4QRSA

Crystal structure of hla b*0801 in complex with elk_iym, elkrkmiym
Total Genus 79
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
79
sequence length
276
structure length
276
Chain Sequence
GSHSMRYFDTAMSRPGRGEPRFISVGYVDDTQFVRFDSDAASPREEPRAPWIEQEGPEYWDRNTQIFKTNTQTDRESLRNLRGYYNQSEAGSHTLQSMYGCDVGPDGRLLRGHNQYAYDGKDYIALNEDLRSWTAADTAAQITQRKWEAARVAEQDRAYLEGTCVEWLRRYLENGKDTLERADPPKTHVTHHPISDHEATLRCWALGFYPAEITLTWQRDGEDQTQDTELVETRPAGDRTFQKWAAVVVPSGEEQRYTCHVQHEGLPKPLTLRWEP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HLA class I histocompatibility antigen, B-8 alpha chain
publication title Molecular imprint of exposure to naturally occurring genetic variants of human cytomegalovirus on the T cell repertoire.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
total genus 79
structure length 276
sequence length 276
ec nomenclature
pdb deposition date 2014-07-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00129 MHC_I Class I Histocompatibility antigen, domains alpha 1 and 2
A PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4qrsA02
3.30.500.10 Alpha Beta 2-Layer Sandwich Murine Class I Major Histocompatibility Complex, H2-DB; Chain A, domain 1 MHC class I-like antigen recognition-like 4qrsA01
4GT7A 1IL1A 4LOUD 3TBWA 3N1MC 3D3VE 4PR5A 2ZKHL 2DKSA 1T1WA 1QEWB 4HCRL 4KI5E 4NQCD 3SGJA 3ILPA 1QR4A 4LSPL 3U4BL 2ERJB 2KZ1B 2ITCA 1G9NH 2YBRA 5A2KH 2HG5B 2Z4QA 4WFFD 4FABH 4EDXB 1H3WM 3IGAA 1RD6A 4D8PA 3MFFB 1TZHA 5JW4N 1J5OH 4C83B 4ODSL 3W9DB 2P45B 3DUSB 4ENEC 4XNYL 2EEAA 5K9QI 3NA4A 3HA0A 3Q1SL 5DTFB 3VRJB 5E8OB 4XX1E 4RX4A 1DQDL 3QXVA 2DQEL 3KYOB 2IWGA 1K4DB 4MLIA 1U8MB 1EGJA 1P53A 5DSCA 4NP4L 1ADQH 1G7IA 4DGIL 5CEZL 1P6AB 2VDOL 2VABB 3P30H 3VJ6A 1PY4A 1U3ZA 5CFHA 1TQBC 2DQFA 3IFPA 4PRNA 4U1NB 4AIZA 5C07E 1BREA 2DRUA 1SYSA 2FB4H 5KOMC 4EUPG 1JPGB 1S9YA 5INCA 3BZ4A 3L9RB 1A64A 1DFBL 4Y4HC 5EO9A 4DZ8B 4Y4FC 3MRRA 4KZDL 2ADIB 1AXTL 1FYTB 3RAJH 3V4UL 1S78D 4NO5B 2Y36L 2I60L 2DYPD 4B50A 3EFDH 1KCKA 4WW2A 2FATH 4JPWL 2UWEA 3PHQB 4JKPH 4LEOB 3QFDB 4BQ9A 1NCTA 2BJML 5ENWA 4YHKL 4HBCH 1C12A 4XVSH 2DLFH 3RY5A 4FQIL 4PRHE 2CKBH 2IAMA 4K8RL 2AGJH 5DC0A 3LZFH 4EDWL 2E7CA 4RFEA 4X0KB 3FTGB 4OCXH 1UZ6E 4WO4C 1DEDA 3OKMA 4G7YL 3PL6C 2DIAA 2AXGB 1HHGB 3FOMB 4UOW0 4YFDB 4D9QE 4C54A 2XN9B 4F57L 5E2WH 5JW3L 4N8VA 4RA0C 1IAIL 4MJ4A 4PFEA 5FM5O 3PGFH 1ZTXH 1GGBL 1G1CA 4PJGA 1ZSDA 5ID0B 5IMKB 5LGHL 1R5VB 1RIHL 2R29H 3LN5A 4ZNEE 4I9WD 4KJQD 1NANI 3NFSL 2BSTB 5C1MB 1BWWA 2ZWLT 4HKXA 2VUOA 3VFGH 5HDLA 3LKNA 1FYTD 5E8NA 4EN3C 1XF4B 3D87B 1UENA 2X4NA 5J06A 5HYEA 1GZQB 1X5HA 3L1OH 3KDMB 4XPFH 3QP3A 3I75B 5DJZB 1C08A 3FOLA 5JOPE 1UJ3B 4HIEA 5HDOA 3UJIL 2UWEF 4XNXH 4UIMB 4BSWA 1DLFH 1TIUA 3SDXB 4DN4L 3ARBC 5IMOA 1G7HA 3ESVF 1IC4H 2VIRB 4OLWL 2HKHH 4JFZL 4Z78B 5F96H 3MCLH 4W4OA 5GGVL 1EEYB 1PJ9A 3MV8E 1TQCC 5CP3H 4R96A 4U6VH 3O9WD 3HB3C 3LAFA 1QFUH 4D9LH 4WTZG 3QUXC 2FGWH 1YPZE 2OL3L 5IOPA 4F7EB 3VFPA 3ZHDA 1N5YL 3WFEH 3DX8B 3V5DA 4NQCA 3T0EE 5I1KH 3FQNB 4F7PA 5IB1A 1DQLL 4YZFF 1DE4A 3B4NA 1NGZA 4FQLL 2D0GA 4ZPTA 3QXDB 4PJGF 3EHBD 2XTJC 3IU3A 5FDWB 2AK4B 5FECA 1XF1A 2YKLL 5JMRA 2BVOB 1YYMH 2V7NB 3SDYH 4HPYH 2OSLB 4XBGB 5E2VH 2NY2B 3TBTB 4JDVB 2YA1A 5CWSB 3RGVC 3GNMH 4LLYA 4ORGA 3G6AA 5IB4A 4NUJB 3MA9L 2QL1A 5ADPH 2WIMA 4JZOA 1DLHA 1XIWB 3S4SB 2ESVB 3TPUA 2I25N 3QNXB 2XRAH 5H35B 1ZMYA 3K46A 3VXTB 1Y6KR 4JLRA 3EYSL 4OD2B 3U0TB 5CBEB 3CFDB 3ARWA 3L3KA 3LRHA 2VC2L 9CGTA 3UZEA 4QEGA 3IJHB 5IIEB 4JO4H 1HCFX 3F62A 2DYPA 5HVWA 3EYVA 3LQZA 1GOHA 5ETUB 4JGUA 1A7OL 5KSBE 2Z92A 4WTZA 3UXFA 4HPOL 5DUBB 1JNNL 1NFIB 4QRSB 2FX9L 3U2SB 3RX7A 4ODUA 4PYHA 2LVEA 6FABL 5JPNB 2HG5A 4F33A 3MLXL 2N7AA 1NMCC 4EDXA 1BJ8A 3MFFA 3Q5TA 4OB5L 2PXYB 4TTDD 3LMJL 3W9DA 4C83A 2AK4D 4Z0BL 2Y07H 4WIQA 3CLEL 3VFUA 1KCVL 3VG0L 4R90L 4IM8A 4PJEA 5E2TH 1FNGB 5DTFA 2NY2D 4M48L 3VRJA 3EGSB 4FTVB 5E8OA 4MJIA 4ZFGH 5DD5H 3LHPH 4GSDH 4M6NH 4P5MB 5DD6A 4X6CF 3REVB 3CLFH 3C2AH 3FB6B 5TFSH 3VDAA 3VMPA 1NUNB 1XIWD 4GAYB 4LCYB 4HF5H 1D5MB 1ZT1B 3DSNA 2ESVD 2KQNA 4E0RB 3D9AH 1T5XB 4P3DA 2FHBA 4PJAE 2HVKA 5LKNA 4RDQG 4U1NA 5IB3B 1S9VA 4NKDA 1DANU 1NEUA 1QSEB 4PJ5E 3QUYB 1JPGA 5HD8D 2HRLA 3GSNL 1TVDA 2IH3A 3U30C 5KANG 1T0MB 4FFYL 1LNUB 4X8XA 3VXPB 2LU7A 5LJYH 4D3CH 4XT1C 1I1FB 5E1HB 4GRLB 4X80L 3IDMB 3QXAA 2H2SC 3TESA 3TIDB 4P2OC 1NGXB 2QEJA 3CU7A 3VXME 1A47A 2J5LB 1HZHL 1IC5L 1MSPA 5FHBH 4W81A 2XKSA 5IW6A 4OFDA 2XQYK 2BSED 2LE9A 5E6IB 4QYOB 1YEDB 3CNKA 1I7RA 3GSXB 5HSFA 3O9WA 4NJAH 2AXGA 4GQ9H 1G7PB 3DX7A 4KTYA 2X1OA 2GITB 1HSAB 2X10A 4NBZB 1HH6B 2RR3A 3ALWA 4WFGE 2EDDA 3F7RA 5DMIH 1YC7A 2NY7L 3P0GB 3NCJL 5IMKA 1ZANH 1W0VB 1IEAA 3OHXA 3R0MA 1WEJL 4OFIA 1TJHL 4HS6B 1QSED 1DBJH 4BKLA 1L6XA 3B9EA 1FZKA 3QUYD 4YDJA 3NAAH 3X3FL 1KTLB 1XGQB 3L5WA 1EVTC 2BSTA 5T1MB 3VW3H 4GW4B 5EOCH 2A73B 1PZUB 4MA8L 4AY0A 2AI0L 4OFVA 5IJKA 4KVCH 2YSSA 5IMMA 1CS6A 3EW3B 1UCTA 3RVWC 1LEGB 1G9MH 1M7IA 3KDMA 1I1AC 1EH9A 4GRLD 4KC3B 2VR9A 4ALAL 5BRZB 3D25A 3S36L 4PV9A 2EIDA 5FO7A 3FO1A 2R2HA 5F7NC 5JXAH 5D5MB 2DMKA 1T0NA 5I19H 2ZP0T 5KS9E 2YPKA 3CDFA 2VIRA 3QIWB 1T80A 1DQMH 1EUUA 1AGCA 1R5IB 5E6ID 1SY6A 3KYMB 5E08H 5LG1A 3CFJB 3W39B 4JG1L 1CLYH 4DKDC 3D85D 3MUJA 3CFCL 2ZUYA 2O5ZH 2WUCH 3G5ZB 4PJ7E 1D5XB 1KSRA 2IALB 4ZD3H 5T3XE 3FQNA 3BYTA 2Z8WC 3T09A 2FIRT 3JUYA 3KPPB 4YHZH 2IJ0C 3U9UB 3OAUL 3WN5B 2GI7A 5B3JF 1QA9A 4LEXH 5D1QC 4JFPB 1U0QA 5GRJH 5FDWA 3G5YB 3VFRB 2ZCKH 2BVOA 2V7NA 2NY6D 3IXAB 5KVGL 1NAKH 5CMAB 2OSLA 5I0DA 4I0PB 5JPMB 3TBTA 5J12C 1AHWB 1TQBB 3L3JB 4O2CB 3AXLB 5C92A 4XB7A 3QHZL 1XGPB 1YEFL 4ZTOH 1CR9L 4NN5B 4I18B 3S4SA 2OK0H 4Q6IB 1B4JL 1BMGA 4ZOAA 1ZVSB 5DMGD 3S37H 3MCKB 5BRZD 5K59E 1JZ3A 4S1QL 2V2XB 4YNYB 1II4E 3MJ7B 4OD2A 4GKSA 3JV6B 4OLZL 5CBEA 3CFDA 1IEBB 4JPKL 3EZJB 4R2GB 4E41B 2D7MA 3SDXF 2M1KA 3IJHA 5TPWL 2VJXA 1L0XA 1FZOA 4NNPH 5EPMB 3E0GA 4OSUL 1U8PA 2X9YA 4OV5B 2X9XA 4KMTH 5MI0C 2BY1A 1SM3H 4UTBH 3MBXL 1S5IH 4XVTH 1NBQA 4QHLB 1NFIA 2X4SA 2AKRB 5E1AA 2OP4L 1WCBA 2H2PC 3U2SA 4KJYA 2XY2A 3QDGB 1U41A 1A7PH 1EEZB 1U42A 3E3QC 2BK8A 3QDME 5ABDE 1QUNA 5EU6B 2XA3A 1W72B 5CJOH 1W0YT 4HJJL 2AJ3A 3P9LB 3CSBA 5A2IH 4I0PD 3RUGE 1KLGA 5FGBA 1SVCP 3OR7B 1A3LH 4P5MA 5I6XC 4HLJA 1CD1B 5AG8A 2VXVL 4GAJL 4GAYA 4LCYA 1UA6L 1D5MA 1FGVL 1ZT1A 4FQXB 4JM2C 3VWKB 4MAYA 1KFAL 3BQUC 4I3RL 5IHZB 3BP5B 2C3GA 4EN3B 3O6LH 1JFMA 5IB3A 4B7IA 4MJ2A 5IBTL 1AGDA 1QSEA 5KW9H 2YC1B 4HXAH 4R2GD 4E41D 4I3SL 5I1LA 4JKMA 1PLGL 3OR6B 3CSYA 3LKOB 1K3IA 1XGRB 3ALPA 2VLRB 3WS6A 3WFDH 1X9QA 4EI6B 1J0HA 4K3JL 2NX5B 1N5AA 1NCAL 3MBEC 3V0VA 1ZGLM 4OJFH 2AJUL 3BUYA 3X11A 5GS1A 1I1FA 4K55A 5ESVA 4DOHE 1SEBB 2P8MA 5E4EC 3IDMA 3GUTB 3MRLA 4K7FB 1JZ7A 2VZUA 1TQCB 3TIDA 3QDGD 1NGXA 3HR6A 2FRGP 3T2NL 3MXVH 4KTEH 2N4IA 4G6MH 1MH5B 2Z0BA 4OBSA 4WI2A 3FO9B 2JJTA 4R97C 2H32H 1YEDA 4U3XA 4JFEB 5EU6D 5AUMB 2Q7YB 4WHDA 2CGRL 3GSXA 5EBMB 2YRPA 3GGWA 4GH7B 1SHMA 1G7PA 3D85A 2GITA 3TNMB 1HH6A 4CW1B 3QQ3A 2XTJB 2BY3A 1RJLA 1FVDB 3I9GH 3VWKD 4FQXD 2EDLA 5L88L 43CAA 4N0UE 4KJPD 4ZUUB 2B8OT 1JV5A 1IE5A 1TJIL 1UH3A 2IFFH 4EN3D 1NSNL 3SN6N 4XI5C 5I76B 4HS6A 4U2YA 1UM4H 1EFXB 4V2CB 3HCVA 3TO2A 1KTLA 1XGQA 5T1MA 4NQVB 5J1SC 2A73A 2XQBL 3WDJA 1UG9A 4LCWE 1LO3L 2VLRD 3MQIA 3EAKA 1N26A 4IRJC 4NJ9L 2OCFD 2AJZB 4N0YL 2NX5D 1MCBA 1LEGA 2A0LD 3QFJE 3T65B 5I30H 3OKEB 1CI5A 2V17H 5F7YC 1CXHA 5EDXA 3SE4A 2A6DA 1ZLUK 5ADOL 4OQTA 3O6FA 3HB3D 3MZGB 4M5YH 2FR4A 1A14L 2HT3D 2ZSWB 1CD8A 3DRQA 4PGDB 2DQCL 5TE7L 4JE4B 4S0SD 4JFED 1MCIA 1FDLH 3KYMA 1XMWA 1BJ1J 3PV6B 5C9JB 3CFJA 1HINL 3W39A 1OTUD 2AK1H 4Y0GA 5T5FL 3B3IB 1NMCB 3BN3B 2XTJD 3G5ZA 2BNQE 3EDEA 3MODH 5I1IH 1T03H 1XR8B 5FHAL 3TYFB 4XWGH 3U9UA 3ZDYF 2A6KA 1NAML 5FYJD 1CLZH 3AFLA 4WWID 4JFPA 2ED9A 3G5YA 2R56H 3W81A 3IXAA 4QXGH 1EAJA 3AB0B 1YA5A 1EMTL 2IAND 3T0EC 2ZUWA 4CNIB 3PDOB 1AHWA 3L3JA 4O2CA 4QKXB 1IKFH 3AXLA 4IDLA 4IEFB 5DJ0B 1QKZL 2AEPL 1XGPA 2PETA 3WIHH 5KJRL 1BGXH 3VMOA 2NXYC 1CGVA 2PKDA 3L3OB 3D18A 4I18A 3H8NA 4Q6IA 3DURA 4NUGH 1FSKB 2R8SL 5BVPL 4JRYE 3MCKA 1KTDA 3NIFE 3QEHA 2VAAA 4P3WA 3NN8B 1P4BL 2V2XA 3KYKL 2HLFC 3NFNA 4YNYA 4H88L 3W0WE 3VFWB 5A1AA 5F21B 1NGWB 3U82B 4E41A 1UACL 1ZHKB 3U7YH 3FB5A 5D5MF 2DI9A 4CADA 1EO5A 4HFWB 4BSJA 1G7MB 4GLRI 2JIXA 3BGMB 4PV8B 4OV5A 1S9XB 2VLKE 4KXZH 3V5HA 1RIUL 4XBPB 1OAXH 3WXWL 3F6LA 5I9QC 5C09E 1HN1A 3CC5B 4QHLA 5EU4B 3KLDA 2VDML 3AC0A 5ILTL 3EO9H 5IHUL 4R4NC 5AZEL 4FFVD 1WTLA 3TBVB 3QDGA 3MV01 2RAMA 3U46B 2EDFA 2NR6C 1ZHLB 2CRZA 3ZMRA 3QCVL 1EEZA 4KUZH 1S9WB 5HHNA 5LWYL 1OF2B 2YUZA 3HNVL 4N0CC 3S3SA 3QCUL 5ESAA 1FGNH 1AQKH 5EU6A 3MV9B 3IFLL 3FB8B 4U7KA 4JO3L 1KLUA 3OXRB 4Y89A 4FA8A 4LCIL 4GAGH 1IC7H 4PJCE 4JHBA 4MNGB 3K1KC 2X89D 5EOTB 5L2KE 4UT6H 2C1OB 4FQXA 5IM7B 4XNUH 4G8GE 2HWZL 2C4FU 5GGSB 5H2BB 1GGIH 4NN6B 1EBPA 2VQUA 5LXGH 1INQB 3SDAC 4K3GA 4P4KC 1JRHH 1TCMA 5ISZB 4Q2ZB 5JNYB 1VENA 1E4XL 3UTPE 2YC1A 2Q6WB 2DJSA 4NRXB 4LHJB 4M7JL 1XCTA 4ZXBC 1QHOA 1N6QH 3MSPA 1XGRA 5TF0A 5CKAA 2VLRA 2CLRA 2QSVA 3DUUB 5DUPH 2ED8A 5GRVL 4NM8L 2NX5A 2O5XH 3GK8L 3ZDXE 1SEQH 3GUTA 3RL2B 4ZFOB 1YUHB 1HCVA 1UJTA 2IPUG 2YS4A 5I1AB 1RZGB 2XYCA 3ORJA 4MXVF 4PY8J 4YXHL 1LO0H 5CEXB 1MFBL 1OTTD 4HWEL 2DQIL 3EYQD 4NT6A 4OD3H 4R4BA 5CSZA 2KUTA 4X7SH 1RMFH 3HNTL 4JFEA 3WEXA 5D4QA 1F6AB 1RZKL 3J8F7 5EORL 4P2YA 5LGJA 1EEQA 3WLBA 1AD0B 4WEMB 4PRIE 3EJJX 1UWXH 1A7RH 2Q76B 3MV7B 1A6VH 4QHMB 1EHLL 3WD5H 2GHWB 4ZUUA 3QCTL 3ISWA 4LMQI 4XB8A 1TPXC 5CHNB 1C5CH 4HWBL 2BY2A 3IDIB 3LB6C 4OZIB 1C5BL 5BZWB 5I76A 3KLSA 1H8SA 2J1KA 1BX2B 3NPSC 5CSGA 5KVMC 1GAFH 5ICZB 1S5HB 1OP9A 3F7VB 3HI5L 2OZ4H 4NQVA 2HJLB 4NZDA 4N8CH 5FOBB 3J7HA 1MCQA 2IANA 2QHRL 5DEGB 3PP3K 4PG2A 1J86A 3B9KD 1Q38A 4LAQL 4NRYA 4L9LC 4LHUB 5F7UA 4UUJA 3T65A 3Q6GH 2DOCA 1KENH 2AQ3A 3OKEA 1OM3H 1UVQB 4UBDD 4XPBL 1K6QL 4EOWL 1M71B 4ODVH 2W60B 4KKCC 1CGTA 3UBXB 5ALCL 3PDGA 5DLML 5EZIH 1U3HC 4AM0A 4PGDA 2B1HH 3RWCB 4KI1A 2EXWD 4S1RL 2FO1A 4NQDB 2X41A 1RU9L 5TGBB 3HUJA 4NQEB 3U7AA 4QCIB 5DVOA 4P46C 1YEHL 3MRFB 2YPLB 3AROA 1UEYA 5C2BH 2DKUA 3HAEB 2I9LB 1EK3A 5D8JL 3MV7D 5IMLA 4QY8A 1T6WA 4XMKH 4HG4J 2J4WL 4WFED 4IS6B 3CZFB 1JUFA 1H3UA 3DBXB 3E6HB 4GO6B 3TYFA 1MCCA 4GW1B 4TVPD 4HAFA 4LK4A 3CK0H 3RWGB 4KZEH 4AEIH 2VWEE 1UB5A 4L4VB 1NBZB 2X4OB 2XA8L 1KELL 2EIZB 1HE7A 3O3AA 1PKQA 5AYUL 2C5DC 5AAWA 3CU1A 5F6IB 15C8H 3BQUB 5HI5C 4CNIA 4HAGA 2AJVL 3P73B 5B39G 3PDOA 2ATKB 4Z7UE 4NO3B 1PGRB 2GTWA 4URTB 4HG4K 5I2IB 1RK1B 4LHUD 2PTVA 2VXSL 3L3OA 2DM3A 4C56B 1LQVA 2WSKA 4UILL 4L4TD 2F74A 4I4WA 1HQ4A 1UQSB 1OB1A 3WLWD 1BQLH 3NN8A 2VO5A 4WI9A 4YHML 2XPGB 3P2TA 5C0BB 3KPRE 1KIRA 3TFKD 5JDSB 4WCYL 2E5EA 4K2UL 2A83B 4HC1L 3BDXA 4NQED 1Q0YH 3JV5A 4DCQB 3T08A 3T2OA 3UYRH 2P8PB 3BGMA 4JFHD 1U6AH 4JQVA 4PV8A 5FYKD 3AGVA 1EA9C 3L3GB 2ZG3A 1D6VH 3LPWA 1JIBA 5LAXB 4AT6B 2ZOKA 3QQ4A 4MCYA 4XP4L 4MQSB 2NYYD 3UJTH 4OIAA 1NCBH 3U0PB 3NFPB 5I15H 2D4DA 3ES6B 1GZPB 1YY9C 2A77H 2R0WL 4BZ2H 5FB8B 4UTAL 3V6ZB 2UYLB 3KPNA 1NMBL 1BLNA 2HTLC 3SDCD 5AEAA 4XMPH 4FHBD 1AD9B 5SWZE 3FB8A 2E3VA 4EIGB 1D5BA 1UGNA 1S8DA 4KY1H 4QXTB 1H3XA 4PJBB 3OXRA 5MERB 1BD2A 3GRWL 1OGAB 4MNGA 1MUJB 4K94L 4PY7B 3HE7A 4C56D 2C1OA 1I7UB 4NBXB 3ECBA 3G5VB 2R15A 3STLA 1QSFB 4H5SB 4OFYD 3MRNB 3VD7A 2FX8L 1B9ZA 1BQHB 1INQA 3ARED 4Q2ZA 5C0BD 1BEYH 1KXQE 2JJSC 4WUUA 4JJ5A 3QEQD 4JKLA 3MRMA 3LEXA 4NRXA 5EIQA 5EZOH 3NIDE 5IW3A 1B88A 1S7WB 1J0ZA 4OD1H 4PP2B 1RUAL 2R2EB 4HH9B 3QIUC 1X6NA 1N64H 3DUUA 4IRSB 1ZWIA 4LLDB 3TJHC 2J88L 3B9KA 5AD0A 3BPOC 1ONQA 4CMHB 3IF1A 4YDIH 1PKOA 2QJDA 2HRPH 4WV1B 3RL2A 2GJZB 3ZKXC 1QFHA 4FZ8L 3SE8H 1HHKA 4QF1A 4QLRA 5CUSL 4ZS6C 2DBLH 1WFUA 1E6OH 3SY0A 3ZTJH 4G6FB 4QRTA 2BFVL 3DMMC 1T1YB 1OP5K 1Y18B 1KEML 1F6AA 2F58H 1JBJA 3UO1L 5T3ZD 1CIUA 1RZIB 3BPCA 1TJGL 2F8VA 4Z5RB 3QQ9C 4XMLL 4PLKD 3M1BB 5D7KE 1E4WL 3OKLB 5CHNA 4MD5B 4EI5B 1ZGLP 3U7WH 3FB7B 2RB8A 4OZIA 5BZWA 1MF2L 4PRPE 4FP8L 1BX2A 4JQIL 1S5HA 3LS5H 1IGML 2AV7A 2HJLA 4UT9L 1RUKH 4M8QB 2G2RB 3DYOA 2ICWB 5F1IB 4OCYL 3G6DL 4F7CB 4Z9KB 4IRSD 3QUMA 3X12B 4K7PH 1CU4H 2CUMA 3P4NB 4LHUA 3JWDL 4HHAB 4MHHG 4J8RB 3MLUL 2X7LB 4EQ3A 5F89A 4L4TA 2B2XL 3NCMA 2W60A 3OKKB 1KT2B 1V7NL 3LN4A 2HT2C 4WHCA 3FFCE 4U6XB 2APFA 3ABZA 3KPOA 2ZUVA 3TFKA 5L8KB 5I9QB 1PEZA 3JTCA 1VFAA 5TGBA 3MJ6A 1CK0H 4NQEA 4Z77B 1S7UA 5D7SH 5GZOD 1SY6H 3DGCR 4NHUB 3BKYL 4I48B 4PRBA 4G80B 5SV4A 3V4VL 5C0CA 4ETQA 3ARTA 4G8EB 3AY4A 3D0VA 3FONA 2MCPH 5H8DA 3H9SB 2VLLA 5JO5A 4PJDE 4KK8C 2DQGL 2I9LA 1KJVB 3KPMB 3FRUB 2V2TB 4ODTH 4RBPK 3WV0A 1EGJL 3MO1A 4LRIC 4IS6A 3BH9B 3CZFA 4G6AC 1KCUH 2EDTA 3CCHB 1DBBH 1G9NC 5I1DB 4HH8A 1MOEA 2X42A 1WJ3A 4EI5D 2A2QT 5DT1H 5L6YH 1ORSB 2ICWJ 1NBZA 2X4OA 4TUJA 1VFUA 2EIZA 5FFLA 2QSCH 3SPVB 3UPRB 2NW2A 2Z91B 1QP1A 4KGJA 3ZE1F 3SDCA 3IDNA 4Y19E 1YMMA 4OZIF 5LBSL 1DQJB 1FFNB 4BQ6A 1S9KC 3EOBA 3P73A 1MCWM 2NY5H 2HLFD 3GSQA 4NO3A 1I9RL 4N8PA 2HFTA 5D2LE 5K9KA 4YWGL 5I2IA 2NNAA 2R0KL 3K7UA 4G9DB 1M7DB 1P7QB 2P5EE 4M62H 3V2AR 4ZXBB 3B9DA 4RFOL 4OFYA 5BCAA 2ICES 2KH2B 3MOBH 5FUZH 4OGAD 1PYWB 8FABB 2C7UB 2DWEB 3MUHL 3AREA 1S7QB 2XPGA 4LLUB 2E27H 1T7ZA 1I8IB 2NY1C 2BHYA 1RHHA 3QEQA 3BX7C 3FQXB 2A83A 4LSUL 4OCRH 3KXFE 5EG6C 4U1JB 2YK1H 5F88B 2P8PA 1PSKH 5FO8B 3BT2L 4WNQB 1JF5A 4XP6H 3QG6B 4PUBL 3EOYG 1YQVL 3MA7A 5FO9B 4AT6A 1JNLL 1JWSB 4HEME 2BP3A 7FABL 1OPGH 1ZA3B 4YHLL 3ZKNC 1FV1A 3NFPA 2B0SH 4G9FB 2IG2H 1JPSH 3HC0A 3RY6A 4P0DA 1XH3B 1F3RB 1IGIL 1WUNT 1EZVY 3BAEH 5I8OL 5FB8A 3C8KA 3V6ZA 4Z7NF 2UYLA 5I1CH 1Y6NR 1TMCB 4J3UA 4TNVK 3OV6A 3LH2L 2W9EL 4QXTA 4P49A 2ORBL 5C70A 5CBAB 4DW2H 2BVQB 4ZS7H 4MSWA 1BECA 4XC3L 1MUJA 3PHOB 3NPSB 4R0LC 1A4JB 4WI8A 2E8ZA 1U91A 1IQDA 1MEXL 1QYGL 4ZXBD 2LTQC 1AY1L 5C0AE 3U1SH 1OTSD 5IB2B 1G7LA 4L3EE 4ONFH 5CP7B 4EQ2A 1BBJA 1HKLL 5TQ2L 4HJ0C 2DMBA 3VGBA 1C7TA 4PRAA 1PBYA 1HHHB 5CEZD 2VDLH 3QQNA 1RFDH 4LSSL 2ZOLB 4M61A 2QADC 1S7WA 4Y5YC 4PP2A 4OUUB 3VWJB 4HH9A 3GBMH 3BH8B 1QVOA 4LLDA 4LKCB 2XFXA 3X14A 1U3HB 5DD0H 4RIRB 4DKEH 4XP9H 5IKCA 5D72H 3MYJB 4WV1A 5BV7L 1RUPL 1JZ4A 4J3SA 4YHOH 4BK5A 1GJIA 5IEKA 4N9GB 2X44D 1T83C 1KTKE 1OAZL 4G9FD 1XGUB 3DV4B 5J89A 1CN4A 4GXUM 2YWZA 3N1QC 2JELL 3EYOB 1UXWB 2YD2A 2JB6A 4K8RD 3UTTA 5HVHC 4Z8FH 1T5WA 1KJMB 4R9HA 2Y9RT 3FL7A 1ZLSH 1NMAL 3ESUF 4P3CH 5DJ8B 5FA4B 5SX4H 2E6PA 2B4CH 1MFCH 1Z3GL 4PJBF 1B0GB 5BO1H 3PXHA 3VXQA 5EWIL 4W70A 1N0XH 4MD5A 2D03H 3CUPB 4GMTL 3GHEL 1Z5LB 1AC0A 2V5SA 1RUQH 4JZJB 2OL3B 3EJYC 4JDTH 3RVXD 4OQ1A 5CGYC 1FVCB 3WMSA 4B0MM 2EH7L 3TN0B 1MQKL 4CDHA 4LL9A 5BS0D 2ICWA 2XWTB 5F1IA 12E8H 4TYUA 3VWJD 1QR1A 3OQ3B 5FCUH 4F7CA 3IU4H 1HQRB 3OKYA 3QDJE 3HMWH 4O02H 1TETH 5DRNB 4HHAA 2KZWA 5HY9B 4YUEH 2X7LA 3SGKA 1HNGA 4H1LB 4P5TA 1N6UA 2NY4B 4LQFH 1ZLWK 5JXED 4MA7H 4FQPA 3HS0A 3MYZA 5CEYB 4V3DB 3PGDB 3CVHL 4OQTH 4NHCL 3GO1L 1MLCA 4GRWB 1UWGL 2MQ0A 4HX1A 2CJUL 5A16B 5JA8B 5E24E 4O2EB 4QRRB 3TP4A 4PJIB 4M3KB 5B4MD 3N85H 4I48A 4WUKH 4IMLB 4KAQH 4M1GH 4M4PA 1OCWL 2PCPB 5HDBF 5E9DE 4KWUA 5TE4L 4YIQB 3FRUA 3HZYA 3ARGC 1I9IL 4O5LL 1KNOB 4XVJH 2IPTH 3CCHA 1FPTH 4OFKA 4OKVA 4U1LA 4Y4KC 1BWMA 4NN7B 5E5UB 5SWQB 5D93C 3HG1B 1FL5B 5GSRB 3WJLA 5BMFL 3O2VH 2Y7QB 4YHYC 3DXAB 3BZEB 3UPRA 2GKIA 4HCRA 1X5FA 3LIZL 3TN0D 2EE3A 3GB7B 4YHIA 3VMNA 2V9RA 1YEJH 3F6IA 1BIIB 1J10A 1FG2B 4PJ9B 3G9VA 3I02B 2QQNL 1KJ3H 4NC2B 3QG7L 1Q94A 3PWJB 2AEIT 1KN4L 3OJMB 1I3GL 3TA3C 4M7LT 3GI8L 3NH7H 5DD3H 2NY4D 4FQQB 1PYWA 4MZ2A 2C7UA 2YD6A 4NPYA 2GSGB 2DWEA 4XPHH 2P4AB 4RMRA 1HIMH 4XXCA 3B5HA 3BKCH 5K93A 4LLUA 2BSRB 1AXSA 2UWEE 3BPOB 5EA0L 4C59B 1KG0B 1UKQA 3EFDL 1MRCH 4LLQB 5DF0A 4QRRD 3W82A 1AQDB 1XFPA 2VXQL 4Y16C 2X09A 4U1JA 3OKOA 1HNFA 4OF7A 3MLTB 3V5KB 1Z0NA 1FFPA 1I8LC 1YY9D 3G6JB 5HHOB 1R0AH 4M6ML 2HJFB 5FA3B 5B38A 2MKLC 5FO9A 1QZ1A 3RVTD 3GSNB 4MVBC 1NCWL 3SO3C 2AGJL 1NLDH 5E7BA 3DMMB 3B6SB 3OSKA 2IC2A 2P24B 1XZ0B 2HTLD 3C08L 1ZA3A 4ZAKD 5DJAB 3NGBC 4HWNA 3WXVH 4G9FA 2R69H 4M7KH 2EYTA 1XGYH 1KBGL 5IVZB 2E7LA 5A2JH 1WWBX 3HG1D 4DFIA 1PQZA 1YNLH 3DXAD 1WFOA 5GS0L 2NW3B 4YZFE 4RGNE 1JFQL 1J0JA 1TMCA 4PJGE 2R9HC 1H5BA 3BP4A 4L3AA 4JFFA 1IFHL 2Y5TB 3LQAH 3EYUH 4OLVL 4PJ9D 4BSVB 4PLOB 2R0LL 3V0WL 2PW1B 1D3CA 4MYWB 2FL5B 5F9OH 5FXCH 1A4JA 3DSFL 4JHAL 4JGMA 1MIMH 4PGCB 4XVUC 5IESL 5LCVH 4UQ3A 4XWOC 5MP6L 5E70A 3MRHB 1YJDL 5IB2A 4FNLL 5E99L 3TJHD 3P0YL 3KGRA 5F7EL 5HHXH 5LGKA 2D7QA 3BEWB 4OIIL 2DS4A 1ZA6A 4KDTA 1KEGL 1ORQB 4XHJC 2ZOLA 2Z8RA 5BS0A 3KYAA 3VWJA 3V4PL 1ZLUH 3BH8A 3DETC 4LKCA 4TNWF 5HHOD 3BIKA 2A6JA 1N59B 4MNQB 3MYJA 4QWWD 1DCLA 4N9GA 2EH8L 3F5WB 5HGDA 2DQUL 2W59A 5JXEA 1JPTH 3P9MB 5L9DL 4I77H 4RGMC 1INEH 3V6OA 1XGUA 2VQ1B 8CGTA 3EDFA 2G5BB 4I8DA 1BF8A 1B6DA 5DA0B 4PJ8C 5D1XB 4ZSOA 1MREL 4MS8C 2J8UB 5DYOB 4OI7A 2HLAB 4WFFE 2BC4B 2CMRH 1OQXA 3CX2A 4NWTL 2O26U 5D71L 5KVFH 3CSGA 1LO4L 3Q0HA 4X6FA 1NDMB 5GRUH 3B43A 4XCEB 1BJ1H 1N2RB 2ZJSH 4WDIB 4FFZH 4JR9H 4HK0B 1MCOL 4X6CE 1WZLA 4DQOH 5M94B 3QRFM 1YYML 2ADFH 2GQHA 4X6DB 3ET9F 4CU8A 1Z5LA 3QHFL 4MNHB 4PP8C 4JZJA 5JQ6H 3CFEB 5FYJH 3KLAA 4K7PX 1KJ2A 3BXNB 4UIKH 3MRCB 4OCSL 3VFTB 4DGVL 1FVCA 1FJ1B 3TN0A 5DDHA 2EC9T 1DDHB 2XWTA 2I5YH 2D2OA 4WI7A 4UMGA 1ZLVH 3HPLB 5HYSB 3WFBL 3MGOB 2SEBA 3O41A 4NWUH 3C60B 3HRZA 5DRNA 4XPAH 3BZFA 1P4LA 4MNQD 4H1LA 4EZMA 1KIQB 1MWAB 2ILLA 1FIGL 2ED7A 3QO1A 2R0ZL 5JOFA 5JOEA 4X7FC 4N1EA 1L8JA 3GMRA 3PGDA 5KTEH 4GXVH 1IAII 1MIEH 4Y5VB 1V5JA 3O45A 3F7YA 1ZT7B 5E56A 4KKNA 5GGVY 4PREB 3SKNB 2X1QA 4ZTPH 2I9TB 5DQDH 5HHVH 2YN3A 4O2EA 5F6HJ 4QRRA 5C9KA 4PJIA 4RWYH 3MGTB 3RVVC 3L7FB 5KAQF 5TH2B 5D1XD 1MCFA 4X99B 1C1EL 1I8MB 1D9KC 3SOBH 5AYQA 5CZXD 4APQC 2B5IB 3ZT7A 1ZS8B 4L5FL 2J7LA 2PCPA 4ZYKA 4UNUA 4KFZC 1T2XA 1JNHA 5GJSL 1LK3H 2UZIL 1VPOL 3WHE1 4PPTA 3U4EB 4HS8H 4YHPB 3VU2A 5KVDH 5MEPA 1F42A 4H20L 3ZO0A 5EUKA 1FCCA 4ZAKA 1SYVA 3ARYA 4POZD 1AGEB 3TH2T 1O7VA 1G9EA 3D0LB 1ED3B 3RVUC 1MFAH 1D6EA 1K4CB 3HG1A 4KHXH 5GSRA 3K2UL 2Y7QA 3LHPL 3O4OC 4AMKL 1GHFH 3GBNL 2XKUA 2LTQB 3LS4H 5GJTH 4JO2L 4G6KH 4PJ9A 1DBMH 4O51A 1BZ9B 3GMLB 2BOBB 3D9AL 1CLOH 5HBBA 3C60D 3UTQB 5E8PA 2F5AH 1YECH 4GG6A 3PWJA 4CBPA 4I9WE 4HWZB 2WUBL 1MCPH 3FCTB 5CJ8A 3H3PL 2QADB 1FYTE 4LIQH 4DN3L 3QUZB 4TULL 2YZ1A 3ARDC 1JK8B 4P4RB 3VG9C 1NFDB 1QSZA 4OLYH 4YH6A 1VFBA 1IGYB 5DR5H 4LLQA 5EU3A 1I8KA 3QXWA 3P3YA 4F3FB 5MENB 1AQDA 4LKXB 4Y4HA 5IVXB 4GRWF 3OX8B 4LRNH 4HLZH 4FN0A 3V5KA 1K5NB 4D2NA 3G6JA 5HHOA 3PWVB 4PJIF 2HJFA 5FA3A 1IGCL 4MB5A 5EBLB 1MCLA 4KPHL 2VDQH 1WF5A 4NKQB 3O4LE 4JO1H 4Z7QF 2OI9A 4HMCA 4FQ2H 3B6SA 5E8DL 3L6FB 1XZ0A 2R4SL 3W5NA 2EZ0C 1UM5H 5DJAA 3RWIB 2C3WA 4CMMB 3RNKB 3GIZH 5T5NF 1TNMA 4AL8H 3MUGB 3K80A 2OJZL 2XN9E 2BY0A 3L7EA 2NW3A 1YNKL 2R1WA 5B3JE 3HE6C 3LKRB 2EIEA 4YGVB 2Y5TA 4WWKB 1YEEL 4BSVA 3SKOB 2YXMA 5GS2D 4X8JA 5HHPB 1NGYA 4OLXL 2RBLA 4HJ0D 3MGAA 1EUTA 3KR3L 1OAKL 4PGCA 1UC6A 5F9WC 4FXGA 4NKIL 1DBJL 3WDIA 4MWFA 4PGZA 4GG6F 3ARFB 3T0XA 4O4YH 3QUZD 1A22B 5IFHH 5EO1A 2F5BL 2D3VA 4M1DH 1CTOA 1LP9B 3UC0L 3IKCB 4KRLB 4NOBA 2ARJB 3OB0H 4E42A 1G9ML 5MEND 2QQLL 1J8HB 1BAFL 1OAQL 4PG9B 3CXDH 1INDL 1R3HB 2DN7A 3SDXE 3F58H 1Z0MA 5EFIA 3T8XA 1BZ7B 3HZMA 1CL7H 3SQOH 4XP1L 1I1YB 1JI2A 3GMMB 1J0KA 3CMOH 4ERSH 5CD5C 5KSAC 3G6JF 3RZCC 3S34L 1PEWA 4KDVA 3SBWA 3IB4A 4BM7A 2K7QA 2BXZA 2E9WA 3F7QA 2VQ1A 1FE8L 2QLVB 4ODWB 1CFNA 3STBA 1FNSL 2BX5A 2G5BA 1LK2A 1BFVL 1H15B 1IAKA 2Z31C 1QSVA 4YO0A 5DZOA 2HN7B 4LSVL 1MJJA 2V7HB 4GBXB 4Y2DC 5DYOA 3U4AA 4AIOA 1A7QL 1L7TL 3KPSB 2EXYC 4WWKD 4ZD3L 4WENB 4EBQL 4UU9B 2CRMA 1B6UA 3GI9H 3MR9A 1U2HA 2WQ8A 5J9PA 3EJYD 4P2RB 2H1PH 4OZHB 4YHYB 1NDMA 2AK4E 4YEFA 1NCDH 5GSVB 4XCEA 2JK5A 3QISA 1OAUL 3D39A 1QFWH 3ARFD 4PJXA 3AVEA 4OLEA 2DBJA 3QPQC 4X6DA 4TVPH 4O58H 1OD9A 2XXCB 3CFEA 3DVNA 4B41A 3LOWA 4X9IA 3BXNA 1R3IL 3EFFB 4JG0H 4J2XA 1F58L 1J1OL 3BHBB 2ESVE 2VN4A 4M5ZH 3OAYK 4X4ZA 4YQXL 2FHFA 5GGRB 5HYSA 3HPLA 3VXSE 3QH3B 1NAMB 5ALBH 1CICB 3MGOA 4QTIH 3QUMH 3RGVA 3C60A 5IBUG 3A6OA 4NO2A 3MUZ1 4YHNA 1DUYB 3MXWL 3VGAC 4RNRB 5JW5B 1XEDA 4IHOB 2FSEB 3BKJH 1A7NH 3SHSA 4M43L 4Y5VA 2Y6SD 5D6CB 2XIDA 1ZT7A 1A1NA 5HI4C 2HMIC 3CDGB 2I9TA 2XKNB 4DKFH 1OW0A 2P1YA 3L7FA 5TH2A 1I8MA 4M93C 3NGBB 4GBXD 2MQCA 4ZODA 1CQYA 3MACL 1D5ZB 1ZS8A 3KPSD 4K9EL 5JUEH 1TZGL 1D5IH 5FYKH 3UTSD 3WFZA 2HFGH 3HAEH 4P2RD 2J8UF 3U4EA 1H3PL 1BFOB 4YHPA 4PJFB 2H26A 4U1KB 5F1KC 3EO1B 3E8UH 2H9GB 1JWMB 3NACL 4HLZG 2PR4H 3BVNB 3SGJC 4IOFD 4FTVE 2A9MH 3D0LA 4QRUA 1GXEA 1P7KA 4MDIA 1K4CA 5I1JH 2N1KA 2YMXL 3I84A 1H3TA 4Y2OA 2YEZB 4JHWH 4X6DF 1LGVA 3VFMA 5CCKL 1KB5L 4OI8A 3RDTB 4M6OL 1JL8A 1FL6B 5ICYB 4WW1B 3PJSB 3H9ZA 1BZ9A 1CICD 3RU8H 5GRYA 4ODXB 2MPAH 1QSEE 1P9MC 3ZL4L 3O3EA 4HWZA 3MRIB 1VADB 3FCTA 1X5XA 1MCDA 3TM6A 2AXFB 3QUZA 3ARZA 3MRDB 1QBML 3S5LA 3MLVL 4P9MH 4DTGL 4N0FB 3RWJB 5LQBL 1MCWW 2MNUA 2V2WB 4MVBD 2YR3A 3VGFA 4HQQL 4F3FA 5MENA 3TVMB 1T66C 4LKXA 3BSZL 1VA9A 1VFMA 4WEBL 1HWHB 3BDBA 3UPAA 2DTML 4UDUB 1HSBA 4JFOB 1U92A 4KRPC 3QXTA 4CN1A 4PP1D 4WW2C 3G04B 5C07B 2IBZY 1CDGA 3VXNA 1MJ8L 1TZIA 5M7QA 4ZDHB 5I74C 1J1PH 4MB3A 4S1DD 1UFUA 2D31B 3GMNB 1EJOL 4U3HA 5ESQB 5GGTL 4CMMA 2Q8BL 2NY0C 5C0FB 2ZPKL 3JSSA 3CDYA 2AEQL 3A6BH 2Q87A 1WVZA 2IAMC 3U0WL 5J6HA 3F7PC 2WY3A 1FFOA 2CDFB 3MUGA 5BOPA 2ZG1A 3TZVC 4UINL 4UNTA 1A3RH 3ZDYE 3JWOL 5EZLB 3WE6B 3HLAB 1WZ1H 4HGMA 3H9HA 5E94A 3RDTD 2YD9A 3D3VD 1T7YA 4DVRH 5F7DB 4KI5D 1AKJA 1IT9L 1ETZA 1RZ7L 3PE9A 5T3ZH 3S35X 1OWRM 1QD0A 1S7TB 2IFFL 3OJDB 3WIIH 1T3FB 3NABL 4OCWH 5JTWA 1UEMA 1S3KH 3QEGH 4JY6B 1YEGH 2M26A 3THMH 4JFDB 2K9UA 4RGNC 5A3IC 2WWMD 3WO3B 3GKWL 5BXFB 4AG4H 4HDIB 4K3HA 2G9HB 1F4XH 3V9FA 2GY7B 2H6PB 4HIJA 2GK0B 4A6YL 25C8H 4XTRC 2CO6B 5ITBL 1PD6A 1AGFB 3IFOA 3X17A 5J4MA 1V8HA 2DD8L 5DUMH 2VZVA 4TPRL 4R3SB 3TVMD 5BRZE 4P9HH 1NFDF 4LSRL 4X4YA 1JGLL 4PG9A 4IRZH 3QDAA 4JPVL 1GC1L 4PD4J 5D5ME 4W6YB 2VRAA 1WIOA 1RPQA 5T33H 2GSIB 5IVXF 5C07D 2GT9A 5FV2A 5I1EH 1MCKA 2QQKH 2MHAA 1RURH 3JTTB 1FZJA 4JJHA 3RNQA 2ZCLH 4OLUH 5C0JB 1D9KB 4G5ZL 4U31A 4APQB 1IM3B 1WC7B 4Q0XL 5EN2B 4JRWA 4FQJL 4ODWA 4P2CG 1WFTA 1J87A 2EE6A 1H15A 1JHTB 1MFEL 1EHXA 5I66B 3G08B 4JHZA 3ALXA 3GJFK 1I9JL 4PD4K 2V7HA 4GBXA 4W4OC 5HYJA 3IRZA 2ZUQB 3UBXG 3I6KB 3KPSA 4PGBA 4QNPF 1AE6H 3UTSA 4W68A 2HFEB 2E7BA 2YD8A 3T0VA 4AYFA 2CXKA 4P2RA 1MHCB 4LOUC 2K7PA 5JHLH 1CLZL 4JFDD 2VZ1A 1RZJH 3OG6B 3FFDB 2J2ZA 3B2VH 3D1MC 4P2QB 4UOJA 3FRPG 3BKML 3AAZB 3MREB 3HAEG 1VFOA 5I1GL 3TJEL 1CG9B 1T2QL 5JORB 2BZDA 2VE6B 1UYWH 1LP9F 5I73C 4O2FA 1LO2L 1NAMA 1EERB 5A2FA 2W9DH 4ELMB 3B8YA 1WIUA 2WINB 4G3YH 4G6JL 3IVKA 1NL0L 1X4YA 4E41E 4RNRA 3KNBB 4LPWA 5E8EA 2FSEA 3U7YL 3WUZA 4GW5B 3BIBX 3EDJA 2HYMA 4NM4L 4XX1G 3S98A 1RK0B 2MJWA 1XR9B 3AS2A 1QBLL 1MNUH 2VL5A 1A0QL 4MXVE 4PJHB 3MRJB 4KHTL 3WUWB 5EBWA 5C6TL 2BNRB 5FF6B 3VD3A 1D5ZA 5JOPD 2M8XA 1S78C 4OCMC 4U1IA 4L8BB 4XBEL 2Y06L 4LMQE 5CJQL 2XZQH 3LD8C 4H8WL 5I0ZA 4Q97A 1OARH 3SE9L 4NZTL 4PJFA 5DD1L 4YR6A 2YD1A 1XF5B 4U1MB 4RAVA 1G0DA 2H9GA 3HI6H 1C5DB 1UM6L 2KKQA 4D0BB 3BVNA 3LKPA 2HH0H 4OZHF 4HZLB 2ERJC 2V9TA 2EDNA 3OAZH 5JLZA 2VAJA 5GGQH 2XT1B 2MQ3A 3H42H 3TWCL 3OPZH 3NA9L 2ZKHH 4HCRH 3GEWB 4LSPH 3D3VA 3U4BH 4DVBB 5IFJB 3DVGA 3KPQB 1P84J 4H25A 1P69B 4WW1A 3NTCH 3PJSA 5JHDB 2WWKO 3RFZC 3RTQD 1JGVL 1CWVA 1KUMA 2XI9A 2I07B 4CN6A 4ODSH 4RFNB 4S10A 1VADA 4XNYH 3MLRL 4RISL 4TUKL 3Q1SH 3SDDB 3FN3A 5DFWH 4JM2A 2VLRE 1U2CA 3JVGA 1DQDH 2DMCA 4NZUL 2HFFA 2NX5E 2VKWA 2VDKL 5HHQA 4NP4H 4GJTB 2IQAA 4QT5B 1MVUB 4BA8A 4KJQC 1T7VA 4DGIH 1P84K 5CEZH 5EC1B 3TBYA 2VDOH 3RZCB 2C9AA 3CDCA 5EIIB 1SEQL 4OM1H 2X70B 3K74B 3DGGB 1X5JA 3ROOA 5D7LB 1I3RB 4X7EC 3BE1L 5C07A 2JTDA 3U83A 1OVZA 5BW7C 4I2XB 3GJFA 1DFBH 2D31A 4JFEE 2VZ3A 4KZDH 4OD3L 2ARWA 1AXTH 1CGSH 4Y2DB 2OBGA 3CFBA 3V4UH 3LCYA 2Y36H 2I60H 1KXTB 4PJFF 2BMKB 1I85C 4U6HB 2PO6B 4JPWH 3FT2A 1JGUL 2XTJE 4QXWA 2BJMH 4YHKH 5DGRA 2W0KA 4IOIB 4OM0L 3LN9A 2FEEI 3VI3E 1PAMA 4FQIH 1A6VL 1JF1A 2BVEA 4F37K 2R1XB 2EDKA 2OTPA 3WD5L 4MA3B 5F7DA 4K8RH 1U8IB 5JHDD 4LNRB 3O9WC 4BQ8A 2FJGB 4PRHA 1S7TA 4EDWH 1C5CL 1EAPB 1T3FA 2J12B 2UY6A 4Q9CA 4JFDA 3IJSB 2GAZB 3SDDD 4L9DA 4G7YH 4ZMAT 2WNGA 4HDIA 5IFAL 2G9HA 3D5OF 4TTGA 4N8CL 1F4WL 2FLRT 1AO7B 1YMHA 4F57H 1ES0B 1T7XA 5JW3H 2QKIB 3EHBC 1IAIH 4RMTA 2HKFL 2DWDB 4X4XB 1OHQA 5CD5D 1GGBH 2D7NA 4R3SA 1A1MA 4ODHL 4I5BB 4HWBA 4IIQB 5IJKC 1FZMA 4WHTA 5LGHH 1UWEL 4J3OC 3TBSB 3VGHA 1WTGT 3EBAA 2WP3O 4ODVL 1QTYT 5EZIL 3TH3T 4YXLL 3NFSH 3U6RB 4NGHL 2KQMA 2QQQA 2B1HL 4PJ5D 4M9PA 4ZNEA 4XRCB 4HKJA 3EOAA 1H8NA 4M93B 5C0JA 1IM3A 1WC7A 5EN2A 2ZNXA 3HI1B 1ACZA 4FG6D 2PO6D 3LKQB 5FGSA 4LP5A 4RRPA 5DEFA 5H94B 4UV7L 3C5ZB 3AM8A 3TBWB 1IL1B 1M1SA 5I66A 3G08A 2VXUL 2VYRE 3OF6A 5DJDB 4U6YB 2YD4A 3ILPB 1Y0LB 3LKSA 3I6KA 2CIIA 4DN4H 5DVNA 2YBRB 2HFEA 2Z4QB 3KLHD 2IFGA 4JFZH 1TZHB 5A43C 2FX7L 5FIEA 5GGVH 2MFNA 1XT5A 3FFDA 3SCMB 3NCFB 2IH1A 1FVEA 3R1GL 2BCKB 4LSQL 2AERT 1FN4A 3V79C 5F3HB 1AO7D 5FEBA 5IW1A 1FNEA 2OL3H 1Q9WA 2OLDA 1N5YH 1CG9A 3WS3B 1HYSD 2L4OA 1YPZA 4TTDC 5JORA 4WFGD 2VE6A 4LIQE 2E6QA 1DQLH 2NY2C 3RTQA 1I1RA 4FQLH 2NY5C 4XNZB 3VJ6B 4PRNB 3IFPB 1A9EB 5J6GA 3QA3A 4AIZB 3DO7A 1SYSB 5B22A 2YKLH 1A4KA 1XIWC 2IF7A 1S9YB 4ZPVB 5INCB 2VN7A 1WZKA 4H1LH 5EO9B 4GKOA 4GW5A 4LCUA 5I8CA 3VH8A 4GAFB 3K2MC 2IMNA 1L4IA 1XR9A 4HIHA 3MA9H 4WW2B 1LILA 3ULVL 3C5ZD 5HD8C 1RJYA 4PJHA 3MRJA 1BHGA 5ENWB 5FF6A 3HHRB 2PW2A 3S7GA 5IQ7L 1MCNA 5HYIA 4L8BA 3EYSH 4LSDA 1AR2A 5DK3A 3QR2A 1ZV5A 1DANT 1KYOJ 3ZSSA 1B3JA 4RFEB 5F7HA 3TCLA 4HC1A 3C87A 4ZUTA 4U1MA 4Z95L 3MV9E 2FIKB 1OLLA 3NZHL 4OGZA 3SCMD 1IKNA 3ULUL 3OKMB 4OCNC 4HZLA 1EJ6A 4M00A 5E00A 1A7OH 1IARB 4MNGE 4LSTL 3BO8B 4HPOH 2G60L 3GSRB 1JNNH 3DJ9A 5JQHC 1QQDB 2FX9H 3KS0H 4N8VB 4DK3A 4BH7A 6FABH 4A2LA 4X6EA 1ZSDB 5FGBC 3MLXH 5J0BA 1KYOK 2MSPA 1CVSC 5ISZE 2BOCA 4OB5H 1YQ2A 2I07A 1FH5L 3LMJH 4Z0BH 5C86A 3ZYZA 3CLEH 3MFGB 1KCVH 3VG0H 4AQ1B 4R90H 4ELMF 4Q9RH 2P8LA 1WT5C 4MAYC 3CD4A 2ADJB 4M48H 4HKXB 3HC4L 5C0RL 5E8NB 4V1DB 3BRGC 4P4KA 1SBBA 1CCZA 1MVUA 3QUYC 2DQJL 4IJ3C 4BJLA 5EC1A 5EOQL 3SJVB 3Q3GA 2X2YA 5EIIA 2EDEA 2R1YB 5IF0A 3DGGA 1BP3B 4HIEB 1KGCE 2VZSA 5D1ZB 3WS6C 4BSWB 4MJ5B 4PJHF 4OAWA 5IMOB 1QRNB 1JTTA 1CFSA 3KHOA 2DBLL 3GSNH 5EUOB 2XWBB 2CSPA 3CIQA 4GRLC 4PJ5A 2YN5A 3PQYB 3DI3B 1NQBA 4FFYH 3T0WA 4ZO7A 1K2DA 3T3PF 2BMKA 1OP3K 3RBSA 1P5UA 2J5LC 4PB0L 4TSAL 1RI8A 3E1F1 5IWLA 3MV7E 4ZOEA 4X80H 5IOPB 3VFPB 2PYFB 5DMYA 2JJTC 2Q7NA 4OZFA 4WFHD 4NQCB 1NH6A 4F7PB 2L7UA 1F45A 3CH8A 4MA3A 4TVPE 4V2BA 1HZHH 4LNRA 3ZE1E 5IB1B 1IC5H 1LMKA 2FJGA 3N9GL 3Q2CA 2VDRL 4OZIE 5J13C 1DE4B 2A6IB 2V5MA 2WBJB 4Z7WB 1JHKL 4ZPTB 2WLYA 3GZKA 2B4CC 2DQTL 1E0OB 3IU3B 1FFRA 3C5JA 4TSBL 5FECB 1LO5B 2GAZA 3VFOB 2CDGB 2CPCA 1B0RA 4P5KB 3PF2A 4V1DD 1AO7A 5FYKU 4ORGB 2NLJB 4L8DA 1ES0A 1WLHA 5IB4B 2QKIA 2NY7H 4OGYH 1DLHB 3NCJH 2DWDA 3TPUB 3SJVD 1F4AA 2NY6C 4NYLB 1SJHB 1JP5A 1FLRH 2NQCA 5D1ZD 1I7TA 4LASL 1NCCL 1WEJH 4TVSa 2ITDA 1TJHH 3U36A 5D7IB 4IBLT 1QRND 3S9DB 4NQDE 3L3KB 3RBGA 1AXIB 3X3FH 5TDNB 3JUZA 2DKMA 2VKXA 4NQEE 4O9HL 5GHWL 4MA8H 1P7HL 5K9JL 1ZKAA 2AI0H 3O3UN 5DMGC 5HVFB 2BRRL 4YDVA 5EO0B 3PQYD 3SE4C 2YPLE 5I71B 5FYKE 4JFHE 5GRWA 2Q1EA 3HI1A 1NEZA 4LCWB 3F12B 4N90D 3EYVB 3LQZB 3LD8B 5DJ2B 3E3QE 3ME0A 2MCPL 2DLGA 2FH6A 4ALAH 5DJDA 4HUUB 4U6YA 4Z7NE 4IDJL 1Y0LA 4ODUB 4P46A 4NCC2 3NCEB 4L4VE 4F33B 1Q72L 2DQDL 2WBJD 4Z18A 5KVEL 5KS9A 2EO1A 1U8NA 3VFUB 3SCMA 2BCKA 4PJEB 4JG1H 4BZ1L 2HTKD 4ONHA 3NCBB 4MJIB 3OJVC 5F3HA 5DJCB 3WN5C 3CFCH 3CVIL 4R4FL 3BPLB 1MJUL 4XNMB 5DD6B 3WS3A 2X9WA 4C56E 1GIGL 1T04A 1DTUA 2DLTA 4JANB 4PJ7A 4I0PC 3OAUH 4P3DB 3ZYOA 2HVKB 1AHWC 4KK9D 5DA4A 5C2UB 1A9EA 5FUZL 5C0BE 1A6UL 3OXSB 1S9VB 4NKDB 1KACB 4NN5C 2GEEA 5FKAB 3WFHB 4I18C 4ZPVA 4Q6IC 5KVGH 2LFGA 5C0DB 1MCJA 1MWAH 3FAXA 5HDQL 2IH3B 1SJEB 3VD9A 2YXFA 5JIHA 4LCWD 3QHZH 3UTZA 1BBDL 1YEFH 1CR9H 1J88A 4U1SB 1PSKL 1B4JH 4RAHA 4R2GC 3S3JA 4HBQA 3QXAB 3WDHA 1IILE 4S1QH 1ACYH 3I3EA 2JF1A 4OLZH 4YBLB 5CKGA 5IW6B 4JPKH 2GFBA 3BISA 2VXTL 1G6RA 3MLYL 2FIKA 5C0ND 4NZRL 1IM9D 1FNFA 2EDXA 1I7RB 1B2WL 2LU4A 4CVXA 3ARPA 5T3ZE 3AMLA 3NZ8B 4OSUH 2B39A 1F11A 4PJBE 3O9WB 3A67L 4MJID 5SWSB 2J8HA 1OGAE 2OR9L 3DX7B 3MBXH 4LLVB 3BO8A 4JN2B 5FYLL 3GSRA 1QQDA 2VLKB 3RA7L 2VNCA 3AS0A 2WQRA 4ZS7L 1Q9OA 4U0RB 1BM3L 1QSFE 1BVKA 5IK3A 2OMBA 5ITFB 2HAZA 3LQAC 5GS2H 1IEAB 3OHXB 4JREB 5ID1B 3DPBA 1WAAA 2NZ9D 3QAZC 4BKLB 2D7TL 1FZKB 1V7ML 3V6BR 4HJJH 4YDJB 1T2JA 4FQXC 3VWKC 3L5WB 4KTDL 1OY3B 4EUPA 2ADJA 2E9JA 4KJPC 2VDLL 4M7LL 3VFNB 4GG8B 4V1DA 2YSSB 3IDGA 4TRPL 5IMMB 2VXVH 4GAJH 2CK0L 1A21A 1D7FA 1UA6H 1FGVH 1M7IB 5EB9A 1KFAH 3O11A 4I3RH 4R6UA 5DD0L 3SJVA 1MAML 5IR1B 3REWA 2R1YA 4WW2F 3D25B 5D1ZA 4PV9B 4MJ5A 5FO7B 3FO1B 2R2HB 1IGTB 3O2WL 5IBTH 1QRNA 1T0NB 3QZWG 4G42B 2YPKB 2BSSA 3JV4A 3TO4B 2A0LC 4I3SH 5EUOA 5HDBE 3DX9B 1AGCB 2XWBA 1IGJB 1JPFB 3PQYA 5CS7A 4F2MA 1J05B 3KYNB 1KLFA 1HHIA 4K3JH 3OG4B 1OSPL 3PP4L 1NCAH 5SWSD 1R3JA 2ZUUA 2H45A 2AJUH 3P4LA 2HT3C 1IAOB 4HUWA 2VLKD 2PYFA 1IGFL 4P3CL 3IDYC 1KJ2L 5AZ2L 1V05A 4YDKL 1KF9B 1VKXB 4E5XA 1OTUC 4ACPA 3T2NH 5DHXB 1CXIA 1FNHA 2A6IA 2DLIA 2WBJA 4KK5D 4Z7WA 1QA9B 3VA2C 5MEOB 5GS0D 1MRDL 2ZUSA 5TQ0L 3OAYH 4FXKA 4Y5XB 1LO5A 3VFOA 2CDGA 5GZND 1WAAF 3RJQB 4P5KA 5K33A 3V7AE 3P77A 5DO2D 5E2UH 2NLJA 1JYNA 1RSFA 4XAKD 5L88H 4NYLA 1SJHA 1TJIH 5J3HD 4N0UA 1NSNH 4ISVA 4G8GD 1U8OA 5D7IA 4PG2C 4GKSB 2AAVA 3TO4D 4LPVA 5TDNA 1A9BA 2AJYL 2XQBH 4NHUE 1I4FA 1U93B 1LO3H 2YD3A 5DK0A 5EO0A 3BP7A 4NJ9H 1OWWA 1J0YA 4AZ8A 1FZOB 5EUOF 4N0YH 3ROLB 3H9SE 4LCWA 4WUKL 1U8PB 3F12A 5DJ2A 3KJ4B 4EEEA 4JAMA 2AQ2A 2X4SB 3QFJA 5E1AB 1WCBB 4HUUA 1PFCA 1UZ8A 4KJYB 3X3GL 3CVHA 1VEPA 5ADOH 1J0IA 4QHUA 4FZEL 4YX2L 1A14H 2Y25A 2DQCH 5TE7H 4HT1L 5GRZA 3CFKB 1IM9A 4FFVC 1RJZA 3CX5J 4FQCL 2AJ3B 6CGTA 4Z7WF 1HINH 2R2BA 1KLGB 4JPIA 5T5FH 2FECI 5DJCA 4UNVA 2GY5A 4XNMA 1FRGL 1KJ3L 4MX7A 4WVRA 5J57B 3GMQA 1VACA 2EEDA 1X4ZA 4JANA 2BNQA 4MAYB 3KWWB 5FHAH 5DRWA 3AB0C 3GSVB 1NAMH 3I50L 3PV7A 1U36A 2Q8AL 3OXSA 3ZLQC 2X1XR 4F9LC 1AGDB 5I16B 5CEZE 3BKCL 5FKAA 3CX5K 3WFHA 5IGXL 4IJ3B 2YHGA 4GQPH 5I1LB 2R4RL 5C0DA 3LEYL 5DJYB 1EMTH 3MV11 1FSKC 5D7IF 4ZUSA 1JF6A 2XG4A 3CSYB 1SJEA 3FO2B 4J6RL 3QIWC 1QKZH 2AEPH 4OZGB 5CINL 1MHHB 5KJRH 3TT3H 5DWUL 1N5AB 4U1SA 3V0VB 3DROB 4Z7UB 1T1ZA 2MTPA 3BUYB 2Q86B 3X11B 2D4FA 4NFBA 5ESVB 5GS1B 5BVPH 2R8SH 2AABL 2P8MB 3MRLB 2C4FT 4G9FE 4OF8A 1P4BH 3KYKH 4H88H 5SV3A 4JRYA 3KAAA 1CFBA 2VLJB 3C09C 2E7LE 4JQVC 3W0WA 3OTTA 4X7TB 1UACH 4BUHA 4HUKB 1YNLL 1KCSL 2VL4A 3NZ8A 1W72L 1CF8H 3GGWB 4MQ7A 5SWSA 5J13B 1RIUH 3MLZH 3WXWH 4LLVA 3D85B 3HMXH 5DC4B 2BDNL 1OTTC 4JN2A 5DFVC 4PJEF 4WU5A 5IHUH 2VDMH 2VLKA 5ILTH 3EYQC 3QQ3B 1LVEA 1RJLB 5AZEH 1JMXA 35C8L 5C09A 4PLJD 4MAYD 3UCRA 43CAB 4MAUL 2VDNL 5ITFA 1JV5B 3ZE2F 1M6OA 3QCVH 2CUHA 3S35L 5L0QB 4P48A 5LWYH 3L5XL 3QNZB 3HNVH 5ID1A 3FO0L 3HFML 1RUML 3QCUH 3QEUA 4UB0L 4ZUWB 4HGWB 5C3TA 4R0LA 4FRWA 2XY1A 3HCVB 3TO2B 4KKAD 3VXRB 1NGQL 4XCFL 1A5FL 2NY6B 3H2WA 4JO3H 4NN6C 4GG8A 3VFNA 1N6VA 5BQ7A 1MFDL 4LCIH 1MI5B 4JN1L 4C4KT 3NVQA 3IRPX 5IR1A 2HWZH 1GPOL 4R7NA 1DN0B 2A6DB 4F58L 4FQ1L 3H7BB 4G8GA 1IGTA 1E4XH 2VLJD 3O6FB 4XAWL 3B9KC 4G42A 4NC1E 2FR4B 3TO4A 3DRQB 1RVFL 3DX9A 3KPRD 4JB9L 4M7JH 1IGJA 2AEWA 4LF3B 4UBDC 1JPFA 2DL9A 1J05A 2EDJA 3KYNA 4NM8H 1VHPA 1E27B 5HVGB 4OTXL 2VUYA 2QR0A 3C8HA 5D96C 4KMQA 1IAOA 2EXWC 2W38A 2F8XC 3MZTA 5GRUL 3Q48A 3P9WB 1MHEA 3RX8A 5CP3A 1VKXA 2PF6A 5HGHA 1TENA 4YXHH 2A6KB 1MFBH 5MEOA 4HWEH 2DQIH 5B21A 2JE8A 3HNTH 2NPLX 4Y5XA 1R3KA 5AAMA 2OJEA 3VXRD 1OAYH 1L0YA 1RZKH 5EORH 2FZ3A 1X5LA 2ID5A 5F7WC 4RDQF 4YAQA 5E03A 3U9PL 5EIVA 4G8IA 5HYQA 4XP5H 2FJHB 5TF1H 1MI5D 4XCNB 1EHLH 4PRIA 4XPTL 3D18B 3RKDD 4LVEA 3RWFB 3DURB 1QFWM 3QCTH 2Z35B 4LGPB 1EO8L 1KTDB 2NXZB 3QEHB 4HWBH 2VAAB 4KROC 4QRQB 1QLFA 1F3DJ 4HKZA 3NFNB 5H37H 1C5BH 2JB5L 3O6FD 5JW4R 4GRWE 4F7TA 5KTEL 4M7ZB 2AJSL 3HI5H 3W2DL 3WNLA 4S0TD 4QRRE 3ARVA 4PJIE 4MA1B 3FB5B 3UDWC 4CADB 2Y1VA 1U93A 1CIDA 2QHRH 2ZCHH 3UJJL 4Z7QE 2ZSVB 1T89A 3WLWC 5KANI 3ROLA 2JIXB 4QHNA 1WBYA 4LAQH 3TH4T 3V5HB 3TFKC 3JBG7 4XPBH 1K6QH 4EOWH 2FDBP 5ALCH 1YEKL 1J12A 3AY4C 5DLMH 2YUWA 1YYLL 4Q9QL 4RMWA 2EDBA 4FXLA 4KQ3L 3DXAE 3LDBB 4S1RH 5HHNB 2KPNA 1JZ5A 5DRZA 1RU9H 2Z93A 4PIRF 1F3JA 5C0GA 4NZJA 5ESAB 3O2DH 3CFKA 1G7QB 2NYYC 4OV6F 1YEHH 2C3VB 5CJXC 2VH5L 2B1AL 1KLUB 3LS4L 2ZZUT 3BOVA 1W8NA 5MEQB 5ACZA 5D8JH 5IVNA 1MRFL 4KK6D 3QAZB 2J4WH 5IROA 1QNZL 1TXKA 2FYYA 1PG7L 1U8JB 5IEHA 3SDCC 5F6IC 3KWWA 4RAUA 1EFQA 1E4KA 1CDUA 2G5RA 3GSVA 2NXZD 2NMSA 2OTUA 4RCAA 5HJ3A 2XA8H 1KELH 1QLEL 5I16A 5AYUH 3O6ML 1KB5B 3LV3A 3N1PC 5DJYA 1XCTB 2AJVH 4LU5L 3FO2A 3CFIC 3RHWK 2CLRB 2F9BT 4OZGA 3G6JE 5HHOE 4DUWA 2JIXD 1MHHA 3AREC 3PWLA 3DROA 3VFSA 4J12A 4Z7UA 5ANMB 1G7JA 2Q86A 3FT4B 4NQSA 2GUOA 4Y16A 4M4RA 2V5YA 4YHMH 1NUDA 2VLJA 2XWJA 1I8LA 4X7TA 4K3DL 2J6EH 4WCYH 3KPRA 4R4BB 4NT6B 4K2UH 1K8IB 3IDYB 4HC1H 5CSZB 3MNVA 2QTEA 4CJ0A 1WBXA 3WEXB 3QJHA 3ZT5A 3RIFK 4MLSA 5LGJB 2P5WE 5JIIA 3WLBB 3RY6C 4ZG1A 3MROA 3O3DA 4R8WL 4AIXA 3JTSA 1YDPA 3OKDA 3DWTA 2Y23A 3BDYL 3MRGB 1YEIL 4HMDA 2FJFA 4GUPA 5HHMB 2R0WH 2W1NA 1H3VA 3QNZA 1XF2B 4UTAH 2XZCL 2Q20A 4ZUWA 1F4YL 4HGWA 1HXMA 3D69B 3PUCA 3VXRA 4JZNB 4CKVX 4PLKC 4LVHC 5F1NA 2IANB 4YFEA 4Y19D 4ELKB 3B2UD 1KIUA 5SWZA 3WKML 5IBLD 2BVTA 1F13A 3GRWH 4XGZA 3S3PA 1MI5A 4NRYB 3P4OB 2BVPB 4MNQE 1AP2B 4UUJB 4OZGF 4P9HC 3WL9A 3TLRA 4MXQD 2FX8H 1DN0A 3H7BA 4Z7UF 4A6YB 4ZFOL 1RZFL 2O5YL 4IRSC 4OZ4A 2OM5A 3KPLA 3H0TA 5DJ6B 2EYSB 4GKZA 4AM0B 4CMHC 3TT1L 4WV1C 3LQMA 4LF3A 5I75B 5F1OB 1JYXA 3HUJB 1RUAH 2J8UE 3B9VA 2XZAL 1KCGC 3WFCL 4HUVB 1E27A 2EEBA 2J88H 2R39A 5HGGS 4PS4L 4LCCA 1J1XL 3U79A 4L8SB 4JM4L 1N8ZB 5IMLB 4QY8B 3QHTC 1UXSA 3QPXL 1UB6B 5DFTA 4FZ8H 4JQXA 5GZOC 1JUFB 5IVOA 5CUSH 4X6DE 4S2SB 1NPUA 5HHMD 1AR1C 3WIFA 1UB5B 2CK2A 4TVPL 4CVZB 2XACC 2BFVH 5CGTA 3O3AB 1KOAA 1PKQB 1RZJC 4YEEA 3WKNA 1KEMH 5F7LB 3T4AA 3M45A 1MPAH 3UO1H 5BZDA 1CE1L 5T1KA 4FOMA 4EI5C 2LQRA 5F97E 2UUDK 2KBGA 2FJHA 4L4JA 1TJGH 5C8JA 4XCNA 1A6WL 2A9NL 2GTWB 4RZCA 4X9FA 4XMLH 1GGTA 3RWFA 5IHBA 3OJ2C 2Z35A 1E4WH 2F74B 4I4WB 1HQ4B 1OB1B 4QRQA 1LEIB 5T1LD 1PX4A 3OZ9L 5DVLA 2FEEL 5C0AD 3TYGL 1MF2H 4FP8H 4JQIH 1KPRA 1KIRB 4PGJA 1IJ9A 4PRPA 1IGMH 3SGKC 3QI9D 3SKMB 2XV6B 4YPGA 2P49B 4OCYH 3G6DH 4P5TC 2ZSVA 4L1HA 2HP4A 4OGAC 3VDBA 1CFVL 4CVWA 3C09B 3SO5A 4F8QA 3JWDH 3MLUH 4XCCL 5JUEL 5GISL 2IPUK 3HR5B 4NSKB 3NIDF 4HFUL 4LLAA 2HFGL 2I26N 2ZOKB 2B2XH 3QQ4B 4MCYB 4XPGL 4B7LA 3I3DA 1V7NH 1BZQK 3MUY1 4K3EL 3EYFB 5AWNL 2RCSL 4TSCL 4NKMB 3W11D 4LFHD 1FL3B 1T7WA 3WUWG 5I1JL 1G7QA 3KPNB 1A6ZA 1JVKA 1SBSL 1BLNB 3V4VH 2F54B 2C3VA 3DYPA 1DBAL 1HWGB 3A6CL 1D5BB 1NANH 1S8DB 2LVCA 3DO3A 5MEQA 1BD2B 4N5ED 1JGEA 3WJLC 1YN7B 4Y1AE 1EGJH 1IVLA 3K1DA 5GIRA 4OBRA 3HE7B 1U8JA 3ECBB 1SJXA 4XCYA 2E7MA 2CDEB 3STLB 3CH1B 1P1ZA 1DQQB 1HOCA 1NFDE 4WY7L 1CGWA 2NTFB 3RHWF 3MC0A 5DEZA 4QRPB 1E28A 5EULV 1KB5A 4WUUB 4JJ5B 1RV6X 3MRMB 5MENE 3LEXB 5LBSH 2JCCB 1BIHA 2XXMB 1AGBB 3QT2A 5IVXE 3GHBL 4Y19A 1OTSC 4OT1H 4KUCD 2XICA 1I9RH 1ZWIB 3GM8A 4XXCC 5D7JB 3B9KB 5AD0B 2R0KH 1NBVL 1ONQB 5ANMA 1F4HA 3IF1B 4DAGL 4LARL 3VXOA 3FT4A 3LEVL 4RFOH 1R3LA 5GS3A 3MLPA 1TTGA 4MXQA 3O0RL 1U58A 1JZ8A 1BOGB 1HHKB 4QF1B 5KSVB 4G43A 2O61B 1T0PB 4GMSL 1U8KA 3PWNA 5D96B 3RIFF 4QNPE 5DFVD 3RQ3A 3SY0B 1ND0A 2OQJA 1P4IL 2AQ1A 4QRTB 1K8IA 1MQ8A 4LSUH 1UCBL 2F54D 3NBNA 4KQ4L 1B90A 3SE3A 3KXFA 4PUBH 3NIGF 1YQVH 43C9B 1YNTA 2E7LC 1BD2D 5INDA 1JNLH 3BPCB 7FABH 4KKLD 4YHLH 5GGTA 3HE7D 3QEGL 2H32A 1GOGA 1YEGL 3HE6A 3MRGA 1F6LL 5K9QG 2V5TA 4K8RC 2CKNA 1CFQA 2A1WL 4YGAB 5HHMA 4FMFA 5CAYB 1LP9E 1IGIH 1XF2A 4JFQA 5I8OH 1X5GA 1CBVL 4QRPD 4WUUD 3D69A 3IS0X 4JZNA 4LVOB 1IAMA 2DQHL 1J8HE 4DGYL 2AV7B 3LH2H 2CQVA 4EUPH 2W9EH 3BN9D 4ELKA 4KROB 2ORBH 2X4UA 5D70L 3QUMB 4YFLI 4IRZL 2DM7A 4XC3H 5D7JD 5B8CA 3FQWB 2XTLA 1MFNA 3C6LA 2BVPA 3I2CL 3P4OA 2AW2A 3RVXC 1AP2A 4HIIB 1ZEAH 1MEXH 1QYGH 4Q9BA 4KDTC 5F89B 1F8TL 1AY1H 4L4TB 4JFYA 3K4DA 3VWJC 1RURL 3P0VL 1IBGH 5CZKA 4A6YA 1HKLH 5T1LA 5C0AA 5TQ2H 1QBBA 5DJ6A 3LN4B 1IAIM 2EYSA 5FKPA 3N50A 3KPOB 1VESA 4LSSH 1L7IL 3QI9A 1LE9A 3ZKQD 1VFAB 5KSAA 1S7UB 1ZAGA 4P23B 4PRBB 3KPSE 5JXEC 4KGLA 5C0CB 4HUVA 1GVIA 4ETQB 2F19L 3D0VB 1LWRA 3FONB 2ZG2A 1MAJA 2VLLB 5JO5B 1VB9A 4P2RE 2BVYA 4GS7C 4L8SA 4OZHE 5J56B 1FAKT 1N8ZA 5BV7H 1RUPH 4NC1C 2Z31A 1UB6A 5GGUB 3MO1B 1AJ7L 1S7XA 5B4MC 5I1HH 1LHZA 2UZYB 4AENA 2VR5A 2FEDD 4S2SA 4N0RA 4NKOA 2AJXL 2JELH 4CVZA 4TUJB 5L8LB 3K4AA 4HZAA 2NW2B 4WHYH 2FBJL 1F90L 3SDCB 3IDNB 1YMMB 5CZVL 4C4KO 4KROD 2F15A 3EOBB 4PTUB 1WK0A 4J4PD 3S88L 3S37X 1NMAH 5TDPA 4OF3A 1FO0L 4JZJC 3PNWA 4N5EA 3GSQB 2EC8A 2VERN 5K9KB 4YXKL 2NNAB 1NDGA 1Z3GH 2W9LA 2DJ4A 5D2NB 3O81A 3O6KL 3TN0C 5EWIH 1RZ8B 1MHPL 4Z76B 2WMPA 3GHEH 5F3BA 3BIAX 3DIFB 1LEIA 3AREB 5B3NA 2GJ6B 2G75B 3HC3L 4X5XA 1RHHB 3QEQB 4RSVA 2EH7H 3B9AA 1FHGA 1MQKH 3SKMA 4M6AA 1V3LA 2NY4C 4P23D 4Z7OF 5C0CD 1JE6A 3HZVA 5L7XL 2NCMA 3IETA 2WBWB 2RHEA 3HUJF 3QO0B 5E5RB 3HR5A 3MA7B 3WNMA 4PJFE 3QDJA 4NSKA 3DV6A 3QSKB 1AI1L 2IMMA 5C08E 3VD4A 4F7MB 1FV1B 1QLRB 1GCFA 3CVHH 4MXWL 1I3UA 4NHCH 3HC0B 3GO1H 1UWGH 3EYFA 1DBKL 2CJUH 1UH2A 1HHJA 4NKMA 3H42L 1FL3A 4XXDA 3RVTC 1G0XA 4JCMA 4CU6A 4UV4L 3C8KB 3MOAH 5AG9A 2C1PA 4O00A 1FAIL 1MLBB 2EKSA 2F54A 4G7VH 4ZAKC 1YMMD 4PB9L 1OCWH 3E2HA 1KN2L 4LP4A 4NN7C 2OX5A 3NTCL 5TE4H 5B39A 1F02I 3UYPA 1YN7A 2YPVL 4MSWB 5E9DA 1I9IH 4O5LH 1KPVA 1DL7L 2K1MA 1U91B 1IQDB 2CDEA 4LVHB 1SQ2N 1X7QA 4IMKC 5E5MA 3CH1A 4LQ1A 4PJ9C 4ONOA 1G7LB 1DQQA 3UX9B 2EE2A 5BMFH 4YK4B 1BBJB 5GPRA 2GJ6D 2NTFA 4BFEA 4N8VG 1P9MA 4QRPA 3BD5A 1NC4D 4PRAB 3LIZH 3IFNL 4HUNB 5E6YA 2GCYA 5JR1L 2JCCA 1AGBA 3K8LA 4M61B 1X5YA 2QQNH 2E9BA 4U1HB 4YE4L 4OM1L 4WTXA 1QVOB 3QG7H 3STZB 4HW6A 2XFXB 5D7JA 1KN4H 3X14B 4UAOC 1I3GH 2A38A 3GI8H 5IKCB 4KUCF 2ATPB 4LDOB 5IEKB 1IQWL 1Q0XL 1BOGA 1YC8A 5KSVA 1CGSL 2O61A 3V6FB 5EA0H 3ULVD 4XC1L 1JTPA 2YD7A 5ECJE 3C8DA 1MAKA 5FUOL 2OI9C 1AIFA 4WI6A 3X13A 1VERA 4KVNL 1A7BA 4QWWC 2VXQH 4ONGL 4X5LA 3PWUB 4NQTA 2JB6B 4CGTA 3UTTB 3QIBB 1T5WB 3EDDA 4M6MH 2DF3A 2WM0A 4JDZA 43C9A 1NCWH 2IEPA 4I3GA 4J3VA 3TZVA 4Q74A 3UMTA 4JFDE 2PN5A 3PGCA 3C08H 1BVLB 3ULUD 3O4LB 5J8OA 3MNWA 2OXHA 2DB8A 4F15B 4S11A 3VXQB 3DVFA 2D0FA 2VSDA 2BXYA 1KBGH 4KXZI 4QOKB 3WSQL 1LEKA 4RGOL 4EXPX 3TEUA 3WNOA 5GS0H 3ILQD 1JFQH 4TQEL 2VDPL 1NFKA 3EOTH 5T1DL 2CLZA 2RIKA 3VGGA 1IFHH 2DDQL 4OLVH 2R0LH 1QR1B 1Q9KB 4J4PA 5C0EB 3V0WH 4AEHL 5MHSE 1GGCL 1Z9SA 3ZTNL 2ADGA 4HXBL 1DSFL 2JCCF 2UVEA 4LPTA 3FQWA 3DSFH 4JHAH 5CLWA 4WHYG 4U1GC 5IESH 4HIIA 3DX6A 4HIXL 2A74B 2OZ4A 5MP6H 5DI8B 5HYFA 1YJDH 4P5TB 4FNLH 3DTXB 1FORL 5E99H 5F9DC 3HS0B 5K9OA 3P0YH 5F7EH 3LY6A 1R24A 4OIIH 4PBVC 1MLCB 4HX1B 1KEGH 4HS3A 1A2YB 3D48R 4J1UB 3JV0A 3V4PH 1WCQA 4P23A 3SBWC 2EDHA 1JRHI 4YBQD 3UTTD 3QIBD 3SKJL 1AR1D 1NUGA 5IG7B 1U3YA 4U0QB 5JZ7D 3FN0L 3HZYB 5GGUA 2EH8H 2FH8A 3PDDA 3RWDA 2DQUH 4TOYL 2EKJA 3O4LD 4P2QE 3MLSL 5D1XC 4RQQA 5L9DH 1G1YA 4U1LB 4OKVB 5CZXC 2Z8SA 5C7XH 5DMKA 4QOKD 1O7SA 3NMEA 5TE6L 5T3XL 1XGTB 1EO7A 2CIKB 2FHCA 3I6LD 3QRGL 1A6AA 2XN9D 1J9CT 1MREH 5C0IA 3QWOB 4POZC 4YHIB 3S96B 4ZFZA 3BD4A 4PTUA 4ELME 4NWTH 1W0WB 5D71H 4KJWD 4F80A 1LO4H 3HNSL 4AH2A 1Q94B 3T1FA 3T0DA 4UT7L 1MCOH 5D2NA 1SMAA 1RZ8A 4Z76A 4P5TD 3DIFA 4X6CA 3QHFH 4NPYB 3WJJC 4X9HA 4E9LA 3C60C 2GJ6A 2ENYA 1AXSB 2G75A 4OCSH 1KCRL 2MKWA 1VCAA 1NC4A 4DGVH 1W8OA 1YN6B 4PJHE 1V3JA 2BNRE 1FNAA 1G6RL 4XH2A 1DN2A 2IGFL 1LDPL 3WFBH 3OKOB 4RMQA 1HXYA 3C9NB 4Y5VC 1CTNA 3VXSB 1FFPB 4JY5L 3QO0A 1N4XL 4L29A 3UEZA 5B38B 5IB5A 3T3PE 3LRGA 2X5PA 1FIGH 4U7MA 2R0ZH 3M8OH 1OW0C 4F7MA 3KJ6L 4NNYA 1QLRA 1K3ZA 2B5IC 2EYTB 4LPXA 3TF7A 1VGEL 1DVFB 4L3CA 1PQZB 3P11L 2W65A 1C1EH 1MLBA 1ZK9A 2BRQA 4QXUL 4WU7B 1H5BB 5JHDE 1QEWA 3BP4B 3FMGL 3GSOB 4JFFB 4L5FH 3INUL 2PTTB 4HUMB 4NNXB 3ZTJG 5GJSH 2QSTA 1FP5A 2UZIH 1VPOH 3O8XB 3FAWA 5CSBA 3TV3L 2RGSA 4H20H 5FK9B 3Q5YA 3K3QA 2IQ9L 3L95B 3DUSA 3R8BB 4UQ3B 4Q9RL 4ZOBA 5I8KL 3K2UH 1CZ8L 4AMKH 3KYOA 1T22B 1K4DA 4R26L 1U8MA 3GBNH 1ZA6B 4JO2H 5BS0B 3QUZC 4U1HA 5D7LE 1TFHA 2VABA 3STZA 3JXAA 1V3MA 3VXSD 4X83A 3S6CA 3BIKB 4CAGA 2A6JB 4I2XE 4MHHI 5L2JB 2WUBH 2FECL 3H3PH 4KKBD 2ATPA 1I7ZB 3L9RA 4DN3H 5HGDB 4TULH 4DZ8A 4U49A 2ADIA 1FYTA 3N1FC 4BELD 5I18L 3MJ9L 4NO5A 3V6FA 3V52L 4GS7B 1DVFD 3PHQA 4LEOA 5BW7A 3QFDA 3PWUA 3ULVF 1EV2E 4ZSOB 4F9PA 4JFFD 4MQXC 3UAJD 3QIBA 3L3DB 1CD0A 1IGCH 1I85A 4KPHH 3O8XD 3BMWA 4K71B 4J7RA 2W0PA 4X6FB 5E8DH 2PXYD 2R4SH 3PABB 4X0KA 1BVLA 3FTGA 1AFVL 3O4LA 1OQOA 4K23L 1L0QA 4WWKC 4WTWA 4QOKA 1CGUA 1AO7E 4FTVD 1RHFA 2OJZH 3ULUF 5FYLD 1HHGA 3FOMA 2EDOA 1ZVHA 2W0FB 3KLAB 1YNKH 1KJ2B 5CILL 2VLME 2XN9A 1RIVL 1HK6A 4OGYL 1A6TB 5DDHB 1YEEH 5IT2L 3ARFC 1Q9KA 5C0EA 5F8RC 5ID0A 4YLQT 1FLRL 3CXHJ 4OLXH 1A8JH 3FZUC 2SEBB 3O41B 4X6BB 3KR3H 2VZOA 3HRZB 2FD6L 1OAKH 1R5VA 4GLRH 3BZFB 4NKIH 1P4LB 2A74A 4M1CD 4LVNC 5DI8A 3QO1B 4S1SL 1QRKA 3DTXA 5JOFB 3H7LA 3IDXL 2F5BH 3GMRB 3WO4B 1XF4A 3UC0H 3O45B 3F7YB 1FBIL 2HA1A 3MTRA 1RULL 3S4SG 1GZQA 1A2YA 1CXLA 2QQLH 3I75A 5DJZA 2VQTA 1BAFH 1F3DH 4J1UA 2BHZA 1OAQH 3CSPA 3ZDZF 3CXHK 3WHXB 3BGAA 1INDH 1UJ3A 1JPST 4UIMA 2Y6SC 4XP1H 4ZYKB 2OS7A 5F44A 2F53B 1DP0A 3SDXA 1G9NL 1JNHB 3LSOB 1JJUA 4DEPC 5IG7A 4FABL 1NCUA 3BJ91 3IYLW 3ZT6A 5MEPB 3S34H 4Z78A 5EUKB 4ZAKB 1J5OL 4GBXC 1SYVB 3EJZD 1EEYA 2EDRA 1FE8H 3ZKMD 2ZNWA 1FNSH 2XQYG 1D6EB 4S0UC 1XGTA 1BFVH 4JEGB 3WNPA 4BUGA 2CIKA 1K85A 1Q1JH 4F7EA 4LSVH 3DX8A 1A7QH 1L7TH 2UY7A 3BEVB 3QWOA 4EBQH 2FWOB 1ADQL 4IOFC 3TNNB 3S96A 1W0WA 4K7PY 4O51B 3P30L 5E8PB 1S7SB 4GG6B 5E95B 3QXDA 1OAUH 2FB4L 3MLWH 2AK4A 1KV3A 1MELA 1WISA 4XBGA 1CICC 1MWAL 4NFCA 4YPJA 4JDVA 4FFWD 5CWSA 3RAJL 1MY5A 1R3IH 4UAOB 1F58H 1J1OH 1VFBB 1YN6A 4NUJA 2FATL 1O5DT 1I8KB 3IDJB 4YQXH 1XIWA <