3GSXA

Crystal structure of the binary complex between hla-a2 and hcmv nlv-t8v peptide variant
Total Genus 78
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
78
sequence length
274
structure length
274
Chain Sequence
b'GSHSMRYFFTSVSRPGRGEPRFIAVGYVDDTQFVRFDSDAASQRMEPRAPWIEQEGPEYWDGETRKVKAHSQTHRVDLGTLRGYYNQSEAGSHTVQRMYGCDVGSDWRFLRGYHQYAYDGKDYIALKEDLRSWTAADMAAQTTKHKWEAAHVAEQLRAYLEGTCVEWLRRYLENGKETLQRTDAPKTHMTHHAVSDHEATLRCWALSFYPAEITLTWQRDGEDQTQDTELVETRPAGDGTFQKWVAVVVPSGQEQRYTCHVQHEGLPKPLTLRW'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HLA class I histocompatibility antigen, A-2 alpha chain
publication title Structural bases for the affinity-driven selection of a public TCR against a dominant human cytomegalovirus epitope.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
total genus 78
structure length 274
sequence length 274
ec nomenclature
pdb deposition date 2009-03-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00129 MHC_I Class I Histocompatibility antigen, domains alpha 1 and 2
A PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3gsxA02
3.30.500.10 Alpha Beta 2-Layer Sandwich Murine Class I Major Histocompatibility Complex, H2-DB; Chain A, domain 1 MHC class I-like antigen recognition-like 3gsxA01
1LO2L 5IF0B 1Y6KR 1AGDA 3BAEH 1HH6B 3CVIH 4UINL 4XP4L 3PJSB 3MLWL 3DX6A 3IDUA 3EDKA 4HS3B 3MRNA 4XMLH 1OF2A 3TNNB 4FQHA 3KPOB 3TBYA 4OB5H 3VXRA 4XPHH 2FDBP 1OSZA 2HT4D 4HHAB 4OM0H 5T1DH 5EOCH 1VADA 1N6UA 1G7LA 3AU1B 2DBLH 4UV4L 5BW7A 2WINA 4TOYH 2DQIL 3ZE2F 2DQDL 2YBRB 1UH3A 4L1DA 4M8QA 2APXA 3DX8A 2DB8A 2RIKA 4OBSA 3OKDB 1NCBL 2HH0L 5ALCL 4X4YB 4BH7A 4X4XA 5HJ3A 4HMDA 2BOCA 2C4FU 4PP2B 2AS5M 1DQLL 3P0YL 4X99A 4NHCL 3ORJA 5JLZA 2NXYB 2BVQA 3RTQD 1CFTB 3ILPB 1Q9OA 3R1GL 4HAFA 3H3KA 3QCUH 4U1IB 4KJQC 4LKXA 4Y2DD 2F53B 2LAAA 3KR3H 4HGWB 1MFNA 3IF1B 1OTSD 3QDAA 3QEGL 4M5ZH 4JFHD 5GQBA 2ADJB 4NRXB 5EWIH 4RMTA 3VXRE 1ZT7A 2R2HB 2DLGA 1I8IA 4BKLA 4JKKA 4Q9BA 2ZUQC 2XA3A 2YS4A 1OM3L 2DMCA 5T33H 2XKNA 4R90H 4PJAF 1X5FA 1RHHA 4DCQA 2E7HA 3TO2B 3DSFL 5HYQA 3HZKA 1A3LH 5J9PA 3I3EA 4D0CA 1RURH 1ZANL 5DC0A 3OKEB 2X7LA 4HULB 5TQ0L 1J8KA 3WNMA 4GAGL 1F00I 3BOVA 5IEHA 4QNPF 3VXMA 5FYLH 4JREB 4TTDC 3V4UL 1DBJH 4JDVA 2CK0H 4PB0H 5DJCA 1XIWB 3WUWG 1S7RA 1MOEA 3UMTA 4I48A 3QZWA 3U36B 5D96C 3MQIA 3MLSL 4JVWA 3QXWA 3G5XB 2Q6WA 4JG0H 1KENH 4YDIL 1BVZA 3ALWA 4X7DC 2MOVA 3S36L 4NCC2 1F11A 1TXKA 2H3NB 3MRJA 2W07A 4RDQF 5HHXH 3H3PL 1CFVL 5TE4H 4IRJB 1GPOH 5CD5C 2GITB 3CUPA 1K3IA 1R3KB 1IMHC 4JCMA 4I5BB 1XAUA 3W0WD 3DVFA 1PKOA 4QT5A 4K94H 3MV7D 1JZ4A 2FX9L 5LGKA 1T7WA 5CINL 3Q48A 4N8VA 1BM3L 3QXUA 4AM0A 3VXME 2ZJSL 4HCRL 4JQIL 1YMMB 4QRUB 2H26A 5DHVA 1EUUA 3H9SD 3MZTA 4AEIL 5DYOA 1CTNA 2YMXH 5DJYA 3S88H 4L4TA 4NM4H 3FCTA 2F74B 1A7RL 1NCWL 4GQ9L 3H7BA 1CICA 5ECJE 5TH2B 3ZHLA 4DN4H 5EA0H 1YNKH 4UB0L 1ZA6A 4P3DA 1N8ZA 3BH9B 1BBDL 3ARDC 2IANB 1UWGH 3BPCA 5F7KC 3U7AA 1ADQL 5T3XH 3DURA 2AJUL 1E4XL 3OR6B 2VL5A 1D9KB 4DZBA 4JFFD 1X6LA 5I66B 3HI5L 3O6ML 1A9BA 1MFAH 4MCYB 1B88A 1I8LA 3OHXA 4F8TA 3R8BB 4ZFOA 5HPOA 3FFCA 5GGUB 2IH3B 4YXHH 3H42H 2A6IB 1H0DB 3QP3A 4NOBA 3RWHB 1UXWA 4TSCL 3GMRA 4MJ2A 1INQA 3AFLA 4K07A 3MV9B 4QXUH 4XH2A 3T0VA 1NLBL 1UA6L 1BVLA 3I02B 4GW5A 4RQQB 3KPMB 3HNTH 5DQJB 4XI5C 2W92A 2A83B 5F9WC 1NBYA 2EKJA 3BP4B 1DBMH 3CJJA 5DLML 2VKWA 5D1QB 4JG1H 3TEUA 4PYGA 1UGNA 5ISZB 1ZGLM 4P23D 3AB0C 2VC2H 1MHPH 4PIRF 1QR1B 1KACB 5F89A 4L3EA 2AEPL 3U83A 1JTPA 4XC3H 5E08L 5CJQL 2ARWA 5IT2H 4XBPA 4OFYA 1PW3A 4U1KB 1TVDA 3MV01 2FEDD 2PXYC 4OD2B 3HCVA 2X89D 4N0FB 3FFCE 4H88H 3THMH 1U8IB 4BFBD 3LIZL 3QDMD 4W70A 4HWZB 4L8BB 5L6YH 4OLXL 1YQVH 2YZ8A 3NAAL 3L3HB 1S7SB 4OM1L 1EHNA 1CK0L 4PBVC 3FAXA 3G5VB 4LSQL 1DBBH 5HI5C 4POYA 1JTTA 2EZ0D 4AEEA 1L6ZA 4GXVL 3MRDA 3MBEC 2E6JA 1YPZB 5EU4A 1IM9A 4MNQB 4JQXC 5J7CC 4MJ6B 1FJ1B 5I1JH 3MLVL 5BMFH 4Z0BH 4J3XA 4L3EE 4Z77B 4PDCE 4U7SA 2VLMD 2WWMC 1WICA 3I6KA 1JI1A 3RNQA 2JF1A 5CZVL 2AJXH 2IAMD 5TF0A 1M7DB 2HJFA 1UCTA 1BJMA 3CFCL 5EZIH 1FVCA 3VXQB 1IGTA 1QD0A 4MB4A 2HJLB 3CH8A 4MJ5B 1QLRA 3JWDL 4RFEB 1S9YA 1KEGH 3SGJC 3GBML 4K55A 4JPKL 1XGYH 5GRYA 3PGCB 1ODAA 4IJ3B 3RL1B 3L5WB 4OFVA 5KANI 5DJ0B 5GGRY 3WSQH 3QXAA 4V1DD 3O3BB 1TJHL 1UQSB 2AK4D 4NNYB 4G9FD 2BNRB 3G9AB 2VKXA 2LU4A 1R3JA 3PWUA 1BFOB 4ZPVA 3ZDYE 5I75B 3FT3B 5JIIA 2AK1H 4Z8FH 2VLJA 1U3HB 2DQFB 3L6FA 4P2CG 2AKRB 4TVPE 3FRPA 4Y4HC 4HKJB 1J1XH 4UILL 1D5BA 4QYOB 1WISA 4NBXB 5HDBE 4BFIB 5F3HB 3TP4A 4CN4A 2BJML 2BSSA 5JQ6H 1H8SA 2P8LA 1T89A 2EDYA 4ESKA 1UT9A 3MRPB 1I3RA 1U8JA 1BIIA 3NGBC 2WW8A 4WY7L 1QKZH 5JMOC 2A2QT 4WW2B 5DMGD 5J6HA 4J4PC 4EN3D 4MZ3A 5IBTH 1IKFH 5GGSA 2KPNA 4WHDA 1YEEL 4PY8J 1HXMA 2P7TB 1T0PB 1XGQB 3GSUB 3MCG1 4MMZC 4P5TB 4XCFH 1F4YL 5HGGS 1JWUB 5TFSH 1N5YH 1TDQA 2E9JA 1OP3K 2X1XR 3OB8A 2VLJE 3PGDA 3DETD 4Q9QL 5KJRL 2OR9H 3D69B 4B41A 4LIQE 3KNBA 4NPYA 3S3SA 3Q5YA 4HK3N 3C5JB 4S1QL 3D9AH 4PJAA 3M1BB 1P7KB 3HRZB 4LPYA 5CD3A 2CIKA 3U4BH 5ICXB 1ZT1B 5H35B 3PQYD 3ZE2E 4Y4KC 3P9LB 5D7LA 1G7PA 4K2UL 1HZHH 3N85H 3TA3A 5EN2B 1A6UH 1N64L 3O8XC 1FN4A 5EZLA 5CEXA 1FRGL 5KOVC 3QHFL 4BZ1L 4JFQB 5K9QG 2BY3A 4JHBA 3KYOB 4KMTH 4NRZA 4KPHL 3MSPA 1KPRB 4U2YA 4IMLB 5DO2C 1SY6L 4KK8D 3CXDH 3IXAA 4FFVC 2DIAA 2CUMA 3FOMB 2MCPL 3IDNA 5IB2B 1I85C 3S34H 1FO0H 3QFJA 5EOQH 1I1CA 5EU3A 3U0TA 1KLUA 5F7EH 3GK8H 4XPFH 1REIA 4PJAE 3GRWA 1H5BA 2QHRL 3CK0L 3QCVL 3K81A 3HFMH 1KPVA 3FQRA 5C1MB 5D7LE 2B2XH 2ZUWA 1G6RA 1T2QH 2QQKL 5C70A 2HTKD 4FXKA 5D8JL 5J8OA 1Z6JT 3CVHL 2VXUH 5ADOH 4QNPE 3OBAA 5JZ7D 5DUPL 3NZHL 4NKMA 4WNQB 2E7CA 2R1WB 5CAYB 3DUSA 2HRPH 4KTDL 5FAAA 4AIXA 4G42A 4JFDD 4W4NA 1C5CL 4L1HA 4ZPTB 3P4NA 1KJ2B 1NSNL 4I0PD 4JVUA 3B2UC 4XBEL 4OQTA 3LRSA 3I3DA 5B39A 3QFJE 3VJ6A 4XPGH 1T04B 1EUTA 2YD2A 1U6AH 3LB6C 5IB1B 1TLKA 2CMRH 3WKNA 1PLGL 2WBJA 4XT1C 3OR7A 2EDWA 3NFSL 3RWFA 2DLTA 3WKMH 4LSVL 2NY3B 5FF6A 1LDPL 3RVXC 3ZTJH 2CUIA 5TDPA 5MP6H 1I4FB 2DYPA 1I9IL 3J8F7 4WFGD 1UXSA 4LKCA 1GGIL 4WDIB 5JQHC 5AAMA 3NFNA 3HAEG 2HVJA 1WT5A 1MCIA 1XF4B 4LCIH 4Z7OF 4KUZL 5DD0H 1TQCB 1YEHH 3H9YA 3VFUA 2BVOA 4ELKB 1G9MH 5FB8B 4HEPG 5IVZA 1LO2H 4M1GL 1MI5D 1HCFX 4XP4H 4UINH 3MLWH 3G04A 1KLGB 4K3JH 2NY5H 1YDPA 1ZHNB 4P9HC 1FE8H 4ZS7L 3HS0A 3S98A 4MA3B 3MLXH 4LPUA 1MUJA 5EIIA 1JGUL 2V2XB 2YKLL 4QRTA 4YO0B 4JM2B 4HZLB 4FQCL 1RZKC 1UJTA 3PGFL 3X14B 1ZHKB 4UV4H 1A6AB 5IMLA 1L0YA 4YXKH 1P5UA 2DQIH 4HPOL 4Z0XA 5I1AA 2DQDH 2JB5L 4MAYA 4IDLA 4XWOC 3R06A 3BGFB 3SCMA 1MIEL 1PSKH 2HH0H 3CNKA 5ALCH 2ZUTA 4DTGH 5IM7B 4JZJB 3M07A 4G8GB 1C5DA 1HQRB 3D25A 4RSVA 1FO0B 3TN0A 3DUHA 4WI9A 1CWVA 1RUML 5FYJD 2XRAH 2UUDH 1CGXA 1TZHB 5F1NA 2YC1A 4E0RA 3UTZB 3V9FA 3WFDL 2CQVA 2IALB 2X5PA 2KQNA 3WNKA 5ID0A 3BPLB 3QEGH 3TYGL 4UIMA 3LKOA 2XQYG 1CYGA 1RJLA 2DKMA 4LGSB 3FQTA 1HHIA 1JI2A 4HK0A 4MLSA 5H37G 4XP1H 4Z78A 3GGWA 4IHOB 4M1CD 3ARQA 3ESUF 2Q20A 3Q0HA 1OM3H 2UYLA 2D7PA 2VDQL 4P5MA 3VWKB 4X9HA 4E9LA 4S1DC 1KIRB 3EHBC 3MLPA 3EYUL 5HYJB 2GEEA 2ADIA 4OD1L 3NFPA 1QBLL 2RFXB 2C1PB 2FZ3A 2CKBA 3PXJA 4GAGH 5FKAA 2J6EA 1A2YA 1P69B 1PY4A 3I50L 4MQXC 2PR4H 1K6QL 4U6YB 3V4UH 5FFLA 2B1AH 5KSBF 4ZQKB 2BRRL 1XGPB 1K8IB 4QRPD 1CICC 3BGMB 5C0CD 2AVGA 3B9VA 5EC2B 1A1NA 4K8RL 3MLSH 3QI9A 4U6XA 4ZFFB 2CRZA 5EO0B 3D18A 4NZDA 1JF5A 3H9HA 3S36H 1ORQB 2GHWB 1MQ8A 3RJQB 4IRSA 3H3PH 1CFVH 1DR9A 1MCPH 5FECA 1I8LC 3C6LA 3CLEL 2EECA 5A2FA 5F7MC 3HC4L 3TNMB 5DK0B 4F58H 5EOTB 2R23A 1GGBL 1LO5A 4R7DA 4LCWB 1FSKC 3U1SL 5I17B 5F9DC 2ICWA 3VWJD 2XOTA 1J8HB 5KVEL 5L2KA 4NKDA 2ZJSH 4HCRH 3VGFA 1MFEH 4KDTA 4AEIH 3QB7C 1HYRC 4HSQA 1LO0L 3ULSB 4JLRA 1WITA 1XGTB 4HQQH 4QRSB 1KIQB 1NCWH 5EBLB 3BP7B 4GQ9H 3GKZA 4YK4C 5SWSA 1IEAB 4F33A 3FTGA 1HNFA 4JRYA 1PEZA 5JIKA 4WU7B 2VDRH 2AJUH 3BRDA 2PO6D 5ETUB 1G7QA 1FL6B 4XPTH 1HKLL 5ID1B 4ZAKD 2HRLA 2GAZB 1FVEA 5IB4B 4G80B 1RK0A 4MAUL 4O2EA 3VFVA 1C16B 1D3CA 4HFUL 1KGCD 1NFIA 5A3IC 5C0EA 5L2KE 2YPLD 4JPVL 4CNIB 4QRRA 1YMHA 5IHLB 2ZG1A 1LO3L 1P6AB 2XQBL 3L5HA 4TSCH 5GSVA 5JOPD 2ADFL 3Q3GA 4KY1L 5CLTA 1UA6H 4B7IA 4WU5A 2QR0B 3EUUA 1KEML 5DLMH 5ALBL 1DVFD 1OB1A 5SWSE 5I1LA 2HKFL 3QULB 1IVLA 5E2TL 4TULH 4WW1A 4JRYE 5DURB 4UQ3B 4NFBA 1D7FA 5IFHL 5F96L 4PRID 3BZ4A 2AEPH 1WEJL 5EC1B 4F3FB 5DK3A 5E08H 1AHWB 5CJQH 1Q0XL 3RHWK 1UVQB 1MCOH 2FD6H 4TSAL 2OTUB 3KPPA 2M2DA 3FO9A 5BV7L 4R4FH 1NDMA 3OTTA 3RWEB 4PRNB 1JYVA 3MLYH 4U1GC 4YGAB 5DSCA 5CCKH 3QIWA 5C7XL 3LIZH 1ZWIB 4QRRE 1JPGB 4HS6B 4OLXH 4FABH 1JHKL 5B22A 4POUB 1K85A 1T4KA 1CGWA 3NAAH 3V52H 4HG4K 2WY3A 4C54A 4GBXA 4NRYB 3BDBA 4U1NA 5BXFA 1EAPB 1CK0H 1NAML 5E8EB 5I18H 5B38B 1G0DA 4NQTA 4YE4L 3W39B 1Q8MA 4MD4B 1KNOA 4GXVH 5JA8B 4LVHC 3W11C 1UZ6E 3RTQB 2BMKA 3MLVH 2DD8L 4GO6B 4PB9H 2HVKB 4HUWA 1V7MH 3ULVF 4Y2DB 1FGNL 4WEUD 5CZVH 2CDGA 4JY5H 3T8XA 5JHDB 1T89C 4D0BB 1LEIB 3CFCH 4GLRH 4F15B 5EBWA 1MVUB 2FEEI 2HTLD 5DRNA 5AD0B 5IW1A 3VRIA 3GBMH 4XMKL 1WLHA 2NTSP 1EA9C 4QKXB 3J7HA 4LBEB 2Y25A 1RI8A 5IHUL 3S4SB 1JJUA 3MA9L 4LP4A 2NNAA 5KVDL 5HDLA 3F7VA 5H94A 4RGND 3TIEA 3UTTA 1VA9A 4PS4H 1OTTC 4JFED 4CVXB 5C92A 3LN5A 4MCZB 4OUUA 2DAVA 3CPLB 3G6AB 1SMAA 3IAPA 3BQUB 4DKFL 3T2NL 3TM6A 1JF1A 1PD6A 1EFXB 3QHTC 5DQ9B 3VXTB 5D6CB 3FZUD 3LKRA 1JFQH 2C3HA 2I9LA 4K3EL 4UILH 4AENB 5DVLA 5TGBB 3WMSA 3TA3C 4XAWL 5HI3C 3T0WA 3Q6FB 3IVKB 2HT3D 2YEZB 3VGGA 1VB9A 1F4AA 1XR9B 5C0DB 2IG2L 5DS8B 3RIFK 2NZIA 5BS0B 1ZT4B 5GRZA 4BSVA 4I3GA 3DO3A 1DQML 2HMID 5IKCB 1ES0A 2B5IC 3VFMA 3W0WB 5C0ND 2V17H 3PP4H 4X7TA 5K9OB 3BDXA 3FHAA 5SWZA 1YEEH 3FQWA 2AXGA 1VEPA 3UTTE 5K9JL 1NMCC 2X4RA 3ZTNL 5CGMA 5EFIB 3VGAB 43C9A 12E8L 2PYEE 3H9SB 1YEDB 2R0WH 5I9QB 1PKQB 4IIQA 4HD9A 4ODTL 1DANT 1HI6A 2VISA 4ZS6D 3LY6A 1Y0LB 5CJBA 1IAIL 1T7XA 3WN5B 5KJRH 1H5BC 2CR6A 3L3DB 1AD9A 3NABL 4KKBD 3IDXL 3U30B 3FHQA 4S1QH 4CKVX 4LOUD 3SDCD 4NT6A 1NL0L 4ZTOH 2DLIA 3CSYB 1NGXB 1GRWA 3V5KA 2CLVA 4YGVB 4RAHA 1E27B 4KROC 1KIPB 2E27H 4JHAL 4QHUB 4GKZB 2XZCH 4P9ML 4F7TB 2MCG1 3AC0A 4AL8L 1S9VB 2EDKA 5KSAB 1HHJB 4BZ1H 1KPUA 3N9GL 4EUPA 4PLOB 3D85D 5DRXA 1TNNA 2EDQA 4KPHH 2EDXA 2XN9A 4B0MM 2NR6C 5SWZE 5KSBA 4OSUL 4QEGA 2FCBA 4LGPB 4MHHG 1YYLL 1HHGB 3S6CA 2P49B 3QWOB 2BNQA 4OBRA 1CDYA 1JGEB 3UJTL 2GSGA 4AEHL 5EZOL 2CUHA 2LU3A 3ZO0A 1Z9MA 3ARWA 1YPZF 1I1YB 5C09A 3U7YL 1CLZL 1VEOA 5F1KC 1IFHL 1F5WA 3V95A 2WBJC 7CGTA 4ZMAT 3BEVB 1U41A 1R6VA 4YC2C 3L3OB 3BWAB 4P23B 3EDJA 1HHHA 3X12A 1IEBA 3KVQA 4FS0A 3GZKA 1S7TA 4AH2B 4LEOA 2XNAA 5I76B 4U0QB 1B0GB 5C6PB 3BIKB 3OKNA 3UYPA 3HI1A 1YEFL 4KDVA 3A6BL 5DUPH 4MD0A 3NZHH 4EDXA 2XN9E 1AGEA 1WT5C 5KSBE 1CDIA 5EUOB 2E6QA 3RWCA 4KTDH 2DWDB 3PWPA 2BNQE 1C5CH 4NN6B 5GRVK 5IF0A 3U9PH 1NSNH 1HH6A 1N4XH 2V5RA 4OI9A 3PJSA 1J05B 4HS3A 5C09E 3TNNA 4XTRC 1TVBB 3KPOA 3NZ8B 4L4JA 4N8PA 3V5HB 3ZT5A 3RUGB 1AY1H 4HHAA 4ZXBD 1NFDB 3S97C 3TH4T 3QNZB 3NFSH 4I2XB 3AU1A 1LDPH 5HVHB 1U36A 1DQTA 5IROA 3MV8D 2YBRA 1KB5H 1R5IB 1U8LB 4JFPB 1BOYA 4MAYC 3OKDA 1XT5A 3NIFF 2I24N 3DHMA 4X4YA 3SCMC 3W9DB 4WW2F 2VDML 2LFGA 1V3KA 4PP2A 1NC4D 1F58L 3WV0A 3PWPE 5K9KB 1DTUA 3TN0C 4RBPK 1CFTA 3ILPA 2IH1B 4KUZH 1X7QB 2Q87A 3VH8B 3ES6B 2VDOL 5IR1B 4Z9KB 4GAYA 2F53A 4HGWA 4J3WA 1IQWL 4NRXA 4M1GH 3MJGX 2P5WD 2R2HA 1MLBB 3BXNB 2BFVL 3V6ZA 4X6DB 5KAQF 5GGTA 4ZS7H 2BXYA 4NZUH 3VW3H 4YHZH 1J1PL 1OP5K 4HBQA 1JGUH 1VFBB 2YKLH 3TO2A 4DW2H 1ZGLB 1UM6L 4FQCH 3PGFH 4HC1A 1I7TB 1U2HA 3AY4A 3OKEA 3BDYL 1CT8B 1JNNL 2VQ1B 2JB5H 5D1ZB 1MIEH 1WBZA 1I3GL 3PP3H 4PJBB 5IOPB 4CDHA 1RUMH 2F53E 1A7NL 2P4AB 1XIWA 1U0QA 3VGHA 2X1QA 2H2PD 3U36A 2C5DC 3O2WL 5ELIA 4M7KL 3G5XA 3QPQC 1BX2B 3QI9C 1J12A 4KZEL 5GHWL 4V2CB 2NW3B 3EJZD 2H3NA 1OAQH 5KTEL 4IRJA 1NANH 2GITA 1ZVSA 4IRSC 3L7EB 2B4CH 1R3KA 3C6LC 2HKHH 4I5BA 4HIJB 1FYHB 2VDQH 1S7UB 3RGVD 2Z4QB 4PJ8A 2NXZC 4JANB 4PY8I 4WI8A 2CRYA 4AY0A 1YMMA 2VRAA 4OD1H 4QRUA 2CLZB 1QBLH 1CXKA 4KDTC 5DRZB 4GLRI 5I8KL 2PTTB 2X9WA 4QXGL 3I50H 4R0LC 1A02N 1CS6A 1U8QB 2F74A 1CDJA 1MRCL 3KPLB 5I8EB 2BRRH 3ET9F 4N1CA 4OF0A 1MWAL 4IRZL 5TH2A 4ONFL 3ULVE 5EDXA 3DXAB 3QQ3B 1TPXB 4GKNB 3IT8D 3BH9A 4F37F 1IAKB 4K8RH 2IANA 3VRJB 1WV7T 2ED7A 4JGJA 3VXSB 1D9KA 5I66A 4HIHB 3ZKMC 5D7KE 5E8OB 5T3ZE 3CCHB 4GRLB 4M6OH 4MCYA 5DC4B 3VD9A 3HHRB 5GGUA 4LCCA 2IH3A 4PRHA 3CLEH 5CGYD 3TIDB 2A6IA 1H0DA 3JUYA 1KV3A 1YMME 1GGBH 3RWHA 5FUOL 3U1SH 3QRGL 3VA2C 4NN5B 6CGTA 5M95B 3EYSH 4S2SB 2DM3A 3MV9A 3DMMB 4M6AA 3I02A 4RQQA 3KPMA 3JWOH 4YDKL 1D5XB 2A83A 3V5DB 5J0BA 3BP4A 4KI5D 3MGOB 3KXFB 2P44B 3NPZB 5D1QA 3MCLH 1NGQH 2JJTA 5ISZA 5HY9B 3U79A 2IANE 1QR1A 5I19L 3STLB 1JNHB 2ESVB 35C8L 4U1KA 2GKIA 4WHYG 5I1GL 4PR5B 3EYFB 1Q94B 4OD2A 4L3CB 1HKLH 4N0FA 3OKKB 1MEXL 2BCKA 1U8IA 4PRHE 4JM2F 4NUJB 1WVZA 3C08H 3ROLB 4HWZA 4L8BA 4KK5D 5CSBA 2J5LC 4HFUH 2R56L 4LLYA 4XP6L 1MCNA 3MV9E 3L3HA 1S7SA 1MCJA 1CR9L 4GBXC 3B9KD 2XQBH 4AIZB 3G5VA 3L9RB 3QIBC 1C1EL 1OW0A 2AGJL 5DT1L 2NZ9D 5ISZE 5HHQB 2H6PB 2XY1A 1KEMH 2XQYK 4MNQA 4MJ6A 5ALBH 1FJ1A 3SPVB 1T1WB 2HKFH 4KV5F 4O5LH 4LARL 4PJEB 3UROR 5EORH 1DZBA 4Z77A 2NY0C 1HSAB 3VFTB 4KTYA 4JGMA 5E2UL 1JPTL 2BSRB 3S96B 2ICCA 1JWMB 4JM4L 1H3GA 5F96H 1M7DA 1L6XA 1Q0XH 5FYLE 3T0EB 4TSAH 3VXQA 3O4OC 5BV7H 3QRFM 2HJLA 1FFOB 3A67L 3L3JB 4MJ5A 4WO4A 4RFEA 3WNPA 1YYML 4M3JA 3PGCA 4P9HL 1T80A 3L5WA 2BP3A 5DJ0A 4B50A 3O3BA 2XA8L 1UQSA 4POZD 1AH1A 2C3WA 2QQQA 4NNYA 3CSBA 2AW2A 4M6NL 4GMTL 2BNRA 4YEFA 2E8ZA 1WIOA 5J13B 3PV6A 2AXHA 1NAMH 4P2QB 3VGDA 5I8OL 4MNQE 1BFOA 3KHOA 4S1RH 4YE4H 1UFUA 4OT1H 3FT3A 4UBDC 4Z7VB 3RWIB 1U3HA 4KRPD 2DTML 1MQKL 4DWHA 5FCUH 2DD8H 2AKRA 2MQ0A 4Z76B 5FM4A 4HKJA 4QYOA 1FGNH 4HF5L 2VLLB 4BFIA 5F3HA 3U0WL 2NY1D 3DJ9A 1ZEAL 3MRPA 2Y5TB 2QLVB 2R15A 1IJ9A 3GFUA 4WW2A 1N0XL 3ARED 3X3FH 5GJTL 3TZVB 3O9WC 4YQXL 5IHUH 2IC2A 2BNRE 1C12A 2YR3A 1Q9WB 2P7TA 1XGQA 4P5TA 1NJ9B 5F8QC 1J1OL 5T3XE 1JWUA 5HGDA 1EO8L 1RMFH 5JIPA 1T22B 4LL9A 4MQTB 4ODUB 1B4RA 4IIQC 4LU5L 3BRFA 1IL1B 3D69A 3K46A 4IDJL 3ZT6A 3ZYIA 3C5JA 3OAZH 2OL3H 3M1BA 1P7KA 3HRZA 5GRUH 2K1MA 5ICXA 1KFAH 4XNUL 5H35A 4LGRB 4P3CH 4K3EH 3P9LA 4OGAD 4Q74A 3UJIL 3NIFE 5FKPB 1L8JA 1X6NA 3IXTB 5D1XB 2KQMA 3LS5L 5FK9B 4MDIB 3BKCL 4LSUL 4JFQA 4WWKD 1RZ7L 2PKDA 3KYOA 2B0SL 2IG2H 2A1WH 1X5HA 1DQMH 1KPRA 4IMLA 3UTSD 2OI9C 1NBVL 2O61B 1MREH 4OGYH 3V6BR 25C8L 3FOMA 3VWJB 1TFHA 5IB2A 5K9JH 4PBWD 3ZTNH 1DLFL 4P46B 3QEUB 3K3QA 12E8H 1BECA 4N0YH 5HI4D 1NCUA 1RUKL 1DL7H 1UADC 3INUL 2CRMA 3P9WB 3TVMD 5BV7B 5F9JB 3O41B 1IAIH 2Y07L 5T1LD 4MNHB 1AGCB 3IDXH 1EMTL 1G1CA 4Y4FB 3HLAB 1NL0H 5GZND 5LGHL 1P2CB 5I0ZA 4LK4A 4WFFD 3O4LD 4MA1B 1PJ9A 4HUMB 3QNXA 4KWUA 2BHZA 4KJYB 3W2DH 5D4QA 7FABH 4P9MH 3F58L 1EBPA 1NANI 4FN0A 4WNQA 2R1WA 5I73B 1GIGL 1NAMB 3GHBL 3MJ6A 4OGZA 5DVNA 4F7EB 3ESVF 4Y19B 1G7MB 2A6JB 5EBGA 1F6LL 5HVFB 5JW4Q 3BW9B 3PNWB 1YYLH 3I9GH 4ZPTA 1EVUA 1R24B 1WAAF 3U4EB 4DJMA 2R8SL 1KJ3L 2XACC 3VFNB 1GSMA 3UJTH 4C57C 1T04A 2I26N 4X9FA 2X70B 4XNXL 5HYSB 3NCYP 5EZOH 1YZZA 4FQLH 5IB1A 1RZJC 5TE7L 3UBXB 1IFHH 1QSFD 1L7TH 3O0RL 3S7GA 4OKVB 3C5SB 3CLFL 1I4FA 4PG9B 2NY6D 2RCSH 5IROC 3RFZC 1QR4A 3HE6D 2H32H 4FG6C 1RULL 4WDIA 4BUHA 2R0ZH 3BSZL 3A6BH 4FXGA 3ME0A 1XF4A 3K0WA 1U95B 3LAFA 3VXPB 1S9WB 2X42A 2NXYC 1IT9H 5CWSB 1ZA3B 2V5TA 5CIPH 1ZHLB 5DGRA 1U8NA 1YJDC 2EDBA 1ITBB 2VN7A 4ELKA 2OL3B 1WZMA 5FB8A 1ED3B 1N6QH 4CN6A 3QDGB 1FL3B 1KLGA 3V0WL 4KAQL 1ZHNA 4D9LL 2W1NA 4LVOB 4JR9L 5IEKB 1BZ7B 4NGHH 3STZB 4YHML 4MA3A 5D96B 4G6ML 1AIFA 1ETZA 2V2XA 1LGVA 4YO0A 4JM2A 5D7JB 4HZLA 1FGVL 3PWVB 3X14A 1ZHKA 2MKLC 1A6AA 5TDNB 1B4JL 1KCUL 4IS6B 1ND0B 3AY4C 4FQ1L 4DQOH 3E2HC 5KVFH 1EJOH 4X98B 1MAML 3D3VB 5IM7A 4JZJA 4G8GA 3K2MC 1HQRA 3EO1B 4JREC 3ZSTA 3VFWB 1FO0A 5FUCC 4M43L 5T1MB 3VXOB 1TZHA 4NZJA 4XZUB 4J8RA 4ONHB 1XIWC 2VDOH 3WHE0 2IALA 1SVZA 3OPZL 3VCLB 4HMEA 4TUJB 4WFEE 4OD3L 2X4QB 3ULVC 1EHAA 1NCCL 4OF8A 3SDXB 2L0DA 4G7VH 2BFVH 4IHOA 2N1KA 1JBJA 2CRIA 4ETQB 1TCMA 3ARDB 1BHGA 1J1PH 1P1ZB 3VWKA 2Z0BA 4PJ8C 1UM6H 4H5SB 1O7VA 4G8GE 2RFXA 4GKOA 5E99H 3S35X 5JPMB 3BDYH 1JNNH 2HLAB 4PJHB 2HA1A 4U6YA 4GS7B 3QUZD 1N0LA 3UTPD 1I3GH 2IPTL 4ZQKA 2V5SA 5FO9B 1XGPA 1K8IA 1HEZB 3MYZA 1QOKA 4KV5E 1A7NH 3BGMA 5DFWH 4A6YL 5EC2A 5AZ2L 3CU1A 1FYTB 2X44D 3LDBC 3M8OL 4M7KH 2AEQL 4ZFFA 1IGJB 4JY6B 3ZKSD 2E6PA 3QPXL 5EO0A 2X41A 5GHWH 4KZEH 3BP6B 4LVEA 1ORQA 4OFKA 2H32B 3AB0B 5F6IB 1Q9LB 5KTEH 4ORZC 5BJTB 3ZE0F 1MIML 3LS4L 4CU8A 3MNZB 4LCCC 1CGVA 2BERA 4XXDB 3TNMA 5DK0A 1JTOA 3WFBH 1VFUA 5EOTA 3SDCB 2QQLL 4L9DA 5I17A 4LCWA 3NCCB 4GAJL 3GRWL 4X4ZA 1FDLL 1J8HA 4K7PL 3UBXI 4ISVB 4M00A 4PJFB 4APQD 4PRBB 3KLAB 3MACL 4H1LH 5I8KH 5GGQL 5EUOF 5F7YC 4QXGH 1QFPA 2HLFC 5GIRB 3ULSA 1AGFB 1XGTA 2Z8VC 1JNLL 4QRSA 1KIQA 2JJTC 4MVBC 4P4KC 4KGLA 4GSDL 4UMGA 5EBLA 4F2MB 1MWAH 4IRZH 4ZUSB 4WCYL 1IEAA 1QO3B 3RI5F 1VDGA 4ODVL 2VLKD 3VDBA 5IB5B 1WSST 3MBEB 3QUYD 2PNDA 1X44A 4X6EB 3RUGF 5IV2B 2R4SL 1NFDF 5ETUA 1FL6A 5ID1A 4OQTL 2GAZA 5IB4A 1KELL 5F6HI 2G9HB 4OLEA 1C16A 4LCWE 1OGAD 1FL5B 2Y36L 4OFPA 1J8HE 4CNIA 3CX5J 3PL6A 4QHNB 5BZWB 1OQXA 4IOIB 5IVNA 2P8MB 2UY6A 4W81A 4FQXD 3TESA 1OW0C 4ODXB 2CDEB 3FB8B 3MRMB 1UEMA 5JXEA 4N0CA 3QULA 5FA4B 4QXTB 1MH5A 1FNLA 1A22B 4D9QE 1R3LB 4UQ3A 5FHAL 3ALXA 1KYOJ 4K94C 3R8QA 3L1OL 1MHCB 5EC1A 5I19H 4F3FA 1GOGA 5BVPH 3HNSL 1AHWA 4KHXL 1NUFA 4X6DF 1UVQA 4G6AC 3DECA 2OTUA 3ULUC 3RWEA 4PRNA 1CFSB 2NY4B 4TPRL 4ZXBB 1IAII 4WO4C 1MEXH 4W4OA 3RVWD 2A77H 1ZWIA 4IJ3C 1H3WM 1RV6X 4G6JL 2V9QA 2AV1A 4R2GD 1JPGA 4B7LA 4HS6A 4XVUD 2R56H 4XP6H 5C08B 1VSCA 3HNVL 4UT7L 1FHGA 3ZT7A 4LLMB 3WJJA 1BFVL 4NRYA 1WAAA 1CR9H 1EAPA 3RJDA 5ANMB 1F4XL 5GS0D 1AXSB 1NH6A 5E8EA 5B38A 3JWNC 4IOSD 2A6DB 1BAFL 1C1EH 3MRBA 4PJBF 3W39A 3K4DA 5DT1H 5I75C 3QBTB 1I1FB 4BSWB 3RTQA 5F1SA 5F70A 1U3HC 3KPSB 2HVKA 5FM5O 4LARH 4Y2DA 4NM8L 3I84A 2IPUK 4TUKH 1CBVL 4JM4H 5JHDA 4HEME 4MJID 1QYGL 2P5WB 4K7FB 4D0BA 3UTQB 3GMNB 4HCRA 1LEIA 1CXHA 1V05A 4H1LB 4DGVL 1MVUA 5AD0A 1DANU 3CZFB 5BRZD 5MENB 1EEQA 4LBEA 5HGAB 1WAAE 3S4SA 1MWAB 4QCIB 2Y4SA 1ZLWH 5CJXA 3TJEH 3OQ3B 4M6NH 4P5TC 4GMTH 3MUHL 4PLKC 2D4FA 1QRKA 1D5IL 1AFVL 2VYRE 4CVXA 3CPLA 3G6AA 1S9KC 5JW4N 3MA7B 4OFDA 1AO7D 1UENA 3BQUA 3CXHK 2CKBL 2YD4A 4EDWL 2J6EL 1EFXA 4HGKC 3VXTA 1I1RA 3VG9C 1KUMA 5JHDE 4AENA 4IOFD 5TGBA 4HF5H 4N90D 4KKNA 3U0WH 5A2JH 3Q6FA 3IVKA 4ORGB 1ZEAH 2YEZA 4UDUB 1XR9A 5C0DA 4HIIA 4FFYL 5JHLL 5DS8A 5BS0A 1N0XH 1ZT4A 1BLNB 2ORBL 3BKJL 5IKCA 3UDWC 1M05B 3W0WA 3C2AL 2ZUVA 2VDLL 5K9OA 5DD1H 2G5BB 3MV7A 5DK2A 5JDJA 2GW5A 2PW2B 4LPWA 1FC2D 1EO8H 1YEDA 1NGWA 3H9SA 1MRDL 1PKQA 2JJWA 5I15L 4KJWC 1WIUA 3WEXB 1Y0LA 4IDJH 1T3FB 3L3DA 5HXMA 2D4DA 1OF2B 3CSYA 2ICEB 1NGXA 4CDGC 3TBYB 4YGVA 2R39A 3NPSC 2V2TB 1E27A 2H2SD 4BH8B 1JGLL 1OP3H 4NDMB 4GKZA 4QHUA 5EZJB 5GGVH 3UJIH 4F7TA 1RPQA 5BS0E 5KSAA 2DIBA 1B3JA 3BKCH 1JFMA 1RZ7H 3W0WE 2WINB 4KVNL 3VRLF 1FAKT 3MV7E 4U49A 1P4LB 2IFGA 3ZKXC 2K9UA 1SEQL 4XB8A 1HHGA 2A38A 4P2OD 1NBVH 3QWOA 5AWNL 2BOCB 3T4YB 5J3HC 1JGEA 3H9SE 25C8H 1PKQE 1PEWA 5JLZB 2ERJB 1I9RL 5CD5D 1DLFH 2Z8RA 1EO7A 1I1YA 1NEZG 5DUMH 4ZO7A 2APTA 2BVEA 3BEVA 4P99A 4PJEF 3KYMB 3ARVA 3TJHD 3L3OA 2FBOJ 5DI8B 2Y07H 3BWAA 2NY3C 4P23A 1A8JH 4RMRA 4S1SL 5LGHH 3KPTA 5DC9B 4AH2A 5CJ5A 3ARSA 1I75A 1PG7L 2APBA 3HMWL 5I76A 2JCCB 3IB4A 1B0GA 3BIKA 1QBAA 1FFQA 1RHHB 4YNYB 2BY0A 3F58H 3OKLB 4RIRB 4X5WB 3U82B 1LDSA 2ICWJ 5CP3H 1GIGH 3GHBH 2UY7A 5EUOA 3AS0A 2DWDA 5DDHB 5F9OL 2QHLA 1KULA 4H25B 2UZXB 5DFVD 5BVJB 1S5IH 5IEHB 2R4RH 4NZTL 1PX4A 3KJ4B 3W5MA 1C7SA 1S7WB 4KKAC 1KJ3H 3IAQA 2RQ8A 2IPKB 4BQCA 1J05A 1HQ4A 1MNUL 4YEEA 2VOTA 2WBKA 2E7LC 4XNXH 1TVBA 3NZ8A 4S11A 3V5HA 1HXYB 4OLUH 1C8PA 4Z7VF 2BC4B 2YRZA 4P2RB 4WVRA 1NFDA 3QG7L 4V3DB 1LILA 5TE7H 5C0FB 5C0IB 2AXJA 3ZE0E 4J3UA 3P77B 5GRVL 2I9TB 4JM2C 4I2XA 4Q9RL 4ERSL 4KHTH 1I9JH 3DI3B 4G6KH 3LN4B 4M4RA 1U8LA 2V7HB 4JFPA 4PP8C 2IAMA 4H0HB 5A16B 1CTOA 5HGHB 3OV6A 1XF1A 3QDJB 5EUOE 3BSZH 1P7QB 1ZK9A 4MXQD 1TNMA 5K9KA 4NJAL 4ALAH 2IH1A 3ES6A 1I9EA 5IR1A 4UT9H 1VERA 1PVHA 5E5MB 1QSEB 3AXLB 2Z31B 3SE3A 2EEBA 3X11B 3BPLC 5F8RC 5D7SH 4L4TB 2PXYD 1I1AB 1MLBA 3V0WH 4UNVA 1NFDE 3SJVD 3BXNA 5IGXH 2R1YB 3DLQR 3H7BB 4X6DA 1FCGA 4HWBL 3GMLB 4P5KB 4I2XE 4G6MH 2QV2A 4RA0C 4R97C 1VFBA 2VLME 1ZGLA 4KRPB 3MRRB 5D2LB 4JO1H 4UIKL 4LAJH 1I7TA 2DWEB 2DQEL 2GJ6B 3PV7A 5HI5D 5J11C 1CT8A 2KH2B 2VQ1A 3OF6D 1L0XA 5JR1L 5D1ZA 1MAMH 3KJ6L 2LABA 2X6MA 3N1FC 1U8KB 4PJBA 5IOPA 2VQTA 2EYRB 4M43H 4DAGL 4AT6B 3LQZA 3RZWA 1GJIA 1ITCA 3M17B 2BXZA 4U2ZA 1BX2A 3R4DA 4X6DE 5F7LB 1MJ7L 1CLCA 5C71A 1NCCH 3O6KH 1RUQL 2NW3A 4HMCA 4YK4B 3QUMH 1GOHA 1JPSH 3V8CA 3CDYA 3UZQA 3L7EA 3QSKB 2YD1A 2V9TA 1S7UA 2Z4QA 4X5XB 2EDDA 1DDHB 4JANA 3TO4D 2OP4H 1G9MC 1AJ7L 4MMXC 2CLZA 2ZSWB 1W72L 5DRZA 2PTTA 4PJBE 2NY5C 3EW3B 2CR3A 3GMOB 3RKDC 1U8QA 4XNYL 3KPLA 2IPTH 5I8EA 5AAWA 4FA8A 4LSDA 1EEUA 4M7LT 1IAOB 5GRXG 3DXAA 3UTSB 1CVRA 4GKNA 4A6YH 4RX4D 3IU3B 4QO1A 5AZ2H 1GGCH 4QWWC 1IAKA 5GS1B 3VRJA 5E2WL 3HG1D 3O6FB 1E4KA 5SV3A 1KB5A 3VXSA 2QADC 4K23L 2Q8AL 4HIHA 2FO1A 5E8OA 3WXWL 2QL1A 3CCHA 3TVMB 3BZEB 3B6SA 4M3KB 1OAYL 3JUZA 5IMMB 1XCQB 1MIMH 3LS4H 4P59L 5KZCD 4NJ9L 5DZOA 3V8OA 5T5NG 1EO5A 5ENWB 2QQLH 4C56D 1OD9A 2D7OA 3PDDA 4GKSB 3PL6C 2DOCA 3O4LB 4U1GB 5DD3H 1NGZB 1QLRB 4K7PH 4S2SA 1MCQA 2GY7B 1NUNB 4JEGB 4PJ5D 3DMMA 5MEPB 4QLRA 4N8CH 3FRUA 1D5XA 3V5DA 5GGQH 3MGOA 3KXFA 1MFDL 3DXAE 4N0CC 1MCDA 3GM8A 1JNLH 5HY9A 4GSDH 5GZOC 1OAKH 4NWTL 3O8XD 3VXSE 2DM4A 3STLA 1JNHA 4AYFA 2ESVA 4G8EB 3RIAF 4PR5A 3DSNA 1CGYA 2R4SH 3QA3B 3EYFA 1R3HB 3L6FB 1Q94A 4QF1A 2VABB 4L3CA 2DJ4A 2LQRA 2HT4C 3L3KB 5DO2D 4JPWL 4NUJA 4W4OC 1YNTB 3ROLA 4YHLH 3RX7A 3T09A 4FFVD 1F2QA 5C0AB 5E95B 2Y36H 1RZJL 2VR5A 1NUDA 2BX5A 1U8JB 3IRZA 3WJJC 3OG4B 4LF3A 2R29H 4AIZA 2CH8A 3L9RA 5AYUL 3KXFE 5C9JB 5LXGH 5JOFB 4S0SD 2J4WH 5GGSB 5HHQA 3V7AG 4PV9B 2H6PA 3SPVA 3RTQC 3V4PL 1T1WA 2EC8A 3NOIA 4PJEA 3NMEA 3QWQB 5TPWL 2IQAB 1R5VB 4Y2DC 3VFTA 2X05A 1U3ZA 1WZ1H 2DS4A 3ZSSA 1BQUA 4B5EA 1OTSC 2BSRA 2ESVE 5FHAH 3S96A 3SDXF 1JWMA 2R9HD 3L1OH 1FFNB 1YJDL 3HNSH 4KHXH 4GRMB 3K4AA 2WNGA 1TTUA 1WK0A 3T0EA 2CIIB 5EIVA 1FFOA 5EBMB 1GZPB 3MLTB 4F15C 4TPRH 3VRLE 3UPRB 1S7QB 2XKSA 3KDMB 5LCVH 2BHYA 1MRFL 1G7PB 2IQ9H 2VAAB 4LHUG 3TA3B 2GSIB 4MB3A 1U9KA 4KQ4H 4NQDB 5E24E 5CJXC 1NAKL 1EBAA 3HNVH 4UT7H 4A6YB 3OAYH 4NWUH 1BFVH 4PJHF 1KJMB 4MA7L 2F5AL 1F4XH 1IGML 2DLHA 4P2QA 1NPUA 2N7AA 4HC1L 2B5IB 3T3PF 4M9PA 5E8NB 4NQEB 15C8L 1EEYB 3HE7D 4PJEE 5KOMC 3RWIA 4Z7VA 3ZDXF 3CU7A 3HC3L 1NMCB 1YEGL 4EBQL 4Z76A 5DJAB 3D2UB 2J1KA 4F9LA 2VLLA 2ZKHL 5E8DL 3T0EE 3LV3B 3O81A 1CBVH 1JRHH 4Y1AB 2DF3A 2Y5TA 3ULVL 2BRQA 5CS7A 2WM0A 1MFCH 1FNGB 4RRPG 3ARZA 3QJHB 4UI2A 1CFBA 4DFHA 1K9TA 4PJFF 1QFUL 1XGRB 1NJ9A 4P2QE 1AQKL 3IDMB 1ZOXA 3D39B 1T22A 3B8SA 3VGAC 2FIKA 3BEWA 4Z7VE 4ODUA 5I9QC 2DQTL 4PGEA 5E1AB 1D5IH 1IL1A 1AFVH 2N4IA 5EB9A 3CVIL 1NBQA 2N56A 3WNNA 3NCEB 1OY3B 1VEMA 1RIHL 2KBGA 2VZVA 4XMLL 5IUSA 3U30C 3EO9L 2OJZH 4XWOD 5K93A 3FN9A 5GSRB 4XXCA 3VXMD 1MELA 1OLLA 5FKPA 4AMKH 4WRLA 3IXTA 1NQBA 5D1XA 3RWFB 1U42A 2YUWA 5D6DA 4MDIA 2YHGA 5FK9A 5KSAC 3K8LA 4FFYH 3REWB 5JHLH 2ORBH 2C3GA 3BKJH 4MYWB 3C2AH 2O61A 4PJ7B 1INEH 3NFNB 1S7VB 4PJGB 3VWJA 3OJ2C 4AQOA 5IFAH 3HR6A 1JUFB 3C60D 4LRNL 4P46A 3QEUA 3GJFH 5D7IB 3KR3L 4N0UB 3A0OA 5F9JA 3LEVH 3O41A 1JMZA 3TT1H 4MNHA 1AGCA 3JZ7A 1VGKA 1EGJL 2L7JA 1A14L 4P23C 5IMKB 4Y4FA 3HLAA 1P2CA 3F7YB 3QXTA 3PABB 4KJYA 5T33L 1JGLH 4MQXD 4JFZL 4K3HA 1MUJB 3BPOC 3SKNB 3IKKA 1A3LL 2FEDC 3IJSA 3QUXB 1NAMA 2D7TL 1SJHB 4NC1E 1RURL 2DKUA 1PX3A 4O9HL 4G43B 4F7EA 4KVNH 2JIXB 4Y19A 1G7MA 2A6JA 3PWLB 4OLWH 2VZ1A 2MMXA 4NN6C 3PNWA 3SCMB 5TJWK 1TQBB 1R24A 1GZQB 3U4EA 1RD6A 2YPLA 5BO1L 3VFNA 2GCYB 1C5DB 4G6FB 5AWNH 1NKRA 1QTYT 4PB0L 4O4YL 2KKQA 2X70A 3TN0B 3WUWB 4IEFB 5HYSA 2YC1B 1TITA 1X5YA 5I1IH 3UBXA 2EZ0C 1JZ2A 3ALPA 4MX7B 5C3TA 3PWNB 4NQCB 4OKVA 1FNEB 3C5SA 1NDGB 5C0GB 5HVHC 4PG9A 2EC9T 2A6KB 1VESA 4FTVB 5HHXL 1T2JA 5TE4L 1GPOL 4EXPX 4RMUA 2M26A 2IAMC 2YA0A 3N50A 4UNTA 3OG6B 5FXCH 2J12B 3B2VH 3N1GC 3ARPA 1TTGA 4P5MB 4K94L 5IW3A 4YHKH 4Y19E 1U95A 3VXPA 1S9WA 1HOCB 5AG8A 5CWSA 4M9OA 2Q7YA 1ZHLA 3ULUL 5CUSL 4L3ED 5FGCB 2FSEB 2OL3A 3SE3C 4JB9L 4OFYD 1ED3A 3S88L 4HKZB 3QDGA 1FL3A 5D5MB 1I8MB 2DL2A 5IEKA 2FWOB 4DN4L 5EA0L 3VE0B 1BZ7A 3EKCA 3STZA 4OCRL 3RWDB 3QG7H 2JJVA 5D7JA 5A3ID 4YAQB 5T3XL 1C7TA 2RB8A 4OLVL 4Q9RH 5TDNA 2GIYA 4PJDB 3FQUB 4IS6A 5DF0A 1ND0A 1MFAL 4XNQB 4X98A 3RVVD 3ABZA 4PUBL 3O45B 5FECB 3KHQA 3G6JB 1I8KB 3EO1A 1IM9D 3VFWA 1FLTX 3GJFB 4OZHA 3QH3B 3BN9D 2WZPD 5D9SB 5T1MA 3VXOA 5BRZB 3TWCL 2ICWB 4XZUA 5DMGC 4ONHA 1WFUA 1RZGA 4JZNA 1FZJA 2EIBA 3NCBB 4TVPD 4YHPB 1H3VA 3QDGE 3VCLA 3HNTL 4TUJA 4WGVB 1YNLH 2X4QA 4NKOB 1AC6A 4R0LB 3SDXA 3TPUB 1PGRB 2Q8BL 3MO1A 4TTGA 4HKBB 2BVYA 1J9CT 4JFEA 4M48L 2D9QB 4HWBH 4L4VB 2X4PB 3GSVB 3IFLH 4ETQA 4XC3L 1AO7B 3ARDA 4QGTA 1P1ZA 3U46A 1UM5H 3SQOL 4P57B 3BE1H 4H5SA 1SJXA 3MUGB 4GXUM 4H88L 3THML 2DQEH 3MROB 3SKJH 2DQCH 2UZYB 1FVEB 4GRWH 3SDDB 5JR1H 2HLAA 4PJHA 3KJ6H 2VLJD 5FO9A 1HEZA 4U3CA 4JO2L 3CZJA 1MCLA 5IFJB 5L2JB 1DBBL 3E8UH 4KK8C 2YA1A 1TPXC 2X4SB 1FYTA 2AQ1A 3SDXE 1XF2B 1IGJA 4TNVK 3T2QA 1MPAH 4RGOL 1A7QL 3TBSB 2P46B 5I1JL 3BP6A 4JFEE 1CD9B 2H32A 4LSSL 4N68A 1BJ1H 1BQHB 3LZFL 6FABH 3RZCB 1Q9LA 1BJ8A 3MFGB 5BJTA 2B20A 2AJXL 3MNZA 2AQ2A 4AK1A 4XXDA 5CIPA 3SDCA 1YEJL 1T21A 2K7QA 2JCCF 3DTXB 4NN5C 1CDCA 2COQA 2HTKC 4PJHE 1AJ7H 4PJFA 4PRBA 1XGYL 3KLAA 1W72H 3T3PE 5JZ7C 2W38A 1CE6B 2BK8A 3BGAA 5GIRA 3IGAB 1AGFA 1LO4H 3ZDXE 1IQDB 1II4E 4MQ7B 4OF3A 4XNYH 5IIEB 1FYTE 4F2MA 4ZUSA 2DKSA 1QO3A 3QIBB 4P2OB 4YFLI 3NVQA 4ZG1A 5IB5A 2BVPB 3MBEA 4GW4B 1U8OA 4X6EA 4YFDB 5IV2A 4Z8FL 2Y6SD 1CGTA 4RFOH 5E8PB 2Q8AH 1J1XL 3K1DA 2FYYB 1LP9B 2G9HA 4NO3B 4RWYL 3T1FB 5JQ6L 1FL5A 1KG0B 3O2DL 4P59H 1QKZL 3O4OB 4F7CB 3T08A 4PJFE 1T1XB 4QHNA 5BZWA 4D9RE 3A6CL 1G0YR 3QFJD 2DQHL 4L5FL 5EBWB 4IOIA 1CLOL 5DRNB 1UH4A 1KSRA 4NSKB 4CJ0A 1P84J 3P73B 4MS8A 1IKFL 4ODXA 2CDEA 3FB8A 4Z95L 4XP9L 3MRMA 4R26L 1RIVL 1MFDH 5FA4A 5TFSL 4QXTA 3F7VB 3HAEH 1N5YL 2B4CC 1UWXH 5H94B 4KROD 3RA7H 4EOWL 1R3LA 4NWTH 1MHCA 1OHQA 2OR9L 2R0KL 4E41B 1E28B 3ISWA 5K33A 1KTKE 5MERB 1BF2A 3MJ7B 2EE9A 1CFSA 2ICWI 4GRWB 4ZOCA 2DQJH 2ZCKH 2WLYA 4ZXBA 1JF1B 1ZS8B 4PJCB 1L9MA 3KAAA 5F44A 4JFOB 5D2LF 1CFQB 2EH7L 5LAXB 5FGSA 1WC7B 2DI7A 1U93B 5GS2H 5C08A 3MRIB 4MB5A 3CFKB 5I71B 4LLMA 2E5EA 1MCCA 4M1DH 4KMTL 1YN6B 2O5XL 5ANMA 1AXSA 2WBJD 2WUCL 3O9WB 2A6DA 3EDEA 3CXDL 2O5YL 4DGYL 4WHTB 1I1FA 1KB9K 4BSWA 3ARBD 2V7NB 3V4PH 5C0BB 3KPSA 4PD4K 1WQVT 1X5KA 3S34L 2OJEB 3MFFB 1JPST 4H26B 5EOQL 1ZLUK 4F9LC 2WWKT 4OKDA 2Y1VA 2VWEE 4U0RC 3T1WA 3K7UA 4D2NA 2VB5A 2P5WA 4K7FA 1N26A 2YD3A 1YJDH 1ZTXH 4FFZH 3SJVB 1MSPA 4N9GB 5DMKB 4I0CC 2OR7A 1RZFH 4H1LA 1W72B 4H20H 3BUYA 3JWOC 4N1HB 4M1CC 5E6YA 1OOAA 5H37H 1IRAY 5MENA 1MRFH 2VXUL 5HGAA 5C08E 5ADOL 4K3DL 3F5WB 4OZFH 4E42B 1MWAA 4QCIA 5ANME 4C59B 2VUYA 4F37K 1M7IB 2HWZH 1NAKH 4RMSA 1Z9LA 2XG4A 5JDSB 1IGMH 1I7ZB 2OI9B 5D93B 5CSGA 5INCB 3KS0H 3KPSE 3MA7A 2BNQB 2FH6A 2IGFL 3HC3H 1JYWA 5HHMB 3OWEA 1N2RB 1H8OA 1U6AL 3WL9B 1XZ0B 2P5WE 4V3EB 1IC7H 4FFEX 1JWSA 2CMRL 5C09B 1SBBA 1BP3B 5E8DH 1ZLSH 4LLQB 2P1YA 2YPVH 4ORGA 4ODHL 5D1XC 4UDUA 3JV0A 5TDOB 2FL5B 5MENE 1D6EB 1V3LA 4O00A 4YZFF 3X12B 2Y7QA 3QDHA 1M05A 3IFNL 3SN6N 4NC1C 1S7TB 4ZUVB 3LQAC 3ARUA 1AR1D 2G5BA 2XTJB 5DJ6B 3HAEB 3AMLA 2PW2A 3VWJC 2CPCA 1KF9B 3F8UB 1AQKH 1JGVL 1YEHL 4P46C 4YLQT 3PWPB 2NY2D 1M4KA 1JPFB 2DQTH 2IMMA 1G9ML 1V7NH 2F54B 2ZUYA 1P4BL 4NKQB 1T3FA 4XHQA 5E5UB 4K3JL 2NY5L 1RIHH 1EH9A 4Y4FC 2ICEA 1QPXA 3EO9H 3ZLQC 1FE8L 2V2TA 3F12B 3GB7B 3RX5A 4MA1C 4BH8A 4OTXH 3ZHDA 3MLXL 1BQLL 4NDMA 5EZJA 4Q6IB 1UZ8B 2ZG3A 5ERWB 2PO6C 3LH2H 3QIUB 1HIML 5I73C 2MWCA 4YXKL 4JRXB 1P4LA 3OX8B 1PSKL 3QI9D 4DTGL 3UZVB 5LWYH 3T4YA 4C56B 2WSKA 5BCAA 1MJUL 2Z91B 3FQNB 4I9WE 1GCFA 2XRAL 3N06B 4PJ5B 1LWRA 4HPYL 3WO3B 1KCSH 4LRNH 4IRSD 4H0GA 4GAYB 1CI5A 4OCMC 4QRQB 2VL4A 3KYMA 5K9QI 1DVFC 2Z35B 5DI8A 1AI1L 3GMPB 2OCFD 1EGJH 1A14H 4XP1L 4GG6A 3V6ZB 4ENED 1A6VL 2HN7B 3DX7B 3HI6L 2JCCA 4JFZH 4CVUA 5C2BL 1KBGH 4YNYA 3OKLA 1BD2D 4RIRA 1AGBB 4X5WA 3JV5A 2VDNL 1T03H 3MRCB 2D7TH 2IJ0C 5LKNA 4O9HH 5SWSD 4Z7QF 5DDHA 1JV5B 2DRUA 2EDLA 3MLRL 3E2HB 4H25A 5BVJA 3B4NA 1OAUH 1QFWH 4JRYD 1SJVA 2PR4L 1S7WA 2MPAH 5BO1H 1WBZB 2IPKA 2UZIL 5EU6B 2B1AL 1P5VA 4O4YH 2JELH 2FBJH 3MZGB 4KI5E 1HXYA 4LVOC 2BC4A 4P2RA 5C0FA 5C0IA 3CC5A 1ULVA 3DX9B 1F45A 3ELAT 3HKFA 2Z8SA 3E0GA 3P77A 5DUBB 2I9TA 5D7JC 4GG6E 1OTUD 4QRRD 1E4JA 1A6TB 1JE6A 2JCCE 4G8IB 3BN3B 3LN4A 2V7HA 3S5LG 4OJFL 5A16A 1MCPL 3FB5B 3KPQB 1ZVSB 4W6XB 1DQQB 5HGHA 1P7HL 3QDJA 3CSPA 1K5NB 1P7QA 4LDLB 4F58L 4PJ8B 2H1PL 2HTLC 5E5MA 5EULV 3ULUH 1MFEL 1QSEA 3AXLA 5CUSH 2Z31A 4HJJH 5ILTH 3X11A 4WJ5B 3IDGB 2F8OA 4JB9H 4Y16D 1SMOA 3SE4A 4JKMA 4HQQL 1I1AA 4P2RE 4AEFA 1HSBB 2R1YA 3QIWD 1RUAH 3STBA 1KJVB 3S3JA 4OCRH 3GMLA 4P5KA 3HE7B 3H7LA 2UUDK 3LDBB 3FT2B 1DEDA 1BGXL 2AERT 2NTFA 3FQXB 3MRRA 5D2LA 1TVHB 2VDRL 2VLRD 4M93B 3FZUC 4OLVH 4XPTL 2DWEA 2GJ6A 3QDJE 3TBWB 4OCSH 3ILQD 4PUBH 3JSSA 1KIUA 3ARGD 4LCCB 1UACH 4PRHB 5HDQL 1WUNT 3EFFB 1EK3A 4GS7C 3SQBA 1U8KA 3K8KA 4DN3H 2EYRA 1QSEE 4N5UA 4AT6A 4PJ7F 3TWCH 2HMIC 1JMXA 5C0NC 4PJGF 4L4TE 3M17A 2QQNL 2ADGB 1IGYB 4HBCL 1S78D 5D7IF 4MZ2A 4P4KB 1A6WL 2Q8BH 3B8YA 4TULL 1WBYB 5F6IC 4M48H 5CFHA 5D2LE 3GKWL 4LLWB 5CP3A 3UC0H 3IDIB 3BESR 3SQOH 4X5XA 4KKBC 1MCOL 2FD6L 4EQ3A 2GJ6E 4LOUC 3SDCC 4KH2A 1DDHA 4R4FL 1MCKA 1F8TL 5CEZD 3KGRA 2BZDA 3MLYL 5CCKL 3RHWF 2BCKB 3UTTD 1WWCA 1Z3GH 5GISL 4PRPB 2ZSWA 1FC1A 4ONGL 3UO1H 2PYED 4HUUB 4PJXB 4UQ2B 3TYFB 3GMOA 3MXWH 4FABL 2YWYA 4LLYB 5BZDB 3V52L 5ADPH 5E00B 3T4AB 5JPNB 4J6RH 5HYIA 4JO2H 1IAOA 3UTSA 4JN2A 4X80L 3WXVH 5I18L 3R0MA 3IU3A 4WTZG 5GS1A 5JOEA 3O6FA 2C4FT 4RGOH 1A7QH 5HSFA 2AJYH 2JK5B 4PB9L 4A2MA 4LSSH 1V7ML 3LZFH 3EJJX 5DZNA 1BQHG 3TVMA 3BZEA 4EVNB 5IMMA 1XCQA 2QSVA 4JY5L 5SWZD 5C07B 2J8UB 4PTTA 1BQSA 1N7ML 2WUBL 5FM8A 5ENWA 1OARL 1YEJH 2EE2A 5DJ2B 4GKSA 4YFLF 3O4LA 3MJ8A 1NGZA 4WO4B 4HXAH 5MEPA 4PRAB 4U1JB 4XHJD 2OXHA 2HP4A 3BZFB 4MS8C 1QBML 1J7VR 3KG5A 4R9HA 3UTSE 1N5AB 3QFDA 2AEWA 1I7RA 4TUOB 1XEDA 3MRKB 3PV6B 4PS4L 5D5MF 4X6CA 3WS6A 5L9DH 4G8EA 4URTB 2VWEC 3QA3A 1R3HA 1QQDB 4JGUA 4KI1A 2VABA 2NY4C 3L3KA 2XN9D 4ZXBC 5CZXD 3JBG7 1JFQL 4YZFE 1QSFA 1QA9B 5C9KA 1YNTA 5A2IH 3UYRH 4LLDB 4JJHA 1Q0YL 2FX8L 4RWYH 4YDJB 5C0AA 3OKYA 4JQVA 4PJDF 3UYOD 3O2DH 1CDGA 3G5ZB 2YUVA 3O4LE 4JO4H 5IBLD 5KBNC 4FZEL 1YEIL 2MKWA 3A6CH 3G6JF 5E56A 2DQHH 4L5FH 1CLOH 4M5YL 1WCBB 4K9EH 5C9JA 1MCSA 2MFNA 2V17L 3PP4L 5E6IB 5JOFA 1TETH 3LKPB 1AE6L 4TNWF 5D71H 4PV9A 3TT3L 4NFDA 4XP9H 4Z95H 4X7CC 1C12B 4R26H 1RIVH 3GO1L 5D70H 5FV2A 5DEZA 4XC1L 3L5IA 5HGDB 2IQAA 5IB3B 1R5VA 4PRDB 2R0WL 4X6CE 4EOWH 4XAKE 1PG7W 4X7FC 2EYSB 3WBDA 1FFNA 1CXLA 4GRMA 2R0KH 5AUMB 3AGVA 2O26U 2CIIA 4D94A 1QSFE 5EBMA 1GZPA 3MLTA 4ZTOL 1Q72L 1QFOA 3VG9B 5C0AE 3UPRA 3C5ZD 5GRWA 1S7QA 3EYQD 3KDMA 1KXQE 1QHPA 3IFPB 2E27L 2EH7H 2XZCL 2VAAA 2AEIT 2GSIA 4DVBB 1QRND 2FO4B 3VI4E 4NQDA 2XG5A 3JV4B 3OMZA 1DBAH 4A6YA 1OQOA 1KJMA 2XXCB 2O5XH 5HHNB 3PDOB 5DTFB 3ARFD 3KYKH 2WUCH 5E8NA 4KKCD 4NQEA 1IC1A 1EEYA 2F9BT 2O5YH 4DGYH 3O3AB 3F7QA 3CFEB 1TZIA 1CF8L 3KPNB 1X4YA 5DJAA 3D2UA 4ZO9A 2XWTA 3LV3A 2CO6B 2MSPA 3G08B 4Y1AA 1UZ6F 1VHPA 3EJZC 2NXYD 4Y2OA 5GRJH 3C6SB 3ZKND 1EEZB 4O58L 3NPSB 4UTAH 4Z7QE 2F53D 1FNGA 1BZ9B 3QNXB 4NQDE 2NX5D 4WEMB 2VN4A 3QJHA 4BA8A 3RGVC 1Q9KB 4K3DH 3IAGC 1VACB 4XPAH 1XGRA 2EE6A 1X5AA 3IDMA 3D39A 1QLFA 4NQEE 4PGBB 1TJIH 5B8CB 5E1AA 3WNLA 3ZKXB 3VMOA 4DGIL 3P0GB 3U9PL 1UYWH 4OCXH 1N4XL 1NBZB 2DL9A 2IGFH 4UOJA 1KXTB 1Z5LB 5DR5L 1AY1L 4YIQB 4Y1AE 4Y0GA 4ZUWB 4Q2ZB 5GSRA 5EG6C 1EX0A 2HG5B 4U05A 3NTCL 5JNYB 1PG7X 4ODHH 1LP9F 1I7UB 1H8NA 8CGTA 1XIWD 1RFDL 3REWA 2GJJA 1KB5L 3U0PB 3TV3H 3P40A 4JRWA 4X5LA 4NKIL 3IFNH 3WHE1 5CGYC 4PJ7A 4EZMA 5GPRA 4U1MB 3D39E 1S7VA 2EC9U 4PJGA 4FXGB 4MGXA 1JUFA 2ERJC 4IRJD 1JGVH 1BOGB 5IVXB 5D7IA 1U8NB 4N0UA 2I60H 4M61B 1XH3B 4KI5C 5T3ZD 4ODSL 1P4BH 4O51B 4G9DB 3IJYB 3OGCB 4KZDH 3WD5H 1L7IL 4QTIH 5IMKA 2QSQA 3DI2B 5IHZB 4FNLH 1YMMD 3MPCA 3F7YA 2X1WL 3PABA 4XX1G 3SE8L 3QUYA 4NZUL 1QLEL 1BQLH 3VW3L 4GRWF 2BVUA 3SKNA 1AIFB 1ETZB 4YHZL 4DW2L 3QUXA 1HIMH 1SJHA 2LE9A 4G43A 4WHYH 3RDTD 2JIXA 1BIHA 4PJ7E 3PWLA 3GBNL 4HX1B 3MCKB 1XR8B 4HUNB 2EYTB 4PJGE 4Y88A 5F1IB 3WFHB 2IAND 4KK5C 1H15B 1GZQA 2Z9TA 3FN0L 3KJ4C 2GCYA 4WUUD 1D9KD 1MJUH 3MODH 3B9KC 1V3JA 3WUWA 5D7IE 4N0UE 1G9EA 2H41A 1SBSL 4HPYH 5IJKA 4J8RB 3EOTL 1L9NA 4X8XA 4QOKD 2NZ9C 3LD8C 4MX7A 2EDRA 1TJGL 3HRPA 3PWNA 4NQCA 2XKUA 1FNEA 1E0OB 1AI1H 1NDGA 4MD5B 1Z0NA 5C0GA 5FYKD 2XFXB 3U4AA 2A6KA 1OAQL 4FTVA 3WIIH 1E4WL 3MV9D 1B90A 4MHHI 1A6VH 2EH8H 3HI6H 2B4CL 4OZFG 2HKHL 4R97B 5C2BH 5D1QD 4HIXH 1MCHA 4PP1D 4YJZL 2VDNH 5I74C 1HOCA 3DROB 3EZJB 1N3NB 3GNML 4G7YH 2YD9A 4JDTL 1NFKA 2FATL 5J11B 3MNVB 3MLRH 4NP4L 3UJJL 4ONOA 2FSEA 2Z31C 5DEFB 4YX2L 1IILE 3OKOB 2Y5EA 4HKZA 4POZC 4U6HB 3SE4C 2UZIH 5D5MA 1SYSB 1I1AC 1I8MA 5IW6B 3RU8L 5FYLD 2FWOA 3VE0A 4AZ8A 3RWDA 4NQCE 4X0KB 1R0AH 1XCTB 2GYSA 3PUCA 3RNKB 4YAQA 3ARBB 4FTVE 2P45B 4KRPC 1S3KH 3GI8H 4LHJB 4PJDA 3FQUA 5FYJL 5T5FH 2ZSVB 2XWJB 4XNQA 4M6OL 4OJFH 4MJIA 2X4UB 3O45A 3T0XA 2NY1C 1VENA 2MNUA 3IDJB 3G6JA 1I8KA 3DUUB 5FM5M 2NMSA 3GJFA 3QH3A 2F15A 3KYNB 5D9SA 3GHEH 5BRZA 5FGCE 1JZ3A 2H1PH 1INDL 1P9MC 3GSXB 5FYKL 3EYSL 2AV7A 4RAUB 2D7QA 4YHPA 1S7XB 3JWOL 5D5ME 1UH2A 3MOAL 4NKOA 4R0LA 1FH5H 3MCLL 2LU7A 4J2XA 1NGQL 2P42B 3TPUA 4OF7A 3L95B 4HKBA 1QHOA 3EZ8A 1OWWA 3PP3K 5FHBL 4L4VA 2X4PA 3GSVA 5JW5B 3LEXB 1AO7A 1DE4B 1NUGA 4PJDE 1BGXH 5I30L 4P57A 4ZFGH 2YN3A 2QADB 4MJIE 1A5FL 5DHYB 3MUGA 3MROA 2F8XC 1GOFA 3G6JE 4D3CH 1B0WA 4R8WH 3SDDA 4L8CB 3C08L 4RISH 1VCAA 1IAIM 4JFXB 5BRZE 4HGMA 4DZ8B 5HDQH 4MLIA 1U3HD 3CX2A 3OXSB 3SGDH 5EU7C 3PL6B 5EO1B 5IFJA 5L2JA 4LEXH 4WTZA 2X4SA 1FZKB 3TPUE 5GS1C 1XF2A 2QQNH 1RJYB 3SDAD 1ZVYA 3O6FC 4L8SB 3LQAL 3TBSA 3T2PA 4HBCH 3F65A 4FFWC 1BQHA 4L4VE 4O5LL 5HI4C 5EORL 1A6WH 1MH5B 3FT4B 3RZCA 5TQ2L 1AO7E 1QZ1A 3MOQA 5DJ8B 3TVMC 2VE6B 4FZ8H 2BSED 3GKWH 3LSOB 4WUKL 2YRPA 4X9GA 5INDB 4PREB 4P5TD 5E7BA 1F8TH 2N7BA 2R0LH 3DTXA 4RFNB 2Y06H 2K7PA 5IWLA 3NCMA 5DA0B 5E2JA 5GISH 4ONGH 1E6OL 1CE6A 4AG4H 1X5XA 1M6OB 2AV1B 3IGAA 3K80A 1IQDA 2W60A 4MQ7A 2B7DT 5IIEA 3BP5B 2R69H 3QZWG 3QIBA 2WANA 4P2OA 3DYOA 4X80H 3IJHB 4S1RL 3MRBB 4OT1L 2UVFA 2BVPA 1G9NH 3WIHL 4GW4A 3WDIA 3WS6C 1GAFH 1DP0A 1RVFH 5E8PA 5FCUL 3O3DB 3TCXA 1J0ZA 1CN4A 3QUKB 4RWHA 2FYYA 1LP9A 4LASL 4NO3A 5GGVY 3KWWB 3T1FA 3TJHA 5J12B 1KG0A 4JQVC 2BSTB 1N7MH 2WUBH 1ZV5A 1OARH 4F7CA 2DMBA 2NY6C 4N8VG 1T1XA 3SKOB 2XZQL 1CD8A 2OLDA 3MRQA 3X3FL 2QSCL 3N1QC 4NSKA 3P73A 3BD3A 1S8DB 3L3GB 3PXHA 4CU7A 1HYSD 1BD2B 2FNBA 2OSLA 1QBMH 4ZO6A 1BVKB 2WP3O 1O7SA 4HWBA 5J06A 4NYLB 4OZ4B 1RMFL 5CEZH 5FUZH 3GSOA 4JPIA 2KZWA 4UNUA 4E41A 1E28A 5MERA 3G9VA 3MJ7A 2OL3L 3IU4H 2MTPA 1LP9E 4KUCD 1CD1B 5GRUL 1ZS8A 4PJCA 1IEHA 1KFAL 1YY8B 4P3CL 4JFOA 1CFQA 5LAXA 1WC7A 5SX5H 1Q0YH 2EXYD 2FX8H 2X4NB 1U93A 3QG6B 3MRIA 3CFKA 1RJZB 1UCBH 4FZEH 1YEIH 4HIIB 1YN6A 4XCCH 2A1WL 2HT2D 3LRHA 1ZE3C 3QISA 3O9WA 4M5YH 3K2UH 1MREL 4OGYL 2ZUSA 4WHTA 3MV7B 5DK2B 1AE6H 5IQ7H 4MXQA 3TT3H 1X5LA 4GG8A 2V7NA 5C0BA 3GO1H 1YQ2A 3X3GL 4XC1H 4N0YL 2OJEA 3MFFA 2HFFB 1NGWB 4H26A 1GXEA 4E41E 1U92B 1DL7L 4CGTA 3C8KB 3IDYC 1H3UA 4Y16B 3HZMB 4Q58C 5DWUL 4BQ8A 1VGEL 4GRWE 4PJCE 3SJVA 4N9GA 5DMKA 1T2XA 3ZDZF 5A40E 5L8LB 1W72A 3BJ91 4J1UB 1Q72H 4MJ4A 1JK8B 2C9AA 1W0VB 3EO0B 1TENA 1CDHA 4ZOAA 3W9EB 4XVSL 3W2DL 3PWJB 2VQUA 7FABL 5HBBA 1X3DA 3F5WA 4XRCB 4OCNC 2VLRB 4E42A 4KKLD 4PV8B 4WGWB 5DVKA 2SEBB 4WFED 4JFFB 1M7IA 3VGBA 4PJXF 4QXWA 1WFNA 3OF6A 3CFJB 5F6HJ 5JDSA 3ARGB 3DRTB 1I7ZA 2OI9A 3GM0A 3I9GL 3VXNA 5INCA 4JM2D 5C0BE 4KRNA 2DMKA 1NGPL 3AM8C 4N5EA 3SDYH 4MXVF 4BQ6A 4QHLB 5HHMA 4FQQB 1CF8H 2ZUUA 5B4MD 4M7LL 1N2RA 3RAJH 3WL9A 1XZ0A 3NH7L 1F3JA 4FQLL 1CE1L 3SJVE 1L7TL 4G8GD 5I6XB 4LLQA 3RY6A 3QEQD 3IYLW 3F6LA 3F7PC 4NHUB 5TDOA 4KK6D 2FL5A 1D6EA 2DI9A 2C3VB 2RCSL 1DFBH 1AKJD 4MXWL 4YHYB 2J8UF 4KRLB 1WWBX 4O58H 5FO7B 3T0AA 5KW9L 3OAZK 1Y6NR 4ZUVA 3ULUF 2EDTA 3D6GA 3BPOB 5DJ6A 3HAEA 3T04D 2R0ZL 3I6LD 3I75B 3EOBB 1CXFA 4RMWA 4WI6A 2OYPA 1IT9L 3RIAK 3MRHB 4L9LC 3CH1B 3OZ9H 3QDMB 1T6WA 1JPFA 2F54A 3U48A 4DGIH 3OAUH 1JCKA 5HHME 3VWKD 4Z5RB 2V5MA 1N6QL 5GGSY 1F2XK 5B21A 1HQ4B 5HYJD 2L7UA 3A6OA 3FRPG 5DR5H 1DUZB 3DV4B 3F12A 3GB7A 4NGHL 4NOFA 4FP8H 3HG1A 4ZNCD 1TZGH 1IGIL 3QUYC 4LHUD 4Q6IA 1UZ8A 5ERWA 1CZ8L 3LRGA 4G5ZL 3NTCH 1TMCB 3QIUA 4EJ1C 3ETBF 5A1AA 1QPPA 3QUXC 1T66D 1RFDH 4DQOL 2XTJE 4JRXA 5KVFL 2IAMB 1Z2KA 1EJOL 4NKIH 3OX8A 1R3IL 1TQBC 4C56A 3LMJH 3WS3B 2YA2A 2Z91A 3FQNA 4X4MA 5ITBL 4HZAA 2VXQL 3T77A 4PJ5A 1SYVB 3O3UN 2F54E 4FQXC 5IJKC 5IG7B 1DQDH 3VFRB 3C2SA 4QRQA 1XMWA 2AI0L 4V1DB 2Z35A 4ODSH 2AK4B 2YD5A 3RL2B 3GMPA 4G9FB 2VH5L 1L7IH 1J8HD 4G7VL 3HG1E 4F7MB 4OZFA 1FVDB 3T0BA 2HN7A 1F02I 3DX7A 5GGTH 4KMLB 3UPAA 3SE8H 1JHTB 3CDFA 3DGCR 1QLEH 3RBGA 1AGBA 4JRXE 4MNGB 3HZYB 3MRCA 4J7RA 5EUKB 4K7PY 2UWEB 5D72H 1IBGL 3MUJA 1MHEA 3FONB 1JV5A 3O6LL 5E99L 3E2HA 4QWWD 3BZDA 3GBNH 4KDWA 4C56E 4S0UC 1FNHA 2DM2A 2WP3T 1M7XA 4R2GC 1ZSDB 4HKXB 4X4ME 4D9QD 4U33A 2X09A 1WIPA 3HB3D 4PJ5E 2I5YH 3FN0H 3REVA 4ZSOB 4EI5D 3MLZH 3TFKD 5EU6A 5HPMB 1PAMA 4DVRH 5GS0C 1SBSH 4GW1B 3LQZB 3LKQA 4EN3B 3EOTH 3DO7B 2X1PA 3DX9A 4RDQG 3EOAB 4MDJB 5IK3B 1TJGH 5DUBA 4MWFB 2FGWH 3DYMA 5HHPA 1A6TA 5CJ8A 2EDJA 3SE9H 1G7JB 2IWGA 4G8IA 1E4WH 1EERB 2IPUG 4Y5YB 1J11A 3FB5A 1F97A 3KPQA 1DQQA 4ACPA 1K5NA 4R4BB 5HHOD 1M71B 2G75B 4N0CD 3WFBL 5JXED 1GVIA 5DRWB 3C5ZB 3PQYB 3GNMH 4JDTH 5DURD 2FATH 3TH3T 4J12A 4NP4H 3AS3A 5FUCE 3RVTD 3UJJH 5EU6E 4WJ5A 2Q86B 1QRNB 2ZOLB 2CJUL 2KUTA 3IDGA 5CP7B 4Y5VA 4YX2H 2AJVH 1AXTH 3ZL4L 5B39G 4R96B 1HSBA 5GXBB 3RU8H 5CJOL 3QCTH 1BWWA 3ARFB 1KJVA 3HE7A 3FT2A 3MC0A 4PJ9D 4YBQC 5HVGB 3FQXA 1TVHA 1H3XA 1KB5B 4HH9B 5ACMA 3QHZL 4HLZG 4IOFC 1LK3L 1HINH 5FYJH 3RPKA 3TBWA 1T0NB 3L3IB 3VD4A 4Z18A 3SDDC 3B6SB 5IMOB 3EFFA 1KCGC 4K71B 1DN0B 4KQ3L 4NO2B 3UAJC 4HXBH 5E9DD 3SKMB 2CGRL 1INDH 1LVEA 4TSBH 1LMKA 2NX5B 5FYKH 4EKXA 1RUPL 2HFEB 4FQJL 5JHDD 3FRUB 1EGJA 4EXKA 4C55A 3MOAH 2ADGA 1IZJA 5H2BB 1IGYA 2OTWB 5IVXF 3MMEB 3JTSA 3NCJL 4MVBA 4P4KA 3W5NA 4JFDB 1BEYL 3MX0A 3RZCC 1WBYA 4PPTA 5FHBH 1UB5B 4LLWA 5DJXA 5MHSE 2E9IA 4I0PB 3IDIA 5BVPL 2PN5A 4HJGB 1NC2D 1N59B 3TGXA 5E5RB 5I30H 4I13B 5JMRA 1JYNA 4QF1B 1A5FH 4YBLB 2H2SC 4PLJC 2RGSA 5IWLC 4NIKB 4PRPA 2A77L 4WI3A 2WQRA 3OL2A 4HUUA 4PJXA 4UQ2A 2NYYD 3TYFA 1U8HB 3BQUD 1U58A 2UV3A 3RQ3A 2Y72A 5BZDA 2JJUA 5GJSH 5E00A 3T4AA 1EFXD 4LMQI 5JPNA 2IF7A 4LF3B 2GI7A 2H45A 4P2OC 1DQJB 5SWQB 4GT7A 3E6FB 1PY9A 2VDPH 3C60A 3ZHKA 2O5ZL 3LQAH 5DMYA 2JK5A 3GIVB 5BS0D 1LE5B 3ZDZE 2PCPB 5MEOB 5TQ2H 4LLVB 3QO0B 4EVNA 2QKIB 4TUKL 3IKCB 4WUKH 1MI5B 5C07A 3TJHC 2J8UA 4FQIL 4U6TA 4LSRH 4F7PB 3RWGB 2VXSH 5DJ2A 4PRPE 1IGCL 2ZOKB 2CXGA 4PJXE 3PF2A 4DKEL 4PRAA 4GJTB 1E6JH 1U2CA 3IRPX 4U1JA 5F9AC 4LSPH 4I18C 3BZFA 2AJSH 2V6HA 1E6OH 1KLFA 1OAXL 4WFHE 3K1KC 4MXVE 3TJEL 1N5AA 3RDTB 4TUOA 1BFSA 3MRKA 3SOBH 5DFVC 4OCYL 2FX7L 1NMBL 2D3VA 4WUUB 2PW1B 5KSAD 4HAGA 3WIHH 3K8MA 1URLA 1QQDA 4W6YB 3NCFB 3GSNL 4NC0B 4QOKB 5C07E 2J8UE 1QA9A 3I2CL 4FXLA 4LLDA 4LASH 4U0RB 1RY7B 4TQEH 4YDJA 3ULUE 3S35L 3SEPA 3G5ZA 3EYOB 1DBKL 2M8XA 2Z93B 1S9XB 3MNWB 1SM3L 5I71C 1FZOB 1WWAX 2EXWD 2XZQH 43CAB 3P9MB 2QSCH 1WCBA 5D2NC 4G8FA 5E6IA 2IBBA 5DD1L 2PTUA 2ITCB 3LKPA 2W9DL 1J88A 2R2BB 4MXQC 4R4NC 4Z7WB 3MRLB 1JIBA 5I1EL 4UAOC 3G6DH 5IB3A 4PRDA 1W2KT 2FIKB 3BEWB 4PGEB 2EYSA 5FIEA 2E3VA 5AUMA 3H0TB 4QRPB 5IBUG 4EIGB 3T65B 5C0CB 1AR2A 2VTFA 2ATPB 4OCWH 3GI9H 3IFPA 3TBVB 4O02L 5GGVL 4DVBA 2BDNH 2FO4A 4OAWA 3JV4A 3WLBB 4U4BA 1DEEB 3B9AA 1JN6B 1EV2E 5HHNA 4JO3H 3UDWA 3PDOA 1IGFH 1U8MB 5DTFA 2HYMA 1IAMA 3KLHD 3LPWA 2ATKB 5D93C 5ACZB 4ZUTB 2VSDA 3O3AA 4N5EC 3CFEA 3KPNA 4QHKJ 5DD6B 1MF2L 1NEZB 1ACYH 2OTPA 3E6HB 4PGDB 3X3GH 1T7ZA 1ZLWK 2IEPA 5DUML 4L8DB 4IM8A 4YFEA 5DWUH 4NBZB 3G08A 3LHPH 1VGEH 3RY6C 4UOW1 1B6DA 1VGKB 2DJSA 2VXTL 1ZHBB 3C6SA 1EEZA 2XWBB 1J0IA 1K8DB 4F9PA 4HT1L 5SV4A 1BZ9A 3BISA 4UT6L 1T1ZB 4KVCH 1XGUB 2KL6A 4LAQL 2XZZA 4XVSH 1ZLUH 1U91B 1Q9KA 2XTJC 3V2AR 5JW3H 1MFBL 2PO6B 1VACA 3OSKA 3TO4C 4XP5L 1KC5L 2ZPKH 4J3SA 3IJSB 4Q7DA 4ZAKB 5F7WC 1CVSC 5F21B 4PGBA 5B8CA 5DEGA 4LRIA 1S5IL 1AP2B 3BT2L 2R4RL 1OPGL 3QQ4A 4V2BA 5F88B 3UTOA 2YPLB 1KJ2H 1NBZA 4JKLA 4NZRL 1NGPH 2VMFA 1EHLL 1NMAL 2MQCA 1Z5LA 2EDFA 4WEBL 4M8VA 4M7LH 4OLUL 1MJ8L 4YIQA 3O2DA 4CUCA 3NH7H 3MYJB 5CKGA 5ICYB 4ZUWA 1MY5A 2ZCLL 4Q2ZA 4OGXL 5D1ZD 1CE1H 3SDAB 1G7HB 3E3QA 2HG5A 2VZ3A 3VFSB 1DVFB 4Q6IC 1WWWX 3ROOA 5JNYA 5FGRA 2EDNA 2EKSB 2X4TB 3QIUC 1I7UA 2LVEA 4PTUB 4KHTL 1I9JL 4G6KL 4MXWH 3V4VH 3U0PA 2HJKB 4ODWB 4PRIB 5KW9H 4F8QA 5L0QC 1YY9D 5EO9B 4KJPD 3OXRB 4U1MA 3FO0L 2OK0L 2D9CA 4ALAL 4X7EC 3BKMH 4UT9L 5FGBA 1BOGA 2Q7YB 3KPRD 5IVXA 4ZD3H 2VDKL 1SVCP 4N9OB 4NQXB 4M61A 1XH3A 2DICA 3CDCA 4O51A 4G9DA 4ETYA 4M02A 1T1YA 3IJYA 5D7SL 3OGCA 1A64A 2E7LA 5IGXL 5IHZA 5J89A 3E3QE 5DXWA 3FO1B 3S36X 1S5HB 2I27N 4JKPL 1IGIH 4XGZB 1ERNA 3VFPB 1CZ8H 4G5ZH 2P5ED 4JO1L 4WV1C 4BQBA 5DJZB 2CLRB 4RGMB 3DXAD 3MJ9L 4HX1A 3MCKA 3FB6B 1XR8A 2EYTA 5F1IA 3WFHA 1H15A 1R3IH 3HPLA 2GT9B 3VXSD 4OZHB 2HFGH 5F1OB 5IVXE 3P30H 1H3PH 5ITBH 4PY7B 2VXQH 4GRLD 1RZGB 4JZNB 5AZEH 1FZJB 5F7FA 3EDDA 1WCQA 1JGDB 5L88L 1FQ9C 1AD0B 2E7LE 2AI0H 1B6UA 1FORH 3O6KL 4MD5A 3B5TA 5ESVB 3FAWA 4JZOB 2EIEA 2VH5H 4PBXA 2XFXA 2NPLX 3MO1B 3NIDF 4RGNB 5LVEA 3QUML 2EICA 3DMMD 3MBXL 1JPSL 5I16B 5E1HB 3IFOA 4JFEB 2R9HC 2D0HA 4IMKA 2DLFL 3LEYH 2ZNWA 4JHWH 3KXFD 3FMGH 2BY1A 3U46B 1MCWM 2F8VA 1GC1C 4XCNB 3DROA 4EUPG 2IBZY 2OP4L 1N3NA 3S3PA 1G7IB 1IBGH 3O6LH 4IBLT 3MNVA 4X9IA 5DEFA 1UKQA 2BOBB 2ESVD 3OKOA 1Y6MR 4U6HA 4Y5VC