3GSXA

Crystal structure of the binary complex between hla-a2 and hcmv nlv-t8v peptide variant
Total Genus 78
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
78
sequence length
274
structure length
274
Chain Sequence
b'GSHSMRYFFTSVSRPGRGEPRFIAVGYVDDTQFVRFDSDAASQRMEPRAPWIEQEGPEYWDGETRKVKAHSQTHRVDLGTLRGYYNQSEAGSHTVQRMYGCDVGSDWRFLRGYHQYAYDGKDYIALKEDLRSWTAADMAAQTTKHKWEAAHVAEQLRAYLEGTCVEWLRRYLENGKETLQRTDAPKTHMTHHAVSDHEATLRCWALSFYPAEITLTWQRDGEDQTQDTELVETRPAGDGTFQKWVAVVVPSGQEQRYTCHVQHEGLPKPLTLRW'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HLA class I histocompatibility antigen, A-2 alpha chain
molecule tags Immune system
source organism Homo sapiens
publication title Structural bases for the affinity-driven selection of a public TCR against a dominant human cytomegalovirus epitope.
pubmed doi rcsb
total genus 78
structure length 274
sequence length 274
ec nomenclature
pdb deposition date 2009-03-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00129 MHC_I Class I Histocompatibility antigen, domains alpha 1 and 2
A PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3gsxA02
3.30.500.10 Alpha Beta 2-Layer Sandwich Murine Class I Major Histocompatibility Complex, H2-DB; Chain A, domain 1 MHC class I-like antigen recognition-like 3gsxA01
2P43B 1NAMH 4CUCA 3S97C 2Y23A 5GGVH 3N1MC 3BN9D 1G7JB 4DVBA 3DOSA 4LCUB 1HH9A 3VXUE 1YEDB 3OKKA 1XGQA 3I50L 3LSOB 1CQYA 2M26A 3P2TA 2AEPH 3QCUH 4WW1B 1GAFL 2HFTA 4X5XA 2AKRA 5HYIA 4PJAB 5GGQH 1AXSA 3GGWA 2AJZA 1IAOA 2DBJA 3C60B 3MV01 3QAZB 5DWUH 3D2UA 1S7XA 4DN3L 1H5BA 3LKSB 1BVZA 2H2SD 3MA7A 4RAHA 4UQ2B 5CZKA 1LK2B 2X41A 3MODH 3G5XB 5HYEA 1CXIA 2DLHA 4NUJB 4PD4K 1QRNB 4XVJH 1BAFL 5FHAL 3LEYH 2BHZA 1FO0A 5CILL 4Z7VF 3E8UL 4JM4H 1MCOH 3GMOA 1KCVL 3DGCR 3DETD 5ICYA 2AXGB 2VB5A 3I9GL 4MJ5B 4IJ3B 1CD9B 4R2GD 4ZNEA 3O6FA 3WIIH 1SVZA 2DL9A 3IDMB 1ZT4A 4LPVA 1EEUA 2CDFA 1HE7A 3W0WA 4PJ7F 5CBAB 2I9TB 3L3KA 4U1SA 5L2JB 2J5LB 4OCXL 2IMNA 4OD3H 3ULVE 1A3QA 1FFRA 2IADA 3MRBA 3L5XL 3GI9L 4MD4B 3IJSB 32C2A 3LN5A 5F9OL 3CDGA 3FOMA 4JFEE 5ACZA 1QSEE 2XT1B 5IQ9B 1ZLSH 3LV3B 3O2WL 3ROOA 3WV0A 1GIGH 5BJTA 4TNVK 1KXTB 1VGKB 5FHBH 4O9HL 3Q48A 1OWWA 3BXNB 3ES6B 3D48R 1N0LA 5F1OB 4P2RE 4QCIA 2XN9E 4CVZA 2RBLA 3DX7A 1IT9L 4S2SA 1ROWA 5FV1L 4GS7B 5TDNA 3K0WA 4DUVA 1FG9C 1TITA 4G9DA 5K33A 1YNTB 3CFCH 1X7QB 2B1HL 1CFTB 4RFOH 4JAMB 4HUVB 4LF3A 4I18A 4PJ7A 3OQ3B 5IB5B 1B2WL 3R8BB 2WBJB 1A9BA 4ZTOL 3IAQA 3RVXC 2DIJA 2JK5B 1NGYB 4AEFA 4YC2B 2G75B 3AAZA 2E7BA 4PRPB 2E7LC 3PL6C 1WC7B 1IC4L 2MCG1 4JRYD 4NC2B 5IHUH 1T0NA 2HVJA 3TNMA 3W81A 4XPGH 2AJZB 5FECA 4JJ5A 4GKZB 5IW6A 4J3UA 1NANI 2IWGA 3PXJA 4TYUA 4Z7NF 2R23B 1G1CA 2AK4D 2FO4A 3EO9H 5EWIL 4UOW1 1OGTB 2O5ZH 2VAJA 2FHCA 4CMHB 4EBQL 4Y4FD 1FG2B 4L9LC 3S96B 3NCFB 3FQWB 4U3CA 1U92A 2BX5A 4NCDA 3GSWA 3PDOB 4IJ3C 5TE4H 3GSQB 3H9SE 4ODTH 2VLJA 4MGXA 1MVFA 1C08A 5C0DA 3TNNB 1AR1C 4P46C 1T04A 3CH8A 3V6FB 4PLNC 5B8CB 5CZXC 1U95B 1BZ9A 3O6FB 3QUXD 3SE4C 1QHPA 4HUUB 1UWEH 2VDNH 5A2KH 3N1QC 2F5BL 1FCGA 5EDXA 4TULH 1SJXA 1UCBL 1IAIL 2JELH 2VR5A 4MD5A 5D6CA 3B5HA 3VMPA 1LO4L 5IMLA 4I0PC 1SY6L 1FO0B 3RTQD 1QVOB 4NRYB 1T5WB 3HZVB 1AR2A 2BSTA 1KCVH 1MCOL 2ZSVB 2Z31C 4JFHD 1T21A 3FRUA 5EO9A 4HCRL 5D7LD 1N8ZB 4WU5A 1NDMB 4QGTA 5DJCA 5C0BE 1UM6L 4LCIL 5T3XH 2J8UF 3MYZA 3MLVL 4U1HB 1FVDA 5IQ7L 1B2WH 4R0LA 3VWKA 1UWGH 3WO4B 2XZZA 4P4RA 3SJVD 4BQ6A 1R3HB 3U30B 3MUY1 5T1LB 3H9ZA 2I9LA 3FB7B 3MRFA 2DQIH 4WI8A 3ZO0A 2FEDC 1VERA 3EOTH 4K3GA 2FATL 1X5JA 4NO3B 4MXQD 5L8KB 2VE6B 4G42A 4HMDA 4P4KC 4F2MB 5BZDA 5JOEA 2Y36L 3S88H 4PRHA 3MLXH 3O2WH 3MLZL 4NO2B 4I18B 2R0LH 1UB5B 2GITB 2OR7A 4GG6E 3CMGA 4JQIL 4FP8H 5TH2A 5INCA 4FQXD 1UEMA 1EGJH 4QRPD 5KVGL 4HPYH 5C0NC 2IFGA 2FEEL 5T1MA 5E8EB 4OCXH 1LE9A 1NBYA 1ZLWK 4RGMB 3LD8C 3QIUB 5FUCE 1I4FA 2AEIT 4G8FA 3MV9E 3B3IB 2MKWA 2OL3B 5HGHB 2BOCB 2ZCHH 1C1EH 4MXWL 1NEZB 2UY6A 3MLWL 2F54B 5FOBB 3HZYB 3QH3A 1A2YB 3GHBL 2XIDA 3BP6A 4M02A 2L7JA 5SWSA 1LDPL 3BJLA 3DVIA 4GRMB 5AUMB 3ZKND 2BNQA 3QEGL 5GIRB 4OZHF 3S35X 1Q0YL 4LCCB 1DQTA 4P5KA 1RU9H 1IKNA 5C6PB 4X7TA 4M61B 1IKNC 3QWOB 3ZTJH 2FBJL 1OP9A 1ZTXL 1AO7E 1M7DB 3FFCE 3REVA 4RFEA 1A6UH 1TVDA 3UPRA 2GK2A 4OKDA 3V2AR 3GHEL 2A6DB 2R4RL 1FNSL 4O58H 4YK4B 1UADC 2NPLX 3KJ6H 1ES0B 2W60B 2P5WB 1TVHA 3EW3B 4M8VA 4ZS6D 3UBXG 5B8CA 4IOFD 1IQDA 4U1MB 5AZEH 2JJUA 1NDGA 4L4TA 5JQ6L 3UJIH 1U8IA 4CVXB 4R0LB 1X44A 1FFQA 2UWEF 4PJXE 4MNHA 3EDKA 4TUOA 2DKMA 1A7OH 1FYTB 2G9HA 2ADFH 4JB9H 2I9LB 1MIMH 4AIOA 3FB7A 3MR9A 2BSTB 4X80H 4JFDD 4MSWB 3B6SA 1LNUB 1P6AB 2IAMC 3LEVL 1D9KD 5DHXB 5CS7A 1XF5A 2B0SH 2QADC 3QIBD 1ERNA 4PJIA 4F9PC 2GK0B 3DXAA 3LRSA 4NPYB 5ESQA 1A8JH 3QCVL 3PIQA 2YA1A 4KQ3L 1E4XI 3GSUB 5ID0A 4OZHB 4JDTH 5BS0A 2VWEC 1KJ2A 1TXKA 2JKXA 1MCWM 1BFOA 2IG2L 1HXMB 2BC4B 4H1LH 4KTYA 1F4HA 1MF2L 1KPRA 1I9IL 2YPLA 4NM8L 4PRHB 1MRFL 1JGLH 4GW4A 4L3AA 2FH8A 1NC4A 4NQED 1RK0A 3V4PH 5JR1H 2HVKB 2EKSB 2UUDK 4O2FA 4YWGL 5JTWA 4ALAL 4MQXD 1EBAA 1XF3A 1KBGH 4NQTA 2Z31A 3ARDC 5I18H 2PXYD 2XZAL 1Y6MR 5AAWA 8FABB 3MBEA 5ITBL 1QA9A 2XWBB 2YZ1A 3P30L 4NBXB 5T3ZD 3B2VH 4JFEB 4N8CL 3NBNA 2CH8A 3GBNL 1J1OH 3VRJA 3IDMA 3MACH 5EBLB 2J6EH 1DEDA 2IBZY 5E08H 3B3IA 1LO3L 1ZKAA 4QRUA 3V8CA 3NH7L 4RA0C 5ILTH 5FKAA 4H0GA 2AQ1A 3BP5A 1HINL 5DS8A 5DD1L 5TPWH 3UTQA 4POYA 4YX2H 1BWMA 1FGNL 5CSZA 3HI6H 3CLFH 3T4YA 3IDXL 5DSCA 3CXDL 1XR9A 4LSUH 1KCUL 5D2LF 4YHZL 3MA9H 4X9BA 2VZ1A 1MHEB 1RU9L 3WDHA 2C26A 3B83A 5JQHC 5T3ZE 3QQ3A 3P9MA 1D6EB 1CCZA 3W82A 3DX7B 2Y6SC 4BH7B 1G6RL 1OF2A 2DD8L 5DK2A 1BD2B 4Q7DA 1IGCL 3L6FA 2VAAB 5DO2C 1V7NL 3KHOA 5E99L 3TH4T 3ZE1F 3BKYL 3OXRB 1RV6X 4NO0A 5DI8A 1M05B 4QXUL 1PYWB 5L9DL 1MSPA 4Z7WA 3HI6L 4TSAL 3LS4H 3MROA 4JO4H 4PRNA 1JRHI 3MJ7A 2A74A 4HWEL 2A9MH 2WWMD 4L4VB 5I1JH 2X70B 4MJIA 3NCJL 4W6XB 4Z95H 1IAKB 4L4VE 2VITA 3OF6D 3BEWB 2Q76B 2IQAA 3ARFD 2Y7QB 1B4JL 5CUSL 4WCYL 4X8JB 4WI6A 2EO1A 4JFED 2OK0H 3P0VH 4YGVA 5DMYA 2DBLL 4P49A 5F96H 3MRMA 2BMKA 2QL1A 1JGDA 1BHGA 4HT1L 1E4XL 2A6DA 5JPMA 4JFDB 5HDQH 3GSUA 1MRCL 3H9YA 3SGJC 4NQUA 2QADB 4TSCH 4M6AA 2ITCB 1XF2A 1DN2A 4Z18A 2VOTA 5F1IA 1DUYA 3SEPA 2ZCLH 3U1SL 5C0BB 5HHNB 4Y2DC 3TVMB 4ZFFB 2HT3D 5KSAD 4PJBF 5IHZA 2VQ1A 1XGUB 4OGXL 5GJSH 3DHMA 5J8OA 4QY8B 2WW8A 2OSLA 1UYWH 4NQXA 5JNYB 2P24A 2X44D 2XWJB 1HILA 2D31B 1DBBH 4WUUA 3Q3GB 5EUOB 4F9LA 1H3XA 2UVFA 2X4QB 5A3IC 2ZSVA 5D7JC 5JHDE 1UT9A 1F02I 2J8UE 1G7QB 5EN2A 5D93B 2P48B 2F5BH 3MRDB 4JZOB 1RZKC 4MX7A 1FVDB 4ZPTB 2HLAB 5D5MF 1V8HA 4BH8B 3LEVH 3SDCD 2VN4A 4OBRA 2CGRH 3OL2A 4WEBH 3MRGA 4HFWB 1KIPB 5ADOL 3HE6A 1L9NA 5HVHC 3TESA 2MPAL 5FKPB 3MV8B 2YRZA 4UIKL 5DD3H 4YHNB 2MJWA 4WTXA 5EG6C 1Z0NA 1R24B 1OQXA 5C0CD 3L7EB 2NTFA 5AZEL 4L1DA 2W9DH 5GGSY 1U8LB 3QDMB 3X17A 1IAMA 1Y6KR 2BRRH 2BVOA 3IU3B 4MQ7B 2IAMD 2YK1H 2CK0L 2X2YA 2WUCH 4DGVL 2V5SA 5EULV 5IBUB 1S7WB 4M6MH 5HGBA 2GSGB 1T1WA 4GKOA 4CNIB 2DKSA 3FFDB 4X4XB 5DVKA 5I75B 1Y18A 5EBLA 1QO3B 1RZJL 1KTKE 4TRPH 1NGQL 1E28B 5JO5A 1PYWA 3B9KB 4TVPE 5T5NG 3MSPA 2AI0H 1RIUH 1P4LB 5I2IB 2R2HA 2FEEI 3S7GA 1TCRB 5E6ZA 2XG4A 1R5VB 4X5LA 5GS2H 1T4KB 4U6YB 1IKFH 4R90H 4C56E 3MLWH 2GI7A 2W38A 1WT5C 4Y1AB 5KVGH 2QHRH 5CP7B 3LHPL 3QFJE 4Y5YB 1UH3A 2GYSA 3IYLW 5SV4A 1X5YA 3VXQA 4FFYH 3G6AA 1UM4L 3GK8L 4IRSC 2KQMA 1B0RB 1C7TA 2C3HA 2CRMA 3L3GA 4OGYH 4YXHL 2DQCH 1CBVH 1K6QH 3QDGA 3LQAL 4Y2DD 5F7EL 3QNZA 4XHJC 4BKLB 4HPYL 4DZ8B 3UPRB 4DGYL 3QDJB 5GRUH 4U1LB 1FZKB 5HD8D 2FX9L 4K8RC 4I0KA 3U0PB 3LKPB 3CJJA 4WEMB 2BY3A 5L7XL 1NGWB 2V7NA 4HH9B 3THMH 3EYOB 2W0PA 5L2KD 1YN6B 2HT3C 2PYEE 3KLAB 3PWPD 4D8PB 5I19L 4QRRD 1I1RA 4RQQA 1UACL 4GKNB 3JUZA 4Z7WB 1NDGB 4LQ1A 4DVBB 3SY0A 1LK3L 3A6CL 1D6VL 5IB1B 4UV7L 3HMXH 3PWNB 4Y19D 1UXSA 2DWEB 4LCIH 5T3XL 5EU5A 2FZ3A 5D7IB 1ED3A 1QHOA 1H5BC 2VDML 3I3EA 4IIQA 3O6ML 2R8SH 4Y19A 3QUZB 1UCBH 2JELL 2WWKO 5JDJA 1XGYH 5IQ7H 4ODXB 4YGVB 3MLVH 4OM1H 3CSGA 1PKOA 2H2SC 2ADJB 3G5XA 1IEHA 3MPCA 1RFDH 4KVNL 1H8OA 5BJTB 4L4JA 2OLDA 4YH6A 1WICA 3VXSD 2FHFA 3FB5B 5C0FA 4M6NH 3UMTA 1SY6H 1MOEA 3FOLA 1PSKL 5B4MD 4OLVH 3SDXB 3DIFB 4PJGA 2W0FA 4HJJL 1MCKA 1MIEL 2JJWA 3BHBB 4U1KB 1BGXH 3QXDB 4E41E 3TJHC 1UACH 5J89A 3DURB 3T0DA 5K9KA 1XGUA 5D6DC 5JW4N 1P84K 3DECA 1PEZA 1P2CA 2DYPB 2EDNA 4WFHD 2EICA 1NFDF 4ZPVB 4XPHH 2X4QA 1FPTL 2FX9H 4PP2B 2YPKB 4LIQH 2I25N 3RWCA 2DICA 3LN4B 3IXAB 1YMHB 3UJJL 2HWZH 3PV6B 4AG4H 1BJMA 4X9FA 1VADA 3V5HB 4LCUA 1RZ7L 1CLCA 1QKZH 4DTGH 3MRRB 1ZHLB 4ZUVB 1NFKA 3AMKA 3UTPD 2A77L 1QSFA 3TZVD 3SKOA 3O11A 4YDVB 3ZKXB 2NY2D 3UTTE 2ZSWB 3L1OH 3MV7B 3DPBA 2XPGA 4U6YA 4Y4KB 3BP5B 4NKQB 4NFBA 1YMMD 1TVBA 4IOIA 3ARTA 4XVUD 3WXVL 5IBLD 5SWZD 2BNQE 2ENYA 1DEEA 5IESL 5L88H 2ICWI 5C07E 2HFEB 2CPCA 3QULA 1ZVSB 1X5KA 1NCUA 5EFIB 3MX0A 4NUJA 2PTUA 3WL9B 2OTWB 3TNNA 4XC1L 3MRCB 4QWWD 1G0YR 1EA9C 4IBLT 3I2CH 1IAIM 4ELME 3X12B 3HI5H 4ERSL 5DJDB 4EIZC 5BRZA 4ZODA 3ZLQC 2R4SL 4QHLB 1KTRL 3GI8H 4GMTH 3BMVA 5F93C 4NRYA 4LGSB 1AY1L 5AWNH 2W9DL 3VMOA 1A4KB 1M05A 2NZ9D 2R23A 4MB4A 5IBTH 3KDMB 4KWUA 3O8XA 4LPCA 2DQJH 1YN7A 2IPTH 4MYWB 2ADGA 2FJFB 4LOUC 1CD0A 2GSIA 2NY0C 2EECA 3WMSA 2X4OB 1TFHA 1IM9D 4H25B 4FOMA 1U92B 1U58A 2JIXA 4F9LC 1MQKL 1R6VA 2O26U 3DUUA 3GB7A 2IQ9L 2DMBA 2Q87A 3CZFA 1AGDA 4MVBD 2ARJB 4UINH 1ADQL 3QHFH 1NLBH 3OB8A 2X10A 4XVJL 4P2YA 5IJVA 4BFIB 2QEJA 1GRWA 1OGTA 3NFSH 4EI6A 5D4QA 2YD6A 4JQVA 4ODWA 3MLPA 1J05B 2QQNH 4RAUA 4ZXBC 5IHBA 2D0GA 4L3EA 4QXWA 2P49B 4U1NB 1JK8A 2AVGA 4QOKA 1OP5K 5CEYA 5T3ZH 5AG8A 2K3TA 4BJLA 3H0TB 4PP2A 2F19H 3S3PA 4M7LH 4L8DB 1AIFA 1T6WA 2XKUA 5GJSL 1HSAA 2D0FA 3ILPB 3ZTJG 4ZYKA 2VLME 1A3LH 4GKNA 1U9KA 2BK8A 2NXYC 3KPLB 4U1HA 3DURA 3VWKB 1FORH 4WTZA 2V2TA 1ITBB 4LKXB 3P0VL 2QSCL 1TQCC 1M7IB 1JF6A 2YS4A 5CWSA 3X14A 2W1NA 3ZT6A 4KRMB 3VGEA 4W4OA 5E5MA 1C5DB 5KS9F 4WW2A 5HYSA 4M62H 2H6PB 3FQXB 4M9OA 1CE1L 2KPNA 5LBSH 3S8WA 1TZHB 3L3HA 2P44B 4GBXC 4XHJD 4OGYL 2X4RB 2Z93B 5FM8A 1TETL 2ADJA 3G6JE 4GO6B 4GG6B 2EDRA 5CJOL 4Y16C 4PJCF 1EAJA 5I76B 1NC2A 1DVFC 2Q7NA 2LTQC 3GSWB 1GOGA 1NBQA 2QHLA 4M7ZC 5DJ6A 1EHAA 3TA3A 3O6LL 1IGCH 5SX4H 5BRZB 2OTUB 4WO4B 1A7BA 4QHLA 1DE4B 1X4XA 1NCAH 2X4UB 4IRSD 3NPSC 3WNLA 3DUSA 3BUYA 2AJSH 2ITDB 2MQ0A 5DFVC 5GRVL 5BMFH 2FB4H 4KKAD 5F9JB 4XBEL 4LU5L 5D96B 4LCYA 4IHOA 3B9KC 2ZG2A 1B4RA 1S78D 1CE6A 2B5IC 5CCKH 1CFQB 3MJ9A 5E2VH 5LWYH 3BP7A 5JA9A 4P4KD 2WINB 1GVIA 1ZV5A 4QXGH 5C0AD 1CGYA 2VL5B 5HYJB 3MRKB 2AV1B 4LBEA 5F88B 5D5MB 2R1XB 1XCTB 3G08B 3O41A 1KN4H 2VZTA 5JXAH 1B88A 2B2XH 3QWOA 3CNKA 1NMAL 4AEEA 5L0QC 5B39A 4UNVA 4NQDD 5GS0D 3PWLA 4X4YB 3IDYC 5FYJL 1T4KA 3ZYJA 5E4IA 3U83A 5C2BH 4XMLH 4LGPB 5CZVL 3L5HA 2VDOH 2V5TA 2BSED 5C09E 5FA4A 3QCTH 4EVNA 1DQML 2DLGA 4PJ5B 3BRDA 1DQQB 1E6OH 3JWNC 4Q0XH 2CXGA 4JDZB 1U8IB 5DJYB 3AMLA 5KS9E 1IEAB 1MJ7L 3DRTB 3VD4A 3GMMA 2LQRA 5I8CB 2A6JB 3VXPB 4OF6A 5AZ2H 3TZVA 1NBYB 2J8HA 2J3SA 3ARDB 3SQBA 3HRZB 4XPAH 1MI5D 2YEZA 5CCKL 1UYWL 1U8MA 4JGUA 4MHHI 3E2HB 2VKXA 2Y07H 3D2UD 5E9DE 5BMFL 2OP4L 3CK0H 4DN4H 4OM0L 3KPRD 1HK6A 1YYLL 1BFTA 1EPFA 2DM3A 4ONFH 1DDHA 3KYNA 4XBPA 3MCKB 2EDTA 1FO0H 4JFYB 5JORB 2V7HB 3W11D 1HXYA 1KB5H 4QF1A 4OZHA 4Y4FC 2ESVE 5HDQL 5AUMA 1CXFA 4X80L 1KJ2B 1S5HA 4GOSA 1A5FL 4HKJA 3IJHB 3MRNA 5FDWA 1FNHA 5L6YH 1NBZB 4JVPA 1INDL 4Y16D 3BQUA 3O45B 3OJ2C 4HCRA 2I24N 4PJIB 1AR1D 1U8HB 2DQTH 3IETA 1ZGLA 3KHQA 3IF1A 3VXSA 1BZQK 1MFCH 4AMKL 3WFCH 1CE1H 1ZGLM 2UWEE 4QOKB 1WLHA 3KPMB 4EOWL 5B22A 4RWYH 1S7RA 3HI1A 3NA9L 4G6ML 1CS6A 5D2LB 2P5WD 3SKMB 4U1JB 2VLLA 5FYKL 1A6UL 1OP3K 2D0HA 2ITDA 4CMMA 1ACZA 1KCLA 1VFBB 3GZKA 1J11A 4UT6H 1A3LL 1KGCD 1T7XA 4J3XA 4NQCE 2BNQD 1FNSH 4XGZA 4P2OC 5SWSD 3TN0D 2RFXA 4BK4A 1ZVYA 5DQDH 2X1OA 3MRKA 4W68A 5E8DH 3LPWA 4M7KH 2F74A 1T66D 2GKIA 4G8IB 3UZVB 4YHPB 2EYTA 3O3EB 4I8DA 1XR9B 1FHGA 1QSFB 3IDJA 43CAA 3Q5OA 1LP9A 2G2RB 4L8SB 4J3VA 4XVTL 3GNML 3QYCA 5DDHB 3EDFA 4XVUC 2BNUB 3LQZB 3MNVA 3QXUA 3PWUB 1J12A 5E94B 1I3GL 1IARB 4FQXC 4KVCH 3BDYL 4LLQB 1EFXD 3WNPA 3L5WA 4Y5XB 5DHYB 2XNAA 5DR5L 3U7YH 1DBKL 4PV8B 4FG6C 4HUKB 4TOYH 2EKSA 4YK4C 4LRIC 1MCCA 4N8CH 4IS6B 1CLOL 1CVSC 1TJIH 4O2EB 3H3PH 4X0KA 3X13A 4OZIB 2J7LA 1UJ3C 4E5XA 4HV8A 2XZCH 1WK0A 4I5BB 5GSVA 5DK2B 3GM8A 4CU6A 5IFJB 3QEUB 4HUXA 3D39E 1JPGA 2PUQT 1YEJL 4GLRI 1PEWA 1PY4A 1Z9MA 5ICXB 5JR1L 4KJQC 4JVWA 3ILQC 4X6FA 1YY8A 4CVUA 1YN7B 1J0ZA 3CFJB 2HLAA 1XH3A 2X4TB 5I1IL 1A7PH 4P5TC 4WNQA 3T1WA 4UBDD 4MDIB 5B8CC 4OZFH 2JIXD 2WV3A 3JWDL 1UB6A 4EI5B 5HYQA 4YFDB 1S9VA 4X6DB 1JMZA 4K2UH 2CKNA 4F15C 5E9DD 1XCQA 3OPZL 4G43B 5IVOA 3G04B 1DQQA 1NGZA 5EZJA 5HI5D 3TVMA 4ZFFA 3OKMA 5C0GA 3AXLA 5IHZB 3L3DA 3HE6D 4D0BB 4UIMB 1P1ZA 1X5XA 3O2VH 4YQXL 2NX5B 2VLJD 3R06A 5GRZA 4NKOA 1NAMA 1G9MC 3KPMA 2OL3L 1GGIL 1SJEA 3JV6A 2BFVH 5EC2B 2OI9C 1FVEB 4JGJA 2BVEA 4JY5H 3MZTA 5J56B 3BZ4A 4OIAA 3TN0A 3EOAB 4MB5A 3F7VB 3S34L 5T5FL 1KB5A 1CLZH 1WBZA 4OLYL 1T66C 3ALXA 3DX8A 2ESVA 3ULUF 1MIEH 3KJ6L 1SJHB 3I3BA 3MRQA 5E6YA 5J13C 3GHEH 3MV8A 4Z7UE 2GJ6A 2KDGA 3RKDD 3LN5B 5IK3A 4FFVC 1AD0A 1KB9J 3QUZC 4Q2ZB 4XNXL 5KVFH 1JN6B 4NKDA 3QG7H 2NW2B 4PJXA 3RL2B 3VI3F 1G7LA 4BH8A 4CN1A 3LV3A 4PRIA 5J11C 3AY4C 4WFFD 5C0CE 3C8KB 5E95B 1MCJA 5E2UH 4F37F 2VR4A 5A43C 2DDQH 2EEBA 5J9PA 3LN9A 3GKZA 5B21A 2B1HH 4ZUTA 4WIQA 2Z8VC 1L6ZA 3PWUA 1U91B 2FECI 1X5AA 3MV7E 2BHUA 1J8HB 1QRNE 1P53A 1ZA6B 4QGYA 1LK3H 2WY3A 3DX9A 1GC1L 1U8LA 3QDMA 1WZKA 4J23A 2XY2A 3VD5A 1A6TB 3FQUA 1S9XA 2O5XH 1OVZA 5E6ID 3B9VA 3LPFA 1A14H 5CHNA 5C08D 2R29H 1NGPH 2ORBL 4JFFA 4D3CH 4ZD3H 3SKNB 2L7UA 2XZCL 5IG7B 3P9LB 4KJPD 1FV1A 1RJZB 1LQSR 5IF0A 5I30L 3HLAA 3O2DH 1GIGL 4UNUA 1H3PL 5I74C 3MLXL 5FDYA 4U0RC 5E6IB 2MMXA 2GT9A 1A6PA 1VEOA 3ORJA 1SHMA 3H6JA 3VG0L 2NY3B 3L5XH 3TPUB 3HC4L 1INQA 3CDGB 1F8TH 1QFWH 1IM3A 3LKPA 3LIZL 2ZKHH 5E5UB 1UB6B 3OXSA 3WIHH 1QEWB 1I9EA 4OZFB 2HFFB 4H5SB 3FT2A 4G9FB 4OFIA 4QYOB 5IVXA 2CIKB 2X9XA 4DOHE 1MAKA 3L3GB 4OB5H 1J18A 1MWAH 5LKNA 1GJIA 4PJ9B 3KLSA 1F4XL 2YKLL 4RIRB 1K2DB 4Z7VE 1FNGB 4YE4L 1KCRL 2WQ8A 1YEIH 4U6XB 1EHLL 4X7FC 4TSBH 3JVGC 4PB9H 4PRDB 4FQ1L 3STZA 1CVRA 3DVFA 3QXVA 4Y5XC 2CK0H 2YPVH 5ETUB 2NW3A 5ECJE 3WS3B 1H0DB 3MRJB 3C5ZA 4NFDA 3MBED 3RAJH 5FXCH 5GISL 4KTDH 5T5FH 4ZUVA 1PG7W 1I7ZA 4ZO6A 3RVVD 2FBOJ 2DI8A 3QUML 1YY9C 4NQEA 3STLA 4XP1L 2A6KA 1ED3B 3G5YB 4JY5L 5I75C 3DVNB 1T03L 5EU6A 3GMRA 4R3SA 3W9DB 4O51B 1HCFX 3OX8B 1CLZL 1ZHBB 4KC3B 2FO4B 3T3ME 2MSPA 4KKLC 4YNYA 5EZJB 1OLLA 4RMRA 1UM4H 3WL9A 5JW5A 1XF4A 4PY7B 2W65A 1K3IA 4NT6A 5J9PB 5HHQB 1RI8A 3FOLB 3DIFA 4ZAKB 5K9QI 3I75A 1KFAL 5F9WB 3TIDA 2I07A 3TT1H 5C07B 1JYWA 2Y72A 4WV1B 5MENE 3MV9B 1D5MA 1ZT1A 4HPOH 4DCQB 2VZ3A 3VJ6B 3D25A 1ZHLA 3EHBD 2COQA 3UTTB 3O8XB 3LKNB 1SMAA 3TZVC 4Z7UA 2H1PH 1Q72H 3MRQB 1NANH 5D96C 4P9MH 1C5CH 1UXWA 2B5IB 5CHNB 3BN3B 3RA7H 3EYQC 2NZIA 4ONGL 2DRUA 1WTLA 3U0WL 3C5JB 4PGBA 1QYGL 4S1RL 5IBLC 5TF0A 4EJ1C 1YEEH 2UUDH 3WFBH 2GW5A 4M8QB 4GAJL 5KG9A 1A7QH 4G9FA 4ZS7L 4G3YL 1D5BB 5IVXB 1G6VK 1OD7A 3DVGB 3PJSA 1NQBA 1A6ZA 2VDOL 1YEGH 3T8XB 2HTLD 5F9OH 3BPNC 4ZUTB 3KS0J 4P2RD 1INQB 4IOIB 1CR9L 2EC8A 2D31A 4WUUB 1TNMA 4YHKH 4RMWA 1FFOB 1QBBA 2WWKT 5EO0A 3FHAA 3IFNH 5C3LD 5J11B 5C7XL 2VSCA 5GRXG 4X7SL 3WIHA 3WN5B 4ZSOA 2Q86B 4MMZC 5KS9A 4MAYD 1I8MB 1WIPA 2DJ4A 1W8OA 3TO4B 2YRLA 4JFFB 4Q9QH 3PHQA 5E8DL 5IFJA 4TPRL 5E8NA 3W5MA 5E5MB 1GCFA 1Z5LA 1GYAA 2AK4E 1OSPH 1RHFA 5EUOE 1BBJA 4BQ9A 3BPCB 3FO9B 2DM2A 4NDMA 2A0LD 2DQUH 4LVHB 2HP4A 3BIKB 2QQKL 5EO1A 2FX8H 3B5TA 5JW4R 1IGIL 1YPZB 2IALA 4XCFH 3I6LD 5FA3A 1YEFH 3HZKA 4BZYA 3CFEB 3OR6A 5I1HH 3X3GL 5F7MC 2X4NA 3SE3C 3RWFA 3EBAA 1YQVH 3HNTL 2LE9A 4Y4FA 3G5YA 3TO2B 1JK8B 1XFPA 3NA9H 2VUYA 4YUEH 4KZDL 4L9LB 4MQ7A 2R2CA 4NUGH 3T3PF 5JW4Q 3C6LB 1U42A 4K8RL 1KJVA 1CGSH 2BY1A 1NUNB 1WWBX 3TC9A 3O8XC 1WZ1L 2CRIA 4M03A 4H8WL 2PYED 1N5YL 3FO1A 4KAQH 4G6MH 1B4JH 1H3VA 1HNFA 1QSEB 2J88H 5HHVL 3WJLA 3VXUB 3C08H 3NIFF 1EHNA 4ELMA 5TE6H 1L4IA 1AC0A 4KHXL 2ZOKA 3CIQA 3PL6D 3OBAA 3QUKB 3TBWB 1DLFL 4WW2B 3SN6N 4OCRH 2E7CA 2HKFL 1D9KB 1BIIB 2P8PA 1A7NL 2H32H 2EYRA 1K4DA 1T2QL 3O0RL 4J6RH 1PX3A 5SX4I 4CDGC 1AGFB 5GJTL 4OF5A 1I9IH 2MKLC 5CD3A 3L95B 4OD2A 3AFLA 1A64A 3GUTB 4U3HA 5EOCH 5T1KD 5J1AB 3TBSB 1HHJB 1BD2E 2XN9B 3LZFH 1G0DA 5HI3C 5AZ2L 2DQEL 4AM0A 4BYHA 2WUBL 3F7YB 2QQKH 4EI6B 4Y4KC 1G7LB 3BUYB 1HHIB 4EVNB 1NLBL 3GRWA 5GS1B 1I7UB 5CEYB 4URTB 5TPWL 4X6EA 1P7QD 1P6FA 1D9KC 5J6GB 4PJ5D 2H9GB 4XMLL 4LIQE 4XT1C 4F3FB 1URLA 5DYOA 1CL7L 5BZWB 1FGVL 5GS2D 3RVVC 2C5DC 3JTTB 3D25B 3IDIB 5C7XH 5CJ5A 4Q9RL 2OBGA 1KCSL 2FIKA 4F2MA 4GAJH 2EH7H 2MQCA 3KXFD 4KH2A 1U0QA 1UQSA 3KPSA 3U46B 3MGOA 4D9RD 5D1XD 2CDEB 1R3IL 4MJIB 5I1LB 2EIBA 3RWFB 5DRXA 4EXKA 1K4CA 2VLJE 4XXCA 4Y4FB 1F5WA 5D93C 3HUJF 4OUUB 4P57A 3IVKB 3PABB 2J8UB 4X4ME 4G8GE 3JTCA 4YDLC 3PNWA 2XXMB 3RRQA 5E6IA 4AZ8A 2QSTA 1KF9B 2ARWA 2F8XC 2W59A 5C0BD 5TQ2H 4MJ4A 1E6JL 1LDPH 2NY5L 2SEBA 1A02N 3HCVB 1ZHKB 4JFDA 4DQOH 1MEXL 3FCTB 1LO5B 4MJ2A 5F97E 1JYNA 3CX2A 4ZSOE 3NAAL 3BO8A 4LHQB 5DHVA 5FUOL 4OF8A 4GRWE 1Z6JT 1JWSA 2XKNA 2V5YA 4G6AD 2ZNWA 4IRSB 3EDDA 4MNGE 1NMBH 3AM8C 3RNQA 4JFQA 4OV5B 1UWXK 3ETBF 4E41B 5DEFB 1JTTA 4EDXB 3MRRA 5A2IH 3W0WD 1U6AL 4MD0A 2R69H 1DN0A 3SDCC 2AQ2A 4F58L 4OCNC 4JCMA 4ELKB 2PXYA 5DFWH 1A7OL 1T03H 1Z9OA 4ZXBA 1YQ2A 1U3JA 5EZOL 1UG9A 1DBJL 1M71B 4BFEA 2YXMA 3F58L 4XX1E 2RGSA 2BSRB 2ZG1A 1AGEA 3PGCA 2WBJC 1NUFA 1JFQL 2HJKB 1IM9B 4RGOH 2R4RH 1I8KB 2GJ6E 1HHJA 1DUZB 1KXQE 1S5HB 1Q1JL 1HKLL 1IC1A 1ZA3A 2QSCH 4JQXA 1I3RB 1KLGB 4KTDL 1ACYL 2FJGB 5IB3B 4P23B 4Y5VC 2VXQL 1IGIH 4J8RA 1FNLA 1EERB 1MI5A 3RGVC 5C09A 1I9RH 3BYTA 4FXKA 3DI2B 4XWOC 2ZOKB 3QR2A 3AREC 2AGJL 3V9FA 2H9GA 3GHBH 2HRPH 4E5XB 3CZJA 5FYKD 1GH7A 1KC5L 1LO4H 1UGNA 3H7BB 1B6UA 4N68A 3UTSD 2OJZH 3OKEB 3OKYA 4B0MM 1D5MB 2AJYH 4G80B 2OR9H 4WUUD 1HSBA 4GW5B 5ICXA 4XI5D 2MQ3A 2EYSA 5MEND 5J1TC 3CPLA 2UWEB 2P5WE 4PJ9C 4APQA 3C8DA 3RUGB 3VFRB 5I30H 3OJDA 2NY7L 4QHKJ 5DK0B 5IB4A 2NR6D 3T2QA 3MNVB 3E6HA 2XRAL 4M5YL 1ZHNB 2Z31B 1ZE3C 3U9PL 5SWQA 5I15L 1VKXA 2EDXA 1K6QL 1CBVL 1H3PH 5FM5O 3PNWB 2HH0L 3I2CL 4AEHH 4JKMA 1OAYH 2VXTH 1BREA 1IQDB 4FFYL 3ULVF 3OKOA 3IB4A 1CIUA 3U0WH 1U8PB 2R4SH 4LHUD 5DJAA 1KPUB 1KYOK 4HIJA 4PB0L 3OF6A 5I1AB 2VABA 4R4ND 2NMSA 1SJEB 4GAYB 1BQHA 1JF1A 4GUPA 4PJFA 4QRUB 4O4YL 1XGTB 1WJ3A 1X5IA 4WI2A 2IBGA 3WN5A 4YEEA 5J12B 4IS6A 4Z7OF 2A9NL 5L88L 3KYKH 3T4YB 1UM6H 3MUHL 5IQ9A 4JRXE 4MNQE 4H20L 2VZSA 1DFBH 1FNEA 4BZ1L 2A83A 3G5VB 4K9EH 4WJ5A 4Q9CA 5F7LB 4WFED 5ESQB 1NGXB 4PGCB 1NCTA 1K4CB 1ZANL 1MFEL 1F6AA 4PJ8D 5DVMA 4H0HB 1OAZH 4F7EA 5CGTA 2KUTA 4YR6A 5DJ6B 3GMNA 3BEVA 3DGGB 4D2NA 4HX1B 4O9HH 3MC0A 4XPFH 4R4BB 1LP9B 3RY4A 4AEHL 3RUGF 4S0TD 3OJVC 4OLXH 3P4OA 1ZMYA 4XNXH 5KVFL 5HVWA 4KGLA 4CU7A 3ZDYF 5I1GH 4NJAL 4HMEA 4ZOBA 1WBXA 2AABL 4XNQB 3H9SB 2O61A 3U30C 4UIKH 3U36B 5HHPB 4PRPA 1KEGL 4LNVA 1KTDA 2XTJC 3SBWC 4XRCA 4U6TA 5F7KC 3EJJX 1LVEA 4X7DC 2V17L 3N85L 4J8RB 1P4BL 3SDXF 3K2UL 1D3CA 3DX9B 3E6FB 4FTVA 1NUGA 3RWIA 1SEBB 2XWTA 1ND0A 1YUHB 4XPGL 3K4DA 3O9WA 4IMLA 5CLWA 1EZVX 3V6OC 4MAYA 3WSQH 4J3TA 3CC5B 4O02L 3QUMB 5IB4B 4YHOH 1FG2A 4H20H 2VLRB 4WW1A 5I1KH 4L3CB 5DF0A 4ZAKC 5H37G 5D1QD 3RBSA 5SX5K 3V5HA 4OGXH 4KROD 3SY0B 1ZXQA 3IDNA 3SDAC 1D6VH 4JRXD 4WWKC 4X9IA 4PRIB 5EIQA 1QRND 5FA4B 3RI5F 2BNRA 5DLML 5EUKA 5DC0A 5I19H 4WFGE 3KPRA 1WV7T 2H26A 3LIZH 4EI5A 5J1AA 1VESA 4HIHA 3MXWH 4PY8I 4JPVL 5T1DH 4M7JL 1OF2B 2WBWB 4RGOL 3VG0H 4HIJB 3SO3B 5JPMB 5C0ND 4WFGD 1C7SA 2G5RA 1JGUH 3PP3K 1RZGB 1KEML 1SEQL 4JPIB 3MLRH 3MLUL 2APTA 1DUYB 3Q5YA 2PR4L 3JWOC 4RA3A 5FF6A 4RCAA 3JV4A 2ZUTA 1CXLA 2CLRA 5JXEA 2Y5EA 3K1DA 4ZTPL 2C7UB 1FVEA 1U91A 4KVCL 4MCYB 4LARL 5FGCE 1QSVA 3DBXB 1PLGL 4KK5D 4HZAA 3AS2A 4MA8H 4LP4A 3KPNB 2X05A 5C6TL 5FCSH 2XA3A 3WFDH 2DYPA 2BP3A 2UWEA 3ULVC 3LKSA 4NQDA 4PRHE 3OTTA 4R4BA 4JZOA 3RHWK 2EC9T 1G7MB 2FWOB 3RIAF 2JTDA 2IH1B 1F42A 2Z91B 3I9GH 1FZJB 1W0WB 4YDJB 2HRPL 4HHAA 4P2QA 1GGUA 5FYJD 5CKAA 2N4IA 2XZQH 1QBLH 5CILH 3EYFA 1DBML 5KSUB 3H9HB 3DARA 4O2CB 3GMOB 1NGQH 1EJOH 2AEQL 4DOHB 3WXWL 4F33B 4JY6A 4P4KA 1DANU 1NMCC 1GC1C 15C8L 1JJUA 3QG7L 3RX8A 5IJVB 4XZUA 1GGTA 4QT5A 3SBWA 3U82B 2APWA 4ETQB 1MCRA 1F58L 1L0XA 5B4MC 2DWDA 1T22B 2OXGA 2OJEA 2HFGL 3E1F1 5EC1A 1U8NB 1UH2A 1WFOA 1TCRA 1I8IB 1NEUA 5GSRB 4KQ4L 1P4IL 5K9JL 3D85B 1NPUA 4AL8L 4ZPTA 4Z7QF 3WD5H 1BQSA 1KPVB 1VFUA 4TNVF 3HPJA 5JZ7D 1DBAL 4UUJB 3RX5A 2NY4B 4PGCA 4PG2A 3GGWB 4M48L 1F6AB 5ADPL 2GFBA 3BPOC 4JHBA 5ESVA 5C0RL 5I9QC 1PG7X 1UZ6F 2G60L 4KROC 1MCBA 4WEBL 1V5JA 3F62A 3QDJA 5B3JF 5CIPB 4PRPD 2GT9B 5FUOH 3GSNL 1OGAE 4M8QA 1K5NA 4POZD 4JAMA 1LEKA 4HUVA 4PJCE 4LF3B 4OLUL 4P5MA 2Y07L 1MEXH 3WHXA 4XC3L 4WWID 4CN4A 1E0OB 3UAJC 5IFHL 2JIXB 5HHPA 3ARDD 4MXQA 5CJXA 3ZE0E 3A67L 1QNZH 3C09C 4GRLB 1A7PL 4Z5RB 4JRXB 4QOKD 4XP4L 3ZZ1A 4J6RL 4L3ED 1T2QH 2BXZA 3O0RH 4AJ0A 2JF1A 1NAKL 2WBKA 3QUZA 1CU4H 3GIVB 3ARBA 1HYRC 1RUKH 1MRCH 4PRDA 2F58H 3ARBC 3S4SA 2HYMA 4ZO7A 1R3IH 2DJUA 1TQBB 3VGDA 4ZAKA 5IVXF 1BX2B 4MDJB 4MD4A 3LRSB 5BS0E 5JIIA 5ESAA 2FZ3B 1DBAH 2ZUYA 4XMPH 3ET9F 2HMID 3T77B 1JPSL 2OK0L 1CD8A 5D1ZC 3L3OB 2YA0A 4XCYB 2EYSB 3D85D 4K94C 4LSRH 3BIKA 4PTUB 3I84A 1CL7H 3FRPA 1RAMA 3AC0A 4N0FA 2YD9A 4P2OB 4NQSA 5TF1L 2Q8AH 1FZKA 4MD5B 4HXAH 5D6CB 5EC1B 5IMLB 4MHHG 1XF3B 2VQTA 3NCBB 4OCSH 4BELD 5DT1L 4GG6A 4R0LC 1JHTA 4BUGA 1JGVH 3DJ9A 2D7MA 4TVPD 3QIBB 2VLRE 3P77A 3PUCA 2ZUQB 4WW2F 5TGBB 4FQHB 3EYSH 3TIDB 4DEPB 1RHHA 4FFWC 4QHKI 3AVEA 4R4NC 5HVHB 3BE1L 3FN0L 2APFA 1OT2A 4RGNE 3ARDA 4Y19E 5SWZA 2F54A 5FOBA 5TDOB 4GXUM 1C1EL 4FFZH 5DC4B 4MWFA 1S7SB 4JFPB 4K94H 4EUPB 2HG5B 3SGKA 4LK4A 2A0LC 4C54A 5EO1B 2J12B 2AEWA 4GRMA 5MP6H 2KKQA 1D5ZA 4Z8FH 2NW2A 2QADD 3F6LA 4PJXB 3RL2A 3QUYA 1UM5H 4P2QB 4X6CF 3QXAA 4OCRL 5GGTA 4LARH 4MB3A 1NGXA 4JLRA 5E8NB 1J86A 4DKAA 4JR9H 3IKCA 5CJOH 2XZAH 4IRJB 4NWUL 3DX6B 4HUNB 3UX9B 4YDLB 3GSRB 3V4VL 1MH5B 4QRRB 4PD4J 4BQ8A 3BHBA 1J5OL 3T04D 2HFEA 4WI4A 1N59A 2VUOA 4YPGB 1YC7A 2CUHA 4K07A 4ZFGL 2A1WL 3RWDA 1JZ4A 5I8KH 3PHOA 2FATH 4Z9KB 3FAXA 4GBXB 1YQVL 2NY6B 3HNTH 3ARXA 4LRIA 43C9B 3U36A 1FO0L 3ARBD 5EU7C 5I1DB 2CO6B 1A2YA 5KVEL 2NCMA 4L4VA 2PF6A 1RIVH 2Q86A 4ZSOB 1WWWX 3NZHL 5FGSA 2VLLB 2XA8L 4UOW0 5FEBA 4NQCB 3SQOH 1UEYA 3C5ZD 3DMMB 5ACMA 4JPWH 3QHFL 3IDYB 1OT1A 5DVLA 3RVTC 4UT7L 4XH2B 3UDWA 3CC5A 3OAZH 3PE9A 4P3WA 1E4WH 3HNSL 3PGDA 5D2NE 4NN6B 4M3KB 3OKDA 2HN7B 2NY3D 4KXZI 2IALB 3NFPA 3RVUC 5CD5C 3LPGA 3UJTH 4PJDA 3VRIA 4NCC1 5IVZB 4H1LG 5E2JA 1JHTB 2HT2C 2DQFB 1EHXA 4M48H 4QF1B 4NNXA 4R4FL 4QRTB 1VSCA 5C0EB 4PG2C 5K93A 2FYYB 5LGHH 4WWKA 2P42B 3HCVA 1S7QB 5HVFB 1RUML 3L7FA 4I4WA 4WHYH 1KJ2L 4YIQA 3QXWA 4F7MB 2M8XA 4ERSH 3HI5L 4FHBD 3DROA 1AJ7L 2FO1A 1WBYB 4XC1H 4P3DB 3TFKA 3SCMC 4XCNB 1QYGH 2LTQB 2XI9A 3MRDA 4S1RH 1PVHA 3P4NA 5ACZB 3HR5B 1CGWA 4JFHE 3W39A 3HZYA 3QH3B 8CGTA 4PIRF 5D1XC 5E2TH 2J4WH 4NQEB 3STLB 3MV9D 3HTLX 4LAQH 2B4CC 2VSDA 4V3EB 5JPNA 3HA0A 3O3AB 4EUPA 1YEKH 3EUUA 1OW0C 4HQQH 1GGBL 3SDAD 4PYGA 1R24A 4Z0XA 4U05A 3LKRA 3TT1L 3V6OA 1QTYT 5BOZG 3D87B 2X4PB 3PGFL 5GS0L 2DI9A 2ZKHL 3JVGA 4A6YH 1N2RA 4MLIA 4KK9C 1FL5A 4GAFB 5I76A 1L6XA 2HTLC 4FS0A 3TF7A 5HD8C 4EQ2A 2WIIB 1D6EA 4CVZB 4OIIH 4NHUE 4XXDA 3O9WD 1FL3A 2P8MA 5F89A 1T6VN 1TVHB 5BQ7A 4KU1A 4Q6YA 1EEYB 2DYPD 3HRPA 4MA8L 1EEZB 4HG4J 4WV1A 4YHLL 1MI5B 2E9JA 4H8WC 3EYVA 5LBSL 4YZFE 2HLFC 3VRJB 2IH3A 4ONOA 4F3FA 4MA7H 2E6PA 4HZLB 4HS6B 4NKOB 1RUAH 2R2HB 2NY7H 3MBEB 2YPLD 1YECL 3RVTD 3MLZH 5D1XA 2D7TH 4JCLA 1PJ9A 3BGFC 4G80A 1CXEA 3CLEL 3MJGX 3LMJH 1NBVL 1SBBA 5H37H 3V6ZB 5HPMA 1ZT7B 3FMGH 2R8SL 5I1LA 3CFIC 1NL0L 4M6NL 4NRZB 4DKEH 4O02H 4EI5D 3WSQL 3P9MB 1X6LA 5C0JB 1YYML 5EA0L 4IRZL 4AQOA 1P7QA 1JN6A 4NQCD 4DJMA 4PJHB 4UTBH 2VDNL 2I5YH 1X5FA 1LO2L 3BESR 1K5NB 5C86A 2BNRE 4UINL 1C08B 1T7ZA 4N8VB 4YHOL 4JRYB 4OIBA 1U3ZA 3QPXL 2EH8L 3G6DL 5KSAA 4OAWA 4U33A 1CN4A 4NNXB 3ULUL 5BXFB 1DSFL 3LMJL 4R96B 4X6BA 3KYNB 2AJ3B 2P8LA 3FQNB 3TZVB 4MCZA 3DUHA 1MCPH 4MS8A 2IPTL 4OLYH 5TDPB 3WNNA 4N5ED 1OTUD 4NO3A 3ZDYE 1OTSD 3QT2A 1IRAY 5DD6A 5TE4L 2R0WL 2V2WA 1I7TA 5JZ7C 4X5WB 1OAZL 1X5GA 2ENSA 4NJAH 5I1GL 5F7EH 1IMHC 4WJ5B 1CFVH 3IAPA 2F9BT 1HXYB 3LDBB 5C0FB 2CJUH 3PL6A 2Q3ZA 3WCYA 3IKKA 3GK8H 1G84A 1CXKA 2ZNXA 3TF7C 5IOPA 5JW3L 1BWWA 1CQKA 5H2BB 3QB7C 4TUJA 3PGFH 5GS0H 1D5IL 1G9NL 4PTTB 1FL5B 1TJHL 4NIKB 2WUCL 4DGVH 1RIUL 4PYHA 3UTZA 4WFHE 1YEKL 4NNYB 5FM4A 3ZE2F 5ELIA 3QO1B 1PFCA 4QYOA 4RNRA 2DM7A 1PBYA 3BH9A 4OZIE 3BKJL 3SKMA 4PBWD 2CJUL 3LH2H 2RIKA 9CGTA 4UZGA 5GIRA 2OR8A 1MCQA 2X70A 4HS6A 2D4DA 5JDSB 4XPHL 1NEZA 4L8SA 5BO1L 2MPAH 4MAYB 5HHXL 1OAYL 2VXTL 2A73B 3UC0L 1H3GA 2VR9A 3GM0A 4LMQE 3AS1A 4HX1A 3S34H 1G7JA 4OTXL 4QRRE 1IE5A 3WJLC 4YHPA 1OCWL 3U7YL 4NWTH 1RURH 4RMSA 2P5WA 5DD3L 1GHFH 4PJDF 5HTSA 5EOQH 5K9QG 5IG7A 2IC2A 4KY1H 5GS1C 5ADOH 5INCB 2VC2L 4G6JL 4KI5F 4YDIL 5J6GA 4G6KH 5KSBE 1OAXH 2XACC 1P7QB 1H9VA 3P4OB 4C56B 3RU8L 3FO2B 4S0SD 4K3DH 5CZXD 3PWPE 2VDLH 1S5IL 1M6OA 4NBYB 2ZCLL 4D8PA 5IR1A 3RZWA 5JIKA 3U4BL 3TT3L 4HK3N 5KVEH 1IM3B 4NT6B 1MLCB 1RSFA 2FL5B 2FSEB 3W5NA 1HKLH 1I7TB 3ARQA 3NCMA 3TWCL 1JPFA 2CDEA 3EJZD 4TUOB 2CIKA 3LD8B 3QIUC 3TYGH 4HT1H 3DRQB 4M4RA 4XB7A 4Z7VB 3HC0A 4WO4C 4X4ZA 3O3DB 3SCMD 1EEQA 3OAUL 3P4MB 3GSOB 3HZMB 4JZNA 3QWRA 1BQLH 4N90D 4LRNL 4XBGA 2J2ZA 4ODSL 4XAKD 5BRZD 5JMRA 5L2KB 5EZOH 4G8GB 2D7NA 2R39A 3DSNA 3VW3L 4PP1C 5DDHA 3MFGB 5HPOA 1IQWH 1GAFH 4XTRD 4U3XA 4YHNA 4HLZG 4OGZA 1NCCH 1N64L 4PREB 5I71B 1J1XH 2C3VB 3KPSD 4YXHH 4WTZG 5I73B 4HC1H 2Z4QA 4PJFE 3V5KB 2NXZB 3V6FA 1QFWI 2D9QB 2PYEB 4GQ9L 3RY5A 4QXUH 4HIIA 3QEQE 5HY9A 3LEXB 4PGEB 5KVDL 2Q20A 1LO0H 2DL2A 2D7QA 1HNGA 3D39A 3BAEH 4MAYC 4LCWE 1H15B 4I5BA 5EU5B 1W8NA 4ZPVA 1NMBL 3HR6A 1IGML 4M93C 5ANMB 1YYLH 4XNZC 3KLAA 3NGBC 4CN6A 1INEL 2NZ9C 5CKGA 4F7TB 2CDGB 3U4AA 1N3NA 4F8QA 2IAND 1FZJA 1W0WA 3ARWA 1BJ1H 3FQTA 3QUMA 4KI5E 5DC9B 3QDMD 1NFDE 5IW3A 3VFNA 5TF1H 2Q8AL 3RY6C 3FB5A 2QTEA 1QG3A 2ZSWA 4PJAE 1Q9KA 4PS4H 2NY0D 4CU8A 3UTTA 2IPKA 3ZTNH 1AD0B 4FQQB 3MRLB 4JN1H 1CT8A 1MLBB 3N1FC 3TIEA 5BVJB 2ZPKL 4BQBA 4S1DC 5LGHL 2XFXB 4LSPH 2VDRL 1IFHH 3PXHA 3C6LD 1R3KB 4XNYH 2EH7L 1CDCA 1HH6A 4HKZB 1NAMB 3VGBA 1S9XB 4M43H 3KXFA 1CFQA 3EZJB 2YPKA 3P73A 4XX1G 1B3JA 1RK1B 2H3NA 4Q74A 3WNKA 3ULVD 3TN0B 4UT9H 5F88A 4K7PL 4X98A 1HSBB 5FO8B 5F3HA 1OAUH 4K55A 1DLHA 1A9EA 4UT7H 5F7DB 5AD0A 1KB5L 2FSEA 4JEGB 3S4SB 4PRNB 1DBBL 3W11C 5E2VL 1WAAE 3IFPB 5LWYL 2Z92A 1X4YA 4XC3H 4B50A 3UTTD 5CJQH 3MOBL 1WGOA 3F12A 3Q2CA 2V2XA 1KLFA 3EOYG 2DQHL 4NKDB 1VPOH 3QULB 4KDTC 4ISVA 1GGCL 1ZVHA 4K7FB 3IDUA 2ARJA 1HI6A 5D6DA 3QZWA 4WU7A 3T0EA 1IZKA 4OCLC 5CEZL 3MOQA 3DI3B 2HKFH 4HK0A 5BV7C 3O6LH 1ITCA 1T7WA 3QIWD 4G8GD 3MV7A 4BM7A 4KUCD 3STBA 1OAUL 4KK9D 1FYTD 2Z9TA 5D7LA 5EU3B 4DUWA 1QUNA 2WAHA 5DD0L 5DQ9B 3O9WC 4KAQL 1N5YH 4LNRA 3QRGH 1ADQA 2C4FU 3O4OB 1TMCB 4FTVD 2VJXA 4QOKE 3VXUD 1QSED 5C6WH 4ZYKB 3RWGB 1LWRA 5KN5B 2FL5A 1IFHL 2FD6L 3UTSB 4NUGL 3D39B 2A74B 1DR9A 4O58L 4R96A 1BX2A 4X6BB 1UM5L 3S35H 3VWJC 4LPUA 2HFGH 2NY1B 1CG9B 3G5VA 1TCMA 4KKNA 5TQ0L 4X6DE 3LS4L 5I6XC 3MNZB 5D2NC 1OAQL 5CEZD 5M95B 4OLZL 5IW1B 2FGWH 4PRBA 5D1ZD 4FFZL 3WS3A 3VU2A 1JV5A 2FRGP 4XPTL 3N9GL 5T1KB 1RZIA 1NJ9B 4YBQC 5HGAB 3MGOB 1NCWL 4ODWB 3F5WA 2XFXA 2K1MA 4HC1A 1F58H 5I66B 1AE6H 3AREA 4XNQA 1OGAB 2RR3A 3HE6B 3WHE1 4D0DB 2FBJH 5F6HI 1SM3H 3UTPE 3FZUC 1T3FB 2H45A 2Z4QB 4P5TA 3CZFB 1LEKB 5LXGL 4P5KB 2IPKB 1ADQH 4X7SH 3IDXH 4UQ2A 1NLDH 4FQLL 4CNIA 1VB9A 1RY7B 3DXAE 3U0TA 3VFGL 3GJFK 4XMKL 5HGDB 3ULVL 4GSDL 1YJDH 5AD0B 4X99B 5FYLD 1CE6B 1P4LA 5I2IA 5AYQA 1EGJL 5TE7H 5L0QB 3TV3H 2EXYD 4QHMA 1CYGA 4NSKB 3E0GA 7FABH 2J6EL 2DQJL 1UKQA 3IFNL 2R0LL 4E41D 4I1NB 5HXMA 3U7WL 4YAQB 4XWGL 1NFDA 5AWNL 3WFBL 1JTOA 1CR9H 3BZFA 4M62L 3QFDA 1U3HD 1XIWD 3D69B 4GMTL 3GI8L 3BJ91 4ODHL 3QI9D 2BDNL 5KAQG 3QBTB 3VE0A 3QDGB 1Q0XH 1W0VB 4N0YL 1Z2KA 3KYOA 3PQYA 4U6VL 4JG0H 3MRPA 5HJ3A 1ZK9A 1TZGL 1LK2A 3D9AH 3L9RB 3UO1L 3GRWL 1A4JB 3ZDXF 5D9SA 4NQSB 4PJHE 1J7VR 2JJSA 3O4LB 4LHUB 3VXRD 4UB0L 3MJ8B 3MREB 4HBCH 3DO3A 2R1YA 5IV2B 3UTSA 3BP7B 2APVA 5D2NB 4IDJL 3WS6C 4Y4KD 2VDLL 1IGFL 3B9KD 1WT5A 1FZMA 4RSVA 4HPOL 4P23A 3QJHB 2LAGB 3DMMC 3KPLA 3ZDXE 2PO6D 1Y18B 4LEXH 3WLBA 1GZPA 3FO9A 2C3XA 2QV2A 3K46A 2E7MA 4G6JH 3HUJE 3BOVA 4KKBD 4Z7QE 4LLUA 2OYPA 5IVNA 1MLCA 1ONQA 4TN9A 1IAIH 2ZUWA 4I2XA 1F90H 3PHSA 5F70A 5A3ID 4X4YA 1IC7H 3NCYS 4MDIA 1U8OB 4B7IA 3TN0C 4L1HA 2CQVA 2PO6B 5EZIH 2F15A 1TQCB 3MTRA 5GS0C 5JQ6H 3GJEB 1HWGB 1EFXB 4S1DD 4JFQB 4OLWH 2ZUQC 1P4IH 5K9JH 3QO0B 4KJWD 4BSWB 3G6AB 1WZLA 5F9DC 2YOCA 4P4KB 1P7HL 1BEYL 2Y5TB 4G42B 1JUFB 3KPPA 4W6WB 5DMIL 3G6JA 2YD3A 4OLVL 1H8SA 5B38A 5C0EA 3VXMB 4W6YB 4KPHL 1YPZE 2ZJSH 2EDLA 1UB5A 4LFHG 3LVEA 2A6JA 3VXPA 4ZO8A 2GJZA 2O5YH 4GW1B 5DEGA 3RAJL 1E4JA 4LKCA 1QSFE 1F45A 1F4XH 1I1FB 3R4DA 4NSKA 5TFSH 2XQBL 3N1PC 3E2HA 4PJ5A 2EXYC 1N5AA 5HHNA 4UDUB 1P69B 4EN3B 4LLWB 1KTLB 5IMKB 1V05A 4UB0H 1WUNT 4BH7A 5F7HA 1QQDA 1TDQA 2XWJA 1R3HA 3Q3GA 5EUOA 5F7FA 3NGBB 1F3RB 2E6QA 4UV7H 5ANMA 4G6AC 3IFOA 4NQCA 4NO0B 4AH2A 1MFBH 2EYRB 1EAPB 1WFUA 2CKBB 3VGGA 3VXTB 3QI9C 3QAZC 1I9JH 5BV7L 5IJKA 3RTQC 3EGSB 2XXCB 5FYLE 3VFNB 1A21A 1AGCA 2VXUL 3WHXB 1NGPL 2ORBH 5E70A 3ECBB 1LP9E 4QXTB 3SJVE 2HH0H 4PJGF 1FL3B 5JPNB 1UVQA 4TOYL 5FYLL 5BZDB 4XP9H 3VA6A 4P46D 4CGTA 1J8HA 3CVHH 3QJHA 5AYUH 1BOGB 2GY5A 4OIIL 5JHDD 1MWAA 4Y1AE 4LLVB 1F4WH 4PR5B 1JYVA 3ZL4L 3K4ZA 3MREA 2K7QA 5KSBA 2OQJA 3FB8A 5DJDA 1L7IL 4ETYA 1FJ1B 4P46B 1U8QB 4RWHA 2AJYL 4OQTA 3ULUE 3WUZA 4MNQB 4HF5L 2XQBH 4LFHD 4LAQL 1XGYL 4OUUA 1T2JA 5TDPA 3PV7A 3QQNA 3HE7A 2EYTB 3O3EA 1NUDA 1AGDB 3S5LB 3WFHB 5E9DA 1F6LL 1JPTL 3P0GB 2DDQL 3KLHD 4OT1L 2X4OA 3MOAH 4XPTH 5C0AA 2BY2A 3SDAA 5DJ2B 4NPYA 1BIHA 1FNFA 3D3VE 1KUMA 3C5ZC 3QJFB 5MEPA 2QQLL 5C9JB 4PRID 3MRPB 2DLFH 1MVUB 4PJHA 4I13B 2ZJSL 1J9CT 2HFFA 4H5SA 1Q1JH 2RB8A 1JWMA 1AKJB 2NR6C 2YD1A 5DTFA 2DI7A 3BZDA 3IU4L 3K7UA 5IBUG 5DUBA 4F7EB 4RFNB 3WS6A 4HIHB 1GGIH 1S7RB 2BHYA 2OL3H 3CX5K 3TFKD 2QQQA 4MNHB 3WFCL 2ESVD 4L3EB 3F58H 1BVLA 4A2LA 2EDDA 3UJTL 4LNRB 1I3VA 3KPTA 4Y1AD 2LU4A 4GLRH 4G8FB 1AIFB 1WZMA 2R0KH 4X6CB 32C2B 2R56L 3K8KA 4Z77B 3MRJA 5JHDB 4QRSA 3OHXA 1Q9WA 2QKIB 4GBXD 1G7PB 3ZT5A 3R1GH 2C7UA 3U46A 2VYRE 1T7VA 2V5RA 2XV6B 4MD0B 1U36A 3EGSA 3HPLB 4C83A 5B3JE 3VFWB 3QEHB 1A6AB 4YEFA 3MLTA 1U2HA 5F6IC 1RZFL 1EO8L 2GIYA 3VWKC 1M1SA 1J0YA 2NY3C 4HJGB 1HXMA 3B9KA 1MH5A 4M61A 4NO0D 3QSKB 3D1MC 3JV0A 3T65B 4OZGB 1YNTA 3RHWF 1T7YA 4QHUA 1NJ9A 1FBIH 1IGTB 1U41A 3T09A 3PP4H 2CRZA 2E8ZA 3BD3A 3D9AL 5DFVD 1WWCA 3DYOA 1YNKL 4QRQB 2N7BA 4JM2F 2IFFH 2EE6A 1YMMA 4PV8A 4KI1A 4UT9L 2PW2A 3G6JF 2XOTA 1PZ5B 3BGMA 3RNKA 5CLTA 3DUSB 4OZ4A 4RX4A 3OB0H 5IMKA 3EOBB 3SPVB 1QSFD 4MVBA 1MJUH 1V3MA 1A1OA 4R9HA 4U1LA 3V0WH 1I3GH 3U0PA 5I1JL 3HE7C 3U7WH 4ZFOB 1N0XL 3KAAA 4JO4L 5E8PA 4GAGH 1S9YB 5FF6B 4KJPC 3D85A 3KPOB 3ARSA 4Q2ZA 2GEEA 3WIIL 3CU1A 3BDYH 2X4RA 2Z93A 3FN3A 5DSCB 5HHOA 4YHIB 2Y7QA 4RMUA 2OX5A 3KLHC 5L2KE 4MQXC 2VMFA 3KS0H 4PDCE 3WIFA 2AGJH 3BE1H 3LZFL 1FSKC 3DHJA 5ID0B 1I8KA 4QRTA 2BMKB 5HYJD 1HDMA 2E9IA 1Z9LA 3GMMB 1K8IB 4KJWC 4NJ9L 1UKSA 3MXVL 4OFPA 4YDKL 4GG8A 5J13B 4I3RL 4U1IB 4P5TD 5A16A 3RBGA 1EO7A 3QI9B 5GGTH 4X6DF 1ZA6A 1EDQA 2Q7YB 2PYFB 1QR1A 4WU5B 1EUTA 3V5DB 4HKXB 1WSST 4Y2DB 3MJ8A 5FB8B 3UPCA 4BFGA 5C3TA 1TENA 3MJ7B 2A1WH 1VGEL 1HHHA 3V8OA 2DBLH 3C08L 1OAQH 3DMMD 3BH9B 4PRAA 4WHTA 3FO2A 5F8QC 3V6OE 1J5OH 2I60L 5GGVL 1BLNB 3LQAC 4HS8L 4HH8A 3V7MA 2HMIC 1BBJB 2NW3B 2VXVH 3MBEC 5IKCB 3R0NA 5DD0H 3ZMRA 2BVUA 2PCPA 4EOWH 3RFZC 1AXIB 3VCLA 1I8LC 1J8HD 3ZYIA 4QHUB 4P48A 1U6AH 2F58L 4HWEH 4XVSH 3NOIA 4NN7B 4ODSH 3MRGB 5KW9L 4GRWH 5EORH 4PLKD 2I60H 3C2SA 4EI5C 1INDH 1PZUB 4JRYE 1YEFL 4OBSA 3OKLB 4XCYA 1A5FH 5JOFB 4X8JA 4V2CB 1TPXB 1FVCB 2YMXL 1N6QH 4M9PA 2GFBB 5TJWK 5LGJB 3QIWA 5ESVB 2M2DA 4EN3C 3TPUA 1BF2A 5I1HL 5GPRA 4JG1L 1VFBA 5I8CA 4CDHA 3Q1SH 4WHCA 1BECA 2BVOB 5HGHA 2QQNL 2MOVA 2FX8L 3KWWA 3IU3A 4AT6A 4YDKH 1MJ7H 5SWSE 5D1XB 1OOAA 1PG7L 4YXKL 2B0SL 4XCCH 3ESVF 2CUMA 1N0XH 3K3QA 2Z35A 1FN4A 2VC2H 3D0VA 1X5ZA 4MMXC 4L3EE 1CGXA 4NRXA 3FFCA 1SEBA 3V0WL 1GHFL 1YUHA 3RVWC 4Z7UB 3ZKSD 1CDIA 1C5DA 1WF5A 1JBJA 5IEKA 3CFBA 1HEZB 1KIRB 4LSRL 3HLAB 1HHGB 4MZ3A 4M7ZB 4HWZB 1Q9KB 4HKJB 5FV2A 4M43L 1A7QL 2I26N 4U0RB 4UV4H 2ICWA 2A2QT 2DQDH 4YNYB 5IEHA 4ZFZA 3ARGB 3NIGE 4XP5L 3PWPA 1T20B 1DVFD 2KH2B 5GRVK 2HT4D 3QPQD 4JLRB 4XXCC 3H9SA 1KBGL 3ES6A 1JP5A 5C0CA 1I7UA 2XG5A 4O2EA 3DVNA 4OFDA 3IXTB 2LV4A 2PW2B 1JGEB 2VDQH 1PZ5A 3BGMB 4LU5H 2X4UA 3BRFA 3GDBA 3FFDA 4X4XA 5DHYA 1A6VH 5CJBA 1YN6A 4W70A 1CK0L 3SKUD 4LSQL 5GGSA 1CDYA 1H15A 1QBLL 3V5DA 4PR5A 3BYYA 4B53A 5DUPL 1R3KA 5HHOD 3IFLL 4OKVB 1ND0B 1SBSL 3UTSE 4P2CG 4WY7H 4IMLB 5GXBB 5D71H 5JIPA 1CZ8H 4IM8A 4QNPE 1EXUB 1VFAB 1OARH 1EV2E 4GQ9H 5GZND 3C5ZB 4A6YB 1BLNA 4G8IA 3DSFH 4QKXB 1MJ8H 4DCQA 1S9WB 4XVSL 3C6LC 3FKUS 3BP4B 1N64H 4JY4A 1DJSA 4UTAH 3QHTC 2R0ZL 4Y2OA 5ABDE 3VH8B 4JQVC 4P9HL 3QZWG 1NC2D 5HI5C 5HHVH 5HSFA 2DJSA 2X4NB 2NLJA 2H8PA 4N0CC 2VXSH 4XPBH 4DVRL 5CMAA 3HG1D 1UH4A 3MLUH 2CD0A 3QI9A 2NTSP 5H35A 1J1XL 4Y5XA 4OCWH 5KG9B 1FFPB 3CMOL 5LJYH 3L3JA 3ULUD 4U1KA 1XEDA 4H26A 1PKQB 3UYRL 3JTSB 4A2MA 3MXWL 3VWJB 5F3BB 4DZ8A 1JPTH 5B39G 3ARYA 3B9DA 4FN0A 1PDKA 2OJEB 4G7YH 2ED9A 5E1AB 4J4PD 1RFDL 4KVNH 4RGMC 3DYPA 3RY6A 3SCMA 4YHMH 1TTGA 3KPNA 2DQUL 1CFNB 4KDWA 4PBXA 1JZ5A 1CDUA 4GBXA 2A6IB 4NNPH 4TPRH 3RVWD 2OM5A 4HKBB 3TT3H 2YPLE 1KCRH 1MQ8A 2WINA 3DWTA 3QUYC 3S96A 2ZZUT 3SO5A 4P5MB 2P4AB 5DA4A 1MHEA 3HC4H 4YHYB 3DO7A 3QRFM 1NBVH 2F53A 5DRNB 3VWKD 3MLTB 4NWTL 3BRGC 3K2UH 5C08E 1XCTA 3G08A 3O41B 4GAGL 4PRBB 4Y4HB 3WEXA 3KXFE 1BVKA 1KJVB 3O3AA 1NCDL 3MRIB 1XCQB 4ONHA 4DUXA 1QFWL 1ULVA 2VAAA 5IHLB 5EBGA 1JRHH 4HUWA 4NGHL 5I73C 4OZFG 4JRWA 3RIFF 3VD3A 2X1PA 3CVHL 4GRWF 3MJ9L 5AYUL 35C8L 3SGJA 3V7AE 1MREH 5A2FA 1YMMB 4LOUD 3MYJB 2RJMA 3IXTA 4L4TE 1JPFB 1J8HE 2NXZD 4N5EA 4Z5RA 5KOMC 3OKEA 1I4FB 3JTTA 3ABZA 4KRPB 3NPSB 5DJ8B 2FYYA 3CVIH 1I9JL 5BV7H 5IESH 3FFCB 1JNNH 1LGVA 4OCYL 5IHUL 1FAKT 3BP4A 2EE9A 4PJIF 4XGZB 5D1QB 4PJBB 5GZNC 4TNWF 4XHQA 4N0FB 1MJJB 2FNBA 3BPOB 3T0AA 2D7OA 4HW6A 4CBPA 1S7UA 1RULH 5JLZB 4HWZA 1L9MA 5HDOA 1GOHA 4HQQL 1KNOB 4KK8D 3PQYB 2AK4A 4ODXA 1U58B 3SE9H 1VACB 3NACH 4Y0GA 1VKXB 1QKZL 4DTGL 1RZ7H 5DMJB 4PV9A 4JREB 2Y06H 5BOPA 1NC4D 3ULSA 4JM2D 1B0GB 4JKWA 3TO2A 2N1KA 1PKQA 4BSVA 1OPGH 2R1YB 4Z7WE 5IV2A 4KKCD 1AQKL 1W72L 2C1PA 1Q94B 5JNYA 2CDFB 3MBXH 3FFCD 5CMAB 3OG4B 4KHTL 4U2YA 3DYMA 1FYHB 2W60A 1MREL 1JNHA 1KEGH 5HGDA 4OF0A 4NGHH 4Q6IB 3GIVA 3C8HA 3TBWA 1F90L 1C16A 4DAGL 4IRJC 1PSKH 5JMOC 1ZT4B 2VLKA 3ZHKA 5GSVB 5KTEH 3VXRE 5HHMD 2NY5C 5DMKB 3TM6A 1VFMA 2V6HA 1K4DB 5E7FA 3K8LA 3RIFK 4CMMB 5ETUA 4QWWC 3Q6FB 1A4KA 3S36X 3ZE1E 4LCCA 3KDMA 3QQ4A 4IMKA 3GSRA 1XF5B 2G5BB 1TZHA 1H5BB 1JZ7A 3AROA 5E0QA 5TDNB 4H0IA 3VWJD 2A6IA 4OZIF 4GRWB 1R5IA 4TSBL 4I2XB 3MGTA 2NY2C 2N7AA 5MENA 5C0IA 2YN5A 3V4UH 1KACB 2A9NH 1FRGH 3BWAB 3OPZH 3SQOL 1IBGL 3CCHB 1KLUA 4V3DB 4JHZA 2G75A 3AAZB 4LKCB 5L8JB 2OTWA 43CAB 4KV5F 1ZHBA 1DE4A 2D3VA 3NIDF 2GSGA 1XR8B 3ZL4H 4LSVH 5DVOA 1HYSD 4PJFF 4JJHA 3VXMA 4HD9A 4TUJB 4GG6F 4FQHA 4Z7WF 1F4WL 2ERJC 4W4OC 4XWOD 1DN0B 4H88H 3GBML 2W92A 3BKML 3RWHA 4DFHA 3CH1B 2YUXA 4XWGH 5DHVB 3IDIA 1KJMA 4OQ1A 5LG1A 3B2UD 5DURB 4HGKC 3EYQD 3EOAA 4NWUH 4GXVL 4D3CL 3HUJA 1ZLWH 4NRXB 1QQDB 4GSDH 4H25A 3F6IA 1CICC 2R69L 3BDXA 4JHWL 2O5XL 2DQFA 3KPRB 4UU9A 5BV7B 4Z78B 4QCIB 4J3WA 2GUOB 4WTWA 4OFYD 4XAWL 4AH2B 3D3VB 3TBTA 3WKML 5F8RC 2OR9L 1EBPA 3GJFH 3V52L 2Q3AA 2EXWD 1FLRH 2HN7A 4FQXA 3NAAH 1CI5A 3FO0H 5FYKU 4UQ3B 1G9NC 4HIXH 4RISL 3VMNA 5E2TL 5DQDL 2Z0BA 1G6RH 5J3HC 3WUWG 4LPYA 4U1NA 2OZ4A 2X1QA 3QQ3B 3INUH 4XP6H 2CLVA 1OTSC 1CDHA 3PQYD 4KKLD 2EDYA 3K2MC 5C70A 1VENA 2MWCA 1LEIA 2X9WA 1UVQB 4PPTA 5IOPB 5HYFA 1CD1A 1JWSB 3B9EA 1HZHL 3MV9A 4PJFB 5C09B 1ZT1B 1PX4A 3HMWL 3ZKQD 4FQ2H 2BNRD 2MTPA 3QFJA 4KPHH 3P0YH 1LEGA 3ZKNC 4JO1L 5DD5H 2WLYA 5GGQL 4N5UA 5DMIH 3TO4A 12E8H 2FD6H 5B39B 4DZBB 1DDHB 1I1AC 3BIAX 4PGDB 4F80A 4FA8A 1MFCL 2DIBA 3KYAA 4MNQA 3M1BB 2AJUL 5ANME 3QQ9C 4NP4H 5EZIL 1KLUB 2IANE 2IQAB 4KTEH 4HJ0D 3BEVB 4J3OC 2XTJB 4P9HH 1A0QH 2YD4A 3QHZH 4CJ0A 4WWKD 3GMLA 4NHUB 4G8GA 4JANA 4NYLA 4R4FH 4I77L 5D7SH 4X83A 2NY6D 1FC1A 3VH8A 1RJYA 1V3JA 1U93A 2BJML 1IC5L 5CEZH 4LLYB 4GMSL 5EU7E 2OL3A 4RMVA 3BWAA 4I18C 1EVUA 1MRFH 3CCHA 5H35B 2NX5E 2WBJD 4RDQF 2OI9A 3DROB 2WUBH 1T21B 1JE6A 3V79C 1SY6A 1EEYA 5DJCB 4OZGE 5CJQL 2E8YA 4PRHD 1YDPA 5DRZA 3A67H 4HIEB 2VO5A 4FXGB 1WISA 2FLRT 2HJLA 3JWDH 1JZ8A 3LEXA 4PGEA 1T1YB 2VISA 1BFVH 2W9LA 3RQ3A 2WQRA 2NY5H 2IH3B 3PQYE 6FABH 3QFDB 4JFYA 3CK0L 4DN4L 2JB5L 5ACLA 2X09A 3HG1A 3MOBH 1SJVA 3E3QA 3JXAA 5D70L 4LEOA 4ACPA 1E6OL 4JM2C 3PDGA 4U31A 5C0JA 2VE6A 3V4VH 3QDAA 1FP5A 5ERWA 3TFKC 3FQTB 5DK0A 2X4PA 1F11B 5FGCB 4FQJL 1CTNA 1ORSA 3E2HC 3NCJH 1A0QL 5GS1A 2A6KB 4QTHA 1R0AH 1TJIL 4KFZC 3VFVB 2J88L 1YZZA 4KI5D 4NZUH 5FGBA 1Q9LB 4HWBL 5DVNA 4CVXA 3OAYH 2DB8A 3D3VA 1BVKB 4KUCF 5LCVH 2B2XL 1FZMB 4KDVA 1EEZA 1QFHA 4YBLC 4LLQA 3SGDH 4CRPA 4Z95L 1CDGA 2BRQA 1S3KH 2X4SB 1OTTC 2Q7YA 1WFNA 2OSLB 4MJID 4PREA 1KPUA 4QXGL 4L8BA 1NLDL 1RJCA 4FQLH 5EU6E 3HNVL 5CEXA 4ODUB 2BSSA 1G6RB 3JSSA 4NN6C 3LB6C 4PGDA 1KJMB 5KVMC 5KSVB 1AFVH 3WLWD 5I1EH 3O6KL 3JV5A 1Q0YH 1EMTH 2H2PC 3IRZA 4KMTH 1GOFA 3MLYH 3HHRB 2E6JA 1NCWH 2IF7A 5F7DA 1KIPA 2YMXH 5FUZH 4D9LL 3TBSA 5DJ0A 5KVDH 2EDEA 1FLRL 3VFSA 1I7RA 2RHEA 4P23C 4Y5VB 4LSUL 5LCVL 5FAAA 2ATPB 3QA3A 4GKSA 4RGND 4U1IA 5A16B 5BW7A 5EORL 3F7YA 3IJYB 1F13A 4NZUL 3ARGC 2R2BA 1I3UA 2XWBA 4YZFF 1S3KL 1F4YH 1B0GA 3MNWA 2NQCA 4FQJH 5KSAB 4OD1L 5MERA 3PWJB 4WHYG 3U2SB 4LLMA 1DQLH 5D7JB 1S78C 1BQUA 1BQLL 1HQ4B 4H8WH 2RAMA 4YWGH 1ZAGA 4MCZB 4FQQA 3V95A 2BERA 3L7EA 4WDIB 2DMCA 4XMPL 3RZCC 3BKMH 1EH9A 1HHKA 4JHAL 4HGWA 4J3SA 3JZ7A 3Q5TA 1YA5A 5FK9B 3P3YA 4MJ6B 5HHQA 1C16B 1JIBA 3BN9C 4FTVE 2DQIL 3ARVA 4JKKA 1BFVL 5DEFA 3T0BA 1FORL 4KQ3H 3OAUH 3MLSL 3QCVH 3RPIB 4G5ZL 3IGAB 1II4E 3TYGL 3IDNB 3NABL 1FYTE 4O2CA 2CKBL 2IG2H 4IRJA 4F33A 3FZUD 4OQTH 3LS5L 4GH7B 4L29A 2CRYA 3KPQA 3OKNA 4JDTL 2EIEA 1CICD 3R1GL 3QIWB 2B8OT 1FC2D 4YDJA 4M93B 1T20A 4UIMA 2NY0B 5IR1B 2W9EL 5F72S 2ICEA 3CSBA 1G7IA 4YHYC 2EXWC 3T3MF 5INDB 4P5TB 5CFHA 3VXQB 4S1SH 2FLBT 1B90A 2FHBA 1VHPA 2NNAA 5GSRA 5F7WC 5IBTL 3KNBB 2VLMD 3KYMA 1AQDB 5EOQL 3G5ZB 4BKLA 2XKSA 4LL9A 1GXEA 2X42A 2DWDB 5HI4C 2NY1D 4ELMB 1JHLL 4XBGB 5L2KA 3I6KB 3UJIL 3P0YL 1GZQA 4EBQH 2YBRA 4PJ9D 1VCAA 3VRLE 2CO7B 4KXZH 5IB2A 5JXAL 5C0AB 3GO1L 3UBXB 1YEEL 2DLIA 1QR4A 5BO1H 3HC0B 1AHWA 3WXWH 3A0OA 1BJ8A 5IT2L 1F3JB 4Q6IC 2H1PL 1HZHH 5IGXH 3I02B 2D03H 2YKLH 5DJYA 3OKLA 4QY8A 3B43A 4PJBE 1U3HA 1XIWA 4BFBD 1OY3B 4I3GA 3UXFA 7CGTA 4AM0B 5J1SC 3QXDA 3ARUA 3WKMH 1MNUL 4JRXA 3U4EA 1P7KA 1BQHB 1JF1B 5EFIA 3BX7C 2NY6C 3PWPB 2MNUA 4K3JH 4MJ5A 1TJGH 1PKQE 1JNNL 4MA1B 4OCYH 5E1HB 2YZ8A 2IBZX 5GHWH 5HY9B 4R7DA 3TPUE 3P77B 1CIDA 2R0KL 4RRPA 3ARFB 5F7UA 5KSVA 5BZWA 5EU4B 2Q8BH 2YD7A 3VFWA 3F7VA 1VADB 3SDYH 2EIZB 2NXYB 5D7KE 3BEWA 3I6GA 2CLZB 2XRAH 4CJ1A 4ZUUA 2PN5A 3VW3H 5EOCJ 3MV8D 4Z0XB 5F1NB 4PLJC 3EOTL 2DS4A 3OJDB 3LKRB 4FQIH 2ICES 3QUYB 2A83B 3IF1B 3VXSB 3S88L 3WJJA 4GKSB 4OCMC 4P2QE 2AQ3A 3L3OA 2AJVL 4LVOB 4RBPK 4UILH 1S9KC 4JPVH 1YYMH 4NYLB 2IAMB 3ULUH 2P5EB 2QSQA 1FIEA 2W0LA 2E7LA 2E27H 3BSZL 1R3JA 3TBYB 2VDMH 4PJCA 4JM4L 2XPGB 2KBGA 3BPNB 1TPXC 3HS0B 3RWIB 4LQFL 2BVTA 1RUPL 1P5UA 5FO7A 1IBGH 4UI2A 1KOAA 4HDIB 3VFTA 1FRGL 2YBRB 4J4PC 4WDIA 3SCMB 3SGKC 1A6WH 5E03A 3VFMB 3DLQR 2DN7A 4HLZH 4FZ8H 2X1WL 4PBVC 3UEZA 3H8NA 5KSAC 1MAJA 1NEZG 1QZ1A 4GRLC 1T1YA 1T2XA 3OSKA 3G5ZA 1MUJA 3FMGL 3QDHA 4I9WE 1H3TA 4JZJA 2R15A 2V9RA 3B5GA 4X5XB 1FYTA 2G9HB 5EUKB 4PJAA 3G9VA 3BXNA 4OTXH 4LVOC 3TO4D 4V1DA 1H3UA 4MWFB 3S6CA 1YECH 3C5SB 1PY9A 2HTKC 1S7SA 1S7XB 4JFPA 5I71C 1NAML 1UC6A 3OX8A 5IWLC 3MBXL 3FOMB 5JXEC 1ONQB 4I0PB 5F7NC 2NTFB 2VN7A 2BFVL 4R2GB 3EYOA 4WFFE 1OPGL 1F11A 2R29L 4RAUB 1AGCB 5DUMH 3SDYL 1RVFL 5F9WC 1NC2B 3K8MA 4HK0B 4KKAC 1AD9B 5FGRA 2JK5A 1MJ8L 2B1AL 1N7ML 1IL1B 1RUQH 1G7HA 4Y4HA 1DL7L 2NNAB 2A38A 3NCYP 1NCBH 2EDHA 2YPLB 3DBXA 2WLZA 1MFEH 1RULL 2Z31D 4IOFC 2ATKA 3AM8A 5LAXA 3C6SA 2JCCF 5IGXL 2MCPL 1GPOH 3E6FA 4BZ1H 2YN3A 3BI9X 4WEUD 4PJXF 3C60D 3IRPX 3FN9A 4ZTOH 5C1MB 4UDTA 5FUCC 1RZJH 4TRPL 1DL7H 4EQ3A 1CFBA 1MAMH 1HIML 3BKCL 4G6FB 4GT7A 2HG5A 3PL6B 1ZLSL 1OB1A 1MHCB 1F2XK 1CFVL 4LDOB 2YUZA 1KJ2H 4PJGB 1JHLH 3OGOE 2LU3A 2PTVA 5LGJA 2YWYA 4OD3L 3QNXB 1U8JA 1EK3A 3WEXB 5GRJL 4NZTH 4Q9RH 5T3XD 4LLAA 3HN3A 5C9JA 2WANA 1N59B 1SMOA 2D2OA 2C4XA 1CFTA 4JPIA 3LKQA 2P8MB 2HAZA 1C5BH 1OSZB 3AU1B 4ZXBD 3PHOB 2IGFL 5KZCB 4Q6IA 1R3JB 1YEHL 1JCKA 1YPZF 4ETQA 3GNMH 2ICWJ 3QNYA 2AS5M 2CGRL 4XCCL 4DKFL 5I9QB 3SKOB 3D39D 5LXGH 2X7LA 3CH1A 2OCFD 4HGMA 3NN8B 1MCLA 4HAFA 4IIQB 2A73A 4GJTB 3QXTA 1N6VA 2C1OB 5J4MA 2F54E 4HBCL 4F7PA 1IJ9A 5F1NA 4XH2A 2Z91A 2BXYA 3WDJA 5MHSE 5ISZA 2CKBH 5T1LA 1UKTA 1DQJB 1I85C 2FCBA 3B8YA 4JG0L 4O5LH 4V1DB 5JXED 4OLZH 2GUOA 4GW5A 1ACYH 2VZUA 4S1QH 5D2NA 4Y89A 5FDWB 4N0CA 5BQ7B 1S7VA 3JBG7 1LE9B 3VFRA 1R5IB 2UZXB 1AP2B 4W4NA 1VA9A 1JFQH 5FYJU 3C6SB 3Q6GH 1M6OB 5F96L 4KK6C 2GITA 1OM3H 1ORQB 4U1MA 5KJRL 2APXA 3QG6B 4PJEB 4C55A 1G7HB 1I8IA 2DQGH 3C60C 3CXHJ 3P11L 4WHDA 4GRLA 2R0ZH 3SKNA 3T1FB 4MXVE 4JR9L 1ZEAH 1KGCE 1CICA 3EDEA 3GSXB 4U7MA 4L8CA 3B6SB 3M8OL 4K3JL 4QLRA 4NM4H 4YO0A 4ZOAA 4B41A 4OI8A 4CADA 1MY7A 3BZFB 4U0QB 3V6ZA 5HPMB 1A1OB 5DUPH 4LLUB 3C09B 3DSFL 3EYSL 2ADGB 1Q9OB 4CL7A 3DV4B 1UFUA 3R0MA 1VPOL 2DQHH 1U8MB 3BKYH 1R5WB 1CZ8L 5JIHA 1CTOA 3UBXA 2VIRB 3TLRA 3MXVH 1A7RH 5D1QC 3VGAB 2XICA 2EDQA 5SWSB 5C2UB 1QFWM 3QUXB 4M7KL 4HULB 3OXSB 5DMGC 2H32B 5ICZA 3MGTB 4XPAL 3MLYL 5JW4M 2AXGA 1E6JH 5IT2H 4YC2C 3N9GH 3T2PA