1S7VA

Crystal structures of the murine class i major histocompatibility complex h-2db in complex with lcmv-derived gp33 index peptide and three of its escape variants
Total Genus 67
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
67
sequence length
276
structure length
276
Chain Sequence
GPHSMRYFETAVSRPGLEEPRYISVGYVDNKEFVRFDSDAENPRYEPRAPWMEQEGPEYWERETQKAKGQEQWFRVSLRNLLGYYNQSAGGSHTLQQMSGCDLGSDWRLLRGYLQFAYEGRDYIALNEDLKTWTAADMAAQITRRKWEQSGAAEHYKAYLEGECVEWLHRYLKNGNATLLRTDSPKAHVTHHPRSKGEVTLRCWALGFYPADITLTWQLNGEELTQDMELVETRPAGDGTFQKWASVVVPLGKEQNYTCRVYHEGLPEPLTLRWEP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Determination of structural principles underlying three different modes of lymphocytic choriomeningitis virus escape from CTL recognition.
pubmed rcsb
source organism Mus musculus
molecule tags Immune system
molecule keywords H-2 class I histocompatibility antigen, D-B alpha chain
total genus 67
structure length 276
sequence length 276
chains with identical sequence D
ec nomenclature
pdb deposition date 2004-01-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00129 MHC_I Class I Histocompatibility antigen, domains alpha 1 and 2
A PF06623 MHC_I_C MHC_I C-terminus
A PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1s7vA02
3.30.500.10 Alpha Beta 2-Layer Sandwich Murine Class I Major Histocompatibility Complex, H2-DB; Chain A, domain 1 MHC class I-like antigen recognition-like 1s7vA01
1M05A 4L3CB 1NQBA 5FYLH 4YO0A 5KVDL 4YUEL 3HR6A 2ZCKH 4W4OA 3ELAT 1A6AB 1HSAA 1RD6A 4D0CB 5FF6A 2VITB 1YY8B 1UCBL 3WKML 3EOBA 4XBPB 5GGSA 5E0QA 4EUPB 3OAZK 4G8FA 3RZCA 3L5WA 4FQXA 1QLEH 5F8RC 4LSDA 2EXWD 4YDJA 1GIGL 4K7PY 5HDLA 5I71B 1CK0L 3HNVL 4QRQB 3QULB 1YY9D 4R8WH 1XR9A 5TQ0L 1I1AB 3X12B 1WFUA 3O8XB 4YBQD 1EHAA 4C56A 2ZUXA 5EUKA 3OL2A 1U8OA 3RVXC 4LQFH 5IR1A 4ZUTA 2EO1A 3GMLB 4DN4H 1E6JH 3O3EA 3VFWA 4Z77A 3CH1B 4GLRI 2NX5B 5TE7L 1PKQB 1VADA 1RZKH 5K9KA 1G6RH 5F9JB 3EYOB 3VXPA 5LG1A 2VAJA 5E5MA 2X4UA 4UT7L 3TBSB 5HHXH 1R3JA 1TETL 1F4YL 2IEPA 1NEZA 3LEVL 4LIQE 4UDUA 3FRUB 1DLHB 2WIIA 3SGKA 4NC1E 4Y4FC 1KG0B 2PXYB 3FQNA 4IIQB 2YD6A 3T0XA 1T1WB 1XCQB 2R29L 5EU6B 4I3RL 3UYOD 2VNCA 3HE7B 3BVNB 3O4LE 1JHKL 4HD9A 1CLYH 5B4MC 4LK4A 5DJ0B 3T4YB 1B0RA 2X7LB 1FNEB 5C08B 2VTFA 2AP2A 2WWKO 3BH8B 3S96B 4JQXA 2F5AH 5E56A 1EO8H 2XFXB 4I3SL 1TITA 1PG7X 3VXRB 5IQ7H 4HBQA 4Q9RH 3TIEB 4WU7A 4ZUVB 3WXWH 1SYSA 4PTUB 4JHWH 5C7XH 3HB3D 4OZGA 4HUMB 5JZ7C 1KPVB 5JIHA 3H2WA 2P8MB 2PO6D 4G6JH 2YUZA 2VABA 1BFVH 4YE4H 1QFWL 2Q76B 2J88L 1S9XA 4R0LA 2OQJB 2VLJB 3OG4B 1MNUH 1Q38A 1DVFC 4HW6A 3DVFA 2WV3A 5HGHB 3BEWB 3GNML 4PS4L 2NXYC 3UTSD 3BD4A 2F58L 1A6UH 1MY7A 2YPVL 1AR1D 2N1KA 2R4SL 4IRSB 5KS9E 5DJZB 4KMQA 4P4KB 5E1AA 3ROOA 1VEPA 4YR6A 5FV2A 3RWDB 2WUBL 3D39A 3DVGB 1T1ZB 1NCBH 2PYEA 4UOW1 1BVLB 3Q6GL 4PRPA 3U6RA 3JWNC 4OSUL 5DJ6B 5EU6D 1RHFA 2CR3A 1KJMB 3O41B 4EKXA 4XMKL 3CPLB 3OJDB 1L7TH 2R56L 2P42B 5CP7B 1AO7D 4POYA 5B3JF 1DBKL 4JANA 2NZIA 2Y06H 4WTZA 4F57H 4Y4HB 1FLRH 3RGVB 1C8PA 1AQKL 5F9WC 3V0AC 2EYRA 3QDME 4KTDL 2ITDB 4BH7B 2WQRA 1RZKL 3KNBB 3BKCH 4QRRA 1S7QB 2NLJA 3D3VB 4JPKL 3UBXB 1LK3L 3UX9B 3T65B 1F58L 3WIHA 2B0SL 3RY6C 3VWKB 2HTLC 3HS0A 5EN2B 5SV3A 4F33A 3O6FA 2XOTA 2DIAA 2DQUL 1LE5A 1PKQE 3T0ED 3FB6A 5D2LE 5KW9L 5HI4C 4ELMA 1TETH 3GMRA 1ED3A 4X6BB 3W82A 5TDPB 4QHNB 5ID0B 4OCWL 2VE6B 1ZLUH 2I60H 4N8CH 3WFZA 5I9QC 3ULUL 1KB5B 1RZJL 3CJJA 1QFUH 3HI1B 4RAVB 4RFNB 3CH1A 4CDGC 5HJ3B 4AM0A 2FRGP 3QA3B 4G9FD 4Z7OE 2JB6B 3D0VB 4L4TA 3N85L 1Q9OB 1GRWA 3NIGE 2DWEB 2BMKA 2A73A 5T5NG 1NEZB 2P5WB 4J8RA 5I1AA 5L2KD 3TBSA 3CX5K 4P4KA 3QHZL 3ROOB 2EICA 4I0PA 5CLTA 3RX8A 1A9BA 3Q2CA 2BXZA 4WEMB 1RJYA 1L9MA 5T1MA 3ZYZA 2HTKC 2P8LA 4X6DF 2X40A 4NQTA 4JO4H 2HT2D 4G8FB 3BE1H 5C0EB 1QFWM 4I18C 5D2LA 1OF2B 3DBXB 3PL6B 4M1CD 4AH2B 1BBDL 5JIKA 2FJHA 4U6XA 5D7IE 3LQMA 5KSBF 1LO0H 1S7UA 3WLBB 1IC5H 4OLXL 4PV9B 4DW2L 1U2HA 1T2QH 3A6BL 3TIEA 4X7CC 4TNWF 1BZ7A 1AHWC 1K8IB 5T3XH 3P0YL 5I74B 4PBXA 4KHXL 1H3VA 4ZTPH 5TDOB 2QL1A 3B2VL 4UI2A 3VXOA 1MF2L 1RFDL 4Q6IC 4FZEL 4KK8D 5T1LA 2XYCA 2AXGB 4QHNA 5ID0A 3J8F7 4KJQD 3VXOB 4NQDD 3LPFA 5EIVA 2Y5TB 3KPSE 5D1XA 1T21B 4E9LA 4YPGB 4OD2B 1RK1A 3O6ML 3L3GA 3S35X 3X17A 4OQTA 1BD2E 5EC2B 4OD2A 2XTLA 4UB0H 3W0WB 4PRAA 1DANU 3DV4B 3QZWA 3L5XH 5JQ6L 3EHBC 4JRYE 1OW0A 1WK0A 2CRMA 1Q0YL 1T0MB 4EOWL 4R7NB 3UJJL 1JHKH 3IFPB 2H41A 1VCAA 3KPOA 4WUKL 5E24E 1AXSA 1JI1A 2R0LL 2X4OB 4M9PA 2ZSVB 3LQAL 3SPVB 1NLBH 4OCYL 1JNLH 4HC1L 4PG9A 5E7BA 2C5DC 1IGJB 2I60L 1MIEL 1NC4A 4TUJA 5A16A 3VXMB 3QDJE 4KTDH 1U95B 3UYRH 2G5RA 1T3FB 3RJDA 2HJFA 2Y4SA 1S7UB 3O6KL 4Z0XA 4BELD 4NKDB 3WD5L 1KTLA 2NY2D 3HC4H 2YPKB 4R97B 4JB9L 4J3UA 4PREB 1DBAH 4TYUA 1KIQA 1I7UB 5BO1L 1CE1L 4JZNB 1IL1B 4NQVB 3MV01 2VE6A 1B2WH 1IKFL 4DK6A 2Q86A 1ZOXA 3M8OH 4DFIA 5ITFB 4XNMB 4RAVA 3WXVL 4EUPA 1KB5A 1SYVB 5ITBH 4YHKH 3JWOC 5HPMA 2X89A 3PDOB 4FRWA 1LMKA 3X13B 1IM9D 2QADD 3MZTA 2FJFB 1NAKL 1YN7A 5D7KD 1E4JA 4OSUH 1WEJL 1PW3A 2IADA 4FTVA 4JDTL 3HLAA 4WGWB 1HH6A 1MIML 4LMQI 4POUB 3X3FL 1CWVA 3FOMB 4M7JH 1BFOA 5JHLL 2YA2A 4GRLC 1UGNA 4LLYA 4OQTL 1ZGLP 1K3IA 2EE6A 3CDGB 1FRGL 4PDCE 5E8PA 1QA9A 3VA2C 4MAUL 3QQ4A 1QEWA 4XC3L 2C1PA 5GISL 4LCYA 1HSBA 1BD2D 4ORGA 1OP3H 4C56E 2IBGA 3NFNB 2IBZY 4CMHB 2XA8L 3IXTB 2HN7A 1JUFA 3OX8B 2A6KB 4MAYB 4ZQKA 1BHGA 4MA1C 2G9HB 3VXSD 3VWKA 4EBQH 2JJTA 5CS7A 5DC4B 3T3PF 5KSBB 4LLVA 3CGTA 1F6AA 4ZS7H 2DI8A 2ZJSH 1GJIA 5IFJA 1NCDL 25C8L 4K9EL 1FPTH 1BVZA 1PAMA 3TVMC 2YD3A 2WBJD 3X14A 1RUAL 4DEPB 4LVNC 5K9JL 3PIQB 1EX0A 2WBJC 1EO8L 3S7GA 5D7IA 2C1OA 2XY2A 4OD1H 3EOTL 2OQJA 2M1KA 4URTB 2CJUL 4MNHA 4YQXH 5TF1L 1FNSH 3BZ4A 3I2CH 4S1QL 1Z9SA 4KHTH 3NTCL 2GI7A 2Z92A 2NY4B 2OZ4H 3BKJL 1H3PH 1NAMH 1UENA 3MV8D 1BOYA 1P84K 3KXFA 2FHFA 4WI5A 2IQ9H 2P5EE 1MLBA 4HT1L 1CYGA 3QIBB 4QRSA 1MCPH 4LVEA 4A6YB 3FHAA 1DUYB 2BC4A 4KROB 3V7AG 5T3ZH 4M1GH 4OZHF 4MA3A 3T0WA 4HAFA 5GGTA 4TSAL 2NTSP 2Z8WC 4WW2F 4LCWD 5I71C 1F2QA 3TT3L 1YDPB 2APWA 4QTHB 5ETUA 5EG6C 2MCPL 1INEH 4Y5XA 4XRCB 1G1CA 3D3VE 3LEYH 4TQEL 4X8JB 2HWZL 3BZFA 4ZFGL 2C4FU 3CDGA 3P11H 4LASH 1Q72H 2HVJB 1QHOA 4HJ0D 5I8KL 3KR3L 4F7PA 3VXUE 3LMJH 4M1CC 1H5BB 4M7KL 4JM2B 4PGEB 4RA3A 4R3SA 4DW2H 3OHXB 3HUJB 1GGCH 4YC2C 1F02I 2HT2C 1JGVH 1MH5B 2EKSA 4LRNL 5D2NC 3WLWD 3QIWA 2MNUA 2FYYA 5D1QD 4Y88A 1JI2A 4YHNA 4RRPA 3C60D 5FYJH 1CGVA 3PWVA 5DJDB 2P5EA 4HULB 1AO7A 1RIUL 2I27N 1YNLL 1OL0A 2I5YL 5DURD 1A1OB 3RZCB 5T5FL 1FZJB 2W1NA 5KN5B 2ADIB 1M7IA 4KI1A 5SWZE 4KJYB 5DK2B 1J0IA 1A1OA 4JPWH 4XPFL 5I76A 4FQ2H 1M6OA 4MVBA 3VGEA 1F11A 5E8EB 3EZJB 3AFLA 3L3GB 3CSPA 4OCXH 1UJ3C 4LSVL 2I07A 5C92A 3KYNA 4P9HH 3EOYG 3C5JB 3GI9H 4U1LB 4ELMF 2BY2A 3QFJD 4WFHE 3QDMD 2HAZA 1QSEE 5K9OA 1T22B 2JCCA 5LGHH 4XT1C 1JJUA 1BIIB 1RULH 3TT1H 4Z77B 4OCWH 5DD3L 3LQAH 3WO4C 3EOBB 2FWOB 3IDXL 5ANME 5B38B 1BOGB 3ARFC 4Y5XB 1DDHB 1G9ML 3OPZL 4QHUA 5IB4B 4C54A 3MLSL 2W65A 3QEUB 4NSKA 2XZZA 3SQOH 3UZQA 2EIEA 2ILLA 4LSUH 5KG9A 1N6QH 1BAFH 4XGZA 5BV7B 3FO9B 5F21B 4WENB 4F7MB 1P4BL 2IANE 3GSNA 1J8HB 3R0NA 4IIQC 4X6DA 3GSVB 3O3UN 3GO1H 5ADPH 5DGQA 5J1AB 4Z0BL 4LOUC 4IRSC 1QO3B 4PJAF 3V4UL 2OL3H 1FYTD 5I73C 2FEEI 5KAQF 5DA0B 4DCQA 3SDAD 3LEYL 4TQEH 3KPLB 4JPVL 4GAGH 1V7ML 3O0RH 5CBEB 3ZYOA 2YRPA 1FFOB 1BLNB 2RHEA 3I3DA 4MNHB 4S10A 1P5VA 4OLWH 1P1ZA 1W72L 1EBAA 3EJZD 3HMXH 5ACLA 5FYKL 4I3GA 4OIIL 3WKMH 1JYVA 1MF2H 2VDQH 5HGAA 5I73B 1GSMA 4QRUA 1UXWA 5J11B 3D3VA 4OZIF 5EB9A 3WFCH 1YN7B 3CVHA 1IC7L 2P7TB 4C4KT 4X4ME 1QFUL 2X4NA 1GH7A 1NGWA 3HB3C 1T89C 4R96B 3CK0H 1TJHH 5J6GB 5GRJH 5JORA 5JR1H 4OM1L 2R23A 2AJZB 4PJFE 4QHLB 1T1WA 1XCQA 5CD3A 3OBAA 3O2DA 3T2OA 4J1UB 3CD4A 3WMSA 5DC0A 3OR6B 4WW2B 5MI0C 1Z9OA 1N2RB 1AGCB 4Z8FL 1TZIB 5C07D 5CBAB 3QEQE 2UY6A 1CFBA 4DKDC 4B7LA 2P5WD 3RWHA 1MLCA 4G8GD 4NBYB 4CL7A 2ZJSL 3V6OE 4BQ6A 2VKWA 2KH2B 4RFNC 4B0MM 2EO9A 4XWOC 1ZHKB 4G8IB 4KU1A 3L95B 4P46A 1AH1A 5I1HL 3IFNL 3UEZA 5MEQA 1XIWB 3OKDB 1XF1A 2O5XH 5I30H 5CP7A 5EA0L 4AEIH 3WL9B 3D18B 3UPRB 4UTBL 5EULV 1EAPB 4LSQL 1EV2E 2V7HA 2XACC 3MRGB 2QEJA 4YNYA 4OGZA 5C07B 2IQ9L 1OVZA 4JJ5B 5DS8A 4I13B 4GBXD 1S5HA 1C08B 5F9OH 1QBML 4PTTB 5HI5C 4Z7WA 4JRYB 5DWUH 2FJFA 4HCRL 4YWGL 1J87A 1A6ZA 1UM5L 4LAQH 4HUVB 4MNQD 1RK1B 3CLEL 1ETZB 5DVLA 1HQRA 1FG2A 1E4XL 3CCHA 3MYJA 2O5YL 1L9NA 3AM8C 3W0WA 2EDYA 5SWSB 4PP8C 4PD4J 5IB5A 1HCFX 1BQHA 1FZKA 2CDEA 5EU4A 5FK9B 3GMQB 3OKLA 1JTTA 2V17H 1MNUL 3QWRA 5ITBL 4L8BB 1IC7H 4MD5B 1I3GH 4JKPH 5EZOH 5FFLA 1VB9A 5TGBB 1Y18B 2VL5A 3NH7L 1T2QL 1B4JH 3O4OC 3EYVB 1KT2B 3KJ6L 4YHOL 2XPGB 4X83A 3H7BA 3I3EA 4OV5B 5EBWA 5DFVD 1DCLA 4RGMB 4EN3B 5DMIH 3V4PH 2QKIB 1DBJL 1KCSL 1XCTB 2VLRA 1RUPL 5EUOE 4MJ2A 3KPLA 1RZ8B 4I18B 1KC5H 4ZFOB 3U36B 1F90L 2JTDA 3NCEB 1EUUA 2F5AL 3I6GA 4D8PA 3MRNA 1KIQB 4CKVX 1VENA 1ZKAA 4OD3H 4LHJB 1KLFA 1FZOB 2PW1B 4Z7OF 5D1ZD 4HJJH 5D7JC 4ZPTA 3V9FA 1WUNT 3HAEB 1X5YA 4PJDE 3ES6A 4K8RH 4QO1A 4WCYH 3QUXD 4AY0A 4UNTA 1RJZA 3FN0L 3KPRA 2ADGA 1JGUH 5GRZA 1E4KC 1BEYL 3ZKND 1P5UA 5DJYA 5EO0B 1A7NH 4JAMA 4QRQA 3BWAA 1JRHH 5D7JB 3BT2L 3MA9H 4M6MH 4P5KB 3BPOB 1RQ5A 4BQCA 5TDNB 1YPZE 3LV3A 2V5YA 3EGSA 3RIAF 5C0BB 2X4QA 2ZOKA 3U4AA 2HLAA 1A14L 3RU8L 2Y23A 3WFHB 1TVHB 2QLVB 4L8SA 1HIMH 1CT8A 1AFVL 3CMOL 2G60L 1J88A 1WWAX 5BRZA 4IRJD 3SDCA 2D0HA 1SMAA 3I3BA 2XN9A 3TO4D 3WLBA 2K7PA 3DTXA 1NUGA 4HQQH 1QTYT 3RVXD 1TVBB 1R3KA 3MLXH 3PQYE 1JWSA 5E9DA 1SBSL 4EI6B 3GSUB 4BZ1L 3B9EA 1DFBH 4YBQC 2YXMA 4H1LH 1SEQH 1S78D 2N7BA 4NQEB 1E0OB 4JPVH 3GSQA 3HZMA 1ZXQA 1N64L 1G0DA 4OUOA 3U1SH 2IPKB 3FTGA 3HG1D 3STBA 3DURB 1A4JA 1FYTA 1ZT1B 3SDXB 3MJ9L 1BGXH 4C83A 1LP9E 4GKNB 5LJYH 1JIBA 3BMWA 4WNQB 3S3JA 3TO2B 4ZAKB 1FHGA 5CCKH 3NFSH 2YRZA 2DJUA 1H9VA 1OM3H 4G43A 4JM2A 4BSWB 3VXSA 2A6KA 3WFBL 1W72B 4AIZA 1IILE 1A6VH 3REWA 1S3KH 2VXSH 4IRJA 2J7LA 3EBAA 2BNRA 4LLDA 4BH8B 2GJZA 3BQUA 1R5VB 4LLQB 1AXTH 3WDHA 4U1IA 3UXFA 1N8ZB 3S5LB 1JBJA 1U58A 2W9DL 1A9EA 3JV6A 5F89A 4NKQB 4YEEA 4MXWH 5HDBF 2WWKT 1FVCA 1ZVSB 2I9TA 1KENL 1IEAB 2Z91A 2R0WL 3R4DA 3TBYA 2WWMD 1KLUB 5JOPE 2X4SA 2AJUL 5ESAB 3ECBB 3MV9D 3K0WA 1S7WB 4LKXA 1JTPA 1HH9B 4PJ5E 5C7XL 1H0DA 3GHEL 3H0TB 3EJJX 5HGHA 3G5XB 4HDIB 3EJYD 4PJEE 4ZFGH 1CFSB 4LVOB 4DEPC 3KYOA 4G6KH 4IRSA 1IRAY 2MPAL 3LIZL 3ZT5A 3HC3L 3DO7A 4BSVB 4QXWA 2CDGB 5C0CB 1FNLA 3IFPA 1CIDA 3QEGH 4UQ3A 2EDJA 3ALWA 3QFJE 3V79C 4PLKD 4JKLA 4PJCB 2PCPB 1K4DA 5J3HD 3PDGA 3QIUC 1A7OL 4G3YL 3O2WL 4R7DB 3BSZH 4NHCL 4NNYB 5EU6A 3RWFB 2FATL 3LKRB 2A74B 2N4IA 2P5ED 4PRIE 1VGEH 2P48B 5CEYA 4NFCA 3QIBC 3FT4B 4XVJH 5E8DL 1JPGA 1A6TB 4GMTH 2OSLA 5C0BE 5EIIB 4PJ9B 3MRBB 3FT4A 4M48H 1YQ2A 3V8OA 1XEDA 3BH8A 5I15L 3OZ9L 1H5BC 3DVNA 4MNQB 2VLKE 3MGOB 2OTWB 1ZWIB 4QKXB 3QNYA 1F5WA 1YNKL 1PSKL 4RNRA 5E4IA 3VJ6A 2VN7A 4OCXL 1L7IH 3HE6C 1R24B 3WYRA 3QEQB 4LKCA 1A3QA 5MP6H 5K9OB 1F58H 4MZ3A 2JB5H 1UA6H 2F74B 3C5ZC 1LO4H 4HV8B 1J8HE 5GS1C 4FFWC 3IAGC 3RUGE 1PKQA 5HHME 4KROC 4ZUSA 4QRTB 1AXIB 5CHNB 4X80L 4ZOBA 1CXLA 2ZUTA 3WNMA 2FJGB 2X4UB 3SDXE 5IMOA 1IGYA 3BP7A 1EFXB 2X9WA 4CU6A 2XNAA 3C5ZB 1LNUB 4M93C 2XZAH 1KCSH 5B8CC 4OZ4A 3L5JA 2WBKA 4FQJH 5SX5K 5F7LB 3JTCA 1CDGA 4HCRA 4QOKE 1RJYB 4P3DA 5CD5C 3O11A 4GW5B 2O5ZL 4F3FA 3O2DL 2FR4B 5DQJA 5HGDA 4JG1H 3MRQB 5IFAL 4M93B 3SE9H 3FT2A 1PG7H 1RVFH 2D31B 1OP3K 2BJMH 4O58L 5IV2A 3IU3A 3MV8E 2MCPH 3ZO0A 1QNZL 2V5SA 4P2RB 4Y16B 1FG9C 2D31A 1RJZB 4K3EH 4M7ZC 3EIFA 1YEGH 2PXYC 5IMMA 1FNSL 2BHUA 2ARJA 5JW3H 4JO3H 4WY7H 2QJDA 3BT2H 3PL6D 4KKAC 4LSPL 1NKOA 1HDMB 3K3QA 2C1OB 2GT9A 1YEIL 1NMCB 2DLHA 5BZDB 3CFKB 2YBRA 4KZEL 3LQZA 1YMME 4ZNEE 4W81A 4I1NB 2ZUSA 1UM5H 2XWTB 4CW1B 1MJJA 1ZA3A 3VXSE 3PHOB 2A38A 1DBBL 2D9CA 3G08B 4HIIA 3L6FA 3GMQA 1JMZA 5E70A 3L9RB 1WEJH 3BRDA 2ZSWA 3SDDC 1K8DB 1S9VA 4FQXD 4R2GC 4MD4B 4XZUA 5DHVA 2BVQA 4S0TD 4HWBH 1I3VA 1A64A 2IWGA 2V2XB 4HC1H 3B5GA 4EIZC 3QI9B 4Z7WB 1WAAE 5L9DH 5I1CL 3W9EB 1FORH 1F97A 3ARDA 3NA4A 1P84J 4DN4L 1KLGB 5HDQL 3DROB 1EEQA 1F42A 4YHIA 4LHUB 3RKDC 3WO4B 1KJ2H 2UWEE 3MUJA 2AJVL 2UYLB 4X8JA 5F6IC 4H25B 1D5XA 4MA3B 1ZV5A 1V7MH 4XNUH 3PWPD 4ZFZB 1LO3H 1XF5A 3CDYA 2A74A 2MHAB 3OHXA 4J4PA 1IEBB 4QEGA 3T0EA 3P40A 4RGND 2FHBA 5FYKE 4U7MA 4Z7UE 1F4XL 4N8VB 2VXSL 3VGGA 1YYMH 5CINH 4P23D 3BP4A 1JPFA 3BZEB 1VESA 4JKKA 1KJ2A 4YH6A 4XI5D 2ED9A 1T0NA 3W81A 3TPKA 4XNZC 1KUMA 1RU9H 2GCYB 2R15A 1N8ZA 2P8MA 3M07A 1OGTA 3K2MC 3U4EA 4OZFG 1DQDL 4WW2C 3EUUA 5DRZA 1PVHA 2ARWA 5ERWB 1S7SB 3I84A 3IJHB 1CTOA 4XP1H 5IT2H 4KGLA 3GMNA 2MTPA 5EORH 2VLMD 2PYED 5AZ2H 1FJ1B 3PWNB 1UWGH 5T1DH 2Z31D 4N0YH 4NDMA 3MRLA 1H0DB 2Z31B 1RUMH 2CUIA 3GM8A 3LEXA 1DBAL 4U1GB 3LN5B 4G6FB 3K8LA 4NJ9H 4JFOB 2I9LB 3VFMB 2Y36H 4M5ZH 3U4BH 1UG9A 2R1YB 1MFEL 4MNGA 4Y19B 3ZSTA 4P4KC 2H45A 2G2RA 1OY3B 2XTJD 4FFYH 5I1HH 1OSZB 3CFEB 2X1WL 2C4FT 3ARDB 3OB8A 4GXVH 4WFEE 4MNGB 3KS0J 4QXTB 1ZLSH 2WZPD 3B9KD 3QJHA 3BDXA 3O4LD 5MHSE 1SY6A 2VL4A 4GKNA 1BECA 2VR9A 4LLYB 3NA9H 2FD6L 2HVKB 3RGVD 4WHTA 5J13C 4JCMA 1HSBB 1QLFB 3Q6FA 2O61B 3MRPB 2BNRD 1FZMB 5E6ZA 3VXRE 1OAQH 3HMWH 3HZVB 1JFQL 3O9WD 2NW3A 3E3QA 3HCVB 5E2VL 1U3ZA 4PP2A 1RJLB 3KLDA 2BY3A 2HH0H 5E6ID 8FABB 3VRJB 5J6HA 4P2RD 3GJEB 1NGQL 3H42H 5TDOA 2ED8A 3GK8H 4O9HH 5E00B 5EFIA 2VWEE 5SX4I 5IVXB 4RGNE 1LO3L 1B0GA 3WHXA 4LSVH 5D6CB 3QDGD 3S9DB 4JHAL 1INEL 3Q0HA 3TCLA 2VDRL 5D1XC 4I0PD 2GK2A 3ILQD 1LEGB 3RA7H 2HT3D 2AV1A 1NBZB 4FQIL 4ONFL 2BP3A 5GRYA 1JF5A 4DGYH 1KIPA 5M95B 5I74C 1G0XA 3QDHA 2GHWB 1VADB 1ZT7B 4I48B 5EPMB 4JO1H 1IGFH 3VW3H 4JFEB 4Z0BH 1ZGLM 1EFQA 4OZ4B 3MLYH 5EU6E 1P7KA 2DDQL 1BZQK 5EPMA 5CD3B 4EI5A 3VXME 5E9DB 1XMWA 4PJDF 2D7TH 3FMGH 3FQNB 4HPOL 1KG0A 1G9NL 4XXDA 3CFJB 4JY5L 3E3QE 4YHYB 1QRNE 2IPUG 4H88L 4WFGD 1YEEH 2BNQD 3MA7B 3TA3A 3L3IB 1ORQA 4ODHL 4C56D 1CLOH 1D9KC 4HKJA 1MRFL 4D9QD 2HKFL 4YDKH 1BOGA 1N64H 1NCTA 2R9HD 3IDNA 4OLVH 5C2UB 4K8RL 4WCYL 3LN9A 4QXUH 3ALXA 4XTRD 5D2LB 2AK4D 1MFBH 5DD1L 4JN1H 3QUXA 5CIPH 3ZZ1A 5I1LA 2YD8A 3QWOB 2QSQA 1MUJB 2GT9B 3GEWB 3KR3H 5F9OL 2OI9B 5A3ID 4ELKA 3MA9L 3T0EE 3LKSA 4XP5H 1MFEH 4L4TE 1UVQA 1A9BB 2WM0A 2AXGA 4L9LC 5F44A 1BJ1J 5HHMB 1IM9A 5DUBA 4TPRL 2DKUA 4MJID 1A14H 4UNUA 5I75B 5EOQL 4DKAA 1DTUA 5D1ZA 4AL8L 5I19L 3LKRA 1HHHA 3MRDB 5DLML 5EBMB 2DN7A 4Q6YA 4XP1L 4ELME 2ZNWA 4HXBH 1JZ7A 2AJXL 1FVDA 4X6CF 1MLBB 1TZGL 3VXPB 3VXQB 5JXEA 1EPFA 1EGJA 1MQKL 5IKCA 3LDBB 4FP8H 4LIQH 1ZT7A 1ERNA 3MMEA 4U1HA 5F1IA 3DX9A 3M1BB 1BFVL 1CXHA 1UB5A 2XRAH 3MGOA 5MEND 2BFVL 5I1EH 5JDSA 2IFFH 4P4RA 1H3XA 3N0PB 4J8RB 1T83A 5HBBA 6CGTA 2HFEB 4QTHA 1UZ8A 5J4MA 1KTDA 2HFTA 4ACPA 5L2JA 1I8IA 5A3IC 1YECH 4M00A 5DJXB 1KB5L 1W0WA 3BX7C 2LQRA 3H8NA 1P7HL 4GMSL 4MAYD 3P73B 2Q7YA 4ZPTB 1S7QA 1FBIH 5DSCA 2NCMA 3KYMA 4D2NA 4LQ1A 1JYWA 4LRIC 3F7QA 2H2SC 1HCVA 3C9NA 5JXED 3INUL 5F88A 1IAOA 4GG8A 2NW3B 2Y07H 2CPCA 2PYFB 5IUSA 4R4ND 3VG9B 1MCRA 2IPTH 5E7FA 3DVNB 4MNQA 2ENYA 5DK0A 2WNGA 4U6VL 3MRJA 4NT6A 4EEEA 4PJEF 4R4NC 3IFNH 3GFUA 3P0VH 3RBGA 1C12B 2H2SD 4OZHE 5J57B 5GZOC 3V5HB 1VFAB 4K7PL 1DBBH 2FNBA 2P8PB 4M62H 3TC9A 2O5YH 4OLUH 3UDWC 2VDLL 2JB5L 5D2NE 1E6OL 4DUWA 5F7DA 1KLGA 3RIAK 1VGKA 4F7CA 1J1OL 2P8PA 3AB0B 4AZ8A 5IESH 3MUGA 1GXEA 1OGAA 3VXUB 2VZUA 2DBLH 2DI9A 1TMCB 4JG0H 2OBGA 3GMRB 2NY4C 1BVLA 3U6RB 2E7LE 4WRLA 2ZPKL 3M8OL 4TNWK 3NCYP 3GMMA 2DTMH 2DQFB 4Z95H 2R8SH 5FA4A 2EYSB 1RFDH 2H9GB 3FOLB 2IANB 1UADC 2C26A 1IT9H 2ERJC 3DETD 4ODWB 2ZUUA 1DLFH 3BP5A 5GXBB 2HKHL 4FZ8H 3CDFA 1UH3A 1JGLL 3KNBA 4NSKB 1RUQL 2GW5A 3HI6H 4XNYL 1AGCA 3TBTB 1P6FA 1TTFA 3W2DL 4M48L 5J12C 1HXYB 3BKYL 1ZHBB 5ENWA 3OXSB 2GJ6D 1RMFH 3OAUL 4MHHG 3SCMD 5ACZB 4S1DC 4Y2DC 4PYHA 1OAUL 2A83A 4U6TA 1QO3A 1JF1A 3NFSL 4QHKI 3OKDA 1W0VA 2WBJB 5CJXC 5E9DD 5GGUA 2HFGL 4P2OC 1PKOA 1M7DA 1TXKA 1WBZB 4O00A 4BZ2H 3OQ3B 1ACYH 3RWJA 4Y4HC 1DVFA 2XTJC 4HWEH 3QEGL 2DL9A 4FHBD 1IFHH 4YFEA 5IHLB 1JWMB 3K74B 4YDIL 3G6JA 5DMGC 2BXYA 3OMZA 3P9MA 3LS5H 3NVQA 4YPGA 4LSUL 5FO8B 4XP6H 1P7QB 5ISZA 1LD9B 4JKMA 2AQ1A 2APTA 3VFGH 3WIIL 3B2VH 5E8OA 2X44D 4Q0XL 5JOFA 5HHOB 3QAZC 3DX7A 5DVOA 5J6GA 2V9TA 4N0RA 1D5BA 1KPUB 1KIRB 3CMOH 2FX7L 5I15H 3MGTB 4HHAB 1A2YA 4JJHA 4LSSL 3RWCA 4APQA 1U3HB 3VXTB 1AGEA 3P30L 4Z6AT 1DQQA 3FQTA 1DL7H 4WO4A 1MRCH 3HKFA 1AD0B 3JTSA 1FZKB 4MLIA 3QEUA 2W65B 3MV7A 4LFHG 1HN1A 3ARBA 4MMXC 3ULSA 5CLWA 3ULUD 1QG3A 2X4QB 4MJ6B 4P23C 5C2BL 5FDWB 5FYJE 4NC1C 1PZ5A 2VQUA 4PRHA 1A7OH 2XZCL 1KF9B 3BPNB 1UH4A 3IETB 4Z78A 1UKSA 4U6HA 4L3AA 5F9JA 3BXNB 4I0PC 4GQPH 3FN0H 1SVZA 1EHNA 3OB0H 4ELKB 2JF1A 2VDLH 3OJVC 2FLBT 4N5EA 4G9DA 1A6AA 4ALAH 3PG2A 4GOSA 3E2HC 2FYYB 4E41E 5L2KB 1Q9KA 2CLRB 2E8ZA 2EH7H 5TFSL 4R2GB 4X9IA 2H2PC 1RU9L 4XMKH 1UWXH 3EFFA 3MRGA 5CUSL 4JFEE 2WINA 4DVRL 1JYNA 2RAMA 5INDB 1L6XA 5B38G 3T3ME 2I26N 3T8XB 3QJFB 4NGHH 1MPAL 3JWDL 4M6OL 3DHJA 1ACZA 4FQXC 5ESQA 3I85A 3VXRD 4OUUB 3IU4H 4EI5B 3HNSL 4MXVF 5EO0A 5KZCB 1BIIA 1OTSD 5KSAA 1WTLA 1QR1A 4PGCB 5J11C 1YEDA 2EDOA 1WZ1L 1X4ZA 4PP1D 1IGML 4NUJA 4BK4A 5T3ZD 3QFDA 4L9LA 2E27H 4XAKE 5CBAA 3WN5A 1BFSA 5F93C 3DUSA 4KKAD 1R5WB 2CDEB 5EU4B 3QXAB 4KKLC 4NO5B 1F4XH 4WWKD 1W0YT 2VDMH 4LNRB 1ULVA 4ZNEA 3ARDD 5IVXE 4HT1H 5FO7A 4L4TB 4YWGH 5C0FA 2Z31C 3ARQA 2FIKA 3DX6A 2OI9A 4M3JA 1RHHB 2HFFB 4U3XA 3T3PE 3FO2B 4U1MA 3BN3B 2GSIA 3OAUH 4M8VA 8FABA 5J6HB 2H3NB 4XH2B 2VDPL 1QYGL 3G5ZB 3IFLH 5D4QA 4OZFB 3ARVA 3T4AA 5EO1A 1QEWB 1L0QA 2W92A 1C12A 4FFZL 5HHVL 2B20A 3TZVC 3ZDYF 3QUZB 2HVKA 3D69B 2FEEL 3DYMA 4PJHA 2EKJA 5DHVH 3TPUA 4HMDA 2YPLA 1INQA 3EDKA 1NDGB 4XNZB 2Q6WA 5D7LD 4RGNC 2X1QA 2B39A 3VWKD 2F58H 2X4RA 3F7PC 4FFWD 4JN1L 5JOPD 4PJAB 3OGCA 1CICA 1XF3A 4FXGB 3O6FC 1RZFH 3IT8D 5IW1B 4YHLH 1XGQA 3DGGB 4KZDL 2C3HA 3RWIB 4M61A 5GIRB 3LB6D 3DMMB 3PP3K 3FRPA 1BJ8A 5FO9A 4NFBA 5JW4M 4CVXA 4XP9H 4HCRH 1FGNL 2Z91B 3MJ8B 4Y19D 4G80A 5I16A 5JW4N 1ZVSA 4JREC 2RGSA 1MHHB 1S9WB 3HAEG 4NKMA 5SV4A 2Y06L 4S0SD 1I9IL 3ILPB 5DLMH 4J1UA 1SM3L 4FTVD 2L7UA 4EDWH 5FOBB 1X3DA 4DN3H 1LO2L 3BP4B 4R2GD 1G7HA 1DBJH 5GS0C 3QIBD 1Y6MR 2P4AB 3B83A 4LHUA 4NRYA 4GG6A 4Z5RA 1IAIL 1B0WA 4GRLA 4PRPB 5I8CA 1CDJA 1Q0XH 4DZBB 3PE9A 2X4PA 2IMNA 3MV7E 2AVGA 3QIUD 1X4YA 5FYJU 4K8RD 2QBWA 5C0IB 3QZWB 1FFPA 1W72H 2GK0A 3HMXL 1Q9KB 2CLRA 5FECB 1S9KC 3GSWB 5J13B 1FN4B 2AJ3A 3G5ZA 1ZTXH 3RTQD 1U8LB 4WHTB 1KEML 3PL6C 2A9NH 1DBMH 3EKCA 5KJRL 1KSRA 1BLNA 4LCWE 4KH2A 1SJXA 4IJ3B 1HKLL 5DQ9B 1J10A 1MFNA 2APFA 4C58B 1BAFL 1OP9A 3VFOA 1ODAA 3NN8B 3ARXA 4MCYA 3FB5A 4TTDC 5IEHB 5E8NB 1BF8A 2YHGA 1K8IA 4ODUB 3RWCB 4APQB 4X6FB 5EH1A 5AG9A 4FFVC 5DUBB 1NAMA 4NKIL 4JM2F 4KTYA 3TNMB 4L9LB 5ICZA 3M45A 3B8SA 1EDQA 5C3TA 4YBLB 4XHJD 2DYPA 4GBXA 5ERWA 4O58H 4E0RA 3MODH 2H6PA 4FQQB 4ENEC 4KROD 4M6NH 3BPOC 5I8EB 1M7XA 1U91A 2YUXA 5EU7E 1IAII 2FBJH 1I7TB 3VDAA 5AWNH 4PRHD 1YC8A 3IAPA 3DVIA 1S7TB 3KWWB 1HIML 1J12A 2NX5D 4NHUA 4NQDA 1R3JB 3BPCB 3S88L 2VJXA 3SQBA 4YHPB 4UOJA 4YO0B 3HRZA 4HKJB 4WO4D 5DHYB 5GJTH 4JFDB 1IVLA 4G59A 5T5FH 3EFFB 4EN3D 2CQVA 2DKMA 5FYLL 5GSRA 5KVDH 3REVA 5EOTB 2IALA 4MWFB 3VFPB 3OGOE 2KL6A 1FYHB 4H88H 1FAKT 3H9SE 1A5FH 1FO0H 3GI8H 3IDIA 1IAMA 4GG6F 5IJKC 4HGWB 2KQMA 5F7YC 3TBTA 4ZAKD 4P23A 2VL5B 3IRZA 3FONA 3MRKB 3O3AA 4MX7B 1DQMH 3QNYB 3AAZB 1F6AB 1ED3B 4X6BA 4WV1B 3UTTE 1GZPA 4U1SB 4ZD3H 4PLKC 3NN8A 4WO4B 1X5GA 4HG4K 2NZ9C 2KBGA 3VWJB 5D1ZB 1A7RH 3MV7B 5HYEA 4EUPH 2OP4H 2GFBB 3MQIA 3D25B 3D2UA 4UOW0 3DYPA 3EJYC 1K2DA 1MCEA 1FNGA 1NSNH 4M43H 4P5TA 2R0ZL 5B39G 5BJTB 3WFEL 3MOBH 3IDJB 4PRIB 5IOPB 3TO4A 3RNKA 2QQKL 5F7KC 4HS8L 5GGVY 5I8OL 1DE4B 4OKVB 4FZ8L 4Z7QF 4QCIB 3BJLA 5C3LD 4J7RA 4X9GA 1YEJL 2ZUVA 5DMKA 3NABL 3K2UH 4FQHB 1M4KA 1TNNA 3UTOA 1I9JH 4GW1B 5GGQH 3GKWL 1T04A 2DJSA 5E6IA 3C6LD 1AR2A 2DBJA 2BERA 3QDGA 1T6VN 1A6WH 2KPNA 3MLSH 5CJBA 3OSKA 3WNNA 1N4XL 3P9LA 1JPGB 3QRGH 4TUKL 1EO7A 3HNTH 3H6JA 5SX5H 3MROA 5CGMA 5AAMA 1S5HB 1RIHH 5IHZB 1YEIH 4XPAH 1T2XA 2EE3A 3ZDYE 25C8H 3L95A 1H3WM 2ERJB 4K9EH 3P0GB 3MXWL 4DFHA 1SBBA 3QG6A 1IGTB 3TVMB 5EU5A 1HINL 1UC6A 4K3JL 5CIPA 1JZ5A 3HZVA 3O4LA 3R06B 2OJZL 5KTEH 1CBVL 3STZB 3W9DB 2OMBA 3FFCA 1CFNB 2F54B 4XVSL 3MLZL 1EHLH 3IJSB 3JTTB 3UAJD 5C0CD 2R69L 3EDFA 3VFGL 3WIIH 3MRCB 4LLUB 3IVKB 1JV5B 4MJ5A 2R1WA 3Q6GH 4I0KA 1FAIL 1LHZA 4YXHL 5JXAH 2VABB 1A7BA 5GS0H 4E5XB 3QEHA 3TO4C 5KOMC 1SEBB 2EIDA 4X7DC 3W0WE 3RNQA 4PJGA 2V5MA 3CVIH 1NMBL 3HI1A 3LKNA 1KELL 3PXJA 5FHAH 3QSKB 4BSWA 4FS0A 2R4RH 1MCWW 2AERT 3DV4A 1MCWM 4NQXB 2DQUH 4NN5B 1IM3A 1CU4H 5JO5A 3MNWA 1R3IH 3MCLL 4BH8A 1Q94A 4UMGA 1AD9B 1FPTL 3ETBF 3I2CL 5D1QA 3V7MA 2H1PH 1XFPA 1VERA 1XF4B 2W9EH 4FQHA 4QRPB 1XF5B 3QDJB 4GW1A 3OR7A 4PJXB 2DQHH 3ZTNH 4J6RH 4ODVH 1UQSA 2HMID 5A1AA 3GMPA 3T4YA 1U3HC 5TPWL 1L7TL 2R56H 4LIQL 4GG8B 4JFZL 3WNKA 2XQYK 2H32A 4HGWA 2VDNL 2Q87A 3WUWA 3QHFL 3PHQB 4TSAH 1YPZB 2GSGB 1ORSB 3KYOB 3DHMA 1S7VB 5EUKB 5FHBL 3EO0B 3QQ9D 5T5NF 2D9QB 4N1CA 4XVJL 3OXRB 5E8DH 1CL7H 4MJIA 4ZUWA 3LHPL 4M7ZB 4D3CH 4PJHF 2AXFA 1NCWL 4JFED 1I1FA 1AJ7H 5FYLE 2X9YA 1OD7A 2X41A 5DFVC 1VEMA 1J0KA 3QZWG 4OAWA 4AENB 4OM0L 2D03L 1MHEB 1YEDB 3GJFK 1NUNB 1QKZH 4YHZH 1KLUA 1EIBA 1NMCC 5DJCA 1QHPA 1MHEA 1U91B 1QD0A 1S7RA 3HC3H 3ZYIA 3V6BR 5DD0L 3QXAA 4NO5A 4IMKC 4TULH 2ORBH 1J0YA 2KQNA 3AMKA 3FO1B 4RISL 5AD0A 2P5WA 4NNPH 2F19L 1CVSC 1FDLH 5FKPA 4MD0B 1EGJL 5E6IB 4FABH 4ZFOA 5FV1L 1CBVH 3AS3A 4KPHL 1CF8L 2YN3A 4TOYL 5IFHH 4NRXA 1IAIM 4KHXH 5FUZH 4EI5D 4K2UL 1YYLL 2X7LA 4RMTA 1SJEB 2APBA 5FHAL 1CICD 3GJFA 5IROC 3CFBB 4TUKH 4JR9H 1MPAH 1K5NB 4ZXBC 3QIWC 1P69B 3ZKMC 3BO8A 4JM2D 4ODHH 1CLOL 3B6SB 4Z7WF 4AT6B 1CDHA 2UZIL 1LE5B 2NY7L 1ONQB 3VA6A 5HHXL 2G9HA 5BXFB 4OLYL 5D7LB 5L2KA 3V6OA 1KIRA 4HWNA 1CG9B 3O0RL 2X70B 2Z4QB 2CSPA 1VDGA 2HA1A 4G7VH 3WHXB 1HQ4A 5JPMA 2GK0B 2AKRA 4XC1L 3CSYA 3HNVH 3VD9A 1NC2A 2FR4A 4LSTH 1U93A 5IG7B 3VW3L 3WFHA 5F97E 1D5ZA 5FO8A 4X98B 1GHFH 4CMMB 2ZOLB 5C9JA 5FA3B 4QTIL 4E5XA 1YMMD 5E9DE 1FAIH 4LARH 4GXVL 1VFAA 5HVWA 1IJ9A 4LBEA 1LO5B 1VFUA 2CKBL 3U0WH 2FSEB 1TJIL 4MXWL 1IQWH 3DRQB 5IMOB 5I2IA 1P7QA 1CTNA 1YDPA 3O81A 1YNTB 4QLRA 5LCVL 1AQDA 3W11D 3FQWA 1G7MA 2PW2A 8CGTA 1OLLA 4U1GC 3RU8H 1IBGH 3STLB 1MRDL 1KN2L 3TF7C 1MCKA 5AG8A 4UTAH 2X42A 4UBDD 4XPAL 3ULVC 3LS5L 4L4VE 4OGXH 4NKMB 4R90L 2PKDA 4RGNB 4GAYB 3E3QC 2EC9T 4DVBA 1HHIB 3WFBH 2WMPA 1ACYL 3NA9L 1E6OH 2DS4A 5GRJL 3PWUA 3TJHC 5KSVB 4JE4B 5MEQB 2FX9H 1G9NC 1KT2A 4MVBD 7FABH 3S37X 5CFHA 1DQJA 1HKLH 2B1HL 1B0GB 3BIKA 5EO1B 3PWUB 5EU3A 1KCRH 4IRSD 5C0IA 3VDBA 3R8QA 3AVEA 4NRZB 2X4SB 4IOFD 4X7SL 5E8NA 3U4EB 3FCTA 2YD5A 4P9MH 4NJ9L 1NKRA 1U0QA 4LDEB 4A6YL 4GQ9L 5GSVA 2DM3A 3N9GH 5HHNB 3RWGA 2E6JA 3O6LL 3QNZA 1W8OA 4I8DA 3W2DH 4YLQT 3OKMA 4D0DA 3QWRD 2QR0A 2EC9U 5BW7C 4RWYH 4R96A 2JIXB 5B3NA 3F7YA 4F9LC 4X5LA 3QO1A 4L1HA 4PS4H 2FECL 3C2SA 4OI7A 1DEEB 1A7NL 1P7QD 3F62A 2PUQT 2DIJA 1V3LA 4J6RL 4OLYH 4PJ7B 5FUCE 3V0VA 4HXAL 5ECJE 2UYLA 4JDVA 1JHTB 4X6CA 1UXSB 4PBVC 4M7JL 3EGSB 35C8L 1IFHL 4JHZA 4KK6C 3R0MA 2VXQH 4W4OC 1Z9MA 1MHCA 1P53A 3VFPA 1N6UA 1T3FA 5HY9A 5JPNA 2YUVA 1Z0MA 2LABA 3D0LA 3V5KB 3DTXB 3MNVA 5E1AB 3WCYA 1KJ2B 3KXFD 4KUCD 1LP9F 2YPKA 4LU5H 4XMPL 2SEBB 2BOBA 4F7MA 1AGFA 4NOBA 1KJ2L 5DK0B 3VI3E 4F2MB 1CFVL 1INDH 4BQBA 3SCMA 3C60C 4ISVA 1OAYH 3UTZB 3CIQA 3I6GB 1FFNA 3UC0H 4PGJA 1AIFB 2QADC 2WP3O 3MO1A 4YHOH 4IDJH 3IXAB 1RV6X 1IGYB 3BP7B 4NN6B 3BDYH 4MB3A 3TV3L 1QRND 3D48R 3MJ7B 1EMTL 1I9EA 1BF2A 2Z93A 2C4XA 1N0XH 1AQDB 5LWYH 1NMAH 4X5XB 3U7WH 3L5IA 2OJEA 3U0WL 3P4LA 3VRLF 5KSUB 4G8EA 1NUFA 5DR5L 1YPZF 4I3SH 3ARUA 5DQJB 2P45B 2NY2C 1MRFH 1QOKA 4ONGH 1TQBC 5HHOD 2VUYA 5C0CE 1XGPB 2VC2H 2FGWL 1JNJA 5AEAA 3WXWL 1EJOL 1QACA 3VWJC 4FQQA 4PGBB 3ARGA 3X11B 2YD1A 3SKNA 4UQ2A 3GMLA 2XZQL 1DP0A 2A6DB 2EEBA 3QQ3A 5DC9B 1R3HB 3FZUD 4HZAA 1FFPB 4HKZB 5D93C 5FYKU 3MNWB 4AG4L 3OKNA 4JFPA 4M7LT 4MA8L 1J86A 1X4XA 2JELL 4HUWB 4U7SA 1D3CA 5K33A 4JZOB 2VB5A 4MQSB 1ZA6B 3MRNB 4DOHB 3VE0A 2X4PB 3BRFA 1J05B 4LVHC 2X09A 3MACH 3QHTC 2OP4L 1W8NA 3TA3B 4OI9A 4HIJA 3DXAD 4J3OC 4ISVB 1JPTH 3MYZA 1T1XB 1A7PL 1B4RA 2CUHA 5T3XL 3D18A 4ODVL 1IC4H 4HKXA 1PLGL 2DQJL 2Z8RA 1KB5H 4PJFB 2FL5B 4JDZB 2DLIA 35C8H 2X1PA 1R3LA 5SWSE 4WHDA 4A6YH 5K59F 1A3RH 3UP1A 4I48A 2BFVH 4EIGB 1E27B 1F4HA 1N5AB 2ENSA 1GGBL 3SEPA 5HGBB 3QO1B 5E5RB 4PRHE 5FA4B 1IM3B 1AE6L 1BQHB 1T7YA 4ESKA 5IBLC 4IHOB 3W0WD 2CXKA 3EOAA 3QCUL 1J8KA 3K46A 1DZBA 3MLRL 4MXQC 2Y25A 4JN2A 3IAQA 3R8BB 4OM0H 5D5ME 5FYLD 1RULL 5GRXG 2Z8SA 5I8EA 2DQTH 4POZD 2J8UB 5MENE 1BQSA 3Q6FB 1QLFA 3RA7L 1HXYA 1BVKA 2FX8L 4W70A 1HHGA 3DXAA 4ONHA 4MHHI 4OQ1A 5CHNA 4XPBL 3RQ3A 4WU5A 2AGJH 4PP2B 3RY6A 5EU7C 2DIBA 3DSFH 1NSNL 1S8DA 3QDAA 1FL6B 3ULVD 4KXZH 2VDNH 2ICWA 3PWPB 4Y4HA 1IGCH 3V0WL 4AJ0A 1ZHNB 1JFQH 1FFOA 2VDOL 1KCUL 5IVZA 1YMMB 4GS7B 4X4XB 1KJMA 3LZFL 3O41A 1XIWD 3RL1B 5C2BH 5GSVB 4IRZH 3QUML 1HZHL 5EUOA 3C2AL 3MRBA 1HOCA 5T1LD 1U8PB 4IMLA 4JY4B 1TZHA 3H3PH 3SO3B 1PBYA 3V5HA 4Y19A 2H8PB 3STZA 3F7YB 4QTIH 4U1SA 4NN7B 1EEZA 1R3IL 4Q74A 3V5DB 1NLDH 1CXEA 4ZODA 4YPJA 3DO3A 4LPYA 1JHLH 4G3YH 3T1WA 5FDYA 1WVZA 2VR4A 3LV3B 4NWTH 4P5TC 4JM4H 1DBKH 2YBRB 4KKBC 5HI4D 1OWWA 5LCVH 4G7VL 2CH8A 1HKFA 1XH3B 2BNQE 2HFGH 2ZG2A 3O3EB 2UWEB 5IVOA 1IZKA 3VFWB 1G7LA 3PQYB 5TE4H 1LEIA 1LK2A 1WIPA 3BGAA 4KK5D 3GKZA 2NY3D 4QOKA 4X8XA 4JM2C 4NZUL 3UJTL 4CU8A 1Q9WB 5CILH 2ZWLT 1KACB 3U46A 4M6AA 3KPMB 2MQ3A 3F7VB 4HZLB 1QR4A 4UINL 1MHPH 2H3NA 4W6XB 4XH2A 5JLZA 4YHIB 5DEGA 5HHMA 3UTSB 5LKNA 2DQGH 2XQYG 5DK2A 3HN3A 1JTOA 4LEXH 5IHZA 4L4TD 3TFKD 4WUUD 1FCGA 1RMFL 1AE6H 1JN6A 1T1XA 5BRZD 1MCQA 5IJKA 4NQDE 4PV8B 1N59A 1BZ9B 2N56A 3MJ9A 1MJUH 5GGVL 1P6AB 4JPIA 5IESL 4PUBL 3BPLB 3E6FB 1FVDB 4KRPD 4I4WB 4X6EA 4XNXL 2WQ8A 2E7MA 3FKUS 4LGRB 5IMMB 4ZAKA 2VISB 2CGRH 2DMBA 1E27A 5I9QB 2WLYA 4QXGH 3B9KA 1NFDB 4UBDC 4D9QE 1QR1B 3VFOB 1EVUA 1QFPA 4WVRA 1CG9A 3VU2A 5T1LB 1U8IA 1X6NA 5I1IH 1PG7L 1RVFL 3QXDB 2E7LC 2AK4E 1ES0B 3G08A 3KLAB 4ZUTB 3C8DA 4I9WE 1FE8H 5D1XB 3O2DH 2OTUB 4ZSOA 4K94L 4GBXB 2NX5A 3EO1B 5ALCH 3RUGF 2H1PL 1KJ3H 4PJIF 5DEFA 4K7PH 3P9MB 5A40E 3BH9A 1FFQA 4Y5VC 5CMAA 5I1EL 3C5ZA 3BPNC 1Y18A 5AD0B 5MHSD 4EXKA 2X89D 3RI5F 3LH2L 4UT6H 2BC4B 1OCWH 3TJEH 2HMIC 3KWWA 3KPQB 4PJ5A 5FUOH 2VDML 1AC0A 4Y4FD 3G6AB 4Y5VB 2A6JB 4JQVA 3FT2B 3SGJC 1JK8A 3HG1E 4B50A 3T08A 5EOTA 1AFVH 2C3GA 1Q8MA 4NM4H 1JK8B 1QPXA 1G7PA 3ZDZF 4OJFL 2HKHH 1UB6B 4JB9H 4N8VG 4FQLL 4QY8B 3QIWD 4XPGH 2CKBA 3G6JB 2V9RA 4DQOL 4NYLB 2H8PA 4UILL 3VI3F 1I75A 2AEPL 5E2WH 2UZYB 5IMKA 4EI5C 1CFQB 2Q20A 3C8KA 1R24A 1ZLUK 3MNVB 1OAZH 5CIPB 2FEDC 5C86A 1T6WA 4U3CA 1C1EL 4X6FA 5C0JB 1BEYH 5HYSB 3F8UB 4KV5E 3H9SA 5F6HI 5GPRA 2HRPH 4H0IA 5IVXA 1SMOA 2DQTL 1R5IA 3UAJC 3LPGA 3ARGB 5ISZD 1CXIA 4XVSH 1EHLL 4MS8A 2WP3T 5CEZL 5ICZB 1AR1C 2ATKB 1OAXL 2IH1B 1BBJB 4IDJL 5DDHB 4KJWD 1ZHKA 4V1DB 4WIQA 3OJ2C 2Y72A 1DVFD 4JFOA 2JCCE 4QRUB 4YXHH 5JXAL 3MRRB 1MJ8H 4OFKA 1YN6B 3U46B 5GRWA 3D39B 3FQUA 4MD0A 3EYQC 3X13A 5JPNB 1W0VB 2L7JA 2WBJA 4ZYKB 2NY0B 4MQXC 5ANMA 3AU1B 2JE8A 1Q94B 3OJDA 1KEGL 4GRWE 3TBWB 4IDLA 3VFRA 1FBIL 3HC0B 2YPLB 3DUUA 1LE9B 2WK2A 5TE6H 2D3VA 3KLHD 2D4FA 4FQCL 4NNXA 2HJKA 1U8QA 1NGZB 4N9GB 5DGRA 3OAZH 3PJSA 1A0QL 1FZMA 2CUMA 4YDKL 4FXLA 5B4MD 2B1AL 4HKBA 4XCNB 5MERB 1EEZB 2CKBB 3VXSB 3DGGA 5HYFA 5FYKH 4ZQKB 1NLBL 4PJIB 4YDVA 4G8IA 1U95A 4ZO9A 3CSBA 1JCKA 3ULVE 4OUUA 4JHAH 4P5KA 1MFDH 4HG4J 3O45A 2GJ6E 1AGBA 1Q0YH 3TBYB 4Z7VE 3MBXL 3UO1L 1J05A 2I9TB 4KMLB 1BQLH 5A2FA 4XC1H 5D71H 5LVEA 4KI5E 3SJVD 1NFDF 3BYYA 4MJIE 5HYJA 4ETQB 3KDMB 5HYIA 3DRQA 4APQC 4PRID 3FAXA 5EDXA 5EOCH 4OKVA 4XZUB 3U0TB 2X4NB 2NY6C 1GOFA 2PTUA 2VKXA 2Q8AH 2E5EA 4XCCL 2HFFA 1NFIB 4CMHC 5DRWB 3MCKB 2GSIB 3U79A 4F9LA 1WCQA 5BV7H 5IEKA 3O9WA 1WBXA 2ICWI 1YY9C 3G5YB 2VXTL 3TJHA 5IROA 1MVUA 3NOIA 2KDGA 4PUBH 4S1SH 4DTGL 5FGSA 3VE0B 9CGTA 5ALBH 2DF3A 4N0UB 5EBLA 4G43B 1RIUH 4PJAE 4IJ3C 1IQWL 4PJXF 1NBYA 4EOWH 1Y0LA 2LTQB 3GSVA 3G9AB 5E2TH 4QRRD 4X5WA 1R3HA 4JRXA 1L0XA 2ORBL 4BFIA 2G5BA 4HS6A 4XHJC 3IJSA 5KSAB 3B6SA 5D9SB 1KXQE 3QDMA 3FFCB 4HWEL 1GL4B 4Z7WE 5KN5A 2BVEA 3C6LC 2EIZA 5IBTL 2CK0H 4F37K 1G9EA 4BFEA 5JHDD 4NQVA 5ALCL 2P5EB 3WJJC 5B38A 1I7UA 1DN0B 4ZDHA 5KSAC 4X0KB 1ZLVK 1AY1L 4CGTA 1PFCA 3C08L 5E1HB 1OD9A 1I7RA 2XG5A 3C5JA 1Z9LA 3RBSA 3SOBL 1UM6L 4JPWL 4XPFH 3C2AH 3TNMA 5C09B 2OLDA 2NY1B 4UDTB 1S7TA 3RAJH 1MRDH 3DV6B 1UYWL 2C3XA 2BRRH 1A0QH 1KGCE 3DV6A 2I5YH 2BVOA 4LF3B 1V5JA 1MRCL 4KDWA 1YZZA 4D9LH 4KGJA 1U8JA 4L8CB 1BX2B 1NGYB 1CL7I 4RCAA 2HT4D 2AABL 1QFWI 4GW5A 4PBWD 5HD8D 3ZKSD 5C0EA 5D6DC 5IWLC 2GAZB 1GGTA 1UM4L 2QSCH 1OB1B 2WINB 3BJ91 5AWNL 3ARFB 4U33A 4BZYA 3ULVL 2CKNA 3ZKQD 5L88L 3TNNB 1I8LA 4ZAKC 5L9DL 3TGXA 3PGDB 3PP4H 4N5EC 2BNQA 2HWZH 2A0LD 3CUPA 3FT3A 1J18A 3LN4B 3TA3D 1F00I 3C6LA 3M17A 1IKNA 43C9A 3QNXB 4RDQF 1AI1L 1N0LA 3VD7A 5T3XE 5DJAB 1T0PB 3U9PH 2GYSA 2LV4A 4H5SA 5JORB 4WO4C 2XWTA 4HSQA 3ABZA 2XQBL 4KRLB 5HHOE 1NCCH 2X5PA 3PWVB 4Y19E 4Q9BA 3S98A 1OTTD 1JPST 4XPHL 1G7JB 1IEHA 1AGBB 1A6UL 4NRZA 4PLNC 3I75A 3U7WL 2BCKB 3NGBC 3WKNA 5I30L 1FL3B 3WUWG 3O3BA 2E7LA 3GUTA 4WW1B 3ILPA 5E2JA 1JWMA 1KB9K 2AEQH 3HE7C 5HYJB 3NZHL 3I9GL 3SKOB 2GTWA 3QHFH 4P5MA 4HUVA 5H35A 3MUZ1 1IC4L 3MV9B 4N0UE 1KYOJ 5C0NC 4PGDB 4YEFA 4M1DL 1DUYA 3MXWH 5CWSB 3FRPG 3VFTA 3SDYH 5F1OB 3A6CL 2FB4H 4HMCA 1KEGH 3WNOA 1X9QA 5FKAA 2PR4H 4GS7C 1K6QL 3LSOB 2J12B 1J1PH 3S5LA 3VFRB 3QRGL 3BKCL 5FKAB 4ODWA 43CAA 5T3ZL 3RVTC 1BD2A 4I0CC 4KRPC 4WWKB 4OD3L 1MLCB 2P8LB 1UKQA 3MLUH 4K3EL 4NHUE 5LGJB 1CXKA 1WIUA 2H26B 2R0KL 1S7WA 1IKNC 1ZVYA 3T0EB 3TEUA 4HWZB 1WC7B 3K2UL 5DD0H 3PDDA 2J4WH 4LLMA 1CLZH 4AMKL 2F54A 4RMQA 5ILTH 2XFXA 1MHCB 4WWKC 3UBXA 2A83B 2NY0D 3NFPA 4KKLD 3ROLA 1PD6A 5HYQB 3PV7A 4PRPD 3SE4C 5SWZB 3FB5B 1UEMA 5EU5B 4LRIA 3RDTB 4OFYA 3RTQC 3D39D 4KTEH 1CR9H 2ADJA 3LD8C 2IF7A 5IG7A 5E08L 1JGLH 2F9BT 4HJGB 3BN9C 5EA0H 3E6HA 4NQCA 3QUMA 4AEFA 1LILA 5BS0B 4JFQB 2EH7L 3UJJH 4WNQA 4MJ5B 5KTEL 2GFBA 4ODTL 2Z31A 5KS9F 3D69A 5F9WB 3RVUD 5IHUH 3U0TA 1ZEAL 1R6VA 1CE1H 4P5TB 5MI0B 3LY6A 2EYTA 1NGPL 2QR0B 4PRNB 3TYGL 3RVVC 1RZKC 4WTXA 2IQAB 2NX5E 1QSFA 4KQ4H 2H2PD 4LAQL 1GGUA 1JWUB 2ZUYA 1C5DA 3WSQL 4P99A 32C2B 5IF0A 3BDBA 4AQOA 1CGTA 2LFGA 1KELH 1DEDA 2J8UA 1NC4D 1FQ9C 4NUJB 2R2BB 5IR1B 4Y16A 3NZHH 5LGHL 1XIWC 4PGZA 4X4ZA 2FCBA 1QBBA 4EVNB 1JZ6A 1MHHA 1U3JA 1IMHC 2NW2A 3RVWC 1F2XK 4PB9L 4TN9A 3RWDA 2FATH 3WFEH 4AH2A 1BVKB 4XHQA 4WUKH 4XPBH 1JRHI 3IB4A 3OAYH 3OF6D 4Y16D 1YEHH 4HPOH 4ZMAT 4HPYL 5I66B 4JFZH 4CADB 1F4WL 3RX5A 4HIXL 1ADQL 2OR9H 5ABDE 2Q76A 3QQNA 2OK0H 4YUEH 1QBAA 3CXDL 4O4YL 4IIQA 4J3SA 3D25A 4ZUWB 4RWYL 5F3BB 1LEGA 5JUEL 3JWOL 1NGXB 3QR2A 1F11B 3GHEH 4JZJB 4OCRH 4CUCA 2NYYC 4LLWB 3QUYB 4M9OA 1T66C 3HR5B 4O2EA 3HTLX 4PJFA 3CVHL 3WUWB 3ZDZE 5TE4L 1C5BH 4G8GA 4V1DA 5DVNA 3CZFA 2YPLE 5AUMB 4AK1A 3V4VH 3BQUD 4RNRB 3RL2A 1NBVL 4KAQL 4PP1C 3QYCA 3TV3H 4PJ7A 4TSCH 3V0VB 3WFCL 2F8OA 1DQLL 5GJTL 4FMFA 4KVNH 4M43L 3FAWA 1MIEH 5I19H 3D3VD 1OTSC 1I8MB 2PTTA 1T5XA 4YHYC 4OTXL 4S1DD 4HUUA 2QQNH 5CUSH 4OZGE 1MJ7L 1ONQA 1YJDH 3GSNL 1CFVH 1FFRA 4D0BB 2KZ1B 1X44A 1KXTB 4KDTC 4WV1A 1ZHLA 1MUJA 4Q6IB 4UB0L 2VH5H 2XZQH 5D7IF 1I4FA 2EIZB 3RZCD 1PY9A 3FOMA 1DFBL 4NQED 1BQHG 4PV8A 4U3HA 4W6WB 1A1MA 2E7HA 4KFZC 3RHWK 4XCEB 5DRXA 1A5FL 1FO0L 3GI8L 5F3HA 1J5OL 1I1FB 3EW3B 5DO2D 5EIIA 1QBLL 3N1QC 4UT9L 5ALBL 1XGRA 2ICCA 1EXUB 3S34L 1RPQA 4MSWA 4P2RA 4PJ7E 5BW7A 5SWZD 2EE9A 3DX7B 2ARJQ 2NLJB 3RIFK 1CLCA 1UWEL 1SHMA 5IW1A 3L3HB 1EHXA 5GGTL 4ZO6A 5F1KC 4UQ3B 3IKKA 1KB9J 1X5HA 5C0GA 2OTUA 4ZSOB 3O45B 4OCNC 2R23B 3LRHA 1RUPH 4IOIA 4YAQA 2EDEA 2P5WE 5DT1L 4JLRB 5IP4A 3MLXL 4MZ2A 5FDWA 1XH3A 4LLAA 4EZMA 2BY0A 3MFFB 4X99A 2V6HA 3Q3GB 4NKIH 4ZFZA 1IGJA 1OQXA 1EZVX 4LU5L 4L8BA 2GTZA 4OBSA 5CEZH 3MODL 4AEHL 3W5NA 4QWWD 5I8CB 3FO2A 4U1MB 1JZ4A 1RZIA 1FV1A 4LNVA 5JA8B 3OKEA 3ZTNL 2ADJB 4U0RC 5T33L 1G9MC 2WUBH 1JE6A 4HQQL 4QXTA 3TZVA 3GMPB 5INCA 1DQJB 1B4JL 1KCKA 2Z4QA 3KJ6H 3UTSA 4ODTH 5T1KB 1HHJA 2E6QA 2NR6C 3MREA 3HI6L 5I6XB 1C1EH 5DRZB 3SKOA 1ADQH 4HLJA 4XC3H 3S36H 1ZEAH 5C0AD 4C57C 4U4BA 4EJ1C 3TH2T 4XB8A 4DVBB 3S96A 3GBML 3RX7A 3U7YL 1HWHB 4U31A 3KPTA 5BZDA 3L3DA 1T0NB 2Q8AL 1HXMA 3ZYJA 4PREA 1MCFA 5D7JA 1UM6H 3MRHA 4CRPA 3QPQD 3AB0C 2AJZA 1EUTA 4JAMB 2QHRH 2ESVA 4N1HB 1BJ1H 3HAEH 1KCVL 3K8MA 4OGYH 4YBLC 3SDYL 1S9XB 4R0LB 1OPGL 3LH2H 3EOAB 4UT6L 3S37H 3GHBL 1C16A 5F9AC 1XF2A 3GSXB 4ZOEA 1RZ7L 4R26H 4FQJL 2R1WB 5GS2D 2OZ4L 3B9VA 3BP5B 2JIXD 3DXAB 4AYFA 2FWOA 4JFFB 4OZGF 3VFVB 1CT8B 2E6PA 5D7KE 5E8EA 1MAMH 1KN4L 5DYOB 1V7NH 4JY6B 5GS2H 1BREA 2R0KH 5D72L 3QPXH 4G5ZL 1EBPA 2HJLB 4ZTOL 4NC0B 5FGCB 1UVQB 4L8SC 3SGKC 5EIQA 4NZRH 3HZYA 4H8WL 1KFAL 3RWEA 1U8JB 3TJHD 2QKIA 2RBLA 5L0QC 1CGYA 1NJ9B 5CJ5A 1G9NH 3C60B 5DT1H 5J1AA 4E42B 5DJDA 2XA8H 4L3CA 1TJHL 3T3MF 4PG2C 2AAVA 1MWAB 2XN9D 1KENH 5IIEA 4OT1L 2BSTB 1K8DA 1NBYB 15C8H 2BOCA 5JXEC 3QUYA 5D7SL 3F7RA 3IRPX 4K71C 2NXZC 1TLKA 2C7UB 3VH8G 2Y1VA 5HGAB 5D7LA 4HUXB 3ZHDA 2DB8A 1CFTA 1P4IH 4TTGA 3PGFL 1JWUA 3BEVB 4PR5A 3MYJB 3SGDH 4L4VB 4CW1A 3H7LA 4WI4A 4HLZH 5E5UB 1GAFH 3JUZA 2NXZB 1P7KB 2FIRT 2VAAB 3ARED 3SDCC 1MCNA 4X5XA 1TJGL 1U8IB 3PUCA 4NO0A 4XBGB 4MB4A 2VXQL 1EJOH 1EK3A 3VFUB 5E03A 4MNGE 5B8CB 4PRPE 1K3ZA 2Z8VC 2Y6SC 4O5LL 5L7XL 3DMMD 3PHSA 3WN5B 1OSPH 4Q9QH 3V8CA 5E94A 3W39B 1SEQL 4YFDB 3SDCB 4LCUB 4R3SB 1Q1JH 5GZNC 3O9WC 4OZFH 3K7UA 5DEFB 2RJMA 3X3GL 3HUJA 3X11A 3RRQA 1KCLA 2DWEA 5DD5H 3EYSL 1NANH 5D5MA 4JFEA 5J7CC 2N7AA 3GI9L 3QUYD 3H9SD 3GSOA 5DYOA 4ODSL 2D0FA 4XPTH 1BX2A 1NGYA 1XCTA 2VLRB 1CGUA 3MCKA 4PB9H 3SJVE 4I0PB 2GITA 4PG2A 3V6FB 3DX9B 3M1BA 4LHQB 1OARL 1AO7B 3GSOB 5C0BD 4CJ1A 3NAAL 4JVUA 4NM8L 4HF5L 3WBDA 3MOAL 3ZKMD 3REVB 5D2NA 4ZXBD 1H15A 2PF6A 2BSSB 4JZJA 2IH3A 3S34H 4S2SB 5LXGH 4KUZH 5FXCH 2CXGA 3ES6B 4WWID 3V2AR 2W0FA 1LEKB 3L7FB 1AP2A 4NZUH 3ULUF 4G6AC 4M4RA 2RFXB 5AZEL 2CKBH 2ICWJ 4ORGB 3S8WA 4D0DB 2NY3B 3PABA 5BVJA 4N90E 1KCUH 5D96B 3DWTA 4ZOCA 3L1OL 4OLUL 4KK9C 1D9KD 5MENA 1MCDA 4LSSH 4HJJL 4HPYH 5GRUL 2MJWA 4GSDH 2YR3A 1S5IL 4KRPB 3SE8L 2J6EH 5F7WC 2OK0L 4X6CB 1MVFA 1T7XA 4NN7C 3ARBB 3LN5A 4CVXB 2LAGB 4G6KL 4DZ8B 1PX4A 2A77L 1Q9OA 4NBZB 2BNRE 2O61A 4GUPA 5BVPH 4XI5C 2AABH 3SDXF 5DVMA 3RNKB 1TZIA 2DJ4A 1I85A 1RUML 3C5SA 3FB8B 4OCMC 1REIA 2KUTA 2FIKB 3DX6B 3FL7A 5FO7B 5C0FB 3VRJA 1ZANH 5GS1A 2BNUA 3SKMB 1N7ML 5JO5B 4S1SL 2I9LA 2CDGA 5D1XD 4DTGH 5C0CA 3W9EA 1DQDH 3HZKB 2RR3A 4FTVB 5EU3B 3LSOA 5DO2C 5KBNC 4PY7B 1K4DB 3OTTA 1NLDL 4U2YA 4QRPA 1MFDL 4P2OB 1VA9A 3CFEA 5D8JL 3QISA 5J9PB 4XCCH 4FABL 2F8XC 3TYFA 1Z3GL 3BIBX 3DSFL 5EC1A 1FN4A 1HZHH 1QSED 1S3KL 1K6QH 1OB1A 4S1RL 2HYMA 3VXMA 2VOTA 1SJVA 2RCSH 3RDTC 3MBEA 1OWRM 1IGCL 3D85B 3V0WH 1R5VA 1SM3H 5C08A 4FQ1H 2X10A 2LU4A 3I6LE 2Q8BH 3RGVC 4F80A 1FH5L 3MJ9H 5DEZA 2JJSA 3OB0K 1RURH 5ACZA 1MFCH 2UVEA 5ACMA 3ZE1F 1MI5E 5BQ7A 4Q6IA 3SE3A 3BPLC 1Q9LB 3LS4H 4QT5A 3O8XA 2M26A 3BGFB 2YKLL 1AGDA 2AKRB 4KUZL 2IAMA 5C1MB 1BP3B 4XCEA 2BHYA 3FB7B 5DRXB 5DJ2B 3VFUA 4LPXA 1UWXK 4P4KD 1RUKL 5L8JB 3MOAH 1MAML 1G7JA 2IH1A 5DDHA 2H9GA 5B8CA 4LAJH 4YX2L 3LCYA 1YMHB 3QCTL 3ARPA 1NH6A 2ADFH 2ZOLA 5C9JB 1T5XB 1DSFH 1M6OB 3GIVA 3ZE2F 4JY4A 5BMFH 3EYOA 2GJ6A 1AKJD 1FNGB 4K3HA 5DMKB 3P4OA 3TBVA 2NYYD 3PWPE 4LSRL 2MSPA 3P77A 4M3KB 4PJGE 1F90H 1TJIH 1AJ7L 2A6JA 4OLVL 1CF8H 2BNUB 4TOYH 4R7NA 3RL2B 2PO6B 5IB1B 3T2QA 1TVBA 3OKKA 3A6CH 1SY6L 2GY5A 3T1FA 5AYUL 1JNNH 2AJSL 3VG0L 3QUMH 2ICWB 4C55A 4K55A 2EDBA 1U3HA 4JHWL 3UTTB 1WJ3A 1D9KB 2IFFL 4ZOAA 3JBG7 3T1FB 1BFTA 2BSSA 4MDIA 4M5YH 1TVHA 3QO0A 2D03H 4RMWA 4F7TB 4TUJB 5A16B 2EXYD 2HVJA 4X99B 1TCRA 1AHWB 5DJ0A 1H5BA 4JVPA 1MI5A 3CH8A 2QSTA 4OFIA 3OG6B 2FH6A 4YHKL 4H8WC 1N7MH 4LFHD 5IJVB 3ARTA 4GRMB 5C07E 1U8HB 2CIKB 3EOTH 1V8HA 3QNXA 1OW0C 3CFKA 5DI8A 1CGSL 5EZLB 5DR5H 1XGUA 1D6EA 4XAWH 2X4TA 2BVTA 1AI1H 5F3BA 1HHHB 2CRIA 4F2MA 3RWJB 4FTVE 3RKDD 3IS0X 4PTTA 1IT9L 4HIIB 1H8NA 4EDWL 5HI3D 4QRTA 1EVTC 2X4TB 3NIDE 4H20H 1HK6A 4EVNA 3TCXA 4YFLF 4HLZG 3O4OB 2VSDA 1C7SA 3N06B 4GKSA 4OFVA 4NGHL 1JNHB 3QP3A 4FQ1L 1HYRC 2XA3A 2MPAH 3SDDD 2Z35A 1PGRB 4GKSB 2GITB 5E99L 3ARZA 3KPOB 5DRWA 3AXLA 2O5XL 5DTFB 3O2WH 1ZMYA 1NFIA 2VXUH 5BRZE 5JMOC 2UY7A 4KI5C 4XBPA 2K1MA 5KSUA 1PQZB 3PP3H 2FZ3B 4WFGE 5FK9A 1WICA 2EH8H 4HIEA 3IYLW 5BOZG 3F65A 1B3JA 2C3VB 1KNOB 2B5IC 4OFDA 2FO1A 2JJUA 4GMTL 3FFCE 2DLTA 1MQ8A 1ZLSL 4KKCC 2NNAA 2OXGA 5DQ9A 3P4MA 4PRDB 2IG2H 1S7VA 4QRRB 3HCVA 2B2XH 3UJTH 3RTQA 2A6DA 3OAYK 1WFOA 3DX8A 1MJ7H 5EZIL 3QEQA 4LKCB 3SGDI 4YJZL 5D7IB 2OYPA 5I1LB 4BSVA 4O2CB 4DGVL 12E8H 3GBMH 4AMKH 4JKWA 5CD5D 1ZWIA 1XGTB 3EO0A 2CO6B 4LHUD 4YDLB 2YEZB 1UJ3A 3QCUH 3HPJB 4OF0A 2IAMB 5JQHC 2NY1D 3ARGC 4JVWA 3RFZC 3MRCA 4OGAD 4M5YL 3IVKA 3MREB 3H42L 1EAPA 1OT2A 1TJGH 4BZ2L 1A47A 4HGMA 4XAKD 5C07A 1A6TA 3CSGA 1L0YA 2VLRE 1SEBA 1GGBH 2WAHA 5MEOA 5EZJA 2AK4A 2VIRB 5HHOA 3TBVB 4UT9H 1OSZA 1T03H 2YUWA 4OFPA 1DQTA 4TTDD 2E7CA 1BPVA 1WT5A 4NQSB 4NCC1 5H94A 4Q2ZB 3BRGC 5T1MB 1G1YA 3RWIA 4OCLC 2DKSA 4ODSH 4XPTL 1A3LH 2IH3B 3L3JA 1IGIH 5I6XC 4BSJA 1U9KA 5GS0L 3I6KB 4X9FA 2NY6B 2XG4A 3C08H 2JCCF 3K1DA 3S4SA 5D5MF 3TO2A 1P4LA 1QRKA 3LRSB 3SKJH 3QUKA 1AXSB 2X4OA 1F3DJ 2K9UA 3IGAB 5HY9B 1MREH 4L4VD 4Y4KD 2YD4A 3TPUB 1E4WH 1NEUA 1U8QB 4IRJC 3IGAA 2JK5A 1T80A 4P2CG 4HIHB 2EECA 2VDRH 4PJ9C 3ZL4L 3F12B 3OXSA 4Q7DA 2X4RB 1G7IB 4LVOC 4P2QA 1MCSA 4WFED 1KPVA 5K9QI 2Y5EA 1LDPH 4QF1B 3EDJA 4NKDA 4GAFB 3JTTA 1BQLL 5FB8A 2BVPA 5GS0D 4Z18A 3I75B 3MX0A 2XKNA 4OF3A 2X70A 1IM9B 1P1ZB 2XTJB 4V1DE 2VXUL 3MUY1 1A6VL 1YJDL 4JG0L 4KJPD 3SJVB 2ZUWA 2FB4L 4NBXB 1ZK9A 4X9HA 1AC6A 1B0RB 1DL7L 5GS1B 1YEJH 1QSVA 2AEPH 1VGKB 5JA9A 4TUOA 2YPVH 1OHQA 3GSQB 3HZMB 5IB3A 3FQUB 5KSAD 3CZFB 3O6FD 2YK1L 1AD0A 5HGBA 4OZIA 1CS6A 1SYSB 3EYSH 3UC0L 1HNFA 5GSRB 5EOCL 1GCFA 3SDXA 2K3TA 3MGTA 4HHAA 1DLHA 5L2JB 1U8NB 2R1XB 3UJIL 2W9LA 3BD5A 2C3VA 4HWZA 3PGDA 3MLRH 3QQ3B 4JLRA 4OZIE 3QFJA 1OAXH 2XKUA 3T8XA 4JFDD 1FLRL 4PJCE 5FM4A 4OGAC 1AQKH 4R26L 3C9NB 5HDOA 1CGWA 3TN0B 3L5HA 4GRMA 5SX4H 2V2WB 3BAEL 5L0QB 1IAOB 1VFBA 4K3DH 1FSKB 3MLWL 4JRWA 5DFWH 4EQ3A 5IBUB 3UTPD 1NCBL 4U6YA 3QXDA 1KBGL 4OZHB 3FRUA 2VLKA 1AGDB 5EZIH 1CDYA 3TCLB 2D4DA 4NOFA 1FDLL 4MJIB 5I76B 1T5WB 5D2NB 3PNWB 3WN5C 5ISZE 4I77L 1U41A 4WEBH 4FOMA 3U36A 2VLKB 1CL7L 3OJMB 3GRWA 4L1DA 5I1CH 1DLFL 1WZKA 2ADIA 2HLFC 5CSZB 1PSKH 4A2MA 2P1YA 4X0KA 3WHE0 5FCSH 3MZGB 2J88H 2AJVH 4APQD 5CEXA 1RZ7H 4X5WB 4I2XE 2ADFL 1JYXA 1I8KA 3CCHB 1TFHA 3DJ9A 4LSQH 4H0GA 4B5EA 1V3KA 1Z5LB 2DQHL 4S11A 2ATPA 5D72H 5TH2B 1RZFL 2ITCA 3UZEA 3O3DA 3IS1X 5CSBA 3VWJA 3VFSB 4HFWB 4O02L 7CGTA 3N50A 4X4MA 1Z5LA 3L3KB 3ZKNC 1QA9B 5KVEH 2PTTB 3GGWA 4GXUM 4HWUA 3OKLB 5TF1H 5KZCD 3G6DH 1A7QL 3QUXC 4L29A 5HI3C 4NZTH 5E2UH 2AK1H 4QOKB 3SDDB 1K5NA 4HWBL 1YEKL 2X1OA 2EYRB 2WUCL 1WBYB 4HUXA 5GQBA 1I9IH 4W4NA 2OTWA 3MRFA 2QQLL 2VZSA 2QHRL 3EYVA 4L5FH 4Y4FB 2HKFH 1T7VA 4J12A 1FIGL 3MBEB 5FCUH 2EKSB 4O2FB 2BSED 3L3OB 1GZQB 3B5TA 3ZE2E 5DUPH 4P2RE 4YK4C 3SGEH 4ZXBA 1A8JH 4KC3B 5DEGB 5MP6L 2EDLA 2V7HB 4G80B 5I16B 1RUAH 5ILTL 5BQ7B 5K9JH 4PJCA 4LASL 3VGDA 5CEZD 4J3WA 1N5YH 2XKNB 1NJ9A 4FP8L 4NNYA 3SO3C 3QDGE 4IMLB 2VXVH 1RSFA 3KDMA 4KAQH 1OF2A 3GK8L 3PL6A 1CICB 1MJUL 1XF3B 1WWWX 1ZS8A 2DTML 2IBZX 1T4KA 1EO5A 3ZE1E 1EAJA 1IC5L 4KJWC 4OLXH 4WI2A 5HYJD 4XNXH 3EJZC 1KBGH 3DMMA 4GW4A 3AU1A 2XY1A 2UZXB 2YS4A 5F96H 3AREB 4PGDA 1FL5B 1LO2H 1VHPA 1NFKA 1LDSA 2YD7A 3L7EA 1OGAD 1S9WA 4LL9A 1CDCA 4LSRH 5IBTH 1C5CL 3AREA 3H3KA 4YIQA 4LOUD 1KCRL 5FGRA 2YZ8A 3IDGB 5GRUH 4E41D 5FO9B 3GJFH 1LK2B 5DMGD 3K80A 5EBLB 5C6TH 2ZUQC 4BKLA 4QXUL 2V7NB 2WLZA 1BQUA 1WFNA 3WE6B 3WO3B 4GAYA 1N2RA 1SBSH 3IFOB 3DX8B 3O6MH 4U6VH 4RFEA 3IDMA 4YGVA 5HI5D 2P47B 1D6VL 3HZKA 3ZKXB 4Y5YC 3OKOB 2XQBH 3FQRB 2WIIB 4XP5L 5HYSG 1BM3L 3ARFD 2IG2L 5JTWA 1T89A 3OKEB 3WJLA 4K07A 2W0LA 1HINH 4ZUUB 3T77A 2AEQL 2WSKA 3PWJA 4WI3A 1S7SA 3WD5H 3RDTD 4Y5YB 3ALPA 5INCB 4C83B 1JP5A 4JRYA 1TTUA 1FZJA 5E2TL 2R0LH 5GZND 5CZXC 2DMKA 2EDNA 5BVJB 4NQCB 3DETC 4UAOB 3PQYD 1U6AL 2VZOA 3DMMC 3WFDH 2C9AA 3NIDF 2EDWA 5I17B 2HP4A 2CMRH 5ESQB 2CIIA 2D7TL 4LLDB 2XRAL 3HLAB 4OLZL 4LGSB 4Q9CA 1KPRA 3BP6B 4OZGB 2VH5L 3VMNA 3NABH 4LF3A 5HYQA 4OCSH 2IBBA 1T22A 2JCCB 4LMQE 4LHUG 5D71L 1KGCD 3T2PA 1YJDC 4Y1AD 3MRLB 3P11L 4BK5A 2Q7YB 2YD2A 3BZFB 1VSCA 4G8GE 5CAYB 3EAKA 1MJJB 1ZA3B 2HRPL 3SY0B 4UIKH 2H32H 3U30C 3QEQD 3CFBA 5GZOD 3KYKL 4RGOH 2P44B 2XXMB 5D8JH 4LNRA 2YXFA 4KDTA 2Y9RT 3SKNB 4L29B 4Y89A 2D7MA 1UZ6E 4U6HB 3GSUA 5HXMA 1EFXA 5IGXH 2FLRT 4P57A 2V9QA 2HG5B 3QDJD 1J8HD 2AQ3A 2F5BH 1ZSDB 3UTQA 4Z7NF 2VLJD 1P4BH 4NC2B 2DQCL 3MRIA 3HPLA 1PQZA 4KPHH 3HMWL 4M8QA 3TP4A 5IIEB 5HGDB 4OCRL 4MXVE 3K4ZA 3O3BB 3G5YA 4IS6B 4X7FC 3MTRA 5IM7A 3QJFA 1RJLA 4LSTL 2WBWB 4W6YB 5F7FA 5IJVA 3GMOA 3BGMA 1Q1JL 5CJOH 2EIBA 3FQXB 5CKGA 4N8CL 1S9YB 4ERSH 4HAGA 2W38A 3GBNL 3B2UD 4JRXB 4YHML 2BZDA 4Z95L 1MCOH 4JFFE 3CX5J 1XR9B 4CVUA 3AUVA 4R9HA 1Y6KR 4XMLH 2ITCB 2F54D 4M1GL 5DJ2A 5FM8A 2FGZA 2W07A 4Y1AE 5EO9B 3MXVH 1IZJA 3AM8A 4P5TD 4XNYH 3QPXL 2BSRA 5IB5B 1NGXA 3Q5OA 5JHLH 1WZLA 1CD0A 2Y6SD 1A3LL 1FIEA 4PJBE 3P77B 5DURB 3V95A 1G7HB 4UV4L 3F7VA 2D7PA 1PLGH 5I8KH 4H20L 1QRNB 5D70H 2XNAB 4JGMA 1RK0A 2YC1A 4TNVK 5CSGA 3SDCD 5IWLA 4Y5VA 2EDXA 4NFDA 2YA1A 4OT1H 5E4EC 5EWIH 2A73B 2VZVA 1M05B 5IFAH 3PGCB 4S1RH 1A3RL 1U2CA 3SCMB 4JEGB 1JGVL 4LRNH 4UUJB 5IFJB 3MRQA 4TNVF 4AG4H 4YHPA 5HHMD 3WL9A 4QF1A 4YDIH 4N0FA 4QWWC 3QUMB 3IKCA 3G6JF 4NQUA 4YNYB 3VFNB 5D1QC 2NXZD 5FEBA 4NCC2 4V3DB 4LVHB 1MVUB 5MEPB 1DSFL 1N3NA 1T20B 3P4NB 1J1OH 1MJ8L 3S3PA 4YHLL 3RGVA 1A1NA 4U0RB 4YDJB 5JW5B 2OXHA 1Z0NA 3K4AA 3VD3A 3CLFH 4RZCA 1HI6A 1ZTXL 3KPRD 1FO0A 1QVOA 4G42A 3MRHB 1MEXL 1CFTB 5H2BA 3OXRA 4QRSB 4LLUA 1OPGH 3S37L 1EEYA 4HS6B 1JNNL 3X3FH 2IAMC 4F33B 3VXUD 1U92A 3LKPB 4NPYB 1M7DB 5EOCJ 4LKXB 4W68A 5IB3B 1ZAGA 5IBLD 2NTFB 2R2EB 3EO9L 5FHBH 5DD6B 3BZ4B 1I1CA 4L8DB 3VH8A 2V7NA 5KVMC 4YAQB 4MDJA 4MA1B 5IT2L 2NMSA 4FN0A 4GSDL 1NCAH 2VIRA 4GUPB 5GGRB 2O26U 3LEXB 1CD9B 1MFBL 1T7ZA 5DD1H 4BFBD