1KTLA

The human non-classical major histocompatibility complex molecule hla-e
Total Genus 68
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
68
sequence length
274
structure length
274
Chain Sequence
GSHSLKYFHTSVSRPGRGEPRFISVGYVDDTQFVRFDNDAASPRMVPRAPWMEQEGSEYWDRETRSARDTAQIFRVNLRTLRGYYNQSEAGSHTLQWMHGCELGPDGRFLRGYEQFAYDGKDYLTLNEDLRSWTAVDTAAQISEQKSNDASEAEHQRAYLEDTCVEWLHKYLEKGKETLLHLEPPKTHVTHHPISDHEATLRCWALGFYPAEITLTWQQDGEGHTQDTELVETRPAGDGTFQKWAAVVVPSGEEQAYTCHVQHEGLPEPVTLRW
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system
molecule keywords HLA CLASS I HISTOCOMPATIBILITY ANTIGEN, ALPHA CHAIN
publication title HLA-E allelic variants: Correlating differential expression, peptide affinities, crystal structures and thermal stabilities
pubmed doi rcsb
source organism Homo sapiens
total genus 68
structure length 274
sequence length 274
chains with identical sequence C
ec nomenclature
pdb deposition date 2002-01-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00129 MHC_I Class I Histocompatibility antigen, domains alpha 1 and 2
A PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1ktlA02
3.30.500.10 Alpha Beta 2-Layer Sandwich Murine Class I Major Histocompatibility Complex, H2-DB; Chain A, domain 1 MHC class I-like antigen recognition-like 1ktlA01
5IMLA 3GEWB 1EO8L 5T1DL 1DQML 3RBGA 4ELMA 1BQHA 5FYJU 3TO2B 4X83A 2YPKB 3C5JB 3GBML 5D2NA 1XH3B 3C8KB 5ICZA 4Y19D 2HG5A 3MUGB 1SJEB 5E94B 3MV7A 3M8OL 4IIQC 4MCYB 4S0UC 3O11A 3GMOB 4JM4L 5IMOA 1MCWW 2AW2A 1U3JA 2ZCKH 4H5SA 2YZ1A 5D6DA 4L4JA 3BGMA 3CC5B 3K7UA 4JB9L 3HB3D 1FNGA 3KYAA 3LMJL 3V0VA 4OBSA 3MRFB 3HZMB 1F45A 3FT4B 5GS0H 3AREC 4KVNH 5CKGA 3JUYA 3LVEA 4FTVE 4LBEB 3O4LD 5IHZB 3PWUA 5IVXB 2HP4A 4KJPC 3D0VA 1V3LA 3C09C 4I77H 1G9MC 1I7RB 2BSSB 1GJIA 5CEXB 2CKBB 4LVNC 5HBBA 2ITCB 3ILPB 4X5XA 1RIHL 2JCCA 4ZFZA 4FFVD 4ZUSA 2R0WH 1YEIH 5F1IA 3TO4A 5CMAB 2PN5A 1RSFA 3V6FA 3MACH 4PJHE 1FL5B 3ARPA 1P69B 2X4RB 3PDOB 2PW2B 3NBNA 1CE6A 1HHKA 3NN8A 3O6FC 1EO5A 4O2CB 2V17H 1ORSA 5DFVD 1J5OH 4ZDHA 4D0DB 5IW1A 3U46B 4YJZL 4Y1AD 5GZOC 3OR7A 5LKNA 3O45B 3LIZH 3TZVB 3CSYA 3O9WB 3P0YL 4Y19A 3ZTNL 1W0YT 1VADA 1Z0NA 5CINL 3LKPA 4YFDB 5TDOB 3E3QA 4MD4A 4C55A 2PCPB 3FMGH 1FCGA 3O3BA 3TBVB 1IQWH 25C8H 5SWSE 4YDIL 2PYFB 3LEYL 4QHLB 1IGML 4EUPG 1F02I 2IQ9H 1LP9A 1T5WB 2OSLB 5I71C 1BQUA 2BNQA 1TJIL 4P4RA 3MZTA 4YDJB 2EDJA 4FMFA 4XPHH 3UZEA 5GGTL 4J3OC 1Q9OA 4LDEB 1CICC 3O4LA 3KR3H 2WUCL 4KUCF 2EC8A 4Z7VF 3UJIH 3LKOA 1C1EH 4LNRA 5AZ2L 1FVCB 3O2WL 4KTEH 3TIEA 4YO0B 2BVOB 2QHRH 4M6MH 2DI7A 5CSZA 4DFHA 3C08L 15C8H 3QIUC 4GH7B 4M02A 1DQLL 3HHRB 3SE3A 3DO3A 2CH8A 1OVZA 3MMEA 4LCWD 2V9TA 2YZ8A 2D0FA 4FNLL 1TPXC 3WUWB 1KCVL 3TT1H 5KN5A 2DB8A 4J3TA 2FIKB 4MAYC 3RWEB 4S2SB 4Y1AA 4TSAL 2KL6A 3CPLB 4JFDD 5F8RC 5DF0A 4DW2L 5C70A 3QO1B 3DVFA 1UADC 1XF3B 1T4KA 2CMRH 1S7WB 5KSAD 3V7AG 3BWAA 1FJ1A 2CUMA 5D93B 1LK3H 1GOGA 3TN0C 3CFEB 2AXGB 5GIRA 4R7NA 1QBML 4O58H 4BQ8A 4D0CA 1F3JA 2Q6WA 4HS8H 3RX5A 4I0PB 3QEQD 4WO4C 3KXFB 1K4DB 3CFKB 2X4OB 4ZMAT 3WL9B 4YFLI 2VE6B 4HIXL 1Q0YH 3E0GA 5I1HH 1CIDA 5ESQB 2V2WA 4JFEB 3RI5K 1P7KA 1JPSH 3MXWL 1PGRB 43C9B 1BLNB 3SOBL 1IC7H 3NFPB 3T0EB 2Q7NA 5BZDB 1AKJD 1NFIA 1N59B 1KC5L 4NDMB 3IDNB 4TSCH 5DUML 1G9NH 1J1PL 4OGXL 4YXKL 1YMME 5F7LB 4MA8L 4XAWH 4OLYL 5HGDA 1A14H 4L8BB 2DD8H 3BUYB 4G8IA 3VXQA 4KRPB 5DDHB 4H88H 3UO1L 2XI9A 4JFDA 2CLVA 4RQQB 1QLEL 1FNLA 3FQXA 2Q8AH 2QEJA 2DJ4A 4LMQE 2VH5L 5DZOA 5KSAA 4UT9L 2C3WA 5GZOD 4U6XA 5CEZD 4KTYA 5JQHC 4NZUL 4L8SA 1N3NA 3Q5YA 1VFMA 2L4OA 1RZKC 5IV2B 4F33A 4F7EA 4S11A 1T5XB 3V79C 3QEQA 2IFGA 3ZSTA 3D2UB 3N0PB 5F89B 1GZQA 5L7XH 3D39B 4L29B 5FK9A 3LPWA 4PJGF 4LVOB 3MCKB 5GGQL 2W0FA 3QI9A 4OIIH 5HYSB 2CGRH 4PYHA 2DL2A 4HULB 3D0LB 4GAGH 1OP3K 1YY8B 5IK3B 3PWJA 1KJMA 4QEGA 1HILB 3IYLW 1GYAA 1TVBA 1NCBH 4LHQB 1LEIA 1MY7A 1EDQA 1KTDB 2NY6D 1FFPA 1N8ZB 3RVUC 2B1HL 5TQ2H 4Y4FC 5I17B 3E6HB 1JPFB 1MLCA 2OJEA 3P9LA 1KJ3L 1EXUB 2OL3A 1JZ2A 3VFPB 1MCWM 4LAQH 3DYPA 5HPMB 1CFQA 1EK3A 3UTOA 3BKJH 3QUMA 4NWUH 4NJ9H 1XCQB 2VDPH 1P7QD 3K3QA 5DVKA 5ADOH 4Z7VB 1JPST 2EC9T 3SE9L 4EIGB 3ULUE 4XZUA 2P8MA 4AYFA 5E6ID 4HF5H 4HFUL 1ZS8A 3NIFF 2GW5A 1KIQB 1OAYH 1X5HA 2IPUK 4W70A 1HWHB 5GRWA 2EIBA 4CU8A 2CDGA 4KMLB 1JGLL 1KN2L 3GMLB 5ERWA 3DOSA 1E4WH 3IAGC 4OGZA 4IBLT 3MGOA 2BERA 5C07E 4NZTH 5FO7B 5MP6L 1A02N 4WO4D 2HTKC 5IEKB 5DD5L 2VIRB 3I6LE 1DTUA 4LDLB 2QR0A 4F9LC 3GRWH 1KJ2H 5FHAH 2NX5D 1RZGA 5D72H 4UTAL 1ZVSB 1K6QL 3EGSA 1I1YA 3TF7C 2UUDH 4XAKE 3CLEH 3TYFB 3IVKA 1W72H 1C5CH 2EDHA 5I19H 4KTDH 1XGTA 3ZKXC 3P40A 1U95B 4I1NB 3H9SE 4LASH 4HWUA 3UPRB 2EIEA 1N2RB 5TPWH 5BVPL 4JDVA 3NMEA 2FBOJ 4IRSC 4OM0L 3C5SA 2OBGA 2Y36H 4OZGF 1NGWB 2W38A 1VA9A 4XMPH 1P7QA 3Q3GB 5LWYL 3VD3A 2QLVB 2Z35A 3DXAD 1P7HL 1UM4H 2BMKB 2H9GB 5E6IA 4C4KO 2GSGB 1LE5A 4RGNE 2YBRB 2NY4B 1CFNA 2O5YL 5FB8A 2YPLD 2FH8A 5HI4D 2R2EA 2MNUA 4NFDA 1T1YA 1ZHKB 4KWUA 4HS6A 2J5LB 2HKFH 1LO4H 4AIZB 4NO0A 4QRSA 2ADGB 1AQKH 5EFIA 4HEME 4G7YL 1JYNA 3LEVH 3MREB 1I3RB 2BDNH 3SCMC 4XCEB 2R0KH 3ZKMC 4FABH 3EYFB 3MJ7B 5I8CA 4M61A 1RHHA 4K94C 3U0WL 2CPCA 1A6ZA 3UYPA 1NC4D 4ZSOA 5IROA 3QXUA 4HG4J 2AK4D 1HXYA 1UWXH 3E6FB 4HKZB 2EECA 3CVHH 1DEDA 3BVNB 1UKTA 3KLHC 3V6ZB 5D1ZC 3ZE0F 1NC2D 3TO2A 1BOYA 3C5JA 4Y4FD 3C8KA 3TZVD 2P5WE 1QYGL 3MUGA 1SJEA 1U42A 4PP8C 4PGJA 3BRFA 2M2DA 4QHNB 4MCYA 2FO1A 1P6AB 3DXAA 3P4NB 1PEWA 1YEEL 4URTB 1JL8A 4MJ2A 3TNNB 4I13B 1AHWA 4JFHD 3VG0H 4QCIB 3R0MA 4P3CH 2F8OA 1LO3H 3CC5A 3QJHB 4ENED 3FFCE 4QRQB 2HFGH 5KS9F 1MFEL 3HZMA 2NXYC 1HCFX 4C83B 2XZCH 2J1KA 4LBEA 1AFVH 1T89A 5IHZA 5IVXA 4YIQB 1U8QB 2W9DH 4AENB 2XTJE 4PIRF 4YXHL 2LU3A 1I7RA 3U9PH 3TJEH 5CEXA 2CLZB 2HTKD 3S5LG 3ILPA 2I5YL 1HOCB 1NAKL 3MA7B 4O9HL 5F7FA 1NC4A 5KVGL 5CMAA 3OGOE 4JRWA 4ZNCD 3L3GB 4WENB 4GLRH 2X4RA 3PDOA 1ZAGA 2PW2A 4BZ2H 2K7QA 3WO4C 1CR9H 4O2CA 1IGFL 4QKXB 4GRMA 3U46A 3SDAB 4XX1E 1QLFB 3LSOB 4PJ5B 4NQCD 3SGKC 1BVLB 3TZVA 1CL7L 3TV3H 2V5YA 3BYTA 2VLJE 4MXQC 2EE9A 3NOIA 5TDOA 1MRFH 3C6SB 3ESUF 1FDLL 5KG9B 4IMLB 2PCPA 2PTTB 3NCJL 3TBVA 3FOMA 4XMKH 2XQBH 5DUPH 1MHCB 1RZ7H 4TRPH 2IGFL 3VFNB 1IKNA 3I3EA 5D70L 5KJRL 1T5WA 2BFVL 2OSLA 3ISWA 4GMSH 2BOCB 2DJSA 1FE8L 5HHOE 5IGXH 4JM2C 1EMTH 1SYSA 4NHCL 3RKPA 4XNUH 1JPGB 4YHPB 1F3RB 5EUKB 1BF2A 1R3JA 4OZGB 4PBXA 1AIFB 5IMMB 4LP4A 3ZDXF 1TXKA 1OAQH 1F4WH 1TTGA 1MRDH 3DI3B 3GHEH 4YO0A 2BVOA 3WKMH 4ODHL 2J4WH 2FB4H 2XKUA 3MJ6A 4K7FB 4MX7B 2OMNA 4DGIL 1BFOB 3ME0A 3PQYB 4ZO7A 3IDGA 4J3WA 4LSVL 2QSVA 1VPOH 3ZKMD 3MRBA 1OPGH 3VWJC 1CVSC 5HHNB 3WUWA 3HA0A 2QQNH 4QXUH 1JWMA 2IQAB 2FIKA 2QL1A 3CU1A 4KRPD 3RWEA 4S2SA 3ZDZE 1RI8A 3M07A 3CPLA 4NQCA 1U9KA 2E7LE 2IALB 3QO1A 4JFXB 1XF3A 1S7WA 3KPMA 1UB6B 5D1XC 3CFEA 2VSCA 5DEGB 5EULV 5J12B 5GRVL 2X70B 1SEQL 4AQOA 3AROA 1FYTB 1MCDA 4KXZH 4RFNB 3PL6B 4I0PA 5ELIA 4XB8A 1KCSH 3KXFA 3D39D 3WL9A 2VE6A 1UGNA 3RVWC 1UWGL 5ESQA 1NCCH 4JFEA 3G6JA 3DVGB 43C9A 1LO2H 4ZYKA 1BLNA 1ZGLA 2H1PH 3F8UB 3VXSE 1FO0L 5H37G 4GXVH 5C92A 3SDYL 1ZMYA 3NFPA 1OB1B 3RY6A 1WWWX 4PBVC 1UZ6F 5DHXB 1N59A 1PVHA 5IIEB 4QNPE 5L8KB 1MFBH 3IJSB 3OAZH 3GMRB 4WTXA 4HCRL 5DJXB 2HJKA 3ULVE 1WZ1L 4L4VB 3TBYB 3GMNB 1YEKH 4KQ3H 5E2JA 3T4YB 3V4VH 3BUYA 4BQCA 1ERNA 5KS9B 5DDHA 3GSVA 4QY8B 35C8H 4L1DA 1FIEA 5E9DD 4XP6H 5B38A 4G8EB 1CGSH 5FUOH 1CXHA 4RQQA 1OP9A 3SPVA 5F9DC 2MWCA 4G8GB 2ZWLT 5L2JA 4ODUA 4OCXL 2F54E 4UIKH 1FFNA 3A6CH 5DJZA 5IQ7L 1R3KA 2MKWA 1REIA 3D3VD 1W8NA 2VDNL 1KBGL 4OQTL 5L2KE 1KTLB 3QEUB 3OZ9H 4HZAA 5DRNB 5EZJB 1JGDB 4OF5A 1DANU 3D2UA 5F89A 1J8HB 2DQFB 3D39A 5LXGH 3FCTA 4OGYL 1IGYB 4OSUH 5CZVH 1KYOJ 1PKQB 5HYSA 1PSKL 2HMID 4R4NC 1B2WH 2BVTA 5I8KH 4LDOB 5D7JC 3D0LA 3H42L 2APVA 4U4BA 4GRWH 1P84J 5E7BA 1YY8A 1MIMH 1G9MH 4HWZB 1KXTB 4U1LB 4DKDC 1HILA 1CFTB 1NBQA 1QA9A 5M94B 1KTDA 1A7RH 3SGJA 3UC0H 2J8UF 1AO7E 1N8ZA 4PUBH 3TJHC 1TETH 5I17A 3QUMH 4JFZH 4M5ZH 3L7EB 2CSPA 2OZ4L 1EXUA 2GITB 2NZ9D 4B41A 2VRAA 3ECBB 3VFPA 1YC7A 3IF1B 5E9DA 2C26A 1ORQB 1RUPL 2XKSA 3QWRA 1JTOA 2VITA 4FFWD 1XCQA 4WFHE 3U4AA 1ZT1B 3U30B 3T2NL 3O2VL 5F97E 4Z7VA 2X9XA 5IVZB 5E99H 5IESH 2C5DC 4WTWA 3KS0J 3QPQD 4QRPB 3D3VA 2NMSA 3BZDA 3HNTL 4JY5L 5IB2B 1QSFD 2W9EH 1GGYA 2BRRH 5BV7H 4N8CH 5D1XD 5KANG 2XZAL 4HPOL 5KSBF 1QNZL 4GKNB 3EYUL 3NTCL 4GJTB 3UBXG 2X4TB 1SM3H 3MRDB 1IEBB 3O81A 5IBUB 5FO7A 2YD3A 4MJ5A 4LSQH 1H5BB 3I6KB 4ZQKB 2IEPA 1VB9A 5FM5M 2VIRA 1QP1A 4JO3H 4ONGH 3QWOB 4AEEA 1P4BH 5JUEL 1ZVSA 1VERA 4QOKB 3RTQB 5FDYA 5FECB 3WHE1 3MV9B 1D5IH 2H2SC 1U95A 1CTNA 5EA0H 1GGCL 3QDGB 3UPRA 1N2RA 2RHEA 4AEIL 3QHTC 5HI3C 3MOAL 2XZQH 3MRHB 1GC1C 2ZPKL 3LDBC 3DRQB 1V7MH 2F58L 1OARH 4BSWB 2EDBA 1F42A 5D4QA 2X42A 1NGWA 1G9EA 1A21A 4ZFGL 1CK0L 2QQKH 3F7YA 3Q3GA 4G8FB 3O3EB 1GH7A 1JGVL 1HINL 5HHXH 2BMKA 1UACL 1H8OA 2H9GA 2VAAB 4IM8A 5CIPA 4H8WH 1AJ7H 3AFLA 1FO0B 1I85C 4WV1C 1QSFA 1R5VA 3S3JA 2RGSA 3WIIH 2O5ZL 2GJ6D 1FNFA 1ZHKA 4MMZC 5LGJA 3HPJA 2AK1L 1FV1B 1DN0A 4AIZA 3IGAB 5FV1L 4OM1L 2ADGA 2HH0H 2ZNWA 4RGOH 4LLMB 3V7MA 4PJDE 1JHLH 3KPRE 4S0TD 1I3RA 3BUTA 1NUNB 1KCGC 4O02H 4R4ND 2JTDA 3MTRA 2NR6C 5L6YL 1PBYA 2EH8H 1DZBA 2QSCL 3IS1X 1JYWA 3D5OF 3KPSB 5J0BA 1YPZE 2AJ3B 1QEWB 3DO7B 3E6FA 1DUYB 4HKZA 1G7LA 3L7FB 2O26U 4I4WB 3V6ZA 4O2EB 1BZ7B 2HT2C 4NQDD 3PWNB 2D31A 1RUQH 1CF8L 3AU1A 4R90L 4MA1C 5JPNA 4KPHL 4PJGA 3OJ2C 5DJ2B 1NSNH 3STZA 4ETQB 4QHNA 1RJLB 3ZDYE 4NUGL 5BOZG 5DR5H 4KGLA 3DGCR 1JZ7A 3SBWA 3TNNA 4KK6C 4Q0XH 5ILTL 3SKNB 4QCIA 4Y4HC 3R1GH 3U4BL 3HI6H 4GG6F 5D2LE 2J8UB 2R23B 2GJ6A 3LZFL 1R3IH 4HV8A 4QRQA 2MCPH 3TPUB 5FO9A 4N1EA 1S7QB 4C83A 3MROB 3SHSA 4YHKH 1BFTA 5KVDH 5MI0B 1MELA 1V7NH 4YIQA 4Z78A 1K9TA 3MR9B 3IJYA 2CO6B 1OM3L 1DL7H 4RDQG 1BEYL 3S35L 3HNVL 2JB5L 1NUDA 1D5MB 1KCRH 2GK0B 1OL0A 3BPOB 1O0VA 1BQLL 2E9BA 5E2TH 5IMKB 1XCTA 3WD5H 2UYLA 4FRWA 3L3GA 3WJLA 5K9JL 3MLRL 4PJ7E 2VL5B 5KSBB 1G7IB 3NH7H 4OZ4A 1UXSB 1QLFA 3VFOB 2XFXB 5BZWB 3LSOA 4PJ5A 1OTTD 1BVLA 1FGVL 5D7IF 3W81A 1I8MB 1UCTA 1P5UA 2K9UA 3T3ME 2L7JA 2YKLL 1HYSC 3NPZB 5DRXB 2Z91B 3C6SA 3NPSC 1ZLVK 5GISL 5KG9A 4IMLA 1EHLH 3JV4A 3QDMD 1MJ7H 2MFNA 4BKLB 4WI5A 1A7QH 3JWDC 3QDJB 3EJJX 2ITDA 2JK5A 3FKUS 1IBGL 2BOCA 2H6PB 3A6BH 3DSFL 5JW3H 2A38A 1FFQA 3QIBC 1IM9B 1SEBB 5J13C 1IGIH 1LD9B 1EA9C 3VDBA 5ACLA 1NMBL 5EUKA 4OZGA 3G04B 3GI9H 1AIFA 5IMMA 1F97A 1E28B 2B2XL 4XNMB 1R5IB 1F4AA 2W92A 1UZ8B 4V1DB 2W0KA 5DI8B 4NO2A 5DVMA 5CBEB 4K7FA 1JUFB 4JFYB 4PY7B 4NC0B 1BFOA 3CZFB 3AREB 4XPFH 3P0VL 2HAZA 2DYPB 4BELD 4EI5B 4I8DA 2I25N 2F19L 4M7LL 3BT2H 5DZNA 3C2AH 5D7LE 2E8ZA 2IQAA 3E8UL 3AMLA 1RZKL 4Q9BA 3HI5L 3VMNA 3QCVL 2IG2L 2IALA 4JFXA 4JG1L 3KHQA 4G8GD 1OW0A 4OF0A 4WY7L 4JLRA 2O61A 1WAAF 1UB6A 4NT6B 5DD0L 3O6FB 2UWEA 4UMGA 1FYTA 3NCEB 5ICXB 1KG0B 5F44A 3HTLX 3PL6A 1JNLL 4NKOB 4LKXB 2VR9A 3QUYD 4HIEB 1MI5E 1UENA 3SDCB 4JZOB 5C09B 1DQMH 4N68A 5A16A 3GBMH 1OSPH 1OAXL 1GGTA 3M8OH 3HG1E 3DVGA 4KHXL 4NKIH 4JEGB 4PJCE 2OI9A 3KJ6L 1NJ9B 1OB1A 4ONOA 5I71B 5EB9A 2QADC 3EOYG 4N0UE 1AR1C 5IIEA 2ARJQ 4K94H 5C6WH 4X7FC 1NEUA 4U1MB 4JB9H 1ND0B 3IJSA 1CICB 3GMRA 5DJXA 4GG6B 1A3RH 4YPJA 5LVEA 1SQ2N 3T4YA 4FZEH 4Y8DC 5KS9A 5CJXC 3MODL 4G8EA 4OFYD 2QTEA 4PGDA 4HKJB 3WS3B 1CLYL 1MCCA 1Q9LA 3O0RL 3FRPG 4G7VH 3RWIB 4G8GA 5INCB 1I9EA 4XCCH 4WFFD 3N85L 3B9KB 4U0QB 3DUSB 4KDVA 5IHLB 1HYSD 4MAYB 2QKIA 2C3XA 5TDNB 1X7QB 3C5ZB 4N90D 4TQEL 2NY3C 3BZ4B 1KTLA 4PYGA 5D1QB 5DRNA 3QUYA 1IGTB 2BXYA 2HLFC 4PB9H 5DEFA 1YJDC 1IGYA 1LO0L 3KPPB 4DGVL 2AERT 3TN0B 3P0YH 3RI5F 3D25A 1KYOK 4PJIF 4XPAH 1AR2A 5D7IB 3ULSB 1I3VA 2QBWA 1WBXB 4LCIL 4HWZA 2QHLA 1P84K 4U1LA 2Z8SA 4PLNC 4CN6A 5JHDB 5E2WL 1CFTA 4OGAD 4HUUB 4QOKD 3RTQD 1JF1A 1CD9B 2A83A 3MNVA 5ID1B 4W4OA 3RWGB 3QDGD 3HC4H 3L7EA 1V3MA 3SO5A 4C4KT 3ESVF 2GITA 3ECBA 2OS7A 2GTZB 1FC1A 2EDYA 3MRCB 4WW2F 5CD5C 4CL7A 4OFYA 2N7BA 3H9HB 5C0CE 4LHUB 1N6QH 1ZT1A 2X05A 4QRTB 5T1MB 2LU7A 2VLRE 1SY6L 2YD7A 3BN9C 5IQ9A 5IVZA 2PETA 4LQ1A 1K5NB 1NMCB 1NEZB 2J88L 4KZDH 4BZ1H 4NNXB 2XA8L 1CGTA 1A8JH 1S9KC 1RFDL 3NA9L 2OLDA 3T4AA 3MZGB 5F1OB 3PGDB 2X4TA 4XP4L 4MLSA 3MRDA 1IEBA 5DRWB 1FSKC 1E4JA 3JTTB 3O6ML 4WI8A 1IAMA 5ANMA 3I6KA 4FQLH 4ZQKA 1BOGB 5HGHB 1BJ1H 2HRPL 3H3PL 3C60C 5F3HA 3KPQB 2A1WH 3F6LA 2EYSB 3JV5A 3GI8L 4QOKA 1A7NL 3RTQA 3OQ3B 5FECA 3MV9A 4AZ8A 1QBBA 4TULH 1UYWL 2LE9A 1KEGL 2QADD 5A2JH 4MDJB 1CT8B 5TH2B 3QDGA 1JZ8A 1E6JH 4XP9L 4XTRD 3THMH 3QCTH 1MFDL 4NKQB 4O5LL 1ZKAA 1RMFL 3DRQA 1MAMH 3WFBL 2IBBA 3RWCB 1GRWA 4BSWA 3SOBH 5CIPH 4DZ8B 4PGCB 1XGQA 3VH8B 1YN7A 1X5XA 1A4JB 5ECJE 2GTWB 4PJAE 3O3EA 1EHNA 4EDWH 1LK2A 1YNTB 3BD3A 4JKPH 3ULUF 1R3LB 1CG9A 1KEML 5J3HC 1OF2B 2P48B 4OLYH 3GUTB 1I9RL 2AJSL 5L9DH 5DMIL 1I1AD 3L3DB 3EO9L 3MUJA 1FV1A 4HCRA 5EZLB 3VXTB 1MCPH 4CMMB 2M1KA 3EUUA 2XOTA 3I84A 2XQYK 4M1CD 2EXWD 1TVHA 3OKDB 4LLMA 4HX1A 4MB3A 4PRPE 4KU1A 1FQ9C 3LS4H 2I26N 5I1AB 2E7HA 3IU3A 4WJ5B 3LQAH 4NZUH 4RAUA 5HD8C 4XC1H 1Z9MA 1FNHA 5KW9L 1ITBB 3CAFA 3KPSA 2R69L 2OQJB 4GKSB 1D6VH 1QEWA 1B0RA 3DO7A 2LTQB 1RULH 2DM3A 3WJJC 3VXRB 4OV5A 3L7FA 4I4WA 4KDTC 3W82A 4O2EA 3PWNA 4MVBC 3MLUL 2ED8A 3VD4A 2EEDA 3QSKB 5DJ2A 3BAEL 3WYRA 3GB7B 4NZRL 5IHUL 1NLBL 3ZLQC 4ETQA 2BNRD 1F2QA 1LDSA 4PJIB 3I9GH 1RJLA 5HHPB 3ARFB 2DOCA 5BRZE 1MLBB 4L4TE 4I18C 4JM2F 4QRUB 4ZOEA 2VDLH 1MQ8A 3SKNA 5JOEA 3BN9D 2I9LB 4CKVX 3QDJD 1VGEL 2R23A 4S1RH 3WSQL 1OQOA 3JVGA 1I1AA 2GAZB 1HWGB 3DECA 3TPUA 2ORBL 3RL2B 1S7QA 4Z7NF 2G9HB 3MROA 4ZODA 2JJUA 2EO9A 3QBTB 4WW2B 1B3JA 1EJOL 2ZUYA 3MR9A 2X89D 3VFUA 3LS5L 2CK0H 4MLIA 2GK0A 1HZHL 2YA1A 4X99B 1NGQL 2E27H 2DYPD 5IMKA 4EI5D 4MD0B 3WNLA 2DQEL 2FR4B 3FQRB 3K81A 3OKNB 3VU2A 3WN5C 1SHMA 2VL5A 4TNWF 5KSBA 3SCMB 3EFDL 3VFOA 1UXSA 3QXWA 5BZWA 1Y6NR 4U1GC 2MQ3A 4U33A 3ZT6A 1F8TL 1RK1A 2BNRA 2XIDA 5DJAA 1RZ8B 5DRXA 1DLFH 2Z91A 4TUOB 1JGUL 3EDKA 1EO7A 5MENE 1CL7I 1IVLA 1ZEAH 4BKLA 4ELME 3B3IA 3MCLH 3QDJA 4OIBA 5D2NE 2D7PA 5I74B 4G3YL 5CGYC 1WQVT 2A77L 3B2VL 3MV7E 5J3HD 2MHAB 5E08L 2JJTA 4YHOL 1SEBA 1BD2B 5ALBH 3ZYJA 1KPRB 4ORGB 3LV3A 2C9AA 1VFOA 5T3ZL 1BMGA 1AGBA 1E28A 1CQKA 4RISL 3BD4A 1R5IA 4WUUD 4YUEL 5FGCB 4V1DA 5DI8A 3MA9H 1DJSA 3AXLB 4JFYA 4PY7A 2NXYB 2V5MA 2EH7L 1BFVL 3CZFA 4G5ZL 4MNGB 3JWNC 2OYPA 3U6RB 4S1SL 1S7SB 1NCWL 5MHSE 2DYPA 4EI5A 2IFFH 1OP5H 5HD8D 1HNGA 3PGFH 3K2UL 4P57B 3L5HA 2X5PA 2AAVA 1DBMH 1AXSB 3EOBB 3AAZB 4D8PB 1NGYB 1Q94B 1KPUB 2VLKB 3MLVL 3B8SA 5HY9B 2HLAB 2JCCE 4ZTPL 2DMBA 4IJ3C 2Y07L 2DQDL 1INEL 5JR1L 4CVUA 2E6PA 5C3TA 1LWRA 4JHWH 4KKCC 5JPMB 1QUNA 4PRIB 3C5ZD 4XCNA 4PR5B 5ICXA 1KG0A 1A3LH 4NKOA 4HIEA 2FGZA 4HWNA 3SDCA 4Y19E 4P99A 4N8VG 4JZOA 5C09A 4I48B 5DD1L 3CFBB 4KHTH 1KPVA 1U8KB 5CD3B 1KJVB 5I75B 4GW4B 3P30H 2XV6B 1MCHA 3LRSB 4D0BB 1AP2B 2EIZA 3F58L 4OTXL 3IETB 3IFNL 4GT7A 3FOLB 4JFFB 2DL9A 1K8DA 1NJ9A 3FN0H 3NABH 1RZJC 3TCLB 3U1SL 1YEEH 2VXUH 3FTGA 3FFDB 1IAIM 3MX0A 1LP9E 4W81A 3KYMB 5IWLC 1JMXA 2AJYL 2BNQE 2LVEA 3BGFB 4ZXBC 5IBTL 2Q86B 3QG6A 5E1AA 5KVEH 3AB0C 3OJMB 4JM2B 4U1MA 1ND0A 5FA4A 3W9DB 3WHXB 4GG6A 1LQVA 3O4LE 1A7OL 5JQ6L 4G9FB 3VE0A 2QJDA 1H15B 1WF5A 4R3SB 2VLME 1V3JA 2J12B 3T3PF 5HYQA 2IANB 5F3BA 1IAIL 5EU5A 2DLIA 4LHUD 4HKJA 3IDUA 3WS3A 4DWHA 2JJSC 3BJ91 3RWIA 4OI9A 5INCA 4Y4KC 3B9KA 3ZHLA 1BAFH 3N06B 2WWKO 5KVGH 1H8NA 5TDNA 4M1GL 3C5ZA 4Y1AE 5D1QA 1XF5B 3BZ4A 5E5UB 2DTML 2V2XB 5F9OL 4HBCH 1UT9A 4Q9RL 2MCG1 4WCYH 3AM8C 1U2HA 1MCEA 1D9KB 2ZKHH 2NY5H 3KPPA 1SMOA 4ORZC 1VEOA 4HIIB 4WI6A 5FDWA 3EYVB 1CL7H 3G9AB 5D7IA 2DQJH 1GC1L 5FV2A 4PB0H 2A74B 2AJVL 2Y6SD 3IJHB 3ARBC 3VXPB 3VGFA 2V5RA 3TYGL 1EGJH 3RAJH 1IC5L 4J3VA 3BH9B 3UDWA 2FATL 4DAGL 3RWGA 4UOW1 4PRAB 5I15L 5SWSD 5DLML 2GTZA 2DWDA 2VZ1A 2FECL 1MFNA 2RIKA 4QRRB 1S3KL 1S9WB 3EO1A 3H9HA 2CR6A 4MNQB 4LHUA 4ODWB 3S36H 4CJ1A 2AV1B 5T1MA 1F6LL 1XIWC 2GFBA 5CJQL 1JWUA 5EBLB 5EU3B 1EFXB 1K5NA 1NAML 3W39B 3OJVC 1NEZA 3K4ZA 2YK1L 4NNXA 1RUMH 5EC1B 1GZPA 3JWDH 5EO0B 4QTHB 1U93B 2YUWA 2H32B 4JFDE 4U6VL 3LKSB 3MRRB 2OP4H 3PGDA 3QNXB 1CXEA 4WHYH 4ODBD 1NFKA 4FQJL 3VGGA 1UVQB 5DRWA 3JTTA 1TJGL 3FAWA 4PJHA 4P2OC 4IRJB 2HA1A 1MCKA 2NY2C 1BOGA 3CX2A 1X6LA 5HGHA 4KKLD 1NLDL 1DQJB 2FHFA 4KY1L 2PF6A 3KPQA 3QEQE 1EAJA 1TCMA 2EYSA 1WAAA 4GMTL 2XN9E 1I1CA 2YXFA 1FAIL 1XF2B 1DBAL 2WBJC 5DURD 3UJTH 4MDJA 3ZHKA 3CNKA 4WNQB 4Q9CA 2YN5A 2JKXA 4PFEA 1JHTB 3EOTL 1JMZA 1Q0XL 3DHJA 4DZ8A 1IL1B 3VH8A 3BPLB 5CFHA 2AJZB 1RZFH 4G6MH 5AG8A 2B0SH 4OZIF 4R4FL 4X7DC 4KV5E 1FCCA 1R3LA 2FBJH 5LBSL 2Q1EA 2XKNB 3RY4A 1HIML 4PBWD 4Y4KD 1L4IA 3FO2B 5ACZA 2OTUB 1RIVL 3GUTA 3EFFB 3HZYB 5CZXC 3L3DA 2VN7A 4YDLC 2VDQL 5EZLA 4CMMA 4ZUVA 4GAJH 2X4PB 4K8RC 4D9RE 2X4SB 5EUOE 5CUSL 1E4XL 5F7DA 1Z3GH 5I1AA 2RCSH 1GOFA 1FNEB 5IQ7H 1HE7A 3JV0A 3B43A 3ZTJH 4RGNC 3S98A 3UTTB 3NIGF 1KBGH 1G7JB 1JFQH 4DKEL 1T04A 1U8HB 1OY3B 3CDGA 1OGTB 1BREA 1FZMB 4M3KB 1A6UL 5IFJB 3CSPA 1JZ4A 2D03L 4FQCH 5K9OB 2D4DA 3VJ6B 1A5FL 3MPCA 1U8MA 1BQSA 3DMMB 3CU7A 3GFUA 4LU5H 4JO1L 3QXDB 2C3GA 1CLOL 3NZHL 4GQ9L 1L9MA 1UJ3C 1ITCA 4QYOB 4M7JL 5HHPA 3IB4A 2GY5A 4PRHB 3ARFA 5IFAH 5IEHB 1T7XA 5ALCL 1MLBA 1XGYL 1WCBB 2Z8WC 2ZCHH 5F6HI 5J6GB 3RIAK 4CADB 4QRUA 1XIWD 2ZUWA 4NKMB 5TFSL 2UZIH 3GSNH 3IRZA 3L95B 3REWA 4M6OH 2GAZA 5MEOB 1UM5L 3PHQB 1FIGH 5T1KB 4FFYH 1GVIA 3RL2A 2G9HA 1AY1L 1TQCC 4NM8L 4Y0GA 1NGZB 1BD2D 4P2QB 3O2VH 4WW2A 1INDH 4HXAH 4XPGL 5JMOC 3LHPH 4QHUB 2VDRL 4MAUL 1A6TB 2NY2D 2EO1A 5BOPA 3QHZH 4OLUH 1TIUA 4LIQL 1AI1L 4X99A 3ULUD 3ARXA 1NAMB 3S37L 3MLTB 1KACB 4MD0A 2FR4A 3FQRA 1QNZH 5TQ0L 3OKNA 3H9ZA 4FMKA 4YX2L 4R26H 3S96B 2ICES 1T2QH 1IAOB 7FABL 3R06B 2XTJC 3TP4A 2D7NA 4ODVH 1XGPA 5A1AA 2ARJB 5JA9A 2HVKA 1UJTA 1RZ8A 2C1OB 4MGXA 4LRIA 1I9JH 3VFRB 1A3QA 4TUOA 5GRYA 1OAUL 1GHFL 2P8PB 1I8LC 5DGQA 4PS4L 3ARDC 3O3UN 4PRID 1KLUB 1BVKB 3KPLB 1I8IB 4XAKD 1OTSD 5C2BH 2AI0H 5F6IC 2WUBH 2VDKH 4JRXB 5TE7L 3ILQC 4X4XA 4M5YL 3H9SD 3CD4A 4HJGB 1MPAH 2XA3A 1RUAH 1D6EB 3QPXL 4KROB 2NTFB 2OR9H 4ZFGH 1BD2A 1CK0H 1FPTL 2R1WA 5CJOH 5CZXD 5DJ6B 4ORGA 3T0WA 4PJ9C 4YK4C 4Y4HB 3NAAH 1T0MB 5ISZB 5DQJB 1UACH 2A9ML 3L6FB 4XNXL 4D9QE 2E9IA 4G80B 5GRXG 5BO1H 1U8PB 3AXLA 3RY5A 2E7BA 1L7TL 1YYML 4MNGA 4OZIB 1S7SA 2VISB 2ZUVA 1NBVH 3E2HC 4OCWL 4WFGD 5IVXE 5AD0B 2R0ZH 4OM1H 1H0DB 3EOBA 1AXSA 3N50A 4GSDH 3AAZA 5E5MB 2PXYB 1MAKA 3MRLA 4JZJB 4D8PA 5FXCH 1Q94A 2VAJA 4PJXF 1KPUA 2R56H 2R4SL 4HJJL 5HY9A 2HLAA 1YJDL 1X5FA 4FOMA 5DVOA 4LOUD 2X1OA 1T83A 3WFCL 1G7PB 3TH4T 1A9EB 3DIFB 1DBKL 1WCQA 4JKWA 2DDQL 5HGAA 2DKUA 5C0ND 2XNAB 3I6GB 5JPMA 4PRIA 5DD6B 2P49B 3DX8B 3V5DB 2VC2H 3NIDE 3F5WB 5I6XC 1IGJB 2WINB 3ZKNC 4I48A 3FQNB 4ONHB 4R90H 3CFBA 4HQQH 3H9SA 1U8KA 1AC6A 5CD3A 1VDGA 2E7LC 3VA6A 3LRSA 4EN3B 4D0BA 1AP2A 4DN4H 2M26A 3V4UH 3IETA 1KIPA 2CUHA 2Q76A 4WU5B 1W0VB 4NNPH 5I1JL 4JFHE 1B0GB 4ZFFA 3FFDA 4HH9B 1YY9C 3KYMA 2VDOL 4ZAKC 3U4BH 2Q86A 4ODTL 5J13B 3MNWA 3G6AB 4M7ZC 5JOFA 4N9GB 3WHXA 4ZUUB 1IMHC 4G9FA 3GNML 2VN4A 1H15A 2DTSA 2ZOKB 4R3SA 4QHKI 4QRRD 2DJUA 1AXTL 3DURB 5FGRA 3TPKA 2AQ1A 1T2XA 3L3JB 3S35H 4H1LA 2BHUA 3HNVH 4X7SL 4NFBA 5EOQL 1MQKH 2APWA 1QD0A 2XTJD 2D7MA 3TEUA 4H20L 3VXUB 3ULVC 1XF5A 3S5LB 3DVNB 2FGWL 2BNUB 1OTUD 1D9KA 2DS4A 4NQVB 3SDXF 5L88L 5I1KH 1JYXA 4MD5B 3OGCB 4PJ8C 2VUOA 4IRJD 3BE1L 3EYVA 1Y18B 2YKLH 2X9YA 4JO4H 4WI7A 2EDDA 3W11D 3IDXL 5J6HA 1CGVA 1C7SA 3ARSA 4PJCF 3QXTA 1OLLA 3IJHA 4PJBB 4XVJH 3VXPA 3KXFE 4PJ9D 2FX9H 5C8JB 2AGJH 2VLJD 4M9PA 4ZOCA 2YEZB 3BH9A 5E56A 3OKEB 4D2NA 1YEHL 3L5XH 4JFEE 2I24N 2VKWA 3QRGH 3L1OH 5FYKD 1UA6L 3GM0A 5EOCL 4QRRA 3T0EE 1S9WA 2B5IC 3T0XA 5TE6L 2Y9RT 4G6JL 1RJYA 2JB6B 5TDPA 1IGCL 4OD1H 4MNQA 5I1EL 1WV7T 4R2GC 4WU7B 4R97C 3GSRA 1P9MA 1HKLH 4PY8I 3CCHB 3HAEB 5EBLA 5EU3A 4AM0B 4D3CH 3PHOA 1U8LB 4U6TA 4H0GA 5EC1A 1GOHA 4XGZB 3GJFK 3QUZC 5KTEH 1DUZA 4LLQB 4M7LH 5EO0A 4QTHA 1U93A 2H32A 4K7PL 3MRRA 1I7TB 3ARGB 3LKSA 3QNXA 2C1PB 4POZD 2P42B 4XNYL 4D94A 5ITBL 4G6KL 1GGBL 4IRJA 1LMKA 4O2FB 1ZLSL 1A6PA 3MLWH 3NZ8B 3ZKND 4PJXB 5CLWA 1KIRB 3EOAB 3H0TA 1A6WH 1DQJA 3VGBA 4XPBH 4JR9H 3QQ9D 1XEDA 2LVCA 5J89A 4IDJH 3UTTD 4WW1B 4OFDA 3D39E 2VLJA 1O7SA 1QTYT 1XF2A 2CK2A 3JBG7 2EKJA 5F7KC 2BOBB 4RCAA 1YNKH 3IFPB 5LQBL 2H2PC 1ADQL 1VACA 4XNZC 3EHBC 4NNYB 4WNQA 1ZLUK 3FONB 1J10A 1OAXH 5GZND 5IB3A 2R4RH 4AEHH 5FYJL 2IH1B 1CBVH 1IL1A 3KJ6H 3TWCL 4P46B 4QHMA 2Y06L 4L8DA 3BP6B 4NJAL 5HDOA 1U6AH 4UINH 3G6DL 5F9WC 3VXSD 5HHMB 2A0LC 1UC6A 3P77B 2FCBA 2FIRT 3FO2A 1KTRL 4OFKA 4OI7A 2OTUA 2R9HD 3EFFA 3I50L 4YWGL 5EO9A 3RDTB 2MOVA 3PV6A 4LVHC 1RHFA 3VXOA 4KRMB 4Z7VE 5E7FA 2XRAL 4ZTOH 1UM6L 4U0RC 1CIUA 1M7IA 4P2QD 4YHLL 1CLYH 3UAJC 2RB8A 2X4SA 3BIAX 1OGAB 1R6VA 4JZNB 1FNEA 1DQQB 3UTTA 1G7JA 1F4XH 1FSKB 4HLZH 1F3DJ 1J1OL 1QFUH 4R7DB 3JWOH 3OKLB 1U8HA 2P45B 3QIWD 1OGTA 3T2QA 3SKOB 5CP7B 1FZMA 4M7LT 3WCYA 5AAMA 5I1DB 1PX4A 2FWOA 2CIKB 1F2XK 3PDGA 3DMMA 4S1QL 3KJ4B 3NVQA 3SDXB 1MIEH 2VUYA 1PYWA 1JVKA 5EBMB 4WWKB 4QYOA 2WQ8A 4JREC 1J9CT 4PRHA 1GCFA 5IEHA 4KAQL 5E8PB 2FD6H 5C7XL 3X17A 5J6GA 1N4XH 1PLGL 3UJJH 2B39A 2Z8RA 5IR1A 3GMPA 3O2DL 4HLJA 4NKMA 5D71H 1JIBA 3ZT5A 1QFWM 2ADJB 3L95A 3Q5TA 5MEOA 1G7MB 4ISVA 3ZMRA 1WWBX 2WV3A 1AO7D 4JRXD 5T1KA 3RNQB 1BQHG 1IAKB 1NGZA 1GAFH 4P2QA 3HNSH 2EXYC 2GCYB 1S9YB 2QQQA 4M93B 4GXUM 4LSTL 4JPVH 4QHUA 1NGXA 1P4LB 1G1CA 4FQHB 1SVZA 4WFHD 1QSEB 1NBYA 4HIJA 1A6TA 4RDQF 5LAXA 1YA5A 5DQ9A 4DUVA 4F9PA 1NAMA 5DHYB 3ET9F 1A22B 3MLTA 2BY1A 3D9AH 3QIWA 5GSVB 4XP4H 4N0CC 1OP3H 5CCKL 1IZKA 1YNLL 2PXYD 1RIUH 3S96A 1NCDL 3L5WB 3U7AA 3FT3B 1IAOA 3UBXB 4DTGH 4HWBL 1FLRL 4JQXA 4HUVB 3KPOB 4TN9A 2FZ3B 2C1OA 5A2IH 1FP5A 3VFRA 3C6LC 2Q7YB 2P8PA 2QSQA 1T80A 2EICA 3GSOA 1CCZA 4Q2ZA 1RZJL 5JXAL 1I8IA 3PUCA 1CZ8H 4GOSA 1A2YB 2AEPL 1B6UA 4U1SB 3ARWA 5E00B 2NY7L 4TYUA 4JRXA 3IFOB 4GS7B 4HJGA 4X8XA 1D6EA 5DJ6A 3P9WB 3O6LH 2ZCLL 1T0MA 5ISZA 1QFHA 5DQJA 1EJ6A 3ULUH 1KUMA 1A7PL 3P2TA 4OD2B 3T77B 2YPVL 3UAJD 1AE6H 4GXUN 1U8PA 4C59B 2PO6B 4ONFL 5FYLL 4NC1E 1K2DB 3MJ9A 5DK0B 2HT4C 6FABL 5AD0A 2WWKT 1JNNL 5E5MA 2PXYA 2V2TA 4JZJA 3GMQB 1MCJA 2NCMA 4JO2L 4HKBB 4K3EH 3SJVB 3T2OA 2VXTH 2ICWB 4HUNB 1G7PA 1A9EA 5E1HB 3IXTB 4KVCH 4QTIL 3WN5B 3TH3T 2P8LA 3KPRD 2XNAA 4P59L 3VGEA 3I6GA 5DD6A 3V6OC 3VXUD 4PJ5E 1IGJA 2WINA 4ERSL 4JN1H 3W2DH 5GS0C 3FQNA 5I1GL 5JW5B 2W0LA 1FL6B 3WIHA 5IHUH 2O5XL 3OKOB 4R96B 4R9HA 4YPGA 4EN3A 5LGHL 2VB5A 3BPNC 3I2CH 3MBXH 5BW7C 3S35X 3CXDL 1KENL 1B0GA 4NN5C 2X1WL 4M03A 4HH9A 1ZT7B 4D9LL 4LGPB 1FGNL 2EXYD 4FFZH 4XWGH 5L0QC 4KK5D 2WWMC 1VGEH 4K3HA 2K1MA 4G6FD 3G6AA 4RA3A 4EOWH 4F7PB 4ZUUA 1T03H 1CE1H 1DQDL 1OAZH 4CN4A 4OZGE 3O8XC 4H1LH 3F7RA 2ZOKA 1I7ZB 4UV7H 3ARYA 2I07B 3DURA 3D85B 2MJWA 3HMXL 4KQ4L 4UNUA 4UTBH 4N0CD 3VI4F 1S7XB 3L3JA 1CFVL 3JSSA 3PQYE 5BS0B 3ROOB 4YHML 1IAII 3EYQC 2X09A 5E03A 3QO0A 4NPYB 3KPRA 3DETC 4XXCA 4YE4L 2CD0A 4LLYA 3IFLL 3VXUA 1OCWH 4HHAB 3DVNA 5HDQL 1HDMA 3C6LD 1IC4L 1AD9A 2BNUA 3ARGD 4IJ3B 4NQVA 4I3GA 1YPZA 1M4KA 1U3HC 3O6KL 3OGCA 3TBSB 1UWEH 3IS0X 1Y18A 5DMKA 3B9DA 1MJJA 4TTGA 4Y5YC 4KZEH 4X4ZA 4WTZA 1FYTE 4RFOL 3VMOA 3WXVL 5CJBA 5EIVA 1CD0A 2J2ZA 3MBED 4GFTB 4BJLA 1BM3H 3IDYC 3DVIA 2YEZA 3OKEA 3U2SA 3X3GL 4BA8A 1EEYA 3MRMB 5CLTA 2DI8A 3UEZA 1W2KT 1DQTA 5E08H 4ZS7L 4YHOH 5J8OA 1RJZA 2FX7H 1DBBL 3DGGA 5HYFA 1VESA 1F58H 2JB6A 3KDMB 4IS6B 4ZXBB 4OUUA 5F6HJ 4WU7A 4HZLB 2DM7A 5I30H 2FECI 2NNAB 3HAEA 3QEHB 1I75A 5E2UH 2H32H 1OT1A 2OX5A 4L4VE 3H7LA 4K3DL 4U05A 5FEBA 1NCWH 4ZG1A 4HSQA 4XGZA 4CJ0A 3ZKQD 5KS9E 3BEWA 4LLQA 5EU4B 5IT2H 3PABB 4YHIA 3EAKA 2Q87A 1EEZB 3RDTD 1I7TA 3ARGA 4LPXA 1HN1A 4G8GE 2R29L 3MLVH 3CVIL 4OF7A 5HSFA 5D7LD 3FO1B 5H94B 4O2FA 3MUZ1 3NZ8A 4PJXA 4M6NL 3EOAA 4YDKL 3KLAB 1INEH 3F62A 5F7EH 4KI5F 1XF4A 4RZCB 1HSAB 4C56B 1GIGL 1J8HE 2MKLC 3MBEA 3RZCB 4K3JH 4WW1A 4AMKH 4XP5H 3WKNA 4GBXB 1G9NC 5FYKH 5GHWL 2F9BT 2BOBA 3IDMB 3BHBB 3IFPA 2KKQA 5C9KA 1PKQE 4OLZH 4CVXB 5ID0B 4IRZL 5E4EC 2WIIB 3TFKA 1EBPA 2EEBA 4NNYA 4LSUH 4J3XA 3FONA 3H3BC 4FN0A 1I3GL 2CIIB 1MI5D 3FZUC 2IH1A 5JOPE 4LPCA 3SKJH 3BSZH 3U1SH 4P46A 2WMPA 5B39A 3BP6A 4OLVH 1Q1JL 4L9LB 4F58L 3PWPB 4NWTL 3HG1D 3HCVB 4PG2A 5IVOA 1MJ8L 3QFJB 5HHMA 3ZT7A 2OTWB 3P77A 5SWZB 4UT7L 1J88A 2JELL 4Y5XC 5F96L 1T1XA 2C3VB 2YN3A 2MTPA 3CGTA 2BVPB 4A6YL 3IAQA 3RDTA 3FQTB 1CU4H 1IQDB 2LQRA 2NW2B 3W5MA 4APQC 2VR5A 1OHQA 4LCCC 1J8KA 4B7IA 2YMXL 2Y5TB 1INQB 3LAFA 1U41A 3ZDXE 1YEFL 1S5IL 3TT3L 1Q38A 1DVFD 5CWSB 3BP7B 4QRPE 1EHAA 3VWKB 4JZNA 1IM3A 1LHZA 3DX6B 3MLSH 5HVGB 1QSED 1KB9J 4BK5A 1DQQA 1B4JL 3SN6N 1O5DT 4S1DC 1PX3A 4YAQB 1S9VB 5FHBL 1E4XI 4P2OB 3SDDB 4EBQL 4R7DA 4WGWB 1S78D 3OKLA 4RWYH 2BSRB 3QXVA 3SKOA 3ZHDA 3CIQA 4G6AD 4ALAL 3UTSB 4DKFL 4R8WH 5JZ7D 4OAWA 3LCYA 2QQLL 5EU7E 1YEDA 4NFCA 3SDXA 2X4QB 3ROLA 3K80A 5EBMA 4WWKA 4QLRA 4QOKE 2WBJB 1UQSB 3NGBB 5ADPL 3MV9E 4UILL 2BP3A 4N5UA 4JQVA 3HG1A 5TE4L 3BKCL 5E8PA 5MEPB 3MXVH 3QDGE 4PJCA 4NC2B 4AH2A 5DO2D 3P4OB 5EBWA 4RX4D 1N6VA 1D5BB 1AGFB 3RGVC 4KV5F 2ADJA 4N0UA 5I15H 5GRVK 5FO8B 2EDFA 5DVNA 5C08B 1G7MA 3T0AA 3L5IA 2P47B 3P11L 3T65A 3RNQA 4AG4H 1IAKA 1R24A 5I0DA 4HC1L 5GJTL 3WXWH 2CLRB 3RHWK 5MEQB 3KWWB 3BXNA 3Q1SH 1DVFA 4OCYH 1UZ6E 2GCYA 2F74B 2UVEA 1C5BL 5FYJD 1NAMH 4P9HL 5EUOF 1RVFH 5C0CD 1P4LA 2F5AH 4FQHA 4GRLD 4MJIB 1QSEA 4L8CB 4YDLB 2VLRD 2CO7B 3X13B 5DHYA 4HT1H 2VWEE 4LQFL 3X11A 4QHKJ 4YHNB 5GSVA 3LY6A 3LN5A 4X9HA 3RRQA 4UDUB 3RIFF 1K85A 5IF0B 5HHQB 1Y0LB 5E70A 1CQYA 1QBLH 3L5WA 3FT3A 1QFPA 2FX8L 2YD9A 3FRUB 4TUJA 4DGYL 1M05B 4HUVA 4G43A 4NQTA 2XYCA 4ZD3H 5DYOB 1BHGA 4YHZL 2FZ3A 3CMOL 3KPSE 3EZ8A 5HJ3B 5KOMC 4UBDD 4HIHB 3RIAF 1Z6JT 1FH5H 2Q7YA 4RX4A 2FJHB 4LVEA 3ZE1F 2OK0L 1P1ZA 1A2YA 1QSVA 4U1SA 5E00A 1OWRM 2WW8A 4BZYA 4OLXH 4MQXC 3CFJB 3EOTH 1MNUL 4XWOC 4Y2DC 1Q0XH 2IBZX 1ADQA 2ADFH 4R6UA 3MFFB 5C2UB 2DQGH 1RURH 1HKFA 5DD3H 1CXFA 4GAFB 1A1NB 4PRBB 1MCFA 4OD2A 3T77A 5C0CA 5BMFH 4GRLA 2J8UE 3VXMB 3MJ9H 4RMRA 2PO6A 3GBNL 5EIIB 3LH2L 2VLRA 3TPUE 1TQCB 5GGSB 2ESVB 1JHKL 2IH3B 1ZSDA 5C9JB 5DK0A 1JPTL 4ZUTA 1U36A 2VQUA 1YN6B 2ATPB 5B3JE 2X4UA 4A6YB 3ULVL 3GMQA 1HH6A 4HKBA 5CUSH 1FRGH 5D6DC 2X6MA 5JORA 5D8JH 4OLWL 5BS0D 5F7NC 2EDXA 4WEMB 5AYUH 3IXTA 2DQCH 3RWHB 4M48L 2W65B 4JY6B 5KSBE 1KB5H 2OM5A 3WIHH 4E41B 4KKAD 4XP1H 3FO9A 2X1QA 2JJVA 1L6ZA 3BYYA 5DSCB 3UXFA 3OXSB 5H8DA 4Z77B 5JW5A 2ZSVB 3RGVD 1FL6A 1M7XA 3OKOA 4R96A 5H35B 3WLBB 4Z7OF 5F8QC 1JTTA 2E6JA 4LCYA 3IT8D 2OJZL 3UP1A 3W5NA 4M43L 3TVMB 3TO4C 4UAOC 4UT6L 2B7DT 3LQZB 5T1LD 4IHOA 1G6RL 3QDJE 4YNYB 3VRIB 1ZT7A 3FQUB 4KGJA 4PJAA 3ABZA 3R4DA 1RQ5A 5BRZD 2P5EB 2Y23A 1SYVB 4RFEB 2KZ1B 5DMGD 4F7PA 4OZFG 1MHPL 3QCUL 4GW5B 1GPOH 3E3QC 2I07A 3D85A 1S5HB 4V1DE 1DR9A 4HUXA 1S7XA 2XXCB 2ZUQC 5L8JB 2VDRH 5DJDA 5ETUB 1EEUA 3RVVD 3WV0A 3ROOA 5BS0A 4BQ9A 4R0LA 4M4PA 4P5TB 4NPYA 3U7YL 5ESVA 1XF1A 4HPYH 5TQ0H 2BVQA 3JXAA 3N1GC 2VXSL 2C7UB 5SX5H 1R0AH 2DQHH 1YC8A 1NCAH 1UB5B 4JPKL 5B38G 1DEEB 2F53B 1TTFA 4ZUWB 2MQCA 3KGRA 3HPLB 1F4YH 3TBSA 4Q6IB 4LPWA 4FFVC 1WICA 2HVJB 1VFUA 3SE3C 5I76B 3VG9B 4Y2DD 1J1XH 3TBTA 5T1LA 4HWBA 4NM4L 5I1IL 3BRGC 2AABH 1CFSB 4C56D 1CYGA 3RZCD 5C09E 1EHXA 3LPFA 4GBXD 4XPTH 4I3RH 5M95B 4P9ML 3MRMA 4JDTH 5MEND 4FQQA 4K3GA 3S34H 4M5YH 5JXED 1NKRA 4M62H 3HAEH 3B2UC 3C2SA 5HDLA 3KDMA 4ZAKB 4H0HB 1PDKA 1BZ9B 1KCUL 3MRJB 1YDPB 2NNAA 3PWPD 4GG6E 2CJUL 2EZ0C 4FQ2L 4JJHA 1NL0H 3LEXB 4FQIH 1G0XA 4JHAL 1NBZB 1SVCP 4AL8H 4ZOAA 5EZOH 3MCG1 3STLB 4L3CB 5AZEL 1Q72H 4M7KL 4QWWC 4POUB 1EEZA 4PD4J 3BX7C 4XRCA 2XWTB 4X7TB 5MHSD 1MCNA 4NCC2 2B1AL 2BX5A 1ZANH 1YQVH 1ZLVH 1P2CB 5ESAB 5C0GA 3OWEA 12E8H 1MUJB 5KANI 3VW3H 3KLAA 3UBXI 2DQUL 4XVSL 5GS1B 2P44B 5T5FH 2V7HB 5CHNA 1Q9KB 5I73C 4Y89A 4XMLL 3HMWH 4X6FB 3V9FA 4C56A 3RZCA 2ZUUA 4GBXA 3TO4D 1EBAA 1B90A 4PJ8B 3GMMB 1ACYL 3IDMA 3BHBA 3VD7A 4CVXA 1AQDB 1C5DA 3BQUB 2WIIA 5MENA 2DLFH 4YFEA 1FORL 5JXEA 5D7IE 3IXAB 2F54B 5KSAC 4Z18A 5JHDE 5IVNA 4N8VB 4J12A 4L8SC 2NY1D 3VGAC 1EUTA 5H37H 3LKQB 4K2UH 1EH9A 4RAVA 5GXBB 4L9LA 5I9QB 3PWPA 1NPUA 2BJML 2GJJA 4NQEB 1P4IL 1EUUA 1QR4A 2LU4A 3QFJA 1L7IL 4JGUA 4DKAA 4FXGB 3RFZC 2B5IB 1G6RB 3QI9C 2CRIA 4N9OB 4NP4L 5DK2B 5GGRB 2BNQD 2YRLA 1LNUB 4R2GB 3FQTA 3KVQA 4LL9A 1IQDA 1R5WB 3M45A 2DKMA 4KC3B 1MRCL 1L0QA 1INQA 2Y5TA 4DJMA 3QP3A 1MWAL 4XBGB 3S88H 3UROR 2VLMD 4DK3A 3VWKA 3GJEB 4DQOH 4MJID 3GO1L 2GT9B 2ICWI 2HFEA 4ODXB 5HGBB 5HTSA 3MRPA 1KB9K 4U3CA 3FRPA 4YAQA 4LLUB 3SDDA 1ZVHA 4F7CA 3MLYL 3RU8H 3MV11 4UV4H 3WFDL 4EEEA 2R8SL 3RL1B 1MJUH 1FLTX 2AJUH 3UTSA 1B0WA 2GUOB 1LDPL 4XHQA 2B4CH 4HJ0C 1S7UB 1UKQA 3ARUA 4NQXB 1FFOB 1WAAE 2NXZB 1S7TB 2WBJA 1YEGL 1UQSA 3BDYL 4OJFH 3WFEH 3Q2CA 4OLEA 3B2UD 4MA7L 5DK3A 2Z31B 5MEPA 2IMNA 5DHVB 1II4E 3MLZL 1WBZA 3SE8H 1D5BA 5BV7C 5KZCB 4N0FA 3VFVB 5FO8A 2EZ0D 5CILH 2Y25A 1UA6H 1TDQA 3N9GL 4X6EB 3WFHA 1MHHA 2ZJSH 2JLLA 1YECL 2WQRA 1OAKH 1AD0B 2CDFB 5F9WB 2CLRA 5EO1B 4QWWD 4X4MA 2NY6C 5JLZB 4UQ3B 1RD6A 4Y2OA 2UZYB 4FFEX 4MS8D 1S7RB 3R0NA 2AVGA 4MJIA 4M8VA 2P7TB 2FDBP 4L8CA 1MHEB 3QZWA 4NO3A 2ESVD 4E42A 1J7VR 2YD4A 3TNMB 4YHNA 4X5WA 1RJCA 4IMKA 3LD8C 2ZCKL 3WEXB 3CUPA 1BBDH 3P4LA 3M1BB 4S0SD 4ZPVB 5HHQA 5IF0A 1MOEA 1Y0LA 4G6KH 5ITBH 3BH8B 5H2BA 4XCYA 1ZLSH 5E6IC 2RAMA 1JE6A 3FRUA 3VRLF 4JFQB 1M05A 4HXBH 3U83A 5GS0L 4MXVF 5DYOA 3DRTA 2VXQH 1S7VA 4H8WC 4OB5L 4UB0H 4QXGH 4EZMA 4BFBD 1RU9H 2UY7A 3VXRE 2AXFB 2ERJC 4E41D 2XN9D 1ZA3B 1CXLA 4JREB 2R0WL 4PJIE 1YEIL 5FYJH 3QI9D 4Y16D 1AGEB 4J1UA 3MFFA 1RZIB 3MLPA 3IU4H 1PZ5A 3OKKB 4UU9B 1J5OL 3W0WB 2V17L 5IROC 3KS0H 3DX7A 1A1NA 4MS8A 4L5FH 4MZ3A 1I1FB 1HEZB 3VXMA 2R2BB 1IT9H 3LIZL 4UOJA 1PG7L 1QQDA 5EIIA 4AT6B 4L3EB 2ESVA 3L3KB 2CDEB 3GJFB 1BWMA 1TZIB 3HUJF 2ARWA 5FF6A 5HYJB 3FMGL 1IQWL 25C8L 3GIVA 1A4KB 1DLHB 1HH9B 4K9EH 2IQ9L 1J0IA 3G5YB 1A7BA 1FNSH 1AHWC 1U8IA 4GG8B 5J1SC 1T2JA 4XPHL 3B83A 5HI4C 4P0DA 4L9DA 2JF1A 4HJ0D 4D9RD 1ETZA 3KR3L 5DJCB 4P5TD 1MWAB 3UJIL 1E27B 3OBAA 1C1EL 3DBXA 4X9GA 1XR8B 4HMEA 2GYSA 4KTEL 4E41A 5B8CB 1T89C 2QHRL 1X5JA 4M6ML 5DJYB 2XN9A 3V52L 5IM7A 2DBJA 3HN3A 3P4MB 1IEAA 4S1QH 2V5TA 5DSCA 3OXSA 4Z77A 5AWNH 2ZSVA 1NQBA 3CSBA 4Y16A 4NN6B 2VZ3A 4JAMB 5H35A 3MQIA 3WLBA 3DUUA 5F70A 3QEGH 1IKFH 3OB0K 4G9DA 4PLJD 3HE6B 3TVMA 4RNRB 3LQZA 5E2VH 4LRNH 2ILLA 1G7HB 3O41B 3FQUA 4KJWD 1EERB 2CMRL 3S37X 5FKPB 5FCUH 4X98B 4DVRL 2P5EA 3TZVC 1BD2E 5EH1A 2D0GA 4PG9B 5I2IB 4O58L 5FUZH 4HS8L 3V5KB 5K59E 1CDUA 4GW5A 1HHJA 5FGCE 5IB1B 4CW1B 2FEDD 4LSRH 3DROB 2K7PA 1IKNC 4YEEA 4MNGE 4HC1A 1Q0YL 5I1HL 3LPGA 4YC2B 5TGBB 4ENEC 2FJFB 1JPSL 4TSBH 2VR4A 5EC2B 2EDOA 1N5AB 1WEJL 3O3DB 1BX2B 1TCRA 4P5TA 2NY0B 1IC7L 5EIQA 1QRNB 43CAB 2J8HA 1N64H 1FBIH 1KTKE 2VLKE 4NO0D 4TSCL 5F1SA 1G9NL 1UB5A 1DEEA 1XZ0B 3U82B 3I3DA 4P23D 4LLDB 2F53A 3Q48A 4ZUWA 4HWBH 4XAWL 1S9XB 4HUWA 1A14L 4Q6IA 2DD8L 3MO1B 2HVJA 1KFAH 2MPAH 4H88L 5LG1A 5I76A 4PRIE 3UZQA 3HLAB 5FOJA 5C0IB 1DSFL 1MFCH 1CFSA 3EDDA 2Q8AL 5DS8B 2AJXH 2WBWB 2VABA 4WWID 3LKNB 3IKCB 1CD1B 3BQUD 2H26B 3BPNB 1EV2E 1N26A 1CI5A 4JFFE 5D7SL 3G5ZB 2DMKA 4U7KA 4I3SH 3GSUA 4GUPB 2NPLX 4ZAKA 5J11B 1ZA6B 5L7XL 5I18L 1NGPH 2YPVH 3MRJA 4I0PC 4OIIL 3QQ4B 4PLOB 1QKZH 2CGRL 4WFGE 5I1LB 4G9FE 3LEXA 5FYLH 1Z5LB 4D9QD 5DC9B 1AC0A 3STLA 3NA4A 1FZKB 2AEQH 3HUJB 4Z7NE 1NCBL 2IANE 3BI9X 3I75B 3RWJA 4H25B 2Z4QB 4PD4K 3ZYIA 4DK6A 4V3EB 3RY6C 4ZNEE 3DWTA 4P23A 1LO5A 5TQ2L 3V0WL 4TOYH 2PKDA 1P2CA 5AG9A 1G6VK 2E9JA 2HRLA 4LAQL 1F6FB 4X0KA 5GS1A 3GIZH 3NFNB 3OXRB 5T3XD 2V7HA 4QTIH 1Q9KA 3BKJL 4JANB 4NWUL 4NJ9L 2VDPL 2VZVA 1OSZB 2EIDA 1CGYA 2IPTH 4KRPC 5ADOL 3CMGA 3EO0B 1MFAH 2X44D 4XCFH 4ERSH 2A9NH 1AQDA 4HF5L 3BQUA 4U2YA 3IXAA 1OAYL 4TNWK 4W6WB 2YPKA 5A2FA 1XH3A 3O9WD 1E4WL 5E94A 3IDYB 4WHYG 2AKRB 1JRHI 3CXDH 4HFWB 4NZTL 4OF8A 3GMOA 1BJMA 4D9LH 2BY3A 3T08A 4WFED 4NBXB 3GRWL 1KJ2L 1ZTXH 4FXGA 5FHAL 4LVOC 1G6RA 3HI1B 5D72L 1GGIH 4QRRE 5KZCD 5DK2A 5GGRA 3QDAA 3MRFA 4MNQE 5DMJB 3FT4A 4BFIB 2AXHA 3CLEL 3S7GA 4Z7WF 1W72L 1C5CL 5I19L 3S4SG 4KTDL 4XBPB 3DUHA 5TPWL 3WBDA 3SGJC 2VXVH 5T3ZE 4LLAA 4YBQC 5C0BB 4XBGA 1X4ZA 1ROWA 3QAZB 2BSSA 3GJEA 1X5LA 4N5ED 2CKBA 2Y36L 1BP3B 2GT9A 4ODXA 5HGBA 3S9DB 4F3FB 2ITCA 5C0AB 4XMPL 4LLUA 2J6EA 5ITFB 3GSQB 4FZ8L 4BH7B 1UM4L 1WWCA 1FHGA 5I8EB 5K9QG 1FL5A 1IFHH 4MQTB 3VFTB 2XTLA 4CN1A 1F4HA 4D0DA 2GUOA 2EE6A 3TA3B 3O45A 1S7UA 4KUZH 3QG7H 1DN2A 3O9WA 1BZQK 3VGHA 2WM0A 4TVPL 1FFOA 1S7TA 2AV7B 5JHLH 3ES6B 2HKFL 1LO4L 3V7AE 1FVDB 4JDZB 3T04D 4P5MB 4F8TA 2YD6A 2Z31A 5CS7A 2PYFA 5DHVA 2F5BL 1EFQA 3LEVL 4QHLA 4PTUB 2BDNL 5FYKE 4I0PD 3REVB 2R0KL 5T33H 2HMIC 4K7PX 4YBLB 5TF0A 3ZTJG 3KXFD 4FABL 2VSDA 3VFVA 1D7FA 5EORH 4YDJA 3EBAA 4X6EA 1MREH 3DHMA 3HE7B 5C0RH 4AEFA 1E6OH 4XI5D 4JFED 1MVUB 1AD0A 5DGRA 3CVHL 1KXQE 2HN7B 2OCFD 4LEOB 5JLZA 2NW3B 1FVCA 2WLYA 3V8OA 3T0ED 4JN2B 1S7RA 2D7OA 3MRGB 4N5EA 4OCSH 2P7TA 3QFDB 5IW3A 1OD7A 5GQBA 3QXAB 2NZ9C 4APQB 1MHEA 1ED3B 2DKSA 4A2MA 5JIKA 1H3PH 1G84A 2DQIH 4FFWC 3T3PE 1VKXB 3VG0L 4ZPVA 4P3CL 3MJ8B 4OCNC 3ZL4H 1LO3L 2SEBB 4M6NH 2HFGL 3QPQC 2NY4C 3UTTE 2BCKB 2XZCL 3FQWB 5DRZB 3VFWB 4X4YB 1AFVL 2AXGA 2W9DL 5B22A 2J5LC 1MCQA 5KSVB 1A1OB 3U4EB 3TJEL 1G7QB 1JRHH 3PWLB 3D2UD 4U7SA 1K4DA 3MOBH 3CFKA 2X4OA 3SO3B 2GI7A 2PYEB 3U0TB 4MXWH 5ICYB 1JZ6A 1M7DB 3RHWF 1EZVX 4FXLA 1AGEA 4PRHE 1RZIA 3OPZH 2VZOA 4BZ2L 4UU9A 3OKKA 5TF1H 1CR9L 1RUKH 3HE6D 3T0EA 4NWTH 1A6VH 1H3UA 1HEZA 5BZDA 2FH6A 3LQAC 3O4OB 2R2BA 2JJWA 4NDMA 2OTPA 3PHSA 3TIDB 4UT7H 4AT6A 3IDNA 3TV3L 5F96H 4L3EA 3QULB 4YBQD 1G0DA 5LGKA 3L3KA 3GJFA 1TZIA 2HTLD 1YYLH 1MRFL 5HYJA 2ZSWB 4Y5VC 4CBPA 4P2QE 3C9NB 4L8BA 1KJ2B 4XMKL 5DUPL 4TRPL 1DLHA 1MH5B 4Z7WB 1YEFH 3TT3H 3QWRD 3SBWC 5EOCJ 3G5YA 4GMSL 5AYQA 1W72B 4KUCD 1H3VA 4LLVB 4JY4B 5IGXL 1EMTL 1YZZA 2ADIB 4XNUL 1NFDF 5DJCA 4DZBB 3V4PH 1E27A 5IV2A 1QRND 1OAQL 1T5XA 4FQ1H 1F4WL 3INUH 4NC1C 1MRDL 3GHEL 5B8CA 2J4WL 2FB4L 5DJYA 4P3DB 4NIKB 4L29A 1W0WB 3P4MA 3VFMB 3MCKA 3JUZA 3FO0H 1VPOL 3QUXB 4XBEH 1EIBA 1OPGL 4CNIB 3HC3H 4QXUL 2QQNL 3HE6A 5IK3A 5EPMB 5JA8B 4RNRA 2KBGA 3WJLC 1G7HA 4UDTB 4U6HB 2OL3H 3NCCB 1CLZH 1NUFA 3BKYH 4JRXE 4OIAA 3ZKSD 5KVMC 5FKPA 4MZ2A 1KT2B 5JDSB 2DICA 3E6HA 1JPFA 4PG9A 5HPMA 5EWIL 4YXLH 4YHYB 1C08B 3V5KA 5ISZE 1CGXA 1KCSL 4LEXH 5B3JF 3ARRA 5GGTA 4QO1A 3I3BA 2LV4A 4P4KB 4OZIE 4AY0A 5ICZB 5TGBA 2HG5B 3CVHB 1NCCL 3U7WH 1ZLWK 2FJFA 5EC2A 1RPQA 2EDTA 1N5AA 1BX2A 1LO2L 2NY4D 2H1PL 1KIQA 3QNZB 4EXPX 4GXVL 1QRNA 43CAA 5E24E 2IJ0C 1B4RA 3GMLA 4WI2A 1NCNA 3P9MB 3PP3K 2Y7QB 1MFBL 4MHHG 1XZ0A 1FNGB 3V0VB 5IEKA 2FYYB 1S9XA 1YEKL 4KQ3L 2ICWJ 3V4VL 3H7BB 1KN4H 2G60H 35C8L 3B5GA 3NIGE 5EZIH 3PWUB 4XP6L 3HLAA 3MV8B 1CGSL 1I9IH 1F90H 5C0IA 1WWAX 4LPUA 3TYFA 2YR3A 4RA0C 1DFBH 4M1DH 1CN4A 1OTTC 4X5XB 3LKNA 1CD1A 1SBSH 3A6CL 4BFGA 5GGVH 3UPCA 1OW0C 2W0PA 4LARH 4HS3B 4DN3H 3EW3B 3OZ9L 3UTQB 3GK8H 4GUPA 1ZA6A 5J12C 5LXGL 4TPRH 4OSUL 3SY0B 1VFBB 4RFNC 2HT3D 4X80H 5CZVL 3GKWH 3QQ4A 4FG6D 3EYSH 2FLBT 2GSGA 1B2WL 3LH2H 5I8KL 2D7TH 4O4YH 5I1LA 2YBRA 3RA7H 3UPAA 3PE9A 5JW4Q 5M7QA 1MIML 4P2YA 1G9ML 2FEEI 4MD4B 3RVXC 5F7MC 3U48A 3VCLB 4EQ3A 5I1CL 4GRWF 3BEVB 1FZKA 3HUJA 5HHVH 2HKHH 2OI9C 3I75A 5C0FB 4J4PD 2WP3O 1A7RL 1WZLA 2X41A 2Z4QA 4H25A 3UC0L 3A67H 4PUBL 2HWZH 3PG2A 3QHFH 4LHUG 4JFZL 4M5ZL 4RIRB 4N0YH 3OKMB 3HS0B 4WVRA 3CK0H 3AGVA 4WUKH 3MREA 5C0BD 4XCEA 4ZPTB 3NFNA 3OXRA 1CD8A 3VXUE 1HQ4B 1AH1A 3EYFA 1EVUA 3MJ7A 5CEZL 4TTDD 3LKOB 1DBJL 4LNRB 4LIQE 1OSZA 1NFDB 1VEMA 3EO0A 4OFIA 5E99L 2JE8A 3RWFB 4BM7A 1F11B 2I60H 3BVNA 1TQBB 4F57L 1MCOH 2IAMB 4P2RB 1MCRA 3BKMH 1LVEA 3SDAD 3MMEB 1W8OA 2W9EL 2BRRL 3UCRA 4PJ5D 4OFVA 3DV6B 5BV7L 1QSZA 4PJBE 2AKRA 3WDJA 1SM3L 2WY3A 4N1HB 3P4NA 4LSQL 3PJSB 3QUYC 4FQXB 5EDXA 6CGTA 4NN7B 4JO3L 2J7LA 4ONGL 3DARA 4Z0BH 2L7UA 1P4BL 1UKSA 2R2HB 1N0XH 3QJHA 5F88B 1WUNT 2XXMB 1WIUA 2O93L 4J4PA 4BFIA 2NY5C 1D5IL 3SQOH 4XBPA 5IJVB 4J6RH 3ARZA 4Z95H 5T3XH 2CKBH 5EA0L 2Q8BH 2YUZA 1U8QA 3VH8G 3VA2C 2XZQL 4AENA 3LKRB 2J6EH 3CLFH 5C0BA 4HK3N 3AS0A 1V7ML 4W4OC 2CLZA 1OARL 4HWEH 4F3FA 1HOCA 1TVDA 3MA7A 2QQKL 3PQYD 3WMSA 3QNYB 3GSQA 3S97C 5HHXL 4BH7A 2FO4B 4H8WL 1AJ7L 4KJQC 1VEPA 3EJZC 3VFTA 3H6JA 4PJXE 5AEAA 5HI5D 3SDAA 3TA3A 4LCWB 3WIIL 3MUY1 4EJ1C 1FVEB 2IF7A 4Z8FH 2AV7A 5IBLD 3G08B 1FVDA 5DUBB 2CLVB 2FHCA 2HH0L 2PTTA 1NDMB 3FQXB 4RGOL 3PP4L 1KSRA 4MYWB 5E8DH 1MHCA 4P9MH 3VFNA 1FYTD 5A3ID 4KK9C 1J11A 4PTUA 3PL6D 3REVA 4EXKA 1N7MH 4O02L 4L8SB 3FL7A 4IIQB 4J2XA 2EH8L 4HLZG 1DANT 4QXTB 3HE7A 3RVXD 3OAYH 3BO8B 1MVUA 1GZQB 2F8VA 1JPGA 4OGAC 4YHPA 1KCUH 4JG0H 5KVFH 5FK9B 1A0QH 2NYYC 3RTQC 2HN7A 3ZE2F 5HHME 2NW3A 3LRGA 5C86A 4JN2A 1RUQL 5GGUB 2CJUH 3OAUH 5F1NB 4JPWH 1NSNL 3QFDA 4MX7A 5FGSA 3QXAA 1T21B 3WE6B 3RWDB 1KJMB 3PQYA 4OD3H 3GHBH 1ED3A 1H3WM 4NKDB 1AKJB 5DR5L 2RBLA 4LSSH 1XR9B 1C8PA 4L4VD 1LEIB 4OCRH 5IFHH 5FIEA 1QHOA 3V95A 3C09B 4GRWB 5HHNA 3BD5A 1FFPB 1F5WA 4Q0XL 1VKXA 2AEIT 3B9EA 1OGAE 3R1GL 3HI6L 2Y4SA 1J0KA 3MJ8A 4LVNB 2OJEB 2SEBA 2C3HA 1R3IL 2KPNA 5GRJH 2MCPL 1CFQB 4FP8H 3L5JA 2BCKA 1UCBL 2UV3A 4YHKL 4XMLH 4KI1A 3FQWA 3VFWA 4X4YA 5KVDL 5DEGA 2X70A 3C8HA 5GRZA 7CGTA 2JIXB 5KSVA 1ZHLB 4WEBH 1U8OB 2VWEC 5DWUH 1G7QA 1ZS8B 5JNYB 3PWLA 1KCRL 3SDXE 1J8HD 1EO8H 5T1DH 4W68A 2N7AA 2PYEA 3BIKB 3HC0B 1JNHB 3U0TA 2CDGB 1GGUA 3NACL 5ICYA 5E2TL 2UVFA 3QUXD 1N6UA 4EDXB 2LAGB 5J7CC 2BVYA 3MJGX 3OG6B 4JM4H 1VGKB 3GJFH 4J8RB 3NH7L 2BHYA 2BJMH 5BV7B 5JOPD 4TVPD 4XTRC 4BK4A 3TIDA 4LFHD 3QULA 4E9LA 3LMJH 1K4CB 4KKNA 4L4VA 3TBYA 3WLWD 3GMNA 2ZSWA 2NY6B 1EHLL 5IJKA 1KJ2A 2FJGB 1MJ7L 1URLA 4QY8A 1A6AB 1MH5A 4I9WE 1A7QL 4OBRA 4Z7WA 3H2WA 1FC2D 1QSEE 1WIOA 3QIUB 4KJQD 3EJZD 3A6BL 5JW3L 4JY4A 1WISA 4P4KD 3GO1H 1IGIL 1RIHH 1TPXB 3JVGC 1I1AC 3LD8B 4QRPD 2IPUG 1U92B 1ZLUH 2X9WA 5GPRA 5EZJA 3QEUA 1LE5B 4CRPA 1JGDA 4M1CC 5JIPA 2EXWC 3N1QC 4P3DA 1J8HA 2X10A 1CFNB 4KKBD 2DQFA 5HVFB 5MI0C 1W0WA 4XPFL 3VFMA 5J56B 4KK9D 3S6CA 1PKQA 1T1YB 3ZTNH 3QUXA 3BPOC 4HS6B 3BT2L 5CINH 4CNIA 3C2AL 3T09A 3BPCB 4MA7H 2FSEB 5EPMA 2YUVA 4WO4B 1G1YA 4YDIH 2NYYD 3CFDB 3LEYH 4U6HA 5EU6B 1IGMH 1ZGLM 3MV9D 2NX5B 1KT2A 1TJIH 4K07A 1RHHB 5GGTH 4ZSOB 4YGAB 1MAJA 3IF1A 1C08A 3OB8A 2WUCH 1ORQA 1HXYB 5FYJE 2Z93B 4BQ6A 5AZ2H 3VFSB 3D1MC 3O2WH 3G6JF 4P4KA 4JFPB 1OSPL 1WC7B 1QZ1A 4UUJB 3QQ3B 2EC9U 3CVHA 3C08H 1E4KA 1DQLH 5FM5O 4X6DF 3PF2A 4NKIL 4QRPA 3DXAB 1PAMA 1J87A 3QNZA 5IB2A 4GKOA 1XMWA 2JJTC 5HDBF 4JE4B 1NKOA 4FNLH 4NGHL 4OZHF 4X8JB 1C7TA 1KCVH 2WANA 3DI2B 1AHWB 3P9MA 4GKNA 3SJVE 4K94L 2YPLB 5F9JB 4TSAH 4ZS6C 2Y7QA 1IEHA 4DW2H 1OD9A 3Q6FB 4Q97A 1H5BA 2FYYA 1A3RL 1TFHA 3ARTA 4FZEL 3QWOA 4H1LG 3H7BA 4EI5C 4OB5H 3MV8A 1QBMH 3B4NA 1QLRB 4G7VL 3V5HB 3KPSD 4XCCL 1FG2B 2W60B 1X3DA 4HIXH 4I2XB 3MRHA 1NC4B 2EYTB 2IAMD 4MB4A 4P2RD 2AK4B 1J12A 4HS3A 3MXWH 2YRPA 3UTQA 4PB9L 5K59F 3SE4A 4LCUB 4GRMB 4G8FA 1NC2B 1NANI 4Y4FB 3SY0A 1VFBA 1KC5H 1PG7H 2VAAA 5FGBA 4FQXD 1HXMB 4XH2B 3SDCC 1FO0A 1TJHL 5DUMH 1J1PH 4OGXH 4XPAL 4YXKH 4MA8H 4G59A 5DMYA 3BFOA 5EOTB 3VCLA 3BEVA 3FOMB 4ZFOL 3CH1B 3FN9A 3S3PA 3UO1H 5C0FA 4Z7UF 3IGAA 1QLEH 5BS0E 2C4XA 4MDIB 4X5LA 4GAYB 4RIRA 3HC4L 2VH5H 3OKMA 4JGMA 1L0YA 4UT9H 3BDBA 3HS0A 1SYSB 2VKXA 4ZPTA 1FN4B 3MNZB 1GL4B 1HQ4A 1R3JB 1N6QL 3AY4A 1NFDA 3NCFB 4LLWB 2AJ3A 4XVUD 3V52H 2AQ2A 3RWFA 1F11A 1DUYA 4KZDL 4BZ1L 2DMCA 2G75B 3AMKA 4YR6B 5GGQH 3IDGB 1BZ7A 2IAMA 4OQTA 4P2RA 2WK2A 4YEFA 3B9KC 3MRBB 3DV6A 4NRZB 5C6TL 1JWMB 4XX1G 3ZKXB 3MRQB 3MV01 5IB4B 3C5ZC 4NQCB 4PRDB 5D1QC 1CDCA 2CXGA 3PJSA 4FQXA 4RRPG 4FQLL 1FYHB 4IRSB 4DVRH 3KPMB 4N8PA 2B1HH 1T0PB 2J8UA 2R2HA 5D6CB 2A1WL 1KJ3H 2P46B 2YC1B 5F88A 3WNPA 1U2CA 2C4FU 4NHUB 1IM9D 4TULL 4PJEF 5IJVA 4ACPA 1WT5A 2OZ4A 5F1KC 1E6JL 3THML 3QCTL 3SE9H 4OZFB 3LKRA 1B9ZA 4ZS6D 3UDWC 4HFUH 1MAML 2YWZA 1D5MA 3G6JB 1WEJH 4V1DD 4ZYKB 1ZGLB 1RV6X 5JW4M 3WS6A 3ARED 1JGLH 1KN2H 3QNYA 4X6DB 5FYLE 1Z0MA 3CFCL 3GZKA 4EDWL 2YSSB 3EIFA 2FO4A 4KJPD 3Q6GL 4JKPL 4OZHB 2DIJA 2E6QA 5MP6H 3T1WA 1G7IA 2HJKB 2XFXA 5DD5H 4LCWA 1NMCC 1FVEA 5L9DL 1I8MA 1K3IA 3GSVB 4UTAH 4C56E 4KH2A 1K6QH 5B38B 1MCPL 3G08A 5DUBA 3WNNA 1DP0A 3OR6B 3QDHA 1DSFH 3SPVB 3SEPA 1NDMA 3O6FD 5D1ZB 5L8LB 5L2JB 4BH8B 2JIXD 4ODUB 3LS4L 1FFNB 3BN3B 5DJZB 5BVPH 1R3KB 4HH8A 3LQAL 3SDCD 4IIQA 1NANH 5C09D 4OM0H 2H6PA 4XC1L 5D7SH 5INDB 2VO5A 4QXTA 1IM9A 3EYOB 1WLHA 3BO8A 3K1KC 1LD9A 1D6VL 2Y6SC 3PWPE 5LWYH 3FCTB 1RULL 5I18H 3G04A 3QFJE 3LN9A 1TENA 3CXHJ 4XNMA 5SWZE 5GGUA 4EQ2A 1UZ8A 5F1NA 5CBEA 1JUFA 2O5YH 4B7LA 1T21A 3AREA 3WE6A 3RWDA 3I9GL 5JW4N 1CICD 4NKDA 1AKJA 1QA9B 2ZUXA 1XR9A 5FM4A 1V5JA 5B4MC 2VDLL 4RBPK 4X6CF 4ZFOB 3VI4E 3V0WH 1E0OB 1Q9WB 2D3VA 4Z7UB 4G7YH 4S1RL 4JFOB 2DBLL 3QIUD 4PJFF 5E9DB 3K8LA 3B9KD 1L0XA 2VITB 4NT6A 3GM8A 3U0WH 3ELAT 3O3AB 3WO4B 3O6FA 4CU7A 4MAYD 2DM4A 3UTSE 2JIXA 1ZHLA 4R4BB 1U8OA 5D1QD 2CK0L 1LEKB 2DLHA 2DRUA 2CRYA 4LKXA 5JNYA 3D3VB 2DIAA 4KKLC 3BIKA 3HC0A 1JNHA 2CQVA 1QYGH 3TN0D 2E27L 4EDXA 3FB5B 4MJ5B 1VGKA 4J8RA 5JHDD 3C87A 4JGJA 2LTQC 4GLRI 5EU6D 5C08E 4QT5B 5D5MF 3JWOC 1CICA 4JQIL 1A9BB 1DLFL 1MFEH 1K4CA 1IJ9A 3CZJA 2FJGA 4X4ME 1ZEAL 1A6AA 3ARFC 3H9YA 3MCLL 3RNKB 4PJEB 4MJIE 3QIUA 4YXHH 1WGOA 2DM2A 1ONQB 3CDFA 2DLGA 1L9NA 3VWJB 2I5YH 1NAKH 5ALBL 3DUSA 3L3OB 4O9HH 1WBYB 3F7YB 4FZ8H 4MAYA 1YQ2A 1X7QA 1U92A 5LCVL 5CIPB 3B6SB 5EUOA 1IGTA 1IGFH 1ZT4B 4WW2C 3MA9L 5A40E 1QSFB 1X5IA 1R5VB 3TN0A 3T0DA 5D1XB 3RQ3A 4CVZB 2IFFL 4TVPH 3MRIB 4KMTL 5LGJB 3HPJB 4KI5E 1DN0B 1NMAL 3PGFL 3ULSA 3BPCA 1WBXA 1DE4B 1DBML 1FDLH 3JTCA 2ED9A 2FSEA 4WO4A 1LEGB 3NCJH 5JHDA 5SWQB 1Y6KR 2F5BH 2IGFH 3CFDA 4HUUA 5EU6A 5D70H 2X2YA 2NX5A 5KJRH 1JP5A 3KLSA 2BFVH 5ID1A 2UWEF 1FE8H 1PEZA 2GIYA 4EUPB 4NHCH 4YH6A 4JHWL 3MRCA 4LRIC 2Z93A 1A3LL 1G7LB 3VXME 5GRUL 2XG5A 1KLFA 2XZZA 5B4MD 4M00A 3VFSA 2D31B 4QRTA 3MSPA 3AU1B 5JPNB 3RVUD 2WP3T 4KHTL 4ODHH 4JFPA 2ESVE 1T6WA 1WC7A 4J3UA 4PJGB 1ZHBB 3QQ3A 1I7UB 3P30L 4UUJA 4KXZI 3STZB 2Z9TA 4Y5VB 1F3DH 4DGIH 5I74C 4TVSa 2YD8A 3CFIC 1J0HA 3MOQA 5HYEA 3G5VB 4LSVH 3IRPX 1BFSA 3NABL 3FN0L 2VXUL 3I85A 4X8JA