4QRSA

Crystal structure of hla b*0801 in complex with elk_iym, elkrkmiym
Total Genus 79
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
79
sequence length
276
structure length
276
Chain Sequence
GSHSMRYFDTAMSRPGRGEPRFISVGYVDDTQFVRFDSDAASPREEPRAPWIEQEGPEYWDRNTQIFKTNTQTDRESLRNLRGYYNQSEAGSHTLQSMYGCDVGPDGRLLRGHNQYAYDGKDYIALNEDLRSWTAADTAAQITQRKWEAARVAEQDRAYLEGTCVEWLRRYLENGKDTLERADPPKTHVTHHPISDHEATLRCWALGFYPAEITLTWQRDGEDQTQDTELVETRPAGDRTFQKWAAVVVPSGEEQRYTCHVQHEGLPKPLTLRWEP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system
molecule keywords HLA class I histocompatibility antigen, B-8 alpha chain
publication title Molecular imprint of exposure to naturally occurring genetic variants of human cytomegalovirus on the T cell repertoire.
pubmed doi rcsb
source organism Homo sapiens
total genus 79
structure length 276
sequence length 276
ec nomenclature
pdb deposition date 2014-07-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00129 MHC_I Class I Histocompatibility antigen, domains alpha 1 and 2
A PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4qrsA02
3.30.500.10 Alpha Beta 2-Layer Sandwich Murine Class I Major Histocompatibility Complex, H2-DB; Chain A, domain 1 MHC class I-like antigen recognition-like 4qrsA01
4HAFA 1JHTA 4HKBB 4P4RB 5M94B 4M6OL 3NIDF 2XY2A 4GSDH 1JV5B 4JHWL 1F3DJ 4HT1H 4YHOH 2VERN 3T77B 3QJHA 4HWZA 2PW1A 5DJ0B 3RUGB 2FH8A 2NY3B 4ONGH 5DO2D 4JDVB 1MY5A 4HS8L 4ODXB 2IWGA 4P5TA 4E41A 1LWRA 3CZJA 4OFVA 3UTTA 2SEBB 1D7FA 1Y18A 4WENB 1M1SA 4UQ3A 4AM0A 3UZQA 4TNVK 1IQWH 4LARH 2H41A 5FGCB 3HB3C 1QYGH 3HE6A 3NZ8B 1UCBH 2NTSP 3I6KA 4OCXH 2HMIC 1A3LL 5DT1L 5GISL 5C0DA 4W4NA 3BO8A 4XXDA 2X89D 4Y4KA 4I4WA 3VFMB 4TSAH 2P4AB 3SDAB 5C0JA 1SY6A 2OYPA 1JZ2A 3G5ZA 5LKNA 3FRPG 5IESH 3SDXE 4PRDA 2B20A 4PRPA 2E7LA 4OZ4B 4PTTB 1FZJB 5HI4D 1D6EA 5BVPL 4FFEX 1CLYL 4MNHB 1T03L 1QEWB 3QNXA 1MHHB 3MBED 1FZOA 1ZHLA 5JNYB 2LAAA 1P1ZB 2HAZA 3CLFH 2VLKB 1X6NA 3EO9L 5FOBA 4LLYB 2JCCF 5D7JD 2VR4A 3FQUA 4X99A 2CJUL 4FXKB 3VG0H 2HLAA 4GQ9L 3DETD 5EIVA 3S37H 3ARDC 3T09A 1MQKH 3FTGA 3OHXB 1PFCA 4PREA 1E27B 2C7UA 3EDKA 1T89C 1JN6A 4LLWB 5GRYA 1JHKH 2XQBH 3HI6H 1X5KA 2HG5A 1CLZL 4FQXC 5C0IB 3U4AA 1PQZB 1CQKA 2UWEA 3VFOB 5J1AB 2B1HL 2ZOLA 4U1GC 4QTHA 3VXNA 1BJ1J 3QIUD 1NGPH 1KCRL 1BIHA 1CCZA 1RHHA 3IU3A 2BNUB 1CD1A 3N1FC 1R5WA 3DMMA 3ZE2F 5IT2L 1L8JA 1FH5L 2APVA 1HCFX 1SJHA 4U1JB 1N0XH 4QRTB 2AW2A 4EUPG 1L0YA 2YEZA 1GC1L 3ARGB 1Q38A 1QFHA 1NCAH 1CYGA 3ZDXE 1IAMA 4JKMA 3O6LL 1UH2A 1GPOL 3PGDB 4M7ZC 2DWDB 4PRNA 5HHNB 3LMJL 1RZGB 4U1IB 5FECA 1YPZA 5IW6B 4YHML 5LWYH 1QSVA 3GGWA 1EEYB 1FDLL 2NY1D 3OB0H 4ZDHB 4OF3A 4DCQB 3OKKA 3K4ZA 1EIBA 3HZYA 1QQDA 1FV1B 4JO2L 4KK5D 1HCVA 2AKRB 3S88H 1LO5B 5T3ZH 4ZO7A 4JKLA 1OQXA 1RUML 3DVGA 5B4MC 4JRXE 2XRAL 4OZGF 2XWBA 4NKQB 2H2SD 1LO0L 2X4PB 4XXCA 3LKSA 4XPTL 4XZUA 1B6UA 2VLJA 1UXSB 2CLVA 2X70B 3HMXH 1PVHA 1I8MB 5CJQL 5IBLC 2WZPD 3TFKA 1FNAA 5F8RC 4J6RL 3LEVH 5DK3A 2JJTA 4FQ2L 4A6YH 5KTEL 1S7XB 3C09C 4NZTL 2BOCB 1QA9A 4KHXH 4PGBB 5K9OA 1CGVA 1FNGB 1LEIB 5GGUB 3L5HA 2FWOA 5B3JE 1P2CA 4P2RB 4RGNC 3KPQB 4ZXBD 3BZFA 3PJSB 1OAQH 3BDYL 3QULB 1CZ8L 5L9DH 3IFPB 4Z7VA 1PX4A 4KKLD 1BECA 5E8OB 5IMKB 4QYOA 3GKZA 4PYHA 5IR1B 3VXRD 1KF9B 1CFSB 4F9LA 2X4NA 1TQCC 4R7NB 3TPKA 2EDXA 4H88L 3VRLE 2R0LH 2ID5A 1ZHNA 3UYRH 4G80B 4U1MA 2XZQL 4JB9H 2IGFL 1RI8A 4JG1L 1PDKA 2DQEH 3ZMRA 4JPWL 1QG3A 4OZHA 1H15A 4MDIA 3UPAA 1AGCB 2DL9A 3O3DA 2HJFB 4X9HA 3ZT7A 3RZCB 4NCC2 4OKVA 4CVWA 1CWVA 3VRJB 4E42B 2A2QT 5C07D 3UYOD 4Y5XB 1IM9A 3ZDZF 4AMKL 3MV7A 3MBEB 2R9HC 5IBUG 5DWUH 2R2HB 4HH9B 3TPUB 3ULUL 4JGUA 1FFNB 5CINL 5HJ3A 4MAYD 1PG7L 5GS2H 1K8DB 5D7JB 3O45A 4XBPA 3U7AA 4NNPL 4R8WH 3FQXB 2FECI 1A7QL 1LK3H 4LFHG 3SE8H 1I1FB 5E4IA 1EUUA 5IB1A 4S2SB 3BUYB 1NC4B 3BE1L 4PRHE 1Q9WB 4GQPH 1OAUH 1XF2B 4P9HL 3D0LB 4GG6A 4PP1D 3EJZD 1MAKA 1DQDL 2EYSA 1YNLL 2YPLE 1JTPA 2CLZB 2D03L 2GITB 3QIUB 4ONHA 4L4TE 2DF3A 3MOAL 3WS6C 1CXLA 3IB4A 2XZZA 3A6BL 4ODSL 4EXKA 1AE6H 1QSFA 4YFLF 5I1JL 2W59A 1MLBB 2QADB 3QUXA 4JCLA 5HHME 4RFNB 3SOBL 1Q9LB 1NGZA 4QHMA 3B2VH 4YXLL 2JB6A 4MA8L 1MCRA 4GRLA 2FGWH 4MCYA 3F5WB 2PO6D 1H9VA 4M7JL 5H2BA 4KRMB 1E4XL 2UWEF 4OB5H 3H9SD 5DMYA 2HTLC 1GAFH 3B9KA 3LRSB 4K94L 1D5BA 4M5YL 4MZ3A 2OR9H 2CIKA 4K2UH 4P5KB 4JLRB 2BVPB 3REVA 4NWUH 1J7VR 1XZ0A 32C2B 2NY1B 2AABH 4FXGB 5TF1H 5DJDA 5DUBB 5LBSH 2KQMA 3LQAC 3QXAA 3FN3A 3IU4L 4WUUA 4TTDD 2X1OA 4J4PC 1AXIB 4NO0D 3D3VD 3HUJE 2FX7L 4U6YA 3BWAA 5CZVL 1NCCL 5E2TL 2GK0A 1FFRA 2GSIA 5HGDB 2BVEA 1EK3A 3CMOH 3PQYB 4MVBC 5FGCE 1XCQB 1YPZF 1KB5H 2YK1L 3VXMD 1MIEH 1N3NB 3BFOA 1EO5A 2IG2L 1CDIA 4HIJA 3NA4A 5E1HB 5D1QC 4F57H 5TQ2H 1P7HL 3U2SB 1RJYB 4O2EA 3RP1A 3GJFH 3OKNA 3VH8A 4NRXA 1TMCB 3WIIL 5TE6L 5CBAA 3N85L 4QOKD 4ZXBB 1IC1A 5F9WC 3EYQC 4MD0B 5TJWK 4ZPTB 3NFSL 5MEND 1CLOL 1M71B 3QUZB 1KACB 4X7CC 3O0RH 5KBNC 3SPVB 3UJTL 1JZ4A 5CKAA 1CU4L 2BK8A 1YA5A 4O2CB 3CDCA 3IFNL 1QRNE 2G5RA 2EYRB 2P24A 3CLEH 2VZOA 5DK2B 4YH6A 2R1YB 1KEMH 2E3VA 3HC4L 5IFAL 3RWEA 4BZ2H 2D9QB 5EBMB 4DGYH 3FT3B 3BQUD 3MRMA 4L8SB 1BQLL 3SKJH 3KPSD 4G6JL 4L4VB 2C3VA 3FO0L 1TZGH 2ICEA 1RURH 3KPPA 2K7PA 4K9EL 4KV5F 5IHZA 2GFBA 5C07B 3VGGA 3BZEB 4RDQF 2V2XB 4HC1A 4KKNA 1RUKL 1U58B 4R7DA 2I26N 4JCMA 4A6YB 4WI8A 1DBBH 3QIBA 4OT1H 5HY9B 3QWOB 4EI5D 3Q3GB 4YHNA 2V2TB 3U1SL 2E6JA 1JTTA 4V2CB 2BVQA 2KKQA 3IDGB 4KZDL 3FN0H 4D3CL 4WHYG 2VIRB 1JL8A 3R06A 4N8VG 4JFYB 4OGXH 1NGXA 2BHZA 4K07A 1L7TL 3KPMA 5KSVA 5KVDH 3VFPA 5I1EL 1DFBH 5AG8A 3QCVH 5L88H 5EOCH 4ZFGL 3E2HB 3EHBD 4LSSL 2H32A 3WN5B 5DZNA 3VDBA 1G7QB 1WAAF 4Y16B 4FQLH 4X98B 2R0KH 1D5MB 5CIPA 3IDMA 1YUHA 3GSVB 3RTQD 2PO6B 5CEZD 4HBCL 2JELH 4PJ7A 5BMFH 2ZSWB 1HHHA 3CH1B 3H9SB 4PJEB 4WEBL 4PUBL 4OI7A 3NACH 5I8CB 1CL7I 2NXZD 2ILLA 1IAKB 1ACYH 1UM5L 3DBXA 4JAMA 1VEMA 4AJ0A 1CR9H 3V5KA 4GH7B 1R5IA 5CAYB 3PP4L 3GSUA 3CSPA 4OFYD 5D93C 4GAJL 4JZOB 3I9GL 3OJDB 4NO0B 3D3VB 1P4LB 5JDSA 3O3BB 3BP7B 5E6IC 1GZQB 3SJVB 1RZJL 3FZUD 1RZKC 4XCFH 1G0XA 4ZUTB 5C08B 5HGBA 3MNVA 1X5LA 3DPBA 2H45A 3TN0C 4OBSA 3KDMA 2Z91B 4XCNB 1MCDA 1D5ZB 5CLWA 4WU7A 4D8PB 3O3EB 2R2BA 3T2QA 4GG8A 5T1KD 1Q0XL 2VL4A 5SWZD 1TVDA 3OXRB 3QUYB 3DX7A 3EDDA 1ES0B 4U0RC 5MEOB 1NUNB 2V5RA 2ORBH 5GJSL 3FCTA 1H0DB 4ZS7H 4ZNCD 2F9BT 1TJHL 3SDXA 4PRBB 5MHSD 4L3CB 3U7WL 4NQCE 1IAIL 3U4BH 3SKNA 4WV1C 2W60A 1BFTA 5ACZA 3SGDH 3QDAA 4L29B 3EOBA 3QNZA 1SEBB 4LRIC 1G7LA 3KLSA 5IGXH 1KT2A 2W9LA 5JW5A 2X44D 4I0CC 2IEPA 1TXKA 1R0AL 5EOQL 3I6LD 3BQUB 1YMMB 5FUZL 2EIZA 2B8OT 4G6AC 2GJJA 3VFTA 2HH0L 3GB7B 3KPSB 5J57B 1CL7H 4AYFA 2EO1A 4MZ2A 2KZ1B 5BS0D 1MFDH 2QSTA 2G2RB 2OL3A 2WQ8A 3MGOB 1U9KA 1N2RB 1P9MC 1A1OB 5SWSB 5C6TL 2A9NH 2MKWA 2ADIB 4QRRD 2HFTA 2WBJD 4ZPVA 4Y5YA 1I8IA 3EDEA 3STZB 3VFRB 1IGMH 4JQIH 4R4BB 4GS7B 1U8NA 5IVZB 4EI5B 1RUQL 4HJGA 2PR4H 2Y07L 3GJFB 5FKPA 4Z78B 1BOYA 3C60C 4JDZA 1RIVH 4LEXL 1RK1A 2VJXA 5IB5A 1YEFL 2FO4A 2XKNA 4WCYL 4FHBD 1F4XH 1OAXL 1HDMB 1TJGH 5D2LE 2CXGA 3MO1B 5E03A 5EZIH 5F96H 4FQHA 1BZ7B 1QKZL 4FNLL 3PHQA 1L6XA 2YSSB 3BIKA 4JFDD 4ISVA 4JDTL 4NC1E 4U7KA 1FLTX 5ENWA 3U0TB 4F37F 3EJJX 1UACH 1J8KA 2B4CC 4HWBL 5ITFB 2X10A 3RTQB 3Q6FA 3NPSC 2BCKA 4XPHL 5HHOB 4BM7A 4G8GB 5C92A 5KSBB 3JUYA 1CF8L 4JRXA 1R3KA 4AL8L 5F70A 4V1DE 1U8JB 4WHDA 1VESA 2DLHA 3FRUA 3DGGB 5CD3B 1R24B 3QIWD 2VITA 1XH3B 3DROB 2J88L 4DEPB 3I6GA 1BBJB 3FB7A 4WTZA 4O58L 4I3RL 4UZGA 4ZUWA 2I9TA 4ZUUA 5HYIA 2ZG1A 4YDJB 1UXWA 1OP3K 4PJ7F 1JHLH 3ZLQC 4IJ3C 1U2CA 1DL7L 2IBZX 5KJRL 1LO2H 5J9PB 3ZKXC 3MNZB 5IEKA 3VXRE 4EOWH 1I7TB 5TPWL 2IQ9H 2XI9A 1NCTA 1UZ8B 3MFFB 3C2AL 4QT5B 7CGTA 4ZO8A 5GS1C 4JREC 5FYJD 4IIQB 3RWHB 5T1KB 5DD5H 3MLRL 4FFYH 2BVUA 1QLEH 1F3RB 1CDBA 2BOBA 1FNFA 1NDMB 4YK4B 3L5JA 2BVTA 2OTWB 2FR4A 2F5AL 4PG2C 5HXMA 4HDIB 4MA3B 4JPIA 1DQQA 5C07E 3RQ3A 5ACLA 5GRVK 5ALBH 2NPLX 1RZIA 3SDYL 5GZOD 1G84A 1MJ8L 1QFWM 3QXUA 1VHPA 1A6WH 5I73C 4G8FA 2CUHA 1G6VK 1Q9KA 4ODHH 3FOLA 3ALXA 3RZWA 2XKUA 1CIUA 3MUZ1 1IM3A 1TVBA 1TDQA 4I18C 1B0RB 3L7FB 2UVEA 1T2QL 2NTFB 2NZ9D 3GK8L 3DO7B 5BS0B 4HEME 3SDXF 4JZJB 2V7HA 5C2BL 1J05A 1HQ4B 1IAOA 4PRHA 4JQXC 3FB6A 4GMSL 3QEHB 4NNXA 1MCQA 3AMKA 1TCRB 2QSCH 4HWEL 4QXUH 4QRRB 3UPCA 2CRMA 2WBJB 4EIGB 3A6CH 3BZ4A 4OCWH 5D70H 5DTFA 3HB3D 3IVKA 4M7KH 1G9EA 1GZPB 2DTML 4L4TA 4NN6C 4Y1AD 4QWWC 2HVJB 2VLRD 4M6AA 2HJLB 2NQCA 3AROA 3GSQA 5HHMA 4X5LA 3MLSH 1MJ7L 5IHLB 1B4JH 2GJ6B 4LKCA 4N9GB 1JWMA 3U30B 3H9SE 4EVNB 3L1OL 1A5FH 3TBTA 2X4QB 3O11B 3U0WH 2DWEB 4XGZA 5EDXA 2OP4L 2ICWA 4GXVH 4WFHD 3FFCD 1K5NB 4HKBA 2MCPL 4NN5C 1RUAL 1M6OA 4HPOL 3VXTB 2A1WH 1NL0H 4K7FB 3BKYL 3T77A 3D3VE 5F1IB 5C6WH 4P9ML 2DKMA 4JDVA 4ODXA 3O3AB 5CUSH 3HUJA 4WW2C 1J88A 2SEBA 4FP8H 4N0YH 3ZDXF 1NUGA 5F9AC 1I3GL 4H0GA 1AY1H 4YBQC 3VXME 3IDXH 3MCLH 3ZZ1A 3DGCR 2NY5L 1A6UH 3NZ8A 3WKNA 4KY1H 4G6ML 3LVEA 3OR7A 3BN3B 3RWDB 1VACA 4NJAH 1N59B 4QOKE 4E5XB 3VWJC 4GAGH 5MENE 4C4KO 3QEQE 3O6ML 1JZ3A 3CVHH 4BQBA 3TH3T 1OL0A 4NQDB 4OZ4A 2HT3C 3ARRA 4NQUA 5B8CB 1RZFH 3LD8C 1B0GB 1QEWA 1MHHA 2P5EB 2J8UB 5IUSA 3GMRA 1DLHB 4GSDL 4OLEA 5JNYA 4HT1L 4YHOL 1BGXH 4NZRH 1QRNA 4IRZH 2NXYD 3GRWH 1LK2A 3O9WD 1P5VA 4AZ8A 4YUEH 4CMMA 1X5AA 4ONGL 2WWMC 3KPSE 1TENA 5CEYB 4HS3B 1OGAB 5HPMA 3B9VA 4H20L 2D9CA 4Z0BH 1E27A 1RFDH 1IQWL 1I1YB 4LARL 4Y4HB 3HMWH 4BFIB 1BVKB 1QYGL 5E99H 4ZQKB 1E6OH 1UCBL 4OCXL 3MRNB 2E9BA 4R2GC 3SQBA 5EO0A 1T1ZB 1AGDA 4QF1B 3UBXA 4TSAL 2DMCA 2QQKH 4POUB 3U36A 2BNUA 5DEFB 3QDMD 1UA6H 1X3DA 5IESL 4MXQC 4QRTA 4PGDB 3ARGA 3QI9C 3ZE1F 2QR0B 2O5XH 1S9YB 3PGDA 1A4JB 5HHNA 1RZGA 3QO1B 3CLFL 5IW6A 5J12B 4M5ZH 2VLRB 3VG0L 5JOEA 4ZDHA 1XF5B 3S37L 3S97C 2ENSA 1MQKL 1T0PB 1FV1A 5CEZE 3AXLB 2AKRA 1UEMA 3C5JB 1LO5A 5I1GH 1JHKL 2XQBL 5I8KH 3HNTH 1UJ3C 5CD5C 1KELH 2X4PA 3P9LB 3PHOB 3BEWA 1P84K 3OGCA 4PY7B 1NFIB 3IJSB 5F6IC 2X70A 2J4WH 3VWKD 3MRPB 2AAVA 2BOCA 4XC1H 4PGBA 4M7LH 1N0XL 4WWKC 3ARDB 5GGUA 4ZO6A 4Z5RB 3LQAH 2X09A 3RA7H 1NCAL 4OCLC 4RMSA 3MA7B 3KPQA 1LE9A 3PJSA 3QULA 5FM5M 3L3OB 4FQXB 1FFOB 3RVTD 5ADOH 3IFPA 2W9DH 4WRLA 5IMKA 1BIIB 4U1GB 5SWZE 3KG5A 5LWYL 1CFSA 1OSZA 3T0EC 4HG4K 2X89A 1IL1B 4U6HB 5DZOA 3SGKC 4YAQA 3HUJF 3S88L 5T3ZL 3LQZA 1JRHI 4MNQD 5INDB 5C9JB 1DQJB 2Q20A 5MHSE 1QR4A 4H1LG 1AGCA 5ICXB 2HJFA 5GGVL 3VRJA 3MRIA 3RVUC 4G7VH 1CGWA 1KG0A 4Y5XA 3HMXL 4KTYA 4M3KB 4I48B 3MBEA 2P8MA 1RJLA 4RAUA 2R2HA 4HH9A 3CZFA 4A6YL 1FFNA 3EUUA 3KS0J 2NXYB 5D7JA 3I6LE 2UV3A 4KHXL 4WHYH 3DUHA 4X7EC 1HOCB 5HI3C 5BS0E 1YC7A 3R8QA 4OGAC 3K8KA 4S2SA 3QA3B 1Q9WA 5DJCB 1OAQL 5L9DL 3S35H 3MRRA 4FTVB 4GJTB 1X5HA 4JM2D 2F19H 2NY4C 4G9DB 4QRRE 4Y5VC 1DQMH 1EBAA 2QLVB 1T0MB 4MHHI 4MVBD 2X4UB 4BJLA 3EOYG 4E0RA 1ODAA 4LVNC 1T7WA 3QIUA 4PJHE 2PYFB 3B6SB 5DJYA 1JNNH 3V6ZB 4LLUB 2R0LL 3UYRL 4JB9L 4ORGA 3WS3B 5F7NC 1RIHH 2YD3A 4KKBC 2EKSB 4QXGH 3WFBH 3THML 2DQEL 4YLQT 3EJYC 3WLWC 1Q9LA 3CVHB 4EKXA 4H26A 3I2CH 2WP3O 3QB7C 4F33B 4RGNB 2F74A 3LKOB 1JGEB 1XGQB 1A6TB 3S3JA 2O26U 2WINB 3AU1A 5DMGD 5DWUL 1S7WA 3FHQA 3LRSA 4XPAH 5D2LA 2COQA 4JFDE 1L7IH 4JLRA 4YR6A 5DMJB 1JRHH 2BVPA 5GXBB 1VGKB 4R8WL 3E3QC 5DZLA 1LK3L 3SE8L 5IOPA 3F6IA 4FXGA 4WO4C 4YXKH 5DUBA 2Q3ZA 1NCNA 2DQFB 3DX6B 1OAUL 1EV2E 1G7IB 3WUWB 1YEGH 4KFZC 5DR5H 3HR6A 3GM8A 4RQQB 5JOFB 2EXYD 5BRZD 3VWKB 1F4YL 1S9WA 1DZBA 4YDLC 4IMLB 3QUMH 1AE6L 1YYLH 5FYLD 5BW7C 4G59A 4PGCA 4C83B 3JTSB 4XNYH 5FEBA 4LHUB 1RJYA 5KSUB 3B2VL 2FEEI 3BPCB 1Y6KR 3HFMH 1T6WA 2FGWL 4ZXBA 5HYFA 1PKOA 4OB5L 4OKDA 2J12B 2BFVH 1GAFL 2OR9L 4K2UL 5FYJE 5FCSH 3BKML 3CDGB 3IYLW 3VXRA 1MLCB 2HLFC 1I1CA 3SPVA 1SYVB 1AD9B 3DTXB 4NWUL 1TQBB 4M93C 3JV0A 3PWNB 4HXAH 5TF1L 2V5SA 3OAUH 5I8EB 4KK9C 5DK2A 5LBSL 2R1YA 4X9IA 3DYPA 4HAGA 2R69H 4MNQB 1ZWIB 3FT3A 4KPHH 1WUNT 5E24E 3UO1H 2QBWA 2WSKA 2D31B 1B4RA 3W9DB 3CMOL 4R4NC 2FECL 3ZKND 1SMOA 5C07A 1R6VA 1KB5L 3QISA 3BZEA 1MIEL 2V2XA 3IDNB 2NX5D 1U58A 1IC4H 4MAYA 4A6YA 4F57L 5TQ2L 3VGDA 2IAND 4MCZB 5EOTB 3QWOA 2AJYH 4K3GA 5CLTA 1X6LA 5E8PB 2P5WB 4BQ8A 2V2TA 1OCWH 5IVXB 4Y19D 3IDGA 4S1DC 4IDJH 2X40A 2VIRA 1J0YA 5EUOB 2XY1A 4K3JH 3O0RL 4JFYA 3MRKA 2BNRB 1JPFB 1TETH 3WV0A 3ESUF 3LHPH 3A67H 4Y1AE 2I24N 3CLEL 2CLRB 3ISWA 1AXSB 1HXMB 5DUMH 5E5RB 1KEML 3E2HA 2VLRE 4BZ2L 3WN5A 4DGYL 1G7QA 2X9YA 2GJZA 4M1CD 4A2LA 4X98A 4HFWB 3SKJL 1D5MA 2IBZY 4HKZA 3KJ4B 3K80A 4OIBA 2DM4A 4NT6A 1TZGL 5F9WB 1RURL 2PO6A 4MMXC 5D7LD 4MJID 4X7FC 4KHTH 2Z31C 4PR5A 3CH1A 3I3EA 1OTUD 3H9SA 3G5XB 4P23D 4WFHE 2PTTA 3FFCE 2C1PB 5B39G 4J3OC 4L9DA 1DBBL 5FXCH 5JZ7D 5J56B 4OT1L 1IAKA 2WV3A 1QO3B 5SX4I 1HH9B 1V7MH 4U6XB 4QXWA 1A0QH 3SE3C 3MLUH 3OR6B 4JZOA 4NO0A 3D3VA 3FN0L 2Y5TA 4G6AD 3CU1A 3O3BA 4I5BB 5FFLA 1ZAGA 2B4CH 3BP7A 1GZQA 1HHGB 2FEDD 4OF5A 1CDUA 2L4OA 1U8MB 4OGXL 3HCVB 5C71A 1RULH 1IEBB 4X4XA 4PP2B 4S11A 5D2LF 3QH3B 4ZUTA 1PLGH 5GGRB 5GJTH 5J3HC 2Z91A 3AS3A 4XCNA 3VXMA 2IQAA 5KVDL 1DFBL 3QCVL 5L88L 5EOCL 4OFKA 3OKDA 1YNTB 1FNHA 3BHBA 1WICA 3OXRA 3QUYA 5IK3B 3DXAB 3RWCB 2Z92B 1KJVB 4FQLL 3NCJH 2R0KL 1AI1H 1LDPH 3KPNB 4MLIA 2CUIA 5D1XD 3OWEA 4QOKA 2J6EH 1H0DA 3GNMH 3GMOB 1T0NB 5BMFL 3H8NA 4QRQB 5MENA 2Z9TA 3B9EA 5IHUH 4DN3H 3NACL 4PRBA 3QDJD 4LLQA 3B5GA 1ACYL 2Z8WC 5LQBH 1LGVA 4L29A 1CR9L 2ED9A 4YZFE 2VR9A 4P46D 1WISA 1UYWH 3DWTA 5CP3A 1XMWA 1SHMA 3BQUA 4X6BB 3TO4C 3GB7A 3KPSA 4XCFL 5MEPA 1I8LC 2IPUG 4EQ3A 3MJ9A 1WIOA 5SX4H 1A1OA 4CU8A 5EU7C 1NAKH 2R39A 3IAPA 1WZLA 1I7RB 3QUMB 3WD5H 3VE0B 3ARPA 4WEMB 3SE4C 4CNIA 3STZA 3VFRA 2IANB 2FNBA 5IVZA 4EI5A 4LSPH 2ORBL 1A21A 1NFDB 3QDME 4P0DA 1NBYA 5I66B 5D93B 4JM4L 4Y19B 3TYFB 4O00A 3ULVE 1WT5A 4MDJA 4ZS7L 5F8QC 3ARXA 4QGTA 3KJ6H 4DFHA 4XP5H 2WANA 2NY2C 2Q8BH 3OJVC 4CDGC 5ID1B 5GRWA 2XWJB 3U4BL 3B9AA 1HDMA 5J0BA 3MO1A 3BX7C 1BZ7A 1QHPA 2YSSA 2AGJH 3ETBF 5EO1B 3TA3D 5L6YH 4NPYB 4U0RB 1YQVH 3U0TA 3RL2A 3AFLA 2ZZUT 1CL7L 2W0KA 3GMPB 4D9LH 5ITFA 1MFDL 3CAFA 3RTQA 3D39D 3MRLB 5D7LB 4MJIB 1UCTA 2Z93B 2J3SA 2A9NL 4OZIB 2V9QA 2YPKB 1ED3B 5L8KB 4MQ7B 2Q86B 2B0SH 3DUSA 1F3DH 1U8JA 1IGML 1AP2A 1I3RB 3DHMA 4JQIL 4WV1B 3DGGA 1CXKA 1XGUA 5CD3A 1R24A 2PR4L 5AYUH 2ICWJ 1HNFA 2VUOA 1OD9A 2ED8A 5EB9A 4XMPH 3DROA 4DKFH 4P5TC 4N0FA 4OZFH 1N4XH 5GS0H 1BBJA 3CFCH 3VGHA 1RIVL 3TP4A 2WAHA 4YDJA 1CGTA 1F4XL 3KHQA 3ARED 4M4PA 3HE6C 2LV4A 2OI9A 4PJAB 1BPVA 2D4DA 1TJGL 1A7RH 1XR8B 4ERSH 5F96L 1I7TA 3MFFA 1TVHA 4UNUA 4Y4KC 1A3RH 3RWHA 4IIQA 4BSJA 5L0QC 5T1KA 2EEBA 4XVSH 1UACL 3BP6B 2A6KA 4FG6C 3MJ7A 4HV8B 2DMBA 1VFBA 5DJ6B 1OLLA 5DS8B 4XX1G 2E7LC 1M4KA 4EIZC 1NDMA 5C0ND 1CDJA 2OTWA 3UTOA 5DLMH 3OAZH 4NFBA 4MA3A 3HE7D 4YNYB 1PD6A 4BUHA 1G9MC 4OAWA 3MLVH 1K9TA 5DEZA 2Q7YB 5GS0D 3BI9X 4WTWA 3L7FA 3SBWA 1IAIM 2NTFA 4L1HA 3F65A 4Z18A 5BS0A 3T4YA 1FFPB 1JHLL 4JZJA 4M9PA 1AC6A 3NPSB 2OJZH 3REWB 1HQ4A 1LO2L 4ODWB 1E4KA 5EUOE 2A0LC 4EOWL 2AJSH 1TCRA 2IQ9L 4PBWD 4WI5A 4Y2DD 4QRRA 1BJ1H 2WBJA 3CUPB 3X14A 5ALCH 2YR3A 2ZUVA 4XP6H 1II4E 5DD5L 4FFYL 3KLHC 1MCIA 3DMMC 1GZPA 1QLEL 4BFGA 2V2WB 4PJHA 1FYHB 3GM0A 4HJJH 3LS4H 1NBVH 1S9XB 1PAMA 3MGTA 1MVFA 1EDQA 1QSED 1JZ6A 3RPIB 1ZA6A 2HJLA 3LRGA 1CK0H 4IJ3B 4DKEH 2GCYB 1RAMA 3GJEB 3IDJA 5ALBL 3F12A 3T2OA 1A6WL 4KROD 4ODHL 2X4QA 3O11A 2YS4A 3MRDB 5GS1B 4JREB 2R2EA 5CJ5A 4ZS6D 2EZ0D 4JFDA 2BMKB 4QLRA 5T1DH 3SE9H 3NIFE 2VAAA 5TDOA 4F2MB 3UEZA 3TVMC 4K7FA 5D9SB 4RAVA 1NSNH 2H1PH 1S7TB 5F1IA 2WWMD 3VD7A 1VCAA 1QRKA 3F7QA 3H6JA 4X4ZA 3O3AA 3TO2B 1CD8A 2QSCL 2FB4H 5DRWB 2KQNA 2A73A 4QXUL 5F9OH 5FF6B 3TFKC 3A6CL 3S96B 3A0OA 4OCWL 5D70L 3L95B 4XWOD 5BRZE 2JJTC 4M7KL 5I73B 4PG9A 4NKMA 2DYPB 1IKNA 4HIEB 1HEZA 1IILE 3QIWA 1J0KA 4X9BA 1BJMA 4I77H 5FYLE 2CMRH 3BGAA 4PIRF 2CUMA 4PRID 4AIZB 5F93C 4B7IA 1FZKB 1N59A 1T83A 2VQ1A 5IF0B 1EAJA 3ALWA 3V4VH 3MLSL 3VFGH 5KVEH 3AREB 3RY6A 1B4JL 4JFED 4XCCH 3L3GB 4GKNB 1A5FL 1ORQA 4F9LC 4LCYB 2L0DA 2W0LA 3U0WL 1X7QA 3LIZH 5ICZB 4GXVL 2UVFA 2X4TA 1B0GA 2J8UA 1CLCA 1DLHA 5T5FH 1FGNH 4NN6B 3ARQA 2A1WL 1NL0L 1NUDA 3ZSTA 1EXUB 3JBG7 2OSLB 3L3JB 1FG9C 5CUSL 5CEYA 4FP8L 4N0YL 3DRTB 1Q0YL 4RWHA 1QNZH 1AY1L 4G43A 1U95B 4KVNH 3IDXL 3CXHK 2NX5E 1A6UL 4BFIA 1BVKA 1ND0A 3K8LA 3FJTA 4ZQKA 1FO0A 1OTTD 4KY1L 4PJFB 1MCSA 1MUJB 2W65B 2IANE 4K3HA 4OZFB 4U0QB 4NQTA 4NN5B 3H3PH 3SY0B 4QF1A 2Y6SC 3WHE0 1NFDE 4NJAL 4MXVE 3ZYJA 4Y19E 3KWWA 3WFEH 5DEFA 4MAUH 4LLDB 3F7VB 1FL6B 4GAGL 4AEEA 2EE3A 3EYOA 4WWKD 4WW2B 3CVHL 4PJDE 1NCDH 3PWPE 1H8OA 3GHBH 5I76A 1RZFL 1G1YA 5AAMA 1S9YA 1A4JA 5A43C 2AEIT 3FOMB 4KJPC 1BQSA 4I0PD 3QO1A 1K3ZA 5EBWA 1BGXL 1OWWA 3QUXC 4IRZL 2UUDK 4KMQA 3GRWL 4Y1AA 3GIZH 4YUEL 3PWVB 3T0ED 2VLRA 4GRLC 4JO4H 1CVSC 1XF5A 1JYVA 1KLFA 2ENYA 5D7LE 3VWJB 4U2YA 4MJIE 3QBTB 4Z0BL 1T1XB 3AXLA 1RFDL 3QFJD 3B9KC 1QLRB 3DRQB 5F3BB 5FO8B 3HMWL 5E00B 5E99L 1E6OL 4U1NB 4ETYA 1T1YB 4YBHA 3LD8B 1T5XA 3PHOA 1G7JA 5E9DD 3FFCA 4PJHF 3MOBH 1NFIA 3IJSA 1X5YA 3S5LG 4X6EB 2QQKL 3MRPA 3LB6D 4I13B 1UA6L 3ZT5A 2VYRE 2D0HA 1YNKH 5KZCD 2XPGB 4GW5B 2VDLH 2Q3AA 2ZCHH 2HRLA 4LHJB 4N8CH 4PJAE 1JUFA 2O5XL 2WW8A 4PD4K 3MRGB 3MLTA 3G08B 3K0WA 2XWTB 3L5WB 3NPZB 3V6OE 1KXVC 4R2GB 2YWZA 4QY8A 1BIIA 5F6HI 5F71A 2NYYD 4X83A 4M5ZL 4ORZC 4PRIB 4PV9B 5DHVB 1IL1A 3PWLB 3ZHDA 1BP3B 5CGYD 4U6HA 5GRJH 4JFEB 1KIRB 2F53D 2P49B 5I1GL 5INDA 3BGMA 5I8KL 1DQJA 3G04B 3HNTL 3QDJE 2GT9B 1KELL 1WFUA 4OCNC 4W70A 2ARJQ 3IF1B 4XHJD 3KPLB 4M62H 1ZLVH 2J4WL 4UNVA 2FSEB 1TZIB 5E95B 4XC1L 3O9WA 4M7LL 4RMQA 3W82A 2GUOB 1P6AB 3LQAL 3QPQD 3RA7L 1W72H 3VH8G 3CGTA 5DJCA 3ULUC 2FJHB 2Y7QA 5ADOL 1UJ3B 2W9DL 3NZHH 3QIBC 1YEHH 3JV6B 1QZ1A 2N56A 3D48R 4HG4J 1T0MA 3IKCA 2X4UA 3GSNH 5MEQA 2YD5A 2WBWB 5DYOB 3EOTH 2PYFA 3B6SA 3V6ZA 4LLUA 2B39A 1UKTA 5FCUH 4BKLA 4YDKH 5FV2A 4X7TB 3QDMA 3O8XD 5IROA 4IDLA 1JPSH 4WWKB 3T1FB 4YX2L 3M8OH 3CVHA 1A8JH 3LKRB 4XI5C 2WUBH 4UBDC 2F8XC 3LKOA 4G7VL 1XGQA 1D6VH 4I9WE 3JVGA 5FKAB 1SM3H 4RNRB 3CC5A 4YGAB 4TVPD 3T0EB 5I0DA 4PV8B 3WHXB 3FQRB 1NLBH 3QHFH 2Y1VA 3OKYA 3D39E 4ZUVB 2DQFA 2HFFA 4GBXC 3VXUD 3GSRB 1G7IA 3S35L 2H2PC 4K94C 3WUWA 5FGRA 1NCUA 2F19L 2G60H 3EGSB 4NBYB 1CT8A 1P7KB 1DQML 1JF1B 3WFCH 5E9DB 3MR9A 5KG9B 4KTDH 2DI9A 2WBKA 4R97C 1JNNL 3VWKA 1J1PH 4CW1B 3ARZA 1OTSC 4IMLA 5AUMB 1BX2A 5J6GB 1RIHL 4QXGL 4LVOB 3WFBL 4C83A 3JTSA 1IGJB 3QXWA 4LHUA 2AS5M 2PYEB 3D87B 3I2CL 2K9UA 3BPCA 3MXWH 4KI1A 1CDYA 4TULH 2NY4B 3FMGH 4Y5VB 2GAZB 5D7KD 2H9GB 4BUGA 4XPAL 1L7IL 1LNUB 3CDGA 4LVNB 1MLCA 1JRHL 3DTXA 2MHAB 5D5ME 4NUGH 4RA3A 3WUZA 3PWNA 1S78C 5I8EA 2DBJA 4YXKL 5IVNA 2LVCA 3MYJB 3RVXC 1YEGL 2LVEA 1ZWIA 4MNQA 4B53A 1BFVH 1M05B 5DR5L 1U93B 1U8HA 2D31A 1EGJA 3UCRA 3W9DA 3TZVD 1AKJD 4LCWD 2A6IB 3QUML 5HDOA 2NLJB 3EYVB 1ZEAH 3WNNA 2XA8H 4Z7UB 5D6CB 4XNYL 4MCZA 1QFWH 1A7BA 5EOTA 2D4FA 3TIEB 1K4DA 4ZMAT 1W0WB 2OQJB 4WU5B 1OD7A 3HFML 3JWNC 3WNMA 2VLLB 4NKIH 4Y5YC 3VGAC 4JM2A 4GXUN 4WHCA 4NC0B 4PJ5D 2BFVL 2VXSH 5EUOA 5F7WC 4MVBA 5CBEA 3STLB 2V17H 4MD5B 1JPFA 1M7IB 5E2WH 3T3ME 4HIHA 4ZOEA 3W0WD 1F45A 4YDLB 5ITBH 4NZDA 4ALAH 4HXAL 4YZFF 2P8LB 4POZC 2MTPA 3OAUL 1AXSA 1QSEE 2R69L 4Z7WB 4I2XB 2AK1H 2YXFA 3QEUA 1ITBB 4KPHL 3UTSD 1UG9A 3O6KH 2BDNH 4HFWA 3UO1L 3HAEA 2VXVH 4NQVB 3K4DA 1WBZB 2ZKHH 4AENA 3SDCD 1FC1A 4UDUB 5FA4B 4EBQH 3G5XA 1IC4L 2C1PA 3CVIH 3WNPA 2F8VA 1AIFB 1X4ZA 4M93B 2I27N 5HBBA 1DBMH 4ZSOE 2AJYL 1HH9A 1AR1C 3EOAA 3MV8D 2F54D 4U6XA 1CFQA 1OCWL 5JHDB 3IFOB 3ULVF 1G7HA 5IM7B 4OBRA 4F7EA 1BREA 1INDH 4Z76B 2QQLH 3AVEA 4AG4H 4IDJL 2LTQC 3CFIC 5ILTH 3V8OA 3ARWA 4TPRH 4K3JL 2CIIA 2E7CA 4YFLI 1EJ6A 3P4MB 1IEBA 3GSNB 1GRWA 4PP2A 4RRPA 5GGRA 1TETL 3QH3A 1PJ9A 5DJ2B 5BRZA 4RMTA 3LHPL 3A67L 3BPOC 4G7YH 5DUML 4JGMA 4TNWK 4NUJA 5AWNH 5GGVY 1FGVH 1OP9A 3PV7A 3RWCA 2Z92A 1KJVA 4X8JB 4XNZB 1MHCA 4JFEE 2Z35A 3KPNA 5D7IE 3LQMA 4I8DA 4KHTL 1YY9D 4QRPD 2FZ3B 4ODUB 3PWJB 4QHKI 5GPRA 3NAAH 4BQ9A 2BSRB 3SKOB 2M1KA 1V7ML 4M6NH 3Q1SH 4X9FA 1A0QL 2XZCH 3MLUL 4BFBD 4ENED 1JFQH 1A6ZB 1H8SA 1SY6H 5D6DA 1UWEH 3ARFC 3T0AA 1TTUA 1MCNA 2B4CL 4WTZG 1H3XA 4OLZH 4X6BA 1H3UA 3TH2T 3O4OC 1RULL 4K71C 1AKJB 3AC0A 5GJTL 4CN4A 1B9ZA 1PLGL 2Z31B 4LCWB 1XGRA 1AGEB 3QUMA 1HHJB 3VE0A 4OV6F 3RKDC 1BOGA 2IANA 4U7SA 3GMMB 4TYUA 3VD4A 5DXWA 1G9MH 1PYWA 3NCJL 5HVHC 1AI1L 1LDPL 1NFDA 3P30L 4M8QB 3PABA 5I66A 3AUVA 3TYFA 4Y19A 1FHGA 3ELAT 1IEAB 2J6EL 2HFEA 3GNML 1KCLA 4DZ8B 5KVMC 4PJ5B 5IHUL 4DN3L 4IS6B 5A3IC 4I0KA 3VI4E 1T6VN 3RIAF 5ID1A 4G6KH 3IS1X 2DS4A 3H9HB 2XWJA 3W0WB 2RB8A 5LQBL 2DM3A 1GGYA 2HT4D 4KZEH 4UB0H 1NCWH 3WL9B 3U4EB 1UYWL 4HW6A 5LVEA 4NPYA 1NMCC 2XXCB 5IMLB 2N7AA 4EJ1C 5HGHA 3QFJE 3GMPA 4JM2F 4Q0XH 3MRLA 5D7LA 2FYYA 3LKQB 4MJIA 1F4AA 5EUOF 1CDCA 3OKLB 2YN5A 3DV6B 3CSYA 1DN0B 1NAKL 5FGSA 4P23A 5L2JB 4P57A 2YPKA 5E9DE 1P7QB 3WD5L 4MQ7A 1KTRL 1FL5B 2Q86A 2XFXA 4MSWA 1EZVX 1YEDB 1U8PA 4YC2C 1I3RA 3SGJA 2BVOB 4HUUB 4LSPL 3WJJA 1FJ1B 4BZ1H 3TO4B 3KJ6L 3IS0X 3KYMA 3QQ9C 2HJKB 4XP5L 2Q8BL 3TV3H 5JOPD 3NIGE 3LEXB 3V5HA 1EFXD 3VXQA 4PJAA 2PUQT 4Z7NF 3RWFB 1XR8A 1NDGA 3NGBB 3AS2A 3WFDH 3V6OA 2AGJL 5I30H 5L6YL 5E1AB 3ZHLA 3NIFF 3SDDD 4GXUM 1YQVL 5T3XD 2ATPA 5HHQB 4HV8A 5DJ6A 1IRAY 1E6JH 4D9LL 5T1MB 5EZJB 3OKMB 2F53E 4JY5H 5DS8A 5D1XA 3E6HA 4YIQB 4WDIA 1MOEA 3M1BB 4OZGB 4QRPB 2LABA 4HXBH 5HDLA 3S4SB 2NY2B 3QDJA 4KGLA 4YNYA 3B3IB 2B0SL 2I60H 1QPXA 3VI3E 5DK0B 5AYUL 1JK8B 2FCBA 5ISZD 4QGYA 1G6RH 1INQB 4XMPL 4DKFL 2VQTA 3BMVA 4P46A 1N4XL 5GS0L 4OI8A 1A02N 5IW1B 3OBAA 3CFCL 1Z9SA 2ZCLH 3TT3H 3TVMD 3VRIB 5FUOH 2X7LB 1CXEA 5GZND 4J3XA 4N0CD 2EDTA 1S7RB 3RVWC 4P59H 1MI5D 4XP1H 4GUPA 3REWA 5BV7H 1JHTB 4AEHH 1HKLL 4ODWA 4Z77B 1A7RL 4ERSL 3BXNA 3OAZK 1A3RL 5CCKL 3FL7A 3PDOB 2JE8A 4XVSL 2PW1B 4LDEB 2C26A 1L6ZA 2V2WA 4E41B 4P5TB 4OIAA 2ITDB 4Z7WE 3OQ3B 2XTJD 4P4KD 3ARGC 4LDLB 4UQ3B 2J6EA 3RPIA 4AM0B 5DLML 3CJJA 2QL1A 4F7MA 1FLRH 3HE6B 3VA6A 2H3NB 4RFOH 4HS6B 1BZQK 3CPLB 1MCKA 4U4BA 3BWUC 4TVPE 4Y4KB 4YHLH 3MLVL 3MRDA 5GS1A 5TH2B 5C0JB 2BMKA 5CGTA 3TA3A 1NFDF 4XNUH 3G5ZB 2ESVD 4MXVF 4PRDB 1GGTA 35C8H 3VXUE 4MXWH 4U49A 3D39A 1S7TA 1D6EB 2OJZL 1F3JA 2P48B 4PJDF 2DQCH 4M4RA 5ANMB 3RNQB 3ROOA 3TO2A 3QAZB 2AJSL 5DRWA 3CD4A 1FZOB 5FF6A 1ZVHA 4HKXA 3S96A 5ALCL 3DHJA 2O5ZH 5FGBA 2ARWA 1D5XB 4XP6L 3L95A 4KRPD 1QBBA 5H37H 3EKCA 4HIEA 4X99B 5IB3A 2HLAB 4LVEA 1FN4B 4HJJL 3LS4L 1NBVL 4DVRH 2OJEB 1G7PB 3V7MA 1IGTB 4JFFD 1H5BC 4AIZA 3BUTA 1FZKA 1CK0L 3P4NB 2HG5B 2MPAH 2NY5C 4DKEL 3AREA 1WWBX 4MQTB 3L3GA 1EFXB 5D7KE 4GKNA 5AYQA 1V5JA 3VXNB 4AEIH 3VJ6B 4MX7B 4FOMA 3BH9B 3OPZH 6CGTA 5ICZA 3KYOB 3QXDA 5T1DL 3SDDB 3SE9L 1R5WB 3DMMB 1CE1H 5AG9A 4ELKA 4PLNC 4MS8D 1NSNL 1CDGA 2H1PL 1EXUA 4WFFD 5HI4C 2DJ4A 2OSLA 3L3JA 2FB4L 4PRNB 5F9OL 4PJAF 1SBSL 3DRTA 4JVUA 3MBEC 5FECB 3HE7A 4LCWE 1NKRA 2BZDA 1YPZB 1U95A 3W2DH 5D7JC 3GGWB 4YGVB 4H8WC 5ISZB 1ZK9A 4I77L 3OKKB 1UB6B 2CMRL 2W65A 3DETC 1A7NH 4PFEA 4IEFB 1KB9K 1NH6A 3TVMB 3ZYIA 2H8PA 5TF0A 1O0VA 3V4VL 3VFGL 5KVEL 3MFGB 3F7VA 3LOWA 4LLDA 2XWBB 1FL6A 4XCCL 5LGHH 3DIFA 4EDXB 1BFSA 3LKSB 3I50H 1I8KB 2EH7H 1I7ZA 3DX8B 4PJ5E 4TNWF 2VLJB 2CLVB 3QIUC 4HC1H 4Y2DA 1UKSA 2YHGA 1O7VA 3LIZL 3FO1B 3W0WE 2VAJA 2OR7A 1QA9B 1NCBH 5K9OB 5T5FL 1FGNL 3KPOA 3IDYB 5GGSB 4HGMA 4CN6A 4JHZA 2XIDA 2YZ1A 5DMIH 3DURB 3MRJA 4RFNC 3H3KA 2FWOB 3UTSE 4P4KB 3PWVA 2WLYA 5SX5H 1QSEA 3BZFB 4QXTB 3CXHJ 2FBOJ 1QNZL 4QYOB 1VDGA 1QLRA 4KVNL 1Z9MA 5F3BA 2X4NB 5D7SH 5E00A 4U1NA 1G6RB 1T1YA 2NY1C 1ZHNB 4NC1C 4U1MB 3H3PL 3MV8E 2F54E 4X6EA 2H32H 3ZE2E 4OUUB 5F9JA 3WFEL 4MAUL 4MDIB 5CIPH 3C9NA 3O3DB 3RVVD 4P99A 5CP7B 1WQVT 4K23H 3MPCA 5BV7B 1QHOA 5FO9A 1NCDL 2XPGA 4GW5A 4HUKB 3GHBL 2V5YA 1BLNB 3BAEH 5HJ3B 5DGRA 3MRGA 3G08A 4LSRH 1MFCH 1XIWD 3L5WA 3OB8A 4JGJA 5IJVA 4O9HH 3OSKA 3GIZL 4GW1B 1VA9A 4JO4L 2WP3T 3O41B 4JFFB 4PRIA 4PV9A 5DHVA 3PWLA 4ZXBC 2EYSB 4KKLC 4JFEA 1T3FA 4QRPE 5IJKA 2R15A 2B5IB 1RUPH 4AQ1B 3G04A 4ONHB 3C6LD 4UBDD 1CDHA 3IF1A 1MREH 1F5WA 3KPLA 1QSFB 2K7QA 3QT2A 1MNUH 4K3DH 3MV9D 1Z2KA 1FZMA 2VZ3A 1TZIA 1NGZB 4LSVH 2X2YA 1W2KT 4QHMB 4OD1H 3VXPA 3PWUB 1YNKL 5H2BB 2OTPA 2VDLL 2ZCHL 4PD4J 4GBXD 4N8CL 3R1GH 2CIKB 2A74B 5DURD 4MAYC 2EIDA 4Z95H 2YD1A 1F6FB 4P48A 1O7SA 1GSMA 1TNNA 5D5MF 3QXAB 4IRJD 5DYOA 3OJMB 1T22B 4NBXB 3BWAB 4N5ED 4WTXA 2AEQH 4PP1C 1JPGA 4GFTB 5E7BA 2GK0B 3EJZC 5GRJL 2EXWD 2OL3H 4WWKA 5K9QI 1RU9H 3T1FA 4OUOA 4Y7MA 2W92A 5CMAB 3LKRA 1SMAA 3ZDZE 2OM5A 4HIJB 4M62L 3BVNB 4NO3B 1X5IA 5FKAA 3I3BA 4XNXH 3D25A 2R4SH 4I0PA 1HXYA 3QQNA 1JNHA 1UC6A 3WN5C 5C2UB 4HK3N 4O2EB 3T0EA 4NRZB 3WHXA 2VDNH 3FQRA 2BX5A 1VFUA 4FZ8H 5IEHB 4ZUVA 2ZSVB 3VU2A 4IOIA 1BFOB 1T2JA 1W72L 3QFJA 1EHXA 2XACC 4D0CB 4DN4H 3CFEB 3EGSA 3NZHL 1YEHL 3P11H 1HI6B 1JF1A 1DLFH 3T3MF 1T20A 3GSNL 1RD6A 1IZKA 5E9DA 1EH9A 5KG9A 3EOTL 4HUMB 4TTDC 1VFAB 5FCUL 3MRMB 1HILB 5AUMA 4YDKL 3SEPA 3EO1B 3KGRA 5I19H 3SKMB 5GIRB 2ICEB 1JPSL 2VISB 1J86A 5KAQF 2GFBB 3M8OL 5ERWA 2WUBL 3P0YL 4R7DB 2OCFD 1D6VL 1L9NA 2BVYA 1SM3L 2AXHA 1XIWB 1U8OB 12E8H 3JSSA 1LNUA 3UC0H 4YHNB 2IBBA 4MJ6A 1C12A 5T3XE 2BVQB 3F58H 4DZBA 5IIEB 1NLBL 3QHFL 1BWWA 1YEJH 1L4IA 5JW4N 3MYJA 2VN4A 2NR6C 2FL5B 5B38B 1NGXB 2G60L 1M05A 5KS9E 3LKNB 2YA1A 4JZNB 4DTGH 4R4FH 4WI9A 1U93A 3KPMB 2Y4SA 3WFCL 1Y6MR 1KXTB 4KTDL 2Z8SA 5EU6D 3U9UB 3W39B 4DFIA 3O81A 4LSTH 5ISZE 1OY3B 1CE6A 2H32B 1J1PL 2HRPH 5I17A 2A6IA 2QQQA 2NLJA 3EYFA 3EYVA 3LN4B 3RHWK 4L8BB 3E3QA 4HK3J 2ICWI 2NY6D 4L3ED 4URTB 3TIEA 1P4BH 1W0WA 2OQJA 4WU5A 1HHHB 3MXWL 1MI5E 5F44A 4GBXB 4KI5E 5D7IF 2YD7A 1I4FB 2IH3B 4TULL 2VLLA 3FMGL 2OLDA 3L3IB 4HJ0D 4LF3B 1EZVY 3DBXB 4LGSB 3GUTA 3V5KB 4QHNB 1R5IB 3UTPD 1M7IA 4IRJB 3ARBD 4R97B 3GSUB 3IAGC 1CGUA 4NUGL 3CU7A 4LOUD 1WT5C 4HUWA 4YHIA 2P8LA 4DOHE 1V3LA 3SO5A 1W0VB 4UIKH 2XTJE 5B3NA 3O8XA 4Z7WA 1N5YH 4K8RD 1WIPA 3DUUB 1BFVL 1UJTA 4WU7B 4NQVA 1WBZA 3MREB 4XT1C 4G3YH 4GG8B 4PLKD 5BZDB 1XGTB 4UAOB 2MJWA 2EKJA 4HIXL 2Y5EA 2CGRH 1LILA 1ZEAL 2G75A 1BQHA 4LPCA 4PRAB 4TQEH 2ESVE 5SV4A 2XA8L 2NY0D 2MCG1 3RTQC 1QFWL 5T33H 5HYQB 3FCTB 3GMNA 3UDWA 4UUJB 2R1XB 5A2FA 1GGBH 2ZUXA 2ERJC 3VXUA 5C0AD 4NKIL 3DV4A 5DJXB 4KUCF 4Z76A 1FFQA 2VXSL 2NXZC 3VI4F 1XCTB 2W60B 3D6GA 2VL5A 3EOBB 3QNZB 2MKLC 3P4MA 2V17L 4WNQB 2ZUTA 5E2WL 1G7LB 1KNOA 2Z8VC 2BHYA 3P3YA 5ITBL 4EZMA 3RGVD 4ALAL 3AM8A 3AS0A 2EIZB 4UU9B 3VFTB 4KDVA 3MODH 1WAAE 2VDQH 4TUKH 4JFFE 3HN3A 2AK1L 3FZUC 2OL3B 3O6KL 2BDNL 1B3JA 4CU6A 3BW9A 4X8JA 2OI9C 4JRYD 1NMAH 2Q6WA 3CH8A 1DEEA 2VXVL 2ZKHL 3VGAB 1JE6A 5DQDH 4EBQL 5A3ID 2FZ3A 4ODUA 4DGVH 3FRPA 3PWJA 1N6QH 1KCVH 1UH4A 4F15C 3CVIL 5K93A 5FKPB 4M61A 3K2UH 1DBML 3X13B 4JDZB 4AIXA 2EC9T 3ZDYF 1RK1B 2FO4B 2XKNB 4WFFE 1A6ZA 1QFUH 4QNPF 1INDL 4AG4L 5ILTL 5E8NB 4TPRL 1ADQH 4BSVB 5C0BD 3PHQB 3TZVA 1AKJA 1XAUA 4KDWA 4LCWA 1C7SA 4ISVB 5DRXA 1V8HA 2RQ8A 5ENWB 4G7YL 3SBWC 4NQED 5JIPA 5AWNL 1FGVL 1WBYB 2NY6B 3GMMA 1F6LL 3SE3A 4M8QA 1E4KC 2CDEA 1IEAA 5FYKD 4BA8A 3ULSB 4LHQB 4DZ8A 4PJ5A 3GO1H 4NKOB 3HC0A 4IS6A 4F58H 3BESR 3V2AR 3NAAL 2E27H 5MI0C 1CGSH 3VI3F 3MRHA 3W0WA 4OD2A 3GIVA 4RFEA 3N0PB 4OD3H 3BPOB 4M6NL 1GGUA 4U3XA 3O6FC 2XZCL 1JFQL 3WL9A 4W4OA 3SO3C 3U4EA 1SY6L 2HN7B 1IE5A 1UWEL 3MACH 1MFBH 3UTSA 1T21B 4OLZL 3L9RA 4XB8A 4APQD 3U30C 5IEKB 3IJHB 4PB9H 1GIGH 2QKIB 4U3CA 1U8LA 3LKQA 3OKLA 1J87A 5JLZA 5L2JA 1AD0B 5JW4M 3MLYH 1OSPH 1CG9B 1FL5A 2BOBB 4KKAD 1G9ML 2BVOA 4G9FE 4HUUA 1UB5B 3PP3H 4Z7WF 2GI7A 3D69B 2IMMA 2F54A 3MV8A 1FJ1A 3D1MC 3ARFB 4HUNB 4JN1H 3TBVA 3BDBA 3HZMB 2QV2A 1RZIB 1JTOA 2VXUH 3P40A 4N90D 2HJKA 3O4OB 1H3WM 5IFJB 5E7FA 4K71B 1IKNC 3QIWC 3LEXA 4G6KL 3IRPX 4HX1A 5D96B 4OQTH 1IM3B 4X6DE 3L7EA 2VLMD 4KZEL 4UB0L 1NCWL 3SE4A 5JXAH 1T83C 5E1AA 3NN8A 4JG0H 1V3KA 2V7HB 3RY6C 4X6FB 5HHQA 2VXQH 4PRHB 1IVLA 3OKMA 5ADPH 4Q0XL 5JORA 4YIQA 1YY8B 3M1BA 3QDHA 3TIDB 5DTFB 1IKFH 4QRPA 3IVKB 1FVEB 2YPLB 4NHCH 3VA2C 3S4SA 4X6CE 2R8SH 1OB1B 1GXEA 3B3IA 5BO1H 3MV9E 4ZFOA 5DK0A 4P5MA 1INQA 4LVHB 3D9AH 1K2DB 4BZ1L 5IW1A 1GOFA 4LKCB 4IOFD 1URLA 1JWMB 3FT2B 4YE4H 3RNKB 1RK0B 1KJ2A 4LCCA 3VRIA 5GZOC 1S7UA 1S7RA 2ICWB 4Z77A 4M9OA 3E0GA 1UM4H 2A38A 1IGCH 4WJ5A 1M6OB 3WFDL 2NZ9C 4NQEB 2BY2A 3PDOA 1UFUA 4YC2B 5HDBF 3TCLB 5I30L 4RCAA 2ATKA 4H8WH 5KN5B 5I1DA 3MMEB 1GHFH 1E6JL 4L8DA 3LPGA 2ITDA 3HUJB 2WUCH 4JY5L 3GEWB 4Q2ZB 2IC2A 4JFOA 4P3DB 1QBLL 3BPNC 3DYMA 3P4OB 2FO1A 4HEPG 4HXBL 5DD3H 4RX4D 2RR3A 1HYRC 1BF8A 2H3NA 3LN9A 4HS6A 1TFHA 3OR7B 2I60L 3B9DA 3CPLA 2VDMH 1RMFH 5J12C 1VACB 1P4IH 1U3HD 1G6RL 43CAB 4HFUH 3EW3B 5TH2A 3V4UH 4UILL 5HYSB 5IW3A 5FM4A 2NW3B 1VERA 3MLXH 2ZCLL 3TT3L 4BELD 3O4LD 1VEPA 5FUOL 2X1XR 1YC8A 4P59L 4XP1L 3NCBB 4LNVA 5BV7L 1U8QA 4AEHL 3RHWF 5ANMA 5F7MC 3RNQA 3AS1A 5TDPA 3GMRB 4Q9QH 2JIXD 4NQCD 4GRWE 3TNMB 1D5XA 1QRNB 4JHBA 1LK2B 3RIFK 4CMMB 2BC4B 2HT2D 4L1DA 3J8F7 1Z3GH 1FN4A 4CBPA 5LGJB 5HPMB 4PGEA 2OJEA 1G7PA 1IGTA 2DL2A 3UAJC 4NC2B 1YZZA 2X6MA 5I1KH 3P4NA 1F97A 1FLRL 1K85A 1MPAH 4RFOL 3U7YH 4H0HB 5DFVD 1EFXA 3WNKA 1JNLH 5EO0B 1AGDB 3VJ6A 4MX7A 4YHLL 3UBXB 4PJ9D 5IQ9A 1KUMA 3BH9A 3U36B 3KYOA 4XNUL 3SDDA 1JJUA 4PJGB 5I9QC 4OQ1A 2XYCA 3B5HA 2HP4A 1JWSA 4QHLA 35C8L 4MXWL 1WFOA 4UOW0 2DQCL 3I75A 2YD2A 4CN1A 3TM6A 5KS9A 3LH2H 5EU6E 4Q58C 2O5ZL 2YD4A 3MRCB 2NXYC 3O9WC 4YGVA 3RKPA 5ISZA 5ESAA 1UB6A 4DVRL 1DDHB 3VG9B 4L3EE 5FUCE 4PJIB 5DRZA 3WIHH 3TVMA 3WO3B 2MPAL 3D85D 3HC3H 3P77B 1MI5A 1U8KB 4EDXA 3BEWB 1I8KA 3DX8A 3OGCB 5C70A 4V1DD 4NYLA 1WJ3A 3UTPE 2W91A 3OPZL 3DECA 3FO1A 3ESVF 1FAKT 5FIEA 3SQOH 1CE1L 5IROC 5GGSA 4P2OD 1F00I 5DSCA 3ULVC 4O4YH 4ZODA 3DURA 4PDCE 4LPUA 4P4KA 1H5BB 3VXOA 1KPUB 1LE9B 1CICD 4RSVA 4QXTA 2ED7A 2KL6A 3JVGC 4DKAA 5E94B 1MCFA 2JF1A 1QP1A 1IBGH 3I02A 3W2DL 2EEAA 1OSZB 1U3HB 2OZ4H 3LN5A 4NKDA 1G6RA 3B83A 1KPVA 1KB9J 4YAQB 1A7NL 1O5DT 2EECA 1C5DA 2ESVA 3LQZB 4PGZA 1E4JA 5HVGB 4OUUA 1A9BA 1LO3H 2B2XH 2V7NA 2R4RL 1KCSH 5C0AE 3MXVH 4WEUD 5LGHL 3FO2A 4N68A 4KDTC 4F37K 5CP7A 3I50L 1MHPH 2EH7L 3BN9D 4J3WA 3MRIB 5SX5K 3ZE1E 1KG0B 1PBYA 1IZJA 2JIXB 4HC1L 4NQCB 2P8MB 1BLNA 5I1IH 1RJLB 4RAUB 3VWKC 3Q5YA 3CZFB 1NCBL 4XVJH 4XNMB 3KNBA 3K1KC 4BH7B 1KLUA 1J0JA 5DMIL 4KQ4H 1KFAH 2C1OB 2ADJB 4C58B 4GW1A 1WAAA 3T65B 3O41A 4JFFA 3ZO0A 4JRYE 3S34H 3MRRB 4XP9H 1MRCH 5J13C 3RVTC 5JXED 4JQVC 4K7PY 4E0RB 3TBSA 5D7SL 4LBEA 3WUWG 4GKZA 5DJYB 1TQBC 4BQ6A 1DQLH 4FA8A 3HG1D 4ORGB 4B7LA 1AHWB 2IPTH 4QO1A 1XGYH 3HKFA 2GHWB 3KYKH 4H26B 4NQSB 2F74B 4K23L 3PWUA 3R0MA 4KVCH 2VE6A 1JGVH 1PX3A 1FQ9C 1UEYA 5C0BE 3AU1B 4PLJD 3BAEL 4LCIH 1S7WB 4LHUG 3TH4T 1NANI 5D2LB 1L0XA 5J6HA 3BP5B 4R9HA 4YR6B 2A74A 4HUXA 4LSRL 5EG6C 3GDBA 2IFFH 1MFCL 5DC0A 4KKCD 5IOPB 4NQEE 4O9HL 4J23A 4GMTH 4CVUA 1QVOA 3L6FB 25C8H 1T22A 5CS7A 2V9RA 5CP3H 1VB9A 4UV4H 2E9IA 4JM2C 1RZ7H 5FYKE 1I9JH 3MJ9H 5KS9F 2VRAA 4X4ME 1RUPL 1JI2A 2IF7A 5CMAA 4V1DB 3ZKSD 3BIBX 3N1MC 3BYTA 2XQYK 1S9WB 4HPYH 5LG1A 2H6PB 1FORH 1MREL 3OTTA 3BVNA 4Q6IA 4NO3A 4PGCB 1KC5H 1MNUL 4K3DL 5E2VH 3RBSA 1Y0LB 4LSVL 4OD1L 5M95B 3K46A 3KJ4C 4NRZA 4JFQB 3S3PA 3MLWH 5LJYH 1KTKE 2GTZB 4KI5F 5IEHA 2PCPB 2ZSVA 3R1GL 3QEQD 5DMGC 1BFOA 2IAMD 2Y36H 2NR6D 3VXRB 4D0CA 4JHAH 4PYGA 3CFEA 4Z95L 5F89A 2YKLH 4JANB 1HI6A 5DA0B 2ITCA 5GHWH 3U0PB 3CIQA 1VFAA 1HILA 2AEQL 1NANH 5D1ZD 2DLFH 1Q9OB 4JKWA 3W9EB 3EO1A 4POYA 2OL3L 3SKMA 2VH5H 5GIRA 5TQ0H 2VISA 1CXIA 1RU9L 5CEZH 4N90E 2EXYC 4GAYA 1NLDH 3QHZH 4M1GH 1FNLA 4U1SA 4YXHH 5BXFB 4MAYB 5I75B 3C5ZC 3QSKB 2VLME 4XNXL 2R4SL 1XIWA 1U8OA 4JO3H 1N7MH 4PJGE 3WFHA 2VDNL 5IIEA 2D0GA 4FZ8L 3W11D 4R0LB 3O2VH 2VKXA 5K9JH 3FB5B 2PXYD 3T2NH 5D72L 4NO2A 2AV7A 2FL5A 3MRKB 4DN4L 5B38A 5F6HJ 4FQJH 3LKNA 5T5NG 3P11L 4JZNA 2JLLA 3QPXH 1DLFL 4IRSC 1TZHB 3BSZH 2GSGB 4X6CA 5CEXA 3U9UA 3W39A 3BRGC 2P45B 1PY9A 4RBPK 5D6DC 3H2WA 3MRBA 2EDOA 3MV9A 2GJZB 1SQ2N 3L3DB 3LN4A 5JA8B 4HKZB 2MOVA 4L8BA 5I19L 4PJIE 4NT6B 3MUHL 3B5TA 3TJEH 2XN9D 3ZKNC 3UP1A 3RIFF 4PR5B 3E1F1 3NFPA 3PG2A 4GBXA 4AIOA 1I4FA 2IH3A 3ZE0F 1I1AD 2PTTB 3G6JE 4ONOA 1SYSA 3L3IA 12E8L 3IGAB 4LF3A 2O61B 1UKQA 1U3JA 3UC0L 3JWOC 2R29H 4QHNA 4FQ1H 4M00A 4Z9KB 5EU4B 4IRJA 3F58L 2X5PA 2CR6A 1YEJL 1HSAA 2Y5TB 4MQXD 4N5EA 1W0VA 3IT8D 5DUPH 5HD8D 1ZT7A 3IETA 1AGFB 5L7XH 1YMHA 3DUUA 3LZFH 4X4XB 3MNWA 3C5SA 1MRFH 4DTGL 4R4FL 3VXMB 2IQAB 5I74B 1PZUB 1X4XA 3MREA 4S1SH 3X3FL 4LSTL 5BZDA 3OKDB 2HRPL 3BHBB 1JZ8A 1XGTA 1OF2B 2ZOKB 5LCVH 4M1CC 1RHFA 4PRAA 3MRQA 1LO4H 4UI2A 2EYTA 1NEZB 5EBLB 5BVJB 3H9YA 3JZ7A 3O4LE 4QOKB 4D94A 5HYQA 1P4BL 1HNGA 4UUJA 4I1NB 4FQIH 5MENB 1BJ8A 2DQDH 1DUZA 2R1XA 3QEQB 1OTUC 4JVPA 2EICA 1FYTD 4MHHG 4P23C 5DJXA 4LLQB 1CQYA 4LLMB 5JZ7C 1XCTA 1L9MA 3SGJC 4NZTH 1D9KD 4U2ZA 4WNQA 3WJJC 1EMTH 1R3JB 4UIKL 4UU9A 3OAYH 3PXHA 3CFBB 2FEDC 4XWGH 3BDYH 1N5YL 5MEPB 2RFXB 3JTTA 2KZWA 3WXVH 3VW3H 3CX5K 4YFEA 3MJ8A 4Z7QE 4V3DB 1A4KB 2BSED 3ZKQD 4G3YL 2OXGA 3V6OC 1FC2D 4P2YA 5C09D 4CNIB 4XTRD 4PJCF 2V5MA 4WUUD 2CGRL 3T4AB 4TQEL 1NBYB 4JG1H 3OZ9H 4PJXB 4YHZH 3ILPB 3X13A 5T33L 4UTAH 5D1XC 3O6FD 4MDJB 2EC8A 4DK3A 1NMBH 1GGBL 2DN7A 2CRZA 2WLZA 1JP5A 2PXYB 3TLRA 2GK2A 4AK1A 5E8NA 4CKVX 2BSSB 4BSVA 4X6DF 1MCPH 2Z4QB 5FYJH 2ICCA 1KJMA 1NBZA 4P46C 3QG6A 3QZWB 3UZVB 5FV1L 3RL2B 1UZ6E 4PY8J 3MODL 2VDQL 4TUKL 1PEZA 5F7LB 3F7PC 1WBYA 4L3EA 1RVFH 4DVBB 2XN9B 1NMAL 3FFDB 2ERJB 1A6AA 2PTVA 4LSDA 4HLJA 3ULSA 2NXZB 5DEGB 3DUSB 5DQDL 1AP2B 2AI0H 4X6CF 4NKOA 4DGVL 1N6QL 1KCVL 1XGUB 4CUCA 1FO0H 3T3PE 4OCSH 3PNWB 1C7TA 1U2HA 1X44A 4N0FB 3ARBA 3K2UL 1FCCA 1CXFA 4JKPH 3CDFA 1S3KH 4W81A 1QFUL 3NOIA 2HN7A 4OLUH 4YDVB 5D71H 2RGSA 4KUZH 2OI9B 1T21A 2AJ3A 1U3YA 4LAQH 4ZAKD 1ADQL 3IJHA 2QKIA 5IBTH 1TVHB 3HS0B 2JJSA 2Q87A 4J8RB 1IARB 5SWZB 2RAMA 3TA3C 4F15B 1AD0A 2A6KB 1R5VA 3MJ7B 1T7VA 2HA1A 1VFBB 3D5OF 5LGKA 1CG9A 2WK2A 2FGZA 3FQTB 5FYKU 1ZGLB 1UB5A 2CRIA 1TJIH 3D69A 3NCYP 4HSQA 3ARFA 1FYTB 5C0AA 4KJQD 3VMOA 3HZMA 5I16B 5FGBC 3GO1L 3U9PH 4P3CH 5KANG 1WF5A 3F7YA 4F58L 3OXSA 5IFJA 4TSBH 1D9KB 2E27L 4OAWB 1CGSL 2OMBA 5J11B 4OD3L 4XCEB 1AQKH 2CKNA 2YC1A 3Q2CA 1IGFH 3NMEA 1C1EH 1T7XA 1QACA 3T4YB 3MACL 1MFBL 5GRVL 4GW4A 3AREC 4X6FA 4KTEH 4W68A 3NCFB 1LEGB 4FFWD 3PP3K 4PB9L 1YY8A 4N1HB 3HLAA 3X14B 3TIDA 5C09B 1C5BL 4GRWF 1FVEA 1KCKA 2YPLA 3HG1E 3MLYL 4PJHB 5MI0B 4A2MA 1OB1A 1OSPL 1V3JA 4H1LA 1WEJH 3MGTB 2AJZB 3MOQA 3O6FB 1ZA6B 5C0NC 3SO3B 3N1PC 1K2DA 5E4EC 4JN1L 1KENH 2VZUA 4QHKJ 1E4WH 2Z8RA 3IDJB 3HE7C 3F12B 2VXUL 3FT2A 1Z0NA 3RNKA 1RK0A 4HLZG 2MQ0A 1EFQA 5C0BA 2R2EB 4OQTL 4JFDB 3MBXH 1G1CA 2Y23A 5GS0C 3ILQD 3VDCA 2VAAB 1YN6A 5JXAL 5CKGA 5TDOB 2XICA 4NQEA 3TCLA 3TJHD 4PRPE 4RAVB 2O5YH 4JG0L 5KN5A 5EA0H 1V7NL 3MMEA 2VXQL 3QUKA 1KN2H 3BMWA 5ADPL 2A73B 4Q2ZA 4P3DA 4Y2DC 3SN6N 3RDTD 3UAJD 3P4OA 1IKFL 5HYEA 4PG9B 1S9VB 4NHCL 4NKMB 4X4MA 3TBWA 1HEZB 3HNSH 2NY7H 3QIWB 4OTXH 2R8SL 4LQFL 2AV1A 2ARJA 5TE7H 2CQVA 1TTGA 1WWAX 5BO1L 4FZEH 3U83A 4NQXA 4ACPA 2VQ1B 3D9AL 43CAA 4MB3A 5HYSA 3BP4A 2PKDA 4ZTPH 4JJ5A 2VDRH 1QD0A 2NW3A 4OZFG 2XNAA 3ULVH 4YE4L 4APQA 1ORQB 2OTUA 3QNYB 1ADQA 3DSNA 4KROC 4JR9H 2P7TA 1X7QB 1N26A 4NHUE 5AAWA 3R0NA 4ZS6C 2X4TB 1NGQH 3GKWH 2EZ0C 3TNMA 1UM4L 1IGCL 3MTRA 1T7YA 1U8IA 3K8MA 4YHYC 2FHFA 3MZGB 1WWWX 1D5IH 1G9NC 3SGEI 4H8WL 2BC4A 1GHFL 1FNEB 2AXFB 3NCMA 2WUCL 5LGJA 3IRZA 4G43B 3PGCA 4GLRI 5DD3L 3WDIA 4XWOC 4EDWH 4C56D 1ND0B 1T2XA 3GI9H 1BF2A 1FO0B 2UUDH 4X5WB 3TWCH 1JFMA 1WK0A 2PW2B 1F2XK 2VDML 3IXTA 1RMFL 2P8PA 4MA1B 1P4IL 4PJXE 4HFUL 3V4UL 1FRGH 3KWWB 1J9CT 2R1WA 2P46B 5E08H 1VSCA 4PJGA 5D2NC 3MLXL 3UPRB 3EYOB 3ULVD 5IJKC 2IPUK 2A83A 3GBMH 4NCDA 1RIUH 3BPNB 5I76B 1YJDC 5JMRA 1IGYB 1IGIH 4QCIB 2R0WH 2W07A 1LE5B 4CDHA 4OF0A 5EBWB 3JV5A 2WIMA 4K3EH 4Y1AB 4I3SH 3MRCA 1F6AB 4ZTOH 3OKOA 1Z3GL 4GKSB 1UADC 2C3HA 2VSDA 1DDHA 2YD6A 4TRPH 1K8IB 1TTFA 2XN9E 1KEGH 4PJIA 8FABA 4U33A 3MUGB 1KIUA 5I1KL 3HI6L 3P77A 1MPAL 3U7YL 1EGJH 1U8KA 1OTTC 1T5XB 1JNLL 5DQJB 1G7JB 1A7PH 1CBVH 3FFCB 3S6CA 1JCKA 4OQTA 1ZTXH 4FFVD 4PJBF 4TVSa 1NGPL 1TIUA 5CSZB 2C9AA 4OZHE 3AMLA 5KSAC 4O02H 2NMSA 4GLRH 5CHNB 4HHAA 2BSTA 1MFNA 1H5BA 5C0EB 2EIBA 1JUFB 3RDTB 1KPUA 5CJBA 3MLTB 3FT4A 2PETA 2W9EH 4RX4A 1U0QA 3LH2L 5E94A 4XVTH 4R96B 4I0PC 4QY8B 2FIKB 3DJ9A 2AXGB 5EU3A 1IFHH 4HWBH 1U3HA 3DLQR 1VKXA 1BD2D 4WGWB 4GG6E 1KJ3H 2MQ3A 2HYMA 5I9QB 4MJ5B 5CGMA 2P44B 3TYGH 2R56H 3WIHL 2ZWLT 4JFPB 3O4LA 3PF2A 3BGMB 3WKMH 3HAEH 3HC3L 1FYTE 4BYHA 5GRZA 1KBGH 4OCYH 2CH8A 2N7BA 3H7LA 3G6AB 2JIXA 4NQCA 4LPVA 2CXKA 2OBGA 3HR5B 3LEVL 4CVXB 2RJMA 1ORSB 2EC9U 3LB6C 3O9WB 5EZLB 3SQOL 3T04D 4LVOC 3RX7A 4XNMA 1IMHC 1HWHB 4BH7A 4O4YL 3ECBA 4OI9A 4WW1A 2C1OA 2ADJA 1FIGH 3KLDA 3MRFB 3T65A 2QJDA 1NAMA 2Y7QB 4J7RA 2DM7A 4C56B 43C9B 1C5CH 1IBGL 2UY7A 5C09E 4HIIB 3IKCB 5E2JA 4I3GA 5MEQB 2NYYC 4WUUE 2OZ4L 4PJ9A 1ZE3C 4F9PA 4BKLB 2NY3D 5CGYC 2M8XA 2C4XA 2OS7A 3QDMB 3QHTC 4JY4B 5FYLH 1ZT1B 1AHWA 5IB2A 1LO3L 4QRSA 5I15H 1KCSL 3MXVL 4NQSA 3U48A 2OMNA 1MHPL 4KK6D 5J4MA 5H94B 4XHJC 3CC5B 5I6XB 5I1IL 4YPGB 3VFSB 3BP5A 4JFZH 5M7QA 2ICES 2FH6A 4XVJL 1Y6NR 2F15A 3SDAD 4PJGF 1MHEA 4JE4B 4KQ4L 1KFAL 2CO7B 3L6FA 3QPQC 2HFFB 2XV6B 1T66D 3S34L 3KAAA 1AO7D 3EO0B 3VFNB 4XP9L 1MRCL 1CT8B 3D85A 3MCKA 4FABH 3WXWH 2RHEA 3MR9B 3EDJA 3EFFB 3T8XB 1HN1A 4V1DA 2VLKD 2NW2A 1DQLL 5BJTA 2H6PA 4MQSB 1BX2B 3C5ZD 4XP4H 4XHQA 1E0OB 3DSFH 3O8XC 1CD9B 1CI5A 2IPTL 4P2OA 1XGYL 3JWOH 1Y0LA 4PJIF 3KYKL 4CADA 2VN7A 2YZ8A 1F11A 4JN2B 4KVCL 4TUOB 4JFQA 1CICA 1SJVA 1Z9LA 1JGVL 2GTZA 4HGKC 5J13B 2PCPA 4XVUD 5DGQA 4LCIL 3G6JF 2IFFL 1JNJA 4IRSD 2AABL 4S0TD 4JANA 1BD2B 5F9DC 3UDWC 2I5YH 4GMTL 25C8L 1J18A 3U0PA 1ZMYA 5C0RH 4KK8D 3WIHA 1XT5A 4LPTA 4UV4L 2ZUYA 1RZ7L 1MIMH 1Q9OA 1U8HB 3W9EA 4F7TB 2E6PA 1I9JL 3MJ9L 1A1NB 1KIPA 3UTZB 2DICA 1ZT4A 4HPYL 3AM8C 1FORL 4IM8A 5DRNB 5BXFA 5HGAA 1CN4A 3U46A 1KC5L 1RQ5A 1K4DB 4RMVA 1EHLH 2Y06H 4LGPB 4WI2A 4XNZC 3P73B 3MV01 2P1YA 1BQHG 5IVOA 2ZG3A 3MLWL 4DKDC 5EORH 4R0LA 4FRWA 4JY6B 4NM8H 4JM2B 5JXEA 1Z6JT 3FB5A 2Y36L 1MJJA 4UT6H 1F13A 3C87A 5CBEB 1C16B 3PWPD 4JHAL 4D0BB 2RBLA 4CVZB 4HIHB 4TSCH 4AY0A 1X5JA 3G9VA 2YKLL 2X9XA 2OZ4A 1TZHA 2VXTH 3HG1A 2GSGA 5I2IB 1J5OH 2FD6H 5GHWL 3QEUB 4H20H 3QG7H 3L3DA 2DLFL 4S1QH 3HAEB 4P2RD 5F3HB 2VH5L 5TQ0L 5CEZL 4Z7QF 2A6DA 2CDGA 3TZVC 4AENB 1NLDL 1DJSA 3QHZL 3LV3B 4M1GL 4RIRA 2YPVH 4YXHL 1QFPA 4XH2A 1AGBA 4NM4H 1FSKC 4Y0GA 3IGAA 2O61A 3DO3A 4JO3L 3EOAB 1N7ML 1MEXH 4RISH 1CFQB 4NGHH 1E28B 3ABZA 5EU4A 1G7HB 3H3BC 1AO7B 4F7EB 3O2VL 1OM3H 5K9JL 4ELMF 3RZCD 1HH6B 4MWFB 1KTDB 2CIIB 1AGFA 3T2NL 3X12A 1PZ5B 3ARTA 2XTLA 4FQJL 4XNQA 5BRZB 3QPXL 2JJVA 4J1UB 5GSRA 3BSZL 3C5ZB 4UIMA 4LLVA 1OOAA 3RY4A 4NUJB 5JW4Q 4W4OC 1HSBA 1UZ6F 4OF6A 1ONQA 1OF2A 2ZOKA 1NC4D 4CMHC 1EUTA 3QDGD 1MHCB 1MH5A 2MFNA 2EDFA 2Z35B 1ITCA 5EBLA 1NEZA 5BVJA 3TJEL 1HKFA 2JELL 2D2OA 5DVKA 4CJ0A 5FB8A 3S9DB 3KXFD 2YRLA 3SDCC 3QEQA 1ZA3A 2IAMA 2MMXA 2DDQH 3DI3B 4NHUA 4IRSB 4LLMA 3K7UA 3T3PF 2DQHH 1GGCH 1H3TA 2D7TH 3AAZB 3ROLA 2R29L 4FQ1L 1AQDA 1TNMA 2QADD 2JJWA 1N64H 2B1AH 2KDGA 1R3JA 2EO9A 4OJFH 5D1ZA 5DUPL 1KTLB 3NH7H 3CFBA 4C55A 3VFWA 2RFXA 5L7XL 3LZFL 1OW0C 4C56E 1MRFL 1WCQA 5T1LD 1XGRB 1A4KA 5CWSA 3C8KB 1FVDB 1KCUH 4D9RD 2NX5B 3OKEB 4EN3D 3NGBC 4S1SL 4P2QD 1BOGB 2ZJSH 5EZOH 4XCYB 1PYWB 5LCVL 3PXJA 3T4AA 4OLYH 1SVCP 3PABB 1LO4L 4PJXA 5DQ9B 3ILPA 2HFEB 1QSZA 5FK9B 4FQIL 4HLZH 5GGVH 2DQDL 3PQYD 1YY9C 3JV4A 3OAYK 3CSGA 4PJDB 2PXYA 3PWPB 5IMMA 1DE4B 3RL1B 4I9WD 1S8DB 2BSSA 4XPFH 1EMTL 5BZWB 4LGRB 2Z4QA 3PUCA 5IGXL 3QXVA 4ENEC 2V6HA 1R3IH 2LFGA 3QZWA 5H35B 4C59B 1GL4B 5HGHB 2VR5A 4B5EA 3CX5J 4XWGL 5F7EH 3X3GH 4LCCC 3WXVL 2FYYB 3VW3L 3QUZD 4DVBA 5C9KA 2XN9A 3CSYB 4LEOB 1SEQH 3KLAB 5JQ6H 3FFDA 4ZD3H 4OM0H 4P23B 4P57B 1I1AA 4UT7H 5JTWA 4ZFFB 2XFXB 4MSWB 5DEGA 4MD4B 1U8PB 3P9MB 2VMFA 15C8H 3S37X 3QXTA 2W38A 1H3GA 1GYAA 5E6YA 3PNWA 3OZ9L 4HZAA 3S4SG 3THMH 3ZKMD 4YHZL 5T3ZD 4OFYA 3FO9A 4UTAL 4L4VD 1RZ8A 3ARVA 3KYMB 1NMBL 4YDVA 1AH1A 3T2PA 3PL6D 1WFNA 1MFEH 3V5HB 2X4SA 3VXQB 1JWUA 4MA7H 5EZIL 1NDGB 2E8ZA 1T4KB 1JF5A 2HT4C 1FAIH 1LD9B 1MCPL 3HS0A 5FYJL 1PY4A 4J8RA 3RPKA 1J0IA 5SWZA 1BD2E 2ATPB 3G6DH 5AEAA 3QDGB 4N9OB 5IWLA 5E8EB 3V79C 5D1XB 3E6HB 3FQTA 1ZGLA 1RVFL 2NZIA 4WDIB 3HTLX 3WNOA 2AK4D 2EEDA 3S36H 1ZVYA 4KXZI 3KXFB 3S5LA 5I1LB 4Q9RH 3QAZC 4DGIH 5HVWA 3QDJB 1FYTA 3T1WA 1F4YH 5I16A 2AI0L 2AQ1A 1LVEA 5ETUB 3VCLA 1D9KA 1FO0L 4OCSL 4BH8B 1UVQA 1IQDB 4P46B 4KJYB 4Y16D 3QWQB 4X8XA 4XCEA 3MV11 4JKPL 4FQCH 4Z0XB 1S3KL 3QJFB 4IOSD 1G9NH 3IXAA 4MGXA 4OLUL 5D71L 4R90H 5AD0B 1MCWW 4KUZL 3GI8H 4Y4FD 4GUPB 4LAQL 5T1LB 2CR3A 1LEGA 4LKXA 4Q7DA 3BKMH 1HYSD 3BXNB 3CSBA 3HZVA 5GS2D 5H8DA 5IB4A 1IT9H 2Q8AH 5IBTL 1WZMA 3E6FA 5FOJA 4EN3B 2BNQD 4H0IA 5J06A 4P2QB 1FCGA 5C09A 2VUYA 4KQ3H 4DJMA 2VC2H 3RUGE 3RX5A 3SDDC 2JK5A 5I0ZA 2ZUSA 3VMPA 1U91B 5ABDE 1CFVH 2AJZA 3SJVD 3O6FA 4D0DB 1XF1A 5DHVH 1TJIL 4JPKH 4MMZC 3PDDA 4FFZH 5C08D 4F7MB 3U9PL 4P3CL 4GAFB 2GQHA 1QLFB 4Z7NE 1YJDH 4TSBL 1BZ9B 1MVUA 3QUYD 5EC2A 2NNAA 3TA3B 2GY5A 3D18B 1AQKL 4KXZH 4PJXF 2W0PA 5FDWA 1IGFL 4U1HB 5ID0B 1C1EL 5JMOC 1A1MB 2DQUH 1AO7E 3D39B 5GZNC 4DWHA 4N0CC 4KTEL 1F3JB 1R3HA 4KI5C 3ROOB 4B41A 3CCHB 1KGCD 4HKXB 5I1AA 2VLKE 4YDIH 3BZDA 5JQHC 1S9VA 2UZXB 5IB3B 5KOMC 3IDYC 2GKIA 3V0VA 1YMMD 1WEJL 2XTJC 4P4KC 3VGEA 5A2KH 3S36X 1XF4A 3BD3A 4Z7VF 3FONA 1JGDA 5AZEH 1WC7B 1Q1JH 1KENL 3BPLC 5SWSD 3PL6B 4UDTB 1E4WL 4FN0A 5INCB 4S0SD 5ECJE 3FB8B 5SV3A 4QTIH 3UTQB 4ZAKA 1XF3B 3GHEH 3QNYA 3HPLB 4Q9CA 3U6RB 3DVFA 1D3CA 3MBXL 3QXDB 4TNVF 3RWGB 3L3KB 3LSOB 5GSVA 4OZHF 2KPNA 1RJZA 4ELKB 5D5MB 1W0YT 2X41A 2O5YL 1BVLA 5EA0L 1I9IH 1FNEA 2AK4B 2E5EA 5BV7C 2AXFA 1KN2L 1KXQE 2DD8H 2DOCA 1K4CB 5E4EB 1B90A 1A14H 1OHQA 4ZG1A 3HE7B 3MCLL 4UINH 4KRPC 3DVNB 3HNSL 2NY7L 4OTXL 3HPJB 3S3SA 4X5WA 5TE7L 5FM5O 1LHZA 4HUVA 4FZEL 2PW2A 3WHE1 2C4FT 3SGDI 4RDQG 4GG6F 1FL3B 1ZANH 5KSAD 2H8PB 3G5VA 4ZTPL 2VDRL 4Y4FB 5HHOD 3OG6B 3DIFB 4G8GD 3JWDC 3ULVL 4NNYB 3UPRA 1I7ZB 3UJJH 3AY4A 2B5IC 1OT1A 3PIQA 4JR9L 4Y2DB 1OWRM 4KUCD 2BNQB 1IGYA 2IADA 4QCIA 4LNRA 1NGQL 2VZ1A 2AJUH 3GKWL 5I1HH 5KW9H 3V6FA 2VTFA 1LE5A 5C86A 3MUY1 1HIMH 3KPOB 5F1NB 5E5MB 4NZRL