1VADA

Mhc class i h-2kb heavy chain complexed with beta-2 microglobulin and yeast alpha-glucosidase
Total Genus 82
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
82
sequence length
274
structure length
274
Chain Sequence
GPHSLRYFVTAVSRPGLGEPRYMEVGYVDDTEFVRFDSDAENPRYEPRARWMEQEGPEYWERETQKAKGNEQSFRVDLRTLLGYYNQSKGGSHTIQVISGCEVGSDGRLLRGYQQYAYDGCDYIALNEDLKTWTAADMAALITKHKWEQAGEAERLRAYLEGTCVEWLRRYLKNGNATLLRTDSPKAHVTHHSRPEDKVTLRCWALGFYPADITLTWQLNGEELIQDMELVETRPAGDGTFQKWASVVVPLGKEQYYTCHVYHQGLPEPLTLRW
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords MHC CLASS I H-2KB HEAVY CHAIN
publication title Crystal structure of an H-2Kb-ovalbumin peptide complex reveals the interplay of primary and secondary anchor positions in the major histocompatibility complex binding groove.
pubmed doi rcsb
source organism Mus musculus
molecule tags Complex (mhc i/peptide)
total genus 82
structure length 274
sequence length 274
ec nomenclature
pdb deposition date 1994-11-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00129 MHC_I Class I Histocompatibility antigen, domains alpha 1 and 2
A PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1vadA02
3.30.500.10 Alpha Beta 2-Layer Sandwich Murine Class I Major Histocompatibility Complex, H2-DB; Chain A, domain 1 MHC class I-like antigen recognition-like 1vadA01
3BRGC 1ZHNB 4TVPD 4KK6D 2QLVB 4W4OC 2PCPB 4JREB 4NKMB 1VDGA 2BMKA 2J6EH 5AD0B 1DQJB 1WZ1L 1N5AB 2VNCA 3RIFF 1MCDA 2IGFL 4KTEL 1KENH 4ELMA 2E27L 5DJAB 2LAAA 2FJGB 2A6JB 4ETQA 3UDWA 1LO0L 4XPTL 1Y0LA 1BREA 5KSAA 1EFXB 2C7UA 4HDIA 4OGAD 1EAJA 3JTTA 1T1YA 2DLTA 2XWBA 1ETZA 5EOQH 1QG3A 4HZAA 5ERWA 4DN3H 2OJEA 4OF6A 4OFKA 4ZQKB 2E7HA 3FB8B 4P46A 1P4LB 3KPOA 3LN5A 1DVFA 2PTVA 1QFWI 2RFXB 3LIZL 5D4QA 5IM7B 3FN0L 3ARZA 5K9QG 4PP1D 3NFSL 1OHQA 5HHQA 4QYOB 3S3SA 2N7BA 4I3SL 1HXYA 1ZVSB 3RWJA 3MBXH 5L2KA 5CP3A 5L88L 1RULH 3B8YA 4PJBF 3PDOA 5D7LD 3OV6A 1LP9B 3REWA 5L8LB 5ECJE 4XP4H 2VXUL 4EN3C 3FQRB 2X4QA 5K9JL 4Z0BL 1I3VA 1GGIL 3RX8A 4HK3J 3TJEH 4NDMA 2OSLB 1S8DA 1RIHL 5KSBB 1ZGLM 1KGCD 1BZ7B 4OIAA 3O3EB 4JPIA 1VADA 5D7LE 3MRDA 4JFYA 2R29H 1KFAH 1UJTA 4NUGH 1ERNA 3WIFB 5CBEB 4XCCH 5I1CH 4WEBH 2R1WB 4R97C 4LVHB 4RISL 3CMOH 4G8GD 4WWID 1C12B 3QHFL 5F72S 2CIKA 1MJUH 1J1XH 2EKSA 4PG9B 1A6VL 4HUXB 4OGAC 5AZEH 3UJIH 4PP2A 3EYVA 5LGKA 4ZYKB 3O8XD 3BEWA 1RUPH 4P4KD 3W0WA 4G6KL 3QFDB 1G7PB 4Z95H 4PP1C 4RRPA 3CSPA 4YDJB 1F97A 3IDXH 2IJ0C 3HZKB 5I73B 1DANT 3MCG1 2ZG3A 1NFDE 4PJ9A 4LQ1A 4OCSL 5E8NA 5E9DB 3VFOB 1NUDA 2HLAA 2CKBL 3KPRA 5I1KL 4S11A 4U2ZA 1OY3B 4UNVA 5CZVH 2R2EB 5BO1H 2ITDA 4PB9H 1L0YA 4CUCA 1IAOA 2WWMD 3MLZH 4N9GB 4F9PC 3NZ8A 3GKWL 1J12A 1BAFH 2F15A 3I9GL 4JJHA 2XNAB 1W2KT 3FZUD 3UPCA 2HRPL 4R7NB 3TIDA 3SDCD 4GRWE 5FA3B 1FVDB 2Q8BL 4P2RD 2CDGA 4S1DD 5F93C 5LAXB 4D0DA 2EDXA 1A6UH 4TTDD 2V2XA 1MH5A 4LPYA 1FO0B 3DGCR 3DVGA 1N5YL 5K9OA 4Y89A 4HZLA 3W39B 1I3GH 4QHKJ 3DETD 1HXMB 2D7MA 3RHWF 4HIJB 3UJTL 4BQ9A 4OD2A 5JOFB 5LQBH 3O8XC 4MQSB 1AXTH 1KEML 1CDUA 1M05A 1JRHL 4ZXBB 4UOW0 3IFNL 4WI7A 1I8KA 1V7NH 4MX7A 1UA6L 4TRPH 2OZ4A 3SBWA 2HJKA 1JNLH 3KPMA 5DLML 3Q6FB 1M71B 3MFFA 1SYSB 2YUXA 4YHLL 5FXCH 4N0UB 4L1HA 5KVFH 3GSQA 1NAMB 3DUHA 2AABL 15C8H 2C3WA 4FQLH 4MA7L 3UPAA 3HMWH 2ZUQB 3RWEB 2ZKHH 3TN0B 4IRSB 3RVWD 2HG5A 1OAXH 2GJJA 1S7SA 3EGSB 2WWMC 4KDTC 1NFDF 5IB4B 3BPOB 4LEXL 2AJUL 3FZUC 4JHBA 5SWZA 5GS0D 2XQBH 4YXHL 2BOCA 3VXUD 1HCVA 4X6CA 4XT1C 3ALWA 3HZVB 2BHYA 4EDWH 1PY4A 3OJDA 3DRQA 4S1DC 5SV4A 3BESR 5EOCL 3N1PC 4QWWD 4YEEA 4JO4H 2P8LA 3U82B 1HN1A 1A4KA 5DJCB 5HGHA 2G5BB 3G08A 1WZMA 2R2BA 2Z4QB 1KJMB 4PJBB 3RWHA 1BJ1H 1JHTA 1EEQA 4P5KB 2YKLL 3KPPA 3ROOB 4Q7DA 1CXHA 1ZANH 2E6JA 3S37L 3ULSA 3CFBA 4C56B 3MV7E 3BKYH 5I8KL 1CDIA 3M8OH 5C0JA 1XGYH 5ITFA 4MZ3A 4DVRH 3HRZB 4GRMB 4YFLF 5GRJL 5I19L 4O4YH 3IF1B 5ID1B 1MHEB 5JMRA 5DS8B 1I7TA 1ZWIB 2V2WA 3RVVD 1N7ML 2VDKH 3RX5A 4KPHH 1FC1A 4OFDA 2FJFB 4WV1C 5IKCA 4ZUSA 4Z8FH 3QR2A 3VXMA 1HH6A 4KKCD 4P2OD 2O26U 1DQLL 2C1OB 3T2PA 2GJZB 2FH6A 2BVOB 3HC4H 3RVWC 4GQ9H 1NBQA 4EI5C 4D3CH 4O2CA 3HZMA 3VXOB 1N6QL 1T0MB 1JBJA 5E8DL 2QADD 4LKXB 4QXTB 4RNRB 2JB5L 2B5IC 5EG6C 3D2UB 5GS0C 1WC7A 3GRWL 1YEKH 2Z93A 4KQ3H 3QBTB 4R3SA 1YEEH 1I7RB 1IQDB 1HHJB 4G8EB 3ARGC 3VGEA 2DQUH 1DJSA 4QWWC 1RUML 4U1NB 4F7MB 5CWSA 4PRID 2CDEB 4K94H 4OSUH 2V2TB 1L6XA 1NCAH 5E08L 1R0AL 5FK9B 5C0DB 2IF7A 5I1JL 5E2TL 2R0LL 1GHFL 2Z31C 2XTJD 2ZUSA 2EDFA 1RZ7H 2WANA 3H9SE 1U3ZA 3TESA 1A0QH 4D0CB 5F1IB 5IW6A 3KXFD 5LCVH 2YUWA 3IAQA 3QA3B 4FNLH 2FD6L 2UVFA 1RU9L 1TFHA 3RGHA 4WW2A 5C08A 1QBLL 1QRNE 3VH8G 2CO6B 3AS2A 5T5NG 3LV3A 4GH7B 3RVVC 2ESVA 5J11B 35C8H 1GXEA 3F12B 2GFBA 2AEQL 3CU7A 4KKCC 3T0XA 5F7UA 4HKXA 5DJYA 4G6MH 1CG9A 3SKOA 5D6CB 2V17L 5D7LB 4LMQI 4DZBB 4UIKH 1G7IB 2HTLD 1PG7H 5DZOA 2DRUA 4MLSA 3K2UH 2I07B 4FQIH 4PJ5E 3IDGA 1NCCL 2V7HB 4JG0L 2QADC 4FXGB 4XBEH 2CLVB 3QO1A 2Y72A 5EC1B 4I18C 2VZOA 2HTKD 3DURA 3MTRA 3DNKA 1YY8B 2HVKA 1A3QA 3H3PL 1KT2A 4FTVE 2YPKB 4XPBL 3LD8C 3DX9B 1MHHA 2ZSVA 3FMGL 1IKNC 4QTHB 3VRIB 1QFHA 1R3JA 5D7SL 4F33A 1GH7A 2G2RA 5DJXB 3ULUH 1A3RL 4HIEA 3OKLB 1NGPH 3VDAA 2YK1H 3STBA 1OWWA 2B2XH 5KVEL 1P1ZA 2VABB 1MAKA 3WUZA 1BIIB 4MJ5B 1T2QL 4NO0D 4XX1G 3AB0C 2EH8L 1QFUH 4YO0B 3DV4A 5D72H 2B0SL 1DE4B 1NFDB 2BNQA 2X44D 3TBTB 4O9HH 1F58L 4P4KB 3EYUL 4ODWA 1H0DB 1P5UA 3EO1B 1NBVL 1B0GB 2BNRA 1Q94A 2VDLH 3GM0A 5E00B 5HGBA 1IT9H 3RRQA 4OV5B 2RCSL 3CU1A 1YECL 2YD3A 3ARQA 4UOW1 4AEIH 3MGTA 5MP6L 1U91A 1H3VA 1KBGH 1BJ1J 4TNWF 2A2QT 5EUKA 2EEDA 2NTFB 3BP5B 3HUJF 2IC2A 4GRWB 1L7IL 4XPHH 1MCWW 2FJHB 1EHAA 4QRSA 2FL5A 2HTLC 4YXKL 3FQWB 3CDFA 3CFJA 3VRJB 3C87A 5DRNB 3P4MB 4EDXB 3VXRD 5I71B 4XCFL 3TNMB 4X9GA 5J8OA 5IGXL 1S7XB 3SDCB 2ID5A 3QJHA 5FM8A 2E9WA 4WUKL 4XCNB 1GOHA 5C0CA 1K3ZA 5E1HB 3V6FA 2FRGP 2IAMA 5FV2A 1S9VB 3QJFA 5J1AA 2EYTA 4H5SB 4C54A 3BPLC 1AQDA 5AYUL 1WBXA 3MRPA 3ARWA 3TJEL 3L3HA 4PFEA 4J2XA 1DSFL 4FG6D 4AJ0A 3FO9B 5I6XB 2V5YA 2F54A 2FECI 4U3HA 5B8CC 3NPZB 4KJQD 2XZZA 3C6SA 4OV6F 4G7YL 1BBDL 2Y5EA 3T09A 4HS6B 1JNNL 1U8LB 4X80L 2EYSA 4M1GH 5T3ZD 3RU8H 5DMGD 2DMBA 1NH6A 1M7DB 1CGSL 4E9LA 2DBJA 2GHWB 1L6ZA 3EHBD 1K4DB 4L4TD 5ID0B 3O45A 2Y06L 4GKOA 4OBRA 2CMRH 1NKRA 2OTWB 1FL6A 2HKFL 2H45A 4AEHH 1DEEB 1YN7A 3NIDF 4UV4H 5GIRB 3UBXA 4CW1A 4K8RH 3B8SA 3FCTA 3RWFA 2IPTH 4QXUH 5F7HA 3DARA 3CVHB 2IH3A 4NPYB 5TH2B 4XMKL 1T89A 1A4JA 1MFEL 3SGDI 3K3QA 4X0KA 4JHWL 1ND0A 4Q2ZB 3BP7B 3H3KA 1RZGB 9CGTA 4PB9L 4RA0C 5IB5B 4FG6C 4B41A 4XB8A 2VLRE 4NNYA 4UDUB 3UTTD 2FBJL 3FQXA 3S36X 3V2AR 4KI5D 4ODHL 4KJQC 3G5ZB 4QRUA 3NPSC 1LHZA 2J8UE 4XGZB 1CXLA 5MEQB 3KYAA 3TWCL 4BK5A 5I1DB 1S7QA 4NJAL 1HDMB 5DMGC 1OAYL 2R4RL 3UTTE 4PJGA 2IQ9H 5C0GB 3JWOC 4GRLD 2JJSC 4GW5B 4P2OB 2QQKL 1FAKT 1Q9OA 3WUWB 1JFQL 3KLSA 3ERYA 4GW1A 4DKEL 1YN6A 3CIQA 4LRNH 2YBRB 1HOCA 5C7XH 5B3JE 4DGVH 5TDPB 4IMKA 1V7NL 2OMNA 4I18B 5IHUL 2H8PB 5GJSL 3BGFB 3D0LA 3O41B 4M93B 3HFMH 1FHGA 4KJWD 1T7WA 2D03L 1OWRM 5FECA 5TPWH 4YDKH 2DWDB 2AQ1A 1A1OA 1YY9D 2Q8AH 4NNPH 1NPUA 4P2QA 5ADPH 5F7MC 3NFNB 3IU4L 3EYFA 4HKZA 4YHZH 1MCOH 2XTJB 2W9DL 3HUJB 1QRNB 1X5AA 1T04B 4DAGH 2FLBT 4XP9H 1T1ZB 5KSAD 4FXKA 3KXFB 3VJ6A 1BVKB 1FNSL 4KI5C 5EA0L 1FH5L 2OYPA 4M6ML 7FABL 4LNRB 4P46D 2AKRA 3KWWA 1DVFD 1NLDL 3TBWA 4APQC 5B38A 4EEEA 3VWJA 4KHXH 2GSIB 3PP4H 3IFPB 2NY3D 3BZEA 1QLRB 4DK6A 4RAUA 3AU1A 4GRLC 4JO3L 3KLDA 4KMTL 2ERJB 4NQTA 5L2KD 1JPFA 4YAQA 1J7VR 5HGAA 1IGIH 2NY5H 5JIHA 3S34L 3EJZD 3HE6B 3T77B 4NKDA 3GIZL 4GKZB 4AMKH 1I9RL 4KI5F 5HVHB 1E28B 3P4LA 5C6PB 5IFHL 4LSPL 1JPTH 4PBVC 5GGRY 2NY1B 3NA9L 4JPVL 4KJWC 1CFSB 5L2KE 4JVUA 4NYLB 5DSCB 1S9KC 1F4YH 2ZNXA 3RIAK 2XIDA 2ZUXA 1YY9C 4H1LB 3QG6B 2MPAH 4NQSA 3D5OF 5JOPD 1JZ5A 4C83B 1A3LL 2WINB 1UM4L 4R7DA 5GS2D 4IJ3B 5JIKA 1E4XH 4A6YA 5CKAA 2D0GA 3UDWC 2VWEC 3FAWA 5KSAC 4NO0B 4F3FB 1MQKL 3D25A 2OL3H 3M1BA 4X6EB 1KB5H 3NACH 4HJJL 1U8QB 4P46C 5B8CB 3RNQA 3P73B 3EO9H 2AV1A 3QIUC 3W0WD 1XF5A 1RK0A 1QYGL 3MLXH 4URTB 3CFCH 2NY3C 5HDLA 1XF3B 2BCKA 3HB3C 1P7QA 3K4ZA 4V1DA 4K9EC 1ZHKB 2M2DA 1RZ7L 2J1KA 1C16A 4XVSH 2EIEA 2WUCH 4P5TA 2R56H 3LH2H 2H32H 4HXBH 3MRKB 4PJ9D 1CDHA 3W0WE 4OTXH 3JTSA 3S35L 4KJPC 5F89B 4ODVL 2B4CL 2IFFH 5H8DA 4LCUA 5E1AA 3WSQH 4CMMA 3VXRB 3BKCH 3BW9B 5I2IB 3ZTNL 1MUJA 4FMFA 4I13B 4X4YB 3M17A 2WBJC 3C60A 3OAYH 3U7YH 4P57B 3BAEH 3MNWA 1OM3H 1KOAA 2HFFB 2ICWB 1QLEL 1GIGL 4RFEA 2CO7B 1PQZB 5EIIA 4OD3H 5I1LA 3MJ8A 3O3UN 1HYSD 1YUHB 1FFPA 2RBLA 4MJ6A 3LKNB 4J4PA 5DEGA 4XRCB 4ERSH 5HYSG 1NGWB 4NZUH 1D5ZB 5KN5A 3H9HA 4OQTH 3T0DA 1MFCH 4MA8H 1QHOA 2ZCHL 2X4OA 5CEZH 2NX5E 2VKWA 1LK2A 3PV6A 2I60H 1U92B 5DRXA 1RVFH 4X5LA 2N1KA 1BBJB 1R3LA 1BGXH 1NCDH 3U46B 1DUYA 3UMTA 3QUYA 5JQ6L 5F96L 3Q5TA 2EDHA 1FIGL 3GMQA 3BH9B 2GEEA 1DQML 1ZT7A 3CFKA 1IFHH 4LLWA 5MERA 2HFTA 1I8IA 3ZE0E 1J87A 4L9LA 5GSRB 4GG6A 3LQZA 1EEYA 4IIQB 2XOTA 2OR9L 2J88L 1ITCA 1EGJH 3EZ8A 4L4TB 2OLDA 1UADC 2HWZL 4CADB 2YMXH 4X8JA 5LBSH 1IT9L 3MZTA 1KJVB 3S98A 1CL7H 3PWLB 3WCYA 1CXFA 1Z3GH 1JGDB 1G9MC 4JAMA 5SWZD 5EUOE 5KANG 4OM0L 3LPGA 1XR9B 4NT6A 5JPMA 3VFGL 3BD5A 2VLRB 3RA7H 1BJMA 1TIUA 2E7LE 2E6PA 1FZJA 4Y4HA 4HIIB 1M7IA 1HYSC 4AZ8A 1AO7A 3L95B 1A64A 3U36A 2W38A 3HC3H 5F6HJ 4KKNA 2XPGB 2P1YA 3DX8A 3VXTB 2P5WA 1WBZB 4RMTA 1DL7L 4HSQA 3UTTB 1F11A 1OQXA 4NBZB 1BEYH 2HKHL 3TZVB 4G5ZL 1ZA6B 3MXVH 3Q6GL 2D7QA 2DQTL 4JKPL 2IPKA 3TJHC 1H9VA 1Y6NR 3STZB 5HI3C 1JYVA 5EU5A 4N0FB 1OAZL 4LLVA 5MENA 4L4VA 1FGNH 4J1UB 4YEFA 4X6FA 3KYKH 4M62H 5EBLB 3VXMD 3BZ4A 1UZ6F 4L8BB 4OUUB 1KIQA 2YWYA 3CCHA 3EFDL 3TH4T 4NZJA 1CE6B 3V52L 1MIMH 1Q0YH 5IMLA 2NW3A 1NGYB 2GK2A 2CLRA 3P11L 4ELKA 1EK3A 3L3DB 5HVWA 3L3JA 3BH8A 3WFCL 3P9LA 4UQ2A 4YXLH 2X1PA 4NP4L 3CUPA 2JJVA 2VXQL 5IB3A 5T33L 1CDGA 1R5IB 4JFEA 5CHNA 4JFZH 1T3FA 4QT5A 4K3JH 4ETQB 3ZHDA 3EDJA 4UTBL 3C5SA 2XWBB 1ETZB 4X5XA 5FUZH 2NLJA 4LBEA 2DDQH 5A2LH 4GAYA 4P46B 4HJGB 5ACZB 1O5DT 1DVFB 2YA2A 2AJSH 3F5WA 1I8MA 4N0CA 5DFWH 5A2KH 1GAFH 5C08D 1UZ8B 1KNOA 1NL0L 2ESVD 3MSPA 2JK5B 2K7QA 4P3WA 1HXYB 5L2KB 3QUXB 5D7JB 5KBNC 3O0RL 4NIKB 4P9HL 3HC0B 3PDOB 4PGEA 4OZIA 1RUAL 3OAZK 1PLGL 4NQDE 1Y6KR 4PRAA 5D1ZA 2X4QB 4YBLC 2FSEA 4UU9A 5D71H 1JGVH 1Q9WA 2XY1A 2F53E 3WMSA 4PJFA 4U6XA 4JN1H 2WK2A 4JPIB 1VADB 3KLHD 3SCMB 3HCVB 2HFEB 3BGMA 4HXAH 1DANU 1MCPL 4PYHA 4EIGB 3E3QA 3WDHA 2X4RA 4G43B 2KH2B 4KKBD 2CIKB 1MLBA 4WFHE 1J8HD 4XNYH 3TBVB 5E8PB 1NCBH 2OL3A 1G7HA 5TDNA 5DJ8A 3MACH 3UTQA 1KULA 1DBKL 4PP2B 1FAIH 1T21B 3O81A 3P4NA 1FV1A 3QO0A 4LQFH 1TTUA 2BNQD 4K23L 3BEWB 3W0WB 6FABL 1NDGB 1P7HL 3GI9L 1ZMYA 4QRRD 1I9JH 1J8HE 4WW2C 43CAB 1QNZH 2BNRD 3GBNL 4NRZA 2R8SH 1ZEAL 5LKNA 2E8YA 1MRCL 4LMQE 1A1NB 1AHWA 1U8PA 5L7XH 2E5EA 5GJTH 3T8XA 2ZPKL 1TQBB 1TLKA 2W59A 5D93B 1R6VA 4PJ9B 4JG1L 4DGYL 1E6OH 5E8NB 3BWAA 5FYKH 1RPQA 2FEDD 2HLAB 3HLAB 4QRRE 2BDNH 5CP7A 1IZKA 2PYEE 3WFDL 1V7ML 1PSKL 4UT6H 2X1XR 5FYJH 5HVFB 1YEIL 2ITDB 4WJ5A 1JZ8A 4LSQH 2OXHA 3BN3B 4WO4B 2JELH 3NZ8B 4G6JL 3U0TB 1KC5H 2AJ3A 1D7FA 4XWOC 4JFHE 5DMYA 3TIDB 4WW2F 3KLHC 4UB0H 4I48A 5IVXA 3MCLL 4JO1L 2NX5B 2CDGB 5C0CD 1B2WH 4YHYB 4F57L 2V2XB 2YN5A 2IAMD 5GRWA 4KKBC 3VGAC 5C0EA 4FQXA 5TF0A 3QHTC 3C08L 4HZLB 4OCYL 4RGNC 3ARTA 1XH3A 1AI1H 3H8NA 3CDGA 2DWEB 3IGAA 3OJMB 3RTQB 3QUMH 4XZUB 1LO3L 4MQTB 4F7CA 2IBGA 4M43H 2F54D 3OZ9H 5JDJA 2Q76A 5INDA 2HVJA 4ODUA 4P59L 1U3HC 3KJ4C 4NNXA 4P5MA 2HJKB 3K8LA 3KPMB 4QGYA 3RJQB 1MVUA 4GG8B 3WL9A 1U8NA 3GBLA 5JA9A 3BEVA 3IDYC 5BVJA 2DQGH 4Z77A 2FEDC 1EIBA 3OKYA 1A7RH 3BGAA 2VISA 2F5BH 5BZDA 4FQHA 3JV4A 4KI1A 5M95B 2HG5B 5EOCJ 1MEXL 1NAML 2VSDA 4X7DC 5TE6L 3E6HA 5ICZA 4KRPC 2C3HA 1OP5K 1LE9A 1QSFD 4J3SA 4HUWA 4AM0A 2FR4B 5CEXA 2FIKA 5F9WC 4HKJA 4U3XA 3DRQB 1ZV5A 3NCJL 3W81A 1GPOH 2CKBA 2HJFB 3EDKA 3I6KA 1OP3H 1U93A 2IAMC 3DBXA 1A4KB 1E4WH 2C3XA 1OGAA 5HGHB 1YYMH 3OPZL 2R2BB 2MOVA 2VQTA 1QSFE 4GUPB 4U1LA 3GGWA 1U0QA 5HYJE 3HR5A 3L7FB 5DD5H 4LHUB 3MRNA 4WHYG 3ES6A 4JFDA 3C2AL 1XZ0B 1F3RB 3OSKA 5C0JB 1FG2A 1UM5H 5ITFB 3EYQD 5IBTL 3MNZA 4LDLB 4GJTB 4BYHA 1A6AB 3ZKXC 5FHBH 1N6UA 4OCXH 1EXUA 5DMIH 4M48L 3T0WA 1EO5A 4JQIL 4N0RA 4KY1L 2V2WB 1KACB 3MROA 1LK3H 4KVNL 2UUDH 1HH6B 2AJVH 4OQTL 3VXMB 5HHOA 2HFGL 3AVEA 4XVJL 25C8L 1WVZA 2EDJA 1RFDL 1AR1D 5FM4A 1YNTB 1JIBA 1T4KA 5DK2B 4HKBB 4MVBA 3NIGF 2C4XA 5GISL 1UWGL 4NQXA 2P49B 3UTSD 4MDJB 4O2CB 4ZS7H 1F4XL 2R0ZL 5C6TL 3UXFA 1WC7B 4NKIH 1UC6A 2Z93B 2FX9H 3PHQA 4R3SB 3SOBL 1G0YR 3STLA 5BMFL 2OQJA 4CVZA 3TYFB 3VG9C 1T89C 2GJ6A 3UTSE 1SBSL 4P2QD 3BXNB 5E8OB 5E94A 4S1QH 4KTYA 4GAFB 1AIFA 5JXAH 5D7IA 3FB7B 5ETUA 3V4UL 3MUGA 4MD4B 3RWDA 2CUIA 1A14L 4KAQL 1DLFL 3EZJB 3VMOA 1XIWB 1WISA 4LLQA 5IW6B 3AROA 1O7VA 5D2NA 4P2QE 4HGWA 1L0QA 1ZSDB 3C6LD 3RJDA 5CINL 3FB6A 5BV7H 3K80A 2BSSA 1S3KH 3RAJH 1VKXA 2CJUH 3D9AL 1UKTA 2XA8H 1ES0B 1XGPB 5C08B 3OJ2C 3GBMH 3VWJD 1CWVA 2DTML 4K71C 1YQVH 1PBYA 2UZXB 2GFBB 5HHMA 1X7QA 1N26A 2F53B 4MQXD 3P40A 2A73B 4HKXB 4M7LH 5CBAA 2W60B 2MCG1 5DJYB 1AE6L 3TVMB 4JANA 4IRJA 3TEUA 1JYXA 2X9WA 4PRNB 3WIHL 2YSSA 1GZPB 4C55A 2HMID 4KUCD 4IMKC 4Q9QL 4XBPA 2XZAL 1XR8A 1INQA 2ZOKA 3DURB 4JY5L 3LMJH 2X7LB 4ZUTA 4W6YB 2NPLX 1KT2B 5HHXL 2ZSVB 3MOQA 4QRTB 3HR6A 5FUOL 4PJGF 2Q7NA 4KZEH 1VFUA 2G2RB 4MSWA 3TT3H 1EJOH 4IRZL 5H35A 4H26A 4EOWH 4Z5RB 1J8HB 4RSVA 1CF8H 2FH8A 3GRWA 2DQFA 1NFKA 2WBWB 3EBAA 5E0QA 2VDQH 1CGYA 1G1CA 1HQ4A 1BM3L 2BVQB 1TJIL 2H2SD 1U36A 4JJ5A 3KLAB 1NLBH 2Y36H 4QRRB 3NMEA 1V05A 1EEZA 2BNRB 1B0RB 2BERA 1P2CB 5JXEC 4V1DD 1P7QD 5MEPB 3KJ4B 3MGTB 2BY0A 1WV7T 3MRJA 4JKMA 4Z18A 1U91B 4MQXC 5FAAA 1K6QH 3RQ3A 2EDEA 4U7MA 3B5HA 4HWBL 4P5TD 4FZ8H 4YHNA 4QRSB 5H94A 3G5VA 4K7PH 1NCUA 4O02H 3IDUA 4NHCL 1YNLH 1RZJH 1DUZA 2X9XA 2BVEA 3PWUA 5C0BE 2QSVA 1A7NH 2ICES 3EOBA 4YPJA 2GTZB 3K7UA 2FWOA 2AV7A 3LRHA 1ZHBA 3MGAA 3IDIA 1RZFH 5CIPH 3QFJD 1CLYL 5JR1H 3V0WL 3C60D 4QHKI 4MQ7B 4LGPB 5GGQH 3AGVA 1LEKA 3GHEH 1A7QH 5C0CB 3CFEA 3JV6A 4MB4A 4JM2B 32C2A 4Z7QE 5C2BH 3O9WD 2H9GB 3QJFB 1X3DA 2EYTB 1AQDB 4J4PD 1BF2A 1WBXB 3MRPB 3QFJE 4MS8A 2VXSH 1CFBA 1EJ6A 3ARUA 5B39A 3MLRL 2H2SC 3IDMB 1KJ2H 3DPBA 5DT1L 3ARDA 1U8MA 2WW8A 2AJXL 3QUYD 4ZOEA 4XNZB 2MCPH 4BZ1H 5I8EA 3R06A 4J6RL 1RMFL 3RDTA 1JGEA 3WNPA 1ZGLA 4YDVA 2EYSB 3QXWA 1HWGB 3PGFH 2O5XL 1FYTE 3MRIA 4XMLL 3CX5J 1WAAE 1JHLH 1FBIL 3OB0H 2P8PA 3B2VL 4K7PY 4OLUH 3T0BA 1DFBL 4OKDA 3O45B 2R69L 3FO0H 4NFDA 3T0EA 4S0TD 1MRDL 2ZG1A 4X83A 4GKNA 3U0PA 1FL6B 4XC3H 3A6BH 4C4KO 5A3IC 4I2XE 4L8SC 4CW1B 2W9EL 3UBXB 1QSFB 1U6AL 4WFED 4KQ4L 2DLEA 3DRTB 4OIBA 3BUYA 4X5WA 5HYJB 2YPLE 3FCTB 5F7EH 2DQIH 3RWFB 3C60C 3WXWL 1QA9B 5T3XE 1HHKA 3VRLF 3ARBA 4LPXA 4PD4K 4Y4HD 3V5DA 4JEGB 4HH8A 1AO7D 1ND0B 1ZTXL 1KEGL 2ADGB 1J05A 2IANA 2DLHA 4KKAD 3QIBB 4U1SB 2P48B 4MNQE 4WNQA 4J4PC 2WIIB 1NSNH 3S96A 1CE1H 3P0VL 3TF7C 2P5WD 1OSZA 1HE7A 4IS6A 3CFDB 3WFHA 1W0WA 3W5NA 4Z7QF 1GCFA 4NO2A 4BH7B 1QSVA 3DMMA 3OKMA 1WWCA 2D31A 3QUYC 4QRUB 5HHVL 3CLFL 1T5XB 3B9DA 3MRLB 1CTNA 4UILL 1KXTB 4HF5H 5FOJA 3MREB 1YPZA 1MOEA 3QCVL 2V5RA 5MEND 4UT9H 2JIXD 4M7JL 4L9LC 1KCRH 2O5ZL 5EOTB 4PJXA 1BZ9A 3MXWL 4XNMA 4AL8L 4PGZA 1YN6B 5FYLD 1JPSL 4MAYA 1CXKA 4BQBA 3QB7C 2X4PA 3UTSB 3GSRA 1A9EA 4L29B 1MF2H 3KPNA 2H2PD 2FHCA 5JO5B 1WAAF 1GGCH 5FGSA 4PG2A 5ABDE 2VAAB 3WYRA 3MCKA 3QQ4A 2CK0H 4UTAH 5FYLE 3ALPA 1A1OB 2EC9T 4OBSA 2CXKA 3U2SA 4P2QB 1FLTX 2I9LA 4Y4HC 4DUVA 1X5YA 1MJ8H 3MO1B 4KC3B 1PG7X 4R90L 4V3DB 4KKAC 3EYFB 1FPTL 4HKZB 1KCVL 3OBAA 4OLYH 4JFED 5IFJB 2NY2D 3FQTB 1F4WH 5D8JH 4BKLB 3K4DA 2DJ4A 5C07A 1BD2A 1IC5L 2FGWL 5HGGS 4NHUA 4FXKB 2X4TB 3Q5YA 2CXGA 2HT4C 5B4MC 3PHOA 3F65A 1T1WA 1G0XA 3FTGA 3C6LB 1U8JB 4PGBA 2F5AL 4QHUB 4KZDL 2AKRB 2XY2A 2EC8A 3ECBA 4N0CD 4PJAA 5B38B 4ZO9A 3VWJB 1X5KA 1CDJA 4E41E 1YDPA 4UUJA 4RAUB 4Y1AA 5GGTH 2VUOA 4NKQB 1MFNA 3MUJA 1PZUB 3INUL 3U83A 4RMRA 5DO2D 5FEBA 4JDZA 4LVNC 1P6FA 3SN6N 3LAFA 5D1ZD 1QFWM 3GDBA 2H2PC 1O7SA 4ONGL 4LU5H 3GMLB 2VITB 3QZWA 3L6FA 1QO3B 1JTOA 2EXWD 1XGTB 2EDYA 2EE6A 4ODBD 4NQSB 5J12C 4ZNCD 4IDLA 4WHYH 1OARH 3EDFA 4MXWL 2NY2C 1QR1A 4R7DB 4I1NB 2DD8H 5GGVY 1X5FA 4ZPVA 5DUPL 1HHHA 5CGMA 3SDXA 2BX5A 2K7PA 1GGBL 4LLDA 1HQRA 5SX4H 4D2NA 4P4RB 3M1BB 4JR9H 4Y2DC 5KS9E 4NWUH 4MCYA 1T22A 4MYWB 5EZLB 1TPXC 2AV1B 3MYZA 2VUYA 1JTTA 1IBGL 5C0BB 2BCKB 3D85A 1P7QB 3GJFA 4JB9L 1DBBL 2FNBA 1JWSA 1D5IL 5D96C 4P5TB 2AK1H 3KYOA 2XWJA 1SVZA 4YZFF 4Q9RL 3WN5B 4U1IB 2E3VA 4JGUA 5DVLA 3MOBH 2V9RA 1RSFA 1FVCB 1KN4L 4LCUB 5D1ZC 1D6EA 2GT9A 4C4KT 1KF9B 5TDOA 1CBVL 1AJ7L 4CMMB 4ONOA 3DTXA 3IFLL 4U6YA 1X5ZA 4TUOA 1MUJB 4HFUH 4QRPA 3QFJB 1GC1C 2EXWC 1JFMA 5C09E 5JA8B 4YHIA 3LS4H 1YNKH 3MNWB 4UV7L 3E3QC 1Q72L 2P47B 5EIIB 4LSUH 3O9WB 4X6DA 2PXYC 2Z0BA 1FFPB 2GUOA 4FQXD 2P5EA 1FNEA 2EDLA 4OZIF 5KN5B 4LAQL 3LKRB 2E7CA 3EIFA 5HHNB 3VMPA 2X4OB 1T1XA 4GOSA 5IW3A 1FYTB 5DRXB 3MLYH 5AAMA 4NO3B 1R3LB 5J13B 4DZ8A 4PJFF 2PO6C 1I8LA 3NABH 3I6LD 1OTTD 1H5BB 4F8TA 4ZFGH 3CFKB 5KS9F 3QDGA 4TVSa 3KDMB 1AHWC 1M6OA 3HNTL 5MERB 3T65B 3F58L 4I2XB 3GMNA 2BHZA 1G7LA 3BFOA 2MFNA 3C5ZA 4L9LB 4HS3B 4OF8A 3LQZB 4Z7WE 4CN6A 1CD8A 1EEYB 3MRMA 1WITA 1UM6H 1VENA 4LIQL 3AS0A 3VU2A 4BSWA 3BP4A 3RL2B 2QQLH 3FL7A 1G6RL 2A83A 2AJYH 2XKUA 2QR0A 2CGRH 5IG7A 2FYYA 4WFFE 5JLZA 5KJRH 3IS0X 5AWNH 4L8CB 3P0GB 4MNQB 5F7YC 1ORQA 4ZUWA 3ZDXE 4G59A 4HS8H 4I77H 2MHAB 2NNAA 5IBLD 4LGSB 4PRDA 1FZJB 3VFUB 1F45A 5I18L 1AO7B 3ZDZE 1OGAD 4X98A 1FG9C 4FQXC 2G5RA 4BSVB 5J89A 5D9SA 5FA4A 4QOKA 3CSBA 1C7SA 2P5WB 3KPLA 4XP5L 1X5LA 1F11B 5IB1A 3MRQB 4PGDB 1DN0A 4JFDD 1S7RB 1MCCA 1INEL 1LDPL 4U4BA 4PYGA 2IPKB 3WUWG 3IAGC 2Y07H 4FP8L 2AXHA 3JUZA 3DVFA 3QCUL 3CH1A 4X7TA 1F4AA 1MCRA 4QNPF 1EHLL 4NJ9L 5FGBA 3MNVA 1SQ2N 2JIXB 4LCIH 3WLBB 2XZCH 1A5FH 3QXDA 5HHOD 2F58H 1FO0H 4NN5B 1QBMH 4XPAH 5C0IA 1KIQB 4MVBD 4OLWL 5IB2B 4LOUD 4TQEH 3Q3GA 3BKML 4K3HA 3GMOA 3UYRL 4WW1B 4CN4A 3WNNA 1DBJH 5I15H 3MJ9L 4HIHA 4FQJL 4OFYA 4EXKA 1ITBB 4OT1L 5IMLB 1P7KA 3KPSA 3H0TA 5CCKL 2Z92A 5HHOE 2FDBP 4I3RL 4FQ1H 4DCQA 1WFTA 5C0FA 3L3JB 3BH8B 5IBLC 3MZGB 3P9LB 4L3EE 4B53A 3NAAL 5JORB 4XVTH 2GJ6D 1JHLL 2BVPA 4U0QB 4UQ2B 3V0VA 3HG1E 5GZND 4NQEA 5TGBA 3TPUE 3CUPB 3O6ML 2X42A 3W11C 5IB3B 2DBLH 1IGFH 4J3UA 5CJOL 3ZDXF 1RHHA 2NY2B 3EO0B 4OF0A 5IR1A 4E41B 5IQ7L 5IW1A 3ZHKA 3U9PL 5T1DL 3BT2H 3H9YA 3C5SB 2GJ6E 3QDJA 4X5XB 2NLJB 4F9LA 5ACLA 3U4EA 4L4JA 4GAYB 1NJ9A 1TPXB 5ISZE 5K9QI 1D3CA 4E5XA 5CKGA 4EI6A 1VEMA 1KNOB 4NCC1 5I16A 4WGWB 4PS4H 1BVZA 1TMCA 1Z2KA 2UZYB 5HHMD 3HPJA 5HYQB 1VEOA 4OJFL 4U1HB 2A1WH 4QHMA 3B83A 3SEPA 3PNWA 3GZKA 5FUCC 1ZLUH 4MVBC 3T1FA 4LOUC 2XACC 4IRJD 3ZKSD 4OZIB 1ZLWH 4H1LG 4YUEL 4PRAB 4RQQA 3V7MA 2ZCKL 4DVBA 3RY6A 5TE4H 3F7PC 4UU9B 5HDQL 1J1OH 4HF5L 1OCWH 1Q9WB 3SKMB 4LCWE 1MWAL 4PJFB 3QXVA 4KK8C 3X14A 1GVIA 1WEJL 3BGMB 2VJXA 3CDYA 5GZNC 3VA2C 5KS9B 5DC9B 4ETYA 4FFZL 1IGCH 5DWUL 1OLLA 1BQHA 2I5YH 3MPCA 3HNVH 4Z7NF 1QFWL 3QDME 2V7NA 3AXLA 1KCLA 1MIEH 2OI9C 3GSXA 1MLBB 5E99H 5LGJA 1G7HB 5TDNB 4HMDA 3X12B 5DJ8B 3UTQB 3UPRA 5D2NC 3EFFA 3O2VL 1FV1B 3QO0B 5CMAA 1S9YA 5JHDE 1ZHNA 3U0WH 2AEPH 2EH7L 2PCPA 4NKMA 4FQPA 4P3CH 2IBBA 3LKOB 3BIAX 4NRZB 4TVPH 5DMKB 5AZ2L 1IAKB 5AD0A 1DQJA 1LEIB 2VLLA 4NKOB 3S6CA 3UZVB 5GGVL 3GSOA 3QEGL 1AHWB 1U8PB 1WUNT 5D8JL 3T8XB 2VQ1A 4LPUA 4HT1H 5FKAB 1RK1B 4HWEL 5HGDA 4JDVA 5DJAA 3BWAB 2A6JA 4IRJC 5FYJD 2OJZL 3LDBC 2VDRL 1JUFA 1ZK9A 1A21A 1I9IH 1QQDA 3FB8A 3NN8B 1HSBA 5DD3H 2Z9TA 4M8VA 1IM9A 5IM7A 4XH2A 1F6LL 1UQSA 4JLRA 5I0DA 2AP2A 3JWDH 4PJHE 1CICA 4TOYL 1UH3A 1E27B 4BQCA 5JHLL 4Q9BA 2UWEE 4WHCA 3BE1L 3V7AE 5C0EB 2IG2H 4R2GD 1IQWL 1K8IB 1LP9A 4CGTA 4M5YL 3NCYS 4ZS6C 1XH3B 3BHBA 4MS8D 1MJ7H 1I1RA 1MFDH 5D70H 4QTIL 5LWYL 4M61A 4PUBL 3KR3H 4S1RL 3QQNA 1OAUH 3ARDD 1UYWH 1RZKL 2DLFL 3O3EA 3R1GH 5KSUA 2Q76B 2HVJB 3BMVA 3A67L 4ODUB 5ADOH 1CVSC 5CBEA 3WIFA 3UO1L 3HTLX 4WEUD 1OB1A 2R0WL 5CILH 1MVUB 1U8NB 3OG4B 5ICXB 3BEVB 2ADIB 4JZJB 4MZ2A 1CK0L 1AC6A 2PUQT 2VISB 4RFOH 4GXVH 5BZDB 4FQHB 3F8UB 3NZHL 3T0ED 4PLKD 1A6TA 4A2LA 2VDNL 2W91A 4LSSH 1RI8A 3QFDA 4PJEA 1FDLH 3LSOA 5CEXB 2FIKB 2XICA 2VDOH 3PP3H 3G9VA 2F19L 4YDJA 3SKNB 4XVUC 1T2XA 2ZCLH 3HN3A 2CKBB 1N0LA 3HZKA 4E42A 5MI0C 4ONHA 3ARBD 3CLEL 2HJLB 4JM4L 3ULVL 1CLOH 5GGUB 4TSCL 4R2GC 3WIIH 5E9DA 2IAND 4HH9A 5IOPB 1ZAGA 3OR6B 3MLWH 3V4VL 3QG7L 4HX1B 4RCAA 1LILA 4MS8C 4XAWL 2VH5H 3HR5B 3MRNB 3QXAB 4LL9A 1T5WB 2RR3A 2UWEF 3ES6B 1S5IH 4N9GA 3PGCA 1FNGB 1E4XI 2EIBA 3ARDC 4R7NA 1FG2B 2H1PL 3DMMD 3QISA 5F7NC 3WBDA 2F8OA 1A6ZA 1DQDL 2NXZB 3D87B 3GB7B 1KJ3L 3MJ6A 5F1KC 4K3EH 5FA3A 1J5OH 4OZ4B 3RDTC 5JW4R 1TDQA 3DUSB 1T0PB 1CLZH 1H3PH 5LAXA 3SY0A 2D7TH 3MROB 4HEPG 1II4E 1DZBA 2PKDA 3BN9C 1TITA 5HHOB 2XN9E 3RKDD 3W39A 1CU4H 1CD1A 1T4KB 1HXMA 3W2DH 3ILQD 4HIJA 2DQCL 1ZHLA 4MAYD 4L3EB 1C8PA 3X13B 3T0EC 3HG1B 3LCYA 3TPUB 4PLKC 2PN5A 4G9FE 1QFPA 4G6FD 2VKXA 4NM4L 5DHXB 4PJXE 1TCMA 4UINH 3TH3T 4FFYL 3V4PL 5AUMB 3Q6FA 1M71A 2GJ6B 3ARBC 4M7ZB 1SYSA 3AMLA 5E94B 4Y2OA 4N0UA 3MR9A 1IRAY 1NAMA 4LF3A 5K33A 3SGJA 5K59E 4K2UL 3RWDB 4JRYE 1HZHL 3QXUA 1MCJA 3L3IA 3TN0A 3S9DB 4IRSA 5C07D 3ZMRA 4WCYL 1AQKH 3AS1A 3B4NA 4YE4H 4AT6A 5KZCD 1Z9MA 1OOAA 3DMMC 1CD9B 5IROC 5I1GH 5EIVA 1S7WB 2BSSB 4LK4A 5GS0H 3HZVA 4DOHE 3ZL4H 4JFOB 1LGVA 4N1CA 3QCTL 2X4NA 2YD6A 3CVHH 1CDYA 4ORGB 2DB8A 5JUEH 3ZKND 3LKSA 5L9DH 5JDSB 4L8DA 3GFUA 5DJCA 5HHMB 1X7QB 1VPOH 1UEYA 2G5BA 2OP4H 4Y1AD 2AQ3A 4Z6AT 2X6MA 3EYSL 3DJ9A 2Z4QA 5JPNA 1WLHA 3ILQC 1ADQH 2C1PA 4OKVB 4P5KA 3E2HA 1NMAL 2YSSB 1C1EL 3GSNL 3VI4E 4C56A 2Y07L 4I9WD 4R9HA 3G6AB 5D1QC 1XR8B 2ZOKB 2VR5A 4XWGH 4GRMA 4PG2C 4ZUTB 3LS5H 4N8CL 2CKNA 1MHEA 3UTOA 5DS8A 1ZWIA 5C86A 3IETA 1CL7I 4OGXL 5E6YA 1YMME 3FRPG 2FJFA 2FHFA 3IU3A 5DQDH 3SE9L 2NTSP 4PJXF 5JMOC 5H35B 1G84A 2H3NB 1U8KA 2GJZA 2GSGA 3BPNB 2BVOA 5J3HD 3RBGA 4BJLA 4RRPG 1TVDA 5KVDH 5TQ0L 3VXOA 1T0MA 2B1AL 5BV7C 4LKXA 4RNRA 5GZOD 3LEVL 3D2UA 2V6HA 4ZOBA 3CZJA 4UNUA 3HS0A 3AREB 1HHJA 1IQDA 5FCUL 1F3DH 2AQ2A 1EEZB 3CXHJ 2PW2A 5CJXA 3V6OC 4U1NA 4F7MA 5CJQL 3IDNA 3MBEA 1QACA 1GZQA 2CDEA 3D85D 3SDXE 2QQNH 3ZKNC 4GMTH 3QYCA 5FK9A 3U1SL 3PJSA 3T2NH 4OI9A 3G6JE 3LQAL 3V8OA 3G5VB 4D0CA 1J88A 1NEUA 3MA9H 4PJHB 3OAYK 1IC7L 1FFOA 1DUZB 1T03L 3NCFB 3FN9A 1I1AB 2YA1A 3X3GL 3HI5L 2UWEB 3I85A 2FWOB 3FO1A 2R0KL 3QA3A 5GRUL 2AV7B 2XG4A 4OIIL 4TSBH 2LTQC 3P4OB 2PTUA 4QRPD 1MREL 2A6IA 1CGUA 5C0NC 1P84J 4OF5A 1KLUA 3BSZL 2WSKA 4OQ1A 1U41A 2FO1A 3FKUS 4JRXE 3CFEB 3JV6B 5DVMA 1FQ9C 1X6NA 3A6CL 4NZRH 1FYHB 4JPKL 3WIHA 32C2B 3ZKMC 4Y5VB 1OW0A 3D3VE 5E2JA 4R2GB 5D7LA 5J3HC 4XP1L 1B6UA 1G7IA 2P5ED 3QQ9D 5GGSY 4WENB 4MA3B 4FXGA 5B39B 3AAZB 4OZFA 5E5RB 3K4AA 5EC1A 1Q9LB 5IWLA 3ABZA 4LLUB 1A7PH 5E2VL 3OB8A 5JW4M 1HSAA 1DQQB 2PETA 1KYOK 1BQLH 3R06B 4O51A 5FCSH 4CMHC 1RUQH 4KXZH 4L1DA 2DF3A 4QTHA 2XRAH 1S7UB 1ZGLB 3E8UH 3QDGD 4X7SL 4H1LH 5DJXA 4YPGB 1CXIA 3MRIB 3C5ZD 3ZZ1A 3OKLA 4OF7A 2VABA 1D6VH 1RURH 1BIIA 1K5NA 3SDXF 3REVA 3DYPA 2QSCH 2XZQH 3T0EB 3O4OB 3U0PB 2APVA 3TBTA 1DE4A 1NFDA 2VC2L 5DRWA 1HINH 4L5FL 1H0DA 3NGBC 3EO1A 1NANH 4U6VH 4IM8A 1B0GA 4M6OH 5FB8B 5E00A 1JPST 3LHPL 4HWBA 4OV5A 4LHUG 5C2UB 1MAML 1HHKB 4PB0H 1C08A 3SDYL 2FECL 1PEWA 1LO2H 3V5DB 4Z7UE 3BP5A 4NQVB 4XNUH 3FAXA 3HI6L 2IANB 1FIEA 3IDJB 2FJHA 4WNQB 3QQ9C 2Z91A 1TETL 3S96B 4GBXC 2GAZA 4QOKD 5DD6B 2JJTC 4IS6B 5DRNA 3P4MA 1B6DA 4EDXA 1MFAL 4WTWA 2RQ8A 5CD5D 1TZGH 1S7XA 3DMMB 4YHOH 4NFCA 3R4DA 2D31B 1XCTB 1W0YT 4XCNA 2EC9U 4JE4B 2NY0D 3SJVE 4G9FB 1EMTL 3OMZA 2CPCA 1S9VA 2L7JA 5E2WH 1R5WA 1YEJL 4PJXB 4XMPH 1V3LA 2OMBA 4H5SA 4JFFE 4HWNA 4XNMB 3U7WL 4MAYB 2NR6C 5M94B 4RBPH 2X4PB 4LRIC 2JCCA 2VDPL 2ARWA 3GSRB 3TCXA 1A9EB 1CS6A 1F3DJ 3HMXL 1I4FB 4OFYD 3KPNB 3LN9A 4FS0A 4RWYL 4G6FB 5EZIH 3TNNB 3I2CH 4M3JA 3KPSD 4M7KL 4G3YL 1R5VB 4JRYB 4IDJH 5DTFA 3MCKB 4V2BA 4DGIL 4HS6A 5I17A 1MNUL 1DN2A 3CXDH 3U2SB 1F4HA 2I9LB 4OCLC 2B4CC 5T3ZH 1M7DA 5F8RC 3ULUE 4RFOL 4NQED 3ME0A 3O2WL 4LP5A 1AXIB 2GW5A 3NIFE 2UZIH 3M07A 3ARXA 1FRGL 5ID0A 3BDBA 4OCRL 5C07B 1Z5LB 3AFLA 1IILE 4MJIA 4TYUA 5D5ME 3BPCB 4NHUB 1C7TA 3DO3A 5CD5C 3PHOB 2ZUVA 1DEEA 3TO4B 3FTGB 5KZCB 5GIRA 3QDJD 4H0IA 2NCMA 2I25N 4KDVA 5LGHH 5F1NA 3ECBB 3CVHA 4HQQH 3HNSH 5TH2A 2VL4A 1NMBL 2V9QA 4MJ2A 3MV7A 5FGBC 1YDPB 5KVGL 4NN7C 1QZ1A 2EZ0D 2DMKA 1CR9H 4Q2ZA 1FSKC 5GSVB 3BP7A 3P30H 1PW3A 1N6VA 4X6BA 3MODH 3G6DH 2BP3A 3WFBL 4JDZB 4WY7L 5M7QA 3TV3L 3CK0L 5BS0E 4DN4H 5A16B 1WWAX 4U1JB 1KCKA 2DQHH 1UB6B 4KVCH 1CLCA 3U4BL 1G7QB 3QZWB 4QRQA 3PXHA 5ILTL 2YPVH 5I75C 4G7VH 1I3RB 3LPFA 2OS7A 5C0GA 1RJZA 4XC1H 3K1KC 3E1F1 2KKQA 1B4JL 4OLXH 4ZPVB 4F7TB 4S2SB 2ZJSH 4RGOL 3SDXB 1AH1A 4LLDB 5TDPA 2BFVL 1FJ1B 3O11A 4XHQA 1YC8A 5K9KA 3NIFF 3O41A 3G6JB 4MCYB 5ITBL 4Y5XB 3H9SA 1TJHH 1U8IA 3LZFH 5F1OB 4Q97A 3S8WA 3WKNA 1KIRB 4DTGL 4LPCA 4HCRL 3BQUD 3D85B 3GJFB 5E95B 5ALBH 1JWSB 4ZPTB 5EU7C 3WNKA 5KVMC 3NFNA 5C0AE 3RUGE 2BZDA 1UWEH 4JDTL 2ICEA 1QRNA 3KYOB 3MRBA 4ZAKA 2XWJB 1T04A 1QPPA 2HH0H 1YA5A 4P23A 4R0LA 2W9LA 1D6EB 2YD2A 3RY6C 4XB7A 4HJ0D 5J57B 2Y7QA 1QUNA 4TUOB 3CJJA 5ESVA 4HWZA 4HEME 1CFTA 5DD0L 4PJ5A 1IM9D 3G04B 1VPOL 2GSIA 4DKFH 2ICWJ 2EECA 2XTLA 5EULV 12E8H 4YHIB 5I1EL 1CICD 1ZS8A 4K9EH 4PY7B 3U79A 2R23A 4JY4A 1HWHB 2FATH 4FTVA 3TYGH 2P5EB 5CP3H 4LGRB 3WNOA 3HE6A 5C0RH 1CZ8H 4ZTPL 4YDIL 4GKZA 3FQUA 2FX7H 4JCMA 3QUZA 3PXJA 1T1XB 1E28A 3RL1B 4OZHE 3SO3B 2ZOLB 5A2FA 1CIDA 4OF3A 3WJJA 1FFQA 1UFUA 1CFSA 1NCWH 3O2DH 4DZ8B 1S5HB 5DSCA 2XFXB 1FVEA 1HIMH 4JREC 3RVTD 5TE7L 3S35X 1BHGA 3ARVA 1A6PA 3QG6A 5BJTA 1Q8MA 3QDGB 1M6OB 3MRGB 4EUPA 3GI8L 3WJLA 4CJ0A 4C83A 1G7LB 3B3IA 3C5ZB 3UBXG 2WINA 3MGOB 3QHZH 2B1HL 1RD6A 2MQ3A 4YHKL 4HW6A 5SX5H 2Q86B 5GS2H 4Z7VE 4BSWB 3BP4B 3JXAA 4F3FA 3BISA 3RWIA 2A83B 5IJKC 5FHAL 5DJDA 4HJ0C 4X6EA 3AS3A 1OP3K 3S36L 1U8QA 4V2CB 4Z7UB 4ODSL 5IG7B 4DW2H 2FYYB 4ENED 5JLZB 4LSRL 1IJ9A 3P73A 1D5MB 5T3XL 5KANI 4PLJD 1ORQB 1OPGL 1N4XL 1YYLH 4HG4J 1OSPL 1XF3A 4P9HC 1FORH 5EU4A 1BOYA 2NNAB 3VGHA 1CICC 3QIWA 1HEZA 4H88L 4PRDB 3ZDYE 3ARPA 3F62A 3DGGB 3MRKA 4X98B 5BZWB 3WDJA 4CVXA 5E9DD 1IARB 3ARFB 4MGXA 4ODTL 2YRZA 5F89A 1NCNA 3SJVB 3KPLB 5IUSA 4N5EC 5HD8D 1F8TL 3KNBB 1YEGH 4WI2A 4XXCA 1DR9A 4ZD3L 4RFNB 2GIYA 3BW9A 1UB5B 1MCIA 2UUDK 4IEFB 3SKJL 4JFFB 5EZOL 4Y5YB 1HHGA 3SO5A 3DHJA 2CRMA 4YWGH 2NY0B 3H3BC 3K2MC 5IFAL 4HAGA 1ZE3C 2M1KA 3KYMB 3MNVB 4LVHC 1UKSA 1YUHA 2OK0H 2ADFL 3WXVH 3IKCB 5C0IB 1C5BL 1D5ZA 4H20H 1SEQH 4HULB 3KJ6H 1CD0A 3GMOB 1U92A 4W4NA 4HIHB 4NM8L 1XF2B 1R3IH 2VDML 4X99A 3S5LB 3WD5L 1P7KB 3H0TB 2AI0H 2V5SA 3HA0A 1QKZH 1H3UA 1T20A 5E03A 1XT5A 4NQCE 3BH9A 3W9DB 3O6FA 3ZT7A 4X7CC 1RIUH 1KPUA 4OGYH 5I73C 1G6RA 2OZ4H 5GSRA 4G8FB 3PWVB 4IIQA 3L5XL 1CGXA 3X11B 4DQOL 3A6OA 1YC7A 3C09B 1RHHB 2UYLA 4YDLB 3MLUL 5EBMB 1DBMH 5HJ3A 5B38G 3BO8B 3OXRA 5I30H 5DEZA 4BZ2L 3TN0D 2HRLA 4CADA 3QDAA 1NUNB 1N64H 3NCBB 1KJVA 4MLIA 2UY7A 4EVNB 3PWLA 4C58B 2BSRA 1YEFH 2BXYA 1JGDA 5ACMA 3DXAE 4PJEF 1NJ9B 1NAKH 1XR9A 2B8OT 4N90D 2VLKE 4E5XB 5BS0B 2VLRA 1IMHC 5EPMB 5I16B 1C5CL 3ARSA 1TMCB 3L95A 2J8UA 5EO1B 1HNGA 8FABB 4S1SL 3VXTA 3D1MC 4N90E 3T1FB 3DSFL 2VSCA 3RGVB 4Y4FA 1IGTB 4RQQB 3TZVA 4ONFH 5CJ8A 1ZLSH 1P9MA 1RZ8A 4C56D 2FZ3A 4WDIB 3IAPA 4GXUM 2Y6SC 1QOKA 4ZXBC 3HAEA 4L9DA 5I1IL 3X14B 1WZLA 4J23A 3VGBA 3EOTH 5J06A 3VXPB 2X70B 4J1UA 1E6JL 1KCSH 3UJJL 2NY6B 1BQHB 1IKFL 3SGJC 1UH2A 3GSXB 4OUUA 5DGRA 2D7OA 4NGHL 5EU6A 2BRRH 4TSAH 1Z9OA 2ZUQC 5LGJB 3TN0C 4IRSC 4HUKB 5CEZE 3UPRB 1CE6A 5ANME 5C0AB 3BPOC 3EFFB 4XCYB 4Z78B 2G60H 1NGYA 5CMAB 1DTUA 3D2UD 1S9YB 3B43A 4M6NH 1BQUA 3L3DA 2ITCA 1FFRA 2DI9A 1LE5A 4KTDH 3BQUB 2VLLB 3JWOL 3MBED 2Q20A 2DQJH 5DUMH 3GSOB 4J7RA 4ZUUA 2VQ1B 3CSGA 4J3WA 2GK0B 5T5FH 3SE4A 1R5IA 1AY1H 4OB5H 5HGDB 4R8WH 3BYYA 1N0XL 3LRGA 4JDVB 5GRVK 4LARH 3FB5B 3I50H 1FNFA 1IGML 1KELH 2A9ML 2EE2A 1JUFB 4MWFA 4HUMB 1J1PL 4HQQL 1WF5A 1QQDB 4TPRL 1FE8L 4HJGA 2IEPA 1HSBB 2CIIB 5J6GA 5ACZA 1F90H 4FZEH 5SWSE 5CJ5A 4LASL 1IM9B 4XH2B 1UQSB 3U48A 4JLRB 1UZ8A 4D9LL 1BP3B 4YHMH 4OLVL 4OZHB 2AXFA 3LKPB 1CICB 4XX1E 2JK5A 4X4ME 5CLWA 2PTTA 1I85A 1G1YA 4B5EA 3QUXA 5D7JA 3QSKB 4IOIA 4GSDH 3HC0A 1UCBL 5CEYA 4WHDA 4HUUA 3BHBB 1MWAA 5LXGH 3GNML 2W0LA 4KK5D 5EWIL 3TT1H 4OLZH 3O2DA 4H8WH 5HYIA 4M61B 1CFVL 4I0KA 4MB3A 4JO2H 4KK6C 2A9NL 4HC1L 1GYAA 5KSUB 1EHXA 3SCMA 3OB0K 3HCVA 2HFEA 5CJXC 4M6AA 1V3JA 4HFWA 3MBEC 5I9QB 1RIVH 1BPVA 3S3JA 5GGRB 3Q1SH 5D1XB 1OB1B 3H6JA 3L1OL 4G43A 1GOFA 1NBZA 3TBVA 5E8PA 2YD5A 4JQXC 5B21A 4ALAL 5EU3B 2BRQA 1JNJA 5ALCH 3R0NA 1VGEH 4YNYB 3MRHA 1IEAB 3FRPA 1YJDL 1T21A 5F9OH 1A6TB 1V8HA 4HBCL 1NDGA 4EBQL 3JWDC 3QNXB 4PJEB 4AG4H 1JZ3A 3LSOB 43CAA 1AGCA 1WSST 4ZFOL 3GEWB 4RA3A 5J11C 1A1NA 1G9NH 5FDYA 4E42B 2X09A 4CNIA 4M5ZH 4ONHB 2AK4E 1E4JA 1PVHA 5GS1B 1OW0C 4QHLA 4PLNC 4HH9B 5MHSD 2VLJE 3HLAA 5TFSL 2QHRH 3VFTA 3UTPD 2D2OA 3OKEB 4P3DB 4WO4A 3PGCB 2J4WH 4CAGA 5IWLC 3U0TA 3GHBH 4P9ML 4XAKE 3O6KH 4GAGH 3N85L 5E70A 3THMH 1A6ZB 2F8XC 5F88B 1SY6L 5SX4I 3RX7A 3TA3A 5MHSE 3D48R 3UYPA 5DZNA 4YX2H 2NX5A 3SY0B 2FATL 5BRZA 5JZ7D 3UTPE 3UC0H 1AP2B 3D0VB 1CZ8L 4NSKA 3U9UA 1T83A 4OZGE 2RGSA 3PGDA 1CD1B 4QO1A 1EPFA 1A6WL 3QPXH 1ZHLB 2I24N 5FO7B 2DWEA 1BOGB 1W72L 4NCDA 3RTQA 4J3VA 4XZUA 4XPGH 2CLZB 4P4KC 1L7TL 4LSTH 2IMNA 3VG0H 3ZYJA 4F15C 1A22B 4KRLB 4AIXA 3LKQB 1JYWA 1TQCB 1XCQA 2JCCE 2DQDH 2KQMA 5CD3B 4GG8A 4LSVH 4JHAL 1JE6A 3MR9B 5BOPA 1E0OB 5EUOA 4LF3B 3VXSA 1CI5A 4O5LH 3KAAA 1RV6X 1PX3A 4OCWH 1RAMA 1CVRA 3EOAB 1UACL 2BVTA 3L3IB 2E7LA 4MJID 3PQYD 5I71C 3OKDB 4R4ND 1I7UB 5BXFB 2H32B 4AT6B 3ZE2E 2XA3A 2R4SH 2FR4A 3SDCC 1K8DB 1OVZA 2YC1B 4UQ3A 1Q1JL 3RP1A 2HJFA 1KN2L 1WGOA 2X4NB 4MJIE 5C3LD 4TTDC 3MV7D 5TQ2H 4R4FH 3LKSB 3PQYE 1G6VK 4L8DB 2BC4A 1ONQB 2COQA 4PV8A 2W1NA 4GRWF 4BFBD 4GUPA 5FYKE 3EYOB 3DETC 5JPNB 4OI7A 2C1PB 3L7FA 4POYA 4LHUA 3VCLA 3E2HB 1XZ0A 1J0IA 5I6XC 1G9ML 5KTEL 1JWMB 4OZGF 1P4BH 4LLYB 1A6AA 2VXTL 3DIFB 1JHKH 2QTEA 3JV5A 3IETB 4GMSL 4CBPA 1K2DA 2VXVH 3IU3B 4L3CB 5HY9A 2YD7A 1PKQE 1ZA3A 1VCAA 2AW2A 4DUWA 1NC2A 2YD9A 4K3DL 1LVEA 3CX2A 2DYPA 1YNTA 1EBAA 5DK2A 4HKBA 1U8KB 2GSGB 3CVIH 2O93L 1JVKA 3CD4A 3RI5F 2JCCF 2DQEH 4LPTA 4MDJA 4LHQB 5AG8A 3ROLB 1SM3L 1A9BB 4R4NC 3JZ7A 5INCB 3WKML 1G9EA 2ED9A 1MY7A 4DUXA 1IC4H 3HS0B 1JGLH 1X4YA 1V5JA 1YEHH 3H9SD 5IHZB 4XNXH 3TYFA 4JZNA 4FABH 2PW2B 4FQCH 3IDNB 3MBEB 1GZQB 2NY7H 4NZTL 3BXNA 5E8OA 1ROWA 3ZE2F 4ZFZA 4ZTOL 2FX8H 3NTCH 3PJSB 3FB7A 3H42L 5SWSB 2YXFA 4PRBB 4MD4A 5EORL 1QRND 4ZAKD 4Z76B 3GSWB 2KZ1B 4AH2A 3BI9X 1XIWA 4P23D 5FYKU 2N56A 4ESKA 1FFOB 2GYSA 4JY6A 4XPFH 1ZSDA 4F58H 3FO1B 5F3BB 5CAYB 3BDYL 3WS6A 4AENA 1ES0A 1XGPA 2A6IB 4NQDA 4PJ5D 1KLUB 1JGUL 3BVNB 4N1EA 4U1KA 3SE8H 1FGVL 2BVYA 3QWRA 4P2OC 2F53A 2YUVA 2A73A 2EXYD 5A43C 2HN7B 4U6HA 2W60A 4CU6A 1QRKA 3TVMA 5I1HH 4FTVD 2ED7A 1J0ZA 1LO4H 3X17A 3HE6D 4PRNA 4MNGE 1S9WB 2Z8RA 1GZPA 3GK8L 3QUZD 4OZFB 3BGFC 4KHTL 4F37K 4M93C 7CGTA 4NOBA 2NY1D 2X7LA 4Q0XL 1HSAB 2VLME 3BKJH 3P3YA 1Q9KB 1KTRL 5BVPH 5TF1L 3O6LL 4O51B 4QRTA 1JNHA 1ZT4B 4BM7A 2WWKT 2APBA 4U3CA 5E6ZA 2XTJC 4Z5RA 1J8HA 3QDHA 2EDRA 4ZAKC 1WJ3A 4P23C 3IJYA 4R0LC 1K5NB 4EQ2A 3REVB 4A6YH 5F9AC 3N9GH 3O4LE 5DR5H 2BVQA 1EAPB 4PV9A 1KLFA 4Y4KA 1AD0B 1EUUA 4M03A 2ORBH 3KLAA 1XMWA 2J6EL 5DRWB 5L6YH 4GS7C 3HZYA 2VLJB 2YZ8A 4QRRA 2PYEA 3X3FH 1B0RA 5C1MB 4WI9A 4KROB 4F15B 5I66B 1P2CA 1KENL 1OAQH 4Y19E 5MEPA 2P44B 3LB6D 1C08B 3LEYH 3QIWD 3V5HA 2CRIA 2EXYC 3NH7H 3P9WB 5JW3H 2ERJC 1QVOB 3FO2A 5I8OH 2E9JA 5EOQL 3QEQE 2Z91B 3HE6C 4DN3L 2BJMH 2GAZB 4UOJA 2CQVA 4P99A 1J18A 3QUZC 1RUKH 1MHPH 5HVHC 2GTZA 5IEHA 2HTKC 4KH2A 3WJJC 2X40A 2NY1C 3QRGH 1EA9C 4HPOH 4OZGB 4D0BA 4B7IA 3MBXL 4MQ7A 4UI2A 3MYJB 4M4RA 1J0HA 1RULL 4G8IB 3MOAH 3VXNB 3V6OE 1MI5A 5KSVA 4JM2A 2WUBH 1KUMA 3WJLC 1R5WB 2H9GA 4XP4L 3PWPE 4IJ3C 1CFQA 4LKCA 4Y88A 1K3IA 2CUMA 3ZSSA 1LWRA 3MV9E 3SGKA 1U42A 2JCCB 3UTZA 4GAJH 3IDMA 1RZIB 2R29L 3SDAB 1TJGH 4RMQA 1KFAL 2AVGA 4NUGL 4XCCL 5I1CL 4WEBL 3RIFK 5DTFB 3LN4B 2VE6A 3U6RA 3QQ3B 3CMOL 4R26H 3LB6C 2KUTA 3O6FD 5I17B 1VA9A 1MJUL 3KHOA 1J1XL 2QKIA 4WHTB 2D7NA 5GQBA 2MTPA 5AZEL 3UJIL 5FFLA 4KDWA 4KUZH 4OM1H 4JFQB 4PRHA 3UZEA 2YOCA 2P43B 1RUPL 1I1YB 1VGKB 2VB5A 4MJIB 4XXCC 5FGRA 1FCGA 2KL6A 4LIQE 3PQYB 4OD1H 4Z95L 2EEAA 3TO2A 3IXAA 1QSFA 1MFBH 4IHOB 4BUGA 3DRTA 5HYJA 3IDXL 5IT2H 5F1NB 1ZLUK 3VW3H 2IPUK 1QA9A 1N59A 1EO8H 2VLRD 1ZLWK 3CPLB 4IMLA 3MV7B 1OQOA 5KG9A 2ADGA 4U1SA 3QIBA 5E2UH 5CZVL 4X6BB 5BO1L 4R96A 2WIIA 3MLZL 5DD1H 2VTFA 4JZOA 1BAFL 5KOMC 3CFDA 2JJWA 3K74B 4J3OC 5DVNA 4Y4FD 4BQ8A 1ACYH 1PKQB 3TZVD 4BH7A 3WFEH 4GO6B 1Q0XH 4U31A 4FFVD 1T5XA 1A6UL 3MRLA 5JNYB 2GTWA 1MCEA 3D39E 5EZJB 5C71A 4QRQB 3MREA 4RDQF 5D2LE 1JYNA 1KSRA 3QUMB 3OAUH 1UEMA 5H2BA 3RPIB 4MA1B 2VZVA 1I3GL 1HI6A 1MRFH 5EOTA 4F9PA 1L9NA 4IIQC 1RJZB 3EHBC 3HMXA 4TULH 3L3KA 3FT2A 4NBXB 4WUUE 3VDCA 5EU6D 5DC0A 2R39A 5LQBL 1GRWA 3PL6B 1AKJB 3OAZH 4LSTL 3UTSA 1ED3A 2AGJH 2OTUA 1AXTL 2Q3ZA 5FYLH 3VG0L 2DM7A 3D18B 4L29A 3KYNB 2PR4H 1H8NA 3O11B 4M02A 5JO5A 4Y16A 5K9KB 4TRPL 1KCUH 1IAIH 1JNLL 2VAAA 3H9SB 1U8IB 2ATKA 1KTKE 3CMGA 4WI5A 5EU6E 5KVFL 4QY8B 4ZUVB 3ZSTA 15C8L 4FQLL 2Q3AA 3HMWL 3MO1A 3GIVA 2XI9A 2ZKHL 3V7AG 4MD0B 2ICEB 1OAXL 5IFJA 3MLSH 4YFLI 3MRBB 3FQTA 4ZAKB 4BKLA 5GRXG 4P23B 1K4CA 4R0LB 1J86A 2X4TA 2XQBL 3VA6A 1F6AB 3TZVC 4NOFA 1P9MC 3C6LA 5CUSH 4EDWL 1U8JA 4JPWH 2O5YH 2Y7QB 5EBGA 1F13A 1ZT1A 4QHUA 1Y6MR 1BFVH 4GS7B 2FB4H 5ESVB 4JO4L 4HWZB 4U0RC 1CFTB 1INDH 4PJ5B 3C5JA 5K93A 2YHGA 4FQ2H 1NUGA 3TBYB 1FCCA 1FL3A 5B39G 3RHWK 4KFZC 1ZS8B 3T1WA 2ATPB 2J8UF 3SQOH 1ZANL 1SJHA 3QUXD 3OKNA 5D7JD 4LLMB 2R23B 4JY4B 2Y5TA 4FTVB 5D2LF 4PJ7E 4N0YH 1TENA 3J7HA 2DIJA 3BKYL 3M8OL 1XGYL 3B9AA 4DVRL 3FQUB 2A77H 2XXCB 3QUZB 3FT3A 4AIZB 3T3PE 2NZIA 4O4YL 2Z8VC 1GSMA 5FF6A 2JTDA 3GMLA 2VDKL 4HPYH 4KPHL 4J3TA 2UV3A 2VITA 5B3JF 1FVEB 1QO3A 4DKAA 4Z8FL 1IC1A 3SCMD 1FLRH 1XGTA 3ZE1E 3PIQB 3SHSA 5GHWH 1GC1H 3JV0A 3MLVH 5BJTB 3CC5B 5DURD 4FN0A 2GITA 4ZO8A 4EUPB 3HC4L 1WTGT 3SE4C 1P4IH 3B3IB 4GQ9L 4UT7H 4NBYB 3WFZA 4D3CL 5FDWA 2X2YA 2Z35B 5F7LB 3PP3K 5F71A 3TC9A 1YEKL 4KQ3L 5T1LA 3RWIB 1YEEL 1X4XA 4P4RA 5DJDB 4N68A 1FNAA 2EDOA 4HCRA 1ZOXA 2R9HD 2DQUL 4FABL 2NZ9D 5EZLA 5L8KB 2Q7YA 4XBGB 4K94L 1DVFC 4OSUL 4DJMA 1WZ1H 1YMHA 3QEQB 1NCAL 1ZLVK 5DI8B 5C0BA 2IGFH 2CRZA 5B3NA 5EU4B 4KTEH 4EI5A 3H9ZA 1UJ3B 2E27H 3QIWB 1HEZB 1I85C 1A0QL 1LO0H 3QUXC 4XPTH 5D7JC 5CFHA 4M9PA 3IFOA 5LCVL 5T1KA 4PREA 4CVXB 3L5WB 3EJZC 3WN5A 4U1IA 2PYFA 4ZODA 3ARGA 4ZOCA 4FNLL 1FVCA 3MQIA 4YR6A 2L4OA 3LIZH 3FN0H 4WFGE 4WO4D 2Q6WB 3NFSH 4PJ7F 5HHPA 35C8L 2Z31A 1TNNA 4PRPE 1HHGB 3QFJA 4HD9A 3GSVB 3SCMC 4I3SH 3TA3D 2ZUUA 5L88H 2NX5D 4G6ML 4XI5D 3QI9A 5E5UB 5BRZD 1D5BB 4UIKL 4HIXH 1PG7L 3O9WA 5DJ6A 3K2UL 4FQIL 4QXGH 2VXUH 5HI4D 4XBEL 3T0AA 5K9JH 4K55A 4Z0BH 1GGIH 3ZKQD 3LKRA 5HHNA 2V9TA 5IF0B 1XGRA 1RIHH 2E8ZA 1FYTA 3RTQD 2R9HC 5BRZE 2Y1VA 2NZ9C 4NO3A 4X99B 1WAAA 1AFVH 2WQRA 1FN4B 1T20B 4MMZC 3ULUL 1H5BA 1LQSR 3O6FB 4RISH 1NGPL 3F7YA 1KPUB 5DJ2B 2YK1L 3QHFH 3KDMA 5DJZA 4K7FB 2B2XL 3T65A 4I2XA 5L0QB 1G6RB 1MLCB 1TQBC 4XCEB 5D93C 4HS3A 4BH8B 4PJ9C 1A6VH 2YPLA 1BZQK 1QFUL 3VXSD 5D72L 2UYLB 3RL2A 1X5IA 4O9HL 5HJ3B 3OXRB 3DO7A 1TVHA 1QSEE 3R8BB 1KIPA 1S7VB 3I6GA 1N2RA 4ZSOE 1L9MA 5E24E 4G6KH 2VDLL 5BW7A 5F3HA 4WO4C 4L8CA 4MNQA 2BSRB 3WO4B 4DEPB 4AEIL 1UVQB 3VXSE 4PJDE 3ULVD 1KBGL 3QEHA 2ZUYA 4ZNEE 5DK0A 2MHAA 4XPHL 3DVIA 4XI5C 5JW4N 4OCSH 3VFUA 4YHYC 4XNQA 3MJ7A 4Y8DC 2CKBH 5I1KH 3RZWA 2J8UB 5CIPB 3D39B 4BSVA 4KXZI 3ZYIA 2WBKA 5D2LB 2W0KA 3UYOD 3QZWG 3ULVE 1RZKC 3GKWH 4LHUD 1FZKA 1KXVC 3I9GH 2HRPH 3VXQB 3MRQA 4Y4FB 3RTQC 4PGDA 5JW4Q 1S7RA 5DYOB 1RZ8B 2OR7A 2FZ3B 2Q8BH 1UWXH 1IEBB 3HAEB 4U0RB 3QNYB 1QBBA 1N5YH 3SBWC 1KJ2B 4I4WA 2JIXA 1NANI 2C3VB 3WLBA 4PPTA 1WWWX 2IQAA 3FONA 4KGLA 1L4IA 3UJTH 1NC2D 5ELIA 2DYPD 1OL0A 5EU6B 5IB2A 3ESVF 4LAJH 2MQCA 2E7LC 5I74B 3QRFM 1U2CA 4WW1A 3ZE0F 1JF6A 1KEMH 1JRHH 1NGXB 3IFNH 5DRZA 5H37G 4M1GL 1UA6H 4U1GB 3RU8L 4WEMB 4TNWK 5DLMH 3G5XA 2ITCB 4YHLH 1LE5B 4WU7A 1NEZA 4AEFA 5JORA 4JRWA 4KUZL 2AABH 4N8VA 3VWKB 4MA7H 4ZUUB 5HBBA 5EUOF 4GQPH 1DDHB 2CMRL 3EO0A 1TCRA 3RWGA 4AEHL 2AEIT 4E41A 4UV4L 5KOVC 4K8RL 4LEXH 2AJUH 1XIWD 2ICWI 3GMMA 2IPTL 4QXUL 4YXHH 4MWFB 1JK8A 5C9JB 5J6GB 4PJ7B 1CGWA 5EOCH 3ULVF 1UT9A 2W65A 2V5TA 3MV8E 4NQDD 3MUZ1 2AXFB 2J5LC 2PTTB 3QWRD 5HYQA 2F53D 2X4SA 2YKLH 2EIDA 4KJYB 4U1HA 2VL5B 4IOIB 3S37H 5CEYB 1NMCB 3TVMD 4HUUB 3ELAT 5I8KH 3PV7A 1MWAB 4Z9KB 2MJWA 5A1AA 5GRJH 4PJIE 5I19H 5DHVA 3SKMA 1OF2A 3T4AB 4WFHD 1N7MH 4BELD 2IQ9L 1YQ2A 4YLQT 3V8CA 1DQLH 4HFWB 5KS9A 5DURB 3HE7B 4LRNL 3DLQR 5C7XL 1JCKA 4KRNA 3SDDB 1NBZB 4DGVL 1N6QH 3GJEB 2FHBA 1PGRB 3ZTJG 1XIWC 2JB5H 3X12A 3HFML 3OG6B 3GRWH 4PJCE 3BWUC 4F37F 3MRHB 1A47A 3CH8A 1T7ZA 4TUJB 4Y4KD 5TPWL 4YDKL 2Q8AL 4I8DA 4NNPL 1RUMH 5ADPL 5F97E 3LKOA 3WS6C 2PYED 1AGCB 5E08H 5DMKA 1R0AH 1IAKA 1LEIA 4YHZL 5E2TH 5I1JH 1MCOL 1BLNA 2R0LH 4NKOA 1GHFH 4CNIB 2YS4A 4XP9L 4DAGL 4JFHD 1RK1A 4PRPB 5FKAA 4QHLB 2CR6A 2RJMA 3TVMC 2DAVA 5C09A 3E6FB 3TIEA 4I0PB 3VFTB 2D9CA 4H8WC 1JF1B 2FD6H 1RU9H 4KHXL 1SJXA 3PP4L 1QBLH 3NN8A 2EIZB 5DFVD 2ED8A 5DUBB 3TA3B 2AEQH 3FFCE 1ORSB 4RBPK 4U1MA 3NCCB 5F70A 3QAZB 5BRZB 2BOBA 1IGIL 2NY5L 4LPVA 1E27A 3F7QA 2V17H 1EBPA 1MI5D 2FBOJ 3JBG7 4JM2D 4G80B 1IE5A 2X4UA 3S5LG 3DROA 4NSKB 3IXTA 4AMKL 3U9UB 4PP8C 1K8IA 1NCCH 4JG0H 1VESA 4APQA 3PGDB 1JPTL 4PJBE 4HC1A 4HMEA 5F7DB 3IVKB 1A2YB 1F4YL 1Z0NA 3ORJA 4Z7WA 3ZHLA 2R2CA 1BIHA 3H3PH 4XPBH 1MI5E 3CSYB 1MCSA 2MPAL 3FMGH 4NRYA 5D7SH 2C26A 4PJCF 1G9NC 5J56B 1A3RH 1B9ZA 3LQAC 3PABB 4E0RA 1XCQB 1E4XL 5KVEH 4YHPB 3JVGA 2ZSWB 5ICXA 2ADIA 2OL3L 5EUOB 4JZJA 43C9A 1T2QH 3RZCB 2JB6B 3VXSB 2EH8H 1KB5L 3NACL 1TVBA 3AC0A 3H7BA 2B0SH 4PRHD 4N1HB 1F58H 3EYUH 3EO9L 4ZFOA 1NBVH 3MLXL 1LD9B 4HG4K 3CFCL 5DFVC 2RCSH 1YECH 1SMAA 5HYJD 4XVSL 4TNVK 4TVPE 5MP6H 4UQ3B 2WUCL 3SKNA 4PRHE 3OTTA 2R56L 3LH2L 4G42B 4HXBL 2CDFB 1WFUA 2K3TA 3IJHB 1L7IH 4OTXL 3FOLA 4JM2C 4KWUA 2HJLA 3NFPB 3OX8A 4YXKH 1F2XK 2PNDA 2BC4B 5GGUA 4PV8B 5FO9B 1QBAA 2IFFL 5ESQA 1W0VB 5IOPA 3KPQA 3QIBD 5E5MA 3WSQL 3OR6A 3QIUA 3BKCL 4HX1A 4XCFH 3ISWA 3SGKC 5IGXH 3VCLB 1J0JA 5FV1L 1SY6A 5IV2A 3QXAA 1T5WA 2BSED 3QP3A 1FNGA 4WUKH 1BQHG 5DXWA 3U7YL 2VR4A 3BOVA 4CVUA 5E4IA 3BAEL 4UIMA 1OM3L 4HV8A 3GB7A 4XNZC 2AEWA 4OD3L 4JQVA 4HIXL 4OZ4A 4QXWA 3DUSA 4QXGL 4ODXA 4WTZG 3M45A 5DQJB 4JM2F 1K2DB 4ERSL 5HY9B 5AYUH 1F5WA 5IEKA 3HPLA 4NZUL 2J5LB 1ZA3B 1W72A 3PHSA 1MFCL 4MA8L 3T4YB 1NC2B 5CEZL 1AXSA 1DSFH 2I60L 2DYPB 1RVFL 4AEEA 2WBJA 3UZQA 4L3EA 1BGXL 1NCDL 3X13A 3TPUA 1AFVL 2EDTA 3HG1A 1BMGA 4JGJA 4YK4B 5DJ0A 5L8JB 2KQNA 1LMKA 4G7YH 1BBDH 1ULVA 2VN4A 4Y16D 1JNNH 1IFHL 4X80H 5HDOA 1KGCE 4ISVA 5T1MA 5AUMA 4JZNB 1CGSH 2WNGA 1EGJL 4ZFZB 5C9KA 1RHFA 2Y06H 3QIBC 5ISZA 4G8GE 4YC2C 2YMXL 3MV8B 4NN6B 5LBSL 2HKFH 1CL7L 1Z0MA 4AH2B 1Z3GL 4WU5B 3LQMA 2FIRT 4JY6B 3EYQC 2LV4A 3RA7L 2AERT 3WE6A 1S7WA 4XMKH 1MFEH 4PD4J 4JFOA 4CU8A 4AENB 4NQDB 5A2JH 5E8EB 1D5XB 2F74B 4JHWH 3HC3L 4ORGA 5JIPA 4U1KB 4PJIB 5JDSA 3GO1H 4LFHD 4LCWA 3GSNB 4U6HB 1AR1C 1XFPA 1BEYL 2FBJH 4OKVA 3MXVL 4FQQB 4ODHH 1SMOA 5I76B 1Q38A 3QDMA 3G6AA 4Y16C 3TWCH 4YGAB 2GI7A 1F6FB 3SPVB 1FGNL 4NJAH 4U49A 5SX5K 3KYKL 1OAYH 2R4RH 4M62L 4PY8J 1NBYA 5J1TC 2QQKH 4PJCB 3TH2T 4P2RE 1JNHB 2DKSA 1JFQH 2NXYD 4DKEH 5JHDA 4YQXH 2H3NA 4MNHB 3TJHA 1MIML 1OD9A 1J0KA 1Q0YL 3IJYB 5IHUH 3I75A 5GJSH 2DTSA 2QBWA 1D9KB 5T1LD 4PV9B 1KLGB 4Y4KB 3C6LC 3RY4A 2D03H 4CKVX 5GRYA 4FRWA 3QNZA 3RIAF 3AREA 3HZYB 1LQVA 4YXLL 4LDOB 3BZFA 2PYEB 1Y18B 3VWJC 3IU4H 5C0BD 1DEDA 4JFZL 4GW4A 4GXUN 3ZO0A 4EI5D 2W9DH 4K3JL 3GJFH 3V5HB 1P5VA 4OFIA 1MHCA 3FO2B 5BQ7B 1WWBX 4HK3N 5H37H 3ZLQC 5T1KD 4UAOC 1FNSH 3FFCB 5FUZL 1GGTA 5AEAA 1EX0A 4PJHA 2DDQL 1FH5H 5EA0H 4M6MH 3ARGD 7FABH 2JLLA 2HMIC 1I1AA 2AJSL 4OAWB 2UWEA 3V6ZB 1GAFL 1NLDH 5IEHB 4RAHA 1B90A 4J8RB 4Q58C 3IJSB 1BFTA 2C5DC 4D9RD 3P4OA 2Z31D 5EFIA 3VXUE 4D0BB 4BFGA 4JO3H 4KMTH 4PGJA 2NXYC 3BRFA 1MI5B 5KSVB 3VFRA 3QI9D 3S34H 1WBYA 4Y5VA 3RWCB 3GIZH 1CFQB 4LKCB 4D9RE 1I9RH 4B50A 5D71L 5IFHH 4LSPH 1JGVL 5J9PA 4MA3A 3NA9H 4JPVH 3AAZA 3UTZB 1Q9LA 4JN1L 1FYTD 1SYVB 1CFNA 1OD7A 4LLUA 4HXAL 1Z9SA 1AR2A 3DUUB 1QLFB 1DQQA 4I0CC 3S88H 5EO9A 2CD0A 5ESAB 1R3HA 2VE6B 3U6RB 1NFIA 1PY9A 1IGYB 4GKSB 1S7UA 1A3LH 2ZWLT 1ODAA 1UM4H 4XNYL 4EN3B 1NCBL 1WK0A 4S10A 2QKIB 4YPGA 1CT8B 3AY4A 3FRUA 4P5TC 3MACL 1MQKH 2YPLD 1HHIB 3WN5C 1FAIL 2J6EA 2CSPA 4LQFL 2LU3A 3ILPB 3C8HA 4PRHB 5FO8B 4HJJH 1JZ6A 1J8KA 5T3XD 1TXKA 2ZP0T 1JWUB 2X1WL 1I9JL 1QNZL 4RMSA 2R8SL 1QYGH 4R97B 3TO2B 4M8QA 3IXAB 2AAVA 4MNQD 5FB8A 5L7XL 1MCKA 4RGMC 5GJTL 3DWTA 3OR7B 1H15A 1N59B 1E6OL 1WIOA 3ZTJH 5FYKL 3V79C 4IMLB 4PRIE 3QI9C 2BDNL 3O9WC 4WI4A 5KG9B 4UT6L 3S35H 4NQVA 5FYJL 4ODVH 3IDJA 1M4KA 2B4CH 4YC2B 4R96B 2XTJE 4LSQL 3HUJE 2JELL 4JZOB 1KC5L 1NGQH 5DD6A 3ZTNH 1FNLA 1UXSB 1P53A 2J8HA 3KXFE 1DP0A 4UB0L 2XN9A 3FQNA 5J13C 4TTGA 1XCTA 3K8KA 1B2WL 2EDDA 1QLEH 2GTWB 1GIGH 2BVUA 1X5JA 1H5BC 3UROR 4G9FA 5H2BB 5FGCE 1EERB 1HI6B 5D6DA 3VFPA 1AI1L 4ZDHB 2ZCHH 3L3KB 3K81A 3FT2B 3QUML 1ZVYA 1TTFA 1XGUA 1BJ8A 3S97C 1L0XA 4M43L 4PR5A 1ED3B 5ENWB 2OTUB 3T2OA 5EC2B 3OZ9L 4W81A 5JQ6H 5BW7C 5F96H 1I4FA 2NYYD 1FIGH 2KDGA 1M7XA 3TNNA 4G8GB 3VFMB 4Y16B 2EEBA 1DQMH 1R5VA 4JRYA 2ATKB 3GUTA 3TPKA 2DQGL 2J88H 2OR9H 2PW1B 1A7RL 2F5BL 3QXTA 3GIVB 3O8XB 4CL7A 2HWZH 2P45B 5HDBE 3I02B 4U7SA 2JKXA 4E41D 1WIUA 1Z5LA 1K4CB 3BPCA 2DLGA 5EBWA 1QFOA 3SGEH 1U3HA 4ZFFA 3MUY1 4OM0H 3TO4A 3VFGH 4AQOA 1BVLB 1GPOL 1ZT1B 1IM3B 3NIDE 4OI8A 4XTRD 1E4WL 3C5JB 1YYML 5HYEA 4LCYA 5CZXD 1FL3B 4IBLT 5IVNA 4OZFG 3MA7B 1KB9J 4RIRB 5DD5L 5GSVA 1TZHB 1MCNA 1SJHB 3AM8A 3OKNB 4NN5C 1DL7H 1U2HA 2Y5TB 4A2MA 1RJYA 4UAOB 4M4PA 2HKHH 2HA1A 4G5ZH 1X5XA 4P2RB 1UM5L 1YMMA 3Q6GH 5A16A 2DQTH 4JKPH 1WCBB 4RMWA 4F7PA 2NYYC 1E4KA 3S4SB 4U1JA 3FT3B 5FHBL 4OCXL 5DMIL 4NC2B 3VXRE 1UB6A 1OAZH 5FF6B 3BJ91 1LK3L 4BSJA 2W0PA 1G7QA