1KTLA

The human non-classical major histocompatibility complex molecule hla-e
Total Genus 68
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
68
sequence length
274
structure length
274
Chain Sequence
GSHSLKYFHTSVSRPGRGEPRFISVGYVDDTQFVRFDNDAASPRMVPRAPWMEQEGSEYWDRETRSARDTAQIFRVNLRTLRGYYNQSEAGSHTLQWMHGCELGPDGRFLRGYEQFAYDGKDYLTLNEDLRSWTAVDTAAQISEQKSNDASEAEHQRAYLEDTCVEWLHKYLEKGKETLLHLEPPKTHVTHHPISDHEATLRCWALGFYPAEITLTWQQDGEGHTQDTELVETRPAGDGTFQKWAAVVVPSGEEQAYTCHVQHEGLPEPVTLRW
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HLA CLASS I HISTOCOMPATIBILITY ANTIGEN, ALPHA CHAIN
publication title HLA-E allelic variants: Correlating differential expression, peptide affinities, crystal structures and thermal stabilities
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
total genus 68
structure length 274
sequence length 274
chains with identical sequence C
ec nomenclature
pdb deposition date 2002-01-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00129 MHC_I Class I Histocompatibility antigen, domains alpha 1 and 2
A PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1ktlA02
3.30.500.10 Alpha Beta 2-Layer Sandwich Murine Class I Major Histocompatibility Complex, H2-DB; Chain A, domain 1 MHC class I-like antigen recognition-like 1ktlA01
1CIUA 1SEQH 3MBED 4P2RA 4DVRH 5F89A 3O2DH 3QIBB 4DGVL 1XCQB 1XIWB 5ESQB 2G75B 4D0DA 3T3PE 1I1AA 1PZ5A 5MENE 4HX1B 1JPSH 4WEBL 3VFTB 2NY6D 1EEYA 1LK2B 2H3NB 1MRCL 4FQ2L 5T3XH 1G7QB 2DTMH 3MV9B 2MCPL 1G7PB 1DLFH 1IAIL 4LSPH 1DUYA 1ACZA 5DLML 3OB0H 4JN2A 4GH7B 1GHFH 3QQ3A 3U7WL 3QHFH 4MDJB 3RA7H 3QI9B 4MCZA 1L7IH 3I50H 3PXJA 4R6UA 4LNRB 4U1JA 3UPCA 3HZMB 4BK5A 5T1DL 1L0YA 2OI9C 2P42B 5IB4A 3MACL 3DVNA 4GAYB 1JPGA 1I1YB 1UZ6E 4PRAB 3K4AA 4OIIH 3MROA 4PJAF 4Y5YA 5EBWB 3RDTC 4CW1B 1LO5A 3LKSA 1ZVSB 3DXAD 3PHOA 4WFHD 1PG7X 3VWKB 3LPFA 4S10A 2D0FA 4OI9A 3P30H 4BZ2L 4ZNCD 4I13B 4JFHE 3ARWA 1T21A 2DQUH 1CI5A 3SDCB 4YDKL 3SDXB 1ACYL 4CL7A 2X4NB 5HYEA 1KEGL 3VJ6A 3FT2A 2QSQA 3RL2A 4MDIB 4J3VA 5E03A 3FB6A 4YNYA 4DAGH 4BZ1L 4MX7A 1MIML 2VABB 1T20B 1BM3H 1X5ZA 3AXLA 5I2IA 4N8CH 4G3YL 2BNQB 1CFSA 2OZ4L 3OMZA 3ZL4H 1F4AA 4XVTL 1CLOH 3KLHC 1GIGH 2R4SH 2DDQH 3E8UL 15C8H 3ECBB 3JVGC 3BD3A 3DXAB 1NUFA 3RWGB 4Z7UA 3V5KB 5I71B 3IDGA 3L3IA 4P0DA 1F2QA 5TGBA 3W39B 1WBXB 4NQVB 2AAVA 4FQCL 5C0AB 1OGAD 4LBEB 5DJCB 5EO0A 1OAKH 1WAAA 1ZT1B 3KPPB 1J0YA 1KN4L 4ZQKB 1KCRH 3GMQB 4ODTL 3K4DA 5FKAB 3NIFF 4MNHB 4KRLB 2DQFA 3QPXH 1DFBH 4MXVF 4RNRB 3OJDB 2GAZA 2X05A 3MODL 3SBWC 2OX5A 3FRPG 4FZEH 4OV5A 4O02L 5MHSD 2OK0L 3OAZH 3OF6D 3HRPA 2D3VA 4BFGA 1AXIB 1MFAH 1PZUB 4OCSH 4LSVH 2DS4A 3LS4H 5HHQA 3CPLB 4XVSH 3RHWK 1OD7A 3ET9F 3BQUA 3ZE0F 1AXTL 1U92A 3QDMA 5CSZA 4LSQL 1JYWA 4LRIA 3LCYA 1S9XB 4WGWB 1E28A 1X7QA 3UCRA 1NCAH 2A74A 1IKNA 1HYSC 1NMBH 4QRRB 2OL3A 5MEOA 2PYEE 5HHVL 3RWEB 1OGAB 4LHUG 1JNNH 3G5ZB 4NKQB 5I66B 2ENSA 4XMPH 5D8JH 3ES6A 2O26U 3MJ7B 4U7SA 4S1QH 3HI1B 2Z8WC 3UBXG 4D0CB 4XWOD 4BQ8A 4Y8DC 3VXNB 5DR5L 3LN9A 4JZJA 2HT4C 5C3TA 1GZQB 4Y4FA 1KCLA 4K3DH 4N0FA 4KJQD 3U82B 1BLNB 4MJIB 2ZG3A 1AKJB 5KS9B 2R9HC 5GGVY 4LASH 4YWGL 2XA3A 1KCVL 2P4AB 4NFDA 3UROR 4QNPE 3IU4H 5F9JA 4YXHL 4Z7OE 1T66C 3BEVB 4C59B 5I73C 3V5HB 3CLFL 3S8WA 4Z5RA 1MHHB 1CU4L 2QR0B 3SY0B 3BZEB 3VFSA 4ONFL 2NQCA 3MRPA 4BUGA 3U46B 3B8YA 3RGVB 4XBPB 1FQ9C 4JG0L 3WN5A 1E4JA 4N0UB 2CKBH 2BJML 3HRZA 3WUWB 4NFCA 3V0VA 3KDMA 3HZKB 1JWMB 5TF0A 3KYOA 2BRQA 4ALAH 1YECL 4E41E 3PL6D 4IDJL 5CLWA 1A47A 1UJTA 3FB7A 1AGCB 3M07A 4PJDB 1A4JA 3EYUH 5MERA 1PEZA 5DFVD 1AIFB 4LPXA 3ULVC 4GBXD 4L8BB 1WAAF 5DRWA 1VPOH 2PCPB 5IJKA 1RIVL 4R96A 4Y2DC 4G6AD 1YC8A 1QPPA 1CLZH 3GHBH 1HEZB 3LEYH 1RK0A 2Y1VA 3MOQA 5FDWA 4M8QA 3VD4A 2GKIA 2A0LD 4FXGA 1F8TL 5EA0H 2F8XC 1N5AA 4EXKA 4M4PA 5FO8B 1RZFH 5E94A 1MJ8L 1EHAA 1WEJH 1O7SA 2H9GB 4F7EA 3BP6A 2BVPA 5GRJH 1S7QB 4UQ2B 1YMHB 3PNWB 5MI0B 2ADGB 4NQEB 3INUL 3MV7A 1J8HB 3S6CA 2LU3A 4XNUH 2JIXB 3HUJA 4I0KA 2UVEA 2EKSB 2X6MA 2X7LB 4YHIA 3SKNB 1HK6A 4OGXL 4FMFA 5TDNB 4RCAA 1UACH 2QL1A 4KKAC 3DETD 4JDVA 3MREB 4DN4L 3KLSA 2OCFD 1IVLA 4PB0L 1KJ2B 3RWJA 4ZNEE 4V1DA 3QJFA 1F4YL 3LZFL 2IFGA 1D9KB 3VGEA 3X13B 1FG9C 4N1CA 4FQXC 1MOEA 4CVXA 3HPJB 4N0YL 4XC3H 3UYRL 3H7BA 5IJVA 4M48L 2WNGA 4JM2F 4CU8A 2VZ3A 4HAFA 1ZTXL 2V7HA 1RUKH 1B0WA 2EYRA 4P2OB 3RUGE 4Z9KB 5FCUL 1N59B 2EH8L 4L29A 4G8GE 2DM2A 3LN5B 1AY1L 5F9OL 5CUSL 1NL0H 4Q2ZB 4RAVA 2YMXL 2GI7A 1RZJH 4JVWA 5E8OB 5EZJB 5BVPL 3LEXA 3HPLA 3WO3B 4KJWC 4H5SB 3HMXL 3IFOA 3RWDA 1DR9A 3G04B 3QUYD 4PJ5D 2CLRA 2IMNA 1QG3A 4XCFH 5GGUA 5GS2D 4ELKB 1T22B 3LV3A 1BVZA 2R4RL 3GMLA 4M3JA 5LXGL 5IHZB 4PJGF 3QPQD 4IS6A 3H42H 2VXSH 1WIUA 4X5WB 3MJ9A 2YK1L 4IDLA 1H9VA 3K8MA 1FL6A 2HJFB 3ULUF 1AD0A 4C4KT 3KPOB 4M3KB 5DJDB 1R3KB 5D7IF 3OPZL 3F58H 3D5OF 3UJJH 1T1WB 1H0DA 4M8VA 3LB6D 2E6QA 2AV7B 1M71A 1SM3L 2X10A 4JR9H 1JGDA 3QUYB 4PB9L 4OZGF 5L6YL 4AQ1B 2SEBA 2BC4A 1U8NA 2YUVA 4LLVB 2H1PL 5GSRA 5LGJB 5GISH 3DJ9A 1L7TL 2NTSP 5F7LB 5DC4B 4KH2A 4CVWA 5BJTA 1Q72L 2CLZA 4X8JA 5GJTH 5FECB 1XR9A 2IH1B 3UO1L 4YDJB 1DQLH 4H1LA 3WSQL 4X4MA 5TJWK 4QXWA 2OTUB 2O5YL 5GRVL 2W0KA 3MCLH 4Z0BL 3HUJF 4OM1L 1DDHA 2LTQB 2X44D 5HXMA 3TA3C 1V7ML 1UYWL 5DD6A 1F2XK 2YXFA 3QWRD 3OKNA 5DT1L 5DJAA 2W9EH 4PJAB 1KJ2L 3L3KA 2H32B 2HVJA 1FE8L 5T1KA 4YQXH 4K2UL 1CGSH 5HHXL 3TPUA 4D9RE 3KYKL 3FQUA 3MFGB 1T3FB 4YBQC 5DRXA 1G9NH 1CR9L 1EVUA 4PJXB 5C0BA 1D6VH 3TCLB 3GKWL 4LKCA 4K3HA 4LPTA 3DURA 3JZ7A 2XPGA 1UA6L 2AXHA 1BZ9A 2CR6A 2EYSA 3EYFB 2H26B 2AS5M 3CMOL 1U8QB 3TO4A 5E9DA 2R2HA 2F53A 1EGJA 4YHPA 1AHWC 3WIIL 3JTTA 4OQ1A 3TIEA 2HRPH 4PRPA 1BBDL 3P0VL 1CF8H 3QG6A 3PG2A 2R23A 1MNUL 4PJHE 3D0LB 1A9EA 5IESL 2YEZA 2HFFA 4OJFL 1K6QH 4F9PC 4OD1L 4P2RD 4OLXH 4DTGL 2WY3A 3A6BH 4X6FB 1I1AD 1IAKB 2J5LB 1GGYA 1MHEA 5AWNL 1I3UA 1LHZA 3STZA 2I9TA 4Y16D 3FO1A 3IFLL 4JY5L 3D3VB 4L3EA 4ORZC 2BNUB 5IVZA 5DMIH 3V79C 3V6OA 2YD4A 1FNEA 5IWLC 3QJHB 4L8SA 4X9BA 1FJ1B 4IRJC 1KT2A 4PRIA 2IADB 5IOPA 1HHKB 5BQ7A 1VACB 1U95B 2AJYL 4LAQH 4X9HA 3DO7A 4O2CB 1NMAH 4P4KA 2RCSH 3CCHB 1VCAA 5I75C 2X09A 4PJ7F 3QFDA 4PV8A 5HJ3A 4LLQB 1U3YA 3TIDA 3M8OL 4XPFH 1R24B 1KPRA 1ORSB 2O61A 4XCCL 1J0HA 3U9UA 1TZGH 1DQQB 2D0HA 1QTYT 3LRHA 3MV01 5CBEA 3TBYA 4Y16B 5AAMA 1M1SA 3VXUA 1CGYA 5DO2C 3ARBD 4EXPX 3RIFF 4XHJD 4CNIB 5H2BA 5JMOC 3UXFA 4RWHA 5B21A 4B0MM 4EN3C 3AU1B 2X4SB 2QQKL 3L7EA 2FBOJ 5IFJA 2EIDA 5C07E 4P23C 3O4OB 5GS0H 1F4WL 1N6UA 4NIKB 3C09C 5CEZE 4MCZB 4DWHA 1XF3B 1KC5L 4F9LC 2YBRB 1RZKC 3ZHKA 3EYQD 3IKCB 3QNXA 4GRLD 3DVNB 2H8PB 4HEME 4XRCB 4XPAL 1TVHA 2B2XH 3HNSL 1CXFA 3BJ91 4CN6A 4WFFE 5FB8A 2PR4H 1A7OH 4TVPH 3K8LA 1IGJA 3EYOB 3BISA 4EOWL 3M1BA 3TO2B 3LIZH 1KB9J 2I07A 4UINL 1T03H 4C56B 1UB5B 4LEXL 4X99A 5ID1A 3ARBB 2DQJL 5CKAA 4M93B 1RY7B 4RGMC 1Q9LA 2MTPA 3OHXA 2DIBA 2BSTA 2D7QA 3ROLA 1LO3L 5BXFB 1EK3A 3I6KA 1IRAY 1YMME 1FL3A 5J1AB 1EIBA 1I75A 1MPAH 2QSTA 2XTJD 1MRDL 1DEEA 2D0GA 5DUPH 1KGCD 2ITCB 1GVIA 3L3GA 2APFA 4PD4J 4XNQA 1G7LA 5HI4D 2YN3A 2XN9A 2K3TA 1R5WA 4GRLB 4NP4L 4NRYB 4OD3L 3MLYL 1S7XA 2G60H 3BQUD 1JNLH 4NZTH 3QDMD 3TT1L 1SEBA 4OSUL 5DQDH 3T2NL 1KG0B 3BJLA 4HKZB 3X3GL 1CK0L 1PKQB 1HSBA 5A40E 3MR9B 3NPSB 1RUAL 1BQHG 3S4SA 1CBVH 1NC2A 4BQ6A 4KZEL 4W68A 4FXKA 1NFDF 5E5UB 3H9SB 4LFHD 4HZAA 1CXLA 3RY6A 3HLAA 4BQCA 1FH5L 1WTLA 2X5PA 3H0TB 3LRSB 3KJ6L 5D7KE 4ZS7H 4WU7B 5I17B 1ZWIA 3MJ9H 1FN4A 1QYGH 1MCNA 2ORBH 3HC0B 5CGTA 5AZ2L 4U1HA 4XP5L 2PXYB 3LKOB 2Y6SD 3BWUC 4WTWA 4Z7QE 5GGRB 4JG1H 4U6YB 1FFRA 3R1GL 1R3JB 1JK8B 5DTFB 4IOSD 4GLRH 4R7DB 3MRLB 4I48B 2EDKA 4JPWL 4JO2H 4QHLA 3BVNB 4NJAL 4UQ3A 2BP3A 5E1HB 1E28B 3Q3GA 4CMHB 3NN8A 4L9LA 1A6ZB 1HN1A 5F9WB 2XZZA 1JGEA 4PRHB 1DBJH 3I9GL 5E1AB 5D7JC 1Y0LB 2CUIA 4Q6IC 4DZBA 1HCFX 5HPMB 4LPYA 4I18C 4APQB 4EZMA 5D1XB 2ZP0T 3BGMA 3ES6B 3MOAH 3CDFA 4MYWB 1TCRB 4Z95L 3NZ8B 2Y5TA 3TYGL 3LH2H 1MCCA 3O45A 1UH4A 3MXVL 5B39A 3DV6B 3NA4A 3VFMA 4K71C 3CFKA 1NGZB 2R29H 1AJ7L 4XPTL 3LQAL 3TPKA 4KPHH 3BN9D 3WHXB 5FF6A 1FLTX 3O6ML 3RVTC 2KQMA 2NMSA 5BS0B 1YEIL 3TNNA 4NO5B 2J4WH 4JM2B 4X6DA 4ZUWA 3SQOL 4JY4B 3MA9L 2HN7A 5J89A 2GEEA 2WINA 1W0VB 3ULUD 2P5WA 3QUZC 2WAHA 1S7VB 4NZJA 5J7CC 1XCTB 5D1QA 4HZLB 3G5XA 2IQAA 1U6AH 4LCCA 1D5ZA 2VMFA 3KWWA 3O6FC 3TV3H 4JGJA 1AR1C 5JDSB 2R8SH 1EGJH 2GK2A 3PWPB 3K2UL 4AIOA 2Z8RA 4MJ6B 5EBGA 4HC1A 3KDMB 2FL5B 2VN4A 4X7EC 3RI5F 3N1PC 3TT3L 3BP5A 5F7KC 1A3QA 4PJGB 5CP7B 4D2NA 2N7AA 1FPTH 3QDAA 1U8IA 5HVFB 3QO1B 3FB7B 4WWKA 3P4OB 5F71A 1P1ZB 1AQKH 3MV7D 1HXMA 4DFHA 3ZHLA 5EWIH 5I8KH 4HFWB 3WCYA 3MJ8A 5D7IB 4DGVH 3BMWA 5JPMB 5FCSH 3MRKA 1WZKA 2E7LA 1URLA 1I4FA 4JQVC 4WEBH 1FZMA 4NN5C 5FDWB 3BDYL 4OZGB 4XWGL 2R2BA 4L8DB 4QCIB 4V1DD 1MRCH 4HUVA 2VDPH 2R15A 3KHOA 4FQ2H 5FHBH 4DVBB 3ULVF 4CU6A 3VI3E 1IAIH 1K4CB 5DLMH 1YC7A 4O5LH 4U0RC 3FQTA 1XGUB 3TYFB 3BP6B 3CZFB 5I6XC 3B9EA 3U7WH 4W4OC 2P8MB 2DKUA 2RBLA 3MC0A 5SX4H 5E5RB 1YUHB 4TUKL 3SDDC 4HGWA 5T1DH 4JO3H 4ZXBB 4LGSB 1MJUL 4MHHI 2GSGA 2JE8A 4PRDA 4BSJA 5K9JL 4KHXL 3X11A 4EUPG 2G2RB 1QR1A 3AREB 1N2RB 4U4BA 3IB4A 4JFYA 3RWJB 4YDKH 1TTFA 5B38A 1JFQL 3BP4A 3ARPA 3QFJA 1ACYH 5JIHA 1IGYA 1KEGH 5ADPL 5FGBA 1OD9A 3WS3B 1YNTA 4NQSA 1DBKL 4HIEB 3ARDC 3AAZB 1DUZA 2O5ZL 4P2CG 2F54A 3KPQA 2EYRB 4MNGE 1MIMH 4KTDL 2DQEH 3PQYE 5KVEL 1NGWA 3QDGB 5JO5A 4G3YH 3T0EA 5DK0B 3BGFB 4XVTH 5B3JF 2KZ1B 4Y0GA 3H2WA 2V5SA 1M05B 5DA4A 2X9YA 4U3HA 3IAGC 4UOJA 3W9EA 4C83A 1A1MA 2NY5C 4FQCH 2EICA 4NPYA 4ODBD 5BMFL 4J12A 1ZMYA 3QZWB 4OF7A 2WUBH 4NC1E 4GQ9H 2Y5EA 5AD0A 2CK0L 3B2UD 2VZVA 3GMLB 2CIIB 2NTFA 1FZJA 1V05A 3ZKXC 1T2QL 5GGSA 3ULUL 5EC1B 1P4LA 3MODH 4MLSA 4AM0B 4KGLA 1B88A 5T1LA 3ERYA 2OK0H 2WIMA 5TF1L 3MLPA 1FL6B 1HIMH 1W72A 4U1LA 4PJ7B 2QKIB 5D6DC 3T3ME 5ERWA 4NT6A 1Y18A 1YYLL 1QSFE 2D2OA 1AXTH 4LSQH 1T7WA 4J8RA 5HYQA 4H8WC 1JGDB 5ESAB 5IB3B 5JUEL 1T1YB 1LEIA 5C0BD 1HI6B 4QT5A 4MNQA 3HC3L 5BV7C 3HTLX 4UU9B 1SVCP 3JTCA 4OLVL 3TO4D 2YZ1A 2EDLA 4XNYH 2EZ0C 2F53D 2HA1A 5E9DD 1XR9B 4PUBL 3RDTD 1BEYL 2E6PA 2V9RA 4PRPD 3DV4A 3RWFB 2FATL 3QNZB 5EUOA 2APTA 2BVQB 1ND0A 4BKLB 2H2SC 1BOYA 5FO9A 4PGCA 2HMID 2GJZA 4NNYB 3KPSE 5BW7A 1FYTA 1WBYA 3O11A 5E00B 5ESVA 2UWEF 3C8DA 1KCVH 5FKPA 4YXHH 3GGWA 5IVXA 4X98B 3QBTB 3TPUB 1XEDA 3CLFH 5KVGL 3BKYL 4L3ED 1CU4H 1IFHL 5DMYA 5DRXB 3GSOB 3MPCA 1IEBB 1VFBB 2DF3A 3IDMA 3QWQB 4G9DA 4ONFH 2HRLA 3QISA 4JFQB 4PRID 5FYLE 1X5KA 5SWZA 5KSVA 1K8IA 2OI9B 2GTZA 5BZDB 4XH2A 2OM5A 2JK5A 4P4KD 3RDTB 4NQCA 5JXEA 4UTBL 3QG6B 4JFEE 3SE4C 5IR1A 1NGYB 3DRQB 5FYKL 1YN7A 3NFSL 3C6SA 1GGBL 3EZJB 4ZODA 5C1MB 2VWEC 3CU1A 1NCDL 4IDJH 3CVHA 4XNZC 5D7SL 3O3UN 2WUCL 2C3VA 2B20A 4HV8B 5DHVH 2EDBA 2I9TB 1VA9A 2NW2B 4HSQA 3SKOB 2W9DL 1HWHB 3DIFA 4XAWL 1UB6A 1MHCB 1U36A 5C6PB 5C0DB 3U83A 1VADA 5D7LA 2B0SL 2CD0A 1NFDB 4LVNC 5DJ8A 3C60A 1AO7E 1JMXA 3FO9A 1DZBA 1GOHA 2G9HA 1FVEA 4QRUA 3DO7B 5GS1A 1F8TH 4YIQB 1LE9A 5IMKA 3T65A 3ORJA 1F58L 3ISWA 3L5JA 2NY2D 4PV8B 1F90L 3CX5J 3TIDB 5IK3B 4HT1L 4IIQC 5CJXC 3I6LE 4H20L 2O61B 4RRPA 3HE7C 3K4ZA 4QTIL 4EIGB 3KPRB 4AJ0A 1K9TA 1AE6L 4YFDB 2HLFC 3T77B 3INUH 1QNZH 1RK1B 3NIGE 2ICEA 1RUMH 5HVWA 5IB2A 3FJTA 4PLOB 4OGXH 4FABH 2LFGA 3I2CL 3WL9B 5SWQA 4H88L 1QFUL 3AS0A 3SGEI 1JGUL 4NM4L 2EO1A 2MOVA 5IIEA 4PB0H 3MRDA 1HH6B 4QRTA 5EUOF 1FFQA 1EHXA 2HJLB 1F4YH 4PRNA 4I3RH 1XFPA 3LKQA 1T1ZB 4PJCA 4Z0XA 4DJMA 4FQLL 4JGUA 4YZFE 2XN9D 4LLYB 2BHUA 3UYRH 1R0AL 5KVDL 4M48H 5CWSA 5DYOB 3KLAA 3ZE1E 3GSQB 2NZ9C 2CLVA 3RHWF 3WJJA 5IVXF 5K9OA 4PJEE 5FCUH 3SGEH 5I1JL 1Z9SA 1AY1H 3M1BB 3MJGX 2NR6C 1JGVL 5CUSH 1NC2D 1YEGH 2YMXH 2VLKA 3S5LB 3FFCA 4JDTL 4E42B 5BVPH 2JKXA 4GXVL 3RX8A 5FUZL 3HMXH 1YQVL 3EFDH 3PHQA 1CGWA 3G5VA 4I0CC 4TUOB 1RZIB 1DVFC 1IGTB 4NZUL 4NQXA 2ZUXA 3HG1A 1YY9D 1FL3B 5ABDE 1NBVH 4PJIA 4KTEL 5D9SA 5GGVL 2R4RH 5LBSH 3L3GB 4BELD 3ULVD 5LXGH 1MEXL 4KRPD 5I73B 1CE1L 1SYSA 1CVRA 3G6JA 4WJ5B 2YA0A 3EYSL 1BREA 2PN5A 2I24N 1FIGL 5I9QC 4TOYL 5EU6B 5HD8D 2YK1H 3IXAB 3EOBB 5KSUA 5TQ0L 5I18L 1MLBA 2W38A 4OBRA 5E56A 1UG9A 3OPZH 1G9EA 5HDQL 3SGJA 1T89A 3GMRB 1QSEE 4X7TA 3SGKA 2IPUG 4NQDE 1SM3H 4PJBA 1BJMA 5DK2B 5L6YH 4U1KA 1PYWB 4FQPA 3MRJA 1WC7B 2H1PH 3B3IA 1UJ3A 1L7TH 3GBML 4U1HB 5FK9A 4LP4A 1JUFB 3IDIB 2DMKA 5EG6C 4LSTL 1Q72H 1UVQB 3UO1H 1LWRA 1H5BA 2Q86A 4Y2DB 3WSQH 4YPGA 4PV9A 3UAJC 4KKAD 4Z0BH 3TBVB 4R9HA 1KTRL 4OCWL 4ZPTA 1JGEB 2P5WD 2X4TB 4ZPVB 4Z7WA 3QCVH 1V7MH 5D1QD 3FRUA 4DZBB 5FYJD 1L6ZA 5DT1H 1KJ2H 1MJJB 2XQYG 1TVBA 3U4EB 4YC2C 3MV9E 4WI6A 1FE8H 3X12B 5I1IL 4FQXD 4K2UH 1YY8A 3RVUC 3O6KL 5F7UA 3C5JB 1YNKL 1CFTB 4DGIL 5GSVB 2O93L 1CR9H 3CLEH 4ZTOH 1ZGLB 3GKWH 3CJJA 3CFKB 4D0BA 2IMMA 4UAOC 3VXSA 1UA6H 4WGVB 2FEEL 5DDHB 4ZYKB 4IRZL 2ZUWA 4HIJA 5IW1B 3WIIH 1KENL 1AH1A 4TSAL 5HI5D 1INQB 2AXGB 3OXRA 2X1QA 3QR2A 2K1MA 3SEPA 1MNUH 1KB9K 2GY7B 4G8IB 2P5WB 5TDOA 1H3VA 4OD1H 4P5KA 4DTGH 1U3HA 1N64H 2KH2B 3SDXE 2CPCA 4AZ8A 3WFEL 2MQ0A 2ZCKL 5AWNH 4FQXB 1AGEB 2ARJB 1T2XA 1F02I 4G6FB 3IFLH 2WWMD 4JY5H 4WTZA 2MJWA 5KN5B 4TPRL 1NKOA 2MFNA 5GZOC 5J1SC 4JY6B 3H9HA 4PD4K 5E2UL 2J3SA 1ZAGA 3IF1A 4PGJA 2Y36L 4GW5A 2A6IB 5FGSA 2AJYH 3CVHH 4UOW0 5I8CB 1QLEH 3DXAE 2D4FA 5E2VL 2DJ4A 3GSNA 3NCYP 4F7CB 1KTLB 1KN2L 4I5BB 1C7SA 1EJ6A 1P5UA 3UC0H 3M8OH 1DP0A 1A64A 3P9WB 2VDQL 5KANG 4OFVA 4A6YB 5T1MB 2RHEA 4MD0B 2JTDA 5HVGB 1NEUA 2F8OA 3NCFB 3UZVB 3ULVL 1FZMB 3SE3A 3F7YA 5INCA 3NA9L 1EBPA 4KK8C 4AEFA 2A6JB 3QFJD 2VYRE 4YDVB 2Q7YA 4HUVB 1I8MA 1RU9H 3HR5A 5ETUA 1QA9A 1JTPA 4D3CL 4AEEA 4P9HC 4N8VA 5DVMA 2QQKH 1XZ0B 2V5MA 3GZKA 2A83A 5D6DA 1LO4L 1OP3K 2F54D 1F4WH 4PR5A 1UM4H 3C2AL 2F5AL 2APXA 4K7PX 1KC5H 35C8L 4TNWF 2H32H 3L3DA 1DBBL 3QQ9C 4HGWB 4QRRE 3RY5A 3T0ED 3MNZA 4KY1L 1OGAE 4YBQD 5IB1A 4K3GA 5D72L 3QIWC 1HH9B 3C6LA 2GT9A 2UWEB 4LCIL 5AYQA 2J88L 1XMWA 3X11B 5E99L 3CC5A 1QR1B 3I3DA 3ZTNH 4EOWH 3T08A 3BPCB 5AYUL 4UINH 1LP9A 1MFEH 3DUSB 3V6ZB 4PIRF 4WDIA 2ZCLL 5D2NE 2AV1A 4LEXH 3BP4B 2DQJH 5ICXB 5MHSE 4OLEA 4OZFB 4UIMB 3TA3B 5KS9E 3KAAA 1T5WB 3I02A 5FV2A 2DI7A 2HT2D 1IAIM 5ISZA 1E4WL 3MUHL 5CD3B 1FFOB 1I7RA 4TUJA 1JIBA 5T1LD 2IBZY 4YBHA 5DRNA 3PP3H 4ODSL 3G6AB 3L5XL 2Q6WA 4WI4A 4NP4H 4OD3H 1MI5B 5FGCE 3TT1H 4ONGL 5DJ6A 3FFDA 3I85A 4U31A 3X3GH 3WNLA 5KAQG 3PWLB 1C1EL 1CK0H 1A14L 4NPYB 1BFTA 1RUAH 3QG7L 4N0UE 3EBAA 3OKLA 1AHWB 1MREL 4MNQD 2AJSL 1Q94A 3QIUC 3H6JA 3SE4A 1FH5H 5C8JA 4FTVA 1A5FL 5GGSB 1JI1A 2AXFB 2D7NA 3MRBA 4U7KA 4XP6L 4A6YL 1XF5B 3QNYA 5TDPA 1CYGA 4LCWA 5FM8A 5TH2A 4PJDE 3ULSB 3MRGA 5F8QC 1ERNA 3O3AB 2BSRB 4QEGA 5AZ2H 5EU4A 3UEZA 4U1LB 5EH1A 1NGQL 1FYTD 4NT6B 5B8CA 3RKDC 3FN0L 5FHAL 4DK3A 2NY3C 4NJAH 4IRJB 4GKSB 4NSKB 5ITBL 1NSNH 2ZOKB 4DUWA 4X8XA 3I9GH 4LKXA 3V9FA 1YPZA 4QT5B 2VRAA 4MNQB 2V2TB 1XGQA 4IHOB 3CUPA 2J6EA 4M62L 5I75B 5C0JA 4KTYA 1KPVB 4Z95H 2NYYD 3MLTB 2DQIL 3TYGH 4XTRC 3RPIA 2FIKA 3MXVH 3ARTA 4OT1L 5JXED 4NQCD 1YQ2A 5E4EC 4ZTPL 3CFJA 3ARQA 3KNBA 2AKRA 5LGKA 3R0NA 3BFOA 4NQEE 4LNVA 1TZIA 1AJ7H 4K07A 3LQAH 1J8HE 4LLMB 2IANB 4XPTH 3S35X 5GIRA 2GJZB 3O9WC 3BP7A 3CK0H 3VMOA 5FDYA 2E5EA 1AI1L 1Z0NA 4MJ5B 1YEIH 1UCBL 2MHAA 4XCYA 2FO4B 3SQOH 3F6IA 3GGWB 3F6LA 5EOTB 3MA9H 5IVXB 3IDYC 4EN3B 4Z7VF 1A6PA 5D96C 1G0DA 2YRLA 4I2XE 4P23B 3PABA 5D7LD 4MA1C 4K3JL 3C09B 4P2QA 3S37X 5EBLA 2DQHL 4P5TA 1OWWA 4QYOB 5AZEL 3C60D 5KSBA 3WLBB 5KSVB 3HCVB 1GAFL 1E4XH 3OGCB 4G9FB 3QUMB 4FQQA 4J3OC 3RGHA 5LAXA 4UDUB 1YN7B 4ZUUA 2BY2A 4KI5C 3TT3H 1KFAL 3V95A 1E4KC 3EOAB 1RZGA 5DD1L 4DKDC 1DSFL 4RGMB 4R8WL 2BY1A 1PEWA 3ZSSA 1M7DB 1OW0C 1LD9A 2KQNA 3DIFB 1RJZA 5D7LB 1ODAA 2YPVL 1AGDB 3MV8A 2ESVD 1JL8A 2R0WH 3PV7A 5BVJA 3C60B 2CGRH 1EXUA 5ADOL 3P4NB 5D6CA 3BDYH 1T83C 4Y89A 5HGHA 1LE9B 5JR1L 1GYAA 4Z18A 5GJSL 3BESR 2XI9A 1HQ4B 1T0MA 3A6OA 1BECA 1Q9WB 3Q5TA 2WWKT 4LHJB 1HHGB 3OSKA 3LD8C 3GBNL 2EIBA 4Y4KA 2F58L 3SPVB 1BQLH 5GHWL 3GMMA 3RFZC 1Z0MA 1TVDA 4TUKH 3GMNB 1MCBA 4PJ5E 1YPZF 3IJSB 3HNVH 2VLKD 4X6EB 4PTTA 3FFCD 4Q7DA 3L5WB 2Z31A 5AAWA 5KW9H 5K9JH 2ESVB 3OKDA 3RU8L 2Q7NA 3UTSA 2EDEA 4WW1A 1VGEH 3HG1D 4HS3A 3GJEA 2R2EB 1JF5A 5F21B 4QWWC 4NQUA 1I8KA 2F74A 3BIKA 1IQDB 5C09A 3IJHB 3TLRA 3HKFA 4Q97A 5ADPH 2JCCF 4HS8L 4ERSH 4WNQB 2P5EA 3RVVC 5D7JB 3D87B 4Q6IB 1HILB 2O5ZH 3VXTA 3MUZ1 3WUZA 4I18B 2CLVB 4PJAE 4KZDH 4KTDH 4TTDC 4GG6F 3CDGA 5KVEH 3JV6B 5HYSG 1RZKL 1MVUB 1MIEL 5HHPA 2R0ZL 3L9RB 2OJEA 3S9DB 2VLKB 2XACC 3C9NA 4K71B 4LLUB 3FT3A 4PJ8C 3QUML 4ODUA 3LMJH 4ZO8A 5DWUL 4AT6A 4YK4C 1H3PL 1OLLA 4NQXB 5BMFH 2NX5D 3HG1B 4UUJA 4QY8B 4J3TA 2CSPA 1GXEA 5IQ7L 2CK0H 4FFYL 2HT3C 2J8UF 3GIVA 4JO1L 3OL2A 5SV4A 3P2TA 5F96H 1SYSB 4C55A 1KIPA 2IG2L 1T6VN 2GTWB 3NCMA 1T2QH 3QUZB 4LCUA 1KBGH 3ULUH 4LMQE 1ZLUH 2PYFA 2WIIA 4CJ0A 1JWSB 3AY4C 1ZGLP 1HWGB 4L4TA 2EDNA 4MMXC 4LLDB 1QHOA 4P3WA 1ZLWH 3O6FB 3PHSA 2KBGA 1I7UB 3BH8B 3D3VE 5I1EL 4Y5VC 4M6ML 1YYLH 1NDGB 1J9CT 1AP2A 1JZ7A 3S96B 3VFOB 3X3FL 5C7XL 3FQNB 1ADQA 1G9MH 4HJ0C 4PJ9A 1EAPA 4U2ZA 1YEEL 4BFBD 4B53A 5LKNA 1NCCH 2NX5B 1E6JL 4F7MB 4MXVE 3CSGA 4V3EB 3HC3H 4LOUC 2GK0B 3CX5K 5F7DB 3VXSD 3LAFA 4N1EA 4OLVH 4AH2A 5DEZA 4PUBH 5T3ZL 1BEYH 1A4KA 3P11L 2P7TB 1VB9A 2FATH 2AVGA 1JVKA 3ZE0E 1BIHA 1JPST 1LNUA 2DM7A 3WNNA 1P4BL 4OD2A 4NN5B 4PY8I 3MA7B 5KOMC 3OAYK 4B7LA 1U3HD 4R4NC 5FOBB 3PUCA 5TE4L 1X5JA 2VNCA 5GGQL 3SJVA 5ALCL 5HHMA 1KIQA 3OR7A 2X4QB 3ARDD 4U0RB 4R2GC 5I6XB 2X1OA 3DMMA 1WK0A 2XA8L 4KHTL 5C0IB 1CT8B 3O2WL 4FFZL 4NHUA 3EDFA 1ETZA 4JDZA 3SDDB 4I0PC 1S9WA 4Y5XA 1XGRB 4LPWA 2HH0L 3OAUL 4QRPA 4PY8J 4ELMA 3U6RB 3BZDA 4MB3A 4UTBH 4GKOA 4GW4A 3OXRB 4HIIA 5ANMA 4RMTA 3FQWB 2YRPA 5FYKH 2PW1B 1C08A 5HHNA 1D5MA 3NFSH 1GGBH 4MD4B 2XZQL 4C56E 4ZS6C 1NCDH 5D7SH 2WUCH 3I75A 4UBDC 3KPLA 1MFBL 4DUXA 5IW3A 1DQTA 1INEL 2ZKHH 1IL1B 3ARDB 2W9DH 5JOPD 1UZ8A 1MCPL 3H9HB 3VXQA 2F15A 4Z6AT 3BGAA 5GRZA 4U2YA 4N9GB 3QULB 3WS6C 4ZO7A 4KK6C 1CQYA 4JRYA 4K7PL 1F58H 1ZSDA 4QHNA 2KL6A 2HKFH 1PKQE 2GYSA 2Z4QB 2FJGA 1WAAE 4I3GA 1S7WB 4H20H 3TFKC 3C6LD 1EH9A 1NH6A 3NVQA 2FIRT 4ZD3L 1SY6A 3H9SE 4HKXA 1CS6A 1U58B 5C92A 4M1GL 3Q6FA 2VC2L 4PDCE 3MRFB 1CWVA 3T0VA 3TN0C 3F7YB 5ALBH 3ZKXB 1RUPL 5FA3A 5LJYH 2L0DA 1U91B 4XNMA 5JXAL 2IPTL 3TBTB 4XGZA 3RIAF 2P8PA 4JFDB 5ETUB 3HE6A 1J87A 1KGCE 4H88H 1G7JB 1M7IA 1JGUH 4MZ2A 3TH3T 2LV4A 4PR5B 4F8TA 5ISZD 1DANU 1WSST 1DBAH 1MLCA 4L4VD 3U0TA 4FQLH 2LAAA 2B1HL 3B9KC 3LVEA 4JFOA 4PRHE 1JZ4A 4HD9A 1R0AH 5IB1B 1RZ8A 4O2EB 4NUJA 5T5NG 5BV7B 1N6QL 3CH8A 2FJFB 3MRIA 1QSVA 3VFVA 1H8NA 3QCUL 5I1JH 1BD2A 4WI8A 4Z7VB 5HGDA 4YHZL 2XWTA 2VISB 1OWRM 1K8DB 2ZSWB 4JDTH 2BVUA 3B4NA 3NAAL 3WFBL 1U8MB 4GXVH 3T0AA 5FUZH 4GRMA 1YQVH 3RWIB 2Z92B 5FM4A 4FTVD 5BS0E 4NZUH 4G7YH 5A3IC 1LDPH 4LCWD 1FNHA 3MGAA 3L3JA 4KTEH 5GGVH 4XXDB 3PIQA 4L4VB 3MNWA 2XNAB 2EH7L 1QFOA 4TSBL 2B4CC 4P57A 2FH8A 1GCFA 4MS8C 4NRXA 4WUUB 4LLAA 2BCKA 3D39A 4PTUA 3EYSH 4JQIL 1J88A 4P5MB 5L2JA 1FIGH 4WY7L 4TOYH 4KJYB 5DJ6B 1B2WH 4KJPC 5I18H 2X40A 1YEFL 5DURD 4UV7L 3PWPE 2VIRB 2GIYA 1ROWA 3W0WA 3WDJA 2JJUA 4Q0XL 5HDQH 1FP5A 2MMXA 3EO1A 5I0ZA 3RTQC 2H2PD 3GSNL 5A2KH 3MLUH 3J8F7 2QADC 1AXSB 2NY5L 4PJGE 32C2B 1FRGL 2ZNWA 1YEJL 1BZ7A 4NOFA 1E4KA 1T4KA 4PG2C 3GBMH 2AJ3B 2E7MA 2MKWA 3MLVL 3LKNB 3ULUE 3TF7C 2OQJB 3L95B 3U0WH 3B83A 5D7IE 3O6LL 5CBAA 5JTWA 3WEXA 3D6GA 5DJYB 2C9AA 4LVNB 3E3QC 4OCWH 2A77L 1W2KT 2FEEI 3FQXA 4ODHL 4OZGE 5C0FB 1JNHA 3QEUB 1BVKB 1YPZB 4P2QD 3V5DA 5TPWL 1JPFB 4M02A 1IGFL 1MCDA 3O3EA 3UTTA 3L7FB 2JJTC 3FONA 4GXUM 3H3PL 1YNKH 4H8WL 2FIKB 4IIQB 4K8RD 2NW3A 4POUB 4HUXA 4DGIH 1EERB 2YPKB 3HE7B 4HXAL 3NCBB 3DUHA 5HHOA 4HF5L 2CDFA 5BV7L 5I1AB 4EQ3A 3V6FA 1U8JA 1P4IH 2NR6D 2N4IA 3HUJE 1I7ZB 4P59L 2BERA 2JCCB 1J7VR 4IRZH 2HG5B 3MYJA 2FHBA 4TSAH 3MRNB 4Q6YA 3JUZA 3MLWH 4RMQA 2NY0C 3MBEC 5ICYA 1MCSA 3D85A 3ZYOA 3DVIA 1JI2A 4GG6B 4U0QB 4WHTA 5FYJU 5J9PA 3RZCA 1OVZA 5EZLA 4I3SH 1U93B 1CICA 3MV8D 3WE6B 2NY6C 3WFHA 1FBIL 3S36X 3WFEH 2ZCKH 2DBLL 1RHFA 1T1XB 2AJZA 5D71L 1OB1A 4GAGH 4ONOA 1A1NA 3ME0A 4FQQB 4TPRH 2DLEA 5JPNB 4YHNA 4E5XB 5E2UH 1NBZA 3GMPA 2OXHA 3DARA 4LSSL 2BZDA 3HZVA 4ZUUB 2J8UB 1QOKA 4KUCF 3ZYZA 5IMOA 3REVA 2VSDA 5L9DL 3FB5A 4Y4KD 1NBQA 4M43L 1CG9A 4ESKA 5FYKE 3TJHA 4YHML 2EDOA 3BDXA 4LF3A 1I1FB 1KN2H 5IT2L 5KSAA 1DVFB 5EO1A 2VL5B 1S7TB 1ZOXA 2VDQH 1IAOA 4D9LL 2EDJA 1UM5L 3M17B 5DMGD 3BWAA 5GGTA 1TENA 1H15A 2EEBA 4KI5F 3UTSD 5LWYL 5HYJA 3EDKA 1XF2B 5DJZA 3MRRB 3SKMA 4R0LC 3NA9H 1WFTA 3P9MB 2YSSB 5I9QB 2BVEA 3V4UL 3BH9A 3MGTB 4Q74A 5FO7A 4D3CH 4PJ7E 5FM5M 2P5ED 4P49A 2HTLD 2NLJA 1F42A 1I7TB 4EVNA 3FCTB 1LO4H 2F5AH 1JWUB 1JJUA 2J6EL 4PYGA 4L3AA 4GKZA 3IETB 1U8LA 1ZHNA 4POZD 4QTHA 3NCCB 5B3NA 3I84A 1Q0XL 5D72H 1QFWI 4JQXC 1MWAA 4JRXA 2YR3A 4OGYL 3VDCA 3QEQA 1KJMA 2J88H 2LVEA 1CXKA 3OKDB 5E99H 3VRIA 2YUXA 2F5BL 1ZA3B 4KK5D 5AYUH 2XWBB 4NQTA 2CIKB 5EBMA 2ZCLH 1T0PB 4LVEA 3CSBA 5E6IA 1YEDA 3BIKB 4OUUB 3NFNB 3T1FA 5D2NC 4WHCA 1NMCC 1KLUB 4MD5A 3TBWA 1LQVA 5BOZG 4MJ2A 4S0SD 3VFPA 4B50A 2CO6B 1E4WH 1A1OA 4L4TD 1FO0B 4XPGH 3MLXH 4YC2B 4YHYC 4HUMB 4PRBA 1XH3B 5CHNB 3TPUE 1HHHA 5B22A 3L5XH 5D93C 4R7NA 5C0BE 4K8RL 2R1XA 5GZOD 4LQFL 3F5WA 4ONGH 1G7HA 4UAOB 1QBLL 2H6PA 4PJ9D 4YR6B 4I0PA 2KUTA 4QGYA 5D5MF 5E9DE 1QPXA 3QG7H 2F53E 2XKNB 4UUJB 1KJ3H 4HBCL 4PRPE 2AJSH 2V7NA 4XWOC 2VXVL 3DGCR 3GIVB 1C16A 5FXCH 4Y2OA 1KXQE 1G84A 3DX9B 5ILTH 4WO4A 2JF1A 1EEZA 1B4RA 4JJ5A 1Q9OA 2WIIB 1I8LC 4XP6H 2EXYC 4A6YH 4G6JL 1MVFA 4H26B 3WKML 4YXLL 1QZ1A 2BSSA 4L4TB 4GW1B 3UTPE 3VRLF 4ZMAT 3ARGA 1X5GA 1NGQH 4GRWF 1CN4A 3QCTL 2CMRL 2XTLA 3D0VB 4WIQA 3VMNA 1SHMA 3FN0H 5FHAH 3SJVD 1FL5B 1NFDE 4LHUD 2IH3A 2I9LA 1BQHA 4PRIE 4CADB 1EAPB 3SDYL 4MQ7B 5KG9A 4MSWB 4CVZA 3P9LA 1A7NH 1ZHKB 4MWFA 3VXOB 3DMMD 2ATKB 2D7TL 4CMMB 3PJSA 4M62H 4TNVF 3QQ9D 2N7BA 4QRPD 5IKCA 1SYVA 4AH2B 4OT1H 2XZCL 1CL7H 5SWSA 3TFKA 1A4KB 4YO0A 5I16B 4ZTPH 2VXUL 4MCYA 5CIPA 3PL6C 4DK6A 4RMRA 3AM8A 4OD2B 5F93C 4ZOAA 4JAMB 5DFVC 3D48R 1AI1H 2W0FA 1UCBH 3MCKA 4GBXC 1Q0YH 3EHBD 4QXTB 4ZUVB 1PDKA 5MEQB 3FO0L 1Z2KA 1A2YA 1ONQA 4LHUB 4RISH 4ZAKA 3Q48A 3V8CA 3OKKB 4X5XB 1FNSH 1KIQB 3B43A 4MA3B 4J3WA 4G6AC 3D18B 5GZND 3EGSB 4FHBD 1DN0A 4HUUB 4K23L 3X14B 4BSWA 4K3JH 4AQOA 3MRMA 3UBXB 4H25B 1FO0L 3BW9A 2IALA 2DQHH 2A0LC 1ETZB 2ATPB 4G43B 2YD1A 4HFUL 2WZPD 1YYML 1GAFH 4DZ8B 4ZO9A 5F6HI 1HOCB 3QIWB 4JRYD 2DYPD 2A6DB 1WVZA 4BFIB 4U6HA 4OFDA 5CFHA 2Y07L 4LEOA 4PJFF 5HHNB 3WLWD 1KLGA 3QEHA 3ZHDA 1CE6A 1KFAH 3SE8L 4XMKL 3VFNB 5D1ZA 5HI3D 1GGTA 3UTQA 3WBDA 1NAMA 2XV6B 3B6SA 3D9AL 3EO0A 5DD0L 2VLRA 5M94B 1MY7A 4R8WH 4K94C 5IG7B 4GG8A 2OP4H 2WV3A 5F6HJ 3N85L 2CDGA 2UY6A 4U1SB 1NFIB 3E6FB 2YPVH 3HE6D 1LEKA 5BOPA 1YMMB 2L4OA 5I1HL 2W9LA 5EORL 4DQOH 4OI8A 5ADOH 2Y23A 5EC2B 4NUGL 3V2AR 5DHYA 4HUWA 3DVGB 3PGFH 5HGAB 1HDMA 5L0QC 3ZYJA 5EU6E 5JR1H 1AD9A 2DYPB 5KVFL 5GJSH 4ONHB 1TQCC 2A9NL 4G8EA 3VFGL 1BBJA 2AJXL 5I8EA 2C3GA 5I1LB 3GKZA 3OZ9L 1R3IH 5GRWA 3EOTL 5MENA 1D5BB 3GBNH 1NC4B 2F58H 4PP2A 1PX4A 3DGGA 1DTUA 3DX7A 3QIUB 1A3RL 2CRYA 5C0EB 3TJEL 1BD2D 3KJ4C 3Q6GL 3T8XB 5FA3B 4JREC 1FVDA 1RVFH 3RBSA 2VE6B 4XGZB 2P8PB 2VQTA 4PG2A 4ZSOA 1X5IA 3ULVE 1A6VL 2FX7L 4ZFOA 1S9YB 1OT1A 2PKDA 5AUMA 5I1CL 2YD9A 3WFCL 3QPQC 3GSVB 2NY3B 1OGTA 4HS8H 4P9HL 4MXQA 1F11A 3UDWA 1MCWM 2P8LB 3D39D 1FGNL 4KUCD 2VUOA 2VL4A 5F9DC 5F7MC 5F70A 5HGBB 2ID5A 3NTCL 3VGDA 1C5DA 4CN4A 4OGAC 2EC8A 4TSCL 3VFVB 1DQJB 4XBEL 4ZUSA 2YD7A 5CEZL 1RZKH 1MIEH 3W82A 3RJQB 2QHLA 2R0ZH 3W0WD 3LB6C 4F7PB 1EV2E 5A16A 4RZCA 4X6BA 1Q1JL 5C08D 3DX6A 4BYHA 5E4EB 1KELH 4EUPA 4OQTL 3QUMH 4PBXA 5DVOA 4JPIB 3B9AA 3VG0L 3GB7A 4KI5D 1IAMA 1R5VB 3BDBA 3O9WB 4AIXA 2IEPA 3CFDB 4JFXB 3T4AA 3I6GB 3NABL 1JTOA 3MRCB 3GMOB 3OTTA 5IQ7H 2HFEA 1F13A 3MNWB 4FFYH 3IS0X 2QV2A 3IDYB 4PJEF 5JIPA 1QLRA 4G6ML 4WV1A 2WBJC 4JO1H 3EKCA 5JHLL 2P5WE 3VXMD 2IG2H 5D96B 2ENYA 5HDLA 4PTUB 4GT7A 1T5XB 4MA1B 2Q76B 1BIIB 1WBZA 4KQ3L 4BZYA 1UFUA 1JTTA 3DO3A 2VDNL 2VUYA 5CJBA 3W0WB 5I1EH 5E08L 4M6MH 3WIHA 1U8KB 3IU3B 3JWOC 2YD3A 5C08B 1PLGL 3OQ3B 4GJTB 1ZANL 4ODWB 4OTXL 5C7XH 1QBBA 1NGPL 4M4RA 1YEEH 2PO6C 3TEUA 3UYPA 1C12B 2Y06H 4KKLD 2IAMA 5HHOD 3K80A 1T4KB 2B5IC 3A67L 3WIFA 2I27N 5EPMB 4XVUC 3VXMB 3EZ8A 1CFNA 5F1IB 1SBSL 2EDWA 4HULB 2F9BT 5T3ZH 2BVTA 4QRSB 5TQ2L 5BCAA 1OCWL 1UWEL 1MSPA 1KPUA 2BY0A 4OUOA 2PYEA 3D85D 4OLYL 4KDTA 1RAMA 5DC9B 1FVCB 1P4BH 4OLUL 1R3HA 2OR8A 1I1AC 3M45A 5C0GB 1H3GA 1BJ1J 3DROB 1VEMA 1CICD 1TQBC 1VFAA 3STLA 2MQ3A 2FWOA 4X80L 1G6RB 4X83A 3GO1H 3DSFL 4AEHH 2YWZA 3G08B 4F2MA 5E70A 5ID0B 4ZG1A 4XP1L 3DRTB 3D25A 4U1NA 1FG2B 1PQZB 3LD8B 3EFFA 2XA8H 4TTDD 1K2DB 4KHTH 5J1TC 3O2WH 4FFZH 4HMCA 1JZ8A 1U8JB 4XVJL 3BX7C 1ZE3C 3ZZ1A 2FD6L 2HH0H 3OAUH 3TNMA 2EDXA 2DRUA 2EXWD 5E7BA 5CEYA 5J6HA 2JB5L 5E8NA 1DQDH 5DJ0A 5H94B 1RHHB 3TJHD 4Y5YC 2YPLA 4M61B 4U6XB 1UXSB 3VFRA 1D5IH 3PF2A 4AG4L 1OSZB 1WITA 1IARB 1ZLSL 2XZQH 3K1KC 3CFEA 5EZLB 5FAAA 5C9JB 3QFJE 2J1KA 3WFHB 3MFFA 1DANT 2GQHA 2NXZD 1MFBH 3OXSB 4MA8L 2XFXA 4OZHA 5FM5O 1N3NB 5HYJD 2CK2A 4XXCA 3GJFA 3FOLA 4HPOL 5D5MB 2F54E 3KYNB 2HTKD 1C5CL 1P2CA 1NQBA 4IOIA 4JM4L 3WNOA 3GMPB 1T7VA 4GXUN 4E41A 5JW5A 5IHLB 1PSKH 3DVFA 4MNGB 2K7QA 4WW2A 1MI5E 1RMFL 1N5YL 4OIAA 2R69L 4PJ8B 1A9BA 2FYYA 4TULL 5LQBL 3TWCL 2XQBL 4PGEB 4YK4B 4PGDA 4AEIL 4AL8L 5E8PB 4G80A 4DKEL 3LS5L 4JRXD 4GRWB 4ZD3H 1EA9C 2VZOA 1CZ8L 3QEQD 1OAZL 2BOBB 5IQ9A 2VC2H 3QXAB 25C8L 4XP9L 1RUPH 1Z5LA 1GZPA 4G8FA 3THML 2DKMA 5E6ID 3SDAA 2PUQT 4Q9QH 1B0GA 2C7UA 2H41A 3BAEL 5FO7B 3R8QA 1J5OL 2XTJC 5J56B 1LE5A 4HMDA 2IBBA 5GRUL 5H35A 3QWOB 5DFTA 1HHIA 2YC1A 4Y5VB 2ED7A 5HI4C 3OKEB 3L3OA 4NO0A 1AC0A 2X9XA 2A38A 3JXAA 1Q9KA 2B1HH 3BQUC 3O2DA 4QTHB 4LRIC 4R2GD 3OWEA 1EDQA 2DLHA 1IKNC 1MWAB 4MNQE 2DWDB 5I1KL 1GC1C 3RVXD 4M7JL 4BH8B 1MCWW 3O3DA 1SJEB 1KJMB 3QEQB 4I0PD 1Z3GL 3QCUH 1J11A 3ROOB 4GUPA 4ZDHA 2BFVL 2DI8A 4ZNEA 4JHAL 4YHZH 4QRQA 1B0RA 2DQGL 5EBMB 5EUOE 3NAAH 3WFBH 1S8DB 4JZJC 2ILLA 2EC9U 2IANE 4JZNB 3BRGC 4WO4D 1D5XB 3JV4B 4Y4FC 3OX8B 4FFEX 3RUGA 4KXZI 1FYTE 4HWZA 2Z9TA 4G8GA 2UUDK 2Q87A 4MLIA 3IDJA 5IVXE 1R3LA 2EH7H 3DBXA 1HHHB 3ARGD 1JHTA 1HCVA 3FMGL 4PJFB 4GSDL 2ZUYA 5C0CA 4R2GB 2XRAL 2AXJA 2GW5A 5EIVA 4XMLL 5ENWB 3ZSTA 2DQCL 4WY7H 1BAFL 5M7QA 2XYCA 2GCYB 3AUVA 5JW4M 4I0PB 4DW2L 1YEFH 3IDNA 4S0UC 1ZGLM 4UV7H 1TFHA 3TBSA 1C8PA 4KXZH 4M03A 2D7OA 1ZHLA 1IKFL 4NQCE 1OAQL 4G9FE 5DJ2B 4Q0XH 3WN5C 4U1MA 4YHOH 1CD1A 3U2SB 3PWNA 4NKOA 5T33L 1QVOB 4Y1AD 2ADJB 3RL1B 3TFKD 5BO1L 4JJ5B 1YEJH 2HLAA 2GHWB 3HI5L 2BSSB 5J57B 4J1UA 1MELA 2J12B 1ZVHA 3MLVH 4OZ4B 3TZVA 4HH8A 4PGZA 4BH7A 3O6LH 4HGKC 1UEMA 5D7LE 2YRZA 3RPKA 3RX5A 3O4LA 5IJKC 1WCBB 3WNPA 5DRZA 2ICWB 2ZCHL 4OLWL 4FZ8L 4ODHH 1FNGB 4AIZA 2FJHA 1PGRB 1AO7B 4TRPL 2XWJB 5TPWH 1QLFA 1IGFH 5F72S 3K46A 2AGJH 4N90D 4Y1AB 2D7MA 3UPRA 3H3PH 4RFOL 4H8WH 2Z91A 3IFPB 1MWAL 4HXAH 5EZIL 3MNVB 1J0IA 4LLWB 4HF5H 5BV7H 3MRQB 4NM8L 3BD4A 4PREB 2V2WB 4P59H 3TN0B 4ZFFB 4EI5D 5D1ZD 3GNML 5DMKA 1MUJB 2VLRD 4QHUA 3LN4A 1W0WB 2ESVE 4NKMA 2BNRA 1NUDA 2WK2A 5J8OA 3G5YB 4HWBL 4YFEA 3H7LA 5JA9A 5A3ID 3CSPA 1DBML 1K5NA 1CDGA 4FFVD 4I77L 1I9RL 3S7GA 4YGAB 4M5YH 1FFNA 4AK1A 3VXRB 1FBIH 5L2KD 3QUKA 4I1NB 2DBLH 1BOGB 3B9KB 1JN6A 3REWB 4D8PA 1OTSC 5GQBA 3FQRA 1S7SB 4C54A 2VDKL 4UIKL 1EPFA 4PJHA 2BVOA 2OMNA 4OBSA 4S1RH 5I15L 1JBJA 2W60A 1K3ZA 1F45A 1KLGB 3J7HA 4MA7L 4PJEB 4XPHL 4FQ1H 5L9DH 2VLKE 3QZWG 5FYLL 4OAWA 3FFCE 4F3FB 4M43H 4X4XB 1VENA 2VLRB 5JORB 4YHMH 5IT2H 2QADD 1EFXA 4OKVA 3K7UA 3HG1E 2AJUL 1ED3B 4D9LH 2GFBA 1UM5H 1Q8MA 4QXGL 2CKBA 5L2KB 5LWYH 3T2QA 4JFPA 5FIEA 4QHMB 2FSEB 4HKBA 1UKTA 5IM7B 2NPLX 3HS0A 5IMLA 1TJGL 4X4ZA 4FS0A 4WU5A 3VFWA 1AD9B 4EEEA 3UPAA 4UT9H 1EBAA 4JCMA 2IPKB 2VAAA 1OF2A 3GSUB 4P99A 3EO9L 4JHBA 1K4DA 2FRGP 5EIIB 3RTQB 4LP5A 2Z93B 5LCVL 43C9A 2CR3A 3IFNL 2QADB 1AQDB 3GSXA 1JF1B 3UTZA 2NX5E 1Q0XH 1UC6A 4NQDB 4R3SB 4P3DA 1OL0A 3G6DL 4OGYH 5C07A 1CDBA 5FOJA 3BZFB 1IM9A 2APWA 3FOMB 2F5BH 1CDIA 1VDGA 1QEWA 2MSPA 3B2UC 4PLJC 5DJXB 1FFPB 4CU7A 4NO2B 1OARL 2AP2A 1WFOA 2HJKA 2NY0D 3P40A 3NH7L 5TFSL 1XGPB 4EDWL 1KEML 1FCGA 3FO2A 5C9KA 3LEVH 3MBXL 5IF0B 2EIZA 3T4YA 2DWEA 1IM3B 4UV4L 1OPGL 3HAEB 1F3JA 1U8HB 4RDQF 2VLJA 5HVHC 1MCLA 1GH7A 1G7MB 5HYIA 1LK3L 4JGMA 5C2BL 5ACMA 1TTUA 5JLZB 1KB5B 3N1QC 4LQFH 1NBYA 1QBLH 1WICA 5MEPA 4QGTA 2ZOLA 3FT4A 3WYRA 1CTNA 4OF8A 3P0YL 2AK4D 2ADFL 1RJYA 4HBCH 2IAMD 3TO4C 5ICZA 1V7NL 5FUCC 2VXVH 1KJVB 3B2VL 3MBEB 2NY0B 1X4YA 4JKKA 5I76B 2A9ML 1TMCA 2RQ8A 4EBQL 5JHDA 3GUTA 2D9QB 2EKJA 4RAUB 2FZ3B 5IEKA 2HMIC 4O51B 3B9VA 4XBGB 4G6JH 3WKMH 1P7KB 5IGXL 2PYED 4YXLH 2NY6B 3ABZA 1WBZB 5EUKB 3ILPA 2X4PB 3GI8L 5CS7A 5B4MD 2B4CL 2NY1D 3QCTH 1NDMB 2B7DT 4MAUL 5E95B 2X4OA 3GI9L 3IXTA 5ITFB 4RMSA 4L8CA 4K7FA 3LSOB 3V6OC 4L8SC 3SKUD 4NWUL 3SDYH 1OAXH 3T0XA 3BHBA 3PDOA 1ZLVK 5CMAB 2AK4B 1SJXA 3PWUB 1XGTA 1A6AA 1RURL 3BO8A 5C2UB 3SO3C 2F8VA 4DCQB 4IMLB 4P4KC 3MXWL 5DK3A 3MRHB 1F4XL 3L3HB 5CJOL 1J1XH 2B8OT 1BQUA 1BFSA 2XZCH 1I3GL 1KPUB 3C5SB 5TE7L 2VXUH 2YPLD 3O41A 1WT5A 3LRGA 3WJLA 3U0PA 1KTDB 3PWJB 4HH9B 1R3HB 1ZV5A 5JOPE 4R0LB 1I3RA 5EN2A 2NY1B 5EFIB 1N4XL 1A7BA 3VE0A 1EHNA 4YHKH 3AS1A 2ZUQC 3FO0H 4JFDE 4HDIB 1QFPA 4FFWD 4F2MB 2ED9A 3NCYS 1A6WL 3D25B 4XCEB 3EJJX 2GJ6A 5IBTL 3EYVA 5KBNC 3IVKA 4BSVB 1HHJB 4HFUH 1YYMH 4MQSB 4XB8A 1U8PB 4M7KL 2NY2C 2X4UA 3DYMA 5EU5A 2GITA 2DBJA 3S5LG 1KB5L 3OKMA 4X7SL 2E6JA 3BUYB 5F1NA 2Y07H 4Z7VE 8CGTA 1S7RB 1NLDL 4QOKA 1FYHB 4XMKH 1BWMA 5JNYA 3D9AH 3GHEL 4U6TA 5DD0H 1QHPA 4WHDA 3BEWA 5D2NB 1WTGT 1NMCB 1ORQA 2ZSVB 4W6WB 4HS6A 4JHZA 3N85H 2EXYD 4UDTA 3MOBL 4WENB 1CLCA 4L4VE 4NYLB 4K9EC 4YHYB 5I1HH 4AMKL 1S7UA 4WUUE 4NUGH 5D93B 3HN3A 4ODVL 2Q1EA 5IVOA 2G5RA 4HK0A 4JANA 2C1OB 3PGCB 4NO0D 1YZZA 3CIQA 1J05B 5FGRA 5E0QA 5FGCB 4NOBA 3RP1A 2A9NH 1U8OA 2GSIA 4QF1A 3PWVB 2AJXH 3VFGH 3F7VA 2A73A 5KAQF 4RFEA 3OZ9H 3EOTH 1UWXK 4DGYH 3VWJA 2UYLB 4RSVA 2NNAA 3TJEH 1I8IB 5T3XD 3Q6GH 3RY6C 3VGFA 4F7TA 2VWEE 5IEHA 1WZMA 3SO5A 3MMEB 2P46B 3QH3B 4JZOB 4UT7L 2ITDA 4P46A 4MJ4A 2RFXB 3DNKA 3UBXI 4Y4HA 1TNNA 1YY9C 4Z7UF 3ARFA 2OTWA 1A6VH 2FX7H 3IJYA 4IRSC 1CDUA 4YAQA 1HHIB 4KRPC 4NBZB 5I1CH 1HKLL 3WFCH 3L3OB 3FTGA 1HKFA 4ODXA 1I1CA 4Y19A 3UMTA 5HD8C 4HAGA 4P9HH 1ZT7A 2WQ8A 3JTSB 5DQ9A 5C0CD 4L9LC 1YPZE 4HIHB 4NZRL 3F12A 4JPKL 2ADIB 2FNBA 3F7RA 5E8EB 3BIBX 1RJLA 5CEZH 2Y7QA 1DE4A 4YDIL 1REIA 1T7XA 5DEGA 4H0GA 1IC5L 3R06A 3CSYA 1IT9H 4OQTH 3NACH 2E7CA 2W65B 2VAJA 1J0ZA 43CAB 3PL6B 2YD6A 2R0KL 1JHLL 3AC0A 3W9DB 1ZHBA 2JCCE 3DUUA 9CGTA 3QXDA 4HWZB 2G5BB 3QYCA 3NABH 4GBXB 2RAMA 3PQYA 5EU3B 5F3HA 2IF7A 1R3LB 4G6MH 4GG6E 3TVMA 3GSWB 5JHLH 4X0KB 1MH5A 5C0CB 1FC1A 1VGKB 2I60L 4BK4A 4LGRB 5IMMA 3O4LD 5HYSA 1EJOL 5D1QC 4I2XB 5CLTA 4E0RA 1LEGA 5I1DA 1W8OA 2OR9L 5CJ5A 5D4QA 1BF8A 5EO9A 4LCCC 2VDNH 3QXTA 1AGFA 3VXPB 4I4WA 3NFPA 4Z76A 1ZANH 5IB5B 4OTXH 1UH3A 3DTXB 4MQXC 2PTTB 3T09A 4HG4J 2WM0A 3PWNB 4FQHA 2J8UE 3H3KA 4PY7A 3SCMA 1FAKT 4RQQA 2BMKB 1CXEA 4J1UB 1R5IA 3VD9A 4WWKC 5HI5C 2KDGA 4YUEL 1MCJA 1QSFA 1YN6A 4FRWA 1SBSH 1PBYA 3MUGB 5IW6B 1UWEH 4D9RD 1XR8B 3KXFA 2BNRD 1GOGA 4ZUTA 5JIIA 2BOCB 4OLYH 2AK1H 2UZXB 1L0QA 5E5MA 4YBLC 5JQ6L 4RIRA 4OLUH 4JPVL 2JJSC 4LRNL 1J12A 2E7LC 3V6BR 4HW6A 3KGRA 1VHPA 5L0QB 2JJVA 4OF0A 3VH8B 7FABL 2WWMC 1UQSB 1G7IB 4TYUA 5ACLA 5JW4N 3MGOB 4KRMB 1NEZB 4X80H 1SEQL 3DX8A 3E6HB 5EOCJ 5MP6H 3DSFH 4DVRL 1TQCB 4TNWK 3L6FB 3Q5YA 3S3PA 4EDXA 4J3XA 4ISVB 5DQJA 1DEDA 1JPSL 1OTUC 4RAHA 4OGAD 3KPSA 1I3VA 5J3HC 4NDMB 3KJ4B 2Q8BL 3IDXL 4WFEE 2FD6H 5IBUB 3CH1A 4GOSA 2DTML 3ETBF 4JREB 1FZKA 1DLFL 2JB5H 2JB6B 4LSPL 4PJ5B 4LU5H 3DI2B 1MJ7L 2BNRB 4CDHA 1JV5A 4AENA 1EFXD 3UTSE 4AG4H 3P77B 1ZLSH 1K5NB 4G42A 2V5YA 1TITA 5CKGA 3QAZC 4ZFZA 4MB5A 1T0NA 1NCTA 4MA8H 2QQNL 2WBJD 4O2FA 2P5EE 1L8JA 3QUXA 5FGBC 4JFEA 5FA4B 1S3KH 3BRFA 2R56L 1C5CH 4JFFA 4R97C 3P4MA 3LKPA 4IEFB 2ZG1A 1RUQL 1DLHA 1FAIL 1L9NA 3BZ4A 4J3SA 5D2LA 1RMFH 1N5YH 4M5ZL 1BX2A 3T0EC 2FR4B 1Z6JT 3BKJL 4TULH 4LDEB 5LQBH 3TWCH 2XQBH 3BPLC 1AGBA 4LCYB 1OTTD 1FV1B 2EC9T 3PGDB 4AEIH 2BX5A 4HHAB 4OKVB 4AL8H 2PO6D 4HCRL 4OZIA 3LS5H 4XZUA 3GRWL 4F33A 1CFQB 1CZ8H 5C07D 2HVKB 3ZL4L 1IM9D 1SJHB 1CLOL 1OAZH 4K94L 2WBJB 3CFBA 15C8L 4XVUD 25C8H 4XP9H 1KNOB 4A2MA 3QHZH 3C5ZA 5DSCA 3WHE0 1BFVH 3THMH 4L4TE 2HT2C 3E2HA 5INDA 1J5OH 2EYTA 5F1OB 5GXBB 1M7XA 5HBBA 5ACZA 3FHAA 4Z77B 1ZT4A 5DUBB 2VLJD 3VFUA 2PW2A 1F00I 1NCUA 3MLSH 3VW3L 3B9DA 1DFBL 3RWHA 1G6RH 2V2XA 5K9QG 4FZEL 3GSXB 2FLRT 3BXNB 2PO6B 4Y8AA 5HY9B 4R4BB 4R4FL 2X1XR 2B5IB 5I1KH 4M7JH 5IV2B 5DI8B 4OCSL 4P4RA 1Z3GH 3O3BA 2BFVH 5AEAA 4JHAH 2BXZA 1OAYH 4NFBA 2CDEA 1N8ZA 2DQGH 1BVLB 1NCAL 2Z35A 4L5FH 1QUNA 5E7FA 4P2RB 1Z9MA 5F89B 1NUGA 4D0DB 4RMWA 5JHDD 4XMPL 1I1AB 1PZ5B 1PG7L 2EIZB 4YGVA 3KPNA 4J2XA 3PV6A 1TQBB 2WP3O 5BW7C 2R1WA 1NJ9A 5JQHC 1EEYB 1EAJA 4PGBA 3SJVE 1CLYL 1WF5A 1XF4A 2JLLA 3HZYA 1H8OA 1DUYB 4FQJH 4XMLH 4JN2B 2DQCH 1BAFH 5D7KD 2QSCL 4RWYL 4NRZA 3QQ3B 3QT2A 2MCG1 2AEIT 1UXWA 4NKDA 4EI6A 4DW2H 4QRPE 4CN1A 4UOW1 3LQZA 3U7YH 3KPTA 3V52L 3IU4L 4U1JB 1LMKA 4FMKA 2NYYC 4NNXA 1OAQH 5IB4B 5CZVL 3TGXA 3VDAA 2OYPA 1JPGB 1QQDA 3AMLA 4BFEA 3MROB 4Y5YB 5ANME 5JXEC 1LO5B 3LKSB 3MCG1 5T33H 3SE9L 3PHOB 3QA3A 2VXTL 3RNKA 5BO1H 5C6TL 3NMEA 1ZA6A 4GRWH 1T21B 2OZ4A 4H0HB 1F5WA 3JV5A 4DFIA 4BA8A 3D69A 3VJ6B 4Z78A 2A6KA 3FT2B 1QSEA 2R1YA 3BPNB 5GGSY 3RL2B 4S2SA 3FB6B 1NGXA 4YNYB 4YFLF 4MX7B 5DS8A 2FLBT 2ZCHH 1YNLL 3V7AG 1L6XA 4OLWH 4FZ8H 3AXLB 5I2IB 3PDOB 3C60C 3C87A 2X70A 3WXVL 1CFSB 1GGIL 2GJ6D 4TRPH 3JWOL 4JRYE 1P7QA 5C0RL 5GS1C 4HIXH 4HK3J 3QIBA 4Z7UB 1XIWA 4RFOH 3IDGB 3L3IB 4TQEL 5ESQA 5C70A 2G75A 3K81A 1KCSL 1SQ2N 5TGBB 4HX1A 1FC2D 4M00A 5EO0B 3LEYL 3VFTA 4NM8H 3UJTL 2UV3A 1LK2A 3OGOE 2H3NA 5EA0L 3KVQA 4LPUA 4QOKD 1SVZA 1G7QA 3MV9A 4W6YB 2DQFB 1G7PA 3GNMH 4N5EA 2GAZB 5J4MA 4HUKB 4HWBH 2XTJB 4MDJA 4Y4FD 4OV5B 3FZUC 2YD5A 3QI9A 4IRSA 1BZQK 1DBMH 2VZSA 4F37K 5CZXD 1XGYL 1UKSA 4I77H 4LNRA 1I9RH 3HZMA 4XNUL 2VDML 3EYVB 1OP3H 5HHQB 4GAYA 4HUNB 1I1YA 4PRAA 3HNTH 5EBWA 3BQUB 1U92B 3QDMB 5CSZB 4CW1A 1ZVSA 3PXHA 1X7QB 1UACL 5EU5B 2A74B 3UYOD 3VWKA 4UIKH 2OL3B 3EW3B 4XX1E 5MEOB 1MFDL 3OKMB 5F3BA 2DIAA 5I15H 2Y25A 3WJJC 3SDCA 4OV6F 3UZQA 3SDXA 4XPHH 4IOFD 2X4NA 5FYLH 3VWJD 3BOVA 4XC3L 4MDIA 1EX0A 4JZJB 1PJ9A 2ICWI 4OCXL 4Y4FB 4N0FB 4E9LA 2AJUH 5FUOH 2VABA 1T20A 4P46D 3VDBA 2BNQA 3L1OL 5C3LD 4QXGH 1P7HL 3ARFD 1CDYA 1RQ5A 1CQKA 4CVUA 5F9JB 3ECBA 3RWGA 1KV3A 5E2JA 1TJGH 3BT2L 4Z5RB 4J23A 3W39A 1J0KA 1WBXA 4NQVA 5C0AA 4LBEA 5DJCA 4Y19D 3VFSB 3MRPB 5I19L 1ZT1A 3KPPA 2ICWJ 3FHQA 4ZQKA 5FKAA 3GMQA 3W0WE 5DHVA 1KLFA 2VXQH 5C08E 4MNHA 3EO9H 3WN5B 4FN0A 2ZZUT 4YPJA 3HRZB 5L88L 3H42L 4RNRA 3OJDA 2NNAB 3V0VB 2VXSL 5LCVH 3SGJC 1T89C 4KI5E 3SGKC 3KYOB 2BXYA 2WQRA 1OP5K 2QJDA 5GS0D 3G6DH 3IDUA 1UJ3C 3N50A 2OTWB 3CPLA 5L8KB 1A4JB 5MERB 3VXME 3SGDI 1S9XA 3PQYD 1OARH 3L5HA 5DRWB 1INDL 4QRRA 1B9ZA 3CFCL 3RWEA 1OGAA 5TFSH 1H5BC 4R96B 2UZYB 2OBGA 1KEMH 4Y19B 4R90L 5IP4A 2AQ2A 3G5ZA 4UB0L 5I66A 4TVPD 3MBXH 2JJSA 4UV4H 3MJ7A 1OPGH 1RK0B 4M8QB 4FXGB 1W0YT 4NCDA 4RBPK 3VXNA 1OTSD 1N5AB 1DQLL 4YHLL 4Z7NF 2EDRA 1ULVA 2JJWA 2MCPH 4U05A 3Q1SL 2CXGA 3SGDH 1JZ2A 1GZQA 3MCLL 5E94B 1BLNA 2OL3L 4MJIA 4F7EB 1AKJA 2BVPB 1EZVX 1GC1L 5KS9A 4RGOL 3ZDYF 1ZHBB 3DUUB 3SCMD 5LVEA 5EIQA 3MV7B 2ADFH 3BEVA 4BM7A 3HUJB 3BMVA 3MACH 1V7NH 3V5HA 4YHIB 3B2VH 5BRZA 1LGVA 1MHHA 4UILL 2QR0A 1QSFD 3BZEA 2A9MH 4EBQH 3U46A 5CCKL 1UENA 4BZ2H 4JDVB 3KXFD 1H3UA 3RGVA 5IGXH 4XBPA 1U3HC 2OXGA 3A6CL 4N0UA 3R4DA 4V1DB 3QJFB 3ESVF 3GI8H 1AGFB 5D5ME 3HMXA 1JWMA 1T2JA 2AERT 4I4WB 4CVXB 1AC6A 2NXYD 3H7BB 5IJVB 4MAUH 4X6DF 3GI9H 1K6QL 2V7HB 4LIQE 4BZ1H 4NWUH 4L29B 3A6BL 1AGCA 4PJDA 1AIFA 4RMVA 1RURH 2OZ4H 4L8BA 4RAVB 1UEYA 4K7PY 1I85A 2PCPA 3E8UH 3MXWH 3LEXB 3HPLB 4U6VL 5CJOH 3IFOB 3RWDB 3VRLE 3K0WA 5F8RC 1I3GH 2JELL 4GRWE 5I0DA 2CLRB 1HEZA 3KXFB 4KKBD 5TE7H 3T04D 4XPBL 4ZUTB 5GGUB 3RIAK 1KN4H 3LV3B 4ODTH 4L1HA 2RCSL 4PLJD 1WZLA 1FIEA 1N4XH 5FO8A 3SE3C 1ZXQA 4IS6B 1JYVA 3V4PL 2H9GA 1YDPA 4PP1D 3U48A 3QUXD 1S7QA 4O02H 5E6ZA 1YMHA 4JFED 3KLDA 2NY4D 4JFFD 1AD0B 4XT1C 1A6WH 2ADGA 4NQEA 3R8BB 4NN7C 1J8HA 5GPRA 3HAEH 1T7YA 5IBTH 2JIXA 3CNKA 2EKSA 2X7LA 1H0DB 3SKNA 5CILL 2QSVA 5T1KD 5TDNA 1M71B 2D03L 4M7KH 4JRXE 1KB5H 5HHVH 2SEBB 4XI5D 2BC4B 1U8NB 4X7SH 3MREA 3QEQE 1LO0L 4OLZL 2YA1A 1FNLA 3C6LC 5GSRB 2X41A 1KJ2A 1NLDH 1D9KA 3X13A 5BJTB 2CLZB 4X8JB 3GHEH 3IRPX 4JVUA 5DR5H 5F44A 4H1LB 5JW4R 4P2OA 1MHPL 4GKNA 3T1WA 2CKNA 4Y7MA 1HINL 2PR4L 3C5ZD 1N59A 1DDHB 4KKCD 3LN5A 2CQVA 5JZ7D 5DD6B 5HVHB 1YEKL 4Q2ZA 3OKNB 4YWGH 4LK4A 5DJAB 2P43B 4J4PA 4AMKH 3L3KB 4CBPA 5EZJA 4PJFE 2P44B 2HVJB 4ODVH 4W81A 4H5SA 5T1KB 1JPTL 1FGVL 1BX2B 2AEWA 3FQUB 1GGCL 1F3RB 1X5FA 5C0BB 3ZO0A 4LKCB 5HDOA 3DURB 4ELKA 1T22A 5L7XL 2XPGB 1H3TA 1BZ9B 3MYZA 2EYSB 5E6YA 3BSZL 4HG4K 4JG0H 3TO4B 5E9DB 2R2HB 5IHZA 2F53B 4YHPB 2BJMH 3JTTB 3TIEB 4UTAL 3L5IA 4N0CA 4PRPB 1KACB 1MCHA 1JNLL 2R23B 2C1PA 1G9MC 1A9EB 1YECH 4UT7H 2YEZB 2HFFB 5DJDA 1R3KA 3STZB 1MHEB 1X44A 1KCKA 1NUNB 4Q58C 2E9BA 2AV7A 3FO1B 5EU7E 4L3EB 3QUYA 5IVZB 3VXUD 3C08L 1RIVH 5B8CC 1FNEB 2V2XB 4LLVA 2DQTL 2FHCA 3MJ9L 4L8SB 5LGJA 1WZ1L 1KT2B 4PRIB 5IOPB 1MFNA 5BQ7B 4NZRH 4JPKH 3SO3B 4P4KB 2IH1A 4Y1AE 4JCLA 3NZHL 2OTUA 3QFDB 5HJ3B 1P5VA 4YDIH 2H2PC 1MJ8H 1IC5H 2ERJC 1DBJL 1JE6A 1KPRB 4DKFL 2R0KH 4Z8FL 5F7FA 3U9UB 2UZIL 1GRWA 4PJAA 2OJZL 2H32A 3LQMA 3PV6B 5CBEB 3TBYB 2D9CA 1NJ9B 2ZUQB 3OAYH 1HXYA 3VXUB 1T3FA 2AEPL 4RGNC 4PJXA 5H2BB 3TCLA 1DQML 3U1SL 2I60H 5IFJB 3L7EB 4DN4H 3EYFA 2V9TA 1EJOH 1GSMA 2H26A 5C71A 1U8QA 3VXRE 5DD3L 4NKDB 2OR9H 2X9WA 4JLRA 2J4WL 3LZFH 3LQZB 4N90E 4P5TC 1JGLL 2AI0L 5C6WH 2NY2B 3QNXB 3QDJA 1P7QD 4N0YH 3D0LA 2FX8L 4K8RC 2D7PA 1ZTXH 1TVHB 4XC1L 4LPCA 5FB8B 1IZKA 1XIWD 4D9QD 1U6AL 2EH8H 4X6FA 1IAKA 1IGJB 3LPWA 2I07B 2YXMA 5F9OH 3TCXA 2VLRE 1EGJL 4M7LL 3D3VA 2BNUA 2W59A 4X99B 3W11D 5ID1B 4YUEH 1Q9LB 3OHXB 3K74B 2BSTB 3QJHA 4Z78B 2R1YB 1WWAX 3ROLB 1FJ1A 3NOIA 5TE6L 2IADA 4N5ED 4S2SB 3I6KB 1VACA 1U95A 1H8SA 4O2CA 5L2KE 3ZDXE 4YH6A 3QI9D 1DEEB 4IRSD 2BHZA 4XNQB 1G7LB 3DOSA 2XN9B 1M4KA 3LKRA 1EO7A 1R5WB 4LLQA 3VGGA 1S7XB 1R24A 1SEBB 1ORSA 3VGHA 1KIUA 3ARSA 3VWKD 1DQQA 1HSBB 5J0BA 4K3EL 1MF2L 1LDSA 1J1OL 3S4SB 4JB9L 1NC2B 4FXKB 3AMKA 4Y16A 3SDCD 1TLKA 4Y4KC 1MCIA 3LOWA 1MAKA 2VDPL 3IDXH 4U3XA 3HLAB 5FHBL 2Q8BH 4CNIA 1KCUL 4PG9A 5HSFA 4PB9H 3AU1A 2X4SA 1MJ7H 1RIUL 4O5LL 4M1CD 4KC3B 2XY2A 1ZWIB 4ZSOE 1FN4B 4POYA 2Z31C 2F19L 5DMGC 1XF3A 4IRSB 3B5TA 4KRPB 3ZDZF 2YBRA 1BWWA 2BNQD 4OCYL 3IKCA 4YEFA 4JO3L 2H8PA 4XRCA 2QQNH 3RBGA 3E3QE 4UQ3B 2P1YA 4QHLB 2O5YH 5CAYB 3Q3GB 3NN8B 1VESA 4L9LB 1QR4A 4OM1H 2R56H 1X5AA 1QKZL 2DJSA 3EYOA 2HTLC 3N1MC 5C0AD 1UYWH 1JP5A 3TO2A 5F3BB 4PJXF 1RD6A 1WWWX 1KIRA 1RUQH 4MB4A 4C56A 2RB8A 1FAIH 2WP3T 1UB5A 1MRFL 3BGMB 4X9IA 4CUCA 3ARBA 5A1AA 2Y5TB 4M5ZH 5HHXH 4POZC 3KYKH 3O45B 4MQXD 5BXFA 5B39B 3BKJH 4PJCF 3VFMB 2E7HA 3DI3B 1KTKE 5J1AA 1EUUA 4HCRH 2DQEL 2ITCA 3BKCL 3CMOH 1U0QA 3DSNA 5FF6B 4KK5C 3GRWH 1JYXA 4GRLA 3TNNB 4Q9BA 2E7BA 4NRYA 4J6RL 4X6DB 1A21A 4WWKD 4WWID 1E6OL 4K94H 4ZUWB 1BBDH 3P0VH 2FHFA 1KG0A 2HN7B 3QRGL 4HKZA 4UZGA 3HFML 2WINB 5IESH 4QRRD 1PKQA 4OJFH 2EE6A 2I26N 3MR9A 5D1QB 3G5XB 4K9EL 2IQAB 2WUBL 3D2UA 2DTSA 4GQ9L 4LCCB 1D5ZB 2BY3A 3H9SA 3KHQA 3KWWB 3T0WA 5DHVB 2VR9A 3LRSA 3H0TA 3KPMA 1HQRA 3VW3H 4PJIF 4WU7A 1UM6L 5I17A 4TNVK 5E8DL 4F8QA 2W07A 3HC0A 3G6JF 2AK4E 4PJ9C 1W8NA 4MJID 4R4FH 3BP5B 1HIML 1OTUD 2PXYA 1AKJD 3LKOA 3DYPA 3OB8A 5GGRA 3PDDA 1U8IB 4U6YA 5J3HD 1R3JA 1JK8A 4WWKB 5HDBF 1WJ3A 2IGFL 5DTFA 4WFHE 4R7DA 1HXMB 3MRLA 4I48A 3UJIL 3BVNA 5A2JH 2FEDD 2ZUTA 1A6ZA 1V5JA 2AABL 3HB3D 4PRHA 3MJ8B 5BRZD 5E1AA 3I3EA 1Y0LA 1A6TA 5HPMA 3DWTA 4OM0L 3UP1A 4XCCH 5J11C 4APQA 1MCQA 1X9QA 4YBLB 5GS2H 3ALXA 5EOQL 1OSPL 4PJBF 4WEMB 3MRKB 5D1XA 1YEHL 1PG7H 1TCRA 1I4FB 2YUZA 5E2WL 1N7ML 3RGVD 2BDNL 3NZ8A 2D31A 4XNYL 1CLYH 2R2BB 1A7QL 4NC0B 3DV6A 3O0RL 4NC2B 3EJZD 1NGZA 1N0LA 3FQTB 3WHXA 1JZ3A 2QSCH 4RWYH 4UI2A 5BS0A 1IZJA 3VGAC 3DMMC 4OCMC 4NO5A 4JM2A 4RA0C 1E27A 4WEUD 3V52H 4JY4A 4Z7WF 3TC9A 3ZT6A 4Y5XC 5CZVH 3MTRA 1W0VA 4XPAH 2YPLE 5BRZB 1S7VA 3HNSH 2GSGB 4PRDB 1XCTA 4HZLA 3SE9H 2VXTH 2HP4A 1PFCA 3SKJL 3RQ3A 1B6UA 2ZPKL 1IGML 5C6TH 2VJXA 3QAZB 5JDSA 3PWPA 4JFYB 4OZHE 5B38B 3QFJB 3EHBC 4MJ6A 5KANI 1IGYB 1R6VA 2ED8A 3WFDL 1IBGL 1YNTB 3RWCA 2FL5A 4NQSB 4X7CC 1LO3H 4R97B 2IWGA 5GZNC 1DUZB 1QFWL 2F54B 3KPQB 4PJGA 5CP7A 5FYJL 1TJIL 4XHQA 1I9JL 1MRDH 1YNLH 3QO1A 3P4OA 4NQED 1NGWB 3WXVH 1EO8L 1P1ZA 2VKXA 5JO5B 1J8HD 1GGIH 3T0EB 3JWOH 2JIXD 5C0RH 3BKML 3EJYD 4KAQL 4IJ3C 3MLYH 4HFWA 3BPLB 4OSUH 4HC1L 5D7IA 3T2NH 4TQEH 5JPMA 3W9EB 1KCSH 4C83B 1A1MB 3QQ4A 3WLWC 3BPOC 3JV0A 4KZEH 4OZGA 5HI3C 3NIDF 3UJTH 3MUY1 5AD0B 4L8DA 4QCIA 3HA0A 1D9KD 2NTFB 4HQQL 4DVBA 1FZJB 1RJCA 1X5HA 2XICA 1DL7L 2DI9A 3KJ6H 1K4CA 1P4LB 2B1AL 1YDPB 1XGUA 3TYFA 1C7TA 3CZFA 4P2OD 4YDLC 2C3XA 2P8MA 3HE6C 5T1LB 3PP4L 2OLDA 4XP5H 1SJVA 1W72B 1XGYH 1YUHA 4XX1G 1U41A 3CMGA 1QNZL 2VDMH 2NY7L 5ERWB 4ZXBA 1Y18B 3R1GH 1LO2L 4V3DB 4J4PD 2MNUA 4JPWH 1RUML 4FABL 4J8RB 3FL7A 1TXKA 5HYQB 1F3DH 5IHUL 3F62A 5IROA 2OSLA 1F3DJ 3U7AA 2G2RA 1LEIB 1MFDH 3AREA 1N2RA 3ZMRA 4M6OL 5T3XE 1TJHL 4I3RL 4M1DL 5SWZD 4QXUL 4XP4L 3WS3A 3WD5L 3QP3A 4N0CD 4HIEA 3CGTA 3AAZA 3DV4B 3NGBB 5EUOB 4NKIL 4GKNB 4OCXH 1ND0B 4RA3A 5HYFA 1MY5A 1OAUL 5E2TL 5FO9B 4PGCB 3O6MH 3ALPA 3QDGA 3MQIA 1FYTB 1WBYB 3L1OH 3O11B 5ESVB 1YEGL 5DK0A 5I74C 5FKPB 3ZKMD 4M7ZC 3FAXA 1G0YR 1M05A 5C0CE 5J12C 1LP9F 3EFDL 1UADC 3BT2H 4EI5A 2YS4A 3IDMB 4XAKD 3QZWA 4G9DB 5I19H 3CAFA 4KVNL 1QACA 1NBVL 5LBSL 5SWZB 2CIIA 1K8IB 2GTZB 4XH2B 3K2UH 3E1F1 1IJ9A 2JK5B 5L88H 4NQCB 5CEXA 4N0RA 5EC1A 4MVBA 4NGHL 5IR1B 2C1PB 4AM0A 2A1WL 3C6SB 5K59E 3SHSA 4PJ7A 5KJRL 3RAJL 2QKIA 2VLLA 3CVHB 2C3VB 1MQ8A 1RZ7L 3KS0H 3KS0J 3O4LE 5SX5K 1UB6B 1INDH 4MGXA 5ESAA 3CFCH 5IB3A 3WNKA 1T1YA 1VADB 1HI6A 3F