3GSXA

Crystal structure of the binary complex between hla-a2 and hcmv nlv-t8v peptide variant
Total Genus 78
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
78
sequence length
274
structure length
274
Chain Sequence
GSHSMRYFFTSVSRPGRGEPRFIAVGYVDDTQFVRFDSDAASQRMEPRAPWIEQEGPEYWDGETRKVKAHSQTHRVDLGTLRGYYNQSEAGSHTVQRMYGCDVGSDWRFLRGYHQYAYDGKDYIALKEDLRSWTAADMAAQTTKHKWEAAHVAEQLRAYLEGTCVEWLRRYLENGKETLQRTDAPKTHMTHHAVSDHEATLRCWALSFYPAEITLTWQRDGEDQTQDTELVETRPAGDGTFQKWVAVVVPSGQEQRYTCHVQHEGLPKPLTLRW
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HLA class I histocompatibility antigen, A-2 alpha chain
publication title Structural bases for the affinity-driven selection of a public TCR against a dominant human cytomegalovirus epitope.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
total genus 78
structure length 274
sequence length 274
ec nomenclature
pdb deposition date 2009-03-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00129 MHC_I Class I Histocompatibility antigen, domains alpha 1 and 2
A PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3gsxA02
3.30.500.10 Alpha Beta 2-Layer Sandwich Murine Class I Major Histocompatibility Complex, H2-DB; Chain A, domain 1 MHC class I-like antigen recognition-like 3gsxA01
1DQJA 3O2DA 3S6CA 2AXGA 3OB0H 3OBAA 5BS0A 3EYUH 2PYEB 1BD2D 4JGUA 4Y19A 1NBZA 3ZTJG 5E8OB 3GBNH 5DURB 4KPHL 2UY6A 1Q0YL 3BKYH 4GQ9L 2XZCL 4PB9H 2GIYA 3ARFD 5J6HA 3WXWH 3EYFB 3BEVB 1QBBA 4P46A 1INEH 2GTZB 1PG7X 1N7ML 4G8IB 2R8SH 1T1WA 5FYLH 2CR6A 1OT1A 3CFBA 2DKMA 3RIAF 3B6SA 4H25A 2ITDA 2NNAA 4WEMB 3KYKL 3U0TB 1T0NB 2ZNXA 3HNSH 2GW5A 3MBXL 1R3KA 1F3DH 2HFTA 3DURB 3FN0H 1DLHA 3TJHD 4TOYL 3U82B 1KPUA 4PJGA 1RZIA 5E5RB 5T1KD 2AV7A 1N2RA 4G6KL 2DD8L 4ZPVB 2HJFB 5LVEA 2J8UA 3UC0L 5E95B 3GMOB 4LP4A 3SE9H 4BSJA 4MJIE 4F7TB 1R3IH 3OKMB 4OFYA 3KXFD 3GNMH 5IHZB 2NXZB 3JTTB 3QI9C 5GGUB 3GMRA 2EECA 3O45A 2C5DC 5MENE 5E1AA 4HWBA 2OJZL 4RNRB 3ZE2E 2B4CH 5I1IL 3PWJB 1FZJB 4JN2B 1CZ8L 2ZUTA 1GXEA 1FIGH 5GZOD 4PREB 3IJSB 5F9DC 3L3DB 5BV7L 3CCHA 2VZ3A 3LKQA 5E6IB 2FJHA 1UVQB 3EO9H 2AJSL 3BE1H 3RA7L 2UVEA 4MA1C 4X6CB 1HH6A 2BCKB 5LWYL 4OZ4A 3QUKB 2J88L 3QEQD 2DBLL 4KJWD 3EZJB 5D1QD 1S5HA 1HINH 4M3KB 1TNNA 1CLYL 3HS0A 4DKDC 3NIGF 2IH3A 1PQZB 2P7TA 4WFFD 1F13A 2IANA 5C0CD 3LEVL 1TJHL 3GSNL 3DX8B 5BZWB 3ZSSA 3KPRE 5DK0B 2CDEB 2CLRB 3HKFA 4PV9B 4YHLH 4HQQL 5IQ7L 1BREA 2Y9RT 3B9KC 5ENWA 3BHBB 3FRPG 5D6CA 1MI5A 2ICCA 3U46B 2QL1A 3V4UL 2XN9B 1VGKA 3KYMA 2C26A 4QHMA 5E00B 3N1MC 5FUZH 4MCZA 5J1TC 3MV8D 3E0GA 3O11B 1PY4A 1DVFB 3KR3L 4MCYB 3HE7B 3RWEA 1TPXB 2Y07H 3SJVA 1OCWH 4OB5L 3TH3T 5C0ND 3FQRB 2AJXH 5KN5B 3KPSB 1ZHBB 1I9JL 4PRPB 4RSVA 2X4NA 1QQDB 1JGVL 5T3XD 3GRWL 4HIJB 5DFVC 4EI5B 2NXYC 4MJ2A 3CGTA 1A5FH 1YEGL 2Y5TB 4P4KB 5ID1A 3RQ3A 1JPST 5J11B 1S7XA 2H26B 2P5ED 4TNVF 3H3BC 2UZIH 5HHNA 4Y4FD 1P6FA 4DUVA 3R4DA 5EOCH 5C09E 4AJ0A 3E2HB 1JZ4A 3IDIB 3KLAA 5J6GA 3A6BH 3MJ7A 3HC4H 2ERJC 3MA9H 3PE9A 5B39G 4CVXA 5DRZB 4HFUL 1RFDL 1IILE 2BSED 1KN4H 5F7FA 3FMGL 1PG7W 3LEYH 3WO3B 5F21B 1HSBB 4D0BB 5IFJA 4R96A 3WE6B 1X5IA 1AIFA 3DUUB 4XMPH 5D5MF 4UOW1 4LCIL 1DLFL 5EB9A 5GS3A 4DUXA 3WL9A 4MHHI 2XV6B 4EJ1C 4EIGB 4PJBF 4KRPC 5TE7L 3WHXB 2E7BA 3MLYH 1QFWI 4ORGA 1V3KA 1Z9LA 2D7PA 3VXRA 1GGBL 2K7QA 1P4BH 4Q9QL 5C0DA 5J9PB 4JFEB 3K4ZA 2VJXA 1W72L 4LHUD 4P3CH 3HTLX 5EPMB 5KSAA 2QQNL 4F7PB 4UU9B 1OAUH 3EGSA 4U3XA 1I8MB 2X1QA 5I17B 4ZSOE 1FYHB 5C0BA 1LDSA 1C12A 1R24A 4Z76B 3U30C 2BP3A 4JFFA 4XPTH 1I9RH 1QLEH 2HYMA 4APQC 5JZ7D 5EUOF 1MPAH 3P0VH 4WENB 4J6RL 3WIFA 2GJJA 3OJDB 4OJFH 1WSST 3MLTB 4UIMB 1DBMH 2OK0H 4PRBB 3FO0L 2VH5H 4GAJL 4UBDC 2ADIB 1P1ZB 2P8LB 3U48A 1ROWA 3MO1A 2X4PA 4HH9A 4RX4D 5ISZB 3HPJB 3QWRA 3TPUB 4WI6A 3LHPH 1WBYA 4NM4L 5I16A 1WFNA 1IAIH 4N5EA 3QG6B 1FGVL 2VDMH 5EC1B 1NAKH 3V7MA 1JPSL 3PWNA 4J3UA 2PO6A 3VFNB 5DD5H 5EBMA 1OGTB 4ZPTB 4CKVX 3MFGB 2GK2A 3D3VE 5JOFB 5D7LE 5LG1A 1KSRA 1A9EB 4WW2B 1TJIL 4P3DA 5HPMB 4JY6B 5KSBA 2HFEB 1T7VA 1CQYA 4AL8H 2G9HA 4DZ8B 2J6EL 4V2CB 3CPLB 2IAMC 2X4SA 5I1DB 2IG2H 3UP1A 5JA8B 4PDCE 1AJ7H 1TNMA 5FKAA 3TT1H 3RWHA 4MNHB 2YD3A 4MJ6B 4OLZL 4ZUVB 3QHTC 5JW3L 1XR8B 1K4DA 3VH8B 5DI8A 1P4LB 1SJVA 2F5AL 3IJYB 4XPHL 3HE6D 5MI0C 2A9NH 4JQIL 2VIRA 5TDOA 3QUYD 5SWZB 3PWPB 3BH9A 1NCAL 4JANA 3SDXE 5IV2A 1N6QL 4TTDC 3QCUH 5ITFB 1VADB 4FQLL 5DYOB 3NACL 3CUPB 4XRCB 1MCPL 3L3KB 1T89A 1UC6A 2HTKD 4NJ9H 4ZXBA 2ZPKH 4NO3B 1Q9LA 1XGYH 3VG9C 2Z31C 2PKDA 5JMOC 1IBGH 3EYOA 4ODXA 3GBML 4G9DA 3GI9L 4MB5A 5CSZB 4JKPL 4ODWA 3X3FL 2GQHA 3BKCL 1BBDH 3MUZ1 3JV4A 1J1OL 1GZQB 1JNLL 2AQ3A 1SYSB 3EFDH 4TQEH 5CD3B 2H9GA 3I3EA 3MBED 4S11A 3P11H 4X6DF 3F7YA 5HTSA 4NHUE 3TLRA 1KGCE 5KTEH 1S3KL 1X6NA 1B0WA 1G7LA 4U6YB 4M02A 5I1GH 1U3JA 5JHDE 1YEHH 1TTFA 1IM9B 1ZEAH 5GGTH 2DBJA 3NABL 4MXWH 2COQA 2YKLH 1LE5A 4FQ2L 1CT8A 5I8OL 3IF1A 4L29B 4UQ2B 2SEBB 4EUPG 1BX2A 3RTQB 3KPPB 4YPGA 3HC0B 1S7SB 1J0ZA 3O6KH 4OBSA 2Y25A 2K7PA 3DIFB 1MFEH 4NQDD 4L4VD 3TO4C 4QRRD 5DMKA 3NIDE 1R3JB 4YDIL 1J05B 2QQQA 5LCVL 4Q6IA 3TH2T 2EIZA 4KTEH 3IU4L 3MV01 1AXTH 3OZ9H 3QO1A 5IMOA 5C0GA 4QRPB 4JM4L 4EBQH 1NC4A 3IETB 1BZ7B 4N0RA 3HLAB 5FA4A 2D9CA 1YEIH 4H1LB 2OL3L 3P73A 4XZUA 1RSFA 1HSAA 2E9IA 4MJIA 2ZWLT 4L8DB 2AJ3A 1CFQB 1IEAA 5T1DL 2QADC 3PGFH 2IADA 4FZ8L 1I3GL 4G42B 4NDMA 3QQ9D 5MENA 2AK4E 2XTJD 2X7LB 5DXWA 4HK0A 3I9GL 1NKRA 1S7TB 4RFEB 5D7IB 1RMFL 5JXED 5FAAA 1NUGA 1NBYB 1M05A 3KS0H 1BVZA 1F97A 2XQYG 4QRQB 5E5UB 4KK5D 1TTUA 3MRQB 3QNYB 5HI3C 1A6UL 1AGFA 1EIBA 1Q8MA 3WHE1 2XKNB 3ILQD 1T21A 5C3TA 3ZDXF 2ENYA 3PP3H 4U31A 5T3ZL 1B90A 4S1SH 1NEZG 3RY5A 3VDBA 2YA1A 1JNNL 3QZWA 1F45A 1MCLA 4JAMB 4OZFH 4YHIA 1HCFX 2Y6SD 4F15B 1F2QA 2BVUA 1N8ZB 4U1SB 1G7JA 2XXCB 2V6HA 3GSWB 3A67H 1YPZE 3V5DB 4LDLB 4UDUA 1KJ3L 4Z0BL 5I73C 4S1DD 4WFEE 1ERNA 3MOAH 1YY9C 4UDTA 2Q8AL 1JRHH 5E08L 5IOPB 4URTB 2DN7A 4HJGA 3EDDA 3W39A 4QF1B 3KPRA 1V3MA 5ADOH 5D1ZA 3T2NH 2HLFC 4WWID 1RZKL 1JHLH 2HWZL 5TQ2H 1MAMH 1TVHB 1FORL 3MV9B 1KTRL 1A3QA 3QUXD 4N0CD 2DWDB 4POZD 2QBWA 3ARGA 4LSDA 3SDDC 5FB8A 1S7VB 2PCPB 4LEOA 1E6JL 1MCWW 1G6RA 2R0KH 2VRAA 4LCCC 4JR9L 3CAFA 3KPMA 3CFEB 2VDNH 3OKNA 4LP5A 4LLMB 3IDXH 3WYRA 1NL0L 4ZFOB 4V1DB 2AJZA 4X9FA 1F4WL 1GZPB 5DEGA 5HVGB 1I3RA 4LSQH 4OZIE 5E2TL 4H20H 5IKCA 5IK3A 2OR9L 2RHEA 3QA3A 3NFNA 4LPVA 3H0TA 5J13C 1WZKA 2VXVH 5C0IB 3ZDYE 5H35B 5C09A 1CDCA 1TZIA 1MCDA 2C3VB 3U0PA 1TJGH 2VDKH 1B88A 2Z4QB 2I25N 5C0FA 3CNKA 4HGKC 7CGTA 2AEIT 1RZ7H 1CK0L 1UB6B 4NNPL 1QKZL 1S7UA 5F1KC 1YJDC 35C8H 2JJTC 5GGTA 5FECA 4S1QL 4YDLB 4P2OA 4X5WB 3MPCA 4H8WH 1LO3H 4HWUA 2OZ4L 4PLJC 5BRZD 1B3JA 3OKOB 4R26L 1JZ8A 1U8HA 2H8PB 4QRTA 1P9MA 4L8BB 4EIZC 5EOQH 2VL5B 3IDJA 4PJ9D 4LF3A 3BGFB 4HK3N 4FQQA 1NC2B 1T4KB 4ZO8A 3X3GH 2YUWA 5JR1H 3RL1B 3SE3C 5HHOD 1C8PA 1J8HB 5E9DE 5F93C 3S96B 1EFXB 3P77A 5TE6H 1E6OH 4JEGB 3P3YA 4XVTL 3QDJD 4NN5B 4UV4L 1DVFC 1BEYL 5DGRA 2E5EA 1TPXC 1RJCA 4JE4B 3FQTB 5GSRB 5DRNA 1KTKE 4X4ZA 4ETYA 1IAII 2D03H 4QHUB 3WXVH 3LS5L 3VXTA 4ZSOA 1MCWM 3MRPA 3RU8L 4P4KC 3V7AE 4GMSL 3IDMB 5J11C 3OG4B 2O5ZH 2HMIC 3DECA 1RV6X 1VFAA 2CK0H 1XR9B 2A9ML 1AGEA 3QIWB 4GBXA 5K33A 1CFVH 2PXYA 4R97C 4DGYL 2A73A 3E2HC 2AABH 1TZHA 2W9LA 5DS8B 4P2QD 2AXHA 4P2YA 3J7HA 3HI5H 2D7OA 4NKIH 1FNEA 4K8RH 5FHBH 1K85A 5T33L 1T1ZA 3TGXA 5B38G 4S0TD 2J8OA 5D1XB 3ZHKA 1FLRL 2J8HA 3TIDA 1RJZA 3C8KB 2W9DL 4UINL 3G6DH 1CGTA 1GRWA 1U8LA 2H2PD 3ARXA 1I7UA 2EDEA 3D3VA 5D7LA 3RDTA 3OKKA 4ERSH 5GGVH 3SO3B 3RL2B 1A0QH 1AXSA 5DFWH 3BZFB 4G6AC 1YECH 4XBGB 1CG9B 4JG0L 1JWMB 4IDJH 1GOGA 4PY8J 4Y19D 5BZDB 5KBNC 3L3HB 2OYPA 1VFOA 1PY9A 4C56B 4NUJB 4OCWH 3IFNL 1U8QA 4DQOH 1E28B 3DUHA 4I1NB 3MLSH 2R39A 1F58L 2EEBA 1RIVH 5A3ID 1BLNB 4P46D 4IBLT 4JPWL 5I1EL 4X6EB 3C2AH 3WD5H 2X4OB 4KJQD 3SDXA 4EQ2A 2FD6L 1TVDA 3TCXA 3BT2L 3SKJL 2G60H 1QPXA 1X3DA 5F89A 5H37H 2F54E 4PG9B 5CP3H 5F1IA 4QKXB 1AI1H 3RGVC 3U4EA 4OCRL 4P5TC 2GAZB 1DBJH 3KPOA 4WW2F 3GSOB 2HG5A 4NWTL 1T20B 3BZ4B 4XPAL 2Z8WC 3OXRA 1MHCA 2CLVA 3GSXB 5I15L 3DX6A 4ZUSA 1QLRA 4OFYD 1M71B 4Q2ZA 2F53B 1MUJA 4AM0B 3BPOC 4ZS7H 3MLVL 3C8DA 5LAXB 4LPUA 2FH6A 3B3IB 3EO0A 2YXMA 4FXKB 4DAGH 3DI2B 2Q3AA 4QOKE 3O6MH 4WW2C 2PTTA 4NHUA 1WCBB 4AH2B 4RZCA 1HKLH 2X70B 1CLZL 2X10A 3W0WE 5JHDA 5L88L 1U3YA 4MJ5B 1ZGLB 1DBAL 2MKLC 4G43B 5I0ZA 1XF3A 4YBQD 4IMLA 4G5ZH 4M7KL 2Z8SA 3FQWB 4J4PA 2JTDA 3GM8A 2VDOH 2OSLB 1OPGH 3NCFB 3U7AA 3RWCB 2Z8VC 1AGBA 5F1NA 3S37H 4YHOH 4U05A 2LU4A 2NW3B 1C5BH 3HNTH 3RVUC 5C6PB 2FL5B 3BP6B 1BZQK 1H5BC 4XCFH 5FUOL 3B8YA 3GIVA 3Q48A 4Z5RA 4OF7A 4CJ0A 3H9HA 4NUGL 3QUML 2Q7NA 5CILL 4M9PA 1S7QA 3VCLB 1WZMA 3UROR 3V6FB 3UTZA 4OIIL 3NZHL 1U8IB 4HKJA 1C08B 3MACH 4D8PA 1LEIA 5D7KE 2F8XC 1OARH 5KSUB 2ZUWA 4KMQA 5ALBL 2BOBA 4FFYL 2YD5A 2AK4A 2VZOA 2AGJL 2GJZB 3HFMH 4HJ0D 5DF0A 1T3FB 3GJFK 4GUPA 3VFPB 5HD8C 1L7TH 1MI5D 3MRHA 3CFJB 5EBWB 4JDZB 4XPFL 4YDJA 1JRHI 1WZ1L 3I6GA 4LFHD 4MD5B 1CGUA 1ZK9A 5CEYB 3SKMB 1I8LC 3U4BL 4K94H 4EQ3A 1RZ8B 2VLKD 3SJVD 1OTSD 5ACMA 1UA6H 3GSQA 2YD6A 4PJIE 5E2WH 5HYQB 2ICWB 3UZEA 3GIZL 3RAJL 1BOGB 3OAYH 1K8IB 4CDGC 1OTUC 3FFDB 5CGYC 1UZ6E 4QCIB 1R6VA 1QA9B 3RTQC 3NAAH 2JE8A 1YPZA 1DQMH 3QI9A 2HA1A 1MCIA 3HI1B 3B2VL 4MZ2A 5D2NB 4P99A 4KK8C 3G6JB 4MNGE 4HT1H 3RVTD 2DM4A 2PR4L 1RUKH 3VXUB 4M48H 1P7QA 4RAUB 4QXUL 1HHJB 5E2UH 3VI4E 3C5ZB 4HDIA 1QSZA 3GJFB 4K71C 5KG9A 5D7IF 2YC1A 2ZNWA 3G5ZB 1DBBH 1YMME 4RMRA 1QOKA 3PWUA 3MGOB 4ORZC 2WIIA 1QLFB 5F7DA 3VXQA 4WUUE 4Y2DB 4XXDA 5CP3A 2VDPL 4Z7UB 3VFMA 1I7RA 1A6VL 4JRYD 3VFRA 5IIEA 1J1PL 2GEEA 4LSRL 4KJPC 2YUZA 1UJ3B 4EVNB 3JWOH 1J86A 3AUVA 1IMHC 3T0EC 4HXAH 1MRDH 4RRPG 3VXRD 2P42B 3L3JA 4OZIA 1WGOA 1HILB 5BO1L 2R2HA 1MFCH 1U95A 2BX5A 4MA3A 4DN3H 4PLKD 2OI9B 5HGHB 3LN5B 4OD3H 5HVFB 1J1XH 3PG2A 1DUZB 3OL2A 5C0BD 1KBGL 1EEUA 1D5MB 4JFFD 3B9KA 1A6AA 1CXEA 3MA7B 4JCLA 1S9WB 2UYLB 3WN5B 3HZMA 3QDMD 4P9ML 2BMKA 3BH8A 3MRJA 4MX7B 4D0CB 2Z93A 5DQDL 5ABDE 5JPMB 5DMIH 4BSWB 1KJ2B 3QWRD 1Z0NA 2FH8A 2WW8A 4G6ML 3IKCB 5IBUB 4MA7L 5I1JL 5KANG 4N5ED 4NGHL 5FO7A 4CADB 1VCAA 5DR5H 2PO6D 3VD5A 5BOPA 4H5SB 1B0GA 3VD9A 3L3IA 5E9DA 2YD9A 2DLHA 2MQ0A 3TIEB 4LLUA 4X6CE 3QUZC 4XPBH 3ULUC 3F7QA 3VFWB 3BDXA 2IMMA 4YHMH 4YQXL 3BMWA 4OFIA 1SM3H 5GZNC 4M1CD 1MAJA 2XA8H 3QEGH 2ZSVA 5KZCD 4YFDB 3AROA 3F7PC 4MB4A 2X41A 2HLAA 2NY6B 5EU5B 4LOUD 2CMRH 3TN0D 3T3MF 3RZCB 1FGNL 1MJUH 2AKRA 3ARUA 5C08E 5DQJA 1DBKL 3TNMB 4JPIB 3FT4B 4OUUB 5DK2A 4EDWH 4FQHA 4GQ9H 2GT9B 3RP1A 1GAFL 3WLBA 1VEMA 4KZDH 4XH2B 4YDLC 3G5VA 2XN9E 4M7ZC 4J3XA 4NRXA 3O0RH 4ZXBD 3ESVF 3NCYP 3TPKA 3VXNB 3O4OC 4D9RD 2IQAA 1FG2B 4RFOH 3HI6H 1AGCA 3KLHD 2W92A 4POUB 4Q6YA 2OR8A 1I1RA 2YWZA 4PRPE 1A1NB 3HMXL 2O5XL 1IAKA 3BGFC 2DQFB 3F7VB 4HUKB 4KVCH 4XHJC 1OP5H 1QUNA 3WFZA 1BVKB 1JI2A 1WC7B 5HHVH 3OSKA 4QHLB 3PHQB 3CSPA 2D0GA 4OCSH 2NY2D 2NY5L 4GS7B 4NKOA 1X5YA 4APQA 3OKEA 3BQUB 2MKWA 1NFIB 4KK9C 5DSCA 2BHUA 2HVJA 4XBPB 4XMLH 4IS6A 1IQDB 1FC1A 4E41B 3E6FA 3PNWA 1D5XA 1JF1B 1AQDB 1X5KA 4H88L 1JTPA 4HKXB 3IDUA 1EFQA 2VDQL 2DRUA 2LFGA 4DVBB 1HZHL 3OG6B 3VRJA 1S9XB 4YE4H 4TVPL 3ZTNH 1JP5A 1F3RB 4LARH 5CGTA 2ADJB 3NA9H 4JN1H 1IAOB 1M1SA 4RMSA 5F72S 3IDYB 3ULSA 3UYRH 2F54A 2R56H 1KIRA 3AM8C 2EKSA 4PV8B 3ORJA 4FABL 4X7SL 4J3OC 1NC4D 1HDMA 1K5NB 3RA7H 2J4WH 3U1SH 3HZYB 2IAMA 3HZVA 2JB6B 4Q97A 2HP4A 3MRGB 3SKUD 2NZ9C 4JFEE 1IT9L 4DWHA 3V8OA 1YEKH 3STBA 1WITA 4HC1L 4KRMB 3HR5B 4QXTA 2I9TB 2D4DA 5MEND 2F9BT 4M93B 4MA8L 1S9YB 4QOKA 3DSNA 3LEVH 1JGEA 3DRTB 1ZSDB 2DI7A 5IBLD 5EG6C 2ICWI 4KVNH 2OJEA 4X8JB 3W0WA 32C2B 3JV6A 4HQQH 4K23H 5JNYA 2CKNA 4FNLH 2NLJB 1KCUL 3DUSB 4MDIA 3ZKXB 1MRCH 2XZAL 3OPZL 1JTOA 1UM5L 3V4UH 3HHRB 2KPNA 2AJUL 3MZGB 2Z31A 1WWWX 2YS4A 3DO7A 3FQXA 4C57C 1XMWA 3DVGA 4RA3A 2BSSB 3QFDA 5KS9B 4BFIB 4NJAH 4ZUWB 1HEZA 4XGZB 3QPXH 4HPOH 1C7SA 2HT2D 3RFZC 3LQAC 3CU1A 3RWIA 3OGOE 4HWEL 4IRSB 1IAMA 3DGGB 4KQ3H 2X2YA 3Q6GL 3U79A 4JFDB 4YDVB 2BVTA 3L5WA 1A6TB 4QTHB 2IPTH 1CICB 4JZJB 4L5FH 3MUJA 2ICEA 1YEGH 3GSNB 3CIQA 4XNXL 5C8JB 1JJUA 1FVDA 2CUIA 1T0MA 5JXAL 1AO7D 2MHAA 5AUMB 4FP8L 2AV1B 3NTCL 1T2QL 1I1CA 5MEQB 4RWHA 1EVTC 4LPXA 1JUFB 3KPRD 1LO0L 4F58L 3BPNC 3I2CH 4YHZH 3MXWH 2HRPL 4O4YH 5H94B 4MQ7B 4IM8A 1AC0A 3HUJB 3DHJA 4GKNB 4XP5H 5FYJU 1BBJA 1R3LA 1LEGB 2QSTA 1FZMA 1V7NL 4OAWA 1CF8L 4RAVB 3S3JA 3VFSB 3TO4A 4CRPA 4U1LA 2HKHL 2P5WD 4X4YB 4PJIA 3MRCA 5MHSE 2VABA 1T5WA 3BW9A 5F9WB 4R7NA 4H26A 4JFZH 5JO5B 2OCFD 4WNQA 1QFHA 1U3ZA 2OXGA 2NY3C 3SCMB 5T1MA 2X4QB 3EJYC 5F7NC 4L9LB 1S7RA 5C09D 1W72H 2DWEA 4HIXH 1ODAA 1J18A 1W2KT 1E4JA 1H3WM 1W0YT 3VXOB 1I4FB 3CDGA 3EFFA 1BP3B 5JOPE 3LS4L 1A7QH 3NZ8B 1KCLA 4RISH 1MCOH 1JGUL 1QSFD 3H9SE 1O5DT 1MOEA 3ZHDA 1KACB 3SHSA 3RRQA 4F7CB 4XC1H 2R0ZL 1AP2A 1YMMA 3DVIA 1EX0A 4OT1H 5E8OA 2ZUXA 1LK3L 4GW4A 1JZ6A 3F62A 1WAAE 4WUUA 5L8JB 3PABA 3ARBB 3QDGD 4XAKE 4YO0B 2BJML 1CVSC 3BEVA 2R4RL 5GS0L 1EH9A 2E27L 1X5ZA 1T5XA 4G8GB 3WFBH 2BY3A 5D7JC 4Z7QE 1W72B 3T09A 4Y4KB 2P24B 1ACYL 1L9NA 4Y16B 1JZ2A 2ICES 2IPKA 5GJTL 2G75A 3U0TA 1JPSH 1KC5L 2EH8L 2EE9A 4QGTA 1CFNA 3G6JF 3MV7D 1FCCA 5B8CC 1VHPA 5DTFA 4FOMA 5FO9B 1MIEH 5ICXB 4R90L 5B4MD 3K2UH 1TJIH 1QBAA 1UQSB 3EZ8A 3QHZH 1CXKA 5IJVB 3UO1L 3NA4A 3GMOA 1QFPA 4LEXL 3O9WA 1R5IA 2BNRE 3JTTA 4M43L 4BM7A 3OJVC 5D2NC 3SDDA 3VE0B 1H3PH 4GBXD 3FB6B 3WNOA 2VUOA 4LCCA 4P2RD 3MLPA 1Z9SA 3DV6A 4Z7UF 5FYJE 5HVWA 1EBPA 2CH8A 5L2KB 2BVOA 3C5ZC 4F2MA 2ILLA 3H8NA 2DYPA 4JN2A 2VTFA 2RCSH 2RFXB 5DLMH 4F57H 1NCAH 3T0EE 3VW3L 1SMOA 3V5KB 1P53A 1XAUA 5H8DA 1MCKA 4X80H 3FO9B 1KG0B 2JB5H 4FTVB 4HIEA 2Z35B 1MCPH 2NY7L 2VLJE 3L3DA 2BVQA 3PDDA 4L8SB 1ZVHA 4XMKL 2DICA 1ZMYA 3LMJL 4NQSB 1L7IH 4AEIH 4DKFH 3HZKB 4X6CA 3SOBH 4G7VL 3GI9H 5ID0B 4PJHB 5B39B 2BCKA 5F9JB 3INUH 4XCCH 1AFVL 4JKPH 1ADQL 3O3BB 2JJTA 2HJKB 4WU7B 1JFMA 4HUWA 4PRAB 3UTSE 2FO4B 1T6VN 4B50A 1YYLH 4NNYB 3OGCB 1TQBB 3AMLA 3CLEH 5IFAL 5IJKC 1IKFL 3DX8A 4U33A 1WLHA 2DQHL 5TF1H 1T7WA 2FIKA 2OI9C 5GHWL 3ZT6A 1S3KH 5C08A 1RZJH 4OI9A 1XGQB 3ULVL 1MVUA 4ODTL 1T66D 4ZUTB 3SE3A 1FFOB 1EZVY 1H3XA 1UACL 4ZO6A 4F33B 2APXA 4X4XB 4XTRC 2XN9A 5EZIH 5EFIB 4HAFA 4G9FB 2ADFH 4WUKH 1MFBH 4U6VH 2JJWA 1SYVA 4PJ7B 4YK4B 1DN0A 2H2SC 4PJFB 3OKDB 1DVFA 4PJEB 4MCYA 3TA3D 4FRWA 1KTLA 3U9PL 3VRIA 4U7SA 5IESL 4PRIB 4PRPA 2Y5EA 3D18A 3TM6A 1Z5LB 3ULUE 1QQDA 3CFKB 1ZA6B 3BDBA 3S5LB 2CD0A 1JZ7A 2DQCL 1OGAB 4I3SH 2LAGB 4JM4H 2BNQB 3T0VA 4P4KA 3G9AB 1OL0A 4NQCB 1N5AB 4XWGL 4YGVB 2ESVB 2H26A 1ZT1B 5GGQH 1JHKL 4R8WH 5A2JH 1IEHA 1J87A 1KGCD 1LNUA 2BFVL 5HY9B 3E2HA 4ENED 3PXHA 1FFQA 1U91B 4JB9H 2DQEL 4X5XA 1ZTXL 5JHDD 4OLYH 3O6LH 2FX9L 2FR4B 1MREL 2CXKA 1HSBA 4NRZA 3WSQL 4D0BA 1DE4B 4IMKC 4J4PD 1FCGA 4YX2H 1JV5B 1S78C 4ODHL 2GCYB 2HFFB 4K3JL 3RZCC 1MWAA 2YEZA 3GMMB 2EDRA 1HK6A 3VXME 1I9IH 2FEDC 1W8OA 5IVZB 4PJXE 2E9WA 2W0FA 1DDHB 1JWSA 4M6NH 4X6FA 1K2DA 2OL3B 3TBSA 3VWJD 2CJUH 1A7RH 4BH8A 4GKZB 2JIXB 3QR2A 5K9OB 1JWUB 1CD0A 5J9PA 4IRZL 2XFXB 4JFEA 1OOAA 3LN4B 4R6UA 5EPMA 2WBJB 1FFPB 5DJ8A 4FQ1H 4A6YL 1BMGA 3WUWG 2Q8AH 4J12A 2AK4D 1P7HL 1I8MA 1DEEB 2DAVA 4M6AA 1HI6A 2B1AH 2DQTL 4Z76A 5IB4B 5CD5D 1INDH 4NNXB 4G8EB 4GS7C 1B2WL 3O6FD 2PW2A 4ONFH 3T2QA 3RGVA 2YD1A 5J8OA 5DJ6A 3MLWL 4KC3B 5GISH 4P5TA 5C0RL 3ZE1F 5IW1A 4QT5A 4DZBB 5DD6A 4LRNH 2V17H 2K3TA 4LSVH 4I9WE 1P1ZA 4L9DA 2G5RA 1IEBA 4WDIB 4WJ5B 2DQUH 3T65B 1IC7H 4OLXH 4OLWL 3O4LE 3QI9D 1OB1A 3D39B 4Y4FC 1FVCA 3VXSD 2DI8A 4WFED 2R29L 4PJ8A 1YN7B 1XIWC 2PTUA 4M8QB 4AYFA 1QSEB 2DF3A 4E5XA 1P7QD 3L5XL 5D2LB 3GZKA 2JJUA 1TCMA 4DZ8A 3IVKB 2XNAA 5FV1L 1SJEA 1HHGB 4CL7A 1T83C 5F8RC 3SGDH 2A77H 2XQYK 3IT8D 3VFVB 4S1QH 2EYRA 2EC8A 1LP9E 5IHUH 3RWJA 1RY7B 2P8PA 4LBEB 4NQUA 4Z95L 2FEEL 4ELMB 1RVFL 5ACLA 4NO0B 3U7WL 4QEGA 2I07A 3ARDB 5I1KL 2Y23A 5JW4M 3IJYA 1VGEH 3W5NA 1CLOH 1A64A 3C5JB 5GGRY 1H5BA 1RD6A 2A6JB 2R2BA 3X11B 1BJMA 5DYOA 3ZKXC 1LD9B 2QQKH 3CUPA 5BV7C 1F3DJ 3WFDH 1NUFA 3O41A 3RI5K 3WEXB 4V3DB 4GXUM 1N0XH 4MHHG 4LIQL 2KUTA 2ZCLH 3L95B 3MSPA 3HRZB 2X6MA 4XVTH 5IVXB 3MYZA 5L8LB 2FBJH 5CSZA 2EO9A 1ZKAA 3MGTA 4OFKA 2XPGB 1NUDA 2Q8BL 1RJLA 3B9KD 1DQDH 3C6SB 2EDBA 1GZQA 4U1MB 1CICC 4P4RA 4JZJC 1SYSA 3SPVB 5CD3A 4MSWB 3HUJF 4U7KA 5EZJB 3UPRA 3H9SA 3JV5A 1EHNA 3TBYB 1NJ9B 3LY6A 1CDIA 4GMSH 1U8PA 1U8KB 4Y1AE 5DT1H 1FFNB 5AWNH 1I8LA 4XVSH 2ORBL 1OAKL 2EDWA 3WBDA 5C07E 3WJJC 1DQLH 5EA0H 4OCXL 3I75B 4U6YA 5DJ0B 1WAAA 2YR3A 4FQIL 1NEZB 4WW1B 3FJTA 1BFSA 5DFVD 3UEZA 4KKLC 1UM4L 4UQ2A 2SEBA 3X13B 2NXYD 2O61A 3LKNA 3OHXB 1AE6L 5DJAB 1LK2B 3SE4C 3UZQA 3RTQA 1QR1B 4ZDHB 4L3ED 4X98A 3VGAB 1QNZL 5CBEA 5E9DD 4JJ5B 1CGVA 1RURH 1FE8L 2XZQL 3O2DL 3BISA 1WZLA 1JF5A 5I6XC 4JO4H 5D8JH 3T0XA 4QRPA 1EO8H 1N3NB 3STZB 4GAYB 1N26A 3HLAA 4U6HB 5F9WC 3NGBC 5KVDL 3V52H 1FDLH 5FOBB 4FMFA 2BNRA 4RMUA 4OI7A 1Q1JL 4NP4L 3ARVA 3BP4A 3M8OL 3PQYD 4L9LC 3L6FB 4U0RB 5HYFA 1A4KA 5TH2A 1L6XA 1L9MA 4UV7H 2BVPA 1C5CL 4LPYA 3QPQC 4XNQB 5DZOA 1KCSH 1FO0A 2VR4A 3BKML 4KRPD 5F8QC 1PYWB 1NBYA 5I1EH 1YEFL 4DVRH 2R23A 3QXDB 2QEJA 3O3DB 4IRJC 6FABH 3T0EA 4JFOB 4GG6F 25C8L 2J2ZA 5ESVB 2MPAL 3MRQA 1XGTB 3BT2H 3QNYA 1INQA 5GQBA 3SKJH 5I1HL 1NQBA 5I66A 2VLJA 4P23C 4P0DA 2IF7A 1BIIB 3ARBC 2YN5A 1PSKL 1IGFL 2DM7A 4I0PB 4PTTB 5HVHB 1FNFA 5HDOA 1TLKA 2ZJSH 1KIPB 4HF5L 1N8ZA 1YYMH 4N90D 1QFWL 4WI4A 1LE9B 3QIUB 3HMWH 4UILH 2XY1A 4HWBL 1FL5A 5EOCJ 5BMFH 4Y16C 5ICYB 2EIBA 3MBEC 1C1EH 4RWYH 3UTSA 1A8JH 1LGVA 3OJMB 4PJ5B 4X8XA 3IFLH 2WBWB 4NOBA 3G08B 4NFCA 1BVLB 3P9MA 4RGND 4UBDD 1NKOA 1OAQH 1PFCA 4JZOB 5L2JA 5L7XH 3SY0B 1I1AC 1EVUA 3UTTB 5CCKH 1TVHA 1G7MB 1LDPL 2YD8A 4PJAB 4OKVB 1U8OB 1WT5C 4LVEA 3B43A 4KY1H 2H6PB 4JZNB 4MD0B 3GHBL 1XF4B 4KHXH 3VFUA 4ALAH 1YY8A 1EGJA 3LQAH 3WFCL 4QNPE 2D2OA 4JJHA 4LLMA 3DYOA 2W65A 4X6BB 3QUZA 4XT1C 1UCBH 2C3GA 3UYPA 15C8H 1AKJB 3PGDA 3TBTA 1R3HB 5ANMB 4ZQKA 4LL9A 2IAMD 4PJHF 1BM3H 2EXYC 1B4RA 4NBZB 2B1HH 4Z7WB 1D5IH 3TYFA 1BD2E 1KT2B 1EEZA 5TQ0L 1NBVL 3FQUA 5CILH 1QTYT 4OF0A 3FKUS 4TULL 4KI5C 5DJXA 3I50L 4TUKL 1CDJA 4QOKD 1MF2L 4PG2C 3NZHH 3MREB 5CJQH 2PTVA 5CP7B 2C3VA 2NY4B 2B0SL 5ALBH 1A14L 1KENL 5DJCB 1TQCB 5SV4A 3W0WD 4TTDD 3D85B 1J0IA 1AQKL 2AGJH 5LXGH 3EYQC 4TSCL 1R5WA 2BHYA 2RB8A 4CMMA 1QFWM 3MXVL 4TVSa 5DA4A 5F70A 1HKFA 1MCHA 5L6YH 4XPFH 5GJSL 1ONQB 1K4CB 1T22B 4PJ7F 2YXFA 1EHLH 1OAXH 4PJFF 1Z9OA 4L8BA 3FO1A 4PJEF 3VXMA 1KN2H 2VL5A 3GFUA 3MJ9A 4PJXA 4I48A 4WI7A 3BSZH 3QUMB 1NCDH 1IGYA 3L3GB 4HUVA 3GGWA 1CXHA 3GBNL 3D6GA 4N0YH 3BUTA 3BKYL 5ITBH 3QWOB 4PB9L 4LPWA 3JSSA 2DQJH 4Z7NF 2ATPA 1U9KA 5TGBB 1TZGH 2R8SL 2PR4H 1S5IH 3VI3E 1V3LA 1K3IA 3MRBA 2Q6WB 4O2EB 5A16B 3KYNB 3RX7A 1Q9WA 2BDNH 3EDJA 3ZYZA 1FJ1B 4YHYC 4MNQD 5AYUH 5E8NB 5HGAB 1XZ0A 3DMMB 3HNSL 3LRSA 3ILPB 3FN0L 2GJ6B 3TO4D 4GMTH 3AM8A 3V0AC 4AIZB 4NSKB 1ZVYA 4W68A 3WFHB 3ZKNC 2VDPH 1WV7T 3RNQB 1OF2B 4OIBA 4MAYC 4HW6A 3SE9L 3SGDI 2A1WH 3GNML 2FHFA 1UEYA 5E7BA 5CFHA 5LGHL 3QG7H 4CMHB 2WK2A 4NC1C 3WIHA 3BDYH 4WFFE 1ZHLB 4BKLB 1BZ9B 3O4LA 3ET9F 5C0CE 1FPTH 3G6AB 1IC4H 4MVBD 3BIBX 2QADD 3IXAA 4TSBH 5IB2A 2B4CL 4NO2A 4RMQA 1U6AH 4IHOB 4R0LC 4WV1C 4F3FA 3O8XB 4Q7DA 1CDYA 1FIGL 1IKNC 2CDGA 3BZFA 3DETC 3KYAA 5C9JB 4XBGA 4N0UE 4NKDA 1C5DB 1JWMA 3L9RB 1KBGH 1T1YA 4CGTA 2ZCKH 1FIEA 4G8FA 1YMMD 5HI3D 1D9KA 3MV8E 1FN4B 4PTUA 5DURD 4C56A 1LP9A 2VITB 1QD0A 5FYKU 3AVEA 2WBJC 4HAGA 4NUJA 4XNMB 4X9BA 3LQMA 3ZLQC 5DQ9A 4YNYA 1RUQH 4XCNB 4UT9H 5T3XE 1X5AA 1U8NA 3S3SA 4PJ9C 1BLNA 1HINL 2A6IA 1XGPB 2EDNA 2O5YH 3O3AA 1KIUA 2X4OA 3LKOB 3BGMA 1ORQB 3FT2B 4KROB 1XCQB 2A6KB 4G6MH 2NPLX 4MA7H 4C55A 1ZT4B 5L8KB 4KGLA 4JPVH 3RBSA 4PG9A 4UIKH 1XH3B 3CK0H 4PRNA 3MRKA 3G5XB 3PDOB 2P43B 2H32A 3MNVA 1XEDA 5J57B 4YHLL 3WKNA 5CWSA 4R9HA 4KHTH 3LSOA 4Z9KB 3PL6B 2R1XB 2A2QT 4KI1A 3BZ4A 5D2LF 1QZ1A 2HLFD 3D2UB 1HYSC 1A6ZA 3BXNA 3FB5B 2D31A 4OF6A 1H15A 3CVIH 1MJ7H 1M71A 2Z0BA 3S36H 5FUZL 4XP4H 2DB8A 3MRRB 5DD3L 2VDRH 1WFTA 3VH8G 3CFDB 2Y07L 1OCWL 3CH1B 4FXKA 4Y1AA 5E99H 3W9EB 1MJJB 4ELMF 2VXTH 4AH2A 1RZKC 3QB7C 3KS0J 4NCDA 5C07A 1LO4H 3SQOL 1AD0B 2E7LC 4NZJA 3TFKC 1DBKH 3EYVB 1BF2A 1UZ8B 1SHMA 3QZWG 1RZGA 2AXFB 1J0HA 3FO2A 1FV1B 4N8CH 3UDWC 1GAFH 2UZIL 3LPFA 2R15A 3SE8H 5HYIA 1VFUA 2GTWB 5EOCL 4P57A 2OSLA 4JM2C 3A6BL 1X9QA 3HC4L 2HAZA 3MA9L 5KS9E 1WJ3A 3VMPA 2NW3A 1KN4L 5BXFA 3O3EB 5IVXF 2FL5A 3JUYA 3LEYL 5I71C 1NGWB 1ZVSB 3LEXA 2DMBA 5EOTB 1G9MH 1NMCC 3ARFB 2WINA 3LH2H 2H45A 4XMPL 4MMZC 2VISB 4PLJD 1JFQL 1H9VA 4XPGH 4LCYB 4X83A 5IW6B 4BUHA 4QO1A 1SQ2N 3ROOA 1TITA 3S7GA 4DGVH 3Q0HA 5FF6B 5FXCH 1ZXQA 3ARPA 4BQBA 3MLYL 4H88H 5FV2A 3OKLA 3KHOA 3OX8B 4OQTH 1P4BL 3BIKB 4QYOA 5FYKE 1MCNA 5AG9A 3T1FA 5D7JA 4L8CB 5DJYB 3CFJA 5EBWA 4JDZA 2XN9D 1NGQH 5TDNA 5FM5O 4LAJH 3WLWC 43CAA 1DQQA 1FH5H 1OAUL 3HB3C 3DX9A 2AK1H 3RI5F 1DVFD 3KXFB 1LQSR 3VU2A 5B8CA 4KDTC 3TV3H 5J1AB 3KPSD 5HYQA 3IXTA 4PRPD 1HHHA 4G7YH 4GG8A 4OLEA 1BOGA 1NBQA 4EI5D 1I9RL 3S88H 1QLEL 1UXSB 1MPAL 3P0VL 4BH7B 4P4KD 1QA9A 2OMBA 4NKMB 4OJFL 2HMID 3RJDA 3M07A 4J3TA 2PYFA 1DBML 5D2NA 1FNSH 3LV3A 4E0RB 2OK0L 4FZEH 2VH5L 1CXIA 1HOCA 2F74B 1GGYA 3HNVH 3LHPL 3BPCA 3C5ZA 2DKSA 1FZOA 3GJFA 2VDML 4WTZG 1NAKL 1NUNB 4K7PH 3D0LA 4ZOAA 1OAZH 2C9AA 2NX5B 5DD5L 4C4KT 4ZFFB 3QEQB 3GSVB 1V5JA 2FJFA 1JE6A 4UT7L 4YZFE 1A7BA 1QLFA 5D1QB 4I5BB 3H6JA 1EBAA 4U0RC 1PVHA 4L3CB 5EN2B 2EDOA 1A9BB 5T3XH 4J7RA 4AL8L 4X4ME 1MCJA 2A83B 2E9BA 2IG2L 1VEPA 1AJ7L 3TT1L 4G6AD 3BP7B 3U2SB 4NO5A 4HKBB 4JHZA 3B2UC 5DWUH 1IGJA 4U2ZA 1HILA 4JFED 1BD2A 1RK1B 4QXGH 4XBEH 2FO1A 4XNXH 4ODSH 4YBLB 2A9NL 4U1KB 5JXAH 3GDBA 1RJYB 1T2QH 4LRIC 2OI9A 3B83A 1DUZA 3QCUL 4P5KA 5EZLA 5HVHC 2VZ1A 3EOBB 2NY1B 1HQRB 4MD4B 4NJ9L 2X40A 2ZPKL 3MA7A 4F58H 5E8DH 2UYLA 1XGYL 4OZFG 1IBGL 1RUPL 3RGVD 4PJAF 3U9UB 4QRRE 4QY8B 1U93B 4WHDA 1Q38A 4P5TD 3J8F7 3TZVB 4LLWB 2GKIA 1BBDL 2H3NB 5MP6H 5ISZD 3DRQA 4LSUH 4ETQA 3EFDL 1GC1C 4TQEL 5IQ9B 4TRPH 3IKCA 4M8VA 2WUCH 1IAIM 4I13B 1PW3A 4DKEH 4HUXB 5AD0A 2LU3A 4Z7WF 4YC2B 5KTEL 1VENA 1MFAL 4KI5E 5I1GL 2GSIB 1YEHL 1ZEAL 2Q20A 1PX3A 3C9NA 1E4WH 5GGTL 3VFOA 4MXWL 3TIEA 3K81A 2CSPA 2YKLL 5INDA 2ENSA 4BSVA 2ZOLB 2ITCB 1Q72H 2Q7YA 4W4NA 2YMXH 1KCGC 3O6KL 4U4BA 3FZUC 1MFEL 4UZGA 5GGSB 4IMKA 2ZKHH 1UYWH 1X7QB 2R0ZH 2GI7A 3B5GA 2DLGA 2IALB 1AXTL 3OZ9L 3Q6FB 3QQ3B 4Z18A 1DSFH 3RZCA 2R2EB 3U4AA 1PZ5A 2Z91B 1LK3H 4EBQL 3RVUD 4ZNEE 2IQ9L 3AU1B 2VZSA 1AD9A 4OUUA 1YEDA 1OP3H 5SWZD 1YEIL 1TQCC 2DTSA 3E8UH 3QEHB 1DTUA 3R1GL 2R4RH 4ZOBA 5GS1C 2E27H 1IE5A 4QHNA 4FS0A 5D7SH 2UWEE 3PGFL 3HPLB 2VE6A 4TUOB 5ETUB 5C0CA 2YBRB 5GJTH 1ES0A 3TO2B 4MWFB 4PLKC 4JDVA 1CD8A 4QWWC 5EIIB 2V9RA 1K6QH 1A1NA 5E5MB 2DQFA 1BVKA 5JOPD 3IFOB 5HD8D 5EU6E 3PHQA 3H3PH 5E4EB 4UUJB 2ESVE 4N0UA 3L7FB 1UH3A 3F12B 4ZFZA 1U3HB 3MZTA 4CU6A 1NDMB 3MNZB 1NFIA 2YRPA 3QYCA 4PD4J 5CZXC 4UQ3B 1Z2KA 5BVJB 4XBPA 4S1SL 4EI6B 4OQ1A 3MV8A 3D1MC 3NIFE 5HPOA 1JF1A 4HKXA 1G9NH 4LLQB 3RBGA 3C60B 5C9KA 1NDGB 1UB5B 4WY7H 5I76B 3A67L 4PRHE 1OTUD 5CGYD 1MHEA 5K9KA 4DFHA 1DR9A 3IU3B 3A6OA 4NC1E 3RTQD 5CHNA 3MOAL 3R06B 3P4MA 3DMMC 4ISVA 1JRHL 3IGAA 2V7HA 2APFA 4Y4FA 4XNZB 1BFOA 4KK8D 3I02B 1F11A 4N0FB 4YR6B 1JN6B 2GFBA 1XIWA 4JFQB 3TBWA 2EDLA 2VSDA 4PV8A 3QJHB 4AQOA 3T2NL 5ADOL 5EO1A 2FYYB 4UTBH 5DVLA 5TQ2L 4XMKH 1D7FA 2ICWJ 4QRPD 4NC0B 3P4NA 2VLRB 4G7VH 5DHVB 5IMLA 2XKSA 1T83A 2JB6A 4CMHC 1NAMA 4J1UB 4CW1A 3MOQA 2JK5B 2R0KL 1U2CA 3AMKA 4Z77B 2BNRD 4ZODA 2VDNL 2VOTA 4Y4HC 1JMXA 3GMPB 4XX1G 3U36A 5T1LB 4JKLA 1U8JB 4B0MM 3DYMA 3JWDH 3O8XC 5FYJD 3C6LC 4KJPD 5IF0B 1I8IB 4LSQL 4H20L 2VXSH 5HHOE 3WKML 3T0ED 4JQXC 1J0JA 1WIUA 2X44D 4ODVH 3S35H 5T3ZE 1WVZA 5DUPL 4D9LH 4M1DH 3QDJE 5EH1A 3WNNA 5HHPA 1IM3A 4NQXA 4LHUA 3KLHC 2VLJD 1MCCA 5DGQA 1LEKA 1TDQA 1TJGL 1RI8A 3CX5J 2Y72A 5KS9A 2XZZA 1RZ7L 3NPZB 2NYYC 3GSRB 1P5UA 2MMXA 4XGZA 35C8L 4DCQA 3ZZ1A 1N59B 2DDQH 5C0JA 3IDGB 3DGGA 1G9EA 4H8WL 4KROC 1A6TA 5I1LB 3O2VH 4U1IB 1ZHNA 1CICA 4JZJA 1WIPA 1ZHKB 4PS4H 4CVZB 3UTSD 3GMLA 2W60B 3ZE0E 5KANI 5C8JA 3K1KC 1XCTA 2MQ3A 5I8KH 4ODUB 1TENA 1H8OA 5EOQL 2QQLH 1ZT7B 1SJHA 1IGML 2X1WL 4IOIA 3PL6C 4JVUA 3WJJA 1OSPH 3V4VH 1QHOA 3EOTH 2BFVH 1JUFA 4R2GC 5H37G 5JR1L 3F5WB 4NQDB 4LU5H 3S37X 4U6TA 4L4VB 3UTQB 4EDXB 1UKQA 4OZGE 3RGHA 2Q87A 3LCYA 4GKNA 3SE4A 5TE6L 1E6OL 5GRWA 2VLME 4LGPB 5CEXB 4BUGA 3B9AA 3REWB 1T80A 2ZG2A 1JNHA 2ZUUA 5HDBF 2VQTA 5BJTA 1NGZB 3GRWA 1V7MH 5IB3A 3UMTA 2FWOB 3WXVL 5E8EA 1JNJA 1FAKT 3SBWC 4MQSB 3PHOB 3ULUD 4YJZL 3F8UB 4OGAC 4N5UA 2XTJB 2O5ZL 3ZT7A 5GZND 2CK0L 3S8WA 5DEFB 4JFYB 1CFVL 2XYCA 5D96C 2BOCA 2AABL 4Z78A 5ICZA 3ALPA 3HAEH 5J12C 4JREB 4MZ3A 4L9LA 4P9HH 3HI5L 3LQZA 3HE6A 4NKIL 4K8RL 1VFMA 4JDTH 5KOMC 4X9IA 3VD7A 1DL7H 4UT6H 4HHAB 2CIIA 1KEGH 3EUUA 4IRJA 3G6DL 4LCUB 4JY4B 5D93B 4X0KB 1YDPB 4BZ1H 3K8LA 1YQVH 4ERSL 1BHGA 2X9YA 4LKXB 2C1OB 5GGVL 4P23A 3MMEB 1A0QL 1KB5H 3CSGA 3T4YB 3ARBA 4LLDB 4WEBH 5E8PA 1YECL 1VACB 4X4MA 4YO0A 1EXUB 2PETA 1G7PA 2XICA 5GPRA 1RK0B 1RQ5A 2BNUB 1BPVA 4IDJL 5GRZA 1SVCP 1XGUA 3TVMB 4U1GC 1PD6A 1J8HD 3O3UN 4W81A 2MWCA 4OCWL 1JGDA 1AR1C 3MBEA 4DQOL 1UXWB 1EFXD 2YSSB 4A6YB 1G7HA 4DW2L 5I75B 3RWGA 1CD1A 3MLSL 1BQHA 4NOFA 1G7QB 4LLAA 1RIVL 5CJOH 3QUXB 4S10A 3LKSA 3C2AL 3MJGX 5ICXA 3WD5L 5FM8A 4X9GA 3B9VA 1I1AA 4PGBA 3VFGL 5IJVA 1GGTA 2G60L 4YAQA 3CXHJ 5CBAB 1AI1L 1V05A 3FRPA 1A4JB 3RPKA 4XP6H 5EU4A 1WT5A 3LD8B 3QIWD 3VE0A 1Z3GH 3FB6A 1DBJL 3NCJH 1QBMH 3GM0A 4QRRA 3QFJE 5ESAA 1Q9KA 5BW7C 5EZOH 4PP2A 1P7KB 3WUZA 4NRYB 5HJ3B 3BAEH 1FYTB 2HTLC 2GITB 3Q5TA 3MROB 1PKQE 2NZ9D 3FO9A 2A74B 4U7MA 5FKPA 4DAGL 3O6ML 3PGCA 4OF8A 4TNWK 1L6ZA 5A2LH 4PG2A 5BRZB 3BX7C 3QXWA 2P1YA 4U1HB 3BWAB 3HZKA 3CVHH 5HGBB 5JXEA 1MI5E 2PNDA 1W8NA 4G5ZL 1RHFA 1QBLH 1ZANH 2FGWH 4WU7A 4GRWB 2VDOL 1OPGL 3GK8L 3IDNA 2VLLB 4YXHH 3BOVA 4C56D 3S37L 4YHOL 2BRRH 3QBTB 5CMAA 2VLKE 4YBLC 4YHPB 1C5BL 3HNTL 4FMKA 4OZHE 4Y5YB 3QJFB 4MB3A 1YNKH 5SWQA 2D7TH 1H8NA 4XCFL 1BFTA 4L4TB 5CKAA 4ZNEA 2F8VA 2NY1C 3EBAA 4P3WA 3UTTE 4JHAH 2APWA 5FGCB 2BVEA 3ZDZE 5F7UA 1FFOA 1UM4H 1IARB 1LO5B 1JHTB 3MACL 1AE6H 5EFIA 3OR6A 1ZGLM 1OARL 2UWEA 3DVNB 4OKDA 3CSYA 4HUUB 3JUZA 3CVHB 1W0WB 1JK8A 2EH7H 4PJFA 3OKDA 3TZVC 3HFML 3STLB 4HKZA 3QT2A 5EBLB 4XC3H 3WUWB 4KKNA 1L7TL 4KGJA 4Z0XB 3KDMB 4LLYB 4FFZH 2OP4H 4JKWA 1EHXA 1EAPA 5TE4L 4P2QB 5EUOB 2RBLA 2F53D 3GSUA 5EU6A 1DP0A 5LGJB 1N5AA 4YC2C 2ESVA 4N0CA 4K94L 5JDSB 2D3VA 5SX5H 4P5MA 1UA6L 2EYTA 4JRYE 3GO1L 2OMNA 2Y1VA 2N7BA 1DANU 3VFTB 5C07D 3CFCH 2N4IA 5GS2D 1C5CH 4MAYA 1KB5A 1F6AA 3F6LA 4MDJB 1HXYB 3CLFH 3K8KA 7FABH 4Z7VF 4PRHA 2FR4A 1DQML 2XWTB 5F9OH 4PB0H 1MH5A 4HT1L 1DQJB 2B5IB 1RUKL 2AXGB 4K3EH 5FA3A 4GFTB 4M48L 3EJYD 1CBVH 5BS0B 3VRLF 4Y19B 5E2UL 1NBZB 1EDQA 5C0BE 4R0LA 4WV1A 1DDHA 3LKPB 1HH9B 5E6YA 2OL3A 4YDKH 4D9QE 1DBBL 5J6HB 1ZWIA 3BFOA 4ZTPH 4IJ3B 3REVA 2X5PA 3QDME 5CLTA 3IS0X 3MJ6A 4HZLA 1T1WB 3T0AA 1T03H 1FFPA 2FGZA 3SKNA 3CFBB 4FQXB 3B6SB 1UKSA 4H25B 2ITDB 2NNAB 3UAJC 4PJ9A 3JWOL 2GK0A 4HXAL 1MRDL 1DLHB 1T66C 1KPUB 1WBZA 4PJGB 1RZIB 5D7JD 4NNXA 2AV7B 1N2RB 5HHOA 3FOMB 2OS7A 2J8UB 2HH0H 2E6PA 8FABA 1MFCL 5HYJB 1LDPH 1KEMH 3EJZC 4DN3L 3QDJA 4B41A 3TA3C 4YGAB 2O26U 1WQVT 1YNLH 1J1XL 4OD3L 1BGXH 2E8YA 3GMRB 1F4YH 3C60C 3D25A 4M03A 2VZUA 3GHBH 3BEWA 3O45B 4PRDA 4RAHA 4WO4B 4DTGH 4M3JA 3S98A 1J7VR 5E1AB 2CGRH 2Y4SA 1OW0C 4WDIA 4DGIH 2DI9A 3QIBC 3RWFA 3P9LA 3FT3A 3MOBH 4X6DB 3D39A 3LPWA 3AAZA 1A22B 4OSUH 2YPKB 4OD1H 2HRLA 5DMIL 3DOSA 5HYSA 4NQVA 4TUKH 1I8KA 3CCHB 4OGZA 2E7LA 2E7HA 3TFKA 3C5ZD 3IVKA 3LKQB 2B0SH 3W2DL 1KIQB 5DR5L 4AZ8A 1BF8A 1HHGA 4PJCE 5LQBL 3UDWA 5IMMB 3P2TA 4OZGA 1HH6B 4EUPA 4OZ4B 5JW4R 4B5EA 4RQQA 1QYGL 3PV6A 3CSBA 5F3HB 1KCVH 4JM2A 5DVNA 1BOYA 2R0LH 3HS0B 2IH3B 3VDCA 4XPBL 2P7TB 3WHE0 4YHML 2IANB 4V3EB 3C5JA 1SM3L 2XA8L 3VMOA 2I9LA 1J9CT 2A6JA 3X11A 5DD0H 3QCTH 3EO1A 2CQVA 3R8BB 2XY2A 2CMRL 5ENWB 3S3PA 1OAYH 1NCNA 5JW5A 1MJUL 4JQVC 4IOFC 5D6CB 1CXFA 4D94A 1IGIH 1VGKB 3KYMB 2VXQH 3HRZA 4EDWL 4ZYKA 4JPKH 1MVFA 5EDXA 4LQ1A 3OR7A 3ULVF 4KZDL 3RWEB 3ZYJA 3SJVB 3BKJH 5JTWA 5CD5C 3NMEA 3O0RL 5INCA 3MJ8A 2OZ4A 3EHBC 4OV5A 2X4NB 3IFPA 4RFOL 3UBXA 3HI6L 3O6FC 4I3RH 4XTRD 1ORSA 3KJ4C 4KKBC 3L1OH 1NJ9A 2EC9U 2IBGA 1Y0LB 3S4SG 3FN3A 3QRFM 1EV2E 5ID1B 4P49A 2H2SD 3ULVC 5HHNB 4KDTA 4KVCL 2RGSA 4AEFA 2WSKA 5HHVL 3PIQA 4OCSL 3KLAB 3WDJA 3MJ7B 1I1YB 3QEUA 4PYGA 3R0NA 3GI8H 3OHXA 4FG6C 1FVEA 4KXZH 4XMLL 4OFDA 5LGHH 1QACA 3LDBB 1QO3A 2FEEI 5CAYB 1MNUH 4GXVH 4ZOEA 2VNCA 1L0XA 1IZKA 1H3TA 5IFJB 2M2DA 5J4MA 3QSKB 4R96B 1AIFB 1BWWA 2IH1A 1I1FA 4YE4L 1ZLVH 3ZTNL 5HBBA 2Q76B 4YHNA 4LARL 3NA9L 4JN1L 2ATKA 2HKFL 3UYRL 2R56L 43C9B 3A6CH 1T1XA 2NTFA 4XAWH 1S78D 3OTTA 4JREC 3L6FA 3RZCD 1HNGA 4XNQA 3QFJA 2FEDD 4LCWB 4UNTA 3NN8A 2J4WL 3TESA 3U1SL 5KSAB 2OXHA 1YQ2A 3KPNA 3EYSH 3EGSB 1M6OA 3VWKC 2R69H 1YEKL 4M6OH 5IEKA 1C12B 1R24B 1PKQA 1XGTA 1AO7E 1A1MA 4DOHE 3WIIH 1Z0MA 3HG1E 2L7UA 1KB9J 1BIIA 4KVNL 5KJRH 4HIIA 1SVZA 4LRIA 1AY1H 4K23L 4FNLL 2APVA 1CS6A 1MRCL 1A3RH 2PW1A 5I74B 1KIPA 5K59E 4NHCH 3RKDC 2ED8A 5MERA 2Q1EA 2ZG1A 4J3VA 1LE9A 5HHME 3TVMC 1FNHA 3LB6D 2QKIA 4N8VA 1S9VA 2X4PB 3MO1B 4HH9B 1WBYB 4K7FA 4NFDA 5I16B 5ALCH 1SBSH 5DD3H 4NJAL 2VLKA 3QPXL 3T3PF 4HPOL 2P5WE 4KMTH 3G08A 4OZHA 5EBMB 2CLZA 3FCTA 4HXBH 4KQ3L 4JZOA 2DQIH 1EO7A 3DPBA 3SQOH 4P3DB 2IPTL 4L5FL 3UXFA 5KSBB 1VSCA 2A38A 3NPSB 3UTTA 4XHQA 1WFOA 2G9HB 2WBKA 3D0VB 4OF3A 5M94B 2Z8RA 1FL3A 4PJAA 4M1GH 5C71A 2X4SB 3LD8C 4JLRA 5FKAB 3RWHB 2CRYA 1XIWD 4MYWB 4JZNA 4MD0A 3QRGH 4RGOH 1OD9A 5KZCB 3UBXI 3S97C 1T04A 1K4DB 3I2CL 5C0AE 3MXWL 2R9HC 4O4YL 5DI8B 3BO8A 3DYPA 4YHZL 2MCPL 2KQMA 1R3HA 4Y5XB 4XP5L 3GMNA 1QSFE 4I4WA 4WTXA 4Z7WA 2VIRB 4K2UH 3BH9B 3KNBA 2OTUA 2H1PH 1KJVA 3FRUA 4GRWF 2XQBL 2Y7QA 1JFQH 4ZXBB 3QDGE 4JRYA 4HV8B 4N1EA 1Q9LB 3JBG7 3PWLA 3RY6C 2FNBA 1NFDE 3EYOB 4JFZL 4ODXB 3ZO0A 3K1DA 3RUGE 3D85A 4G9DB 4HFWB 5BQ7B 5GS1A 4M61B 5K9JH 5B38A 5E94A 5JIIA 3JV4B 3E3QC 4PLNC 2PUQT 2X89A 4Z7OF 1GIGH 5IEHA 1MLBA 3MV7E 1K4CA 4KKCD 4HIXL 3RWDA 2NY2B 4Y5YC 2H9GB 3LAFA 4TNWF 1YA5A 3WO4B 1A7QL 4RISL 3S5LG 1MCOL 4OCLC 4Q74A 4WU5A 1S8DA 4JFDD 4XC1L 1CICD 4OT1L 3B4NA 3D87B 1LE5B 1CT8B 3IF1B 1YUHA 3QDMA 4KKAC 4P2RE 1BX2B 4O9HH 3VGGA 4YPGB 1KXQE 1CLCA 4RGNC 4HH8A 5DDHA 3C5SA 3WFBL 4O2EA 4KKLD 5A16A 4Q6IB 4GH7B 2EIZB 3QO1B 5FYKD 5JDJA 5IMOB 5C0GB 1NC4B 1B0RA 4XI5D 5HGAA 1OM3L 1UH2A 2ARJB 2LTQC 4ONGH 5FA4B 5CEZE 3ILPA 4I3GA 12E8H 4YHKH 3P73B 4XZUB 1HSAB 1MIEL 2D7NA 4MJIB 4UT7H 1X4YA 3K2UL 2AJ3B 1IEAB 1J8KA 3QHZL 2AAVA 1OF2A 5KVFH 2IADB 4NDMB 2DLIA 3W5MA 3PWVA 4S2SB 4HK0B 5IFHL 1MLCA 1IL1A 2DLFL 2JJSC 5E0QA 1H3PL 4KDVA 5L0QC 4PJDE 5FO8A 1JTTA 5FK9A 1M05B 3DX7B 2J7LA 2B5IC 3DHMA 3G6AA 1FSKB 4Y4HA 3TN0A 4YUEH 1F8TH 4IIQC 3QPQD 4ESKA 1Y18A 1EMTH 3BPLB 1KV3A 2RCSL 5DLML 4F57L 3BGAA 3O8XA 5J89A 3C6LA 4X80L 4JG1H 3QZWB 2JB5L 5KSVB 3ISWA 1C5DA 4O58H 3L9RA 1G6RH 4IRJD 3Q1SH 4PJCA 4PJGF 4JQXA 4YHIB 3ARZA 2YUXA 1SEBA 3MLRH 3OXSA 4YXKH 5I9QC 2J8UF 1JIBA 3T4AA 3M17A 1L7IL 2YA0A 4P23D 1RUPH 2I60L 3C09C 4OLUH 4AEIL 4CDHA 4DKFL 4FQXC 3SOBL 5IT2H 3ARBD 1IQWH 4UDTB 3INUL 4XCCL 4K9EH 1QEWA 1B4JH 1M7DA 1EJ6A 4HJGB 3FT2A 3W39B 3KLDA 1YYLL 5D1ZB 3U6RA 3BD3A 4Y16D 3RZWA 3CLEL 2QTEA 5TF1L 5DD1L 2ZUQB 1MFAH 1RZJL 2GSGA 1H3UA 4HD9A 4AMKH 5SV3A 3ARGB 5FB8B 3PL6A 3W82A 4LEOB 4WO4C 4FFEX 1G6RB 2X42A 1E4XH 3QAZC 4F7EA 5CGMA 4KXZI 5IM7A 1I1AD 3RVWD 3D48R 3OKNB 4J8RA 3V0VA 1CVRA 5EZIL 2ADFL 4WUKL 1MFBL 2KDGA 2AJZB 4U6VL 4HGMA 1WEJH 5IHLB 5DEGB 1I3RB 3MCKA 5A2IH 1X5GA 3THMH 3Q3GB 1AD0A 4I3SL 3H0TB 3SBWA 3EYVA 1JL8A 1G1YA 4U1NA 2IQ9H 1P6AB 1U8MB 2WY3A 5C09B 1CFTB 1TZIB 3CC5A 1EEYA 2EXYD 2HN7A 1C16A 3K7UA 5C0EA 3U0PB 3KPLB 5GGQL 3R1GH 5C0FB 1VKXB 4FTVD 1FNGB 4K3HA 1S7UB 4R8WL 2DMCA 4WWKB 2V2XB 1E27A 2LQRA 4MVBC 5FECB 4P2OB 4KI5D 3KWWA 4JB9L 2R1WB 1DQTA 4OLYL 3O6LL 5GSVA 1U8HB 1FL6B 4QRTB 1ZVSA 2IPUG 3EYQD 3PP3K 4YX2L 1H0DB 4LF3B 5F1SA 3DI3B 1T7ZA 5F96H 4FQQB 2D7MA 4LCYA 4GW5B 1OQOA 2YUVA 1I9IL 1D3CA 3NFSH 3BZEA 4M6NL 3QULA 5ESQA 3DSFH 3P77B 3X12A 4I8DA 2CJUL 1A7RL 3FB7A 3W9DB 3OX8A 4UTAH 3RNKB 1GHFH 3VXSE 1NANH 4G9FD 4ZSOB 4MLIA 3MRPB 4FQ1L 3CMOH 1AO7A 2FHBA 3KAAA 2EYSA 3HG1A 2BY2A 1VFAB 3HMXA 2B1AL 5J1AA 3ARQA 1AGEB 4GBXB 5GGRA 2PXYB 2C1PA 1INDL 4RMTA 2EE3A 1VA9A 2A73B 5M7QA 1TZHB 1OGAD 3MRDA 1FBIH 1G7IB 4LMQE 2X1OA 2CIKB 5EU6D 4ONFL 2NXZC 4U6XB 2ESVD 5HHMA 1I7TB 1FNEB 3RHWK 4P59H 3LDBC 4ZUUB 4OZFB 1T1ZB 5GISL 4DJMA 4LRNL 2V17L 3TIDB 1RJZB 4LSVL 4J23A 2F74A 1JYXA 2P5WA 3ZKND 5BW7A 2DQUL 4MAYD 1U8LB 1UADC 2VN7A 1IC7L 4OLXL 3D3VB 1OP9A 3PJSB 5D7LB 4PRHD 3RDTB 3OKKB 3N1FC 2NX5A 5DJ2B 3E1F1 4ZFFA 5GRXG 3WKMH 4BQ9A 3GSVA 5C86A 2KKQA 1JVKA 3AS1A 3EDFA 1IFHH 5DUPH 5MEOA 4CJ1A 5E6IC 1CYGA 4KJYB 4KV5F 5MEPA 3MRFB 4FQJL 4C83A 4DEPB 5C0AA 4G6JH 3DETD 2A77L 3NIGE 3MRNA 1QSFA 2QV2A 5IHUL 1ED3A 4JRWA 4WI2A 3SDXB 2B4CC 5IR1A 5IG7A 1N5YH 4N1CA 2WBJD 1VGEL 5DK3A 1CLOL 4MXVF 1RJYA 5F1IB 2EDJA 3QDGA 3U4EB 1IGMH 5DZNA 4N9GA 4GRLB 2QQKL 1EUUA 1NFDA 4MD4A 3WFDL 2HG5B 3RUGA 1MHHA 4L3EE 5KSBF 1N0XL 1EGJL 3OXRB 1MHCB 2CLVB 1ZLWH 3DX6B 5T3ZD 2ZCLL 2FATH 4ZUSB 1QLRB 3QISA 4Q2ZB 1MUJB 2FBJL 3HE7C 1GGIH 3MV7A 5DVOA 1JPFB 5E56A 3TZVA 4HMCA 3EO0B 1J0YA 2BSTB 1KLGA 2H3NA 1DQDL 5IB1A 1HYSD 4EI5C 4NHUB 1FYTE 1WBXA 3PP4L 2M1KA 1OSZA 3SDAB 4JFPB 5JHDB 5C3LD 2YPLB 3D39D 4N68A 5DT1L 5AWNL 4XVSL 4UNVA 2IGFH 3PQYE 1DQLL 1XF3B 5EA0L 1D5BA 4IMLB 2BC4B 3EDKA 2GSIA 4P2RA 4JGJA 2B7DT 5IMKB 4AEHH 5CSGA 3TFKD 1KELH 2UUDH 1L0QA 5F1NB 4Y5XC 4HS3A 3T1WA 1ETZA 3FTGA 5D5ME 1F4XH 3ALXA 4MQXD 3EW3B 5LBSH 8CGTA 3GIVB 4Z5RB 1RURL 2DQDL 1TFHA 5CIPH 2VLMD 4QTIL 5ELIA 1KPRB 1X7QA 4JM2D 1JMZA 1T89C 3ARDD 5JOEA 4QRUA 4JO4L 1S7QB 4PJBE 3CJJA 3DXAE 4HWNA 5I2IA 4L4TE 5D8JL 3GBLA 3UTZB 1EO8L 4D8PB 3AU1A 2QHRH 4HKJB 3NFPA 3P4OB 4X7EC 1BAFH 1MY7A 4N90E 4ELKB 3V52L 1FDLL 3O2WH 2BOBB 5HXMA 2AK4B 4LIQE 3TNNB 4GUPB 5ADPH 4BZYA 4PJDA 3HPLA 3T77B 4UV7L 3MRHB 4D0DA 4DW2H 1YMHA 1KCSL 4YDJB 3I6GB 4MWFA 2JF1A 3WO4C 3NCCB 4RGNE 3UJTH 2CR3A 3LZFH 4OCYH 4JY5H 1RULH 2DL2A 4DVRL 2M26A 5EULV 4XVJH 6FABL 1ULVA 5EUOE 3GSQB 3X14A 3VFGH 3L7FA 4WVRA 1NCBH 1NDMA 2X4UA 3MNZA 3WLWD 4UQ3A 4F9PC 5BVJA 3HB3D 1J11A 1NGXA 5IBTH 1E4XI 1YPZB 4OD2A 3ROLA 1CGYA 3TA3A 5FOJA 3WNLA 2DMKA 3C60A 2ZJSL 1EJOH 2VSCA 1ND0A 1YYML 5E03A 1TETH 3IAPA 3MV11 1UKTA 1EEQA 4KUCD 3HMWL 4UILL 1SEQH 1OW0A 3FFCE 5BMFL 1P7QB 5DO2C 3IU3A 1C1EL 3QIBA 4RWYL 5A2FA 4PD4K 4HDIB 1TMCA 3IFLL 3ZE2F 5KG9B 5E6ZA 2NQCA 2YC1B 5AAWA 3JXAA 4YR6A 2OM5A 1OAQL 3PWUB 5L7XL 3ZKMC 2WIIB 2FYYA 5F7DB 3VXQB 4XXDB 5CCKL 2MJWA 3VFMB 3RVVC 4M7LH 5DHVA 4MA1B 5IIEB 4KY1L 3M1BB 4KHXL 3QDAA 4ALAL 3HN3A 3JWNC 5CUSH 3GK8H 3LQAL 5CZVH 4BZ2H 2V9TA 3L3JB 3VGHA 1UCBL 5T1LA 15C8L 3QFJD 2DQGH 3BPLC 1BM3L 1JPTH 3H7BB 1RPQA 1U95B 2B1HL 1CIUA 1D5IL 4MA3B 1CIDA 3VWJA 1N4XL 3H42L 4GT7A 4BQ6A 4TN9A 3B2UD 1F4HA 5HYJE 3CZFB 4HCRA 1P2CA 3B9KB 1A6AB 5F7EH 3S36X 4JQVA 5CJQL 3WDIA 3MRIA 3HZMB 4FFVC 4ZD3H 3VD4A 2BMKB 2A6DA 2C4XA 3MNWA 2FSEA 4I0PD 3MRLB 5LXGL 1D6VH 2CO6B 1KFAL 3KPQA 5B3JF 1NANI 1RHHA 3IDGA 3V9FA 1HYRC 3S34H 4MXQC 4MNQE 3QIUD 4X6DE 3HCVA 4U1IA 5D1ZC 3RVXD 5L6YL 5TE4H 1ZHKA 3O6FA 1A3LH 1A2YA 4PGDA 3OAYK 2FCBA 4PJ5D 1EHLL 1OAXL 2ZUQC 3CX5K 2CKBH 5FO7B 1KOAA 1KN2L 5CIPA 1FAIH 1MELA 3LKRA 1B0GB 3L3IB 3GO1H 3BSZL 4NQEB 1NCDL 5E9DB 4HSQA 3V4PH 4LSSH 5HHQA 3SQBA 1QRNB 4LLUB 5ERWA 4EDXA 3UTTD 5DUMH 4QLRA 1Q94A 5EU3B 4GKSA 4N0YL 4F8TA 5ITBL 3G04B 1NMBH 3Q5YA 3VXSA 4OCNC 2DQJL 3REWA 2ZSVB 3WNPA 3BUYA 1TZGL 1S5IL 1UWEH 4JO3L 5E70A 2WP3T 3VGEA 3MR9A 2BDNL 3IB4A 3KPTA 4NYLA 2AKRB 5DQJB 1S7WA 5AYUL 4ZFGH 2WANA 4HJJH 3VJ6B 5DK2B 3AXLA 4CN6A 4FQHB 5DEFA 5EUKB 3FZUD 1QP1A 2PYEE 4KRPB 4PGCA 5EO9A 3JV0A 3WLBB 4WWKC 4GMTL 1F3JA 2AS5M 1YEEH 4R4BA 3G5VB 2FECI 4P2OC 4HBCH 2O93L 5I1AA 3BVNA 4M5ZL 3IAGC 2IQAB 2G2RA 2A1WL 2NY4D 1AGCB 2I24N 3ES6B 1QVOA 2ARWA 2IMNA 3QG7L 3D85D 1P4IL 4HHAA 3BDYL 3VWKA 3TCLB 1HHKA 1FPTL 3ZDXE 1IC4L 5TDPB 4TSBL 2X89D 3U30B 3BJ91 4WIQA 1U6AL 3IKKA 4NKOB 4RFNB 4APQB 3OKEB 3LVEA 3Q2CA 4LKXA 2C1OA 3MMEA 2WLZA 4Z8FH 2HVJB 3T4YA 1JPGA 4IS6B 4O02H 4QWWD 4G3YL 5GRUH 2DIAA 4F15C 2X4RA 4NZUH 3PNWB 1GJIA 4RCAA 1D5XB 1V8HA 1MJ8H 2ZCKL 3WS3A 5A1AA 1RK0A 4D9QD 2XWBA 4OI8A 1GOHA 1HHIA 4LVOB 3VRJB 4K7PX 3TJEH 5CZXD 3OQ3B 4AK1A 4A6YA 1RUQL 3WFEH 3ULSB 4RIRA 4U1JB 1GYAA 4UT9L 5LJYH 3OV6A 4WCYH 1DUYB 2H41A 5FYLE 3TC9A 1R0AH 1OTTC 2F54B 2O5YL 2VXUH 1IGTA 4F7MB 3MUGA 2X9WA 4XCYA 5F7KC 5FEBA 3DV4A 4JPVL 5CBAA 3MYJA 4UIKL 3CK0L 3W2DH 4UAOB 5B3NA 5JQ6H 4L3EA 2VQUA 5FDWA 3DMMD 5LQBH 1LILA 2IAMB 2P47B 3ARRA 4KHTL 1QYGH 2EDDA 5FM4A 1IVLA 4LCWE 5IWLC 5EC2A 3BJLA 1K8DA 1GCFA 2R1YA 4MAUH 4O2CB 2WP3O 4QXTB 3CVIL 2ZZUT 1MJ7L 5F71A 3CXHK 1O7VA 3S36L 1FYTA 2X05A 1JGEB 4XP4L 5MI0B 2VDRL 5DRWA 2OJEB 2DLTA 3V6ZA 3W0WB 3K3QA 2C7UB 3JV6B 2AEQH 5E99L 5JNYB 3QNXA 3RHWF 3SDXF 2VXTL 1L4IA 4Y4HD 5EORL 5DJDA 3PQYA 1LO4L 1BFVH 1UM6H 3D69A 1GOFA 2XIDA 1MFDH 3MGAA 2CKBA 4KQ4L 2Z31B 3GHEH 1J10A 3DO7B 3O8XD 4N8CL 4EZMA 3FQXB 3C6LD 1A6PA 4PBVC 3RY6A 3SE8L 4NT6B 4R7DB 3W11C 1JCKA 1TTGA 4LHJB 4XCEA 4KDWA 1UGNA 1NH6A 5D5MA 3MRMA 1PKOA 1F02I 2GUOA 1CFSA 1SBBA 3L5WB 5JHLH 1KCKA 1OP5K 5JORA 2ICEB 3I6LE 4J3WA 3GUTA 3KPSE 1FVDB 3ABZA 1T0MB 3UTPE 4PJBA 4ZG1A 3DXAA 4G80A 2NYYD 4L4TA 2MHAB 2IBZX 4X7TA 4GRLC 1G9ML 5DJZA 3LH2L 3UTOA 1E0OB 4KROD 3K4DA 4OF5A 3IYLW 4XPGL 1JHTA 4DGVL 4AG4L 3FONA 2XWJA 3QQ4B 1CGSL 4HUUA 3C08L 4NN5C 4PBWD 1BBJB 2DIBA 1R3LB 2HVKA 3PL6D 3E6HB 4OQTL 4R2GD 2D4FA 4JFXA 3WUWA 1FZMB 4OAWB 3EOAA 5DMJB 4U1LB 2WMPA 1NGQL 3SDAC 5EUOA 3I3DA 4PJIB 5TJWK 3NIDF 3MRCB 4PYHA 1FH5L 2HKFH 2VKXA 3DO3A 1MHPL 2AK1L 2VABB 1T5WB 1YC7A 5A40E 1RUMH 5JDSA 4C59B 3F58L 3QIWC 3BW9B 4H26B 5C7XH 1KTDA 3TV3L 4G7YL 1D5ZA 3BYTA 3CXDH 1A7NL 2CDFA 3PUCA 4LHUG 4WNQB 5DRXA 3S88L 5T1MB 1A7OH 4NPYA 4MNGB 1GSMA 4OGAD 2DWEB 2I5YH 3GJEA 3FFCA 5D1XC 4WHTB 2JJSA 5DMYA 3CDGB 3VDAA 1FNSL 3EFFB 4Y5VB 3GB7A 4F9LC 3SKOB 4FZEL 1AGDB 4LSPL 2ED9A 1YN6A 3HNVL 5DUBA 5KAQF 4OTXH 1AP2B 1YMMB 3L7EA 3NCBB 5CS7A 4IIQA 3SO3C 5KOVC 1MFNA 2Q86A 2C3HA 4K7PL 1OAZL 3LKPA 1HH9A 4GW4B 4WUUB 3PABB 3WDHA 3C87A 5EIVA 1OT2A 5FCUH 1T5XB 1WWBX 3EJJX 5T3XL 4K8RC 1I3UA 1EAJA 3GMQA 4FQXA 2IPKB 5I73B 1YPZF 2G75B 2R4SH 2V7NA 3VGDA 1EA9C 1M7IA 4TUJA 5ISZE 4LSTH 4E9LA 1CFNB 4PP1C 4BELD 3TPUE 2CUMA 2G5BB 5DTFB 4QHKJ 1PDKA 5DWUL 1HQ4A 3V0WH 2ZSWB 4I0CC 1XGRB 4XBEL 4QXGL 1R5VB 3BP5A 3FOMA 1D6EA 4ODSL 5E4IA 1AR1D 1KLUA 5HYJA 3CX2A 1MCEA 3O9WB 1R5IB 3HG1D 3TWCH 2YD7A 1JGLH 2GY7B 3KG5A 5C2UB 4BQ8A 1NAML 3SDDB 4BFEA 2ADGA 4WO4A 1YJDH 4LCCB 5KVEH 5E8DL 3L5JA 1A47A 3DV6B 2MCPH 4I77H 3K80A 1W0VA 2D0FA 1Q9OB 2AJYH 2BVOB 2K9UA 5HHMD 4F2MB 2W91A 4MNQA 2DYPB 4X6DA 2JELH 3KYOA 3S35X 3S4SB 2YPKA 2XQBH 2E6JA 3I6KA 4HIEB 5MP6L 3TBVB 3QXAA 3PWPE 2BVQB 4K3DH 4LSUL 4TVPD 2V9QA 5SWZE 5I0DA 4OZIF 3DROB 4TRPL 2WUCL 2BSRB 4ZO9A 5J13B 2EDTA 2E3VA 5HI4C 3V6BR 1NGYA 4DKEL 4X9HA 4HS6A 2HTLD 4KUZL 1KIQA 4YFEA 2NX5D 4U49A 1LHZA 5IMMA 3ZDYF 5I8CA 1DFBH 4AENB 3TP4A 1HN1A 3SN6N 3HR6A 1E4WL 5F3HA 3QHFH 4MVBA 4HUWB 1VESA 3IJHA 2V2WA 3N0PB 1BQHG 1Q72L 5DMGC 2YMXL 4NFBA 5C0AD 3VXPA 2P8MA 2WV3A 4JO2H 2FIKB 3W81A 3LOWA 3MC0A 5C08B 1RIHH 3UPCA 5LKNA 5HI5C 2ZKHL 5F3BB 4WI9A 1UYWL 2W07A 1MVUB 2PYEA 4GW1B 1DSFL 4W6WB 4WHYH 2P46B 2IWGA 3E8UL 5FYKL 5B3JE 1SYVB 1NGPH 4HX1B 5BVPH 1ZGLP 3EYFA 1DN0B 2D0HA 3TF7C 2GTZA 2NY1D 4S1RH 1KTLB 4G8IA 5D7SL 3VRIB 3FOLB 4NM8H 3U0WH 4GG6B 3IAQA 1RIUH 2B2XH 4ZTOH 3D18B 4Y8AA 4YPJA 2WWMC 1MWAH 3H9YA 1Y0LA 1T0NA 2MFNA 1OM3H 4Z6AT 3DURA 1K6QL 3TZVD 3LRHA 4QRPE 2ZUSA 4I0KA 4MS8C 3M45A 3C8HA 4R97B 4ZPVA 1LNUB 2HJFA 3H3PL 1I1YA 4X5XB 1KXVC 2DS4A 4ZAKB 4F7TA 3OKMA 4Q9BA 5IHZA 5GGUA 5IFHH 4ZS6C 2DLFH 2UZXB 5F6HI 3BRGC 1G9NL 2WUBH 4WY7L 4NRZB 5I18H 3NH7H 4KFZC 5KVGH 5CKGA 4RNRA 1DCLA 5D7IE 3SGJC 1PG7L 3V5HB 3PWJA 1FZJA 5AZ2L 2FRGP 1NLBH 1MWAB 2Q76A 2YEZB 3QH3B 4K94C 1URLA 3SDYH 2W0FB 1JWSB 4X6FB 2Q3ZA 4HK3J 1K2DB 4PREA 3TBSB 3IJSA 43C9A 2ZCHL 4BH8B 3MLUH 4Y2DC 4RA0C 5CEZD 3DJ9A 3AREB 4UTBL 3T0BA 5E6IA 4KH2A 4KRLB 2I60H 4LCWA 1G6VK 1UVQA 1IC5H 5CJXC 3MUHL 5DJ8B 1Z6JT 3QUKA 1UJ3C 3HAEG 4Q9RH 1HI6B 1PEWA 1T2XA 1PQZA 5B22A 4QRSB 4RFNC 4OIAA 5BZWA 3JWDL 4KU1A 1WIOA 2PW2B 4LGSB 4X7FC 5DD1H 3VA6A 5DK0A 2CDEA 2BXYA 4EOWH 3FL7A 2CLRA 3RGVB 2WQ8A 4PV9A 3UAJD 3VG0H 2VXSL 5DJ6B 3OAZK 5CZKA 4P5TB 5IW1B 4QT5B 3JZ7A 5CJ5A 4ODVL 3BHBA 3S35L 5DD6B 2Z9TA 3MV9E 3P30H 1I75A 3WN5C 3U46A 4D9LL 1U3HD 4M1DL 4LVOC 1IEBB 3OAZH 5E00A 5EWIL 5DZLA 3EJZD 1CGXA 1KB9K 3O11A 4GRMB 3HE7A 1OB1B 3BPOB 3JWOC 4X99B 5GS0D 3FQRA 3C60D 4V1DE 1FVCB 5KN5A 4IOSD 1KULA 2DDQL 3KPSA 1ZHBA 1FP5A 4PJ8B 4RMVA 4HIJA 4EI5A 3O2VL 2HT3C 4E5XB 4PS4L 2DKUA 1ZLSH 4G6FD 2Y5TA 3QIBD 4MQTB 4UAOC 2R2CA 3D0VA 2XNAB 5FIEA 5I8KL 4LQFH 1SJEB 2XI9A 1RZFH 2QQLL 2YPVH 4WFHD 1X5LA 2FX7H 1OSPL 3V4VL 3EOTL 4JRXB 5IROC 4AEEA 3MLZH 3IDIA 2EYRB 4LU5L 3RWJB 2P8PB 1J5OH 4HMDA 5DRZA 1Y6KR 1KF9B 2I07B 3FQNB 4Y5XA 2VLRD 1KCRH 1PGRB 4KRNA 4NZTL 1F00I 1H5BB 4R4FH 3T3ME 3WE6A 3DUUA 2R2BB 1IZJA 2NY6C 1MQKL 1V7ML 4PBXA 3O41B 5T1LD 4G59A 4LASH 4N9OB 4HV8A 4EN3B 4KTDH 3WHXA 5D72H 4GAGH 4HFWA 3MGTB 5BQ7A 2GY5A 1J8HE 4D2NA 2KH2B 4M61A 4XP1L 5FCSH 1RJLB 1DN2A 1LO2H 1GPOH 4P9HL 4IOFD 1OWWA 4P4RB 1G0XA 5F44A 4F7PA 4UU9A 3UPRB 3BRFA 3H9SB 2XOTA 5HGGS 4N1HB 4JDTL 1U8PB 1DL7L 5I17A 1GH7A 4UT6L 4H1LH 5HYSG 5EU7C 2J1KA 2LV4A 1KEGL 2NY0B 4HPYH 3OF6A 2YPLE 3EHBD 3LB6C 2AJVH 2UY7A 3BQUC 2ZOKB 4DK3A 2IEPA 4BZ1L 4PR5B 4PJIF 1YQVL 4KKBD 5D70H 2O61B 3LKNB 1PLGH 4M7JH 1A21A 4F9PA 1KB5L 3OJDA 3MLTA 1FO0H 4UIMA 4WEBL 1UZ6F 4X98B 5FYJH 3ULVD 5CBEB 1FLTX 4PRBA 4X7CC 1N64H 3QNZB 2ADIA 1VDGA 2P8LA 2YRLA 5CINH 5ISZA 3HPJA 3TPUA 4XP9H 4FG6D 2HT4D 3F65A 4GAFB 3QG6A 3IDYC 5EC1A 2N7AA 1A6WH 4PGZA 3VFNA 4TSAH 4K71B 2ARJA 1OGTA 4ZPTA 5CJOL 5DC0A 3VI4F 5JOFA 1A9EA 4WW2A 5HPMA 5TF0A 1NLDL 2BNRB 4JY6A 2HFEA