3GSXA

Crystal structure of the binary complex between hla-a2 and hcmv nlv-t8v peptide variant
Total Genus 78
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
78
sequence length
274
structure length
274
Chain Sequence
GSHSMRYFFTSVSRPGRGEPRFIAVGYVDDTQFVRFDSDAASQRMEPRAPWIEQEGPEYWDGETRKVKAHSQTHRVDLGTLRGYYNQSEAGSHTVQRMYGCDVGSDWRFLRGYHQYAYDGKDYIALKEDLRSWTAADMAAQTTKHKWEAAHVAEQLRAYLEGTCVEWLRRYLENGKETLQRTDAPKTHMTHHAVSDHEATLRCWALSFYPAEITLTWQRDGEDQTQDTELVETRPAGDGTFQKWVAVVVPSGQEQRYTCHVQHEGLPKPLTLRW
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system
molecule keywords HLA class I histocompatibility antigen, A-2 alpha chain
publication title Structural bases for the affinity-driven selection of a public TCR against a dominant human cytomegalovirus epitope.
pubmed doi rcsb
source organism Homo sapiens
total genus 78
structure length 274
sequence length 274
ec nomenclature
pdb deposition date 2009-03-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00129 MHC_I Class I Histocompatibility antigen, domains alpha 1 and 2
A PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3gsxA02
3.30.500.10 Alpha Beta 2-Layer Sandwich Murine Class I Major Histocompatibility Complex, H2-DB; Chain A, domain 1 MHC class I-like antigen recognition-like 3gsxA01
5CJXC 4LARL 4YIQA 2NR6D 5ESQA 4CMMB 1MELA 3SO3C 4N9GA 4Y4HB 1I1AA 1D5MB 2X44D 2A9NL 1IAOA 4HBCH 4S1QL 5CD5D 3RIAK 1ZA3A 4PJXF 4OKVB 1EUTA 5D7LD 4GG6F 4HFWA 4HX1A 4GT7A 4ONGH 5D7JA 3UPAA 3VXNA 1Q94B 1KYOK 4M5ZH 4FTVD 4KUZL 1BBJB 4NNYA 3SOBL 4MA8L 2FJHA 3IJSB 2Q8AL 4LMQI 2JCCA 3VWKB 1AGEB 3WNMA 1WWBX 1FAIL 2AK4D 1RY7B 5DHVA 3DX6B 4YHMH 1LILA 3KXFD 4KRLB 4XP5L 3HC0A 4UAOB 3VRLF 2E9JA 1QSEB 4RMSA 1SY6A 4XBEL 4Q9RL 1CFVL 5BZDB 5IVOA 2AXFA 1IGFH 2F53A 1X5ZA 4WFHD 4XC3H 3FCTA 4OKDA 3DETC 2HJLA 5FA4A 3VFRB 4EIGB 5B8CA 2PYEE 2G2RA 4M1CD 1EHNA 2WUCH 2EDFA 3GKZA 4NRXB 1C08A 4XP4H 4BKLB 3I02A 3KJ4B 4LQFL 1DR9A 3JSSA 4X6BA 4WEUD 1I3RB 3HE6C 4U1SA 2HN7A 1MUJB 3HAEB 3QUYC 2QHRL 5J8OA 3MRIA 4OLXH 1DSFL 4NNPL 5J7CC 4K2UH 3BYYA 3L1OL 1XR8A 1OTUC 4HAFA 4HBQA 2YC1A 5HHNA 1SJEB 3RNQB 3O9WC 3NFPB 3STBA 3MPCA 3VFNB 4LHJB 3MRFB 1XF3A 2DWDB 3CX2A 3FT2B 3ARBC 4K3JH 2WINA 3B83A 4O9HH 4WI9A 4C59B 5FYKU 1FSKB 1KCRL 4K7PL 4FQLH 4KGLA 2O93L 2R0ZL 3A0OA 5EOTA 1QD0A 3TNNA 4AEIH 3KPSB 4QF1A 4M02A 4P2CG 1NAMA 2CRZA 4PRHE 5CD3B 2VLKA 1YJDC 3QDJD 3RX7A 4D3CH 5DJAA 2AV1B 4YXHL 3OB0K 2P4AB 5JO5B 1OB1B 4N0CA 4F57L 1CQYA 5KVGL 4FQPA 1WFNA 3MRNA 3WV0A 4YK4B 4NQCD 1QFPA 3GSRB 4ESKA 1LP9F 3MLTA 1T03H 5DVOA 3REVB 1UZ8B 4K23H 1FZJB 4YDJB 4ZUSA 3PABB 3BQUB 3OV6A 2ESVE 2IJ0C 2I07B 4Y5YC 4U3HA 3INUH 4NRZA 1Q9OA 3QI9C 3HZMB 5SWSB 3TBYB 5IB2B 4KJWC 3QDHA 1CLYH 5J1AA 4GAGL 2OR8A 4GXVL 1VGEH 1IGJA 4Q6YA 1WITA 4DTGL 3CDYA 1PYWB 3B43A 3KWWB 4H20H 4NO0D 4GKSB 1AKJB 1U8QA 3LB6C 1J18A 5MI0B 3RTQA 5IW6B 4Y0GA 2Z93B 4JKKA 1LO3L 4KI5E 4F3FA 3FQXB 4MA7H 1AXTL 1J9CT 3NIFE 2GTWA 3MGAA 3Q5YA 4NFBA 3WSQL 4F7EA 4FQCL 1YECH 2W65B 4U6YB 4JQXC 4LLAA 3VFSB 4P23A 3OGCB 3FT4A 3PWPD 5FM4A 3GBNH 5TE7L 5JIKA 4PY8I 3HMXL 4ODSH 5CFHA 3OKMB 2X4UB 2J8UE 1EO8L 1A6AA 2BSTB 5D70H 3DHJA 1DBML 2P8PA 4KROC 1X6NA 3FB6B 4EBQH 4WW1A 2YD6A 1K6QL 2LE9A 5JQ6H 2EH7L 2RR3A 5GZOC 3QNYA 2V5YA 2W0FB 2VDLL 1N8ZB 2OJZH 1GHFL 2XA3A 2APTA 1BBDL 1MCNA 2BCKA 5D7SH 4TULH 3OJMB 4X7DC 5DFVD 5TDNA 4AL8L 1FL3B 5KTEL 4MS8D 2X4NB 3I2CL 5HGGS 4W6WB 3T2NL 4WI4A 4KZDH 2PR4L 1I1RA 4RMUA 3HNSH 1JGUH 1OWWA 3WE6B 2NY0C 1KJ3H 1F8TH 3RVVD 4ZAKB 3WIHL 1MJJA 1QACA 1HILA 2VDKH 3SDCB 3EO9L 4KV5E 3RVWD 4DAGH 1ETZB 3MREB 2YD4A 3L7FB 4JPIB 1NFDF 1G84A 4HKJA 2BVOA 5IBUG 5C9JA 2DJSA 4J3OC 3G6AB 2FH8A 3ARPA 1IC7H 4P4KC 3M8OH 3BGFB 1QFWL 1U3ZA 1U8PB 2W60A 1CD8A 3LS4H 2M8XA 2JJVA 5JUEH 2DQTH 4J3TA 4YLQT 2O5XH 2GJ6D 4WV1A 1OTTD 4Z6AT 1P6AB 3DRTA 2MSPA 1KTDB 3C5ZC 4QHMA 1YDPA 1QA9A 4EIZC 1KN2H 1KNOB 3LSOA 3VXPB 4CN6A 3MRJB 3OKDA 5JLZA 1H3XA 3UEZA 1GGBH 2BNQB 5AZEH 3O0RL 4G9DB 4YUEH 3ULVE 3QO0A 1FNGA 5A43C 5T1MB 1U2HA 3AC0A 4PJCA 3T65B 3LEXA 4ALAH 3MV9B 3IRZA 3UJTL 1RIVH 3IVKA 4GG6E 4MHHG 2IAMD 4N1EA 2FDBP 4RGOH 1FL5A 1LE9A 2BVQA 1CXHA 2C1OB 5J6HA 3K7UA 3LEVH 4TSCH 3ILQD 1KPRA 4YIQB 1JL8A 1I1AB 4Z7WA 1MCKA 4PRIE 5IHZA 5GJTL 1IAOB 1WBXA 3MLWH 5FYLE 3KVQA 3VRLE 1TJGH 1ZA3B 4QRRD 3L5IA 4NWTH 5HDQH 3U4AA 5FGBC 3O4LD 4J3SA 4PRAA 2X6MA 4H1LA 4RGNB 1JGEA 1AXIB 4HFWB 1QVOA 5D7JB 5LQBL 3VXNB 1RAMA 1P9MA 4NWUL 2AEPH 4NNYB 4DQOL 5E6IC 2FJHB 3CVHA 4PB9L 4XP6H 5I2IB 5BS0D 1A21A 2JCCB 1EX0A 1XT5A 1FYTD 1UM6H 3G9VA 2E7CA 5GGVY 4G8GA 3DXAD 3VXRE 4KZEH 5DHVB 4LSVH 3HC0B 3V7AE 4X6EA 2CRIA 1INEH 1I7UB 5HHME 3ARGA 2R2BA 4LEXH 2XPGA 5F7EH 1S3KH 3MOQA 1TCRA 2AXFB 2NY6D 5KW9L 2F53B 3MOBH 1D5IH 5KVEL 1P4LA 2CR3A 3FCTB 1UWGL 5FGSA 3VD9A 2EXWC 2HJLB 5IT2H 1TPXC 1LK3H 3U7AA 3PDGA 5B8CB 5ID1A 2G2RB 3PWNA 2XWBA 4FS0A 1BWWA 1WFUA 2BVUA 2OQJB 4JM2C 2CDFB 4JO1H 4NJAL 1C08B 3I02B 4I48B 4TOYL 4PJAF 3JWOC 3GJFK 3B2UD 3MGTA 3A6CL 4X6BB 4YDIH 1BF8A 2ARWA 1MRDH 3UC0L 5IHUH 1SBBA 3IDXL 4U1SB 1VENA 4ZTPH 2WBJA 3MRIB 2VITB 5DFWH 5F9DC 1HIMH 4O58L 5JOPE 4U1KA 4HK3J 4XZUA 3MZTA 4B7IA 1RZKC 1BLNA 2HMIC 4TN9A 2YPLE 4PRNA 2PCPA 3OAUH 1ADQL 2EDDA 2YC1B 5HHNB 4WTZG 5SWZD 3MRPA 4HWBL 1G7JA 1OAYL 3O6FC 1JCKA 1I8LC 4Q74A 2OXHA 1N6VA 4P9ML 2F58L 1KFAL 1XF3B 1NGPL 5KS9F 3ULUE 1D9KA 3TC9A 2EYRA 5DK0A 1WFOA 3LKRA 1EUUA 1P7QA 4L1HA 3B8SA 5EOTB 5HYSA 3TNNB 4QF1B 1NAMB 1FBIH 1YC8A 2VLKB 4HIHA 5DJAB 1TFHA 1C5BH 1OARH 5LGHL 4KI5C 1A64A 3MRNB 4L4VD 1BD2A 3UAJD 2PO6D 2XA8L 3MLTB 3P77A 3WS6C 1VPOH 3QXUA 4EUPH 5I1JH 4ZUSB 1XGUA 3VFTB 3LRGA 4PLJD 4ZSOE 4A6YA 4GRLA 5ISZD 3QJHA 3W81A 2HWZL 3QQ4A 4XNZC 1C7SA 1Q9OB 2ADFL 1MCIA 4PJDF 5J1AB 1I9IL 4FFEX 3TVMD 1IGJB 3EDJA 1E0OB 1CDHA 4KQ3H 1WF5A 3ZE1E 4BA8A 1PZ5B 3NTCH 3B2VH 1FIGH 3RUGA 4HK3N 5FYKH 5ICXA 5DD3H 1GAFH 3RTQB 4MXWL 3BN3B 1DUZA 1YEKH 5JW4M 3NCBB 4F3FB 2GTWB 1UWEH 4F7EB 2RB8A 1BOGA 4P23B 4X6CF 3MLVH 3FT4B 3MLZH 5IIEA 5LGJA 3QPXH 1IEBB 3T1WA 1A6AB 1RULL 4OJFL 1KJ2H 2P8PB 1E6JL 5F8RC 5C3LD 3QRFM 5GJSH 5DJ2A 4WW1B 2NW2B 3QNYB 5IB1A 5HDBE 3G6JE 5GSRA 5L8KB 1T1ZA 4U6XA 3TT1H 1ZTXL 1L0YA 4FQJL 1S7QA 1X4XA 4GG8A 3A67L 2BCKB 5JW3L 2NX5D 3HTLX 4PJ5A 5TDNB 4QKXB 4RZCA 4M61B 3EFDH 2VDMH 3NFSH 3PGDA 3L5JA 5GRUL 2Y1VA 4LSUL 2A38A 3SGEI 4LPXA 3TO4D 4GRWH 1PQZA 5GS0D 1HHHA 4WI6A 4OLVL 5EU6E 5HGHA 4LSRH 3RA7L 3S3PA 3D0LB 5FB8A 4IRSD 1MJJB 1HILB 1KB5A 1LO4H 2X09A 3UJJH 3MRMA 5C6PB 3ULVC 1IEAA 2FX8H 1FNFA 5HXMA 4UMGA 1HYSD 4OSUH 1CXEA 5E5MA 5GSVA 3ZE2F 4M9PA 1GZQA 4PV8A 4PG2A 4HKJB 1HXMB 2BVOB 5C9JB 3U30B 2WIIA 1M7XA 2OBGA 3F12A 2W60B 5JHDD 3VD4A 4WV1B 1TTGA 4PJ7A 4H8WL 1ULVA 3DRTB 4UIMA 4CMHB 1BOYA 4QHUA 4QHMB 1I9RL 1T4KA 1H3WM 1DBAL 1W0WA 1X5KA 1JK8A 3LSOB 4O2CA 1LO5A 3U36B 3OKDB 4UT6L 1MLCA 5JLZB 5C0RH 1LQVA 1ZT7A 5IGXH 4LSQL 1EMTH 4QHLA 3K80A 3FMGH 3QO0B 4M7KL 1FNGB 5GRZA 5JDJA 5E2TL 5L9DH 5IEKA 3ARDC 2JJWA 1ZXQA 2J4WL 3WHE1 4PJCB 4IOFC 3G5VA 4JZJA 5C0AE 4O5LH 4DZBA 3LEXB 4JQVC 3H7BA 1QFUL 1OD9A 3FN0H 1NMBH 2IG2L 3IVKB 4BFEA 5T3ZH 5ITBH 1FL5B 4DEPC 1ZGLP 1LE9B 2WLZA 3EJZC 4K7PY 5BO1H 4P2QD 1RUPL 2VTFA 2BVQB 3VFMA 3I9GL 4CN1A 4LDOB 3V4UL 1KPRB 4M62H 1J12A 3C09B 4FABL 4R26H 4LLDA 3WDIA 2HG5A 4RX4A 4YHYC 4Z7WB 3FB7A 5IHZB 1R3IL 4NDMA 1WBXB 1KEMH 4ZS6D 3MRBA 1A7NL 4OV6F 3PL6B 1CLOL 1J8HA 4OZHA 5E00A 1V7ML 4PRAB 3L3DA 1RUMH 4H1LB 4YXLH 3SCMD 1QVOB 5TE4L 1U8HA 4HAGA 5CP3H 3G6DH 2AV7A 4MQXC 3KR3L 1EH9A 3K46A 3MLYH 2HFGL 2YWYA 4G8GB 6FABL 1JZ6A 5D7IE 4PJAE 4KMQA 5D5MA 3MLSL 2MCG1 4X6EB 2EIDA 3TBWA 3ARGB 2R2BB 3VU2A 3HUJF 1AY1H 4MMXC 4L5FL 2XPGB 5CCKL 1YEDA 2NY4D 1TCRB 4LASL 1HH9A 2XTJD 4PRBB 3FQRA 3HR5A 2VDNH 5LAXA 3BH8A 5ID1B 2R1YA 3PWNB 3ULUC 2HYMA 2XWBB 1QPPA 2ZPKH 5D71L 4FQIH 3RIFK 3BO8A 3QQ3A 3T0VA 3QQ9C 4M93C 2VIRA 4AMKH 1MJUH 5DHYA 3ARFC 5E6YA 4J1UA 1OGAD 4HJJH 4TTDC 3MGTB 1GCFA 2YA2A 5B3JF 3I6KB 2NY3D 2JJTC 2WBJB 1GC1H 5C0DA 4C55A 4IBLT 1CXIA 4U1KB 4XZUB 2XN9A 2R4RH 1BLNB 4HBCL 2AEWA 1FZMA 1F02I 3BP6A 2PCPB 1NBZB 1HHGA 5CWSA 4MA3A 4HGMA 2YD5A 4G6FD 3MRPB 2EC9U 1XIWD 4LPVA 2VABB 1G7JB 3ROOB 4E41E 3QIBC 1D5XA 5C09D 1VGKA 2IFFH 2I60L 4M5ZL 3MJ9A 4H25A 4YHOH 1D9KB 5LBSH 4DGYL 3FFCE 5ENWA 2EYRB 3P9LB 1L4IA 5DK0B 4AQOA 1QFWM 3LKRB 3UJIL 2BK8A 1GXEA 4YHML 1P7QB 4UIKH 1J7VR 4OF8A 5HYSB 5F71A 4FZ8H 4XAKE 4HWNA 3BPNB 3WS3B 1NANI 5EBMA 4C54A 3SDYH 1Y6MR 2LQRA 4OZIB 2J6EA 3SDXF 3CH1A 4NHUA 3DJ9A 3WFEH 5DZLA 1IGFL 1BD2B 2EDRA 3U6RA 2YS4A 3P77B 4WHDA 3BFOA 1T5WA 4ZNEE 2ADIA 1XGUB 1F2XK 4A6YB 2WUCL 4GRLB 3QJHB 4XP4L 4XGZA 4IDJH 5EU7E 5JXEC 1SMAA 3M07A 2BDNL 1YN6A 4CU6A 3H9ZA 5T3XE 1UH3A 5GGUA 5CIPH 1UXSA 3KGRA 2VLME 5D1ZD 5TQ0L 3RUGB 5FFLA 4YC2C 4Q6IC 5ICXB 5J89A 1SEBB 4OZGE 1FGVL 2QADB 4EKXA 3H9HA 4KTDH 1GGTA 4K2UL 1DUZB 3QPQD 4PY7A 2DMKA 4HXAL 3I6LD 5F9JB 4JPKH 1T2JA 4HH9A 1OVZA 2F9BT 1YPZA 5IIEB 5LGJB 3SBWC 4O9HL 5IV2A 1CBVH 3HMWL 1FYHB 1EAPA 3DPBA 1TZHA 1Y0LA 5JOEA 4AEIL 5DJ2B 1MF2H 4HPOL 4FHBD 3WO3B 2OCFD 3QDJB 4MQSB 3P0GB 4D3CL 3GRWH 5IB1B 5JPNA 2FIRT 1T1ZB 4U6XB 1T21A 1WICA 1B0RB 2VDRL 1UKTA 1S7QB 4GG8B 3ZE2E 3CFKA 1OP9A 1T03L 2VO5A 1WT5A 3FOMA 4XWOD 5CILL 4RZCB 2WK2A 4NT6A 3QAZC 5DTFA 2M26A 2VB5A 1UQSA 4RWYL 3INUL 3V5KA 1KGCD 3DOSA 3PGDB 1ED3A 3ELAT 1CLYL 1HHHB 5INDA 2IC2A 5HGHB 4PIRF 3UTTD 2KPNA 1KB5B 2JK5A 3MRMB 1IEAB 4H20L 4HS8H 4OCSL 5DQDL 3OKKA 4OBRA 5E5MB 5GSVB 1GZQB 2A9MH 4PV8B 4LCCC 1DLHB 3K4ZA 1PX4A 3SE3C 2WIIB 5L88L 4PB0H 3KPRA 3F12B 1S8DA 3LKNA 4I2XA 3P30H 3F58H 4ZD3L 1YECL 4PJ7B 5GGRY 5KSBF 3CUPA 4UIMB 5I17A 2E6QA 3GBNL 4QHUB 5E0QA 1T4KB 1CFQA 2IQAA 3BAEH 1W0WB 4GOSA 1JK8B 4KDTC 5D70L 2GYSA 5I73C 1LO5B 1D6VL 2VLJE 5KBNC 4RSVA 3NIDF 5A2IH 1KULA 1MLCB 4UOJA 4YO0A 1N26A 3BP5A 1ZT7B 1G7IB 4QHLB 5C0EA 2DQGH 1E4WH 1CYGA 1QLEL 4RRPA 5CLTA 2B4CH 5JQ6L 4V3EB 5IEKB 1CDBA 2UUDK 1DANU 1O0VA 3G5VB 4JZJB 4DZBB 3KLHC 3ZT5A 3H7BB 1QSVA 3LAFA 4KKCD 1FH5H 4EOWH 5D7SL 4TULL 3M17A 5HYEA 1V3MA 2YUXA 5E95B 3VFMB 1OLLA 2D31B 4RMRA 1L7IL 3L95A 2VXVH 4HWEL 3RI5K 2HT4C 4KZDL 4XVJH 1GRWA 1KTKE 4IRZH 5EUKA 1JGUL 4LLDB 2Y06H 2E7LA 2HG5B 12E8H 2RCSH 3QIWD 3TJHA 4LPWA 2BNRD 3FB7B 3ZKMC 3ZLQC 4NDMB 2ED7A 5HI4D 3MRBB 1JIBA 1MCOH 4YPGA 2JJSC 1J8HB 4OZHB 3O3AA 4NQVB 1EBPA 5E00B 3L3DB 2BY1A 5D1XA 4OGAD 4PJHA 1PD6A 2DTMH 2VLRD 1IC7L 1KV3A 3M8OL 2NCMA 3LS4L 2AV7B 4GQ9L 4MXQA 4QWWC 3VGAB 4BH7B 5JUEL 2DQTL 2O5XL 1OGTA 4V1DA 4HKBA 3ESVF 3KG5A 3GUTA 1CD0A 4K3HA 4XNQA 4FQXA 5D5MB 2VQTA 2KKQA 4NKQB 2JCCF 2PXYC 4PJFA 3TBWB 1E6OL 2W1NA 2YD9A 5T5FH 3EYQC 1A2YA 1NGQL 1FLRH 1B4JH 3QHZH 3T0ED 5AZEL 2WLYA 1MQ8A 1YEDB 5JHLH 3FB8A 4U6TA 4YUEL 2HT3D 1HH9B 5AAMA 4AM0A 3FQRB 3HR5B 5ADPH 3EFFA 4DW2H 3V6OE 3BH8B 5HYJE 3A6OA 4ALAL 3C5JA 2R1YB 3ZDZF 1U41A 5FF6A 3U7WL 3UTOA 5L7XH 2ZSWA 3BO8B 3QQ3B 3VDCA 1S5IH 3VG9B 2VIRB 5CKGA 4J1UB 2DN7A 2V2TB 3EDFA 3M45A 4OTXH 4TSCL 2UWEE 3TV3H 3O8XC 4KKAD 3FO9A 1I8IA 2W9DH 3L3GA 1MFEH 3DVGA 1UZ6E 2X40A 1S9XA 2F54D 2XN9B 4JHZA 4NIKB 3FB5A 3MLWL 3NA4A 4PJIF 1OQOA 1TJGL 4Y7MA 1FZMB 3CCHA 5E8NB 2VISA 3BP6B 4P2RD 4NWTL 1HHGB 5HDQL 3WN5A 4MA3B 1RSFA 1YEEH 1MREH 1XGQA 3EYFA 4MDJA 4PJEF 3FAXA 1NCTA 4P46D 1D5XB 1AO7E 4JHAH 1VGKB 3QUYD 2DQJL 5EZJA 3UTSD 4H25B 4ZS7L 1G0XA 4XPTH 3LDBB 5GRVK 4MNQA 5ENWB 4K71B 1OTUD 3T2PA 1DBKH 4NQDA 1HKFA 1JZ2A 3BWAA 2ZOKA 4LSVL 1U3HA 1WVZA 2ERJB 5GGRA 3TF7C 1Y6NR 4Z8FL 1INEL 2ID5A 2WW8A 1R5VA 2LVEA 5J06A 5EBMB 2UVFA 2G5BA 4TUJB 4LEXL 5MP6H 5DJDB 5F7EL 3RZWA 2HJKA 1FFOA 4LSTH 3I50H 3CH1B 4NHUB 1D5IL 1YYLH 1IBGH 4F80A 1T5WB 3AREC 5IT2L 2ADIB 2VRAA 5CJQH 1QR4A 4HWBA 3FRPG 4JO1L 1OM3L 1BQLH 1WV7T 5C08A 4XGZB 2VKWA 5E2UH 1MCDA 5GS3A 1UWXH 4KAQH 1T0PB 1X5YA 4YDIL 3CSBA 1QP1A 1YN6B 1MRDL 2NY2B 2FD6L 4ONFL 3NPSC 4TNVK 5IHUL 3WFCH 4ZTPL 4N8CH 5GGUB 1IT9H 1DBBH 2BVEA 1IJ9A 4PD4J 3UO1H 1HIML 1UXSB 1HOCA 2I9LA 1K5NA 1YUHA 3SJVD 3H9HB 4AY0A 3WFDH 4B50A 1YC7A 4DFHA 1FN4A 4KJWD 4HUXB 1UJ3B 4HH9B 3AB0B 4JDTH 5I19L 4JFFD 4TQEL 3LQZA 4JG0L 5SV4A 1YPZB 5BV7H 5IV2B 3BRDA 1JHKH 4M03A 3PP4L 1TZHB 1Y0LB 5E2VH 3PF2A 5GISH 2GQHA 2DQFA 1NLBH 1C5BL 1N5YH 3BKMH 1H3UA 1N0LA 3CFKB 4YH6A 3FOMB 1VPOL 1H3PL 5ACMA 4KROD 1UM4L 4NT6B 5DTFB 1MQKL 1UQSB 3D9AL 3QHFH 3IB4A 3V5KB 2A1WL 3OBAA 4K94C 1ED3B 1WQVT 5AAWA 4LCUA 4KQ3L 2D2OA 1MFCH 2JLLA 4FN0A 3D3VD 5CZVH 3NTCL 3FN3A 1FIGL 3S35X 2ILLA 5FYKL 3F65A 3NIDE 1YEFH 4OLEA 1AC0A 3ZDXF 4S0TD 3OMZA 4Y2DD 4LLUA 1CGUA 1YEKL 3KPRB 2NY0D 1S8DB 4F15C 3LKNB 4ELMA 4XCYA 3KPQA 4I2XB 1TETH 1UWEL 2MKWA 4L3EE 1INDL 3KYKH 4Y1AA 3CUPB 3MLVL 4ELKA 5I17B 1Z3GH 3MLZL 1CFQB 2IQAB 1BM3H 4O51A 4BELD 3LN4A 1W8OA 1EJOH 1UA6H 2GUOA 4YO0B 2V9QA 3BP5B 3QDMD 5GZND 5C0EB 3RBGA 4OI7A 1BZ9A 1JUFB 4OB5H 3TT1L 3FFDA 3HPLA 4TUOA 4OLZH 3SQBA 1CDYA 4R4ND 3VRIA 5GXBB 2DD8H 3M17B 1QSFD 3EFDL 3HAEH 2VDML 3L95B 3NFSL 4I77H 1X44A 4J3WA 2FZ3B 1X4YA 2V2XA 5EUKB 3TO4B 3P2TA 3IT8D 4F9LC 1JHLH 4NYLA 2VDOH 3DYMA 2J5LC 4M6MH 1BP3B 3UJJL 5IWLC 2FX8L 5F6HI 4WO4D 4LKCB 3O3AB 3V6OC 4OSUL 1GGCH 1KIQB 3LPFA 1S7SB 3W39A 4F37F 3K1DA 1VFAA 5D1XB 1H8OA 4PD4K 3JV0A 3W0WE 4PJHB 2EDWA 3SEPA 1AIFA 3FOLA 3SPVA 4Y19A 3CFEA 1OGTB 4V1DB 4HKBB 2NXYC 2R0LL 3GUTB 4R7NA 1TQCC 4XNQB 2B39A 4FQXB 5DVKA 3FQTA 1MCFA 3WFBH 3VCLA 2EIEA 5DZNA 4PJFB 3WHE0 4XH2A 2YD2A 1A2YB 4JY5H 4HUUA 5IGXL 4N0UA 4R2GC 1J0ZA 1EMTL 1HYRC 3K2UH 3STLA 2EICA 3FB8B 5C9KA 2GI7A 5L9DL 3VGFA 4X7EC 4JZOA 2NY1D 3H0TA 4LP4A 4AM0B 1KF9B 2RGSA 4GMSH 3EFFB 4O5LL 4PJBE 3FN0L 5L8JB 2AQ2A 1G9MH 1FFNA 5FF6B 4DWHA 1A6UH 1NMBL 1HQ4A 4WW2F 3L3IA 3CU7A 1YY9C 5ITBL 5BO1L 3U4EA 1NGZA 1IC4H 1F3JA 4XCEA 2OTWA 3T0XA 2XY1A 2D7OA 4P5KA 1IQWL 3CSYA 1QG3A 4M62L 1KEGH 5C0CA 2EXWD 3FO9B 2W9EH 1I8IB 2J1KA 3L3GB 3DVGB 1RZFL 1S9XB 4JM2D 3FB5B 4N5EC 5ANMA 5DT1H 3HI5H 3CCHB 4AEHH 2EZ0C 3V0VA 2VISB 2Z31C 1IZJA 4DVRL 5JDSA 3WN5B 4MJIE 3GMLA 3SCMB 2AEQH 1XGQB 3EYFB 4MDJB 1RUML 4MNHA 4YXLL 4BZ2H 4PRHD 1JWUA 4GO6B 3WNOA 4CADA 4UOW1 5EZJB 4UDTA 3W9EA 3VA2C 1IGMH 4MNQB 3MLYL 4CKVX 3RWHA 4LVOB 4NQDB 3BWAB 5EFIA 1ZVSA 2ZOKB 1U3HB 1T1XA 2ITDA 2ESVD 1NGYA 4XXCC 3UROR 3O6FD 5JMOC 5C1MB 1R5VB 2EDOA 1MHEA 1NAKH 2YMXH 4U05A 5FAAA 2G5BB 3DHMA 4PY8J 1FFOB 4XVSH 4PRPE 3QEHA 4HCRA 2R1WB 4BQBA 4G8IA 1S7WA 3BZEB 5IROC 1BQUA 1KSRA 4OZIF 4DN4H 3O6KH 2FR4A 4AMKL 1MJUL 4RA0C 3MUJA 2BHYA 1XGTA 4KRMB 4KI5D 3DVFA 5E4IA 1XR9A 4MAUH 1GC1L 4M00A 5ACZA 4JDZA 5GRVL 2DDQH 1HOCB 2NNAA 3RWIB 2I9LB 4M8QA 4RIRB 4K9EH 1K5NB 5BRZD 1JPSH 1YUHB 3GJFA 5JPMB 2Z92A 1BIHA 1YEJL 1INQA 3MLPA 5C07E 4GRWE 1FN4B 4JRYE 5DJ6A 5CEXA 4ODVL 4YZFE 5CBEA 5JNYA 1UWXK 3R06A 3WNPA 4D9LH 3T2OA 3HE6A 3MBEA 4HIEA 2G9HB 4RMTA 3EAKA 5HD8D 2DBLH 4BK5A 3LQZB 3CFCH 1M4KA 4YHOL 2YRPA 5LBSL 1A1MA 4WGVB 1XCQA 1B6UA 3WKNA 1CS6A 5DJCA 1X3DA 1EBAA 3DMMA 3T8XA 4UIKL 3PGFH 3O9WA 4HWZA 4FZ8L 2BHUA 1XF5A 3W2DH 1AHWA 4LP5A 4JO3H 2DQFB 3ARBA 3SDYL 3CLEL 2HLAA 4Z7NF 1BVZA 2GW5A 4QO1A 1IC5L 4P5TA 4ZQKA 3BIBX 1VHPA 4UB0H 5MENA 4KJYA 1JGVH 1PEZA 4WGWB 3MNZA 1L0XA 4IDJL 3RU8H 2OZ4A 2CRYA 4RGMB 5HPMA 4JQIH 4TVPH 5DRXA 1C12A 3TM6A 3C6LC 4LCUB 5FV1L 2EH8H 4JFEE 4JREC 4UT9H 4N8VG 2MTPA 5T3ZE 2WWKT 4QOKE 6CGTA 3B5GA 1OPGH 1OT1A 2CO7B 3T0WA 1BREA 5CEZH 4MA1C 5BJTA 3QUZC 5DMYA 3F7YA 1NC4D 1JYVA 5KVMC 3QI9A 1U8OB 1QZ1A 4JY4A 2LAGB 1GGIL 4ELMB 4XCYB 3KPQB 2BSRA 3PGCA 1R5WB 4JPKL 5DHVH 4DKDC 5DA4A 4KY1H 3ULVD 4Y1AB 3JTCA 1SY6H 2FJGA 3V9FA 1BJMA 3O41A 3U0TA 4O51B 3BPOC 3LN4B 3BPLC 4U31A 4QRSA 5I8CB 1A3LL 2NZIA 5DA0B 3TN0A 2GUOB 3N1GC 4WWID 1MF2L 1BVKB 1DVFD 4KKBD 3CX5J 4Q2ZA 1BZ9B 4FG6D 4M5YH 3VXSA 2PW2A 4C58B 2CO6B 1EA9C 3HPLB 4TUOB 2FHCA 4MJ2A 3KHOA 5E99H 4PRID 1NUDA 3OF6A 3VRIB 4FP8H 1AC6A 3FRUA 3PQYA 1VERA 4J2XA 4KK8C 4UQ2A 3U48A 1Z9LA 4GS7B 5C0BE 2DM4A 2X7LA 1N3NA 2YZ1A 1EO7A 2V2XB 4Y4FA 1KPUA 2V7NA 3SKJL 4NYLB 3GSVA 3NPZB 3B6SA 3SGEH 5H35A 4LF3A 5I9QB 4L9DA 4R0LC 2AJXH 3R4DA 3VXRD 3VXMA 1YNKL 2CD0A 4JFZH 3W39B 2A9ML 1VFAB 3UPCA 4HD9A 5D8JH 5JORA 4X4XA 5JMRA 5HHMD 4PB0L 4GBXC 5IHLB 1AIFB 3FOLB 3SPVB 4Y19B 2Z8SA 3P30L 4YHLH 3CFEB 4Q9QH 1WAAE 1P53A 3SE9H 3L7EA 4QY8A 1NAMH 3RJDA 4R7NB 3BAEL 3KJ6H 2OL3A 3RVXC 3FQTB 3VCLB 3OJVC 3IKCA 4KRNA 5C0JB 3GO1H 3JWDH 4P4KA 4XH2B 1YMME 1MCPH 1GIGL 4HUUB 2ZUYA 4MQXD 4RFOH 4N0UB 5K93A 4APQD 5JW4R 4K3DH 3CFDA 1E4WL 2DQGL 3STLB 5E9DD 1IE5A 4JZOB 3C5ZA 3H0TB 1MCWW 3MJ6A 4OFVA 1A14H 2ADJA 3MC0A 2UZYB 1WEJH 1MI5E 3GHBL 3LKOA 1FH5L 4EOWL 2ZJSH 1HQ4B 3L3IB 5E8EA 3AS1A 1K8DA 3U4EB 1IKFH 3MLRH 2EEAA 1NGZB 4NKIL 4QYOA 4B7LA 3UZQA 1KG0B 4F2MA 1F3JB 4XCEB 5KOVC 2VXVL 1PX3A 4AEEA 1ZVHA 4KTEL 2LV4A 1VEPA 3CSYB 4XVJL 4IRZL 5HHVL 4GJTB 1CDUA 3TO2A 5C0CB 2Y06L 3QEQE 3IDYC 2BERA 12E8L 1E28A 3O3BA 3ULUD 5DD6B 5H94A 5ANMB 4LVEA 4UILL 3QQ9D 1MCOL 3V0VB 4BM7A 3ARFD 2AK4E 2EIBA 4TTDD 5JDSB 5FEBA 3GMLB 3GBMH 4U4BA 3KXFE 3GKWL 2VOTA 5D2NE 4LBEA 3U0WH 2DTML 1H15A 1JWUB 4Y8AA 3A6BH 4FNLH 3TBTA 4CADB 1G0YR 4UDTB 3W9EB 2EDJA 3HHRB 4WUUD 3IFLH 1LO0H 1I4FA 2OK0H 1R6VA 1FJ1B 3RWHB 1VESA 4D8PA 3NH7L 2PYEA 5EFIB 1EEUA 1ZVSB 3THMH 1T1XB 2ITDB 4XNMA 1NGYB 2YUWA 3QIBD 1AD0A 5T5FL 4HUKB 1D5ZB 4GUPB 1MHEB 1FLRL 5E6IA 3QEHB 5JHLL 4F58H 1RIHH 4G8IB 1S7WB 4KK6C 5AUMA 1T2XA 3GMMA 3QBTB 5ADPL 3MRQA 4DW2L 4N9OB 4X5XA 3CX5K 4OFKA 4URTB 5L7XL 4Y5XC 1S5IL 1TTUA 2FR4B 1XGTB 4WVRA 3MO1A 1N64H 3TV3L 3REWA 4PG9A 5BW7A 2UYLA 1XR9B 5AD0A 5ACZB 2W9DL 4JDZB 4NCDA 1DQLH 1UB5A 5HGBA 1VSCA 4M8QB 4X4ME 3GJFB 2Z92B 1INQB 2ZP0T 4XMLH 4JR9L 5DJ6B 5CEXB 2FBJH 1YEEL 5JNYB 4AH2A 2FO4A 3R06B 5SWQA 3HE6B 3MBEB 4HIEB 2CH8A 4XX1G 2VSDA 2COQA 3RDTA 35C8H 1M71A 5KG9A 1DJSA 1CIUA 3P4MA 4XPTL 1A1MB 2W0PA 3HRPA 1XCQB 5DJCB 1BMGA 4NQCE 3QIUD 3VXUE 3T8XB 5CZKA 1CDGA 3O9WB 4ISVA 2YRZA 1N2RA 4HWZB 5TH2A 5C86A 1I8LA 1XF5B 2B0SH 3DX8A 3ARBB 2HLAB 3GSNA 1NANH 5EU6D 2AJSH 5K9JL 3ZYJA 2BXZA 1CGWA 1YYLL 3G08A 4P5TB 4Y4KC 2PTVA 4X5WA 1IBGL 2C3VA 3CMGA 4ZQKB 5FM5O 5KANG 2CIKA 3UXFA 3H8NA 4KK5C 5CJQL 1U8JA 3VGHA 2V5SA 4KJYB 4PLKD 1AQKH 3LCYA 1BQLL 2YD3A 4HC1L 5DURD 5FXCH 5K9KA 3MNZB 4ZOAA 5HYFA 5BCAA 2AW2A 5HPMB 5J57B 4KAQL 1NCDH 1Q9KA 5TF1H 3N85L 5DRXB 4LL9A 5EBGA 3C87A 3HZYA 1XF4A 1C12B 1NCBH 5CGYC 5L2KE 2CXGA 5GGSY 3WFCL 2MKLC 2XZZA 4N8CL 4H1LH 1IT9L 3ARRA 3UO1L 4FRWA 1TTFA 3SDDD 1F00I 1F4AA 3P0VH 3GM8A 4WI2A 5BJTB 4Y5YB 2D7PA 1RU9H 3F7YB 3WFDL 3QI9B 3H6JA 1QRKA 3U4BL 1RIUL 2X1PA 1RZ7H 4JZNA 2B2XH 5DD5H 4JY4B 5BZWA 2ZUQC 3NZ8A 2H2PC 2BSRB 3PGCB 4KK9D 4U3CA 2CMRH 3L6FA 3VFPB 5FKAA 4JDTL 3DSFL 3VI3F 1Z9SA 4Y16C 2JB6A 4EUPA 5ERWA 2FJGB 4CVUA 1RURL 3O41B 1KC5L 2JELH 4ZO9A 1CDIA 3VDBA 3RKDC 2L4OA 2JKXA 3WXVH 1AQDA 3PWVA 3DO7A 2NMSA 2XXMB 4FXKA 1KTLA 1JHKL 2ED9A 5E2VL 3SE4C 5JA9A 5GISL 4KJPC 2YEZA 2AXJA 4ODTH 2VAAA 3QULA 3BIAX 4HXBL 1NLBL 5JOFA 4Q2ZB 3E3QA 3VXSB 2EDLA 2PW2B 3DLQR 3BKML 4P0DA 3O45A 3NBNA 1OOAA 3H42H 4MSWA 1PGRB 3JXAA 4Y5VC 2ORBH 3FRUB 3UZEA 3PP3H 3PQYB 2GSGB 4UZGA 4WW2C 4UQ2B 3TA3A 2HH0L 2VDQL 5DUBA 1LWRA 4JFOA 1IAMA 4P4RA 3QHFL 3FN9A 4PREA 5EB9A 2X7LB 1N3NB 3HC3H 1V7NH 1R0AH 4OFYD 1KPUB 5B4MD 2V7NB 5B21A 3EO1A 4ZO7A 3GSVB 3B6SB 5H35B 4LF3B 2NZ9C 2X1OA 3D3VB 3OKYA 5CZVL 1KCUH 3VXMB 2QSTA 1MHHB 4CVXA 2NR6C 4ZDHA 4AENA 2K3TA 1PKQA 4I18A 2HT4D 4PJGF 3QNXA 5JORB 1IILE 4X4XB 2EE6A 4FFYH 5BOPA 3MLUL 3WL9A 4MX7A 1TETL 5EU5A 3ZKMD 4UV4L 5D6DC 2X4OA 3PV6A 3KLAB 3KYKL 1U8NA 3L7EB 3NN8A 4QY8B 1Z3GL 3C2AH 4M7LT 4FQ1H 4PJXA 5KVFH 1BM3L 1S7VA 5EORL 2OL3B 2VXSH 2CK0H 1RK0B 3IKCB 4GG6A 2D9CA 4P4KB 1EJOL 4F33A 3E6HA 1UA6L 5EOCH 3MRRB 1OQXA 5D2NC 3CFDB 3O81A 5DVNA 3V52L 4A6YH 3C5ZB 5IJKC 4OB5L 1JGDA 3NA9L 4OZ4A 2ADJB 2OXGA 1G7PA 3QWRA 3O2VL 3LKOB 2JB5L 4DCQA 3V79C 4U2YA 2PXYD 2DD8L 5FGCE 5E8EB 4NZTL 4ZO6A 3EYQD 1K8DB 4QYOB 4XPHH 1UJTA 4F2MB 5AWNH 3MV7A 5M94B 4I77L 1RZJH 1B2WH 3Q3GA 4M1CC 4E41D 5EUOF 1JPGA 3ARDA 1ZLVK 3C60A 3TCLA 1OCWH 3TO2B 3LMJL 1D5BA 1C1EH 2E8ZA 2VDOL 1E28B 3O3BB 2EYTA 2XKUA 5H94B 3FFCD 4M6ML 3NMEA 4LIQE 2Y25A 1J86A 15C8L 1WFTA 1M6OA 3DXAE 2JTDA 1GGCL 4HPYH 3TFKA 3T0AA 5JIHA 1HHIA 4LBEB 4NKMA 1HQRA 1H15B 2BC4A 3G9AB 3TBTB 4NCC2 1RI8A 2H32A 3VWJA 3Q5TA 1I4FB 1T7WA 2NXZD 1LEGA 1KXQE 2MNUA 2OMBA 2IANE 1H0DA 4D8PB 2PYEB 5A3ID 4TUKH 4E42A 4XNMB 2A74A 1ZMYA 1GGUA 2FX7H 4ZXBA 1AD0B 1ORQB 2NY7H 2UY7A 3EYUH 3GSOA 5DLMH 4JY5L 2OM5A 5E6IB 2FEDD 1MNUL 4G80A 3ZTNH 1F3RB 1TQBC 5T3XD 4P2OA 5AUMB 4BJLA 3GMMB 3P11H 4GMSL 3MRQB 3HG1A 2VLMD 4X5XB 3LEYL 1WCQA 3HZKB 4MYWB 1OTSC 4Z76A 2YPLA 3OXSA 1KB5H 3MO1B 1I9EA 3REWB 4PG9B 3D87B 4U1LA 1F4WH 4O4YH 1KEGL 2UYLB 1TPXB 2W9EL 1CFTA 5AD0B 2WP3T 1UB5B 1CIDA 1PVHA 1MCJA 4AEHL 5BMFH 1BGXH 4JKLA 4AH2B 2FO4B 5SWQB 4Y88A 4BZ2L 4S1DC 3VD7A 4E9LA 2B1HH 4PGCA 1CD9B 3RDTB 4QRPA 1CF8H 2P5WD 5KG9B 3MUGA 4FQQA 3P4MB 3T3MF 4FXLA 5DJ8B 3ESUF 1IGML 1DDHA 4IHOA 5I1EL 5EN2A 4L4VE 2V5TA 4XPGH 2I24N 4LEOA 4B53A 4PJ8C 1LK2A 5L0QB 1N2RB 1JTOA 5TH2B 1IGCH 4NP4H 5ISZE 3DX8B 1CFBA 5I74B 4LRNL 3GSNB 4U6VL 2ITCA 1A7OH 3OXRA 4XVSL 4C56A 3JUYA 3SGDI 3G08B 4XBGA 3ME0A 5EOCJ 1F6AA 1HZHH 1E4KA 1NMCC 2C3VB 4X5WB 3RY6A 1H8SA 4X7FC 5BVPH 1U8JB 5E70A 1XF1A 3DRQA 1NMAH 2YZ8A 5K9KB 4LSDA 3O6KL 4HKXA 4OZFB 2F5BH 5IM7A 3NIGF 1Q9KB 1FGNL 2JF1A 2V5MA 3HZYB 4JJ5A 1XF4B 3KS0J 2X9XA 3RZCA 1RVFL 3QEUA 2VUOA 2C1PA 4MAUL 3FHQA 4ZUUA 2DRUA 2DDQL 4OUOA 1D6EA 4K9EL 4PJ9C 2HKHL 1ERNA 4EN3D 4XNZB 5FA3A 3H3PH 4UINL 5JXEA 4F37K 3BEWA 2J3SA 3U79A 4JZNB 5HYSG 5FECA 1A1OA 5BZWB 4D9LL 4N5UA 1LDPH 3L6FB 3RGVC 1WBYA 5FKAB 2DBLL 5GGTA 2OLDA 1WC7A 2JB6B 4BK4A 4M1DL 4EUPB 5ERWB 3CFCL 2IPUG 1TMCA 4B5EA 5FV2A 4YDVA 1NFDA 1AQDB 2A9NH 3PWVB 3DO7B 4P3CL 4FXKB 1OTTC 1KTLB 2NX5E 4G8FB 5FYJU 4U33A 5DHXB 3H9YA 1BZ7A 3W2DL 2YEZB 2P8MA 2VAAB 4JO3L 1OP3H 3QULB 4I3RH 5JOFB 5CIPA 5T1KA 2DQIL 1A3RH 3S88H 3VH8A 4DVBA 5F88A 2IMMA 3O45B 4NUJA 3ARVA 4MSWB 4XHJD 2Q8AH 2OSLA 4NZUH 3V0AC 4UB0L 3ZKNC 3TA3B 1S9WB 1JGVL 5CZXC 5DUBB 5F21B 4IMKC 4JFOB 2YHGA 4XP5H 3GEWB 4MNGA 4P4RB 3KPLA 4HDIA 3RU8L 4PREB 2VXQL 5DGQA 4TVPL 4L8BA 2A6IA 4Q9RH 1CFVH 3GJEA 3EO1B 1AFVH 5SWSE 4UT9L 4OD2B 3NZHL 3ILQC 3RVUC 4EI5C 3MX0A 4Z0XA 4CVXB 3PP3K 4ZDHB 2DYPA 5CEZL 4AENB 3MJ9H 1PKQB 3F7RA 4I18B 1NC4B 5J4MA 3OKEA 3BT2H 1YEHL 3WL9B 4NM4H 1FE8H 1OY3B 5EU5B 3TH2T 2X4OB 3PV6B 1U8NB 3NN8B 5C0AA 3U0PA 4PJXB 4CDHA 4IDLA 5HYJD 1S7VB 1JN6A 2J6EH 4Q0XL 2NPLX 1DSFH 3RPIA 3SE3A 4GG6B 2X1XR 4F33B 3E6HB 4OM1L 3L1OH 2EYSA 4P48A 3GHEL 4XP9H 3QXWA 1NUGA 2NXYD 1JGDB 3CDGA 4M5YL 4OZ4B 1G7PB 1QLFA 1JZ8A 4ONHA 4Z78A 2CXKA 4PRIB 1RZGA 1FP5A 1MJ8H 3ETBF 4KDTA 4WHYH 5E99L 5GRWA 4BH8A 4DCQB 4FP8L 4QXGH 4OT1H 2NY6C 2IPUK 1NDMA 1KCRH 4K7PH 4UT7H 5I8KH 4R2GD 3MV7B 4XPBL 3Q3GB 1JPGB 3BJLA 1AO7D 3ARDB 3R0NA 2QLVB 1CWVA 3C60B 3TCLB 1BFSA 2OI9A 1D5BB 3Q6GL 4OAWA 2AABL 3B2UC 5BV7C 1F4HA 4F57H 2EYTB 1J05A 4LVHB 2GSIB 3ZHDA 5DXWA 3S97C 2AJXL 4DEPB 1M6OB 4PJAA 1H3VA 1PSKH 2ZG3A 2P5EA 4L8SC 4NC0B 1HHIB 5D8JL 4NKMB 3V5HA 1HQRB 2CGRH 2EDNA 2H8PA 3D2UA 2H32B 4Y4FD 2ZCHL 5CLWA 4YHYB 1NCUA 2O5ZL 2Q8BH 2EC8A 4YHLL 3VWJB 4LHUA 1F2QA 1JBJA 1WISA 1H5BA 4N5ED 1LEGB 3HI1A 4GW4A 4DTGH 2Z31D 4OGXH 4IOIA 2I5YL 1H0DB 4BUGA 3KJ6L 4E42B 2WNGA 3PXHA 3QUMA 2A74B 4HS6A 1XH3B 4ZXBB 3GO1L 3JWDL 3DUHA 4HIXH 2QR0A 4NQED 2ZZUT 1CTNA 1MCPL 3GSOB 8FABA 1ZT1B 4RFOL 4CW1A 1LO3H 3OTTA 2DKUA 4WCYH 5KS9A 4K3DL 5GRXG 1A3QA 4G80B 2FEEI 4TSBL 5EPMA 3QXVA 1LD9A 3WSQH 4P2OB 4FQCH 1A14L 4N90D 5H37H 1WEJL 4BFIA 1A4JA 2ZJSL 1PZUB 1BEYH 1OSPH 4CNIA 3MV9E 4HQQL 4OIIH 4Z76B 1FZKA 2YPLB 1CDCA 3UAJC 2MWCA 2PO6C 1IKFL 2FL5A 3OXSB 2VXTL 5HGDB 3MFGB 3V7MA 4PLJC 4U1LB 3CZJA 5C09E 3L3HA 3P4OA 1CFTB 2WUBH 5DEZA 2VDLH 3IAPA 4MJ6A 4M93B 3VD5A 4Q9CA 1EFXD 2HLFC 4JFHD 1CVSC 2FWOA 5I1HH 3EZ8A 5GS1A 5IMMB 1G6RA 5FOJA 4AL8H 4PJDA 1RQ5A 1K4DA 3U0WL 4P99A 3A6BL 4PGCB 4FNLL 1WBZA 4QRPB 4G6ML 2PR4H 3MUGB 2H26A 4FQQB 5CEZE 3RWFA 1LO0L 1I8KA 2WWMD 1PFCA 1DDHB 4IHOB 1AR2A 5EN2B 4LEOB 4M7JH 3LH2H 1LK2B 2DBJA 3NIGE 4KGJA 1DP0A 3QIBB 4XRCA 3R0MA 2BHZA 2XZCL 4XX1E 4BYHA 4X6CA 2ITCB 1S9VA 3OXRB 4U6HA 4C56B 2H3NB 4F58L 1AH1A 1NC2A 4YHIA 4XBGB 1F6AB 2P49B 3BP7A 3MJGX 5CMAA 3TF7A 3ROLA 4HKXB 2QQQA 2XKNA 4OF3A 4X9GA 5IM7B 3AMKA 4JJ5B 3WXWL 2B8OT 3O0RH 2BY0A 3BGAA 3QEUB 4LGSB 3O3DA 2C1PB 3AREA 1MCBA 4ZUUB 4NNXB 3RL1B 5GS0C 1C16A 1D6EB 5FA3B 3C8KA 4IRSC 3UJTH 4HF5L 4XMLL 3BEWB 5DZOA 2FBJL 2EE2A 3IU4H 5FECB 1A1OB 4RFEA 4G9FA 1HYSC 3LKSA 4MQTB 5F6HJ 35C8L 3STZA 1TMCB 3KPOA 4P2YA 4YC2B 3FO1A 4HC1A 1G9MC 4YDVB 1NFDB 4YQXH 1QRNA 2VZUA 3IDNA 1ZHKA 3I3EA 4P9HL 1DN2A 2HTKC 1J8KA 1BZ7B 2B0SL 5DJ0B 2P8MB 3D6GA 3PDOB 2QKIA 5SV3A 2VLKE 3IYLW 3VH8B 4X9HA 5F88B 1QO3A 4DVBB 2Z8WC 1QFOA 4NUJB 4PB9H 2OSLB 3O2WH 1BQHB 1IGTA 3OJDA 3IDJA 1AQKL 5DURB 4MNGB 1AGFA 3KPLB 4HDIB 3W0WD 1NCDL 1MCWM 2F8OA 2A6IB 4L8BB 4JKWA 4OD1H 4PPTA 3TP4A 3GJEB 3PIQA 2HJFA 1JNNH 1NCBL 4HLZG 5F1KC 7CGTA 3BW9A 1EZVX 2VUYA 2RHEA 4KK8D 4JFDA 4Z0XB 3QAZB 3MV8A 3QISA 2DYPB 3P0VL 4FA8A 4G7YH 1LMKA 3HPJA 1RU9L 4X5LA 2H6PA 5LCVH 2VLJA 1UB6B 5DD0H 1I75A 4ZS6C 3OKEB 5FYJH 5B38A 1RZ7L 2B2XL 5DD5L 3WDJA 2CQVA 4L8DA 2CMRL 1HHKA 3HE7A 4X99A 2WM0A 3IDXH 5D96C 5C0AB 3U0PB 4ZYKA 1NEUA 1JN6B 3WXVL 2P1YA 5IFAL 1M1SA 5DK3A 1N0XH 3OL2A 2DM3A 1V8HA 2XFXA 3FONA 4ODTL 4K3GA 4WFED 4HWBH 2FSEA 5MHSD 1WK0A 2ZOLA 3BD5A 2A73A 3CDGB 3CH8A 3IU3A 3MSPA 1DUYB 2NY5H 3EJJX 4ONHB 4Z78B 3MBXL 4QRUA 3RVXD 3BGFC 1RZGB 3H42L 2BNRE 1X5GA 4BH8B 3WLWD 2NY4C 5I73B 2ORBL 3VWKA 1NDMB 3UZVB 1AGEA 5DEFB 5CSGA 1R3LA 2K9UA 4MB3A 3DX6A 3HUJA 1NGWA 4GXUN 2X10A 3HC3L 1MCCA 1L8JA 1NLDL 3BPCA 1KN4H 5HI3C 1IARB 2OI9B 5K9QI 2KZ1B 4OAWB 2NYYC 3N50A 5LGHH 1ZKAA 1J05B 1JV5A 1G7QA 4NN5C 3QT2A 2XA8H 1KCUL 5DUMH 4PJAB 2W92A 4KVCH 2CRMA 2WZPD 3VXQB 2P5EB 2FB4H 4X9FA 2B1AH 3B9KD 4YJZL 3V5HB 3H2WA 3RX8A 1VFMA 4NRXA 4F9LA 5ILTH 1ZGLA 4I0PD 2HWZH 3E1F1 5HHOD 5GGQH 5TGBA 3T0EE 3HCVA 3IXTB 4MXVF 4RRPG 4LHUB 3L3OA 4PRPD 1H5BB 2BXYA 4G6KH 1XIWC 3HRZB 2MJWA 5IWLA 1OW0C 1J0YA 3HI1B 4GW4B 2H41A 4IOIB 1WCBA 4FQ1L 1OAKL 1MUJA 4H0HB 5F7YC 3QUMB 4HS6B 2V6HA 2WMPA 5E5RB 3W82A 4R3SB 2YPVH 1RV6X 3ZHLA 2OP4H 8FABB 4ZUTA 4CW1B 5KS9B 2VXUL 3RNQA 3HNVH 5EPMB 1LD9B 1ZT4A 3AAZB 4NKOA 4A6YL 3OB0H 1VB9A 4AJ0A 3FT2A 3W9DA 4BFIB 1A4JB 1P5UA 3H9SD 3U9UA 2F54E 4CNIB 2G5RA 1FZKB 1CK0L 4P2RE 1RULH 2FL5B 5C07D 4OJFH 5I66A 1MPAH 1RZJL 3SDXA 4BQ8A 3QNZB 4KTYA 1JMZA 4MVBA 1OCWL 1TJIH 1C1EL 3P4OB 5ICYA 3UTSE 5E2WH 5I8EA 3PJSA 4L4TA 3FFCB 4MJ6B 1ZTXH 3KYMA 4Z7WE 4FQJH 4MQ7A 2D7NA 1T0MA 4XNYL 3A67H 2XQYK 3B4NA 2FWOB 3WYRA 3X12A 5GS1B 3GB7A 3LQAC 1G6RB 4KMTH 4YDJA 4JM2F 5D1ZC 1U93A 1K4DB 4WTZA 1GGYA 2V7HA 4U0RC 3O8XB 1WBZB 3FAWA 2H26B 1G1CA 1I8KB 4I5BB 4OLVH 5ACLA 1X5IA 3T4YA 3DGGA 4G8GE 3KWWA 2IMNA 1UG9A 1KYOJ 3EYSH 3S37H 4XRCB 2FX7L 3CJJA 1AKJA 3EYUL 4MAYD 8CGTA 1RPQA 4I3SL 3AGVA 1S9VB 3QFJD 4U6HB 4CAGA 3ZTNL 4IM8A 1NC2B 4YHIB 1F4XH 3P9WB 1JFQH 2FBOJ 3P11L 5T3ZD 1CXLA 1IFHH 4H8WH 5IG7A 3BP7B 4QOKD 1HKLH 2BSED 5CMAB 2GFBA 1Y6KR 4HMCA 1I9RH 4OZGB 3ROLB 4OM0H 1DBAH 2XKNB 4OCLC 1KB5L 5EOQL 3TWCH 3SKMA 3N0PB 2WWKO 4UT6H 5D1QD 2XWJA 3SKUD 1GYAA 4J3VA 1F4WL 4O4YL 1C8PA 2FYYA 4L8CA 5IROA 3O3DB 2CLZA 3AREB 4JFFE 4M7KH 3SDAD 4X83A 4KI5F 5EULV 4KK5D 5IVZA 4ZUWA 1C16B 1N8ZA 4WDIA 2CJUL 3C8KB 1MIEL 5BMFL 1BGXL 4JRXD 5EH1A 1JNLH 5K59F 4RFEB 2Q1EA 32C2B 4G9FB 3BSZL 2DQEL 2Q7YA 2LVCA 5DWUH 2J8UF 2B1HL 3LKSB 3D39A 3EBAA 1CF8L 3STZB 2VZOA 3KPOB 5EU4A 1X7QB 3WE6A 3FO1B 4XPGL 1LEKA 1QRNB 2R56L 1R3IH 3IDNB 4M48L 4LSSH 2SEBA 1T1WA 4LLYA 1A7NH 1ZHKB 2R1XB 4CU7A 1CLOH 25C8H 5IBTL 2H2PD 1IGCL 4NP4L 4JPIA 2RFXA 1V7MH 2ICWJ 4NN7C 5KSBA 2QKIB 2VL5A 5HJ3A 3G6AA 1A7OL 1QO3B 1E4XL 5TE6H 3RKDD 3ULSA 2DB8A 1BD2E 1HZHL 4GRMA 1CGSL 1OD7A 4AZ8A 4P23C 3QCTH 3OJDB 3IDJB 1NMAL 2HFEA 2JIXA 2QHLA 1AGFB 3MLSH 4YBLC 5J12B 2F5BL 2MQCA 4J3UA 1KENH 2BFVL 2C4FT 3PIQB 2HJFB 3C9NA 2FX9H 4P3DA 5CCKH 2R8SL 4LPTA 5I0ZA 3MJ8B 1MCQA 1EFQA 4JFDB 4J23A 1G9NC 1EJ6A 3G5ZA 3MV8B 3GSXA 4GKNA 5T5NG 3RUGE 3HPJB 3H3PL 2H6PB 4O02L 1B0WA 2YD7A 4R4FH 2VLJB 5B38B 1YMMD 2GIYA 5IBUB 4LU5H 3C6LA 4L8DB 1LDPL 1CG9A 4QRTA 3HE7B 4X99B 3IFPA 3CDCA 2Y4SA 4OGAC 4ZYKB 1XGPA 3DX7A 1MI5D 3QUZA 3ULVF 4ZFOL 4HCRH 2O26U 3TIDA 3ERYA 4F15B 1QSFE 4XNXH 1N7MH 2XFXB 3FONB 1XFPA 4YEEA 2FSEB 4I3RL 2ZOLB 4DN3H 2A73B 1A3RL 3S88L 3IU3B 3QEQD 4UUJA 2I60H 3T0EC 1RJYA 4HEPG 4QRUB 4YDKL 5I2IA 4DGYH 4NZUL 2HT3C 3DTXA 3MXWL 1R3LB 3UJIH 4PJ5E 3SE8H 4ZPTA 3HUJB 1J0KA 4MXVE 1NGWB 4RA3A 1JZ4A 3BPCB 3GJFH 3RWJA 1I7UA 1AFVL 5KZCB 3EIFA 3QDGA 3VXOA 4X98A 2GJZA 1JV5B 1ZWIA 1G7QB 5KSAA 1A22B 4NHCH 1EGJL 2JJUA 1S7RA 4KKAC 5GIRB 2P48B 1MH5A 3MJ9L 2ATPA 4YBHA 2OQJA 2CDFA 4OIAA 4I48A 1ZGLB 4I9WE 3BT2L 3MA9H 2QSCH 1FE8L 4NM4L 5EU3A 5TGBB 3HCVB 5DK2A 2J5LB 3L3OB 3CSGA 2BDNH 5F97E 4PJIA 4PJ7E 4P46C 1YY8A 2YR3A 1WCBB 1EEYA 2VITA 4U0QB 5CKAA 4PJEA 5TQ0H 2J6EL 1IAIL 1FGVH 4GBXA 4ZOEA 2EKJA 1U9KA 4P59L 2OJEA 1MY5A 2R15A 4ZUTB 3K1KC 5EC1A 4JM4H 4XP9L 4HXAH 1ZT4B 4NKOB 4ZFZA 2GITA 1YJDH 4JO2L 1RJLA 1TQCB 2OZ4H 2DOCA 3QSKB 3QG7L 3S7GA 4XCFL 1QYGL 2BVYA 3W9DB 3MCLL 4IRJD 5IB5A 1MJ8L 1CGXA 3U9UB 2BP3A 4QXGL 4OT1L 3S3JA 5K9OA 1UENA 4UT7L 4MJIA 3QQNA 5I8KL 5I66B 3HMWH 4ERSL 1FORH 3OKLA 1EO5A 3SDXB 3PXJA 4OLYL 2DI7A 4HPOH 3ZYIA 5DF0A 4K8RC 5ICYB 1KLGB 3D85D 3QRGL 5BOZG 3ARGC 5I8EB 3PJSB 4L4TB 3KYMB 1OTSD 4MQ7B 1T0MB 2VDRH 3VXUD 1G1YA 4R96A 3X12B 1BQSA 1PSKL 2YOCA 3GI8H 3MACL 4U7KA 1QR1B 3GB7B 5CILH 4OZHE 3ULUF 3VFTA 1U93B 2V7HB 1DBJL 3V0WL 2CGRL 4RWYH 3OX8A 3PV7A 4I8DA 3OB8A 1M7DA 4LOUC 2Q8BL 1VKXB 5EBLA 5FO9B 4Z9KB 1ONQA 3T4YB 4OGXL 3CNKA 4QXTA 1PZ5A 4WFGD 3MUY1 3DGGB 3W11D 2PW1A 4OCSH 5DQDH 2NTFB 1W72L 4S1DD 4HIXL 3ZDYE 4MJ4A 1O5DT 4MHHI 2Q7NA 1MRFL 1IC1A 1T7VA 4WCYL 1P7HL 1C5DA 5L88H 4MB4A 1NBQA 3GSWA 3HNTH 2D7MA 2KQNA 5L2KD 5IMKA 5I1LB 4ZD3H 2EEDA 5IG7B 5CJBA 1SVCP 4PJ8D 4IOSD 2GFBB 2C3HA 1SBSH 1BEYL 5K59E 1IEBA 1OSPL 2DS4A 4OIIL 3I84A 3TH3T 3ZE1F 5BRZE 3KLSA 4JRYA 5F7NC 3U46A 1D6VH 1FQ9C 4LSPH 3SKMB 4PR5B 2XWJB 3BZFB 2FYYB 1URLA 4L8CB 3V4VL 2CLZB 1QLEH 4LKXB 1JPFA 2NW2A 3DUSA 2WUBL 4ENEC 5IVZB 4ZUWB 4Y5XA 2D7TL 4WDIB 4OI9A 2Y5TA 5EO0A 5I1HL 2P44B 3RWEA 4M61A 2Q7YB 5IW1A 1L7IH 1DQDH 2OL3H 3D39B 4HWEH 3F62A 4GRLC 4NRYA 4Y2DC 2AGJH 5EU4B 4H0IA 1QFHA 4WFFD 4LAQH 4PJ9D 4PGBA 1LEKB 3TZVD 5IVXF 3D0LA 4M7JL 3LH2L 5HDBF 3G6JF 2SEBB 1T1WB 3ZT7A 4LLYB 1VACA 2YK1L 4X4ZA 4OLUH 1FVDA 1VFUA 5J1TC 2CKBL 3FQWA 3RGVD 4KRPD 1J1OH 2RFXB 5KSBB 2QADC 2VL5B 1HXMA 1ZV5A 5HJ3B 1GOGA 5ELIA 4UV7L 2VERN 4GQ9H 4JFEA 3IFNH 3ULSB 1REIA 4HULB 2ARJB 5GHWH 5GZNC 4GRMB 4YXKL 2R4SH 3SGDH 2HFEB 2R2CA 5KAQF 2JIXB 2H9GB 4JAMA 1IM9D 2X89D 5HDLA 1DLFL 4R4NC 4I3GA 1E6OH 3U36A 3I6GA 2PTUA 3C9NB 1I1FB 1NGQH 2IBZX 1A9EA 4P3DB 4CDGC 4L3EB 4Y4KA 1CFSA 3GSQA 3ZKND 2V2WB 4Z7UF 5ID0B 1JNHA 3G5ZB 4H26A 5HHXH 5CZXD 1UVQA 3GSXB 3N1QC 5ETUB 4S0UC 4YX2H 4GKNB 3U7WH 3F6IA 2DQDL 3IU4L 3QUXA 4WO4C 5ICZA 1T3FA 3C6LB 1IRAY 4JREB 5CJOH 1OAUH 2GT9A 4JHBA 1CG9B 3MRCA 2AJUH 4QRTB 3S4SA 2D0GA 3IFPB 3RVUD 1CL7I 4EI5D 2AXHA 2XIDA 1CICD 3LZFH 4MA1B 1R3JA 1XGPB 1YPZE 3F5WA 4LDEB 3DX7B 1G9EA 1WWCA 3NCCB 3QUZB 4OFPA 4YQXL 3GI9H 4DUWA 1ZE3C 3TIDB 3PL6A 1A7QH 3BKYL 5FDYA 1FNHA 4W6XB 1T66D 3S3SA 5C0BA 4WWKD 1UM5L 4Y16A 1ZS8B 1ZSDA 4QHNA 4UUJB 2DQJH 1RJYB 4ZS7H 1MLBA 4NM8H 3O2WL 2W0LA 3ARXA 3V95A 1FCGA 2NY1C 3DTXB 2FHBA 2ZWLT 3SE4A 1U95A 4OQTA 4NOBA 3E6FA 4ZPTB 3WJJA 1AD9A 5E24E 2YD1A 1IKNC 4F8TA 4Z8FH 4LCWA 4DK3A 1ZOXA 4OD1L 3RWJB 4Z5RA 3H3KA 4JGJA 1D3CA 1JNNL 4NUGH 3QDGB 3VXOB 4HLJA 4X98B 2GJZB 3LHPL 4M3JA 5ESAA 1ZWIB 4KDWA 4WUKH 4WW2A 4PRBA 1DEDA 2IAND 5KSAB 3OR6A 1S7RB 1MH5B 4G7YL 1RJCA 2ATPB 5C92A 1QEWA 1RFDL 1RZKH 5LCVL 2ZUUA 1OM3H 5DD0L 5FYJL 1YYMH 5F9WB 3D48R 5D7IF 2DTSA 1YQVH 1MWAB 5EU3B 3P0YL 3ES6A 3KPRE 5DK2B 1KACB 1JF6A 1WSST 4WU5A 4I2XE 4R0LB 5E9DE 2FD6H 4PJIB 4ONFH 3I6KA 5T1LD 1YY8B 3TGXA 4OI8A 1EEYB 3TYGL 3GSNH 4PJEB 5DR5L 2VZ3A 1J88A 3VDAA 4MLIA 1J5OH 4GBXB 1N0XL 3MRKA 3WO4B 4F7TA 1NBZA 2OJEB 2AJVL 5EC1B 5D7LA 2VABA 3ZSSA 3C5SA 3ROOA 1F42A 4ZFZB 2GITB 1RJLB 5I19H 4OZFH 1OT2A 2NY5L 4TQEH 1LE5A 4FTVA 5IB5B 4JG0H 1AP2A 3TBSA 4Y4HD 4UU9A 5K9OB 3P9LA 5DD1L 2AK4A 4R8WH 4POZD 4MJIB 4S11A 4X8JB 3KXFA 2R0KH 4EXPX 5D2NA 1IGIH 3PP4H 4JFQA 3OKLB 1XF2B 1IL1A 3MLXH 1KN4L 3CK0L 3WS3A 2HVKA 2VDPL 2QEJA 2DLGA 4WUUE 1TXKA 4OZIA 5LWYH 3IF1A 5DUML 4KVCL 4R96B 1ZANH 4JY6A 2LABA 1H3PH 2FB4L 2B1AL 3IDMA 1UM4H 4ZOCA 2E27H 4RDQG 1MQKH 3D9AH 1QSED 3OX8B 4LPCA 5ILTL 3IDYB 4PJHE 2A1WH 3SKOA 4WI7A 2X1WL 5GGQL 1KIPA 1M7DB 2OX5A 1HCVA 5EBLB 5IMOB 4G6KL 1ONQB 2YWZA 4V1DE 5HD8C 1FFQA 2HLFD 4QXTB 1NUNB 3IJYA 2MMXA 1BECA 5CJ5A 3RFZC 2RBLA 2PW1B 2IPTH 1QKZH 3G5XA 1GSMA 2YKLL 1AR1C 1SEBA 4K7FB 1MFBH 2YPVL 1ZVYA 2OP4L 4JVPA 4F8QA 1C5DB 4KXZH 4D2NA 1VCAA 3GSWB 1T20B 3HNVL 5F9JA 5IMKB 1UH2A 1MCSA 4HEME 1INDH 1KB9K 3O3EA 5CS7A 5DUPL 5L6YL 1UACL 1G0DA 1CTOA 3K4DA 3FRPA 4JRYB 4CVWA 2IQ9H 3U46B 4YGVA 1MPAL 3GSUB 4XAWH 1YZZA 4OZGF 1KCKA 2ICCA 4GLRI 4N1CA 1TJIL 3QDJA 5IVXE 1JPFB 3DUSB 3SHSA 4CJ0A 1JTPA 5E2WL 2BY2A 4U1GC 4Y5XB 1B0RA 1IMHC 2Y5TB 4NQCA 5EO0B 4XTRC 4KMTL 3PUCA 4GMTH 1ITBB 3RWEB 3MRLA 3KPSD 5IW1B 3BMVA 4XI5C 4NRYB 3K81A 1MCEA 3DROA 1HE7A 4YFEA 5E56A 4PGBB 1BJ1H 3AU1A 1DEEA 4MNQE 4QNPE 2ZUSA 1VACB 1EXUA 3GMNA 4NQDE 4NO0A 4D0BA 3EYSL 1FVDB 3S37L 3BQUD 3FQWB 4TNWK 5LXGL 3FT3A 5FYLH 3WMSA 1DLHA 1KLFA 1QQDA 4JANA 5IMLA 3TH4T 2DL9A 2NQCA 3ZE0F 4Z7UE 5SWSD 1T7XA 2XTLA 4JFEB 2VWEE 1F4XL 1JFQL 1DVFC 1IFHL 4KKBC 2UUDH 1HKLL 4LCIL 4XBPA 5EG6C 5C6TL 3PWPA 4FG6C 2R0LH 3JUZA 4W81A 2HTKD 4OM0L 3WUWG 2NTSP 4JAMB 3TNMA 3IJHA 3BRFA 5C08E 4RWHA 1B90A 3GM0A 3I6GB 3TWCL 1A9EB 1QBMH 1G7IA 2F8VA 1FLTX 3DARA 4Y4KB 5KN5A 1CFSB 3S36H 4IIQC 4QHKI 1WZKA 3GSQB 3Q5OA 3MGOB 1JNHB 4H26B 3UTPD 1UVQB 2R9HC 2B5IC 2EDXA 2H32H 2QQKH 4PGEA 3JZ7A 4L9LC 3BJ91 4PYHA 2VN7A 1JNLL 1KUMA 3QUXB 1WT5C 5ICZB 1MCRA 1T3FB 2PTTA 3FQNA 4LRIC 4IJ3C 5DWUL 2D31A 4KUCD 4MS8A 2GT9B 2YXFA 3MRCB 3S4SB 4XXDA 1IQWH 5AEAA 3BVNA 4I0CC 1WLHA 1R3JB 3F5WB 1W0YT 1EK3A 3NAAH 4J4PD 1P84J 1RZFH 3MUZ1 5F3HA 4LSSL 2QQLL 25C8L 2ZUQB 5LG1A 4DVRH 2VKXA 4NQVA 4GW1A 5C0BB 3RP1A 5FM5M 3DI3B 4Y16B 3QWQB 1SJHA 4R7DA 1ZSDB 4QHNB 5TE6L 4BH7A 4APQC 5EBWA 2GJ6A 1MLBB 4ZAKD 4XPFH 3MA7A 4OCMC 5JR1L 2C3GA 1GVIA 3SDCD 1JZ3A 1U95B 3QCTL 1MCHA 2VQUA 3E6FB 2X4TA 4JGMA 1AD9B 1BF2A 2VJXA 3ULUH 1H8NA 4NFDA 2GTZA 4HGWA 4LCWB 1KENL 1HHJA 3JV6A 4Z5RB 4CGTA 5JW4N 2FX9L 3VRJA 2F15A 5LJYH 2VZSA 3MCG1 4ZFOA 4Y5VB 4EUPG 5ESAB 4WW2B 4RAHA 4L29A 3QO1A 3OR6B 1XGYH 3QCUH 1X5XA 5T1DH 4UI2A 4O00A 3MYZA 4MZ3A 1QEWB 4R9HA 5CUSL 4R4FL 2FCBA 5HI3D 1YMMB 2IAMA 3JWNC 3RGHA 4LU5L 5C2UB 5I1GH 2NYYD 3ES6B 5C0GB 3F8UB 2V2TA 4EDXA 2WIMA 2GHWB 3WNKA 2BNQD 4WU5B 1S7XA 3L5HA 2VN4A 1JHTA 1P4BH 1LO2L 4HFUH 4KHXH 3MROA 1N5AA 3OR7A 4WEMB 1A47A 3LD8B 2IH1A 5I1AA 1I7RA 3TJHC 3EYVA 3MV9D 4HCRL 3MRKB 5E8NA 1EHXA 3UBXA 4F7TB 4HK0A 1YEJH 1BHGA 4QRRA 4KHTH 3VI4E 1BJ1J 4XNXL 1N7ML 5FCSH 3O4LA 1EDQA 1SM3H 3CIQA 4ODVH 4AQ1B 5DRWA 5D7LB 2BRRH 3C5SB 4DN3L 2MHAA 5D1XC 4FQ2H 1EGJA 5E7BA 1LE5B 4FTVB 4H5SA 2UWEF 1T80A 1AP2B 2VZTA 4XVUC 1NPUA 3TBSB 1I1AD 5BS0A 4DKFH 2L7UA 1FYTA 4UU9B 1VEMA 4TVPD 3DXAA 2AK4B 2FLBT 3SE8L 3KXFB 1UZ6F 5D2NB 4JFQB 4FQXC 4X4YA 3MZGB 1IL1B 2HVKB 2MCPH 3EJYC 5D7JD 1SEQH 4TUJA 5CEZD 7FABH 2QQNL 3CLEH 5DJDA 4Z7OF 2ZG1A 3PHSA 3RRQA 3VD3A 1B4RA 1T6WA 1IC5H 3IF1B 4NHCL 5GGTH 3BUTA 2X41A 4X9IA 5E1HB 4JY6B 4DOHE 5JIPA 3IDMB 3N9GH 3SKOB 2XOTA 3MA9L 1JPST 1KIPB 2QSCL 2AQ3A 3DWTA 1B9ZA 1CE1H 1HN1A 4PP2B 1FNLA 1ZAGA 2X9WA 2F53D 3IJYB 3VA6A 2Y6SD 4L8SA 3G5XB 2YN3A 4LHQB 2VL4A 1SJXA 5DC4B 1ACZA 3QIUC 3LVEA 3UTZA 1J11A 5SWZA 1P84K 2HFTA 4JM4L 4HUXA 5J13C 4N0UE 4Z0BH 1GGIH 2MQ3A 2IWGA 1UJ3A 3RY4A 1YJDL 2OZ4L 2KBGA 2Q6WA 3BD3A 5HSFA 4TTGA 3O3EB 1WGOA 2R29L 2BNUA 2XRAH 2N4IA 5BQ7A 1RMFH 4E5XA 3LOWA 2HTLC 2NLJA 3RWCA 1A3LH 4LVOC 4GKOA 1CGVA 1FORL 4YGVB 2J8HA 1U3HC 4M7LH 4PLKC 1FIEA 4RDQF 2KZWA 3D85B 5C0CE 2P5WE 1ZLSH 4GW5B 4YE4H 1W72A 4L4VA 4NQCB 2PO6A 5ANME 1Z9MA 3GI8L 2BRQA 1X5AA 2YN5A 3SDDC 5A40E 3QCVH 3ZE0E 4AIXA 5ISZA 3MRLB 3IDUA 2VLKD 3MFFA 4BSVB 2DLHA 3DROB 4N0CD 3SKJH 1R5IA 3TVMA 2V5RA 3T4AA 3AU1B 4KK9C 1DEEB 3DO3A 2YA1A 1EXUB 3GMNB 4NO0B 4D0BB 5ITFA 1YNKH 3DI2B 3EZJB 1S9YA 2AI0H 3FT3B 1QQDB 2VLLA 4JANB 5IMLB 1G7HA 2KQMA 4GFTB 1EHLH 3HNTL 5L2KB 4NN6C 1UH4A 4XBPB 3PWPB 2BOBB 3NCJL 1SBSL 3O6LH 3D1MC 2DJUA 4D9RD 2DICA 3TNMB 3HI6L 2EDBA 3IJHB 1PY4A 3VGBA 4D9QE 3RTQD 2WBWB 4LSPL 4Q7DA 3RJQB 1GIGH 5IFJA 1X5JA 1TVDA 5KN5B 1NMCB 3IGAA 4N8VA 1JUFA 4P23D 2LTQC 5B4MC 3GDBA 1U0QA 4YHPA 2CKBA 3G04A 5DRNA 4PGEB 1F13A 4N8PA 2M2DA 3K8MA 3GHBH 4NO3A 1BFTA 1X5FA 1Q8MA 5E8PA 2NX5A 1LQSR 3WFHA 2PTTB 3FQNB 2B7DT 3QZWA 4NKIH 4MD4A 1O7SA 1DQDL 2OL3L 1GJIA 4KTEH 3QUMH 4XXDB 3LIZL 2H1PL 5HHVH 2FZ3A 3BVNB 1Q1JL 3TO4A 4QTIL 2AGJL 1RZ8A 4LAQL 5IB4A 5KSVA 1F11A 4IRSA 4PJGA 4KKLC 5F3HB 1KCSL 5E2JA 4UILH 4OLUL 3RIFF 4LKCA 2IBBA 4GW1B 1CE6A 1KIQA 3JV4A 1S7SA 1B6DA 1NGXA 1J1OL 2EE3A 3GKWH 4LPYA 1A6ZA 5I8OH 1SJHB 4R7DB 1YEIH 3O11A 1SHMA 5JHDA 3NACH 3ECBA 3IFNL 5EBWB 1BAFL 2GJ6B 5GHWL 1L9MA 4U7SA 3MA7B 1G7LA 2R4SL 1U42A 4YFLI 3BX7C 1VFBA 3WIIH 3NH7H 2X4TB 2C3WA 4FXGA 2LU7A 4HGKC 5MENE 3BOVA 1U36A 2N7BA 4WNQA 2GTZB 4G6AD 4HGWB 4PUBL 3X17A 5K9QG 1HHJB 3JV6B 4PBVC 5FHAH 3VRJB 1M05A 1G6RH 1H3GA 4ZFOB 5EZIL 4OCWH 3IAQA 3K4AA 5TQ2H 4V2CB 4L29B 3QO1B 1A8JH 3VGEA 5HHXL 3BKCH 4YX2L 4NC1E 1ORSA 1KPVA 5EUOA 2IAMB 5ESVA 4P2QA 4EDXB 5CJOL 1OAUL 4S10A 1YEGH 1S7XB 2AJUL 4EI5B 1FRGL 4GS7C 4H8WC 1JHTB 1ND0A 3VH8G 3MROB 3LZFL 1N5AB 2DKMA 3OR7B 4J8RA 4KI1A 4OV5A 2IH1B 5I1AB 1I7RB 3EHBC 3GI9L 3EYVB 2NXZC 5FGCB 5I9QC 3E2HA 1NDGA 3UBXB 5B39G 4HK0B 1A7QL 4QRRB 4WI8A 4PJBF 4JR9H 1J87A 3O4LB 5A3IC 3SCMA 5DRWB 4Z7OE 1CXKA 2MHAB 3PWLB 5EC2A 5EU7C 2KUTA 1I3GH 3GK8L 5D4QA 4BZ1H 2LAAA 3AY4A 1EPFA 4H5SB 1CI5A 5BS0B 4NM8L 1FYTB 2FEDC 3DXAB 3LRHA 3PQYE 2PNDA 2ZCKL 2WQRA 2C7UA 4PBWD 2Q20A 4X4YB 5TDOA 3KHQA 3GIVA 4NUGL 3JWOL 1MHCA 2CKNA 1E4XI 3HC4L 2EE9A 4WHTA 2XQBL 5F1NA 2I25N 2NY6B 2R1WA 4WUKL 5EDXA 5K9JH 1KELL 1XCTA 3BZEA 4G8GD 4D94A 3ARWA 4PP8C 3BDBA 4K3EL 1RZKL 4HC1H 1YYML 4XC1H 4NQEE 4K8RD 1YQVL 1OGAA 5E8DL 3ARGD 3N85H 1QBBA 1JP5A 1PG7W 3ARZA 3QXDA 5T1LB 4AG4H 4XCNA 2GEEA 2UZIH 43C9A 1I85C 1FZOA 4N90E 4L8SB 4XHQA 3GSNL 1ZHNA 2DIBA 3RWIA 2XZQH 2BVTA 4RIRA 1J5OL 3VFVA 5JPMA 2PYFA 3HS0B 1OAQH 4LOUD 1CT8A 3UTZB 1PW3A 5SWZB 3U4BH 1OL0A 1RIUH 1XIWA 1OW0A 5C09A 2G9HA 5BVJA 1P7KA 2X42A 1Y18A 3CMOL 3DSFH 1UYWH 4ODWA 2Q6WB 2WBJD 1RURH 3LKPA 1KC5H 2BNUB 5BQ7B 3PWUA 4R8WL 4JFHE 4E5XB 4HIIB 2NLJB 3RWCB 3ZT6A 2R0KL 1RK1A 1IGIL 1S7TA 3MUHL 3MLXL 5GS2D 2ARJQ 4GRWF 4K94H 2ICWA 2ZG2A 4HXBH 5IUSA 4YZFF 4LHUG 5A2JH 2BJML 1W72B 4FMFA 4L4VB 5LWYL 1D9KD 3NCMA 4G6JH 2PO6B 1UADC 1IZKA 1ZANL 3HZVA 5DQ9B 5TPWH 1P7QD 2Q3AA 1HWGB 2HH0H 4W6YB 2VDQH 2E27L 1U92B 5ISZB 4JN2B 3BP4A 1A7PH 1NEZA 5SX5H 4EN3C 1IGYA 2DQCH 3UBXI 3MFFB 3T3PF 4ENED 2X70A 5F8QC 2L0DA 1F90L 1I1CA 3NABH 1R5IB 3TVMB 3GIZH 3T4AB 1T83A 1BD2D 4PYGA 4R90H 4JPVL 2IPTL 5D1ZA 1QKZL 5CAYB 3KPNA 3NVQA 5ITFB 1J0IA 1NBVL 4KWUA 1S9YB 1NH6A 1ITCA 5C70A 1MFBL 2AJYL 4GRLD 4M8VA 2VLLB 3RI5F 1G7HB 1U8OA 4M7ZC 3MLUH 4KJQD 5EZLA 5IESL 1R5WA 4UV4H 3MBEC 1YNLL 5FIEA 2FEEL 2APXA 3RAJL 2A6DA 1IAII 5EORH 3OGOE 4OF6A 2QADD 1BWMA 4XHJC 5I8CA 4BZYA 2IQ9L 3D18A 1R24A 3DMMC 4XAWL 2APBA 5IFJB 1JZ5A 1BVKA 2WBKA 4GSDH 3IGAB 2XG4A 1MAJA 3S96A 3V52H 1AHWC 4N8VB 1Z0NA 3NA9H 3LV3A 4YHPB 2CKBB 3G04B 5DRNB 2W0KA 4NBYB 5C0IA 3O2VH 4NO3B 2JB5H 4PLNC 5E8PB 1TVHA 3ULVL 3X14A 2NX5B 3MOAH 4P5TC 4NZTH 4GMTL 3WFHB 3EYOB 5I6XB 3QZWB 4FFWC 5F7WC 4MD4B 4NQXA 1EVTC 3HR6A 1AJ7H 3LMJH 3AM8C 3QEGH 1RZ8B 2XY2A 5IB4B 5KSVB 1F11B 4IRSB 3UTTA 4PJGB 2K7QA 5FO8A 15C8H 4PJ5D 4QGYA 5M7QA 4BUHA 1CE6B 3JV4B 4NC1C 1NGXB 1GH7A 5FYLL 1A6ZB 4NCC1 1A1NA 1IM3A 1U58A 3O11B 1EEQA 5JHDB 3ECBB 5EWIH 1NCNA 3U2SA 1JZ7A 3T2QA 1G7LB 4TPRH 2E9WA 5DMKA 1FL6A 3B3IA 1VFBB 4POYA 2LU4A 2PN5A 1IVLA 4FXGB 4TRPL 4WNQB 3S5LA 5C0JA 3WUZA 1MEXH 5SX4I 3ZL4H 2EDTA 4I9WD 2DLEA 3TN0C 1M05B 1QBML 4MCYA 1Q0XH 4WY7H 3S36L 1MNUH 2EDQA 3N1FC 3BZDA 5F72S 2QQKL 1ORSB 1FAKT 1WAAF 4P57A 1A9BA 3LEYH 1KPVB 5EUOB 4X6DF 5ESVB 4U1MA 4P2QB 2ATKA 5DJZA 2CIIA 1KG0A 4WFEE 1ACYH 4ZODA 5MHSE 1ND0B 2N56A 3QIWA 4J8RB 4Y4FC 1CL7H 2BNRA 4OV5B 3NAAL 4WRLA 5DD6A 2GCYA 5GRYA 4U1JA 4GAJH 4EEEA 3E2HB 1NDGB 3V4PL 3WFZA 4EDWH 1OAXL 5I71C 3BMWA 4LDLB 4YR6A 5D96B 2VLRA 5CJXA 5EC2B 5I75B 2CLRA 4TNVF 2DF3A 3E3QE 2XT1B 4A2MA 5FYKE 4RX4D 3T77A 5I1KH 2YRLA 5I1DA 4J3XA 1FJ1A 4XPFL 5I1EH 2YUVA 1IQDA 2C4FU 3QYCA 1J8HD 2IGFL 3ULUL 2C7UB 5TDOB 5B38G 5F6IC 3GIVB 2Q87A 1D5ZA 1MHCB 4GUPA 4LRNH 3T0EA 5HHOE 3RVTC 4U6VH 2NY4B 1T2QH 2HRPL 4WHTB 5F1NB 2XTJB 3V8OA 3IS1X 3ZZ1A 5AG8A 3VW3H 1XCTB 1XGYL 2FECL 2R69L 3QCUL 5CJ8A 2O61A 5T1DL 1CXFA 4WJ5A 4POUB 1WIOA 3KYNA 1PKQE 4U2ZA 1NFKA 2PF6A 5I1GL 3OQ3B 1CD1A 1OGAB 1FGNH 4JE4B 4XP1L 3QXDB 1MRCH 4NN5B 4RAVB 1P4BL 4XCNB 1RVFH 4HFUL 4KHXL 2NY3B 1OWRM 43C9B 1FZOB 2Z8RA 1T6VN 3MR9A 4PJXE 1ZHNB 4K55A 2F54A 2ZCLH 2WWMC 3RWGA 3H9SE 4ZPVA 3VFVB 2HKHH 2PYFB 4P2RA 4UINH 4KHTL 4OCXL 1CT8B 4R97C 4G6FB 1SM3L 1XIWB 2BRRL 1BIIB 1TVBA 4P46A 5C09B 5BVJB 2J8OA 3QUYA 1P7KB 4FQ2L 1Y18B 4ODWB 5ESQB 3UTSA 3CPLA 4M1DH 2DM2A 4N9GB 3DUUA 1FVEA 3LKPB 4DKFL 1AR1D 4HMEA 2XN9D 2E3VA 4K7PX 2E7BA 3PWUB 5FO7A 4P3CH 4V2BA 3WNNA 1RK1B 3T3PE 1O7VA 1S7TB 4ZFGL 3BE1H 4G7VL 3MV7E 3RNKA 4HX1B 4FFZH 2M1KA 2MCPL 2ICWB 1SEQL 7FABL 2DQIH 4AIZA 3Q1SH 1NQBA 3PDDA 5J11C 3HAEG 5GGTL 1YQ2A 3HZVB 3UYRH 1KJMA 3CZFA 4YFLF 1MFDH 4X7SL 3BP4B 3N9GL 1NEZB 1PLGH 1IGYB 4YNYA 1TZGH 3JTTA 2F8XC 2VXQH 2X70B 5DI8A 4HUVA 3QFJE 1CE1L 1BJ8A 4HJ0D 2AS5M 4ZO8A 4XWGL 1K4CA 3MODH 1PG7L 1L6XA 3IDIA 4KMLB 5BW7C 3NZHH 4XMPL 4XTRD 3FHAA 4NPYA 4PDCE 5FA4B 1F58H 2ZKHH 5D1ZB 3KPNB 1JTTA 4U0RB 1A6PA 3D5OF 4Y5YA 3SJVA 4XI5D 3SQOL 3V6BR 5SX5K 3KYAA 1YEHH 3EOTL 4Z0BL 5EZLB 3SY0A 3UMTA 2WQ8A 2NY2D 3VFPA 3U9PL 2Q3ZA 1TJHH 2HN7B 4JFFA 2BMKA 2A6DB 3RDTC 2PETA 5HPOA 3HG1E