3GSXA

Crystal structure of the binary complex between hla-a2 and hcmv nlv-t8v peptide variant
Total Genus 78
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
78
sequence length
274
structure length
274
Chain Sequence
GSHSMRYFFTSVSRPGRGEPRFIAVGYVDDTQFVRFDSDAASQRMEPRAPWIEQEGPEYWDGETRKVKAHSQTHRVDLGTLRGYYNQSEAGSHTVQRMYGCDVGSDWRFLRGYHQYAYDGKDYIALKEDLRSWTAADMAAQTTKHKWEAAHVAEQLRAYLEGTCVEWLRRYLENGKETLQRTDAPKTHMTHHAVSDHEATLRCWALSFYPAEITLTWQRDGEDQTQDTELVETRPAGDGTFQKWVAVVVPSGQEQRYTCHVQHEGLPKPLTLRW
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HLA class I histocompatibility antigen, A-2 alpha chain
publication title Structural bases for the affinity-driven selection of a public TCR against a dominant human cytomegalovirus epitope.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
total genus 78
structure length 274
sequence length 274
ec nomenclature
pdb deposition date 2009-03-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00129 MHC_I Class I Histocompatibility antigen, domains alpha 1 and 2
A PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3gsxA02
3.30.500.10 Alpha Beta 2-Layer Sandwich Murine Class I Major Histocompatibility Complex, H2-DB; Chain A, domain 1 MHC class I-like antigen recognition-like 3gsxA01
4ODXB 1KXQE 4KTDH 3OXSA 5GGTL 3TEUA 1I8IA 4NQCD 2YOCA 4I5BB 4PJEF 3B9KA 1M1SA 3FB6A 1ZKAA 2JB5H 4X6DA 3EYQC 5ERWB 4MSWA 4BSVA 1GC1H 4HWEL 4YXHH 1QRKA 2J8UE 4U7KA 4JQIL 3ZMRA 2YD5A 3N1MC 5FF6A 2IG2L 2A1WL 2FGWL 1T21A 2YWYA 5F71A 3VD5A 4ZFFA 2W0KA 1A7PH 5T3XE 4LHUG 3P73A 4JKKA 5JW4Q 2UYLA 2OL3L 2W59A 5IBLC 3OX8A 4FQHB 5HI4D 4YUEL 2ZUUA 3T8XB 1KF9B 1EEYA 3UTZA 2OMNA 4ONGL 5L8JB 1CXKA 2M8XA 2AEPH 2X70B 1BAFL 2FL5A 4M02A 5EOQH 1HHIA 5EBGA 3DPBA 4NKOB 3S35X 4RFNB 4OGXH 3UZQA 1MCPH 1A7RL 5F7EL 1P6AB 1JL8A 2A83A 2WBWB 3KPRE 4KRPB 5EC1A 3SN6N 4P2OB 3RZCD 3WKMH 2AXGA 2HH0H 2R2HA 2NY6D 5JIHA 3LRHA 1P6FA 4WI9A 1IAIL 4R97B 1SJHB 4NSKA 1RZIB 4FQXB 2A0LC 3MR9A 4ORGB 2Q3ZA 4O58H 1JPGB 4UNVA 1T1YB 5D96B 1S5IL 4RMQA 1PQZB 1NFIB 5GS0L 4EDXA 5J6HB 5H35B 2HJKA 4QEGA 3HHRB 4X4XB 3GRWH 1OGTB 3DX8A 4XP4H 3S35L 4JFPA 3SDXF 2W38A 4DEPB 4HC1L 1ZVHA 3OKEA 1EZVX 2WP3T 5LGJB 3QIUC 5DD3L 2QSVA 3K4AA 1H3XA 3WYRA 3FT4B 3LKOB 4AG4H 4S10A 4BYHA 4G6JL 5CILL 1NC2B 4HFUH 5H2BB 4I48A 2Z31D 4R9HA 2HMIC 5DVMA 4MAYD 5KZCB 1RK1B 2CPCA 3KJ6L 5MENB 2AW2A 1IFHL 4K8RL 4KZEL 4E42A 1YPZE 4GKNB 3CCHA 3B2UC 3JV5A 5F1NB 3QBTB 5I1JL 4XMLL 5FYJU 2R2BB 3N1QC 1FNEA 3L5XL 5EU6D 1FSKC 3TJEH 3L3DB 4GKZA 2EH7L 3O45B 1RZKL 1BBDL 5C0IA 5T1KD 1RU9H 5J1AA 4HJJH 1CLZL 1SM3L 5D5MF 4RWYL 5I8OL 4ZDHB 4F7TB 3NZHL 4MNHA 3CFBB 5CBAB 2X1WL 4NQSB 3ZSSA 4A6YB 4TQEL 2ADIB 2D7OA 4FZ8H 4OZHB 1YNKH 4N0CA 2Q76A 4XPBH 4KK9D 5F44A 4KH2A 5GRXG 1L6XA 1FGNH 2VWEC 2F19H 2F5BH 2FD6L 3HFMH 1FLRL 5E9DD 2KL6A 4MJ2A 3TA3D 4OCSL 2EH8H 3KDMA 2ZOLA 5I66A 1XGTB 3CK0H 1YEIL 2W9EL 1YQVL 4OCXL 3U2SB 4NQED 5BXFB 1I7RB 4XCCH 3CAFA 4JPWH 5I16A 1C12B 4JVUA 1LE9B 1EO8H 5KSAD 2UZXB 1KNOA 1VFUA 3RNQA 3V6OC 3EYVB 1WFUA 3O81A 4P3CL 4UT9H 5JOFA 1HHKA 3N1GC 3GSQA 4X8XA 3V5KB 4NNXB 1AHWC 1OTTD 1S7TB 3MOBH 3MBEA 4DN3L 3DTXA 2FSEA 4FQJL 4Z8FH 4NJ9H 4BUGA 3BZFB 4DGVL 5DI8A 1P7QD 4MHHI 2ZPKL 1IGFL 1ZA6A 3P9MB 3EGSB 3FFCD 3TBYA 3ULUD 1RHHA 3RY4A 1VB9A 2HFTA 4ZPTB 1WBZA 3RVTD 4KJQC 5FGSA 1H8OA 5F7LB 4P5TB 5BMFL 2D7PA 3RX7A 1A14H 4PB9H 1GC1C 4WFGD 4XBEH 3PV7A 3ARWA 5I30L 2SEBA 4LCYA 1AD0A 3R1GH 1CG9A 4I0PC 1YNTB 4RAVA 5IT2L 1J0ZA 1IAKB 5HVFB 1AGDA 1BM3L 2Z35B 2EYRA 2OS7A 3W81A 4E41B 1JMZA 3MTRA 1H3GA 3MLXL 1U8LB 4TSCL 1FFPB 4ZOCA 5F8QC 1WV7T 1JHKH 5F9AC 1KOAA 3HE7D 2C3HA 5J1SC 2MPAL 2MKWA 4R7NA 1J1PH 1MFCL 4Y4HA 4XAWH 4IOIA 2ZUTA 1NCAH 1FL5A 1MFEL 3DVGA 4LAQH 3CUPA 2W65A 4I2XE 4KFZC 5HPOA 3PWLB 3CD4A 3TYFB 2CUMA 1Q72H 3IDJB 3SQBA 3FB5A 3FT2A 4HMDA 2YZ8A 2OL3B 4HPYL 1KLFA 2I60H 3S6CA 1W2KT 1JMXA 2P8MB 3WV0A 5IFHH 1NFDA 5E7BA 4NHUE 1QBLL 3C5JB 4MQ7A 2PTTA 3BQUB 2UWEF 3AU1B 3I6GA 1RUMH 5L7XH 3REVA 2BCKA 5DJZA 4F15C 5JIIA 5EN2A 4ZNCD 1TCRA 4M1GL 2FX8H 1YEKH 2N1KA 2F54A 3MGOB 3MV7B 1DBJH 4WY7L 4IRZH 4AIXA 3TN0A 2HP4A 3DI3B 4XVSH 5CEXA 2NX5D 4ZUSB 4QRPB 4U1GB 4YDJB 4LASH 4MNGB 1GOHA 2IMMA 4FABH 3PWVA 2X41A 5EBLA 4V1DE 1FFNA 4LCCA 4HF5H 4HPOH 3WUWB 1JYNA 3E6HA 4LOUC 4TSAH 2IBBA 3AB0C 1M4KA 1AE6L 1RIVL 5C07B 4WWKB 5C3LD 7FABH 2WBJA 3RP1A 1RJLA 1P2CA 4FNLH 1HIMH 1NEZB 3IAQA 4APQC 5ADOH 3MJ9L 1LO0L 3VA2C 1DE4A 3DBXA 4G8EA 1Y18B 1S7RB 4JO1H 4OFPA 1B9ZA 1SYVB 4QGYA 3FB7A 4R4BA 3CFCH 4DVBB 4U49A 2XA3A 3OJDA 2P8PB 3C5ZD 2DRUA 2VLRE 2YPLB 3D9AH 1O7VA 4G9FA 4D0DB 1U91B 1TJHL 2VAJA 3ZT6A 3IDXL 1D5BB 1XIWC 3TO2A 4PG9A 5E8EB 2I07A 5IQ9B 2F5AL 3WNNA 1SJEA 4LKXB 1H5BA 4HIIB 2XQYK 4QXGH 2CRYA 5B22A 1A6UL 1KYOK 1JUFB 2VJXA 3S88H 2BMKB 2VE6A 3WLWD 2WQ8A 1AR2A 1A22B 2IAMA 2JE8A 3G08A 3LEYL 2F53A 3DVNB 4JRXE 4ZYKA 1FYHB 5FKPA 3AROA 2PCPA 4IMKC 4PP2B 3KPLA 4N0UB 3UBXG 4BH7B 2YUVA 3QEUB 3V0VB 2NR6C 1VESA 3SDDA 5E2VL 2V2WA 3UCRA 3QG7H 3UBXA 1WWBX 3T09A 3L5IA 4NOFA 2YD1A 4NJAL 1A2YB 3C6SB 4QO1A 3LIZH 2E7BA 3T1FB 4F37F 1I1FA 4MS8C 5F72S 1QSZA 3U0TA 4M5YH 2YUZA 3B5GA 5C0RL 4S0UC 4JRWA 3WNLA 3W9EB 2Q8AH 3O8XD 4L4TA 1BMGA 3QCVH 5K9JH 4NWUH 1T0NB 3I3EA 4TULL 1D6VH 2VDNH 3EJZD 1BZ9A 3P3YA 4AEEA 1E4KC 3PWUB 2CUIA 4WNQA 1KPVA 3H42H 4O00A 3VMPA 3Q6GH 2IBGA 4Z77A 5DJAB 2R56L 3ARGC 4PRAA 3H9HB 4JPIB 1UC6A 4N9GB 2D0FA 5C0AD 3TBTA 4HIEB 4YHOH 4PJHF 5I6XC 4JZNB 3MLUH 1Y0LB 1OAQH 1R3IH 3PP4L 3QG6A 1MELA 3KXFE 3QWQB 5IMOA 4L3EA 4HKBB 4B41A 1Q94A 4UILH 2V5SA 3CVHH 5LAXB 4U6HA 1LEKA 5IK3A 1YYMH 1L0YA 3ARUA 4R4FH 3GMNB 5GS2D 5H94B 3CVIH 4NGHL 5DK2B 2YN5A 1UJ3C 3BPCA 3F7VB 2ESVB 3MOAH 1J8HB 3E2HC 2QHRL 2VQUA 1OAUH 3D2UA 4U0RB 4U6VL 3U1SH 5KBNC 1ZLUK 1MWAA 1T04B 1FHGA 2FCBA 5L0QB 4F7CA 1X5FA 4UQ2A 4XX1E 3C6LB 3MRNA 3GI9L 3CU7A 4G6AC 1I7ZA 5CZXC 3G6JB 1F13A 2NCMA 4P99A 5F1OB 3MGTB 4G42A 4NNYB 1C7TA 3MXVH 1CGTA 1CD8A 1VEMA 1MI5A 2YEZB 4PJGA 5IG7B 3HI5H 3BP4B 3FB8B 2AQ3A 3NIDE 2PETA 4DFIA 4PRIB 4GBXA 5JLZA 1B88A 3VXUE 4JGUA 1T2XA 2QQNL 3MNWA 1DEEB 3H9ZA 4O2EB 4XRCA 2A77L 5IHZA 4DTGH 5IFJA 1U41A 1DN0B 3DARA 1CFSB 2VMFA 4DK3A 3BIAX 5GJSH 2WUBH 4IRJC 1E6OH 5I1EL 3O3DA 5J11B 2DD8H 2JCCE 1FL3A 3RY5A 4JM2B 5EUOB 1EJOL 1X5ZA 1NLDL 5FA3B 2EDBA 3B3IA 3O2WL 5BRZE 5FV2A 2NY2C 5K9OB 4XAKD 3C9NA 1FVEB 4YWGL 4I13B 3LSOB 4KAQH 3O3UN 4S1SH 5L6YH 3T77B 1JWMB 2FJGB 3DX6B 2ICWI 1O7SA 3GSNH 4JZOA 5FOJA 2FX9L 4G8FB 4HK3J 4MA3B 1H8NA 1F02I 4L3CB 3V7AE 3NFNB 3B9KD 3ILQC 1J1OL 4X7EC 4Z7QF 3ROLA 5BS0E 4NFDA 1EEZB 4JKWA 1MJJB 2LU7A 4QHLA 5IVXF 5HYJE 3QEQB 2MMXA 4EVNA 2VC2H 5DUMH 5E6IA 3BGFB 5CEYB 2BNRA 2W0PA 4OF8A 1EV2E 2XA8L 3RWCB 1ZLWH 2V7HB 5ICXA 4LHUD 1JYWA 2NY0C 3FOLB 3K8KA 4H1LH 4UT7L 3RWHB 4XGZB 3C87A 2P1YA 4P4KA 1A6VH 4QOKE 4KJPD 2H32B 3WFBH 2NY3B 3DV6B 1KUMA 4MX7A 4KRPD 4X8JB 1AXTH 4P2OD 3VWKC 3HZKB 3N85H 4GRWF 1KXTB 1IAIM 1T0PB 2X4QA 2VR5A 4NQCE 2Y06H 4LEXL 4MXQD 2Q6WB 5FYJL 3PWJA 3O41A 3EDJA 2YUXA 2Z92A 3BEVA 4HIJB 4R3SA 5DD1H 3W11C 5CIPA 4F9LC 4N8VG 1Q0XH 1AC0A 3IKCB 5IHUL 3BWUC 1QFOA 2J8UF 3I50L 4K2UH 4LVEA 3BEWA 1DANU 3E8UL 5JDSA 2GSIB 4N8VA 4OLXL 4GAJH 4GXUM 4XP6L 2P7TA 1CR9L 2OBGA 3NBNA 4M1DH 4CVZA 4PGDA 2ZSWB 4X9BA 2NPLX 3AXLB 3QPQC 2F58H 4YDLB 3QFJA 3VMNA 1IT9L 4OKVA 1NC2D 1ZGLP 2K7QA 2I26N 5JHDB 3D85B 5FGBA 3QUMH 1S7VB 4C58B 1KCSH 1N5YH 3GSWA 1XH3B 1X5IA 1A47A 4QRUA 2E7LA 1AO7A 3LV3B 5A40E 3IDMB 3O4OB 3DURA 2FWOA 1E0OB 5I0ZA 4DCQA 4OIIL 2IQAA 2Z93A 2R4SH 1QR1B 5FXCH 2XNAA 1IGTB 3OKKB 5D8JL 3WFEH 3M17B 2W0FB 3HZMB 3DWTA 3MQIA 2MCPL 1MF2L 4HWBH 1ULVA 3S5LA 1FZOB 3C2AL 5E6ZA 3LD8B 3QIBB 1UZ8B 3DVFA 3OXRB 2CQVA 4CVWA 2PTUA 4ISVA 5I1CL 3QNYB 2VXTL 5F1SA 2XRAH 3VFMA 3LRGA 4HKXA 1KCUL 3H7BB 1TXKA 4O9HH 4OZ4B 4ZSOB 5IW1A 1VDGA 1X5AA 4UUJB 5C0NC 1FO0A 4GRWH 1U8HB 4OD2A 2ZCLH 3CFEB 2ZUQB 3G5XA 1G84A 3O6FD 1RZJC 5JPNB 4ZD3H 3QQ4B 4N9OB 1LE5B 3RDTC 5JQHC 5I1AA 2AJSL 5JR1L 4CJ1A 3QJHB 5HGAA 2FIRT 3VXMB 1LGVA 4OLEA 2B5IB 5DC9B 1YYLH 5C9KA 1DQDL 2HT2C 1LO4H 2XV6B 5T1DL 1CE6B 1YPZF 1PX3A 1WAAF 3P0GB 1A7PL 2CKBH 3MLPA 4XCNB 4JDTH 4DWHA 5EU6E 4C4KO 2XTJB 6FABH 3PV6B 5KW9H 4EUPH 2WUCH 3DI2B 1AKJA 4OFYA 4OZIB 5GHWL 1HQ4A 3AAZA 5F7HA 4G6MH 4OQTA 3NA9H 1CF8H 1F8TH 4FN0A 1F6AB 1EBAA 2AEPL 1LP9B 3UAJD 1ETZB 3AY4C 2NZ9C 3WDJA 2H26B 1JYXA 2EDWA 3KPPA 5A2JH 4OGXL 5TDNB 3WXVH 1MCPL 1UWXH 1QEWA 3PWNB 3E0GA 2P46B 1QFUH 1H3PH 1IAMA 1BZ7A 2EC8A 4TUJB 4W68A 5K9KB 4BFBD 4KI5E 2HH0L 1Q9KB 3EDKA 8FABB 5E9DE 1FG2B 4YIQA 1U8QB 2IEPA 4JO3H 4JGMA 3DX7B 1G7JA 5E5MA 3CH8A 5KVGH 4NQEE 2W92A 2ITCB 3D1MC 4UAOC 2CLZA 4OT1H 2AJUH 4YDKL 1HXMB 1UGNA 3L7EA 4XP4L 4NO2B 2YBRB 4K7FB 4Y19B 4LSUL 1CZ8L 1IC5H 1N8ZB 5DS8A 4TVPH 5MHSD 3STBA 4NQTA 1OAXH 4AG4L 4Y8DC 4IOFD 2E9WA 3TV3H 3FFCE 4WHTB 2FR4B 3T2NH 1BWWA 3L95B 4YGVB 2FHCA 4P23C 2A9MH 1IRAY 4NZTL 4DGYL 2GT9B 2APFA 4JY5H 4X6CF 1ZS8A 5EO9B 2OP4L 3ARBC 3QIUA 1ZSDA 1EXUA 5HHQB 1UM6H 3BQUD 1XF3A 4QF1A 4WFGE 2X4UB 4YFDB 5DRZB 4M43H 2DM3A 4HIXH 2FH6A 4POUB 4TYUA 4PY8I 4X7TA 1JGLL 1T2QH 2F54D 4MJ5B 4ZUWA 2NY4C 3TJEL 3WKNA 4NZJA 5IWLC 1O0VA 5TE7H 5IIEB 4D9RE 5CJQH 3R0MA 3ZKQD 5C6PB 2BSED 4GAGH 1CGXA 2RFXB 1BD2B 3I02A 4M1CC 1P84K 4KK5D 2DQDL 3MRFB 2EDOA 3QSKB 4HMCA 1CD0A 4V2BA 3LZFL 2DQEH 5KAQG 2EIEA 5CJ5A 4J4PD 1YNKL 2WNGA 3GBLA 3AM8A 5JW4N 4QRRA 5T5FL 4NNPH 5JO5A 2WBJD 3GK8L 2DQFB 1QBMH 1QO3A 1TNMA 1Q9OA 1LK3L 3IDGA 3IFOA 4P2QA 4KKLD 4P3DB 5DMJB 4I4WB 2BY0A 2EH8L 5K9QG 1U58A 3CK0L 2Z91A 4WUUB 1LK2B 3HCVB 4XCFL 5HYSG 4Q9QH 3MUJA 3JV6B 1EO8L 5E5RB 3FO0H 1T5WB 1WGOA 2GUOB 4DQOH 5DEFB 4X7CC 5ITBH 4PB0H 2HVKA 1TFHA 3QDJA 3BH8A 3MV11 1A1MB 3RWJA 5AYUL 2NX5E 4MQXC 4YHYC 4Y4FB 5DT1H 1ODAA 3V4VH 1QHOA 1EGJA 4ZO6A 4JFDB 4IHOA 2NY1C 3QXDA 3V6OA 1K4DB 4EEEA 4KTYA 1J0HA 1MCWW 1CGSH 4LLYB 3STLA 1LDSA 3KYNB 1IC4H 4M8QA 2YK1H 2DL2A 1C5DB 1A4KA 2IAMD 2XICA 2APTA 1A14L 1ZAGA 2F53D 4XBEL 1FJ1B 5BV7C 1G7PB 2AV1B 1BF2A 4JFOB 3DJ9A 2EIZA 3R1GL 3L7FA 3SDCC 1HH9A 1I8LA 3BKJL 4PBWD 1L6ZA 4IJ3B 3M1BA 1R3JA 2VXVH 1EUUA 2H2SC 4HG4J 4P2RD 3SDDD 4NRYB 3RWIB 3VGDA 4KVNL 1FN4A 4NPYA 3JVGC 5DJCA 5B8CA 5D1QB 1JHKL 1FNGB 1XGRA 2ARJB 4YK4B 4KY1H 1N59B 3VA6A 3MLTA 5B38A 5I8CB 4XAWL 4I0PA 1NCAL 2AKRA 4LAQL 1EHXA 2DI7A 1IBGH 4UNTA 3VD9A 2X4OB 4JB9H 5JORB 2J12B 2FIKA 2I60L 4X98A 3KPOA 2W9DH 5ICYA 1H15B 4LRIC 1ZVSB 3IETB 3L3IA 1YMMA 2JKXA 3P2TA 3GMMB 1CLYH 1OWWA 1RUML 4UQ3B 3S98A 4N1HB 4H5SB 4Y1AB 3ARFC 4ZOAA 1TVHB 1YQ2A 4ENED 2FX8L 4GG6A 1U3HC 4FMKA 3LY6A 3OAYH 1TPXC 3Q3GA 4IRZL 5I8KL 3TIEB 3P4MA 4XVSL 1I7UB 1CVRA 1W0YT 4PV8A 1G9NC 3H6JA 4PJ7A 4MQSB 5CUSH 4LASL 4ZPVB 3HUJE 3KR3H 4F57L 2OTWA 4HPOL 2D03H 3RBSA 4JAMA 4FFZH 4TSAL 1BX2B 2NW2B 2V6HA 1W0VA 1RZFH 3C09C 5DJXA 3LS4H 3C60B 3L3OB 2XACC 3FAXA 2G9HA 1IEAB 2JJTC 1E6JH 3NH7H 3MMEB 5ADOL 4U7MA 2ESVD 2PN5A 4EI5C 2BNQA 4KVCL 2EDEA 5CZKA 4HK0B 4PJEB 5E8PB 3EFFB 4JY4A 4NM4H 1F3JA 1T1ZB 1RUPH 5D1XC 4APQA 1DN2A 1ZHBB 2HJLA 3RGVA 3U9UA 4PRNA 3VXRB 1MI5D 4FTVB 5FUZH 4YHNB 1JI2A 4GBXD 3CZFB 4NCC2 4QXGL 4XNYL 1REIA 3MRRB 1E27A 3S88L 4Z7WF 1JGVL 4I3SH 4NO0B 2CH8A 1KC5H 2IPTH 1XGUA 1E4XI 5IMLA 1K9TA 3VMOA 1XIWA 3T04D 4MB4A 3BZDA 2FJHA 1YJDL 1MCLA 4JFXA 2QQKL 5FKAA 3MRMA 4DW2H 2DLEA 2ZKHH 4HH8A 2A74B 1SY6H 1FPTH 3HAEH 4PJXE 1HCVA 1NCWL 3NCCB 3VGBA 4ODXA 3RKDC 1U92B 3LKQB 4HBQA 5J13C 4KPHL 3WCYA 4IMKA 3QXUA 4M5YL 2EXWD 1S9VA 5ERWA 4AQ1B 1EH9A 5L8KB 3HNSL 5F1IB 1A3LL 2WLYA 4PREB 1HHGB 3H9SB 1ZWIB 3SDXB 3NIDF 3WO3B 3QCVL 5K9JL 2VDNL 4CW1B 5E6ID 1N5AA 3QIWD 5HTSA 4MS8A 4F80A 2CIIB 2EDDA 2Z9TA 4X99B 4JQVC 5DMKB 3SE8H 3H42L 2P4AB 3X13B 5HSFA 4X4ZA 2HT3C 1XGYL 2MQ0A 2JCCF 3QDME 2J4WH 4CNIB 2DF3A 3QEGH 4XAKE 1WLHA 4D0CA 3RNKB 3NN8B 3CFIC 4P4KD 1N4XL 4NKOA 5TGBA 4HAFA 1YN7A 5I1KH 5SWSB 5F3BB 3MLUL 4JVWA 4TNWF 1OAQL 1TLKA 2YMXH 3UZEA 4KJWD 4P4RA 3M8OH 4N5UA 3U7YH 2W60A 4Z7UA 4CKVX 5CCKL 3ARGA 3S8WA 1SJHA 2BERA 25C8H 4U1SB 1INEH 4PG2C 1QSFD 5DQDL 3DNKA 3TNMB 2FECL 3F7PC 3BP6B 5BQ7A 4GW1A 4HS6B 5D5MB 4F58H 4CMHC 1NFIA 2EKJA 1L7TL 2LVCA 3TC9A 5H35A 3VXSB 2OZ4A 5I75C 5HI3C 3ZO0A 5ESQB 3I6LE 1YY9D 5MEPB 2CSPA 4MWFB 1OAUL 3RWDA 2E6QA 2HN7A 3D39B 4M7LH 2VKWA 3VFVB 4Y4KB 3HNTH 4RGMB 4GUPB 4TUOA 2PW1B 3TWCH 5JHDD 1MREH 1FGVH 5DRWB 1U8JB 4WU5A 4OLYH 5FGCB 4UBDC 5IBTH 3VI3E 4K3EL 4KMQA 5DK3A 3HI5L 5IOPB 5MENA 1AO7D 3KPMA 3IF1B 3BOVA 5FGRA 2K1MA 3DV4A 1BGXH 2WIMA 1M7XA 1NBQA 5E1AA 1HEZB 1GCFA 4HCRH 3MRIB 3T65B 5GJSL 1BQHG 2WUBL 1E6OL 5BZWB 2OJZL 3RFZC 2DD8L 2AEWA 5GGUB 1DANT 5DDHA 4HMEA 2EXYD 1BQHA 4LF3B 4V3DB 3JTSA 1WC7B 4JN2A 4LVHB 1KELH 1MRDL 1G9ML 1AY1L 3UYOD 3LHPH 4HFWA 2AJXH 1RVFH 1X6LA 1SYSB 5EUKA 3G5VB 4KAQL 5CBAA 1JTOA 4FS0A 1ZVYA 1ACYL 2X9XA 4A6YA 3QPXH 2VXSL 4S1SL 5L6YL 4IRJA 3ETBF 2VDML 3GSNL 1NMBH 4KHXH 1UXSA 2XWTA 1JGDB 5BZDA 1E4XH 1NC4B 1UXWB 3L3GA 5IKCA 3VRJB 5ESAB 3QAZC 3ELAT 4M4RA 5M94B 1XAUA 1QPXA 3ALWA 1B2WH 3UJTL 3EO1B 1JNHA 4FQ1H 4WHYH 2HLAA 4LCUB 1D5MA 1WBXA 1UZ6E 1BECA 2B2XL 1MHCA 2VDKL 3IJHB 2R69H 2H9GB 1E28B 3ALXA 2VC2L 2JIXA 5DUML 4X7FC 2X4RA 3K46A 3EYVA 3QHZL 2Y7QB 4W4OC 4PJFA 3LKSB 5IB1B 5JW5A 4JLRB 5F9JA 3L6FA 1S7TA 3EYQD 1AKJD 3BW9A 4OFYD 3WJJC 3SE9H 1MCOH 1T1XA 4M6MH 4P57A 3EGSA 1TZHA 4PJIF 5DZNA 3PIQB 5KS9B 1JHTB 5TDOA 4PGEB 2UWEB 3WFBL 4NWTH 4KKAC 4OZHE 3SJVB 1WF5A 2DQGH 4HZLB 1AXTL 5IBLD 3N85L 2EIBA 1M05B 2NLJA 2Y06L 3PJSA 4Y5XC 3OR6A 3RVXC 4TTDC 5JA8B 1LO2L 2GI7A 5DD1L 3FFDB 1VPOH 2B4CL 1Q0XL 4JO4H 4MB3A 1F42A 3RIAF 5ACLA 2EO1A 4E41A 3ES6B 5C6TH 3IKKA 3F7RA 4HK3N 1DDHB 4WW2F 2MTPA 5GGTA 3VWKB 3QDGA 2RR3A 4X6EA 2V7NB 3SKUD 4K23L 3PL6C 1ZK9A 4F9LA 1OF2B 2A0LD 3FO9A 3ILPB 1EA9C 4RBPK 1S9WA 2L0DA 1NAML 4RGNC 3FQXA 2EDLA 4KKCC 3BPNB 5ETUA 2Z8VC 2RBLA 4M48H 2N56A 2O5ZH 2J5LC 5AZ2H 2JF1A 5IB5B 3ME0A 5AUMB 4AM0A 1U2CA 3ERYA 5F7DA 5C0BD 3QIUD 4YHIB 5HPMA 3G9AB 3ZL4L 2DQUL 5FUOH 2EEAA 5JHLH 1S9XB 3JTTB 1CLOH 1UM4H 3PWPB 4KRLB 5FYLL 1IQWL 4X6BB 4LFHG 1J11A 2BVTA 1KEGL 2AXFB 2O61A 4U1NA 5DMIL 1SJVA 4P2CG 3TPUB 3EOBB 4HWBL 2HMID 5ECJE 4ODUA 3P0YH 1NCUA 3U0PB 3T3MF 2AQ1A 4QRPA 1KENL 1WIOA 1PG7H 1OAKH 2O5YH 4WI3A 4F7EA 4M4PA 2FO4A 3MRGB 2X4NA 4Z0XA 2XRAL 3B2UD 1IM9A 3SGDH 1RY7B 4AK1A 4OCWH 5MHSE 3RTQB 5ILTH 2ZCLL 2VZ3A 3U7WH 5ISZB 1FQ9C 5DRXA 4QRRD 4ONOA 1MOEA 4ZD3L 2QSQA 3SHSA 4U33A 3QXVA 3ULUF 4P2QD 3MRPA 2E7CA 4QRTB 1NGXA 4O4YL 1S7RA 1LO4L 4IDLA 2GFBA 4MZ3A 1MJ7L 5E00B 2OLDA 1WFNA 2CKBL 2GCYA 4BH8A 3KYMA 2F54E 2XQYG 4YHZH 1HINH 3RDTA 1ZA3A 6FABL 3DRTB 5KW9L 4PLOB 1JK8B 3QCTL 1U91A 4UDTB 2XN9A 3NA9L 1CF8L 4MNGE 1F8TL 5F6IC 3W39B 1CD1B 1FDLL 3DVIA 4ZXBC 1EX0A 5EIVA 4RNRB 3HG1A 2XYCA 4PIRF 2RAMA 5C07E 1RHFA 2VKXA 4RAUB 3JWDH 4I9WD 4LDOB 3TVMC 1TVDA 2CXKA 3TM6A 3GSXB 5T3ZH 1TJGH 4AT6B 3P30H 1Q0YH 3WHXA 4PJHB 1C16A 3OPZL 4R0LC 3GSOB 3RY6C 1G0YR 1MEXL 4LKCB 3FQTA 3AY4A 1EK3A 3GSNB 4NYLB 4H20L 4OT1L 2BFVL 4FQPA 2AJUL 3T2PA 1NDGB 4PRBB 4KJQD 4MD0B 2LAAA 4L29B 4YBQC 4LCWB 5DEZA 5JUEL 2QADC 5D1QD 5HHMA 1WFOA 5GRUL 3T1FA 3BX7C 2VQ1B 4I3RL 2BHUA 4TVPL 2PXYC 2DYPD 3DUHA 1X5GA 4I0PD 1OAXL 2D4FA 1X5XA 3S3PA 2P5EB 4UAOB 3ULUH 4W6WB 4CDHA 5DRNB 3BPLC 3NFPA 3T2NL 1MRCL 1NGQL 2NQCA 5ANMA 2J88L 3MCKA 4UU9A 4P2YA 1T0NA 1HK6A 1X6NA 3HZYA 4TN9A 1IEHA 1NH6A 4E0RA 4H1LG 2QL1A 4JY5L 1DQJB 2BJMH 3PWUA 2WWMC 1QRND 4GW5A 1LQVA 3QDAA 1UM6L 1YMMD 2F53E 3MLYH 3UXFA 2AERT 4EJ1C 3PGCB 3LS5H 4M43L 4N0UE 1GOFA 4OZFG 4JPIA 3CSPA 4P23A 3DROB 3OJMB 4O02L 4P2RE 1KTLB 4RQQA 5TE7L 4HIEA 4OZFA 3P11H 2XWJA 3E1F1 2DQHH 1Z9OA 3X11B 4GAGL 3ARBB 4RSVA 1GZQA 1QVOB 3ZDZE 4ORZC 2E6PA 4HKBA 1ZLVK 1XT5A 3GBML 1FNSH 1PY4A 1P7KB 4UOJA 2DQEL 2HFGH 1TVBB 3GB7A 3K0WA 2UUDK 1F2QA 4YBLC 2XWBB 2XKUA 4G6KL 4NNPL 4JCLA 1QSEB 2VLKD 1CI5A 4XCYB 5DD5H 1QBML 1IC7H 3OMZA 4C4KT 3BI9X 3JUZA 4JHZA 1KCGC 1DVFB 1HWHB 1TMCA 3MLWH 5E94B 5KANI 1QFPA 4U1LB 3DIFB 4Q9QL 2HVJA 3ET9F 1F3DJ 1LILA 4LOUD 1AQDB 1T04A 3BH9A 3MJ8A 5B4MC 3DX9A 3FO0L 1RMFH 4I18B 3I75B 4OIAA 4IRSB 4ZAKC 4FA8A 3EW3B 3FQNB 2W9LA 1X7QB 3HE6C 3VE0B 3SQOH 5TE6H 4APQD 4XVTH 5IVXB 1CICB 4KDTC 2YEZA 5SX5K 4QCIB 3WUZA 3QWOA 3QA3A 1LDPH 4HH9A 3EDDA 5DT1L 5KSBA 5FV1L 1TENA 4ZQKB 1NSNH 3GUTA 3ZDYE 3C8KA 2C3XA 2DKUA 1DN0A 5ICZA 1JCKA 4WJ5B 4CU7A 3EYFA 3H3PH 3TF7C 5FM5M 1IC4L 2YK1L 1I3GL 2C9AA 5D2NC 1AFVH 1BIHA 5C0CB 3TZVA 3V6BR 3PF2A 4JM2A 1HYRC 1XIWD 2X5PA 4JKLA 2ESVE 1J8HE 4PV9A 5AWNL 5BVJB 1JZ6A 4K9EL 4GRWB 2D0HA 4V3EB 1JJUA 5LWYH 4X5XB 4RX4A 1AGBB 2YPKB 5BVPH 4F2MB 1Q9LA 4PBXA 3QHFH 4PTUB 3TJHA 4PJCA 3HMXH 1JZ5A 1CDYA 3G6JE 4MA3A 4KY1L 3GMQA 3MJ9A 4L3CA 4OCMC 1M7IB 4DKEH 2BY2A 1FNHA 4FHBD 3SDCA 2Y07L 5CP3H 1MI5E 2F15A 2ICWB 4LU5H 4K94L 4PRIE 2NR6D 4EUPG 3JTCA 3H9SD 2ID5A 2CKBB 2EE2A 3BJ91 4JB9L 3JVGA 1M7DB 4EIZC 2ITDA 3JWDC 3QZWB 3INUH 1RPQA 4LLVB 4EN3A 1II4E 2YRPA 2R9HC 1HYSC 4D9QE 3SGKC 1I9JH 1JGUL 4MS8D 1K8IA 3OGCB 5DK0B 4U1KA 5FDWB 1T83C 1Z2KA 1YY8B 1S7QA 5HJ3B 3PQYA 5C0JB 3VRIB 5IB2B 4BFGA 1CCZA 1FFRA 4XGZA 4PRPA 1UACL 3N06B 2CDEA 4G7VH 2H32A 4G7YH 4F7PB 3DV6A 2GKIA 5GGVL 5SWSD 4PD4J 3QISA 5JOEA 3HZKA 2ZCHH 4YR6B 1ZLVH 3MO1B 1XF5B 5EZLA 5F7KC 1AIFB 1X44A 2YPVL 1HDMB 3X3GL 5FHAL 2D03L 3ARGD 1HILA 1PAMA 3ARFB 2X09A 4GRLB 4RA0C 4QTHB 3IDNB 1U3HB 1RZFL 1TJIH 3QUZC 3LS4L 5IJKC 3D3VB 1BQSA 4RWHA 3WFCH 1VEPA 5JW3L 1HI6A 5FUCE 1N6QL 1IZJA 2QQQA 3H0TB 3C2SA 3QEQE 1GGUA 1JNNH 3BT2H 3O0RH 3NH7L 4HJGA 2C3VB 1A6PA 2BVUA 2BVEA 1RI8A 5DJ6A 1FCGA 2G60L 2LVEA 2ZSVB 3OHXB 3VFTB 1DFBL 1Q1JL 1XR8A 5IMKA 1NMAH 1U8IA 4NM4L 4K3JH 4P9HL 2R23A 3K1KC 4JREB 2JJTA 4R90L 4BKLB 3D85A 1RUPL 1F3RB 4M03A 3WFDL 1DBBH 4DUXA 1JBJA 5KSUB 2OJEA 3IXAB 1YPZB 1XH3A 4LLQA 1RURH 4X9HA 4C55A 3LV3A 1CDGA 2X4SB 4EI5A 2P49B 3BISA 5HHOD 2EYSB 5DJDB 3MJ7A 4L8BA 3UTTA 2YA2A 2F74B 3GKWL 3SGEI 1EERB 4YC2B 7CGTA 1N6UA 3HZMA 2MKLC 4G6AD 1QSFE 4X6DF 5D1XA 5CZXD 2BZDA 4JDZB 5LXGH 1BQLH 3BZEA 4OKDA 1KC5L 4FXGB 4BZ2H 2IPTL 3UTSB 1RQ5A 4X7SH 1NBYA 3OZ9H 1MJ8H 1G7LA 2BXZA 1U6AL 3NCBB 4NFBA 3MLRL 4UINL 4DW2L 3LQAH 4OZ4A 4ZSOA 5I74C 1KLUB 2ICEB 5EIQA 3WN5C 3EAKA 1SY6L 1QACA 1U8HA 4IRJD 3U6RA 3WLBA 1FPTL 4K71C 3VXOA 5JHDE 3T0EC 3O4LA 3QQ4A 4N0YH 4YHPB 4OLUH 4HXBH 5I1GH 1AXSB 5I71C 2Q7YB 1I7TA 2LAGB 1KPUA 3OKDB 3ARDC 2Z4QB 5BCAA 1PKOA 4O5LH 1A7NH 1CFNB 5TFSH 1KJ2H 4BFIA 5MERA 3OR7A 3W0WB 2I9TA 4TRPH 2OK0H 3KVQA 5CBEB 2JIXD 4XCNA 2AI0H 3QO1B 5EWIH 2XG4A 3U4EA 5HGHA 3O6KH 3P4NB 4K3HA 5C9JB 5J13B 3PV6A 2C5DC 3ZTJH 3QB7C 3RA7H 2VLJA 3SE8L 4EI6B 1R3KA 1WIPA 3ILQD 5MEQB 4HX1B 1R3LB 3MJ6A 1F6AA 1R5VB 4X6CB 2BVYA 3HZVA 4DOHE 3OJVC 2IANB 2PO6C 1ETZA 4JFEB 4YO0B 4M6AA 4I0KA 2FX7H 4KJYB 2GY5A 1T4KA 3W2DL 4N0FA 5TDNA 1KLGB 4CN1A 2ATKB 4YZFE 3T0VA 2PNDA 5I1LA 4FFEX 1MH5A 3KS0J 4KKBC 8FABA 3QULB 4Y5VC 4ZTOH 2NY0D 1FG2A 2G2RA 5DGRA 1QYGH 1ADQL 25C8L 2EE9A 1F97A 3TO4B 3DX7A 1INEL 1BFOA 3VCLB 4O2CB 4MMXC 1CDJA 3P77B 2KZWA 3OKLB 4JRYD 4AJ0A 2ITCA 1CIUA 1JTPA 1CT8A 3RVWC 4F58L 4ODWB 1CU4H 4W4NA 3GBNL 4MXVF 1JWSB 3CZJA 4RZCA 3VWKD 3IJSB 4G80B 3IAGC 3IFLL 3QDGD 2XTJE 1OP3H 5HDQH 5HDOA 5DZOA 4I2XB 2YBRA 4ZNEE 1RZGA 4QWWC 4M7LL 3W11D 1FYTD 4JKPH 2Y4SA 3HNTL 3NTCL 4MLIA 1LP9E 1W8OA 4K07A 3D69B 1NGZA 4GG8B 1FGVL 4AH2B 1U8KB 1JI1A 3L95A 5D7IE 2E9JA 1OCWH 4R26L 5CHNA 2RJMA 1QBAA 5IBTL 3MX0A 4NHUB 1OM3L 4WHCA 4Q9RH 3MRQB 1MVUA 3SCMC 4Z7OE 2ARWA 3O3EB 4AZ8A 4NN5B 2X4UA 1D7FA 3QPQD 3ZHLA 3JZ7A 3NIGF 1G7IB 1DUZB 4D94A 4HCRL 3RHWF 1EUTA 1FVCB 1S5HA 4JANB 2OSLA 1QNZL 4XNQA 2I25N 4LFHD 4TSBH 4OJFH 1KELL 1JPTL 3JBG7 4ETQB 3B2VL 4M61B 4PTTA 3SGEH 5C0GA 4HSQA 4CVUA 5EA0L 3X14A 1I8KB 1FCCA 4X7DC 2XPGB 1MVFA 1E4XL 1I1YB 2R4RH 5HGDB 3BZ4B 1R5IB 5EZOH 2I9LB 1MRFH 5HHXH 1HOCB 4P3DA 1GSMA 4I4WA 1B2WL 3N50A 3WSQH 4LSPH 3WE6A 3QO0A 4BSWB 3P0VL 5C0BE 3VFGH 1HSAB 1QOKA 1YUHB 5C0ND 1BIIA 5GS1B 1EMTH 2EC9T 2C3WA 2VLRB 2GUOA 2B0SH 4YPGA 4XXCC 4MD4A 3TBWA 3RDTD 5I18L 4KROC 1A1MA 3GJFK 3BRGC 1S7SB 4JFFA 5FK9B 3SE9L 1MCOL 1A0QL 3IFNH 1N2RB 2HT2D 5CP7A 2IH3A 3EZ8A 4M6ML 4Y4FA 4F3FB 5FYJE 1BD2E 3GM0A 4Q6IC 3AMLA 1H3TA 3O3BA 4JFDA 1SVCP 1RUAH 4YXLH 2K9UA 1K4DA 3HG1D 4W4OA 1U42A 1KG0B 2YZ1A 2HWZH 3MUZ1 4MQTB 1JHLL 3WJJA 1EHLH 4L8DA 1FJ1A 3ZYJA 4HGMA 1PBYA 1R6VA 2X44D 3GMPA 1KFAH 4WUUE 3EJYC 1VPOL 3O9WA 2V17L 2R1WA 2EE3A 1FFOB 3T0XA 4JO4L 1F4YL 4NKMB 2NZ9D 4M5ZH 3CSYB 4XPTH 3HAEB 1NFDF 1J1XH 3PABA 2VRAA 1GXEA 5C8JB 1IILE 2VWEE 4Y5XA 1OARL 1CL7I 3BKMH 3UYRH 3OB8A 1C1EH 2FBJH 1T66C 1KB9J 2BXYA 4P46C 3V79C 1MCEA 3ULVE 1TETH 5BW7A 5JXAL 1NDMA 2X4OA 1PG7X 5JORA 1GOGA 5JMOC 4FQQA 1B4JL 5IMMA 4M48L 2YA1A 2Q86B 1G6VK 3PL6A 5AZ2L 1MFBH 2RHEA 3UBXI 1MFAL 2HKFL 4J23A 4WU7B 1PGRB 4WFEE 4CVXA 3CC5B 5T5NG 1Q9WB 1CLOL 3JWOL 3GIZL 2DMBA 4OLZL 3MREB 4LBEA 5DJ8B 1JV5B 4JM4H 4P23D 3TIEA 3GSVB 1I7UA 3P0YL 4PLKC 3FCTB 3MA9L 4U2YA 1FE8L 2NTFA 4NUJB 3FONB 5DLMH 1OAKL 4ZFZB 3RWEB 4Z7WB 3ARBD 4QHKI 3MRLA 3OKMA 4CUCA 4JKMA 4U6XB 1NAKL 2Y1VA 1DBMH 3L5WB 4ONHA 2A2QT 3MRHB 1IM3A 5ILTL 3SDAB 3EYOA 2OTUB 4QYOB 3C60A 3SE3C 2NY4D 2BRQA 3L3OA 2ZG3A 5DTFB 5DURB 2D31A 4PJ9C 3EFDH 2WM0A 5IW3A 4OV5A 3GDBA 3CX5J 2V2TB 1MLCA 4RA3A 3F5WA 3HS0A 5IBUG 1QRNE 4M1CD 2DJSA 3P9LB 1D6EA 4IDJH 3G6AB 5FYKD 5D72H 3LN4B 4BQ9A 2KZ1B 3GI8L 1KIRA 5E8PA 1XF4A 3EFFA 5IB4B 1F90H 3CPLA 3REWB 5TQ2H 4Y5YC 1JRHI 1HINL 3LH2H 2EECA 4RFOH 5FM4A 5A2LH 3X12A 4OBSA 3MV8A 1CIDA 2F9BT 4LQFL 1C08A 3MRCA 3OB0K 4U1IB 4H26B 3CIQA 4NQDA 2X7LB 1J12A 3CZFA 3ZDZF 2VDQL 3R4DA 4OCYH 4M9PA 1A6AB 2AJZB 2BSTB 1JF1A 3G5ZA 2VZ1A 3WFHB 3CFKA 4G8GD 1AGCB 5FOBB 4DVRH 2VLKE 4Y2DB 4LLAA 3AREC 2E7HA 4M8VA 3SPVA 4MQXD 1TJGL 4XC1L 2J3SA 4Y16B 3P30L 1Q0YL 1IGCH 4PGBB 1K85A 5SWQB 4WO4A 4L8CA 1C7SA 1EEUA 5C08B 3TT3H 2NY1D 4HIHB 4LCIL 3FRUB 4PJEE 3R0NA 5HHVH 4RX4D 5IJVA 4EZMA 3TVMA 4MCYB 1UB5A 4YEEA 3FQRA 1OGAB 1U92A 4MDIB 2BSSB 5DUPL 2EIDA 2BNUB 2FB4H 4UTAH 4R0LA 3RY6A 1T3FA 3SDCD 3VXRE 4G6FD 3ECBB 1F4WL 5EBWA 4YXKH 1JZ4A 4PREA 4XWGH 4TPRH 1HHGA 1K5NA 4F7MB 2H2SD 4PJ5D 3PGFL 3SDXA 1VADA 4N0CC 5CD3B 1ORSB 1CL7H 2Y5TB 4IOSD 5KJRH 2CDFA 2BJML 1UQSB 3S37H 2G5RA 2PXYB 2MHAA 3MLYL 4QXWA 5F9WB 1C5CH 2B39A 3HC0A 5F70A 4KUCD 5GRVL 3CMGA 1JNLH 3BVNA 3PQYD 3PNWB 3L3HB 2DAVA 1CFQA 4IEFB 1OP9A 4C57C 2ORBL 3NN8A 4QHMA 1NGWA 3SDYL 5DVOA 3F7QA 4NN6C 4QRSB 4NQCB 2H45A 2DQHL 1QSVA 2P43B 2VSCA 3QXAB 3V0WL 3HR5A 2X05A 3LQZA 3MBEC 4HUXB 1FNSL 2R8SH 1Z3GH 1UKQA 1EHAA 2HFGL 3ARFD 4ACPA 1AGEB 32C2A 3VH8G 4IS6B 5EOTA 1U3HD 5JDJA 5HXMA 3D3VD 3H9SE 3TNMA 1G7MA 4Z9KB 5IV2A 6CGTA 4HUVA 4HS6A 5D5MA 3SKJH 5DD5L 3VH8A 1LO5A 2N7BA 4M62H 1U8NA 5D70L 3PXHA 3OAZK 3AGVA 2FGZA 3UX9B 2VR9A 5ESQA 1Y6KR 1G7HB 2FATH 1X4ZA 1GPOL 1FRGH 2AK4B 3P4OB 4KDWA 4U1JA 4OM1L 5DYOB 3QFDB 1L0QA 3BSZH 3KGRA 3ZYIA 3FRPA 4L1DA 1GHFL 1RMFL 4MJ6B 3QQ3B 3LN9A 2PW1A 4HGKC 4NQXB 4U1MB 3D87B 4WI6A 3LPFA 3RWFA 4HV8B 5DRWA 1OLLA 3SQOL 5TE6L 3RZCB 3EYSL 3VFOB 1U8JA 2MNUA 3GM8A 4IIQB 3VWJC 5SWSE 2NY6B 5HHNA 2ZUSA 4EOWH 1KT2A 4PJBA 5GRJL 4XVJH 4JHAH 4X5WA 4EI5D 5F6HI 4Y4HC 1LDPL 3Q1SH 2NXZC 2JLLA 1HWGB 3UTTD 1JRHH 4ZAKA 2DWEA 1HEZA 3MRIA 1J88A 3HE6A 2VITA 3Q2CA 2XI9A 5D1XD 1A9EA 3C08H 5BZWA 4UDUB 4PJIB 1PKQA 3G04B 1AFVL 4KDTA 3UTSD 5D7KE 2R2EB 4P49A 4C56D 4UTBL 4WFHD 2VAAA 1L7IL 1WC7A 3VXSE 2VH5L 1WCBA 3O2VH 1A6ZB 4XBGB 1CYGA 1ITBB 1MWAH 3D39E 3ARRA 5LWYL 4WTZG 5BVPL 2Z31B 4OF7A 3QHFL 4CU6A 1S7UB 5IM7A 3TN0C 1NC4A 5D2NA 4MAYB 1E4WH 4NKIH 3VRJA 5ESAA 5EO0B 4XNUH 1J8KA 2Z8RA 4WTZA 4ZS7L 3GKZA 2BY1A 5FGCE 3A6BH 4LP4A 1A1OB 4WW2B 2Q87A 4LU5L 2C3GA 5HHOE 4YDVA 4R96A 4MGXA 2IH1A 4ZO7A 5EU6B 5BJTA 3W0WD 5TQ0H 4LSRL 3OKOA 2H9GA 1E28A 4OSUL 4EQ3A 3DXAD 3S96A 5JTWA 3KYAA 5T1KB 2VN4A 3RKDD 5IB1A 1LNUB 3T4YA 3EO0B 3GMRA 3MXWH 5HYFA 4PJDE 3KNBA 5IF0B 1T7XA 2CRZA 4ZFGH 4GH7B 1FAIL 1U8PA 3IXTA 1Q38A 1C5BH 1WQVT 1PZ5B 2FNBA 4NO3B 5TF1H 2GJ6A 4RMVA 3PIQA 2IAND 3F7YB 4JFED 4G7VL 3T0WA 5GSVB 3SGJA 2ADJB 3SKOA 1ES0B 3SGKA 3KPQB 4QXTA 1JN6A 2ZNWA 3FQUA 4K3DH 4RRPG 5E9DB 3U36B 1WBYA 3TA3B 5AD0B 3FO1A 4LHJB 3MCG1 4XXDB 2J8HA 2QJDA 2HT3D 4M7JH 1URLA 2CLRA 5TF0A 2IPUK 4NQEB 4C83A 5D1ZB 3H8NA 5KSAB 2PR4L 2YXMA 3WNOA 3I3DA 3ES6A 4X4YA 1ZT4B 5KOMC 3V5DB 4ZTPL 2WY3A 3K81A 4HWZA 5B39G 2ZG2A 2O5XH 4KGLA 1P7QB 5KSVB 1OF2A 3FFCB 3QUZA 1Z9MA 1NMAL 2B7DT 35C8H 2IQ9L 4NT6A 5KS9E 2X42A 4YNYB 1AD9B 5T33L 1QTYT 1SEBB 2H2PC 1DBBL 1KTKE 3WEXB 2Y36H 3RPIB 3SJVE 3LKRA 4Z7VA 5HI3D 2A6JB 3B9EA 1FV1B 1D5ZB 5C0FB 1VERA 1RJZB 1LEIB 3NGBC 1D9KC 3OKNB 4YZFF 4YHIA 4R2GB 5C92A 3VW3H 2DLHA 1ZT7B 5CIPH 1TZGH 2C1OA 3UPRB 1TZIA 5GRVK 1MHHB 1UWGH 2BDNH 4FQCL 2D7QA 1UB6B 2B1HL 5DHVA 5LXGL 4JRYE 1V7MH 1BQLL 4UBDD 2ZJSL 1WZKA 3LEVH 1KTRL 1NUNB 2WQRA 1IAOA 3OZ9L 1MJ8L 3IGAA 5DJYA 1BVLA 3GSRB 1H3VA 1K3IA 3IRZA 3QDGE 4PY7B 3V2AR 3BWAA 4XPGH 1I75A 3NFSL 3NCFB 4EDWH 3TFKC 3WL9A 2LTQB 4JFQA 3LQAL 2VABA 5EU3B 2W0LA 4XCEB 1FYTE 4P5MB 2BVOA 3OAUL 2C1PB 3VFWB 1P4IL 1KCKA 5DWUH 4MA1B 5E4EC 3UROR 2LU4A 4MJ4A 5C7XH 3CMOH 3VXPB 5EU7E 4N0YL 4HUNB 4OLUL 2ILLA 4KU1A 5IB3B 4HXBL 5I1GL 1KCVH 4XNZC 5D7IF 1I3RA 5F1KC 2X40A 5EPMA 1MLBB 4QRTA 3L1OH 1FG9C 4O5LL 1A7NL 4O2FB 3WN5A 5I74B 5TFSL 4HKZB 4Z7OF 3TYGH 4YJZL 5E00A 5E1HB 3R8BB 3B43A 3S7GA 4TRPL 3PWPE 2OK0L 2AI0L 3T0EA 4X4MA 2NX5B 4J1UB 5INCB 3RA7L 3KLDA 3MRDB 5I71B 3KPSA 4OTXL 4UDTA 5E8NB 3ARDA 4M93B 4WGWB 4JFFD 4FRWA 2BOCA 2WIIA 1CFTA 4XP5L 5D7LA 4W81A 1CQYA 4H8WC 2Y72A 2A6IB 1FO0H 5IVZA 3PHQB 2V5TA 1I9EA 4RAUA 5K9QI 5ISZE 1HCFX 3FAWA 5DD6A 2VUOA 5I8EB 1XF2B 4ZTOL 4MJIA 2Q8BL 3EOAB 1GGBH 4FFYL 1HH6A 1IGYB 3B9AA 4PJHA 1PYWB 1T5XB 1VFBA 3KHOA 2OI9B 1PEZA 4AEFA 4JO2H 4R7DA 2PO6B 3RU8H 3KJ4B 3D18B 1QA9A 1IGIH 3DSFH 3VGAC 4DAGH 4HUWA 1WEJH 4YBHA 4CDGC 4MD0A 2PYFB 2BOBB 4FQ2H 5EOCH 1AH1A 5HDQL 1YEHH 4Y5VB 5DQ9B 2IFFH 5C09A 3RVXD 4TTDD 2QKIA 3FOMA 4OQTH 3O11A 1OP5H 2V2XA 3IU3B 2BVQB 1QQDA 4WDIB 3FN3A 4NO5A 5IP4A 1B6DA 4QXUL 1KIQB 1ZTXL 2DM4A 3SKMA 4RAHA 1OCWL 3FN9A 5FO8B 2ERJC 1MCKA 3LEXA 3PHOA 4FXKA 1M71B 3PL6D 3G5YA 2IADB 3NABL 4FP8H 4Z95H 1AJ7L 4ZUVB 3PGCA 2R1YB 4M6NL 2UVFA 1KIPB 4F8QA 5KAQF 4RGND 1TQBB 2P8LB 2DOCA 3IS1X 2GTZB 3PGDA 1UADC 3BPOC 4WUKH 3STZA 2PYEA 5DVKA 1KTLA 1ZGLA 3BESR 3QH3B 3SCMA 3X11A 5JZ7D 1NJ9B 3D6GA 4U6TA 5CWSA 1OAZL 3VD3A 3HC4L 1VGKB 5I73C 4ELMA 5FHBH 3O8XB 1FZMA 5I17A 1ZHKA 1I9IL 5FCUL 5SWZA 1W0WB 4MNQD 2R4RL 2P5EE 4JFYB 3WO4B 2NZIA 5DA4A 5FB8B 4LDLB 1YC8A 4XCYA 1G7QB 2IALB 1CGUA 1MRFL 5HHXL 1ZT1B 4BSJA 3S34L 1KXVC 3V0AC 2DQCH 4LSPL 4U1LA 1KCRH 3FJTA 1JPSH 1DUYB 3BIKA 1NAMA 4MAUH 4PUBL 1CE1H 3GGWB 4TUKL 1EMTL 4D3CL 5ACZA 5C0AB 3ZKXC 1VACA 3U4BL 4I18A 1MAKA 3BO8A 4G8IA 2PW2A 2XOTA 2DQTH 4IRSA 3TBSB 3EO9L 2B0SL 2CRMA 3V4PH 3FQNA 1I85C 1X7QA 4LVOB 4OM0H 4G5ZL 2VIRA 2QLVB 2N4IA 1N0XH 1Z5LB 1MIEH 4YAQA 2AGJH 3NPSC 4PJ8A 2D7TH 3OKYA 1U8OB 5DQJB 5ENWB 1K4CA 3TIDA 3RAJH 4UZGA 4NQDD 2FEDC 4LLUA 5D7JC 2Q1EA 3RVUC 1RUKH 4XXCA 1P1ZB 5FGBC 2HWZL 3MV9B 5D71L 4F33A 1QSEE 5EO1B 2P47B 5C0CA 1EHLL 2P45B 1NEUA 2FYYB 2DM2A 4Q6IA 5BVJA 1YEGL 4ZXBD 3V6ZA 1IL1B 2G75B 2H3NB 5HVGB 3MYZA 3S4SG 1I8MA 2QR0B 3P4LA 1HHHB 1SVZA 4M5ZL 4XPTL 5CEZH 1JGEA 1YZZA 4XMPL 3TVMD 3WIIH 4I77L 4DZ8A 3S4SA 1BBJB 4X80H 2J8UA 4GG6F 2YA0A 3JWNC 5GSRB 3MRJA 3WS6C 4HG4K 4U1HA 5GIRB 3JXAA 3V6FB 3QJFA 3BXNA 2X4PB 3AS1A 3LDBB 1B3JA 4YDIL 1EGJH 4L8SB 3PHSA 2R0ZH 4KXZH 4X6FA 4RGOH 4S1QH 4YBQD 3F12B 2QADD 4KI5C 5TE4H 1KGCD 1OB1A 3W9DA 4G8GE 1B0GA 3QNXB 2PXYD 2XG5A 4DFHA 4E9LA 4PRDA 1T0MA 3C8HA 1HQRA 2WW8A 1G1YA 1RULH 1PW3A 2FZ3A 4GRWE 1IGJA 3MNZB 5CJOL 3KPRA 4JM4L 4GW4B 4D8PB 1A3RL 5TDPA 1FC2D 2NY5L 3IDYC 3OXSB 1KACB 1OQOA 5DLML 4LVNB 2WWMD 3B9KB 3FB6B 4X6DB 5EIIA 5EULV 4PJCE 1WCQA 1B4RA 3RX5A 4CBPA 1JPFA 3BP5A 5C2UB 3QUYC 1NCBH 4GRLA 1LO3H 1A4JB 3SOBL 3CX2A 4ZFFB 4PJ5E 5E5UB 3R06A 3P73B 1QFWI 2UYLB 3IYLW 3T0BA 3OX8B 4L9LC 4WI5A 1PJ9A 4LHUB 2AK4D 3JV4A 1EEYB 1EPFA 4IDJL 4IM8A 2DTSA 4JR9L 1CK0L 1R5WA 4UMGA 3UTZB 2ZSVA 3OHXA 5D72L 3VFTA 2QV2A 4HQQL 1HE7A 3IFPB 3SE3A 2FL5B 3KPNA 1F90L 2VR4A 3L3JB 3PQYE 1HHIB 5TQ2L 4PJ9A 4YH6A 3DO7B 3FMGH 3ORJA 5EC1B 3K2MC 5IEHA 4I0CC 1S7XB 2AXGB 5J12C 1HXYA 1ORQA 2R2HB 3HE7C 5IGXH 2X4SA 4YQXL 3IJYB 5HVWA 1CN4A 4NSKB 5EH1A 4YHMH 5B4MD 4EKXA 4OAWA 4OCYL 3L5JA 4Y5YA 5CINH 4ZAKD 3S36H 5HYQA 3D3VE 5E4IA 4JDZA 4EDXB 3HE6D 5IVOA 2HJKB 2E8YA 4DVRL 1S9KC 4J3VA 4KDVA 3RI5K 4FXGA 4JFPB 4UV7H 1K6QH 2CRIA 3K3QA 3UJIL 4WTXA 3OKEB 5DZLA 2VN7A 4TVPE 1PSKH 5CZVH 1UVQB 3DUUA 4N0RA 2XKNA 2G5BB 3TT3L 3U82B 1N7MH 2CMRH 2HFEA 1KLUA 5HHVL 3S37X 2DLFH 3CDFA 4I48B 1L8JA 3AREA 1JTTA 3DHMA 5KVMC 1UEYA 2JELL 1V3MA 3D0VA 1MHPH 4YHPA 3Q0HA 1WAAE 1YEEH 4E42B 3RIFK 4DZBA 3OKDA 3CCHB 4YXKL 3S3JA 2Z4QA 1MFDH 4TPRL 4NC2B 1PFCA 4OB5H 2DL9A 3BD4A 1UM5H 1FNEB 4QNPE 1RZ7L 2WWKO 1KIUA 5KTEH 4UI2A 4Z7UF 3AM8C 4PY8J 1CL7L 2VDLH 4GKZB 4XZUB 5KJRL 2GQHA 3MNVA 1T7YA 5C9JA 4JFHD 5C0IB 3PDOA 1AI1H 3O2DA 1DLFL 3UTSE 4EI6A 4C56E 1C5CL 4XMKL 5DJ2B 1PZUB 4HX1A 1R3LA 4Z0BL 3U83A 1EFXA 1JNLL 4LHQB 1ZLSL 1ED3A 1GGIH 5I19H 3O6FB 3FT3B 3HA0A 4BQBA 4XI5C 4TOYL 5E8DH 1XGQB 2R9HD 1HYSD 1NMCC 3X17A 5T3ZD 1ZHNA 3ZTNH 3KDMB 5I66B 1BOGA 4OGYH 5D1ZD 5I16B 3MFFA 4NHCH 5ADPL 2MCG1 5BO1H 4PLNC 5EZIH 4PFEA 5GZNC 1OHQA 3RNQB 3SKJL 3W0WE 4RMTA 5JOFB 1HHKB 1JWSA 3GSQB 5IR1B 4GLRI 3DXAE 4NZUH 3U0WH 4GS7B 2FATL 3DTXB 1FRGL 2FSEB 2X10A 2UZIL 1FIGH 4I2XA 4EIGB 3QXTA 1F4XH 1N64H 2J6EL 1QLFA 1MIMH 1W72L 4B7IA 3IU4H 1I8LC 5FEBA 1F58H 2EDJA 3QUZD 3TBYB 4ONFH 4PJDF 1QFWH 4X6CE 5LGHH 1WBZB 2IANE 4JFEE 5A3IC 4GSDH 4JHWH 4NHUA 5B8CC 1QUNA 4EOWL 1U3ZA 4JHAL 4AIOA 1MCBA 5IFAH 2SEBB 5JQ6H 3FZUC 3Q1SL 3O3EA 4Y2OA 1CG9B 4R2GD 4AYFA 5ESVA 4FG6C 4ODVH 1JRHL 4RAVB 1G7IA 2EYRB 1MUJA 1BFVH 4WEBH 3V4UL 4U6YA 2EDXA 3VWJA 2UY6A 2OQJA 5F89A 4YHKH 1HZHH 5J6GB 1NL0H 4V1DA 5DVLA 4KK8C 2OZ4H 4R7NB 4WCYL 2JK5A 2VDRL 3LQMA 1FL5B 3DVGB 3CUPB 5I1IL 4JG1L 4PJFF 1R3HA 1MWAL 2I5YH 1IKFH 3EOYG 3QQNA 4OCRH 2MQCA 3O6ML 3MYJB 3CLEH 4CMMA 3FB5B 2HA1A 5KS9F 1NFDB 1DBAH 3QI9C 4J6RH 2IPKA 4Z78A 4HUKB 4MQ7B 2PTTB 3I6GB 2DI9A 4HBCH 4GXVL 3REVB 2BCKB 5A2FA 5DJZB 2AJVH 3FN0H 5EN2B 1TCRB 1GGTA 3VG0L 3VFPA 2F54B 4WW1A 4NUGH 2VLRA 2FLRT 3GJFA 4ZFOA 1YC7A 1BVKA 2DTMH 2CIKA 3I84A 4L4VA 4GO6B 3T0ED 5CEXB 4QY8B 4KC3B 3PWVB 1JF5A 4LPCA 2EDQA 4ZUTA 1FNFA 1S7SA 2P5WD 2DM7A 5EBLB 1FFNB 3ARDD 4LCCB 1C5BL 5FK9A 3NAAL 5ID0B 3E6HB 3AS2A 1B6UA 3MROA 4AIZA 5D7LD 4NM8H 4WEUD 1S7WA 4POZC 1OTSC 5IROC 2WBJB 3K80A 1UA6H 1P2CB 1P5VA 4JRXA 3QUXC 5MI0B 5F9OL 4G3YH 4ZUUA 1I9RL 5TJWK 3RGVC 2BRRH 1DE4B 4XBPA 1WTGT 2NW3A 1VFMA 4M7JL 3DBXB 4FQLH 4G8EB 3U4AA 4MJID 3TCXA 1SMAA 2PO6D 4OGAC 1FFOA 3FB7B 1NCTA 1MAML 2R29H 1SY6A 4R4BB 2FJFA 5C1MB 3OJDB 1FH5L 3DMMC 1N3NA 1V5JA 3NZ8A 5E99L 4LNRA 1BJ1H 2O5XL 2CJUL 1MCHA 5I15H 3V5HA 3TO2B 2GAZB 4PG9B 5C09D 3RUGE 5F88A 2I07B 1A6TB 4PS4L 3QCUL 3TT1H 5C3TA 1MCIA 1SJEB 1H5BB 4LSQH 35C8L 2HJFB 3RVWD 1J0YA 1Y6NR 1BEYH 4GLRH 2EYTA 1G6RA 3B8SA 4IMLA 2IAMB 2Y36L 3G08B 4Z5RA 2F53B 1BP3B 4ZYKB 3BP7A 5FKPB 5J89A 4M7KL 2PCPB 2EDKA 4WU7A 3KPLB 3KYOA 1UH4A 4KV5F 4OLWL 4GMTH 1Q9WA 3BMVA 3GHEH 5DXWA 4P2RB 3SDDB 5I1DA 2ENYA 3X3FH 2V2WB 4S1RH 2H8PA 1UWGL 3MREA 2BHZA 1FLTX 3UBXB 5DFVC 3VDBA 5INDA 2PYED 3KXFA 1RFDH 1I1AA 5GGTH 1I1FB 3RWEA 2DWDA 1D9KA 3NGBB 3SCMD 3U0TB 2VYRE 1I1CA 4NDMB 4B53A 1ADQA 5C0DA 4EDWL 4NRXA 2YD8A 4JQIH 1INDL 3EJJX 2HKHL 2IG2H 3LKNA 1DLHA 4MXWH 4HDIA 3L3KA 2FGWH 1J05B 2OTUA 4JY6A 5SWZD 3V52L 4Q97A 1BZ9B 5KG9A 5F7WC 3GMLB 4UB0L 3BUYA 4YUEH 1KPVB 3TBVB 2HTKC 3TFKA 1W72B 4Z77B 4WV1B 1MHEA 4R97C 4H25A 4PRAB 1UG9A 4WFFD 4FQXC 4XVUC 4J3XA 1A8JH 1BAFH 3TH3T 3I9GH 4RGNE 3TBTB 5E4EB 3REWA 2AEQH 5F7EH 3FTGA 5EG6C 3QG6B 4XPHL 3T1WA 4XNZB 3VXUA 4KKNA 4L3EB 4DJMA 4DEPC 5GGQL 4Z7WE 1Q94B 5L2KD 1IAIH 2YRLA 4AEHH 2C26A 4U6HB 1LEKB 2YD7A 5IK3B 2DQJH 4BFEA 1NUGA 2A9NL 2AJZA 4MVBC 3V8OA 5CJXC 2JCCA 4MNQE 5FO7A 1ZHLA 4LPXA 3MV9D 4X9FA 3VFNA 4KROD 3BPCB 1BF8A 3A6CH 3MPCA 3BKCH 5BRZA 3OL2A 2P24A 1KB5L 4XWOC 4RIRB 1MWAB 3UEZA 4JO2L 5SWQA 3DGGB 4F7CB 3V7AG 2GYSA 3I6KB 4UQ2B 3FRUA 1NBVH 4WVRA 2NYYC 3DSFL 4DAGL 4G6JH 3MRNB 1X5YA 4GKSA 1WEJL 4BUHA 1RZJH 1BPVA 1RJCA 4XPFL 4JFZL 1ZANH 1DP0A 4JN1H 4G42B 5HYIA 4HLJA 3QNZA 5KN5A 2ADGB 1MI5B 2IFFL 5BS0A 3KJ6H 3E3QE 3RL1A 4FQIL 2CUHA 4GBXB 4K8RH 4KZEH 3EJYD 1LEGA 3MNWB 4F9PC 1NGYA 1KSRA 5HYJA 1YMHA 2EDTA 3RWGA 5IHZB 5IFJB 3ZYOA 5I1JH 5T3XD 4JGJA 2K3TA 3BE1L 4XMLH 4NQDE 4ZMAT 4WGVB 4Y7MA 1ORSA 1UH3A 3F6IA 3O3DB 1FL3B 2J8OA 1RZKH 4LARH 3GSUA 3KLAA 1T66D 2LQRA 4P46D 1MCCA 2F8XC 1K2DA 3C9NB 1SM3H 1A1NA 3WIHL 3NZHH 4QOKA 1CXEA 4TQEH 5DR5H 5C08E 3KPRD 1MCFA 2BP3A 4NQCA 1OPGH 2B20A 1OGAE 5HHPB 1DQML 3QXAA 2JJUA 5GZOC 1A7BA 4OCSH 3ROLB 1YEIH 2W9EH 1YQVH 4OCXH 3CH1B 4IS6A 4BK5A 3VG9B 4WI4A 4RMSA 4QHLB 1JZ7A 3ARPA 4EVNB 5I9QC 3C5SA 5E6IB 5E08L 3QIWB 4PLKD 2BNRB 2X1XR 3VRLF 5KSBF 4HS3A 1U93A 2XZCL 4P5TC 1V7NL 2DQCL 4DN3H 1G7HA 2B1AH 4HHAA 5I73B 4FQJH 1KCRL 2APWA 1JPSL 1YEFL 5CD5D 3HNVH 4DGVH 2ZUYA 1IGFH 1TITA 1GIGH 2WBKA 1CE1L 5DO2C 2AK1L 4P4KB 3D48R 1CFVH 2DQTL 3V4PL 4U1MA 3MUY1 4MX7B 4PJ9D 3EYUL 5J9PA 4GT7A 4G43A 1I3VA 5T1LA 4OZFH 4D2NA 5BMFH 2DIAA 2X4QB 5D93C 1N0XL 4OUUA 1PLGH 5T1MA 4ETYA 4POYA 5I1HL 2VLMD 4RFEA 1T22A 4LIQH 2D7TL 3CDGB 3O41B 2E3VA 2Z92B 3BEVB 1QSFB 4R3SB 3RAJL 3V9FA 3QR2A 5CIPB 5FECA 4PJCF 2VTFA 3P40A 3ZKXB 1QKZH 4WWID 5IT2H 1KTDB 1I85A 1BM3H 3BEWB 1NBZA 5JDSB 4OZGE 3MLXH 4N8VB 5DJ0A 4TSCH 1MCNA 1NLBH 2AVGA 3QP3A 3RZWA 1LD9A 1EIBA 5EU4A 4CVZB 3NCYS 4PGDB 4HUUA 1ZLUH 1WWAX 2MPAH 2AK4E 1A6ZA 3RX8A 1MFEH 4JDVA 5FYKH 1QZ1A 5D7JA 1BWMA 3QFJB 4OKVB 5D2LE 2DS4A 4ODSH 2VZOA 4KUCF 2JJSC 3ARED 3NCYP 4HPYH 3GSWB 4QRUB 2IGFL 1YEJL 1AO7B 3DURB 2APXA 2FWOB 2CLVA 4DCQB 1QBLH 3G9VA 2Z93B 4XHQA 5H37G 3ULVL 3S5LG 2XNAB 4OV6F 4J4PC 1AQKH 3BUTA 4WWKC 1D5XA 4WY7H 5GS0C 4S1QL 4OD1L 2X4TB 2YSSA 1KPRA 4QRQA 5T1KA 1MNUH 4PJIE 3WS6A 2R2CA 4ISVB 4PGZA 4DOHB 4HXAH 1CGVA 5F3HA 3VFMB 1EFXD 2I24N 1RULL 1FO0B 1ZEAL 4G9DA 4N8CH 4N0CD 1RIVH 2P44B 3G5XB 5EBMA 1GH7A 4KTDL 3ULSB 3TP4A 3KPQA 4Y8AA 1B0RA 2JB5L 2CGRH 3OWEA 5D2NE 5I1AB 1GC1L 4YXHL 1KB5B 5BV7H 5HGAB 3MJ9H 1J7VR 4K8RC 5JNYA 4NQEA 1NCBL 2A6DA 4P5KA 1LO3L 1P4BH 3TNNB 1DZBA 4PD4K 1QPPA 3V7MA 1YECH 3VFRA 3UTQA 4Y89A 3VD4A 1RZKC 5J8OA 1J86A 3RL2A 2IC2A 4QNPF 4L4JA 3MBED 1AKJB 1HQ4B 3AAZB 5MEOA 5AEAA 1P7QA 3QUYA 2ZCKH 3S36X 5F8RC 2BC4A 2HTLC 4LGSB 3FFCA 5EOQL 3DLQR 5CAYB 5D7IB 4QHUA 1A6UH 5GRWA 1FL6A 1AD9A 1QEWB 3FMGL 1SEBA 5DMGC 3VFUB 2EO9A 2H32H 4L9LA 3WKML 3D25A 1F6FB 3LEYH 3EZJB 4HGWA 5IGXL 1FV1A 5A1AA 5T3ZE 1RJZA 2JB6A 3WIFA 4YIQB 5E5MB 1G7JB 4IBLT 4O58L 3QRFM 3T3ME 5CINL 2H6PB 2YRZA 3S36L 3TPKA 1XZ0A 2CLZB 4ESKA 2AV7A 3GRWL 2YUWA 1G9NH 3L7EB 3VWJD 3NOIA 4UV7L 5IUSA 3HE7A 1K6QL 1EO5A 4V1DD 4Y4HD 2BSRA 2NXZD 5C0RH 5GQBA 1N7ML 2CMRL 5EU3A 4HFUL 2EEDA 4XCEA 3ULUE 3WHE1 1VFAA 2VISB 4FZEH 2VL5B 1IGMH 3MLSH 1J9CT 2ATPB 3EKCA 1ZS8B 5I76B 5DSCB 5C0BB 3QIUB 1ZSDB 1AC6A 1XF3B 4QF1B 3SKNA 1NKRA 3BFOA 1SMOA 1YDPA 4OB5L 2X9WA 4X7TB 1UM5L 2AABH 1HHJB 5ABDE 5KTEL 4O51A 3RJQB 4ZUWB 3TN0D 5B3JE 4MLSA 4L4VD 1RU9L 2CDGB 3EIFA 1AI1L 4HJJL 3PP4H 1LWRA 3MOQA 5CMAA 2BVPA 3I02B 2NNAB 4U0RC 3ZE1E 3K8LA 4FZ8L 2ZOKB 3VGHA 3SO5A 1FSKB 5L0QC 4V2CB 1GGIL 4XPBL 4L5FH 3F6LA 3Q6FA 4QRRB 1UKTA 1FGNL 5E8DL 3C6LC 2F19L 2F5BL 3HFML 2N7AA 3HPLA 1QO3B 4JRXD 4J8RA 3IDGB 4P2QB 3GZKA 3K2UH 3VXNA 5HGBB 4PJAA 3UC0H 1U58B 3BIBX 1XF2A 2DBLH 3GIVB 2QHRH 4U6VH 4JCMA 3HC3H 4ZODA 4XCCL 4JPWL 1PYWA 3MRKA 4OGYL 1T5XA 4NHCL 5IW6A 1ONQA 4AMKH 1PD6A 5DHYA 3D18A 2ICES 5FO9B 5HYSB 4UT9L 3MC0A 3KG5A 1Z0MA 3C5ZA 3GI9H 1EO7A 1U8MA 1X5KA 4GRMB 3QDJB 4G9FD 3U0WL 3MOBL 5HVHC 3T0EE 4Z8FL 3RWJB 4NJ9L 5DC0A 5J11C 3TZVC 2OR7A 4DUWA 5DA0B 4JM2C 1F4XL 1RV6X 4NQVA 1MIML 2P5WE 3DSNA 5HY9B 3T0AA 3IU4L 1XCQA 2QQNH 3BYYA 3O6LH 1QFWL 3DETC 2A77H 1OY3B 2IWGA 5LGHL 1KIQA 5D7LE 3STLB 1AHWB 4M8QB 5I1EH 1A4KB 4PB9L 1J87A 1JWUA 3TJHC 2HFFA 1EJOH 5HDLA 1NLDH 3RBGA 2EIZB 4ZUVA 2AJYH 2R1YA 4QHNA 3M1BB 4YWGH 3HLAB 5FUCC 1X5HA 3BRDA 2GTZA 4UIKH 3KWWA 5B38G 5M7QA 1KJMA 2H2PD 4M3KB 1FN4B 4NPYB 2GSGA 2QTEA 2A6KA 5DJCB 3HUJA 3BGFC 4EN3C 5B8CB 1EAPA 3KXFD 4NN7C 1XGRB 1MPAH 1J1PL 2OZ4L 3MLTB 5B38B 3EUUA 2DYPB 1D9KD 3VGEA 4I0PB 5C86A 2AKRB 1J1OH 1Q72L 1IKFL 4OCRL 3FQWA 4L4TD 4BZ1H 3RUGF 2GITB 1DQLH 1ROWA 3MA7A 3KPTA 2WWKT 2FIKB 5A2IH 4X98B 5IFHL 1T20A 2NY3C 3KPOB 5ICYB 1QRNB 4JZJA 1DBAL 4J6RL 4QGTA 1GRWA 5C0EA 1MCDA 1YMMB 5L7XL 4HBCL 2AAVA 5GXBB 3TFKD 5L88H 2RGSA 1FZJA 3BAEH 3FN0L 2Y5EA 1YEKL 4GG6B 3B9VA 1DBJL 4UT7H 2CK2A 3Q3GB 3GMOA 4P3WA 5E24E 3P4MB 2YC1A 4HWUA 3CFJB 1W8NA 4PJ7B 1V3KA 3HMWH 3BHBA 3QI9A 4FABL 2YD4A 3LN5A 4L3ED 3K4ZA 4HF5L 3VXUD 2LABA 4KUZH 4KQ3H 4F15B 1P4LA 3SY0B 4JAMB 1U8OA 7FABL 1IJ9A 2H41A 2IF7A 4ELME 4TNVF 4YDLC 2VLKB 2CK0H 2G9HB 1UA6L 4FNLL 1HIML 5CFHA 3E8UH 1XR9A 1IQDA 5SWZE 4Q7DA 1RZ8A 4G3YL 4OCNC 2Y6SC 2BRRL 1CR9H 5BRZD 1XCTB 3O4OC 3VXQA 4FQLL 3D2UD 4JO1L 4LSSH 1HSBA 3AB0B 5K93A 4LLDA 3CFCL 3VJ6A 4PJXA 5IROA 1F3JB 4NIKB 1IT9H 3QUXA 3D9AL 5C0AE 1YEDA 1YN6A 4APQB 5E7FA 4UT6H 5FA4A 4YFLI 3RGVB 3NCEB 3U9UB 1GYAA 4PRNB 3LD8C 3QIBC 5I15L 1FVDB 4NBXB 5GIRA 2FRGP 5T5NF 5L2KE 4LSQL 1R24A 3MUGA 1KJVB 5HYJD 3FO2A 1E27B 3ARYA 4L8SA 3DMMA 1MF2H 3HRZA 3Q5YA 1KB9K 2EDFA 4YX2H 1XGUB 5IMLB 3MV9E 4LLMA 1XIWB 3QDMA 3MCLH 2FJHB 4KZDH 4JFXB 4PRHA 2B5IC 4H0IA 3HI1A 3MRMB 1KCUH 3X3FL 4S1RL 4M00A 1F11A 1OSZA 4BM7A 3QG7L 4XHJC 4GKOA 5GGSB 1Z9LA 3LIZL 2YD6A 5F7MC 4I5BA 2XTJC 4N5EC 4ELKB 2AJSH 4X5LA 5JR1H 3W5MA 2KQMA 1S9VB 4Y88A 1VHPA 3H2WA 5HD8C 2Q8AL 5D6DC 1OD9A 1DQDH 4MXWL 4C59B 1QLEH 5T1DH 1A4JA 4NWUL 1D6VL 1H3WM 3MRBB 4OF3A 1N5AB 1F00I 2BNRD 3ZE0F 4FQHA 3UZVB 1S78C 3Q6GL 4J3WA 4YFLF 4LHUA 3T8XA 5GHWH 2DKSA 3BRFA 2JTDA 1NQBA 2X70A 3IFPA 3B6SB 3I9GL 4D0CB 3L3JA 4LGRB 4YHOL 5TGBB 2HT4C 2O26U 1YN7B 1JIBA 3CX5K 2AEQL 3OJ2C 3DO7A 1S9YB 4P2OA 1R3IL 1NGPH 1S7XA 2RQ8A 2DLGA 4P4RB 5T1LD 4CL7A 2W60B 2GTWB 4Z7UB 5K59E 4UILL 1X5JA 3CVHL 4MXQA 3ARGB 3IJYA 2UV3A 4X6DE 1RZIA 1BJ8A 4FQXA 4AEHL 3C8DA 3WS3B 4ORGA 3E6FB 1U3JA 2D9CA 1JPGA 2DQJL 1T1YA 1YYML 4R4FL 4W6YB 5BQ7B 1PQZA 3CVIL 4GW1B 5I6XB 5J6HA 3BDBA 4X4XA 1OGTA 3A6CL 3F65A 3R8QA 4YDKH 3MOAL 3BKCL 3U1SL 2J7LA 3RWDB 4LSUH 5LGJA 1CZ8H 3EBAA 1A7QH 4LEOB 2HN7B 1UVQA 3FT4A 3LKOA 2G5BA 1NBVL 2FEDD 5DF0A 4MVBA 3QFJD 5D7JD 1NC2A 5CJXA 1MCSA 4TUOB 3RVUD 4E5XB 5H2BA 4XH2B 1RZJL 12E8H 2VSDA 1UJ3B 1ZANL 2GJZB 4JJ5B 4JN1L 4WU5B 3MXVL 4KMLB 4YLQT 4NZTH 1RK1A 2ZWLT 4DGYH 1MJUH 3E2HB 5EB9A 5HHOB 3BDYH 2OP4H 5EZJB 3KPMB 1M6OB 4GKNA 4AENB 3DV4B 3NVQA 2VLME 5IEKB 3NMEA 5GRZA 2YD2A 4DTGL 5F1NA 5E1AB 5ALCH 5E2UH 3SGDI 4WI2A 5F97E 1H0DB 2R2BA 1L4IA 3BN3B 3VDAA 1OVZA 1JGLH 3L3DA 1WZ1H 4XZUA 2L4OA 3O45A 4PJDB 5DDHB 4LARL 1BQHB 3JTSB 1UYWH 4JN2B 1I4FB 3DYMA 4OZGF 5C2BH 2DICA 4HFWB 4F9PA 2KBGA 2MFNA 5DJ2A 4ZDHA 5JXEC 4F7TA 2XXMB 3CFBA 5EUKB 2DQDH 4NQSA 2ADIA 3CNKA 3LZFH 4OZHA 5DR5L 4IRJB 5JW4R 1GL4B 3O6FA 1UXSB 2XWTB 3FT3A 5BZDB 2IBZY 1NPUA 3L3GB 1P5UA 5T5FH 5IKCB 1XGQA 3N1PC 1X4XA 4KI5D 3RGHA 1OPGL 2DDQH 3GK8H 4A2MA 2XXCB 1KEMH 1LK3H 5D2LF 2VB5A 4LP5A 1S3KH 4U3XA 1XFPA 1XGTA 2NY2B 1JNHB 1FAKT 1NKOA 1NUFA 4XCFH 5ALBH 4MXVE 3U2SA 4J7RA 2HLAB 1I7RA 1D5MB 1WBXB 4RDQG 4Y4FC 5BXFA 3ULVC 4HLZH 1C12A 1LE9A 3NACH 1MHCB 2JIXB 4PJBF 4H0GA 2X4RB 1WWWX 4PJFB 5JW5B 3V5KA 1F6LL 4NNXA 4OCLC 5IR1A 5F9JB 3L6FB 3RVVC 1BFTA 2B1AL 5AYUH 3BZFA 3N9GH 3BW9B 2OCFD 3HNVL 3NCJH 3P9MA 3QUYD 1T1XB 4P57B 1GIGL 1TZHB 3O9WC 5TDOB 4IJ3C 1A6VL 4NC1E 4ZPTA 5I9QB 1CFVL 3FHQA 4CADB 2APVA 1V05A 4P5TA 4ZOEA 1CD9B 5D1QC 4MDJB 3NIGE 1PLGL 4YK4C 2NLJB 3PJSB 1GAFH 2NY0B 4LIQL 3RPKA 3OR6B 3Q5TA 5EC2B 5DUBB 5LJYH 3BKJH 1YNTA 4JRYB 1QKZL 1IAKA 4K2UL 2Z35A 5BW7C 1U8LA 4D9RD 4GAJL 4KVNH 4OLVH 1NLBL 2VDOH 1FFPA 3QXWA 3QDGB 2E9IA 4X6EB 4M1DL 1OD7A 5D93B 2CO6B 2KDGA 5J6GA 2MOVA 5J56B 2X89A 3FO9B 1FYTB 2F58L 5FYKL 3PWLA 3TYFA 1S9WB 4LPWA 4MA7H 2PF6A 3IDJA 3FQXB 3QUML 1TTUA 3MYJA 3SE4C 5L2JB 1KCSL 5ETUB 2OL3A 3AS0A 4ODSL 5I0DA 4QKXB 1N5YL 4PR5B 2P8MA 2E6JA 3AVEA 1RJYB 1F4HA 4AM0B 3C5JA 3BQUA 5E2TH 2R4SL 5F7DB 5HPMB 3AU1A 1AGFB 1A6WH 2P42B 3WFEL 3S97C 3ZSTA 3VI4E 3MGOA 3MV7A 2O61B 4U1NB 1AQKL 4Q2ZB 3WBDA 1OW0A 3BMWA 3C60C 5I8KH 3MODH 2JJSA 4ODUB 4QY8A 4ZUSA 4YEFA 1MCJA 2FECI 1MNUL 4YDJA 3WUWG 4MNGA 1QP1A 4F7EB 3CVHB 2FO4B 1VEOA 4HXAL 4F57H 3VD7A 2X4NB 4Z0XB 4WTWA 4O9HL 3WUWA 4QHKJ 1IM9B 1JVKA 1OT2A 5ID0A 3A0OA 1NEZG 4J4PA 4N8CL 4N90D 4WWKA 5C07A 1FFQA 5KOVC 5DRXB 1NEZA 2CGRL 4HC1A 5TPWH 3MRPB 5BV7L 4R4NC 1YYLL 1Y18A 1NGXB 1NFDE 3HB3C 2MJWA 4KTEH 1JZ2A 2GFBB 4KVCH 1P4BL 1SYVA 5CEZD 5EDXA 4Z7VF 1YECL 4JDTL 1SBSH 2GCYB 4DVBA 4BH8B 3SEPA 4XI5D 4F37K 2P8PA 3KYMB 4ZS6C 3RDTB 2YPLA 1ZA3B 3QDJD 4D0DA 2WUCL 1G1CA 3HTLX 4L4VE 4G6ML 4X0KB 1LHZA 2I27N 2XN9B 3VGFA 1D5BA 5B3JF 2ZCKL 1KULA 2GAZA 5E8EA 1QFWM 5IQ9A 1A6TA 4ZG1A 3QT2A 4LKXA 4HIIA 4WO4C 4XNYH 5GZND 1JUFA 3HG1B 2HJFA 2OR9H 2AJ3B 3WXVL 2BMKA 3OTTA 3ZE1F 4CN6A 1QFUL 1H3PL 2AP2A 1JGVH 5E95B 4AY0A 5GGVY 2VDPH 3DVNA 4AEIH 1CDIA 3HR6A 1UENA 5F96H 3WHXB 4G59A 4JO3L 4PP2A 4N0UA 5KVGL 1C16B 2WMPA 5MP6H 4BH7A 1YJDH 3QEUA 1ERNA 3V0VA 4BJLA 3FQTB 2QQKH 4P2RA 2EDYA 2ZUXA 5GGRB 5A3ID 4AL8H 1G9NL 1A2YA 1NCWH 3C6SA 1AP2B 5HHMB 3MACH 5BOZG 4G9FE 3J8F7 1IC5L 3D0LB 4Z76B 4KPHH 3FZUD 4RBPH 4NDMA 4FG6D 3HNSH 4LLWB 3W9EA 1A3LH 3JSSA 3TV3L 1VENA 3NFPB 5ANMB 3MCKB 2A9ML 1J05A 1X9QA 2HLFC 1DTUA 1FORH 1IGML 4FZEL 1QBBA 4PP1C 3HZYB 4UU9B 3MLSL 2AS5M 4Z6AT 4E0RB 3VDCA 4B5EA 3OSKA 3GMLA 4KK8D 4CGTA 2HYMA 4GW5B 4YE4H 1ZLWK 3TBVA 2J6EA 3DRQB 4H1LB 5DJAA 1W72A 4WV1A 1XGYH 4HIXL 3H9HA 3ZE2F 4BZYA 1T2QL 2AABL 3LKPB 4N9GA 2ZP0T 1SBBA 4P23B 4RQQB 1N4XH 5CJQL 5DHVH 4OZFB 4U7SA 3NPZB 4JZNA 3ZZ1A 2XWJB 1Y0LA 4M6OH 3QI9D 1GZQB 4FMFA 4ODHH 5CCKH 2W91A 5LAXA 3GB7B 4Y4KC 4L5FL 5DQDH 2NY4B 4N8PA 4NCDA 4RGMC 2Z8WC 4L4TE 3GMNA 5H94A 5DK2A 1L7TH 5E56A 3K2UL 3KYKH 3F7VA 4UV4H 2LU3A 4RMWA 1TMCB 2ESVA 3UC0L 1J8HA 3UPCA 2DBLL 2HVJB 2BNQD 3HC3L 4RIRA 3BH9B 4LSTH 4DK6A 3DGGA 3ARSA