFL 3IFPB 4U1LB 1EJOL 5IESH 3LS4L 3QCTL 4GLRI 1S5IL 1QO3A 4Z7NE 1HQ4A 2AJXL 5K9OA 1RD6A 2GTWB 2XPGB 4GMSL 1CFNB 5IB1B 3RGHA 2GK2A 1BIHA 1SVZA 1FG2A 4X99A 1VA9A 1YPZE 4HKJA 4RAUB 4LARL 2VKXA 5DJXB 3ULUF 1NC4D 5I15L 2NNAB 1OSPH 4TYUA 5IJKA 1G7IB 1BP3B 4HQQL 2AJSH 2HT2C 2XFXB 1A14H 4NQXA 1F58H 4Y1AB 4HUWB 3TEUA 3F65A 1A3LH 4MVBC 5ALCL 1JHTB 1CT8A 1I8LA 4X8JB 2CR6A 3MLXH 2V9QA 3BJ91 1IKNA 4KZDH 3THML 4P5TA 3DV6A 1NGXB 3P73B 5I16B 4GSDH 4G8GD 1SEQL 4ONGH 3RBGA 3MACL 1AFVL 4JEGB 5I17A 1T1ZA 1U8HA 2VJXA 3SQOL 4NO2A 3H9SA 4UMGA 1MRFL 4BFIA 3MJ7A 2ITCA 2ITDB 4Y4KC 1XIWC 3QHZH 35C8H 3BZDA 3DRQB 1T5WB 4YDIL 5E2VH 3LEYL 2HKFL 1A7NL 4KMTH 3A6OA 5J3HC 5FHBL 4KY1H 4UQ2A 1QEWA 3IFLH 4RISH 3I6LD 2DMBA 5KSAB 5MHSD 4GUPB 5I18L 4JG1L 3S7GA 4WWID 5C71A 3SDCC 1S7RB 3O6FD 4FP8H 3VFPA 1KACB 3IDGA 4NYLA 2P24A 4LMQI 4FQCL 5A3IC 1DVFC 3ARPA 3U9PL 4O02L 1A7RL 4PRPD 1RZ8A 2I5YL 5I8CB 2HJLA 1F4XL 5JR1H 2ICES 3IGAB 3PJSB 5FCSH 2CLVA 4KKCC 3I2CH 3PHQA 5DUML 1S9YA 3U83A 2VN7A 5TPWH 5D1ZD 1C5DB 2X1PA 1WWWX 4HMDA 1KPRB 4LSVH 3ZYIA 2E6JA 4CN4A 1MHCA 3ZE2F 2BNRB 4PJ8C 1GGBL 2B0SH 2R0LL 4W6XB 4X98B 2APTA 4U1IB 1KJVA 3F7PC 4KK6D 2CLRA 3UROR 5I30H 4NQEA 5AZ2L 2EYSA 4MA7L 4R8WL 1OP5K 3WO4B 5FV1L 3CVHB 2MPAL 4R0LA 3FB8B 2EEAA 1HDMB 1HEZA 1VHPA 1T4KB 3MLZL 4JCMA 2DLFH 2DDQL 3AAZB 4MDIA 5GGTA 2YD4A 1MFNA 1T5XA 2UZYB 1MJUH 3QDME 3ZT7A 2J3SA 3TT3L 3O41A 3ZE0F 3X11A 4POYA 2OL3H 2V9TA 1J1XL 1CFSA 2YHGA 2DQCH 3WHXA 4L8SC 3TM6A 5C9JA 1DDHB 4J3WA 4TNVF 4ZUTA 4WV1A 5D7KE 5TE6H 4N8PA 1TTFA 4JDTL 4NN7B 4BQ9A 3RZCD 4GRLD 4NZUL 2BNUB 1CIDA 3TV3L 3MFFA 5KAQG 2W59A 3CZFA 1RMFH 4XXCC 3BGAA 4FZEH 3PWVA 4XCEB 2H6PA 4FXKB 4YDVB 3V4PL 1XF2B 3C9NB 2P5WB 2ZOLB 5ICXB 5T1KD 3HE7B 4GW4A 3ARGD 1GJIA 1ZHLA 2H9GA 1HQRB 4M5ZL 1KPUB 3D5OF 4JFED 3Q5OA 3QR2A 1YEIL 1IRAY 4S2SB 2E8ZA 4K94L 1QA9B 3JUYA 3NPSB 4OIIH 5I1LA 2R9HD 4DGYL 4MDJA 1JPFB 4O9HH 3LD8B 3QRGL 3V6BR 1G9EA 2PR4H 3ESUF 1OQOA 2ARJQ 3GIVB 4MHHI 4P4RA 1UM4L 3MOAH 4LPXA 4DAGH 3BIAX 1AQDB 1YC8A 1YNKL 3O2DH 1AXIB 5EPMA 3IU4H 4UT7H 5EN2B 1YMMD 2ZNXA 4F7CB 3BGMB 1X4ZA 2VXTL 3IU3A 4EUPG 1LEKB 1G7QB 4PV8B 4S1RL 4TUOB 1KJ3H 4R7NB 3F5WA 3T65A 4G6KH 4XX1G 2BOCB 3QQ9D 5HI5D 4LCCB 4LPCA 1XGPB 1DSFL 4HUXB 3FB5A 4HWBA 3WFEH 2EO9A 3PWJB 1C7TA 4F2MA 4Z7VF 5IBTL 3WKML 2EE9A 1B9ZA 1X5JA 4DK6A 3JWOH 3EFDL 4YHKH 5JOPE 4GH7B 4WHTB 3MCLL 2JTDA 4LASL 4MA8L 4BFGA 5FYKD 2BHZA 1XGYH 5D6DC 5DSCB 2Q8AH 4U1SA 1ZT4B 4Z95H 4GAJL 3V4UH 1GC1H 1FGNL 1MAJA 2CUHA 5DI8A 1JGUH 2P46B 4HXBH 1SY6L 1V3KA 5DQDH 2R8SL 4L8DA 4U6XA 2IH1B 3P9LA 2ZUTA 2AK4B 2YD8A 1J0JA 3B9KA 3G9AB 1BD2D 5EO0B 3VXPB 1H0DB 3S36L 2YN5A 4V1DB 2UYLA 5JW3L 4HK3N 1ZSDA 3FONA 5EOTA 5AWNL 2DIJA 5E70A 4C83B 3B9AA 1FFPB 2VXSH 4PPTA 2W9EL 4CU6A 1RVFL 3O6FC 4HDIB 5DVLA 5FYJE 2E7CA 4YQXH 4L4TB 1CFTB 4DVRL 4ZS6D 2DQUH 3GSVB 3NIDF 5DK0B 4YAQA 5I1AB 4JM2D 3MJGX 2Q86B 1F3JA 3QDGD 2BY3A 2J5LC 1PEWA 5CIPA 2FBOJ 3QEQA 4J4PD 4JR9H 5IT2L 1CLYL 5IK3B 1OF2B 3EFFB 3OKKB 2A6JA 5LCVH 1BFOB 4PJAF 3GZKA 1WIPA 1A7BA 3BEVA 1X5XA 3MXVH 2IH3A 3ZO0A 3KDMA 2GT9B 3NCCB 4OZHF 4MNQD 4KK6C 5FGBC 3VXRD 3DROA 1OGAE 2P42B 1CK0L 3IB4A 3P30H 1N0XH 4XGZB 3HN3A 5CBEB 2MCPH 1NBZA 3E0GA 2FO4A 4M8VA 1JK8A 2VZUA 5EC2A 1AO7B 4UUJB 5GRXG 3LH2L 2VITA 5K9QG 5CGYC 3TJHA 1EHLL 1KJ2B 1KIRA 4UT6L 4ZUUB 1KCGC 5IHZB 1QVOB 3U9UB 3PE9A 3U4BL 4TSAH 4JO1L 4RDQF 2WIIA 5SWSE 5DD1H 1JN6A 2IQ9H 1HNGA 5DVOA 3RWIA 5EB9A 4R2GB 5TFSL 3H0TA 1EUUA 3QWOB 1A4JB 5I0DA 4KKBD 2X89A 1NGZB 1SHMA 4U31A 4ZS7H 3F8UB 4NKOB 3X3FL 3DX6B 4UU9B 1XEDA 3WCYA 2WIMA 5A2LH 3WYRA 2DB8A 3KYKL 1MHPL 4EXKA 5J4MA 4KUCF 1UB6A 1A0QH 4Y2OA 3WBDA 5B8CA 4MD4A 4KMLB 1ACYL 4HEPG 1INEH 5B22A 3ZHKA 5FGCB 3HB3D 3MYZA 4LHUD 3QUMB 4HWEH 5IVXA 3GDBA 4LCIH 5CAYB 4OUUA 2DF3A 4PV9A 1WT5A 3O8XD 1L0YA 3BOVA 4ORZC 3BFOA 1FV1A 4FMKA 5DD6A 5HHPB 3MV7E 2DTSA 5EC1B 1RI8A 2XN9D 4QRUA 5KTEH 1UXSA 2HFTA 2GITB 5DQ9B 2EYTB 4UBDC 2XICA 1VCAA 4P46D 3DXAB 5H94B 4NC1E 3UTTE 2UV3A 1PKQE 1JZ8A 4OZIA 3LPWA 4WW1B 1A7PH 2BVOB 5E5UB 1DEEA 3QA3B 3HNSL 1RZJH 2X6MA 3O81A 3TBTA 1QLEH 3NCJH 5KSUA 3HPLA 5HI5C 3ZT5A 4CADA 2A9NH 4OFYA 3Q5TA 3SBWC 1A3QA 2L0DA 4JAMA 4XP9L 4ELKB 3VRJA 3OKYA 4L3CA 1ORSA 4X4ME 1I7RA 3RVXD 1JF1A 3WO3B 1XGUA 3IDNA 3IF1B 4PRAB 4L1HA 5CUSL 4A2MA 4AM0A 4X9IA 3MRMA 4HXAH 1QR1A 2FSEA 4DKAA 1X7QB 1O7VA 2RCSH 5GRVK 4WI9A 3OAUH 4LVEA 2VZOA 4YUEH 3KLDA 1F13A 4L5FL 4JHWL 1FNEA 2HT4D 1R3KB 4Q74A 3UYPA 3D25B 1LO5B 3WFBH 43CAA 1KTLB 3WS3A 1CLZL 4RFNC 2YKLH 4S1QL 5I19H 4ZDHB 2X4NA 4L4JA 4XAKE 5C70A 3PL6D 1PG7H 4D9LL 1MI5B 5D2LF 4XWGH 3W82A 1BQHA 1KCRL 2HVKB 3FO0L 4KH2A 3BD4A 2DWDA 1JF6A 4PJ9C 2F5BH 1RJZB 3PABA 3O45B 3S34L 4ZS6C 2D3VA 4GKSB 1IC1A 1T2QL 4G8FB 1C5CH 2M8XA 2IPUK 1U8PB 3L6FA 2OK0L 3QIWD 1NEZA 3VI4E 3QJHA 2EKJA 1LVEA 1INDL 5D7IA 2BVPA 5DHVA 4LKXA 1WBXB 1JTOA 1M6OA 4J4PC 1WCBB 5ESAA 3IKKA 4TVPD 1RU9L 4P99A 3O4LB 1OGAD 2HTLD 4G6JH 3DGGA 5GJTL 1U3ZA 2DIBA 3LQMA 1NC4A 2Y7QA 2BXZA 4HG4J 1AGFB 1RK0B 1RAMA 5EUOA 2NY2C 3RGVD 4JN2A 3GJEA 3T0EE 4WI3A 3R1GH 3LKOA 5DK2B 3LEXB 3ZYZA 2YA0A 4EDXA 1RJCA 1JHLL 3NA9H 2BDNL 3BJLA 3N06B 1U95B 1MIMH 5HHQB 3IS1X 2HRLA 1GAFL 2OS7A 3BWUC 2MQCA 1ES0A 1HI6A 1EVUA 4UIKL 5GRUH 3QIUC 2FGWH 5JORB 1HYSD 1W0VB 3MXWH 2ADIB 5I74C 4AJ0A 3KAAA 1H9VA 4G8GA 2KBGA 1WZKA 4ODHL 5J12B 4RCAA 5E5RB 1A3RL 4QHMA 3F6IA 5EORL 3V6ZB 3WS6A 2QSVA 4OLXH 3IAGC 3K8KA 3D3VB 4LAQL 1J0HA 4HGKC 4KAQL 1R3IL 4M4PA 4FQPA 4JO2H 2EZ0D 4O2EA 4JCLA 4HAFA 3CMGA 3L5XH 3SGJC 4D3CH 4F9PA 1JNNH 1P5VA 5ITFA 5EUKA 5F96H 5C8JA 4HAGA 4K3DL 1NUFA 3T8XB 4QHKI 2BSRB 3OBAA 3RY5A 4RGOH 1CBVH 1BVKB 2SEBA 5ETUA 2G2RA 1X3DA 3C6SA 4POZC 3RWDB 4KTYA 4JFZL 4R26H 3VXNB 2MWCA 4L9LC 2Q8BL 1XF4B 2AJYH 2WZPD 2JCCA 1MCCA 2CDEB 2R0KL 2RIKA 5F93C 4B0MM 4RQQB 2H8PB 1VERA 3L5HA 5D5MF 4JREC 1M1SA 4DGIH 3H8NA 1YEFH 2NZIA 3NH7H 1UACL 2CJUH 3QXUA 4JO3L 5C09E 4EOWH 4JFPA 5DC9B 4ZYKB 1JZ4A 5K33A 1HHGB 4AT6B 2FIKB 1CXHA 2DQFB 5KAQF 5K9JL 5H35A 5I71B 2E6QA 1EGJA 3NCYS 1NJ9B 3JTSB 3MLSH 1IAIH 5IHLB 3X12A 5DJZB 2A74B 1TJGL 4P4KC 5IB2A 4X6CB 3GSXB 4PUBH 2R4SL 5F8QC 4LCWD 4NRYA 3VFSB 4ERSH 1FIGH 3GMNA 4NKQB 3ARTA 2D0HA 3JV5A 4MJID 1P7QA 3G6DL 5DMJB 1VGEH 2MCG1 3ULVH 1CD1B 3TWCH 1FZKA 3QNYB 5MP6L 2BY1A 4YXLL 4Z7OE 3RVXC 3GMQA 3CPLB 4UT9H 3O3AB 3J7HA 1DBBH 2VLRB 2ADGB 1PYWB 3JWNC 1WCQA 1JHKL 1MHEB 2NY3B 3WFHB 3HI1A 1ZWIA 2EO1A 2VAJA 1T0MB 5TDOA 3RZCA 5GJSH 4LK4A 3L3OA 3D0LB 3EYVB 4BQBA 3C6LB 2G75B 2V2WB 1A6TA 1CVRA 2BOBB 4JVWA 1E28A 1IL1A 1PEZA 4YHPA 4NT6A 4ZUWB 3WIHH 1NAKL 5CMAB 3I75A 1OP5H 1W0WA 1JNHB 3PL6C 3EYFA 2XZQH 1KF9B 3LQAL 4HT1L 1U3JA 2IAMC 3MQIA 1TPXB 4H8WL 3SKMB 4NWUL 1ZVHA 3F7YA 2B8OT 2BSSA 3EO9L 2OP4L 4EDWH 2IC2A 3LDBB 1OAZH 3F58L 5MENB 4JPKL 4P5MA 1TZGL 2Z31B 3QIWC 4R7DA 3LKQA 1IAOB 1NFDB 5T1DH 3F62A 5DJ2B 3LKSB 2VDPH 5AG9A 3ULUD 1FYTB 3PGCA 1TCMA 5ISZE 3HAEB 2VISB 2HTLC 2FYYA 1HHHB 3HNVL 4Z18A 3W0WD 1OL0A 5CZVL 5C0AD 5I1DB 3WN5B 3A6CH 3E8UH 5HHOD 1NCCL 1T7VA 2QQNL 1X5IA 3RGVC 3OR6B 1RZ7L 4G42A 4FQ1H 4RMVA 5EOQH 3S9DB 1FL6A 5GGQH 2EXWD 4BQ6A 1DQJB 4XNMB 1MFEH 1U8MB 5IROA 5EO9A 3FKUS 3DTXB 3UTOA 5GRYA 3V4VH 5E94A 2M26A 3NOIA 4PTTB 2UZIH 3H3PH 4APQA 4DW2H 4OFDA 4M7KL 4DGVH 3CX5J 1V3LA 3LKRA 1HYSC 5DC0A 4KVNH 1NCWL 3IXAB 5DYOB 1CN4A 5F89B 3QXDA 2ZUQB 4LEOA 1NCAL 3CCHB 2EYRA 3ZDXE 3H6JA 4NKDA 1KCKA 2MJWA 2I60L 1KCSL 4KKLD 1LO0H 5HGDB 1JV5A 5A40E 1CCZA 5CBAB 4TUJA 3VG0H 4U6VH 1GIGL 2CDGA 2EZ0C 3BKJL 2R23B 1LK3L 1QD0A 4GBXD 5EA0H 1VFBB 5KVDL 1MRCL 4XC1L 3BZ4A 4U1GB 1OPGH 3JV4B 1MFAL 2AXFB 2VLKD 1HIMH 4HUVB 3OMZA 4UAOB 1LWRA 3QI9B 1NMCC 1FL5A 4ODTH 3CDGB 3QWQB 4FQQA 4MD0A 3MRRB 2D7MA 3O3DA 2DBJA 2EDLA 4Y19E 2W0KA 1P4BH 4TULH 4Y8DC 4LRNH 3UTQA 4YGAB 1J88A 1UCTA 4LLYB 4NQTA 1QTYT 4PLJD 2DQJL 3M8OL 2ARWA 4MAYB 3MREB 4JRYD 4U0RB 2XNAA 1D9KC 1FRGL 1JPTL 3MRJB 4DN3H 5F1SA 2D03H 3KS0H 3CUPA 1T20B 2FATH 1ZHKB 2JJWA 4PJ5E 4M6MH 5GGVL 4BZ2L 1L7IL 4GG6B 1ZV5A 2DD8L 5C0ND 4D9RD 2VQTA 4P59L 1YNTA 2H2SD 5FHAL 3HMWH 5C0CB 4MNQA 1HXYA 3GSRB 3EO0A 2GTZB 4W4OA 4J3TA 4IDLA 1UEMA 4NFDA 2HA1A 3BH9A 4WJ5A 5C0RH 1P7KB 1GVIA 3MV8E 2APWA 3QDMA 4L3AA 1MCNA 1Q0YH 3MYJA 3L1OL 4K7PX 2VDNL 4M6NH 5HD8C 2Y36H 4CU8A 4F7TB 2R2EB 1D5ZA 4KXZI 4WUKL 3K0WA 3KLAA 4B53A 3OGCB 2W60B 5HJ3A 5L2KB 5I1KL 4RGND 3LRGA 4EI6B 4G7VL 1FZMB 3SE3C 5GS0C 3N50A 1XF3B 2AABL 2OJZH 5I66A 5BZDB 3VU2A 2FBJH 5KG9A 4XPHH 1RZFL 3VFNB 5F3BA 3E3QE 5L6YH 3PWNA 3AC0A 3EOAA 3FO1A 4MNHA 1I1RA 3L9RB 1AD9A 4MNGE 1EMTH 2DRUA 3RQ3A 2Y06H 4JFYA 5D1QA 1QBLL 1F97A 5GSVB 1N5AA 1DQLL 4W81A 3O6MH 4QT5A 4TNWK 1FH5L 3UTPD 3D39B 4Z0XA 3TO4B 1KGCE 1TJHH 3K1DA 1AXSA 4QRPD 4WWKA 4I9WE 4RMQA 1SY6A 1PVHA 5JQ6H 1D5BA 5EFIB 1FG9C 3G6JB 3O8XA 5LXGL 5I1JL 2B4CH 3RL1B 3S35L 4RSVA 5EBMB 1ROWA 3VWJC 1NH6A 3QCVL 1MCBA 3VW3L 3C5SA 1J86A 3ULUC 3SGEI 2QQKH 5FUZL 3SY0B 4KGLA 1TETL 5SWZB 4YO0B 4DN4H 2XOTA 1KG0B 4W4NA 3N1FC 4GXVL 2GK0B 5C2BH 3RDTB 3SDXB 3Q6FA 5C0BD 5DJ8B 4G5ZL 3FQTA 1XGTA 2P5ED 1WV7T 4C55A 2CLZA 2VOTA 5IMMA 4X5WA 1A9BB 3OQ3B 2Z91B 4JPIA 2AGJH 5EZJA 3N85L 1QSEE 1HCVA 3O6LL 5B21A 1ZOXA 1EFXB 5I76B 5BW7C 3VJ6A 4NKIL 2EDEA 3O4OB 1MQKH 1NLBL 1CL7L 2IQAB 3C87A 2XIDA 5JUEH 3MGTB 2Z35A 2ATKB 4KKLC 3SN6N 2JIXD 2QHRH 5ID0B 1VADA 1CFVH 1U6AL 1PAMA 1L7TH 4LSQL 1E4WH 5C07B 3U1SL 3L95A 2PUQT 5HHNB 3TT1L 3RJQB 4R4FL 4Z0BL 1AHWB 4G8IB 4GG8A 4HLZH 3U48A 4JGUA 4KHXL 3D2UD 3BSZL 4FXLA 5L88L 1BPVA 5EZLB 4NO0B 1MWAL 4MA3B 5FV2A 5E99L 4Z7WB 4LPWA 5GPRA 4L4VB 1T3FA 1WWCA 5CJXC 3BZFA 5I6XB 3MBEA 5ESVB 5EWIH 4F7EA 2W0LA 1F11A 4HWBH 4W6YB 2VLLA 4O51A 2VDML 3EKCA 3D48R 3PIQA 2I07A 3TF7A 4WFFE 4XNYL 2H32A 1EERB 3RNKB 1QLFB 3ZTJH 5BRZB 1GZPA 4OLWL 1OGAA 3EOYG 4LLWA 3FFDB 4JY5H 4R3SA 3RPKA 1UYWL 4HJJL 5C08D 5KS9B 4Z7UF 5C0NC 4RX4A 5BVPH 2GJ6B 2H2SC 2C4FT 3W81A 5T3ZE 1R6VA 5DURD 1YUHA 4L8BB 1SM3H 4K71B 5F71A 4OLVH 1G0YR 1OM3L 3VXUB 5E8PA 1B0RB 3G04B 1CICA 3B6SB 5JOFA 3C5JA 1U0QA 3FQNA 1SJHB 2X4PA 4O4YH 5GGUB 3MRFA 5SWSA 4P23C 1FYHB 4X9FA 4PYHA 1UJ3A 2PXYD 5FO8B 1CE1H 3QISA 4I8DA 3RFZC 4YHOL 1N2RA 1XCTA 1ED3B 2RJMA 3IDJB 1QYGL 5JHDB 4RGNC 3IAQA 3ARFD 3N9GL 1T6WA 3UMTA 5E8OA 4L3ED 1H5BA 3EDEA 3LN9A 2XA3A 2BHUA 2OJEA 1A6UH 5IB5B 1EFQA 3GSQA 5ANMB 1HQ4B 5K9OB 5CIPH 4OGAC 1FG2B 1Q9WB 4S10A 5KVFL 3L3JA 3I50L 1VPOH 3R4DA 4UV4L 3JV6B 3BAEL 1CDYA 4LLDB 4K2UL 4XNZC 2O5XH 3GUTA 3F7VA 5T3ZL 1EJ6A 4LSTL 4NHCH 5ADOL 12E8L 2WWKO 2VE6B 3GHBL 3TA3D 3OGOE 1EO8L 3RWHB 3MV7A 3DYMA 3P11L 1T03H 4NQXB 4M9PA 2EXYD 2N1KA 3FRUA 3KG5A 3SKUD 3RY6A 4OJFH 2E3VA 1FFRA 2DYPA 3KPSB 5CKAA 2WLYA 3KR3H 4PB0H 2WK2A 4XPBH 2CIIA 1N7MH 1U58A 3HMXA 5EU6E 5GHWH 5EH1A 3VXOB 3KXFB 1E0OB 2IWGA 5GGSB 1PKQA 5LGHL 1G84A 1RHHB 4OV6F 4KHTH 2APBA 4NO2B 2IFFL 1CXKA 2XZAH 1F3RB 4WHYH 1AIFB 1UM5H 2ITCB 4Y2DA 4PGJA 3OPZH 1D6VL 1NKRA 1RUQL 1R5VA 3B2UD 5DRZA 1UWGL 3BP6B 4LCWA 1KYOK 1NFDF 4EN3B 1RZKL 1D5IH 4X4MA 3EHBC 2F54B 5CZXC 3U0TB 4MJIA 2ZG3A 1QEWB 1T1YB 3C5ZD 1WWAX 2Q7NA 4GLRH 3GI8H 1A9EA 1LO3H 2ZG1A 2R69H 5EU4A 3RVUC 4YDKL 1D6EA 2WSKA 3VFPB 2W38A 1VEPA 5DZOA 4ZFGH 2QSTA 5E8EA 5FK9A 2BNQB 4PJ7E 3U79A 4DZBA 2F58H 4JY4A 2FEEL 4QF1B 5AEAA 1RZ8B 1YEKL 3BEWA 1DJSA 2H45A 3MX0A 2IANB 1AJ7L 2VDKL 5C0IA 4LSUH 4KQ4L 3RPIB 3EOBA 3H9YA 3ZL4H 2ICCA 4HULB 3LEVH 5EBWB 5TGBA 3FOMA 1VENA 2ERJC 2DI9A 1N4XH 3G5YA 2UZXB 3KPQA 3JWDC 4JANB 3CXHJ 3LHPH 4X4XA 1KIQA 1OW0A 1N5YL 5IR1B 1Q0XH 1JCKA 3GMOA 4LSSH 4OTXL 2EE2A 3AS0A 4NQEB 4N1HB 4I18C 1IEHA 3TVMD 4XCFL 4G43A 3NCEB 3DVGB 3DSFL 5DMGD 4R0LB 4YK4C 2OBGA 4PJGB 2H3NB 2LU4A 5CGMA 5IW1B 3UAJC 2DQEL 2ZUSA 3X13B 3MRGB 4U6HB 3WHE0 4X9GA 2OTWB 4KRMB 1XH3B 1CL7I 1DUYA 5F9AC 2OR8A 4PRDA 1U8NB 2QL1A 3WUZA 3SDAB 2IMNA 1G7MA 4FQ2L 1TZIA 3UPCA 5K59E 3WHXB 2J6EH 1WWBX 5C9JB 1CDUA 2Y23A 3W0WA 2NPLX 4DK3A 4XWOD 2P7TA 4CMMA 4HK3J 2DJ4A 5C0AA 3MO1B 4D0DA 3QG6B 5E7FA 1AGDA 2NY0D 4CAGA 4JQIL 3TNMB 3W5NA 2F19H 1N3NB 4OCLC 5E2TL 3MFFB 4PG2A 5ILTH 1C1EL 2MNUA 3CZFB 1PZ5A 2AEQL 4CVWA 4M61A 4Y4FA 1FPTL 3HG1B 4JPWH 2HWZL 3DBXB 1BZ7B 4I4WB 1ZHLB 2PXYC 2H9GB 3NN8A 3V6FB 5IKCB 4HH9A 1DBML 3ZTNL 3U4EB 2OI9C 3DGCR 3N1PC 4F9LC 4JRXD 5CSBA 4P49A 3ES6B 3PP4L 5GSRA 1DLHA 5AAMA 2X44D 4MDJB 3DO7A 1QRND 5I73B 4HLZG 3FHAA 4K8RC 1EEZA 4PJBB 4WEBL 2VSCA 2OZ4H 1BECA 4WW2B 3OAZK 1GL4B 1AGEB 3MCKA 4QRRD 1LNUB 5IBLC 4XPGL 4IIQC 3NCFB 4PRBB 3QUXB 4GBXA 5DZLA 1FSKB 4ZSOE 1KC5H 3IU3B 2VLKA 3ARDC 3CVIH 4WO4A 4NIKB 1EEYB 1DP0A 3F5WB 4N8VA 4PREA 2R1XB 5T1MB 2EECA 4P2RE 3SKJH 3S37H 2YPLE 5DDHA 4BZ1L 2V7NA 4Q6IA 1E4KA 4X6BA 3S98A 3WIFA 5C09A 3EW3B 1KCVL 2VLJB 4HFWA 2EXYC 4PJCB 5CZKA 3ULSB 1ZA3A 3FQRB 3OXRB 1NC2B 4ODWA 4OAWB 4AIZB 2Y72A 1M05B 1IEBB 2ATPA 4NKMA 1OSPL 1NAMB 4FN0A 1A2YA 4O00A 4AIOA 1XAUA 1QHPA 3UBXA 1ZGLA 4U2YA 2GY7B 2PN5A 1WF5A 1K4DA 5E9DE 3WJLC 4M7ZB 1F58L 3O2WH 3ZE1F 1Q9KB 5C0EB 2I27N 2GSIA 5I8OH 3EYQD 4HS8L 4LLVB 4ALAL 3MLXL 1FZJA 4M1DH 3MTRA 1BVLA 3B2UC 4U6XB 2IPUG 4KZDL 5F7DA 2YK1H 4LSDA 3UZVB 5MEQA 1RUPH 4JFXB 5D6CA 3FOLA 4OCYH 2UYLB 4RRPA 3C5ZC 3FONB 4NUGH 2ARJB 2P48B 4KUZH 5IEKA 2AV7A 4NNYA 2NY1B 1SYSA 3BXNB 5DRXB 3A6BH 2B7DT 4KMTL 4OT1L 4KY1L 3IFLL 4G6FD 4KZEH 2EDRA 3T09A 3OKDB 4XCNA 2F74B 1N0LA 2VRAA 4PJDF 4E5XA 5DD3H 1MVUB 4PFEA 1V7MH 3LQZA 1X44A 4LGPB 2A6JB 3EJJX 4YHIA 1NCBH 4I3SH 3IDMA 4HIIA 3EJZD 4MQXD 2IH3B 3ARSA 2R1WA 1KIPA 3GSUA 4KJWC 4NSKB 2LVCA 2AV1A 3BD5A 3GMRB 3U7AA 3L3DA 3PWPE 1M7IA 1WTLA 1J8HB 1NBZB 4N0UE 3TVMC 5FGRA 2ICEB 4OZFH 1XR8B 4FQXA 2R2CA 5DMGC 3UJTH 3D18B 1CFBA 3RWEA 1VACA 4GMSH 5KSAC 4LSVL 2UWEB 4WHYG 1KIRB 1OAQL 3EJYD 3B83A 1CGSL 3VXSE 3ZLQC 5ISZA 4QRSB 4TVSa 1KJMB 3ZKNC 4LARH 2D2OA 1S9WA 2WIIB 4PLKD 4Y4HD 1JN6B 2CKBL 5I30L 5IB4A 4Z7WF 4ELMB 1U8JA 3SGKC 1IC7H 5SV3A 3ZDYF 4F58L 5T3XE 3DMMD 2FJGA 4HQQH 4XWOC 4Y4KB 1XIWB 1XR9B 2Z92B 5JIKA 4ZNCD 1TVHA 2DJSA 2DLFL 4IOIB 2CK0L 5DJAB 2F9BT 1Z5LB 2P5EA 1AKJD 4I2XA 3QEUA 2DQCL 4YXHL 5HPOA 15C8H 1LE9A 5HVFB 1A7QH 3THMH 3FO2B 3AU1B 5B8CB 2VIRA 3IETA 5I1HL 1CD9B 1TIUA 1SEQH 4Q9RL 3MACH 5TE6L 1AFVH 4BSVA 3ZDZE 3WO4C 5TDNB 4WGVB 5CLWA 1MRFH 4JKPH 1A8JH 1DVFB 4KI1A 5I1GH 3GMMB 1TVBB 1I9IH 1EZVX 3PHOA 4PV9B 3ARXA 1RMFL 3WLWC 2JIXA 3RY4A 3GFUA 4FZEL 5FYKU 4XZUA 4YDIH 1IGML 1KV3A 2HKFH 4YX2L 1IC5L 3HC0A 3MV11 4R2GD 4ETQB 4QRUB 1UXSB 2H1PL 4NHUA 5HXMA 3OF6D 3VFMB 5I18H 3HC4L 4UILL 3QUZD 5BOZG 4PJ8B 4XNQA 4OKDA 5IIEA 4NQSB 4QYOA 4FHBD 2GIYA 4NN7C 4OIIL 3TYFB 5T3XL 5BQ7A 3D2UA 4AZ8A 2JLLA 5ACZB 2FL5A 3U9PH 4O02H 1A7RH 4CN1A 3V8OA 4PJIA 3MLTB 1GOGA 2H2PC 2IG2L 2PR4L 3IRZA 4QRQA 5D7JD 5I75C 1F4XH 2F53E 3MOAL 3BUYA 1L9MA 3ZSTA 4DAGL 3HE7C 5DUMH 3KYNA 3D6GA 4GRWE 4UIMA 2W65A 3VRJB 5HBBA 1KLFA 1GZQA 4KRPD 4TPRL 4XVUD 1JZ2A 4KJYA 1I7RB 1JF1B 1T66D 3G5VA 4QTHA 1GGBH 1KJ3L 4HBQA 1A6AA 5I1IL 1DE4B 3NPSC 4G6KL 4Z8FL 4G9FE 2HG5B 1QR1B 1GGYA 2NX5E 2PYEB 3LD8C 4JFDE 5AZ2H 5L8KB 1I3VA 3NFNB 3FMGH 3MV8A 4MS8D 1FFNB 2MPAH 4NNXA 4JJ5A 1KBGH 2P8MA 1VFMA 3MLZH 1F6FB 1BQHG 4HPYH 3JWOL 2DDQH 3TIEA 43CAB 1MJJA 2QSQA 4ZOCA 5EU3A 2ZSWB 3QFJD 1CFQA 1J1XH 1XGYL 4J3UA 2Z93B 3QO1A 1NEZG 1MUJA 4Z95L 3V4UL 1GC1L 1FO0B 5A2IH 3SDYL 4HXBL 2DWDB 2V2XA 4G80A 3HR5A 4JDTH 4PGDB 4LCCC 4LCUB 1BX2A 4MCYB 3RVTD 3E3QA 5E4IA 2ORBL 4MMZC 1F02I 5GGRB 1BJ1H 2D0FA 1WZLA 4PJFB 3TV3H 3KNBA 2DOCA 5DHVB 4LKXB 4YEFA 5TH2A 4RFOH 3L7EA 4KKAD 4QNPE 2V7HA 5ESAB 1G7LA 5GS0L 1CR9H 1X5YA 1NDGA 5DEFA 1OTUC 4M5ZH 4YQXL 4PP2A 2FGZA 1NC4B 2Y7QB 2DQUL 3EJZC 3P4MA 4XRCB 3P4LA 2C5DC 3OKMA 4WUUE 4K94H 5FF6B 4H1LA 2ESVD 2EKSA 4OLYH 1ZT1A 3TA3A 3GM0A 4EDXB 3QRGH 1G9NH 5LCVL 5IFJA 3VD3A 1OLLA 2BXYA 1MI5D 5ENWA 5EZOL 5IWLC 3OXSA 4K7FA 4FQLL 3EJYC 3RU8L 3MXVL 1YNKH 1N6QH 2B1HH 1UWEH 1MY5A 2VXTH 4G8GB 3P30L 1N0XL 1MWAA 3IKCA 2BZDA 4ODSH 4BK4A 3ROOB 1KENH 1S7SA 4ZFOL 3U6RA 3DMMC 1JI2A 1HH9B 1OT1A 3NFPA 1SVCP 1MAMH 4RMRA 2X7LA 4CGTA 1DSFH 3LKPA 3CU7A 1QSEA 4O2EB 4QHUA 4QHNA 4TSAL 3ARED 1I7UB 3MR9B 5DLMH 5ITFB 2QR0B 5IBTH 3WKMH 4MD5A 5HYJD 3EFDH 3MRNA 5BS0D 3V8CA 2XZCL 4U4BA 5T1LA 3MCLH 4LASH 4MA8H 4XH2A 4YBQC 3ZKMD 2SEBB 3O6FB 4ZS7L 3I3BA 5ETUB 3C6SB 5DJDA 2ZG2A 4GAJH 1WFNA 5HDLA 5F7EL 1FGNH 5INCB 1Q8MA 5H2BB 3B3IB 1CD8A 2IGFL 3ECBB 4PRPB 5CP7A 2VDRH 5DZNA 3MUJA 2CUIA 1A0QL 3PGDA 3BHBA 3RUGE 3S36H 3O9WD 4XCYA 4JFPB 1A6VL 5JW3H 4R2GC 3SJVE 3WFCH 1Z9MA 4NRZB 3C8HA 5D1ZB 4OZFG 5AWNH 3HLAA 1BWMA 1QBML 4TTDD 1RVFH 1J0ZA 4LCIL 3LSOA 3OL2A 4DVRH 5IB2B 5KSBB 2PW2B 5DMYA 4NRYB 3BP4B 3MSPA 1F4WL 1K85A 1B6DA 1SEBB 3MMEA 2EDFA 4PJEE 4MCZA 5IT2H 5J7CC 8FABB 4HK0B 2YWYA 3TN0D 2ZCLL 5F3HB 1T66C 3GMQB 1S7VA 1S7TA 2CIKB 3HUJB 4H26A 2Q7YB 1A7PL 2HN7A 3OKEA 2HTKD 4HBCH 1CK0H 2GAZB 2EDKA 4OFKA 3T3ME 2VAAB 3QZWG 4E42B 4ZNEE 3VRIA 4NQDE 3RZCB 4GRLB 4MS8C 4D9QE 3LH2H 4OZ4A 4OZGE 2EDWA 3VRLF 1XT5A 1R24A 3FT4B 4MXVE 5JA8B 1KN2H 2DWEB 3FQUA 4UT6H 1ERNA 1IL1B 4L29A 1P6AB 3U4BH 4JO1H 2WBKA 2YN3A 4YH6A 1UC6A 3AMKA 5BO1L 4X7TB 2PYFB 5T1KB 5FYJH 3ARGB 2LU7A 3EYFB 5TFSH 1JGEB 5HDBE 3S5LB 3NVQA 2BFVL 5TDPB 3MV9E 1YY8B 3WFDH 1FNGB 3OAUL 4JFEB 4ZFFA 2ZUYA 4WFED 4YUEL 3B5HA 5ICZA 1QG3A 4JRXA 1JYNA 3TYGL 3X3FH 1XCQA 3MZGB 3SKNA 5CSZB 3W11C 4HKBA 1MCHA 2R2HB 4P5MB 3SE8L 4L8CB 4R7DB 4M43H 5C9KA 3G08B 3QNZB 4WI5A 3KYAA 1AP2B 5LKNA 1IAKA 4KKAC 3WXWL 4Y16D 3OKLB 1K2DB 2H32H 1FVCB 3MJ8A 1ACYH 3WEXA 5E2JA 1YMMB 2F5BL 4HIHA 2NTFA 3FHQA 4M1GH 1S7UA 3VFRA 4JQXC 2NCMA 4YR6B 3V6OE 4ZTOH 4PJXA 1CLOH 4ORGA 3WLBA 2KL6A 2NYYD 2HRPH 5EU6A 5KOMC 4G6JL 4FFWD 4Z7VE 5D96C 4LLMB 2Y1VA 3ZZ1A 1XF1A 3LKRB 4CNIA 5JXEA 4WHDA 2A6KB 4LEOB 5TQ0H 2Y07H 1ZTXH 1KTDA 3OAZH 2QQLL 3NA9L 4ZOEA 5F88A 1FLRH 2C1OA 4AQOA 1MIML 1RHFA 3UZEA 2DQDL 1JV5B 5C0JA 1BVZA 3HNSH 1U92B 3QBTB 4F7MA 4X7DC 2FGWL 6CGTA 4LOUC 1BD2B 1I3UA 3MXWL 3D87B 4IBLT 4X0KB 3VXQA 5CHNA 4I3RH 3PQYE 4HC1H 2X1WL 1I1AD 5FA4A 2R1YB 4NRXA 1CQYA 4OKVA 3TNNB 3REWB 2G9HB 3HA0A 1LEGA 4PJ7A 3B5TA 1NGPH 2YZ8A 5DQJB 4OLXL 1FDLL 1FL5B 3GMLB 3ZKMC 5INDA 1HSAA 2A73A 4OSUH 4DKFH 4FQQB 4JO2L 2CDFB 2DM3A 1GGIH 3O3DB 4EUPA 7FABH 4DUXA 4U0QB 3NIDE 3BWAA 4LCYB 4D3CL 4L5FH 1JNNL 4JHWH 5KSVA 3SPVA 3MZTA 5F96L 2AXGB 4JM2B 3FN0H 3QDGB 5DUBB 3ULVE 4WFGD 3W39A 1CLZH 2YPKB 5J11B 1CBVL 1PX4A 1T0PB 1OD9A 3O9WC 1S7QA 1JRHL 3F12A 5J12C 4JO4L 4R26L 1I1FA 4D9LH 3HPJA 1HHKA 4HWNA 5IVXF 1TMCA 4LHJB 1MLBA 1OB1A 1KCRH 4NO5A 1YNTB 3FO0H 4JHZA 3BPCB 1YZZA 1Y18A 1INQB 4MNQB 3VXRB 1HXYB 4DGIL 2A0LC 3B5GA 4MA1B 1MJ8H 3S34H 1YEFL 2KQMA 1S8DB 1T2QH 2Q20A 4BKLB 4X9HA 1KOAA 3VXTB 2FHCA 1TTGA 2OK0H 3U0PA 1C16A 1A02N 4PRHD 1DUZB 3FTGA 4OBRA 3VFWA 2F15A 4JFFE 3VGEA 3QI9D 4LBEA 4Z6AT 1MH5A 1D5ZB 5ESQA 3TN0C 2BHYA 3EYOB 4WFHD 1NPUA 1BIIA 1IAIL 4I1NB 4NCC2 2AKRA 1BOGB 1KB5L 1MIEL 2EIEA 5GJTH 1ZT7B 4Y4HA 3D69A 4OZIF 3IS0X 2IALA 1AGBA 1B3JA 1I7ZA 4ERSL 4AH2B 3VXME 1BFVL 3NCMA 4EQ2A 3AS2A 4QHLA 2BP3A 1SJXA 2F5AH 5EIIB 2HVJA 3P77A 3ULVL 4IRJD 1T22A 1LO2L 3FCTB 3TWCL 3RVVD 4I5BA 4YHML 4KK8D 2VDQH 3PWNB 3ZT6A 4K23L 1LHZA 3HCVA 4ENED 1I4FA 5I71C 4UT9L 3U2SA 1IGYA 4UIKH 4C56D 1X6LA 2GJZA 3FFCE 1DBBL 3CH1A 1JP5A 1N5AB 4MQ7B 4L9LA 1MCKA 1L0XA 2GFBB 4R4BA 1VFAA 1A3RH 1XGQB 4Z0XB 4IRZL 4EIZC 4X6DE 3R0MA 3AM8C 1EK3A 4LHUB 5EORH 3HKFA 3VD9A 4LAQH 1AY1H 4BSJA 3O8XB 1R3IH 4KAQH 4KU1A 4GRMB 3B43A 1OHQA 1IQDA 5FO7B 3WIHL 5F7WC 3FT2A 3L3HB 4P2QD 4ZSOA 4K3DH 2XN9B 3QCUL 3OF6A 1MCWM 3QT2A 2NY3C 1X4XA 4XMLH 1X5FA 1OCWH 5A16A 3ILPA 4XCCH 4ZAKA 5EG6C 5FUCC 4JFZH 4P46B 2YPLA 3VGAB 5DK3A 4PD4K 2Q8BH 4OCMC 4K8RL 4KXZH 3HI6H 3WFZA 2APVA 3CSGA 5D7IF 3OV6A 5D7JA 1ND0A 3EAKA 3FQTB 1XGTB 2L4OA 1F4YH 2D7TL 3QIBD 1UACH 1FVEA 2A2QT 2HT3D 4JGMA 5J9PB 2VDPL 3RWCB 4KKNA 4PR5A 2EDJA 1JPST 1JGVH 2BC4A 4FFWC 1KNOA 5EUOF 5D7SL 3A6CL 5E9DA 3E8UL 5KVGH 4KK9D 1QBAA 5CD5D 2A6IB 5EOQL 1RZIB 2C1PA 1JYVA 3HRZA 2R2BB 4Y1AE 5GGQL 5DC4B 4YNYA 2NXZD 3FAWA 1RJYA 2Z31C 2YD3A 3S6CA 3H3KA 4HFUL 1NCNA 2UZIL 3H3PL 1Q9OA 3G6DH 4DW2L 3TBVA 1I8MA 2AXHA 3LN4B 2CKNA 4DGVL 4CRPA 1DBAL 3L95B 5MP6H 2EH7H 4MXQD 5IBUG 4YXLH 2XWBA 3WN5C 1I1AC 3PL6B 3REVA 1JPGB 2JB6B 1LO0L 4N0CD 1JHKH 4HJ0D 1RZJC 4K9EL 4CUCA 5JW5A 4WTWA 1BQLL 1QFWL 1MNUL 1IGJA 2WBJD 4U6VL 3IT8D 1RJLB 4GAGH 1MF2L 3FZUD 3SGEH 4LLUA 5AG8A 3QIWB 5EA0L 4NQCD 4QY8B 1OPGL 4PGBA 3A67L 2NLJB 1HIML 2XWTB 4M93C 4ONOA 2I07B 1NAKH 1HINH 4M9OA 1IM9A 1LEIB 1VKXA 2HKHH 3MRQB 2X05A 4GKNB 1OGAB 4LLWB 2JCCF 5F7MC 5CEYA 4FS0A 4U1NA 4R3SB 4D0CA 1P4BL 4HT1H 3DX8A 4N0UA 4TULL 3RI5K 5IQ9B 4Z77A 1NCTA 2X4TB 5E24E 2E9IA 2BVTA 3EO9H 4XPFL 2ESVA 2OP4H 3TFKA 1V5JA 5IVZB 2NXYD 4IRSA 4PGEA 4YXKL 3VXSA 4JPKH 5D9SB 1TZGH 1CICB 5JOFB 3CX2A 2BNRE 3VGGA 3VWKD 4U1GC 4X7SL 2XZZA 1WZMA 3DVIA 4NJ9H 2FATL 4M6ML 2P1YA 3QI9C 1UT9A 1UJ3B 1FFOB 1N2RB 1XCTB 3HNVH 4NZTH 2I9LA 5BZWA 1KCUL 4O58H 3HRPA 2ZJSL 1JBJA 1NCCH 5AYUL 2QQNH 1I8KA 3WIIL 1RZ7H 1JRHI 3WUWB 1LMKA 1Q0YL 4MAYC 2ZUXA 4M6NL 1I85A 2Y36L 4U0RC 3D85D 4IRJC 4QOKD 3SCMD 1QFOA 3RVVC 4FA8A 3WNKA 4KK8C 5BRZD 2BCKB 3OX8A 4HJGA 4TSBL 4JZJA 4P2OD 3HS0A 3L3JB 1M71B 4CVZB 2H26B 3UPRA 4M7KH 5BS0A 5F1IA 1GHFH 3G9VA 3GUTB 2FBJL 3KPRD 1DBKL 3CFJA 1NMCB 1NCAH 3LV3B 4XPHL 3F7QA 3LB6D 4KGJA 2I60H 2MMXA 5F21B 3V0AC 3DURB 4KMQA 3K8LA 1JI1A 5HHMD 3O2VL 5DEGB 5D7LD 1NSNH 4P3WA 3FRUB 2P5WE 2X40A 2DLEA 1GIGH 4PJHB 1D9KA 3BH8A 2BX5A 3BKJH 4J3OC 1LK3H 3RP1A 2E9JA 4RGMC 3O6ML 2P8PA 4I0PD 1MRCH 4XC1H 4JZNB 5JLZA 1V7NL 3CVHL 1AR1C 1MFAH 3P4OA 3L5IA 3DVNB 5DXWA 4Z7NF 2R0WH 1IE5A 2V2TA 2HMID 2FLBT 1HHJB 3CFBB 4TSCL 2W0FB 2O61A 3FQXA 2F53A 4KTEL 2FEDD 1BBJB 5IEHA 4NC2B 4LCWB 1F2QA 1CG9A 2DQJH 2ENYA 2WWMC 3M8OH 4ZD3L 3VA6A 1JFMA 5LAXB 4MJIB 4UQ3A 2HT3C 2OTPA 2XACC 1L8JA 2J8UB 3MRHA 5F6HI 1BLNA 1M4KA 4ONHB 4XNXL 4LLQA 1FRGH 2DS4A 1JPTH 1DR9A 4G9FA 4GW5A 2NX5A 4OD2B 2XT1B 3TO4C 4JFDA 3BPLB 5GGVH 4N90E 1IVLA 1A6PA 2CPCA 2YC1A 5CD5C 5E8EB 4U1KA 4CJ0A 4Y5YA 4PGZA 2QTEA 4POUB 4DZBB 3PDDA 2XTJD 2DL9A 3BEWB 5HY9A 1CDJA 5C0IB 4P5TD 1ORQA 3RIFK 3BGFC 1BEYH 5TGBB 5HGHB 2VDNH 3FOMB 4XXDB 4WUKH 2VQUA 3H9SD 3B9EA 5B3NA 1MCWW 5B39B 1YEDB 2XRAL 1MQKL 1KIQB 3GMOB 4G7VH 1QLRB 4NUJB 2HP4A 5J0BA 3PDGA 2AABH 1R3HA 5GIRA 3RDTC 3NGBC 3TGXA 4ZFOA 2QHRL 4F3FA 4EZMA 2AK4E 3VFTA 3PP3K 3N1QC 1KT2B 1L7TL 1N8ZA 3OWEA 4FTVD 1AD0A 4G8EA 1E4WL 4OCRL 4V1DE 1B0GB 3VWJA 5FYLD 2P45B 3KPOB 2GUOB 2IADA 3ZHDA 4IM8A 3MRBB 1N64H 1WBYA 4OIAA 4PRDB 5IHUH 2YS4A 3S4SA 4AEEA 1QBLH 1SJVA 3HFML 4PY7B 1TENA 3O4OC 4X9BA 5JW4N 4WUUA 1BBDL 4ODUA 4L4TE 4ZPTA 3VFUB 4HWZA 1FH5H 2NW3A 3W0WB 4MLSA 3BQUA 4CMMB 1R5WA 5C0AB 4D0DB 5HHOB 3VFVA 1AGDB 2YBRB 4G7YH 3O0RH 5LXGH 3LKNB 4LDOB 5EOCH 3BDYL 5DS8A 1JUFA 5GRVL 1AHWC 5HI4C 2VWEE 4PRNA 3QCVH 1BM3L 1HXMB 2MKLC 1QFWI 4JY5L 1UEYA 4YDJA 5BVPL 1G7PB 2FZ3B 5FUZH 4A6YB 3MLWH 4HH9B 1TETH 1FNAA 1NGQH 1WLHA 4OLVL 1PFCA 1AO7E 3EOTH 1V3MA 1DLHB 4QRTB 4OQ1A 3NCYP 5JPNB 2IBZY 2QQQA 2OTUA 4G5ZH 4O4YL 1VGKA 3RIAK 4B5EA 1UH4A 4E9LA 2ICWJ 4FXGA 4LNRA 4JFQB 1CE1L 3I6KA 3MCKB 4N8VG 3SCMC 4MJ6A 2E7LC 4X4ZA 4P5KA 3N85H 3IJSA 3MRKA 4HS3B 3IDIB 1RV6X 4H5SB 4P2OC 1H3PL 4GBXB 1T7YA 1CGTA 3CC5A 2ZWLT 2YSSA 2VLKB 3GJFB 5A1AA 1P4LA 4K71C 1CL7H 5CJXA 1TQCB 2R0ZH 4H1LH 3ALWA 4GO6B 2AEPL 3DRTA 5D2NB 5DDHB 5FDWB 4Q6IB 1G9MC 3RUGA 1QSFE 1U6AH 3SJVA 1VPOL 5DWUH 3RBSA 4ODWB 4NO3B 2ZOKB 3U1SH 2O5XL 5DVKA 5I8EB 4OLZL 3AMLA 4R4FH 4JRYB 4Z0BH 5FGCE 1LDPL 1A2YB 4KHXH 1UZ8A 2UUDK 3UBXB 4AEHH 5L88H 1H3WM 3GSOB 5TF0A 3DUUA 5F7NC 1MWAH 5GRZA 1KLUB 5E99H 4FZ8L 4IMLA 2HMIC 4RRPG 1KJ2L 2XKUA 4P3DA 1QKZH 2GSIB 5E6IA 4PJEA 3KYMA 2FEDC 1BVLB 4P23A 3CXDH 3BDXA 2X42A 3L7FA 1Z3GL 3QFDA 5F7DB 3EIFA 2EIZB 5MEQB 1N7ML 3PNWA 1QQDB 3OHXA 3NZHH 2VXQH 4EVNA 5FB8B 3DXAE 4XNYH 1Z9OA 2YPVL 4KHTL 3SKOA 5IJKC 4U7KA 4OLWH 2DM2A 1UM5L 2AJ3A 5IEKB 2AV7B 4ZNEA 4LIQE 4TRPL 4NQDA 1K8DA 4MX7A 4OZGA 3LRSA 1I8LC 1JWSB 4LP4A 2A9MH 4QWWD 1IKNC 1DQQA 1DQTA 2D7NA 4XCNB 3VDBA 3GI8L 4F8QA 3ZKSD 1FVDB 3QUML 1ZEAL 4YHIB 1CTOA 2HLAB 4YHOH 5F1KC 5J57B 4YGVB 4ZFGL 1QYGH 1DANU 3CDCA 4LVHC 4HPOH 2VXVH 2F58L 4QKXB 3N9GH 3BW9B 1ULVA 5CD3B 4RIRB 1AI1L 2EDOA 3CFEA 4OQTH 4HS6B 4PRID 3B9KD 2FNBA 2VLME 4QRPB 5FO9A 3ZL4L 3LAFA 4QXTA 4C54A 2XKNB 3HC3L 2FHFA 3RWEB 1ZHNB 4HX1A 1A47A 1J0YA 5GZOC 2VH5L 1Z9SA 4XP6L 4X6EB 4HIJB 3DV4B 5KVFH 4LSSL 4Z5RA 1S9WB 2WLZA 4K2UH 4LIQL 5CWSB 1PDKA 1KPVA 3VD4A 1SYVB 4LSTH 3V6OA 4DTGL 1I3RA 5J6HB 12E8H 4G9DB 5J6GA 3GHBH 4HUKB 3QEQD 1EO8H 1TDQA 1RIVL 1WIOA 3TCLB 2QADD 1KB9J 2C7UA 5C0BB 2IF7A 4CW1A 2P5EB 4I2XB 3VH8A 3O4LE 2ED9A 1QR4A 4GAYA 4X5XB 5TE7L 1LE9B 2YZ1A 4NDMA 4JFHD 3SDDA 1LD9A 3WXVL 3UJJH 3QO0A 3GRWL 4I3GA 3MNWA 2IFFH 4R0LC 2BY2A 2F19L 2VTFA 3TJHD 4DVBB 5F9JA 2BVYA 3RWGB 1G6RH 2B4CC 4NWTL 1OAKL 5MEPA 4GFTB 2A83A 2E7MA 5KOVC 2JIXB 3O6KL 1IGIL 4Q2ZA 1YJDC 4IHOA 4YEEA 4N9GB 3RWFB 3VD7A 2EIBA 4RZCB 3HC0B 3VCLB 3T08A 2JKXA 2E8YA 4NHUB 2V17L 2DKMA 3BDBA 1KB5A 2X89D 5IIEB 4DKEH 4BH7A 4ZPVB 3V0VB 3D2UB 4WRLA 3D3VE 1P84J 1OARL 3M17A 2PTTB 3V5DA 4PJIB 3L3KA 2VL5B 4LKCA 1S7XB 1D5MB 2VDKH 3DUSA 3WE6A 2CRMA 1CZ8L 3UDWA 3S96A 1KTRL 3KYNB 2CMRL 3M1BA 2RBLA 1M7DA 1K4CB 2ZSVA 4HEME 2EC9U 1IEAA 3UCRA 4PJAB 4P2YA 4QTHB 1N5YH 4XMKH 2Q76A 4OTXH 3SKJL 2NTSP 1NGYA 4OZHB 1S3KL 4KVCL 5I73C 4MYWB 5C08B 1MREL 1T21A 2NR6C 4XCFH 3DSFH 3RTQD 3DX7A 1MLCA 5DURB 3F6LA 2KUTA 2P8MB 4JFFA 4U6YB 5EO1B 3WIHA 1HOCA 2A77H 1XMWA 5LBSH 5I1CL 5IOPB 3T0VA 5EU3B 1E6OL 1CFQB 4FQ2H 5EZIL 4OV5A 1A1OB 2PXYB 4F33B 1I3GL 5F6IB 3TLRA 1MUJB 4EI5D 4X6CE 3FB7B 3VXMA 4JDZA 2OI9B 1EXUA 3ARFB 3STLB 4Y5VB 1RPQA 3HR5B 5EULV 3ZKQD 2D9QB 5TE4L 2AS5M 1BX2B 4GKOA 4OFYD 3V5HA 4L3EB 2V9RA 4JQIH 1JGLH 3CAFA 2X41A 1MJ7H 1GOHA 1JGDB 5E2TH 3KNBB 4OCYL 4IIQA 1C1EH 1RK1A 3FFCA 2RR3A 4QWWC 4Z76B 3D85A 4H1LG 1FPTH 1SJEB 4WNQA 2QKIA 2ZUVA 3CGTA 2VLRE 3RRQA 2R56H 4LPYA 5B4MD 4X6DA 1DBMH 2BVUA 4PP2B 5HYIA 3ZTNH 2RFXA 3E1F1 5T33H 5FUCE 3T0WA 1G7JA 4J8RA 4BH8B 3HZKB 4N0RA 1YYML 4DOHB 1OTSC 1LDSA 3PP4H 1NDMB 3DHMA 1P7HL 3B9KC 1K5NB 1T0NB 3TA3B 2HFFB 3BPNC 4OF5A 4OM0H 1A7OL 3GMPA 1J12A 4WEBH 1ZLVK 1JWUA 3MGOA 1V7ML 3BIKA 3L5WB 5IFJB 1EAPA 2OSLB 4YHLL 3OXSB 4XPGH 4K7FB 1FBIH 3EYUL 3DIFB 2NY1C 3I85A 5DRWA 1R5IB 4QO1A 4I0PA 5F8RC 3VDCA 4DKDC 1WBZB 4EXPX 1QHOA 2GTWA 3B9DA 3IKCB 1MFDL 4F57H 1JF5A 2AVGA 3MOBH 5BV7B 3WDJA 3UJTL 5MENE 2J1KA 4WU5A 1XZ0B 3BPOB 4BZ1H 5LVEA 3LVEA 4RAUA 5DJXA 3INUH 1KCVH 2QADC 3LKPB 4OGZA 3MRDB 1QSEB 2NNAA 4QHNB 2GJJA 1FYTE 4LQ1A 2YRZA 3BD3A 3MUZ1 1G7IA 3C5ZB 2HAZA 1AQKL 4WI6A 2ADJB 1C08A 2XFXA 1IC7L 4OF0A 4Y1AA 4HUWA 5IMLA 4KQ3H 3NCBB 5C0GA 1JHTA 3QG7H 4X8JA 1DL7L 5MI0B 1MFBL 3T3PF 1V8HA 1C5BL 1V05A 2GY5A 4ETYA 4HS8H 4NN6C 3TJHC 1BGXH 1NFIB 4ALAH 1K3ZA 3P73A 2RQ8A 5I16A 5JA9A 5CP7B 1IILE 15C8L 3PWLB 1A7QL 4EQ3A 1HE7A 3I9GL 3H3BC 2ITDA 1DQML 2N7BA 4RWYL 5JDSB 5F9OH 4WDIB 4JKPL 4R97C 4OF6A 5I1GL 3TH2T 5D2LB 3DRQA 1I9IL 1T5WA 3K2MC 3W2DL 4BQ8A 3OKNA 1R3LB 2LABA 5J13B 3DX9A 1G6VK 3LIZL 3TVMB 4OT1H 5KSAA 4GUPA 4FTVA 3GKWH 1YECL 4JZOA 3G5ZA 3GIZH 1I1YB 4TTGA 1S7RA 3DECA 4OCWL 5B8CC 2E7HA 5E8NB 1K6QL 1J9CT 2YRPA 1S7VB 1S7TB 5I8CA 2K9UA 4H26B 2DJUA 2OQJA 3IGAA 5JIPA 4KI5C 1XF5B 3H9HB 1V3JA 1C5DA 2PW1A 1KPRA 4F7PB 2NY0B 2BNRA 2DBLL 4OZ4B 1ZGLP 3ELAT 4X98A 2DLGA 3DJ9A 1OAQH 1CGSH 1O7SA 2JJTA 1OSZB 4JPVH 4GG6E 1X5HA 3U82B 3CVHA 3NFSL 2CKBH 2G5BB 3PP3H 5C0CE 3KHQA 3WDHA 3FB8A 4OB5L 2W07A 3Q6GL 1EV2E 3RL2B 1HDMA 1L6ZA 1YMHA 3FMGL 3RVWD 2HLFD 2CO7B 4JQVA 4KDVA 2OXGA 1SQ2N 5DJ0B 4ZFFB 4F58H 1EHXA 3X14A 3CMOH 1KBGL 5ICZB 3MLRH 4N8CL 1P7QD 1WQVT 4JRXB 1WSST 1RIUL 4HPYL 5E08H 4MJ4A 4YC2B 5GXBB 3CSBA 1BOYA 3AFLA 1MCJA 1XCQB 1QRNB 4Z7OF 2CRYA 2CK0H 4Y7MA 4XMPL 1SMOA 4XTRD 1UADC 5I9QB 2N4IA 1EIBA 5L2KE 4YXHH 4QRRB 2PTVA 2NZ9C 5I1HH 4G6AD 3KS0J 3MJ8B 4AIXA 4Q9RH 4HKXB 1ITBB 4JHAL 5B4MC 3TESA 1W0YT 3UTSE 1Q9LB 4UI2A 4PS4L 4J23A 2NTFB 4UOW0 5FOJA 1S9XB 2Q6WB 4XCEA 4FXKA 4YDVA 5DGQA 4DJMA 2R15A 3ARBD 3C9NA 2ZOLA 5D5MB 5ICXA 3HE7A 5I75B 4PJXB