5AD0A

Complex of a b21 chicken mhc class i molecule and a 11mer chicken peptide
Total Genus 55
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
55
sequence length
269
structure length
269
Chain Sequence
LHTLRYIRTAMTDPGPGLPWFVDVGYVDGELFMHYNSTARRAVPRTEWIAANTDQQYWDRETQIVQGSEQINRENLDILRRRYNQTGGSHTVQWMSGCDILEDGTIRGYHQAAYDGRDFVAFDKGTMTLTAAVPEAVPTKRKWEEGGYAEGLKQYLEETCVEWLRRYVEYGKAELGRRERPEVRVWGKEADGILTLSCRAHGFYPRPIVVSWLKDGAVRGQDAQSGGIVPNGDGTYHTWVTIDAQPGDGDKYQCRVEHASLPQPGLYSW
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system
molecule keywords MHC CLASS I ALPHA CHAIN 2
publication title Complex of a B21 Chicken Mhc Class I Molecule and a 11mer Chicken Peptide
rcsb
source organism Gallus gallus
total genus 55
structure length 269
sequence length 269
ec nomenclature
pdb deposition date 2015-08-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00129 MHC_I Class I Histocompatibility antigen, domains alpha 1 and 2
A PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5ad0A02
3.30.500.10 Alpha Beta 2-Layer Sandwich Murine Class I Major Histocompatibility Complex, H2-DB; Chain A, domain 1 MHC class I-like antigen recognition-like 5ad0A01
4OLUL 4Y4HD 2DM7A 3STLB 1S5HB 4TRPH 3DI2B 2HT3C 3SBWC 3P3YA 3VE0B 4QNPF 4G9FD 2YUXA 3G04A 4G59A 4AEHL 4XCEA 4HUMB 3TO4B 4YXLH 3BP7B 3MRHA 5HYSB 5D9SA 3RL1A 1J0KA 3QHTC 3AB0C 4U1KB 5IMKB 1NL0L 4MA8H 4DOHE 1CBVH 2XZAH 3SKNB 4FXGB 3ARBA 1JPGB 5FKPB 4MNGE 4BH8A 3I9GH 2PYED 1MCIA 2XYCA 3KLAA 4BFEA 4NQED 4LHUB 3C6LC 3RVWC 3FB5A 5DK0A 1BZ7B 4JJ5B 2WV3A 2J5LC 1EMTH 3C8KA 3ZDYE 3V5HA 4J3OC 3F65A 4XH2A 1NBQA 4D9QD 5DO2D 3R1GH 5FA3B 1T1XA 4MB4A 1EUUA 4P5MB 3X14B 3QEGL 4MHHI 4R90H 4D9LH 4MAYB 5E2WH 2APXA 1OAYH 2CKNA 2JJTA 3NIFF 1FIEA 4JFHE 2PTVA 4LKXA 2IAMC 2WQRA 5EU7C 5F1OB 5J6HB 5I8OH 1ZGLB 5MERA 2Q76A 3UPRA 1ZLUK 1KOAA 1JMZA 3MRNA 3U7YH 5HYQA 4PJ7F 4FABL 3HLAB 3MRQA 3HR5B 5B22A 4TTDD 3E3QA 4J8RA 5JOEA 1JVKA 3WNMA 4LLVB 2OP4L 1L7TL 3O3BB 3ZKQD 3LN4A 3W39B 5L2KD 3RZCB 4F7PB 3R4DA 4QXTB 3KYOA 4F8TA 1BJ8A 4NO2B 1RQ5A 2X6MA 4NQDB 3VWJB 4L8BB 2GTZA 3ROLA 4HEPG 2R2HB 3MREA 4S0TD 3TN0D 2PR4L 4MB5A 1CDCA 5ACLA 1G9NC 2VITA 4KJQD 1VGEL 4WCYL 4Y1AB 1JUFB 1DBJH 3L3KA 4I3RL 1UEYA 1VDGA 1CDJA 1W0WB 1PQZA 1A7PL 1NBVL 5IHUL 1BJ1H 5D96C 1CN4A 4OF8A 1QSFB 3UTPD 2CIIB 4G42B 3S4SG 3EFFB 1P53A 3RL2B 5IHLB 5A16B 5KOMC 2IMMA 3K2UL 1MJ8H 1PYWB 1KIUA 3ZLQC 2ZG2A 3LKSB 5D7IF 3LEYH 1XIWD 3IFOA 1GPOL 1GGYA 3DRQA 3BH8A 35C8H 1P4IH 3RRQA 1V3LA 4YNYB 2BVUA 2MKLC 4X9GA 4XAKD 5D5ME 2ICEB 2Y07L 5B8CC 1QBAA 4GG6E 5IEHA 5E8EB 1SBSH 4KC3B 2DWEA 1RPQA 3SOBL 1KENH 3ILQC 1CZ8H 3L5IA 4C83A 4UU9A 1H8OA 1G7QA 3TT3H 3QUYB 4ODSH 3HI6H 3TFKA 4LIQE 4RMVA 1CGUA 5CLTA 1LEKB 3VXUB 3QISA 5TE4H 2ITDA 2QEJA 4WW2F 1ZHBB 2DIBA 4FQXA 5AUMB 2X09A 2KH2B 4KPHH 1QLRB 2L0DA 2M2DA 3HNTL 5IB4A 4C4KT 4V1DD 3RIFF 4GUPB 2CGRH 2RCSL 3DWTA 1FFPB 1YNKH 4LASL 3KPSE 5JPMB 4L3EE 4H20H 3TBVA 1N6UA 5B38B 2BSED 3OJDA 4L8SA 4LLYB 3T2OA 3PP3H 4U3HA 3MCLL 4KZEH 2X7LA 3V0AC 2PYFB 1MCOH 1HKFA 1E6JH 3KLHD 1J0HA 2VDQL 5KZCD 4Z7QF 4YPGB 4AEFA 3BKYH 4Y4KB 1N8ZA 5BS0A 2I9LB 5KG9B 4XMKH 2XA8H 4HHAA 1F90L 1HHIA 1AO7A 2FB4L 3HPJB 4FA8A 2VZSA 5FGCE 2VMFA 1VFAB 4M6NH 1TETL 1YPZB 1A5FH 3O8XB 4UINH 4NCDA 4CVZA 4Y8AA 2ZSWA 4OD1H 5IW1A 3VRJB 5D70L 1O7SA 4JZOB 5HVWA 3C2SA 4NRZA 3E8UL 4YBLC 3VA6A 5GSRA 1O7VA 5IG7B 2CR3A 3OL2A 5SX5H 4ODUA 1MLCA 3ULUH 5A40E 3HRZB 2PUQT 3OWEA 1JWMA 1RVFL 3U79A 3VFVA 1E4JA 1VGKA 5EU4B 3MZGB 1ZT7A 2A9MH 4FOMA 4HC1A 3QNYB 4EXKA 3EJZC 5CCKL 2GAZA 4C58B 3CX2A 4UOJA 5HHQB 3C5ZD 4JRYA 1DVFA 4PRIB 1FNSH 2E9BA 4DN3L 2O5YL 3SKOB 3RIAK 4MXWL 4WEMB 4WFED 3M8OH 4Y5XB 4Y5VA 1PFCA 5KW9L 3BO8A 4MA7L 1U8LB 2AEWA 2DLEA 1OGAE 3DPBA 3VFMA 4LLAA 2FJHB 4LCYA 3ARUA 2O26U 4R6UA 5F7EL 4QY8A 3I02B 4X6DE 1GVIA 2FWOA 3UBXI 1BMGA 1G0XA 5SWSB 3S36H 4Q9QL 1ZLWK 1YEHH 2C1OB 3NZ8A 3EO0A 1R3HA 2DL9A 5DURB 2R69H 3MXVH 5MEQA 3T77A 1B9ZA 4EI5B 5IKCA 4XX1G 4P57B 2CO6B 1MI5D 5E6ZA 3UC0H 5K33A 1AHWB 5DJ8A 3DXAB 1KLFA 2WANA 3M07A 3UDWA 1FBIH 5FUZL 3NCYP 4Z0BH 3QUKB 3GNML 3INUH 4FMKA 2LU3A 2LQRA 2C4FU 3JWOC 2D4FA 3KVQA 1BREA 2G60L 1KB5H 5EORH 4QCIA 3QEQA 2JJUA 1LE5B 2R1XB 3GMRB 4D2NA 2XWTB 1UB5A 4NQUA 3ROOB 1LP9A 4X99B 4KK5C 2V7HA 4Y88A 2ZUTA 3HZKA 2VLRD 2ARWA 3FRPG 1A47A 3MV8A 2I07B 3C5JB 3DMMB 4GKNA 5BO1L 2IANA 5F9WB 5E8PA 3SGKC 1A7BA 5E9DD 1KF9B 1BD2D 1BVZA 2N7BA 2ENSA 4GAJL 3ILPA 1UYWH 1CLOH 1F6FB 4P99A 2QQNL 1D5ZB 4ONGL 4G3YH 2MJWA 2BNQB 1XCTB 3QI9C 4PJEF 3X11A 3KPOA 5BZDA 2HJLA 3QIBC 3FFDA 2SEBB 4ZFOB 3O0RH 3RGVA 1IM3B 1DSFH 4YHML 1ZWIA 3MMEB 5DJ6B 4NP4L 5D1QA 3B6SB 4N5ED 4WO4D 5DUBA 3QUZA 2V5TA 1J1OL 1RUML 4K07A 4B41A 5D6CB 4NKIH 1ND0A 4L4TE 4ONFL 5DUPH 1I8KA 4DGYH 2Y1VA 1ZHKB 3BWAA 4NJ9H 3UCRA 2GUOB 5FYJE 1CFVH 2QQLH 1WIOA 3EYVA 5D6DA 3SQOH 4QHLA 4PJXE 5HJ3A 3TF7A 4LLQA 5DQDL 3TA3D 1T2JA 1KJ3H 3FT2B 3QR2A 3DO7A 3MRPB 3DTXB 4U1LB 2R0LL 3TYGH 4YDIL 3GHBH 4O02L 3FQNB 1X5FA 1HSAB 3S7GA 2IPTH 5F44A 3OF6D 1Z9LA 4ONOA 4YQXL 1GGCL 1PKQE 3LS4L 2DI9A 4NBXB 3QFJE 3MV11 4AM0B 2J8UE 4X80L 5C09B 3SJVE 1EGJL 1S9YB 2X1QA 5JLZB 1S9KC 1UG9A 3RWEA 3WLBA 4L3CA 1E28B 5FHAL 4NZRH 3KPMB 2KPNA 4NUGH 4YXKL 4KUZL 3UPAA 4M61B 4IDLA 4LSRL 4IRZL 5E8DH 3AVEA 3TO2A 4Z77B 1LO0H 4K8RD 2XWJB 7FABL 4HF5H 2HFEB 3ZSSA 4S1SL 3U30B 3BZEA 1N7ML 4YHYC 1MWAA 1MEXH 1E6OH 5GGSB 5FHBL 4WTXA 4Z7UE 2Z93A 2HH0L 5HYSG 1FVCA 4M6MH 1WIPA 5CWSB 4IRSC 1AGCA 3P4NB 5KSVB 1Y6NR 2M26A 1C12B 4QRTB 5DEGA 2FECI 4Y4FD 3TH2T 1IAMA 4LF3A 12E8H 5HHOB 2BNRE 1C16B 5DJCB 1BFOA 1FNFA 1WT5C 2EO9A 3D2UD 4LSUL 5FM8A 2EIDA 4HW6A 1JRHH 3T65B 4DCQB 4POUB 3FB6A 5C08D 3MROA 3VXQB 2JLLA 1FVEB 4Q9BA 5I74B 3QZWB 4PJ9C 3ZE0F 4C56D 3OKMB 4Y89A 5KSAD 3RTQC 1M6OA 3CSPA 4N0UB 5GGQL 1NAMB 5T1DH 1MCKA 2NY0C 4ZODA 1CL7I 2EYSB 4M1DL 4XNMB 2F53D 3DV6B 4PFEA 4D94A 2CK0H 3QPQD 1EBAA 3OAZH 3S35H 2VC2H 4HIHB 3S3JA 4MA3A 1IFHL 1HHJB 1CD8A 1DN0A 3ULUE 2W0PA 2YMXH 4K71B 5IFHH 1CGSL 1UQSA 4XMPH 1PG7L 2EEDA 1HWHB 4K9EH 5DJ2A 3O6MH 4JKPH 3DROA 4F9LA 1JWUA 2ZUYA 3RY6A 5FCUL 3D0VA 2AVGA 3KS0J 2VLJD 3PWJA 2R2BB 4QRRB 4DKDC 5EBLB 5ALBH 2HT2D 5HHNA 4HIXH 4K3GA 4LRIA 1IKNA 4CKVX 1J10A 3ARFB 4M7ZB 4UT9L 4PJ5A 5DJZB 4U6XB 1IGIH 5E1AA 2CRZA 1XF5B 4LL9A 1HQRB 4B7IA 3T4YA 1D9KB 5T3XH 4PRHD 5E6IA 2A77H 3HE7D 5CLWA 3WXWL 4D3CL 3E6HA 4R4FH 1HXYB 5DC9B 3SQBA 4GAFB 4XVJH 3VXMB 1SEQL 5I30L 4LQFL 4G8FB 3EDKA 2ZG3A 1UA6H 3WFEH 1FIGH 4NWUL 1I7RA 1YN6B 4LVNC 5AD0A 4K7PL 1B4RA 4E41E 3D9AH 1RZFL 5HHMA 2WY3A 4XB8A 5I1HH 5JXED 3KPRA 5ELIA 3IFPA 4I77H 4E5XA 4XPTH 1XF2B 2F19H 1T2XA 1F4XL 4P46C 4TUJA 2YZ1A 4U1MB 3BZFA 4WHTA 4Z18A 1U8KA 1XR8B 3ARVA 3FO9B 4YFDB 4J23A 1FFNA 5M94B 1WBZA 3NZHH 4M93C 5C0DA 5C6TH 2GITA 1CE6A 2H8PA 4JFDA 4LFHD 2BMKB 5BVJB 2VLLB 1T66C 4DQOL 3QEUA 2NY6D 1NBYA 3OXRA 3UROR 2A6KB 2UVFA 3V0WH 3UEZA 3FT3A 1A6WL 4RMRA 4ZYKA 1ZHLA 3S4SA 3QUML 3DX9A 4JREB 3O2WL 1J88A 1K4CB 4RWHA 3MJ9L 3KPLA 1I1CA 3IJYA 4XP1L 1OT2A 5T5FL 4PTTB 2EDJA 2Z0BA 4OFPA 3HC4L 4KROD 5FGSA 4G6AC 4ODVL 3O3AA 3MRIA 5MENA 2C3VB 5TPWH 1CTOA 5B38G 1IKFL 3ULUC 4TNWF 3QXAB 1N59A 3S37X 4PJBF 1IGYA 1CF8L 2GJ6E 1QYGH 1U8QA 3REWA 2BOCA 2P24A 4EDWL 3UZQA 1T04B 1DDHB 5C07E 1JZ8A 4HDIA 3BN9C 3FQXB 4UMGA 3MA7B 4EZMA 5GRWA 3GBNL 3QXVA 1RU9L 2NY3D 3PQYA 2VXVH 3O6FD 3QNXA 1QEWB 3RY4A 4PP2A 2P8MB 3T3PF 1YECL 5JXEC 4OLZL 1EV2E 1YYLH 3Q2CA 3QSKB 3ARSA 3I6KA 3JTSA 4PV9B 5HDQH 5K9OA 4CADB 3TPUB 1OCWH 3RNQB 4POZC 5D1XA 1D6EB 3WJLA 4AENB 2YD3A 3KPQB 1A6TB 3AREC 5F7WC 3D0LA 1EFQA 3PXHA 4JLRB 3CVIL 4X6CE 4X9FA 1FPTH 1CU4L 1JNHA 2HG5B 5K9QG 1MUJB 2NY6C 3QQ3A 1S78C 2FIRT 4UV4L 4ERSL 3H3BC 3OJMB 4O9HH 4CU8A 3BAEH 5FO9B 4TQEL 4JO3H 1Z3GL 4WUKL 5EA0H 3PJSB 4P9HH 3SPVB 5TE6H 1M7IA 1AGEB 2KQMA 1A1MA 4I18A 5I8EB 4XAWL 2XI9A 1E4XI 3KJ4B 1JL8A 4PRAA 1VCAA 1HILA 1T4KB 3W5MA 2X70A 1IGFH 4OD2A 1RZKH 1GZQA 3FTGB 5DQ9A 3JWDL 3ZYJA 5C0NC 4Y5YB 4LKCB 2HTKC 4PD4K 5EH1A 3BP4A 5EOTA 4MAUL 3WMSA 3WNNA 3TFKD 5JZ7C 3H7BA 4XWOD 2F15A 3IFLH 2O61B 3O9WD 1ZA6A 4XVTH 3PWUB 3VD4A 4ZXBB 1JN6A 3P2TA 1EXUB 2FX7L 3CDCA 2W0FA 1FNHA 1XZ0A 1I85C 5BVPH 5JW4R 3LRGA 2XKNA 2APFA 3GSWA 1AGBB 3UYPA 2F74B 2Y25A 4WWKC 4GKZB 2XTJD 4OFDA 2GFBB 5FDWB 4DAGH 4Q9CA 4XT1C 4AK1A 5J56B 3LV3B 1DBAL 4I3SH 4OCSL 1HH6A 3CDGB 3WFDH 1IBGH 2CMRH 4OF6A 3BXNA 4MZ2A 1UXSB 1T0NA 3D87B 1TVHA 1BQHB 4G6MH 5BS0D 2WBJB 1MQKH 1HKLL 2R8SH 4M48L 3KXFA 2DTML 3R06A 4CVUA 5EBWB 1H5BB 4XPBH 3TBYA 4Z8FL 2VWEC 2JB5L 2W9LA 1DFBH 5DDHB 4ZFZA 3P4MA 1G7JA 3WHXB 5EU6E 4JFEA 4RGND 1T22A 4I13B 2JCCA 5CP7B 4QHUB 3VI3F 4MNHB 4OZIB 4TOYL 4N0CA 2EDKA 2DQCH 3FRPA 2JE8A 2ATKA 3BUYB 4YHNA 5LGHH 5E8NA 4L4VB 4F7MB 4KK9D 5CGYC 1JNNL 4U6YA 3V0VB 3QEHB 4JM4L 2Z4QA 4RISL 3CXHJ 2EDOA 3MJ7B 2VRAA 5D7KE 1K8DA 4S1RL 1QA9B 4YFLF 3WUZA 4JRYD 4Q6IC 2WBWB 3W9EA 5AAWA 4XP6L 4PJHB 4JRXE 3RWIB 3FB7B 4J7RA 3ZKSD 4PRNA 4KRPC 4G7VL 2EO1A 1OAUL 5DGRA 1S8DB 4RMUA 3HAEA 5I73B 4YXHH 2X4SA 1Q9OA 3IF1A 2H2SD 3TVMB 4JPKH 4KK8D 4N0FA 1EX0A 3BQUC 5EOCJ 3NCFB 3WBDA 3VFGL 2A83A 4P2QB 3C8DA 4OCRL 1DBKL 2VERN 3GBML 3UTSB 4KVCL 4OF7A 1PLGL 2BSRB 1KACB 4PV8A 5GQBA 2NNAA 3K0WA 3KWWA 3PDOB 3QJFA 3BEWA 2E9WA 1OVZA 1CQKA 3SDCD 5CJ8A 2DAVA 1CICD 2QADC 5EU3B 1ZXQA 1GH7A 2QSCL 4K3HA 2F8VA 2VLKB 3DVNB 1CCZA 1I9IL 3ARDC 2BNUB 5JDSB 5TF1H 2OYPA 4TNVF 1QVOB 4HG4J 3BD4A 2NXYD 1UJ3B 1R24B 3IDGA 3FN0L 1L7IL 5EIIB 1AE6H 3OHXA 4XBPB 1F58H 2IG2H 3WJJA 3WIHA 1U42A 3EYQD 5H2BA 4J4PA 1T83A 4XNYL 3QIWC 5IROC 3TZVC 4U1NB 1AQKL 4IRJB 4WFFE 5GXBB 1U8JA 2LTQC 2BY0A 5FO8A 3DHJA 1KTLA 4OCNC 5I2IB 3VFRA 1IL1A 4F9PC 1KN2L 3MV8D 4UZGA 4E9LA 5IBLC 4K9EC 4PUBH 4HZLA 1Y0LA 3CFCL 2GKIA 1NLBL 1UGNA 4HBCL 4LCIH 4PJGE 5DRXA 3GB7B 3QZWG 1RY7B 3ZE2E 3STLA 1S5HA 2D9QB 3RIFK 5GHWH 6FABH 4C4KO 4EBQH 4OLUH 3VE0A 1YNLL 2E27L 1UENA 1BAFL 3TO4A 2R29H 3BP7A 3BT2L 4IDJL 3UAJC 5HYSA 4AEHH 3BKML 4U1KA 3FAXA 5IMKA 1EZVY 2FL5B 3RGVD 1NUFA 3SKNA 4R7DA 1NL0H 2DQTH 1JGUH 3C60B 2EDFA 4FXGA 3VU2A 4H88L 2CRMA 1B90A 1JPGA 1PDKA 2DD8L 2YUVA 1NCWL 3GDBA 5C6PB 2HP4A 5F88B 3NABL 3PWPA 1MF2L 4LHUA 1BQLL 5B39B 2MTPA 4AH2B 5L7XL 1BZ7A 1F4AA 4OZHE 4XXCA 5T1LB 1KCUL 1G6RB 2EDYA 1A3LL 5DI8B 1T89A 2NX5B 1L9NA 3SCMB 5FA3A 4U2ZA 4EIGB 5CINL 3THML 4NOFA 5C0AA 3P30L 4P5MA 3X14A 3WO4C 5F3HB 1D5MB 5E03A 1OTUD 3CU1A 4ENED 4MAYA 4IBLT 3E2HB 3A6BL 1WIUA 3QQ4B 3QEGH 4J12A 2IGFL 2ZJSL 5I75C 4I0PB 5A2FA 3FFCE 1MCRA 5KJRL 5J6HA 1RJLA 1ZGLA 4NNXB 3N50A 3O11B 4K2UL 4LBEB 2C1PB 4LU5L 3GK8H 2ICES 1IEHA 3BX7C 4KTYA 3HLAA 3HR5A 1MCBA 2HVJB 3OTTA 4ISVB 5CIPH 4FABH 1ZSDB 4LLVA 3MRRA 2OBGA 3NPSB 1IQWL 3D3VE 4OZGB 3O3BA 5CJXA 3W39A 4WFHE 2OP4H 3RZCA 4YUEL 4GMSL 4F7PA 1L7TH 4QXTA 1G6VK 4M5YL 4NO2A 4LHJB 1CT8B 4PLJC 4NQDA 2D3VA 2VO5A 3VWJA 4L8BA 2Q6WB 3O2VL 4C57C 4U0RB 3OR7B 2XFXB 2R2HA 2E7LA 3QDME 4ZO7A 5BQ7B 3P40A 2PR4H 1XH3B 5FO7B 4Y1AA 1JUFA 4Y19A 2FR4B 4YBHA 1VGEH 1W0WA 2ZUUA 4WCYH 1OPGL 3RVXC 1SY6A 4I3RH 1KXTB 4LPVA 1QSFA 4G9FE 4KDWA 2CIIA 2NYYD 1NBVH 1LQVA 2ZG1A 3EFFA 3RL2A 1CE1L 2JJWA 5A16A 4MWFB 1YEGL 2A0LD 4NUJB 4ZS7L 3UTOA 1PYWA 3CMOL 4PBWD 2K3TA 3L3GB 3LKSA 1X4ZA 2Z31B 4R96B 1WAAA 3G6DH 3K2UH 4F15C 3CLEL 3VGHA 3RX5A 2P47B 1GPOH 4YNYA 4IMKA 4P23C 3TBTB 2ICEA 3ZT6A 3CH1B 3VRLF 5E8EA 5JO5B 2AXJA 3I50L 2Y07H 2F54B 3NN8B 4AIOA 4AG4L 4LEXL 1MFEL 3SOBH 3QUYA 4KJWC 4XBEH 1RIHL 1WVZA 1AKJD 1QSED 3DSFL 3VXUA 5HYJD 3WS3B 3U7WL 1ZHBA 1A4KB 2Z9TA 5AUMA 3ZHDA 1HOCB 3MV7B 4GBXC 1AD0B 1QLRA 4Z7OF 1GL4B 4GUPA 2DL2A 3G5YB 1FFPA 3PL6B 4MXQC 3MBEA 3EOBB 1KCVH 4LCCB 5JPMA 2DBJA 2RCSH 5T5NG 1OW0A 1QUNA 2YK1L 2AJ3B 5B38A 2VZOA 4P9HC 4LASH 4ELMB 1VSCA 4GXUM 4LLYA 1ZAGA 2CSPA 1NEUA 2PO6C 3GSXB 1G7MB 4KZDH 3MCLH 4YPGA 4Y4KA 4RRPA 2I9LA 5KG9A 2VDQH 3HPJA 4LSDA 3VMOA 5GGRY 1VFAA 1JRHI 3AM8C 1F90H 4G5ZL 2ZCKL 4XB7A 2FB4H 1YPZA 1P6AB 5ANMB 3O8XA 5LGKA 1QRNA 5CSBA 5FGRA 4LPCA 4JFZL 3NA9L 3VRJA 1TETH 4JZOA 4LNVA 3B9EA 1O0VA 5D70H 5IG7A 2KQNA 1K2DB 4KHTL 3HNSL 1QLFB 4AEIH 4GKSB 1JCKA 1ADQL 1IC7H 4RCAA 5FUCE 5EU4A 3EUUA 2H3NB 1X5GA 5BRZD 4HLZG 3QNYA 3UJJH 3QDJE 1CDHA 5J3HD 2VDKL 1KPUB 5ACZB 2F5AL 1S7WB 5CCKH 1H3UA 3OBAA 4UNVA 5HHQA 3KLDA 4PRIA 3TNMB 3SKOA 4Y5XA 5GGVL 4HQQL 4DEPB 3OKLB 3MACL 1F4WL 1U8LA 2O5YH 4NCC2 4DN3H 1IT9L 3CCHB 1A14L 3G08B 1TQCB 5CZVL 5IVXB 3V6OE 5KW9H 4WJ5B 2HKFL 4KRLB 3QUXC 5EZOL 5SWSA 4YGAB 1YMMB 4ODTL 1IZJA 1VPOL 1P7QB 4JY5L 4Q9QH 4H1LB 5GZNC 2J3SA 1DUYB 2EIBA 2RBLA 1FYTB 4EI5A 3D39E 1N5YL 3UBXB 2FBJL 1G6RL 5EIVA 3AB0B 1AHWA 1CYGA 3DXAA 2JCCF 3MLTA 1GRWA 2YPVH 5GPRA 3VXRD 1BQHG 3QUKA 1OLZA 5I1IL 1I3RB 4YE4L 3U2SB 5FUZH 3GNMH 4XNXL 4ZUVB 5EOCL 2MHAB 1INEL 5FYKU 3BGFB 5GGUB 1HHGB 5CD5C 2HT4C 3VW3L 2FYYB 4Y0GA 1LE5A 2R1XA 3GMRA 4RBPH 1FN4B 2XWTA 3DLQR 2X4UB 1KTKE 3MRGB 3ROOA 5HHXL 4B0MM 2V2XB 2NMSA 3SDXE 4X99A 1SM3L 1EERB 4K23L 2K1MA 2I07A 3C5JA 5D72L 4PJCE 3WFHB 4MLIA 4MJIA 2MQ3A 4Y2DA 5FUOL 2B1HL 1HZHL 5J89A 1V8HA 4PTUB 4G9DB 1T5XA 3GHEL 1V7NL 4UIKL 4GAJH 3ZYOA 5BMFH 1MRCL 2IAMB 1D5ZA 4OZFB 2P5WE 2YPLB 2BNQA 1XCTA 2R9HC 2R1YB 5HI4D 5CKGA 5C0BE 2QQNH 5FYLL 4KK6D 5DD5L 3EJJX 3STZB 3AXLB 2AGJL 5KVEL 5HDBF 3V2AR 2SEBA 3FO0L 4ZFOA 1T5WB 1IM3A 4ORGB 3IU4L 1HHKB 4HXBH 1TVDA 4NYLB 3MMEA 5DJ6A 3B6SA 4YHMH 2BJML 4Y4HB 3LPWA 2R0ZL 2OL3B 3SGJC 4NP4H 4BJLA 4WGVB 4X0KB 5D6CA 3HRPA 1NCDL 1J1OH 1RUMH 3LMJL 1ZHKA 1FZOB 1DL7L 2PTUA 5FUCC 4P2RD 4ONFH 2VJXA 2GUOA 5E5MB 1PSKH 4HPOL 4WFEE 4M9PA 3MRPA 3DTXA 5CJ5A 4U1LA 4PRPB 3MLRL 5DQDH 4PP1D 1MFDH 3B5HA 1I8IA 3FQNA 1HSAA 4ODXB 2R0LH 2XN9E 4KDTA 2AERT 1IGTB 3VXSB 3ZT5A 1Q94B 3F7RA 4YDIH 3P4OB 3HE6D 3PWNB 2PYEB 4O02H 4RX4D 2BHUA 1J1XL 3P77B 1X4YA 3L5JA 2UWEB 4AM0A 1GGCH 5DXWA 3V6OC 5D96B 5C09A 3ZTJH 1S7VA 4JZJB 1S9YA 5DVLA 1OTSD 5MHSE 4KJPD 1CR9L 5IF0B 1E28A 2LAAA 1AP2A 2D7OA 3KPMA 2ICWA 4YGVB 2B2XL 3BW9B 1KT2B 2CKBB 5FHAH 3EAKA 3L1OL 3MCG1 4YXKH 4OFKA 4KUZH 4Z77A 4IRZH 4LSPL 1OSPL 2XWJA 1J86A 3NFNB 3RWFA 5B8CB 2HFEA 1J8HD 4Z7VE 5F7MC 1PG7W 5CZXD 7FABH 2OCFD 3RVVC 5C0EB 1LEGB 5JTWA 4S1SH 3L3HB 4ZMAT 43CAB 4MMXC 1CLCA 4U7MA 4F8QA 3BEVB 5CWSA 1VFMA 5FHBH 3P4NA 5KSVA 2HH0H 4PJIF 1C12A 3BGMA 4QRTA 4ZAKC 2PXYD 3OAZK 5HHOA 5DJCA 3MR9B 4DCQA 3T65A 4PGBB 4LSUH 1I1AD 5LBSH 4YHOL 3WDIA 2A6DA 1TJGL 4P49A 3VXQA 1T0PB 1FVEA 3G9VA 4LSQL 3QZWA 5DZOA 2ATPB 5AAMA 3OKMA 4HJJL 5L2KB 3MV9D 5T3ZL 5IQ7L 3OSKA 3RJDA 4N0UA 1NAMA 4MS8D 2DIAA 4KV5E 4X6FB 2EYSA 3BUTA 1W2KT 3VXPB 4XNMA 4YBQC 5J11C 3DV6A 5GGQH 3RPKA 1KJVB 2D2OA 3OAUL 3NA4A 3LDBC 2OXGA 5TH2B 1B6DA 3OKKA 3TN0B 5F9JA 5IIEB 1HHJA 2AEQH 5C86A 5HGDB 1IFHH 2XV6B 3ME0A 4M9OA 3VCLB 2JJSA 4E0RB 2VDRL 4M3KB 4D9RE 3P9LB 1CGSH 4JFQB 2J8HA 4U1SB 2VKXA 1PG7H 3SE9H 3L3DB 2CIKB 4HXAL 1TZIB 3NFSL 4MHHG 2GEEA 4EKXA 4DGIL 4HCRH 1U8OA 4U3XA 1PX4A 1NPUA 3P73B 2R2BA 4QXGH 3RVTD 4QRRA 1CDUA 5EBLA 1XIWB 1MCCA 3ARFA 5IBTL 4NNPL 1XF5A 1HQRA 4NC1E 4UT9H 1ZLSL 1MAKA 3BMVA 1TJHL 1A1NB 3O6KL 2J1KA 3BKCL 4Q6YA 4X9HA 1HXYA 3WXWH 4D3CH 4IHOB 2I60L 1I8LA 2HLAB 4G8GE 4CJ0A 3VXMA 4ZPVB 1NC4B 3JTTB 4R4BB 2FH6A 3QT2A 4LCUB 1SEQH 5I30H 4LQFH 4R97C 1YN6A 4L9LC 2AJUL 1CDGA 1UVQB 4LARL 1T6WA 4V1DB 4NWUH 1KC5L 1E4WL 2FBOJ 5D7SL 3HMXL 2IALB 1Q0XL 3HUJF 3DIFB 2P49B 3VGAB 4K7PH 2Y6SD 1RZFH 5DD6B 2Z92B 4WY7L 2YN3A 2JELL 5KANI 3DOSA 3CPLB 4NDMA 2YXFA 1XF2A 3RUGE 4RAUB 1XR8A 4WW1B 3SO3C 3B9KC 2X4OB 2AABL 3QBTB 1WQVT 2NY4C 5D2NB 1R3IL 3UYRL 2LVCA 1DCLA 4KXZH 4XBGB 2BMKA 5BVJA 2VLLA 3CX5K 4EN3C 2V2WB 1DANT 4NO3A 4ZQKA 4JFOB 1SYSB 5BW7C 5C0GB 2Q87A 3NFPB 4DQOH 1IGCL 3PV6B 3BPOB 3ZL4H 1TXKA 4EUPB 4O2FB 1A6WH 1CGWA 3TJHA 4PJ7B 1MNUL 1DR9A 2XWBB 2DYPD 4IMLB 5MI0C 5IMOB 1K4CA 4UBDC 4M7LT 3B5TA 3KPSB 3QUMH 2A74B 4QYOB 3QDGA 3O2WH 5FIEA 2APVA 1J7VR 3MJ9H 4QWWC 5T5FH 2APBA 4YZFE 3QRGH 4FQIL 1YMHB 1KYOK 3HC4H 2C3VA 3EFDL 4ODVH 4H25B 3UMTA 3QXAA 1EUTA 5DHVB 5BZWB 3F8UB 5KS9E 1IKFH 1XGYL 4P59L 3EO9L 5ISZD 3QIBB 5JPNB 2X4QB 1DDHA 1CF8H 1R3JB 3ZHLA 4TUOB 1G9NL 3P0YL 3FQXA 4NHUE 3V8OA 3MA7A 3KYMA 5F1NB 4PBXA 3QCUL 4X5XB 4OCWL 2XRAL 1A2YA 2O5ZL 4PJFE 3GBNH 1QEWA 3IYLW 3TESA 2P8MA 3FB8B 1UCTA 4NQDD 4KH2A 2V5RA 2I26N 2FZ3B 4PV9A 4NC1C 4CADA 1BF8A 4OLZH 3RZWA 3TPUA 5D7IB 1YJDC 3RNQA 3QIUD 4JQVC 5JUEL 4AENA 1C7TA 2NY2C 2CKBL 1A6TA 3MRKB 4OFYD 2P44B 5E2TL 4JLRA 3IDYC 4LSTL 1I9JL 4KTDL 1U9KA 5AG8A 3N06B 2HG5A 1MUJA 1EHAA 3CVIH 2DRUA 1CU4H 4JQIL 1RZ7L 5GRVL 4UV4H 5FO9A 5HHVL 4YPJA 8FABA 1B2WL 4ERSH 1QHPA 3KHQA 3PJSA 1P9MA 2FDBP 3ESVF 4MXVF 1WF5A 3WKML 2YD8A 5A3IC 2VLRB 3SPVA 3CIQA 3QG7L 2X42A 1AGEA 1Z3GH 4WUKH 5ICZB 5I8EA 4RFEB 3ULVE 5CMAB 3U0TB 1DQML 1QBLH 1T4KA 4NKDB 5E0QA 4H0HB 3LQZB 4XAWH 5E9DB 3VI4F 1S9WB 1BD2B 1EJ6A 1MELA 2YEZB 1TENA 1QQDB 2FECL 2J6EA 3FTGA 1L4IA 1OAXH 1IQDB 3CSBA 4X7DC 4Y5YA 4LKCA 2COQA 3D6GA 4WI5A 1V7ML 3JWDH 3UBXG 4AJ0A 4G80A 4IRSB 1HN1A 2NY1C 3D69B 3QP3A 4OCYL 3MRDB 4A2MA 2BP3A 4MAUH 3VXUD 3LEVL 4QF1B 1E27B 2O61A 2XQYG 3KNBB 3ZT7A 1L6XA 4OUUB 3PWUA 4ZXBA 1CL7L 1EXUA 3WIIH 2IQAB 1EVUA 1MPAL 2FX7H 2BXZA 3WS6C 4PJ9B 4YAQB 4NKOA 2F74A 5DRZB 4GKZA 2NY0B 3BD3A 2GFBA 5FDWA 1MCPL 3U36A 3LV3A 4AY0A 4JANB 3BYYA 3CDGA 5DD0L 4J3UA 1DBAH 4ETYA 4OCSH 2Y4SA 1M4KA 2FX8L 5A2KH 1A7NL 3G6JF 1BQHA 3GRWA 3W11C 2WBJA 3E3QE 5JR1H 4Z7WF 2QR0B 2P8PB 3QHZL 1ONQB 4JM2F 3AU1B 4NQCD 5JXAL 1HKLH 4YDLC 1DBMH 3GIZL 5EBWA 4NO0B 1H5BA 3KPPB 2DTMH 4XHJD 3D25A 5DDHA 4F2MA 1NFDE 1X44A 4OZFG 4Z8FH 4HX1B 5LCVL 3WHXA 4K7PY 1F97A 2JB5H 5D7LA 2ZPKL 1U36A 4QHUA 1EEZB 4OZIA 5IVZB 3UTZB 3BUYA 2V9TA 5EIQA 4L4VA 4TOYH 4DKEL 3JV6B 2DF3A 3QEHA 3S3SA 1QZ1A 5L6YL 1NANI 1CI5A 5D7JD 1JNNH 3MJ7A 1MCFA 3AS2A 5JHDD 3T2QA 4RISH 4MJ2A 2N1KA 4JKWA 1QA9A 3ES6B 3SDAC 2MNUA 3L3IB 3GMMB 5CGMA 4S1RH 1A6VL 4O58L 1KXQE 4PJHA 1XEDA 1I8MB 4TVPE 3RWIA 2WP3T 1SJEB 3QFJB 4XP6H 4ZSOB 3D2UB 1S8DA 2J8UB 4QLRA 4PJDA 2AK4D 5IJVA 3TVMA 2G5RA 4G7VH 1OAUH 2DJSA 3IETB 4QRPE 5C08B 5SWSD 3RWGA 3JWOL 5C0FB 1C08A 4LIQL 4P2QA 5D1ZC 2VYRE 2QL1A 3PGDB 4K3EL 3UTSA 4C56B 3F7VB 2MOVA 4LLWA 4HGWB 4DKFL 3EJYC 3VFGH 2X4PB 4OCRH 1DBKH 3GBMH 3ULVC 4KVCH 3CFIC 4EI5D 3PDOA 1RV6X 4AZ8A 1EHLL 1PLGH 3ARBC 2F53B 3V4VL 3MRCB 1VKXB 2EZ0D 3CK0L 3DXAD 4GW4B 1CFNB 4P46B 2F9BT 5KSBE 2WINB 3CZFB 1NFKA 1CFTB 2VLKA 2WLZA 4WRLA 2H1PL 3SO5A 2BNUA 5JDSA 1M7XA 1OOAA 4KKBD 4JFFD 3OG4B 5F72S 2M8XA 1R24A 5EIIA 4XBPA 3K3QA 2BNRB 3MJGX 1T7ZA 3TIEB 2GYSA 4ORZC 2EE3A 1L7IH 2E9JA 4GFTB 4U1NA 4IRJA 4MJ5B 1AI1L 5JDJA 1G0DA 2VLJB 4XNYH 1GJIA 1AQKH 2DQDL 2F5BL 5DF0A 5I2IA 1PVHA 1OL0A 1Z0NA 4ZOEA 3RNKB 3DMMD 1ADQA 2JJTC 3KS0H 3RAJL 1FCGA 5TDNB 5HVGB 3WLWD 1KN2H 1VESA 5D4QA 2R0KH 1UWEL 5BS0E 1H3PH 2MCG1 3CFKA 5KVFL 3GB7A 3T0EA 1AO7E 1UXWB 3CFCH 1CFSB 3QA3B 4PRHB 2HFFB 1NLBH 2IBZX 2VDNL 4HBCH 4NM8L 1NKRA 3N1QC 2EDRA 5GGTA 2DQIL 2AJSL 3E3QC 2W91A 3RX7A 1YNLH 2PTTB 2E27H 4JPWL 1BAFH 1IM9D 1DQDL 3BT2H 4IDJH 5EWIL 3BKMH 3V8CA 3C60A 4M1GH 5GS1B 4JM2D 4TRPL 1HI6B 4X4XA 4YH6A 3VWKD 5F88A 3I75B 2HJKB 4EXPX 2DD8H 3ZKMC 3UJIL 1NCWH 5I1EL 3MCKB 1MF2H 5B39A 2FJGB 4H5SA 4NM4L 3V95A 4AH2A 2DI8A 4ZS6C 1BQLH 1RUPL 4QEGA 3EBAA 3Q0HA 5DSCB 4PJ8D 5T1LA 5L7XH 1G6RA 4W4NA 5DI8A 2NX5A 3ZDXF 2W0LA 1OP9A 4PGEB 1FGNL 4WUUB 5EO1B 1D5MA 1DUZB 2FIKB 4HUNB 1KXVC 2FRGP 5CINH 3E2HA 4GLRH 3THMH 3P30H 5GRXG 3QQ4A 3EOTH 5F9OL 3MSPA 4OGYL 1JZ7A 3S34H 5EUOF 2NY6B 4I0PA 3SHSA 2IGFH 2ZJSH 4OBSA 1E4XL 1NSNL 2J7LA 3WKNA 3GJEB 3O11A 3R1GL 4GAYA 4LBEA 5BV7C 1UWXH 4W6YB 4LU5H 1KB5B 4ISVA 2NTFB 4KROB 4OZGA 3FCTB 4N8VB 2BSSB 4LOUD 1FFOB 1XGPB 4WVRA 1JGVL 2OR9L 2Q3AA 3QEQE 1CT8A 1KNOB 1QO3B 2ZUQC 3K2MC 4FQXC 4GMSH 4IOFC 2EICA 4M5YH 2HN7B 2Q6WA 3B2VL 1JGEB 1LP9E 1LO3L 5HHOD 2XFXA 5F6IB 1BJMA 4ESKA 2HTLC 3O2VH 1LILA 4MVBA 3LS5L 5DWUH 5FO7A 2IANE 2B0SH 4W6XB 2NY3B 5HI3C 5F3BB 4WHYH 1OPGH 4CAGA 4EUPG 4X7TB 1HHHB 1LDPL 4X7FC 2EH7L 1F4HA 1LD9B 4MWFA 4NUJA 5IEKB 2HFGH 3CFDB 3L3GA 1CE1H 1BQSA 5DEZA 4R96A 1YEGH 4ZS7H 3CMOH 3QCVL 4RMSA 5FOJA 3EDFA 3TBTA 3CLEH 1HE7A 5FYJL 3CH1A 4X4ME 1JF1B 5JO5A 1JHTB 4V2CB 1FNGB 2F54A 3HFML 3NN8A 4YK4B 4ZUTB 1S7SB 3I50H 4NZDA 4HWBL 4A6YL 3LEYL 1C5CL 3DGCR 4AG4H 2H9GB 4LEXH 35C8L 1CQYA 2LE9A 1MFEH 3W0WD 3WS3A 2FGZA 2JK5B 4ZO8A 1A4KA 1MHPL 4FNLL 1RIHH 3S5LA 3ARFD 3MV7A 1AD0A 3U7WH 1N6QH 1DVFC 5C92A 4YHLH 2CRYA 5JMRA 1D9KD 3G5YA 3C08L 4PB0H 3PL6A 4Y5VC 3EOBA 4BH7B 4LCCA 3TT3L 1YEJL 4HJ0C 5CEXB 2EYRB 1ZTXH 5IB5B 2VXUH 1P5VA 4ELMA 2YK1H 2F8XC 2XOTA 2BCKB 3B4NA 2XT1B 4ZPTA 5IWLA 4KPHL 1A7QH 3GSXA 1G7MA 4KRPB 3MLWL 3SE4A 1TFHA 2CGRL 4PG2C 4JG0L 4WEUD 1YNKL 2H41A 3BQUB 3L95B 1WFUA 3ZKND 2H32H 5ANMA 4XNUL 1EDQA 3UDWC 5HDLA 4G5ZH 4KI1A 2XTJB 1FDLL 2ZCKH 4KZEL 4F33B 3HHRB 2E7HA 2I24N 2VISB 2ADFL 1K2DA 1YDPA 1QLFA 2XA8L 5HGGS 2LVEA 4UB0H 1CDYA 4KHTH 3HNSH 3WXVL 4M6NL 3ARDB 2ID5A 2H3NA 1IE5A 4JPVH 3MGOB 1KPUA 1NCUA 4APQA 1YQ2A 4JVWA 2W9DH 4N9GB 1S7WA 1IAKB 3LB6D 1VB9A 2VDKH 4G43B 1R5VB 4PJBB 3TNMA 2HRLA 2F5AH 2E3VA 3TJHD 2LTQB 3H2WA 4FQJL 4Y2OA 3OKLA 5LJYH 2VABB 5I66A 1KPRB 3ERYA 5GGVH 3CCHA 4HQQH 3G08A 5IVXA 3MACH 1F4WH 2HMIC 2UVEA 4WJ5A 1IT9H 1PGRB 1A14H 1A6ZB 5CZVH 1AGFB 2HKFH 1YMMA 2BFVH 1F11B 3UJTH 1FNSL 1P7QA 3STBA 2GJZB 3SBWA 3TBWA 3VMNA 4DZ8B 3UPCA 1VPOH 4H1LA 1DUYA 4RBPK 3H8NA 1FYTA 3UBXA 5D1QC 4FG6C 1OAQL 1HK6A 3QUZC 2MSPA 1N5YH 2FBJH 2WAHA 1I3RA 3T08A 2XZCL 3U2SA 4QHKI 4PJ5E 4ZUVA 5D6DC 5I1IH 2R69L 3TF7C 2MHAA 4YE4H 3RX8A 2GSGB 1RUKL 5GGUA 1HHGA 1WBXA 4XNXH 2D9CA 4GO6B 5EOCH 1INEH 1AXIB 4I0CC 2DN7A 1FN4A 3VW3H 1JPFB 1P1ZA 2X4RB 2X4UA 3MRGA 1TQBB 3SDCB 1CICB 2V2XA 3DHMA 5HHXH 3BDYH 2R2EB 3WFHA 4KMLB 4KGJA 3AAZB 5D71L 5EORL 1F2XK 3BJ91 5D72H 4FFWC 4DVRH 4JRXB 4P5TD 4XNZB 1D5BB 1Q9WA 2NXYB 4PTUA 5FUOH 4G9DA 3I6LE 4G7YL 3KPNB 4G6JL 2B1HH 3TCXA 4LVEA 2DMCA 3DX7B 5FF6B 4UIKH 1V7NH 3HTLX 3L7EA 4OZFA 5HHME 1B0WA 3KPRE 2R1YA 5I1CL 3S96A 2D0GA 3ALPA 2D7PA 3STZA 3AXLA 5KVMC 5FYLH 3HZVB 5DD5H 1JZ5A 2E9IA 4KMTL 1X5LA 4ORGA 2AGJH 2VQTA 5KVEH 5D8JL 3FO0H 3VH8B 5EUKB 4NYLA 2RAMA 4JFDE 4WWID 4QTHA 4G8EB 4Y4HA 5I76B 5J12B 2OL3A 4X0KA 5F9AC 2BJMH 1TTUA 1UH2A 2R0ZH 2MFNA 1WWWX 1FZOA 4MDIB 2UY6A 5I18L 2YRPA 1NCDH 3LMJH 5E5MA 1WZKA 1DL7H 1DSFL 2LV4A 3X13B 3CSYB 4WGWB 1FORL 3CD4A 1LNUB 3IU3A 4PRPA 3VD7A 4HPOH 2ENYA 4QXWA 3GEWB 2WZPD 4ODXA 4NKIL 4R2GC 5HGHB 3CUPB 3VXSA 5DUPL 3V6BR 1Q94A 2P7TB 3P4OA 3PWNA 4DGYL 2PYEA 2AQ3A 2UUDH 4NQEA 3P77A 2UWEA 5I6XB 5MENE 1F5WA 4D0BB 3W2DL 1Z5LB 1J1XH 4JZJA 2YBRB 2FHBA 5IF0A 1B0RA 2ADIA 1CR9H 1WZLA 4UDUB 4YGVA 3BW9A 5GS2D 2Y5EA 4YWGL 2B2XH 2YD1A 4J3TA 1JFMA 1YY8A 3L1OH 5TQ0H 3NH7L 3VD3A 3NFNA 3C9NB 1LO4L 3PQYE 4XVUD 3R8BB 1OSPH 4FRWA 5C0EA 4O2EB 3FMGL 4I9WD 3L3HA 43CAA 4LRIC 4NUGL 3BEVA 5E2VL 5E8DL 1PY4A 4RA3A 5E6IC 2FEDD 4U1IB 3AMLA 3MR9A 1KIPB 1H15B 1RJZB 4XNQB 1BBJB 2W59A 4CMMA 1MEXL 2ATPA 5HHPB 1T80A 2OI9B 4YHOH 1TJGH 5L2KA 4LSQH 5IFJA 2R23B 2YOCA 4HJJH 4X6FA 1VEMA 3VXPA 5IQ7H 2GY5A 3UO1L 3Q1SL 1KJVA 4HUUB 4RGMC 3F7QA 1KJMB 5TH2A 1BVKB 3TN0A 1F3RB 5FM4A 1FE8L 3FFCB 5IIEA 1F42A 3GJFH 1INQB 1K5NB 3I3BA 5HGDA 5L2JB 43C9B 3VCLA 5B3JF 5T1DL 4E0RA 3UTSD 1S9VB 3P9LA 4JFQA 1ED3A 3WUWG 3HMWL 2QLVB 2VDRH 2C5DC 1UZ6F 1SEBB 5HI5D 5E70A 4OQTA 2FJFB 4HXAH 3NFSH 3T8XB 4LPUA 5GJTH 1VHPA 3P73A 4GKOA 2VLKD 4XRCB 2HVKB 1XIWA 4W81A 3M1BA 3IDMB 2X1XR 2YWYA 3S3PA 4K9EL 1OGTB 3GSVB 4OJFL 4N8VG 1JPSH 3FZUC 5IBTH 2DOCA 1U8NB 5E7FA 1QFWI 1A1NA 4LGPB 4MNQE 4QXUL 1JBJA 4IRJD 1TJHH 1K9TA 3O6KH 4PYHA 3QAZB 2HLAA 4HIXL 4WU5A 1J18A 4HKBB 4XX1E 4JGMA 1NC4A 3JTTA 4R4BA 1UWGL 2I60H 1AKJB 2BC4B 2RJMA 5HYJB 4LCUA 5I17A 2XTLA 4R9HA 5A2LH 4LEOB 5IHBA 5E4EC 1GAFL 4V1DA 4OT1L 3KXFE 2D4DA 4HKJB 5C2UB 1FSKB 4LARH 5JORB 1U93B 2IALA 2YD7A 4E42B 1I9EA 1KC5H 1E4WH 2X44D 4J3VA 5D2LF 5D7SH 3HMXH 1KIQB 1Q0XH 4G8IB 5DD6A 2Z92A 4O51B 4UUJB 3IVKB 1CXKA 15C8H 4JFEE 3CPLA 4WY7H 4RAUA 5F96L 4PD4J 1XAUA 4WW1A 2X4OA 3C60D 4GRMA 4P4RB 3H9ZA 5D2NA 3ET9F 2AABH 4XBGA 3OKNB 1R3IH 3UYRH 5I8CB 3GIVB 5IOPB 2APWA 2QSQA 3U0PB 2V2WA 4JFOA 3ARQA 1SYSA 4U2YA 5C0GA 3NFPA 5D1XC 3VRIB 4XPTL 2B8OT 2F19L 3QQ9D 3WJLC 1HCFX 3IDJB 3PV6A 4EUPA 4F58L 3T2NL 5T1LD 4O2FA 4RSVA 3OJVC 1N0XL 1DANU 4XP4L 4PJ7A 2XWBA 4IMLA 1NMAL 3BZDA 4WI6A 5IMOA 3SCMD 1KCSL 5AZ2L 4QYOA 2A74A 1YNTB 5DS8B 3BPLC 3OV6A 3N9GL 4MD5B 5BRZB 1D3CA 2FD6L 4Z78B 1YMHA 3KYNA 4I0PD 3RBSA 5GZOD 2DLIA 2ARJB 3VMPA 5GS0H 4I18C 4FQIH 2V5MA 3JVGC 1SQ2N 4H25A 5DHVA 1VENA 5BZWA 3B2UD 2B39A 1NGPL 3QIBA 1U8MB 1YZZA 5FKAB 5JPNA 1KEGL 2YKLL 1XGYH 4P59H 5FECB 4KKCC 2WP3O 1S7RB 3N85L 5DEFB 5F1NA 5ADPL 4OV5B 4NOBA 3P0YH 5IR1B 5GRJL 3PGFL 3K8MA 1RZJL 3LPGA 2P5EE 1BIHA 5K59E 1QP1A 3QCUH 3FB8A 4OCWH 5IM7A 2XRAH 2O5ZH 5FYLD 4HMCA 1MI5A 1HYSD 2FZ3A 2P8LB 3O2DA 1LK3L 3QDJB 5D7IA 5GGRB 1T3FB 3VXRB 4TULL 1MFAL 4OGAD 5JA8B 5M7QA 3NMEA 5K9JL 2JIXB 3MRKA 4KKAD 2BVPB 1PJ9A 5JUEH 4YX2L 3VFSB 1ZA3A 3D18B 2OXHA 4LSTH 5I8KH 1I9JH 4KTDH 4WNQB 4OF5A 1DQQA 2Q20A 1OTTD 3CVHL 1WCQA 5E94B 4JQIH 5H35A 1RZ7H 4WW2A 4K94L 3T0DA 2Z31D 4CN1A 1FVDA 5HHVH 2VLRA 1B2WH 4L8DB 5ICZA 4RFEA 4QTIL 3WKMH 5CMAA 3U0TA 3QG7H 1RZGB 1PEWA 4NKDA 4XCYB 5E9DA 3LQZA 1S9WA 1BD2A 1EEUA 2YEZA 2C7UA 6CGTA 4N1EA 3PWPE 1QQDA 2D0HA 1DQMH 4KVNL 4H26B 4N0CC 1V3JA 1IQDA 1WC7B 4GLRI 5EA0L 4NBZB 1GOHA 1A7OL 2WIMA 3MJ6A 5TE6L 4IRSA 3D69A 4HMEA 3MRDA 2OSLB 1V7MH 5ERWB 4QF1A 1E27A 4ZAKB 3VFNB 2NXZC 3KNBA 1R0AH 1WT5A 3HG1D 5CJBA 3LEVH 5CBAB 1IGFL 1CK0L 1IARB 2OMBA 3E6FA 3LQAH 5C0AE 3AMKA 4N5EA 1CL7H 4OIBA 5SWZD 2H45A 1F6AB 4YAQA 5CEZE 4HUXB 1RHHB 5DRZA 1M71B 4P2RB 1PZUB 1NUDA 4JANA 3K1DA 5B4MD 3O6LL 5CIPB 3LDBB 5EC1A 3MRLB 2V5YA 1JYWA 5CHNB 5DC4B 5DD0H 3GI9L 2JKXA 3MLSL 4RDQF 2DIJA 2QR0A 1A7NH 3LKPB 2P8PA 2X9WA 3NIDF 1ONQA 1BIIB 2VXSL 3AU1A 3HE6B 3OF6A 4Z6AT 1U3HD 4KY1L 5T3ZD 1U3JA 2EXWC 3KPPA 3WE6B 3K4DA 1WFNA 4DKAA 4I3SL 3IS1X 3GIZH 1MJ7L 2EC9T 4HX1A 4KQ3L 3WFDL 2C3WA 3SKMB 2IQ9L 3GUTB 4X9BA 4Q0XL 4DFIA 3WCYA 2FNBA 4G6ML 5LCVH 1MIML 3LY6A 1QFHA 4BZ2H 1KCGC 1KBGH 1EEZA 2W65B 1L0YA 5IVZA 3IAPA 4HAFA 2ZPKH 4I5BB 3WJJC 3UTZA 3V6FB 2E7LE 3VH8G 3MLYH 2ZZUT 1ZEAL 3JV6A 3KLSA 4U1GB 1AQDB 1MAJA 2NW3A 4Y1AE 4Y19E 1JYXA 5FOBB 1J8HB 3TM6A 4ZUSB 3DBXB 1OWWA 3MNWB 2VOTA 1N3NB 3ES6A 3L3IA 1QSFE 3GMMA 4FHBD 1F6LL 4HULB 1I8MA 3IDNB 7CGTA 4M7JL 2NR6C 1A6VH 1SJEA 4O58H 1MCNA 4ZSOA 3D2UA 2J8UA 1WAAE 3K4ZA 3P0VL 4NCC1 4R97B 2MCPL 5JW4N 3SY0B 1I1AB 3IETA 3TO4C 1G7LA 5C08A 2FGWL 3I3EA 1P6FA 5C0FA 1UM5L 1IC5L 2OLDA 5HDOA 1P7QD 5DRWB 1U92B 2HT3D 4C56A 4MD0B 3F7VA 4KUCF 3HPLB 3JWOH 3MV9B 4HGWA 4LIQH 2X4PA 1JFQL 2Z91A 4KDVA 1FYTD 4DKFH 5CKAA 2F53A 3MRCA 3OR6B 1VKXA 1RK0B 2CDGB 5F1IB 1S7TB 4YXHL 4GW4A 1CFNA 4P46A 3SDYL 4Z7VB 3V4VH 4W70A 4R4NC 1NDGB 2WINA 3CZFA 1CFTA 1HDMB 3CK0H 4Q7DA 4JFXB 2NY4B 5KVGH 2H1PH 1W72L 3ZDYF 4OIIL 1T89C 3C6LD 1FFQA 3RVWD 1ZT1A 2BNRA 3TIEA 4YDVB 3MV01 4YR6B 2RFXB 4KRNA 4MCZB 4MJ5A 4MAYC 2VLJA 3H9SB 4H8WH 4ALAL 2IC2A 3BZ4B 5IMMB 1AI1H 4GRLC 3RNKA 5TF1L 3PNWB 3VFWB 3U0WL 2DQDH 2F5BH 5TDNA 1Q1JL 1NH6A 3TGXA 1F58L 2CDFB 1HQ4B 1P84J 1UXWA 3QA3A 1CFSA 1MSPA 5ICXB 1UWEH 2HFFA 4PRHA 4QGTA 5KVFH 1YPZE 4HS6B 4O5LL 1OB1A 2IAMD 3MRFB 2VDNH 1QRNE 2YPLD 2VAJA 4JG1L 4NM8H 1A8JH 2PTTA 3CNKA 2DQIH 3QB7C 3TEUA 4YHKL 2YC1A 1IZKA 5CJXC 1CG9B 4UDTB 2ESVD 1NGZB 3RZCC 4EOWH 5J57B 1DQDH 5EWIH 1B4JL 5GS1A 2EE2A 1HI6A 2HFTA 4XI5C 3I75A 1ITBB 3VWJC 1ZANH 5KAQF 3OXSB 4GJTB 1WGOA 4NWTL 3MCKA 2R29L 2DI7A 2WUCL 2FJGA 3UJIH 2E7LC 4P2YA 1I1YB 5I1EH 1DLFH 2XPGB 5JXEA 5DJXB 2C3HA 4QRUB 4PRIE 5IBUG 4NM4H 5DSCA 4PY7B 3QO0B 2DQTL 1JGUL 1RUPH 3VFTB 1A9EB 1U3YA 4FQ1L 4PRPD 1AR1C 1XMWA 5JW4M 1D6VL 3LH2L 2GCYB 5DLML 4HH8A 3D48R 4PGEA 1T0MB 4WUUA 5EO1A 1DUZA 3VXSD 2AJVL 2FIKA 1UADC 1FGNH 1FG2B 3IDYB 3H9HB 3D5OF 3IGAB 2G9HB 5F9OH 5K93A 4OGYH 4WEBL 4I4WB 5E99L 2H6PB 3GJEA 4PJIB 4IMKC 4WFGD 1E4XH 5D5MF 2C3GA 2DYPB 1NSNH 4GG6F 1JTTA 2BK8A 1WJ3A 1OP3K 1XF1A 4LPYA 1KB5A 5F8QC 2HLFC 2FX9H 4L8CB 3QUYC 4QHMB 3K80A 4KUCD 2GW5A 4NZUL 3FCTA 3KYAA 4N8VA 1TTGA 2BSSA 1FFOA 4YIQB 1S7QB 4GW1B 3ILQD 4TN9A 1QO3A 5DJYA 3GK8L 3JTCA 5I1GH 1BFVH 1XF4B 1JGVH 2HN7A 2OR9H 5F89B 1Q38A 1JGEA 3EW3B 1KUMA 2NY1B 2VAAB 3UYOD 5E56A 5ISZB 2QTEA 3BPNB 3MBEC 4NFBA 3B2VH 1LO3H 1AD9B 1OW0C 4XGZB 5BOPA 4K7FB 5KANG 4MJIE 2V17L 1VACB 5GS0C 3W82A 3LS5H 1PBYA 1L0XA 2QSTA 5F3BA 1H0DB 4AMKL 3O6FA 3MNVB 5ID0B 1DTUA 1S9XB 2OR7A 4WTZG 5C1MB 1T7XA 3PHSA 4Y4KC 1TVBB 2BNQE 2QQQA 1EO8L 1LD9A 1VADB 1MJJB 3AGVA 5DMJB 2HAZA 1LDPH 1T1WB 3CFDA 4JFHD 4QHNB 4QOKE 4TPRL 3QIUB 2EH7H 4NGHH 3O8XC 4RNRB 3ESUF 3CDYA 3AFLA 4HIIB 5I15L 1X5IA 4FQHB 3TCLB 4OCMC 1RZIA 3QCVH 4YDLB 1LDSA 4X4YB 5FYJH 1JHTA 1FNGA 5LGJB 1NMBL 4KAQH 4ZUTA 3G9AB 1S7SA 3LIZL 3HFMH 2A6JB 5DK2B 4HIEA 1BECA 4MCYB 5J13C 3G6DL 2H9GA 4HWBH 4OFVA 4A6YH 1C5CH 2I25N 2N7AA 4ODWB 3HCVB 4MMZC 1TMCB 1MHPH 4FNLH 4DN4L 4UT7L 2DTSA 4I2XA 3NIGE 1BM3H 2VQ1B 3HUJB 4Y5XC 3EJZD 3NCYS 2I27N 4BH7A 4ZD3L 3C08H 3N1PC 1QSZA 3GI8L 2EYRA 4XBEL 4QHKJ 5C09E 4BZ1L 1NMCC 2HYMA 3IXTA 5IB5A 1XF3B 1YEJH 4M1CC 4GW5B 1N6VA 1NC4D 2BCKA 4X6DF 5DT1L 3HB3C 3QFDB 3D85D 5FK9B 3QXDB 3O9WA 1RUAL 4KKLC 5TDPB 5SWQB 1RMFL 3MLWH 3H9YA 4BQBA 1KCVL 5I9QB 4Z0XB 5IESL 3MRHB 4JG0H 5D9SB 1J8KA 4FFVC 4NN7C 2HJFA 5D1ZB 4JQXA 2BY3A 4IOIB 4OI7A 2DLFH 4JFPB 3QQNA 4CU6A 1KLGB 1FZKA 4F33A 4XNUH 4DTGH 4K55A 4KZDL 1FDLH 2VISA 4BKLB 1X5ZA 5HVHC 3LQAC 3QHFL 5ENWA 3C09B 2ADFH 5HHOE 1ORSB 1XR9B 3FB5B 3TBSB 3ARDA 3KPTA 1MFBL 3WXVH 4NQCB 2KBGA 4GS7C 4F57L 4X5WB 5DJ0A 4Y16C 4NBYB 1DEEB 3MGOA 4C54A 2R0WL 5FYKE 1KFAL 4N9GA 1RK1B 1IAKA 3N1GC 4N0UE 1C1EL 1XGQB 5EO0B 4G43A 1R5VA 2DJ4A 3CXHK 4PJBA 4AEIL 4Y2DC 4WI7A 2XY1A 4F7EB 4CRPA 1IC7L 1U8PB 4KK5D 2VABA 1KPRA 1QR4A 3KPSD 4HLJA 1WISA 4FQJH 2B1AL 3UJJL 4PGDA 3Q5TA 3CH8A 1A6ZA 5MERB 4HWUA 2CPCA 2DLGA 4NKMB 2WBKA 5D7JB 1F11A 2GJZA 5JHDB 1Y6KR 4DZ8A 5K9KB 4FZEL 4Z9KB 4FTVE 5DVMA 3QI9D 4UTBL 3DVIA 1B0GB 3PV7A 3QIBD 2YA2A 1T2QL 3MLXH 4QRRE 1BLNB 1YJDL 1OAQH 1FO0L 1RHFA 1CDBA 3EOAB 1NFDB 2DKUA 2AK4B 1JHLL 1HWGB 4KI5E 2EXYC 3P11L 5ETUB 3RWCA 1ZLUH 2XZCH 4PJXF 2GSGA 1ZKAA 1D5XB 3TC9A 2RR3A 1C5DB 2XZZA 4HG4K 1RUKH 1L6ZA 2YPVL 1C5BL 2X4RA 4OLYH 5J0BA 4KDTC 3SDCA 5DMGC 1CICA 2BVQB 4X7SL 1BEYL 3VXME 2CUHA 4K8RL 4AQOA 2R2EA 2D31B 2J8UF 4QKXB 3AAZA 1J5OL 1G7HB 3LD8C 3UTQB 4U6VH 4Z5RB 1I4FB 4JFFB 1D5BA 5GISL 5D71H 4PGJA 3KPNA 1OGAD 1U95B 25C8L 4M4PA 4P2CG 2A2QT 4G7YH 4G6JH 1G1CA 1ULVA 3DX7A 3K8KA 2PN5A 4QRPB 3MGTB 1GGBH 2V7NB 3JZ7A 3TJEL 5I1CH 3U30C 3HZVA 3FKUS 1CLZL 3OB0K 2Z35B 2CD0A 3VH8A 5EUKA 4Z7UF 2Q8AH 1I7TB 4KMTH 4XVSH 5TGBB 4G8EA 5D8JH 3HZMB 5BMFL 5I76A 3SDDD 2H26B 4TSAL 5ALCL 1EHNA 5J4MA 5KSBB 1GGIL 4H8WC 3ARTA 1FL3B 4GT7A 3BHBB 2ZUQB 4MDIA 4RMTA 1RSFA 4IRSD 3QUMB 2MQ0A 3X13A 5I18H 5I74C 3CSYA 1IM9B 4HXBL 3G6JB 3V7MA 3ALWA 1LNUA 3ECBB 3OX8B 2J4WL 4Z7WB 4RMWA 3QDGE 1FORH 3TBVB 2NZIA 4JM2B 1I3UA 2Z8VC 3G5XA 5HGHA 1EIBA 3CUPA 3VWKB 5IGXL 2P7TA 4PJ9D 4P3WA 1NFIB 4ZTOL 1SYVB 2X7LB 3RTQD 4DGVL 3ZE1E 1XGRB 3J7HA 2NY0D 1F3DJ 3U4AA 3MOBL 1PSKL 1HNFA 1Z5LA 4P5KB 3BIAX 2X4TB 5E4IA 3ULUF 4K71C 4PJ8B 1U58B 3W2DH 1MFCL 2YBRA 1AO7B 2ZOKA 1MFDL 2JJSC 2BVOB 1CXEA 4UDUA 1FLRL 4F7CB 3BFOA 3PF2A 3X3GL 2N4IA 4D0DB 1IEBB 4RWYL 2VNCA 3LSOB 2EIZB 1BQUA 5MP6H 3V52L 3CFJB 1G9EA 2X1OA 4YDKL 1EO5A 4NO0D 3C9NA 3MUHL 4YWGH 4N90E 1QFUL 1KJ2H 4J1UB 3NH7H 1NGWB 2VL5B 1LO4H 1JWMB 4KI5C 4M7ZC 3U6RB 4JEGB 3FMGH 1XT5A 4NN6C 1TITA 4L4TD 3TPUE 4U1IA 3SGEI 5E2VH 4HK3J 4XTRC 2VDOH 3MXWL 1KIPA 1H15A 4MJ4A 1RJZA 4ZOBA 5FYJD 2D03L 1X5JA 2DKMA 4OCLC 4XNQA 1BBJA 4S11A 1Z6JT 4G6FD 1VFUA 3SDDC 1I8LC 3DYMA 5HHPA 2OI9A 3K4AA 4Y5VB 2R23A 2WUBH 1SHMA 3ULVL 1GOGA 5KBNC 2FEEI 1KJMA 3QFJD 3UO1H 3Q1SH 1P7KB 1BVKA 5LBSL 3TLRA 3KG5A 1R3HB 3SJVD 1KTDB 1INQA 1K5NA 2FLRT 1FE8H 3T77B 5L2JA 2W92A 43C9A 5CZKA 1S9VA 3TV3L 3Q6GL 3QNZB 1E4KA 3WD5H 2QQKL 2WM0A 1WWAX 3I3DA 4U31A 4F37K 3EYSL 2W1NA 2FJFA 3HMWH 4V3EB 4PPTA 3MUJA 1AH1A 4P46D 5F7UA 3MA9L 2CH8A 2AEQL 4R26L 3EOYG 2FO1A 5F7LB 1ZLWH 5T1KD 4XRCA 2HVKA 3IDMA 1CVRA 2X89D 1QFOA 3REVB 4L1HA 1FL5B 2XQYK 4XPGL 1OGTA 2GIYA 3SE9L 1T66D 2YD6A 3MLUH 1LP9B 2BX5A 4CMHB 2E7MA 3S88L 4L29B 2Y72A 2NZ9C 4HCRL 2BNRD 4JREC 1U8NA 4OJFH 3X3FL 3C5SA 2AKRB 5E8OB 4QXGL 5L8LB 4XXDB 2VN4A 4QXUH 1QFPA 3EGSB 1KCLA 4HKBA 5C0JB 1JZ3A 2L4OA 5IW6B 5TF0A 1AKJA 4GMTL 1QSEA 2BC4A 3W0WB 5HYJA 1QBML 2KL6A 1TZGL 1UWGH 4MQXC 4LAJH 1JYNA 3BWUC 1X6LA 4NFDA 4EJ1C 4G6AD 5C0CE 2DQFA 1S3KL 1Q9LB 4HKJA 5JQ6L 1Y6MR 2VDLL 4R0LB 5JORA 4M6OL 1U93A 4E42A 1GAFH 4OT1H 1P4BL 1FAIH 4NO5B 3ULUD 1KIQA 4G8IA 4UUJA 4P3CL 5IVNA 3IVKA 3IJHB 1JMXA 5D7LE 3UX9B 2AEPL 2XICA 4JN1L 4OZIE 3BIBX 4P4RA 4M4RA 2PW1B 3BN9D 4TSBL 5F96H 4NNYB 4P4KC 3L5XL 4I3GA 4L4VE 4UAOB 3NCCB 3OKNA 5DFWH 5I8CA 3GIVA 4MA1B 4TVPL 4PLNC 5IOPA 32C2B 5EUOB 3U0PA 4LVHB 3WN5B 4QT5B 1Q0YL 3VRIA 3IDJA 4PJAE 4WTZA 1OY3B 3LQMA 4XWGL 5J1AB 4PJHE 4F58H 4X6CF 3T2NH 5BV7L 1N0XH 4PR5B 4POZD 1ZLVK 5L88H 5ABDE 4XP4H 3FO2B 5CBEB 1NMAH 2ICWI 4WUUD 1Q8MA 1YNTA 3ARED 3KJ6H 5DS8A 4PJDE 3DX6A 4P3DB 1KCSH 5AZ2H 4MD5A 1J05B 2VZTA 5BRZA 3O4OB 3ZTJG 4LVOC 3N9GH 1LEIB 4P2QE 3RWEB 3ZL4L 4Z78A 1P9MC 4L3CB 1S78D 3CFBB 2ARJA 1JPTL 1X5KA 2FD6H 4MSWA 4DFHA 4DK3A 3WNOA 1R3KB 1A22B 2DDQL 3PUCA 4E41D 3LHPH 1U8MA 3VG0L 3IAGC 5FKAA 5FECA 1X4XA 3RDTC 4DUXA 1NGPH 4IS6B 4Y5YC 2Q1EA 1KEGH 2ADJB 2YKLH 3QRGL 3WIFB 5DEFA 4HS8L 4XCFL 4OV5A 2AJZA 5IR1A 3SGJA 5E08L 3N85H 2OMNA 1TDQA 1BZQK 5ADPH 5C0ND 3MTRA 2HTKD 5JA9A 5GRJH 3PGFH 3T4AA 5GRZA 1RZJH 2ZNWA 4ZXBC 3PP4L 2BRRL 3HN3A 2DM3A 5JZ7D 1HIMH 3QPXL 4M00A 3SE8H 1F13A 2IBGA 3PIQB 5I71B 2P8LA 4YDJB 5GGRA 1L9MA 1T3FA 3VXRA 5EBMB 3VGDA 1LK3H 3QG6B 2JIXA 2BVPA 2V9QA 4TULH 1MFAH 4R2GB 2O5XL 5K9JH 1FJ1B 1VEOA 2J2ZA 3PE9A 3T0EE 4YX2H 4CBPA 4HWEL 3D18A 3VFSA 4N9OB 3LVEA 4IIQB 4WWKD 1NKOA 2Y9RT 3V6OA 4WNQA 1T7YA 2WBJC 2ZUSA 1EO7A 1DN0B 4CNIB 4NZTL 2LABA 1ZVSB 4HC1L 3CVHH 4R3SB 1H5BC 2FHFA 4HJGB 1K8IA 3LRSB 4K94H 3EHBC 2VDML 1RZGA 4XCYA 1NJ9B 1TZHB 2VUYA 4QTIH 1CXFA 1MH5B 4P5TB 2GJ6D 4FP8L 5D93C 3O3UN 4H26A 5C07D 1WC7A 5DD3L 2EDQA 4KVNH 1WTGT 2DKSA 4HT1H 2WWMC 2P4AB 3JV4B 3MUGB 2OSLA 5ERWA 1A7OH 5E6IB 3VFNA 4PYGA 1QBLL 1EEYB 2NX5E 3AY4C 3E6HB 5CGYD 3DETC 1OAXL 2OR8A 3U4BH 1CK0H 4R8WL 1KGCE 3Q5OA 5CILH 1F6AA 5INCB 1RHHA 1OHQA 5I73C 5EFIB 3K74B 1M71A 4P2RA 3TVMC 4F3FB 1TJIL 3GM0A 4RGMB 5CIPA 1ODAA 4KRPD 3MRLA 3MFFA 1X9QA 3WIIL 1CGTA 4J6RL 3O6LH 5CHNA 1FC1A 4LPXA 4KU1A 3MGAA 3LKPA 4P2OC 3BQUD 3KPRB 1WZMA 3GI9H 3T3ME 1BIIA 3MLPA 1LO5B 3MLSH 3HE6A 4WTWA 4HUVB 4E5XB 1NCNA 4OZGE 4RX4A 5L9DL 3WE6A 2VXSH 2GT9B 3UTTB 5ITBL 2HRPH 4KY1H 1NGQH 4U4BA 1A4JB 3GSQB 4KGLA 1SJXA 5J8OA 3FN3A 5GIRB 3SKMA 3GUTA 1ZHNB 2QADD 3QJHB 3U9PL 1MJ7H 3ZDZE 2EDHA 4KQ3H 1QRKA 1MCWM 2IQ9H 5JR1L 1NGXB 4Q0XH 2W65A 2EC9U 1QFWL 4I5BA 1MIMH 1EJOL 3V6FA 3ARDD 1NBYB 3V5KB 1DBML 2VKWA 2VTFA 1AQDA 4JPIB 5SV4A 5E1HB 4FXKA 5E5UB 1QOKA 1ZHLB 1ZEAH 5FOBA 1J8HA 1HEZB 5KSUB 3L3JB 3AC0A 4YHPB 4ZUSA 3DBXA 1I3GL 3MNWA 5A1AA 2MMXA 3QIWD 2KUTA 3TZVD 1TTFA 3F5WB 3T1FB 4PLKC 3IDNA 2AQ1A 3T0EC 4PJGF 2PXYA 3ZE2F 4WU7B 5IB2A 3MRIB 5IBLD 3O3DA 4M7JH 2BVYA 2YD9A 3SY0A 1X3DA 2EDWA 1I1AA 5E4EB 3P0VH 2MCPH 3KHOA 4U0QB 5DRWA 1F4YL 1U92A 5HD8C 4MD0A 2FGWH 3MV9A 1U8QB 1UM5H 1IC5H 2EH8H 4MS8A 2F54E 4HWNA 1IGJB 3RKDC 3UAJD 1RULL 4X4ZA 1GC1C 4WV1B 2X2YA 1JFQH 3OR6A 1RK0A 2CDGA 1OAKL 1FCCA 5LAXA 1S7TA 1ZV5A 5B21A 3ARGC 4M8VA 4Z7VA 1NDGA 5IV2A 1HDMA 5T3XD 4A2LA 5F7YC 3SDYH 4JFXA 4NJAH 4XMLL 3SE3C 1XGTB 5EU6D 2GK2A 3MV7E 3B8YA 2ERJC 4OZHF 4GSDL 1JE6A 1N4XL 2FSEA 4YDVA 1W72H 4XPFL 4OIIH 4YR6A 4PRDA 4WI4A 2RFXA 4MCZA 4U7KA 4QRSB 1OF2A 4ELME 3H9SA 3E2HC 1XFPA 1J1PH 3BZ4A 5D7KD 1WCBB 4PBVC 4YC2B 1JNHB 3PNWA 5E5RB 3VFWA 4ALAH 1D5IL 2H2PC 1MWAL 1ZE3C 2H32B 3U0WH 4JRXD 5TDOB 5JHLL 2CDFA 5LXGH 1Q1JH 1BWWA 1HQ4A 5FV2A 4YJZL 1HXMB 1OD9A 5ICXA 4OLVL 5C3LD 3CZJA 3ZYZA 4XPAL 5ANME 3MRFA 3BRFA 1J11A 5F1KC 1CTNA 4O5LH 3VFOB 2OZ4H 3NPSC 3VXTA 4JG1H 5DA0B 1KEML 2R0KL 4UDTA 1IMHC 5IFAL 4OD2B 4YHKH 1H3PL 4KQ4L 4LPTA 1URLA 5IJKC 3CFEB 1JF6A 2IPKB 4JY6B 1B4JH 5JOPE 3OXSA 4B50A 4U0RC 1FV1B 1Z9SA 1JI2A 4OLWH 3SKJL 5DRNB 2YPKB 3O4LE 4MVBC 5AYUL 2VR4A 1I1YA 4N0RA 1FZJB 2XPGA 4NWTH 4OZ4B 4PLJD 5DJXA 5IUSA 4QRUA 4B5EA 2WUCH 1JZ6A 2V6HA 5CUSL 4EDXB 3MRBB 3QO0A 4M1GL 1OAZL 1A9EA 4MNQB 2GCYA 4PGZA 2P48B 5FKPA 5IVXE 2X9YA 4FQ1H 3S98A 4IJ3C 1D6VH 4WFFD 3LH2H 3ZZ1A 5DLMH 3LKOB 1FG2A 2AJVH 1YMME 3H9HA 3UZVB 4U1HB 3RVXD 4I1NB 3IGAA 1RZ8B 2IFGA 4JJ5A 2VLME 2G9HA 4HS3B 3RVUC 3H42L 4OGXL 4I4WA 4PJIA 1ITCA 4WEBH 2DYPA 4OIAA 5E99H 4CW1B 5JOFB 4MD4B 4W68A 1SMAA 4DZBB 2X40A 4Q2ZB 4LCWE 4Q97A 3EOTL 3OPZH 4P23D 1G7JB 4M62L 3S34L 4L8CA 4QHMA 4AL8L 3WNPA 4NN5B 4UIMB 3NCBB 3M17B 4XZUB 1YYML 1S7QA 4YIQA 1ORQB 4GW1A 3S36X 4NZUH 3IRZA 4PG9B 2ATKB 5GRUL 1AC6A 1XF4A 4KWUA 4ZUUB 1IAOB 4KJWD 4HUKB 5F89A 2VAAA 3UP1A 2OJZL 5ISZA 1NCAL 3PL6C 2NXZB 3U1SL 1JZ4A 1TLKA 4QGYA 4LCCC 1AD9A 1K8DB 4GBXD 5ACMA 2CUMA 1Q9KB 1VACA 2IEPA 2OTPA 5HXMA 3W9EB 5DYOB 3ZKXC 4MXQD 5DD1L 2V17H 2ZOLB 5IWLC 1BHGA 3D1MC 1H0DA 5ID0A 3MNVA 3FQTB 2OTUB 1S9XA 2VH5L 3SE4C 2UZIL 1Q9OB 2BZDA 4AMKH 1TVBA 4ODHL 2ZCLL 1GYAA 1VADA 2PO6D 5DFVC 3MZTA 2N56A 5DJAB 3QIUA 5DWUL 2XNAB 1EO8H 3FFCD 3S37H 1YY9C 4RNRA 2B0SL 4Z7NE 5DZLA 4TPRH 5T1MB 4OFYA 4HIIA 1MCEA 4FQHA 3TCLA 4CGTA 4JHAH 1RZJC 5DMIL 4X4YA 5I15H 5F93C 4OI8A 4XCNB 2LU4A 5LGJA 1IC4L 2HFGL 4G42A 2A6JA 5DK2A 4MCYA 1NMBH 3D3VD 1A7RL 1G7IB 3LIZH 2V2TB 5E2JA 4WFHD 2VIRB 4BQCA 2B4CC 4ODWA 1NANH 4APQC 2P5EB 3HCVA 3Q6FB 3RWJB 1TMCA 2NY7L 1PW3A 1HH9B 3VXSE 2VQ1A 3HUJA 2PYEE 1H9VA 4DN4H 5D2LB 4CU7A 4UT7H 2VZUA 3FQWB 4NQEE 3WDHA 3QDMD 1EGJA 2UWEE 4URTB 1DLHB 1U2HA 4ZD3H 3PP3K 3GI8H 4GW5A 4K94C 4BZ1H 3GSNH 3QFDA 1LEKA 1EA9C 5FK9A 4WFGE 4HGKC 1IC1A 3QXDA 1N6QL 4YHLL 4ZTPL 5TDPA 5DT1H 3HG1B 4PB0L 2XA3A 4D9QE 2Q8BL 1P4LB 5SWQA 1RUAH 2I9TB 3QUXD 3MRMB 1VFOA 4Z0XA 1LWRA 1RIUL 1RMFH 5DC0A 5SWZB 1ZTXL 1SBBA 5D1ZA 4IOIA 2VXUL 5IESH 4FQ2L 4JFPA 1KLGA 5GZND 1LQSR 3IS0X 5C0RL 1MREH 4P48A 3F12B 1YEIL 4R7DB 4S1DC 3GKWH 1A7QL 4AIZB 2X41A 2CDEB 5SX5K 4BKLA 3GSRB 2PYFA 3PWPB 5H37H 3BGFC 1ORSA 2YSSB 1XR9A 3TBSA 3QHFH 1UT9A 1UM6L 5M95B 3VA2C 2IJ0C 1MCHA 4NQCA 1U3HB 1MFBH 4X5WA 3SDXF 5ESVB 5CD5D 4W4OA 1DEEA 2HT4D 4EIZC 3PDDA 5L2KE 1RK1A 4F57H 4I8DA 4PJCF 1XGQA 4Q58C 5EO0A 4ETQB 2R0WH 4B53A 5J9PB 1KFAH 5C0AB 1VEPA 4F7EA 1C1EH 3GJFB 4UB0L 1U8PA 3RPIB 3HI5L 3HRZA 5GSVB 1I1RA 4GRLB 4HZAA 1BGXL 1ES0B 4OF3A 4JPVL 4ZOAA 4J3XA 1RJLB 4JZNB 2B1AH 2W9DL 4NKMA 2XIDA 4HCRA 5D7JA 1CGVA 4OF0A 1DBBH 5JHDA 5I1JL 3LKQB 5K9KA 2WNGA 4M03A 1INDL 1KPVB 3DGGB 2R9HD 3UTPE 1NEZB 4FZEH 3MRRB 4ZDHB 1A21A 1B0GA 4YFEA 4Y4HC 4UTBH 1BLNA 1MFNA 3EOAA 1NFDA 1T2QH 2FJHA 2AK4A 1N64L 2BFVL 1YJDH 1DQJB 1FO0H 4M7LH 3S35X 3I02A 3UJTL 5IT2H 3L5HA 5ETUA 4BQ9A 1JHLH 4XAKE 4XC1L 1FLTX 2C1OA 2BRQA 3P11H 2BVEA 2EE9A 4QNPE 1D5XA 1JNJA 3QXTA 1C5DA 1HINL 3VFPB 3VD5A 4PREB 1S7XB 4P57A 4NT6B 2FCBA 4XP9H 1RUQL 2BVQA 3QDJD 4Y19B 1C5BH 2DQHL 4X7SH 3TYFB 1BEYH 2D31A 2JIXD 2IPUG 2DM2A 1BP3B 4K8RH 3BSZL 4WHYG 1G7HA 4JZJC 3UTQA 2YR3A 4Z5RA 1I4FA 4JFFA 4V1DE 1J5OH 1GCFA 2UZYB 4BA8A 1U95A 3C6LB 5BJTB 3EYOB 5GISH 1RURH 3QULB 5DO2C 2R1WB 3TWCH 2J5LB 25C8H 2HA1A 3BDYL 4QRPA 1IJ9A 3MGTA 2V7NA 4UV7L 4Z7VF 3DMMA 3BRGC 4S2SB 2Z35A 4DVRL 3A6OA 3TJEH 3D39D 1CLZH 5D2NE 1I7TA 3ZHKA 5TGBA 3HZMA 2E5EA 3H0TB 1A0QH 3NVQA 2W9EL 2H26A 3NIFE 5BOZG 5C9JB 5KSBA 1JF5A 3JBG7 3RVVD 3H3PL 4TTDC 4TSAH 5ALCH 4BM7A 1FL3A 3BHBA 1GGIH 4AIXA 5JMOC 3VGEA 3QUMA 4IM8A 1JGDB 5TJWK 5FDYA 4ZAKD 3MJ9A 1IM9A 1VFBB 4PJ7E 3G6JA 2JB6B 1QPXA 2ESVB 3MBEB 3PGCB 4OKVB 3ECBA 3OX8A 2GK0B 1C8PA 4Z7WA 4JM2A 3DX8B 4JCMA 4KV5F 2Y23A 2J4WH 4OCXH 3VWKA 1FGVL 1NFIA 5IGXH 1SYVA 3WEXB 4RGOL 1XGRA 3TN0C 4ZTOH 5B3NA 4P5KA 2KKQA 4KJQC 2X4TA 4YBQD 4HKZB 4DGVH 1BWMA 2VQUA 5EC2B 3RHWF 4X98B 5MEOB 3MOBH 1U58A 4PJ8A 3TIDB 5IMLB 1EFXD 3FT2A 2BVOA 3AUVA 1MFCH 4F7CA 1AXTL 4D0DA 1IEBA 3IDUA 3LSOA 1QRNB 2P5WD 3WIHL 2EIZA 2P45B 1FLRH 4IOSD 5C0BD 3X3GH 2JJVA 1NCCL 4RWYH 3CFJA 3ABZA 1H3WM 3BPCB 3V52H 4FZ8L 1FYHB 4J1UA 4OSUL 1NGWA 4YDKH 3F6IA 1XIWC 2VL5A 5IVOA 1AC0A 1CFBA 1QFUH 3GZKA 3NCMA 3U6RA 5JLZA 4OB5L 5J13B 1MI5E 1F8TH 4M61A 1JIBA 2YZ8A 5D7IE 1NBZB 3GMNB 5TQ0L 1FFRA 1G9MH 1KLUB 1JTPA 4LLMB 3JWNC 3MXWH 1RIVH 2MPAL 4DOHB 2D03H 5HYEA 2R4RL 2YD4A 5GGSA 1J87A 1BFSA 5DA4A 2QJDA 4MNGB 2XN9D 2DICA 4FFYL 1NMCB 4Z76B 4OTXL 4TNWK 4HK0B 1A3QA 1VERA 3ULVH 1ROWA 1C16A 2CO7B 1P7KA 3VGAC 2VLRE 1KTDA 3IDXL 2CUIA 1JK8B 4PG2A 3A6CH 5EU5B 5MHSD 5ESAB 4JR9L 3ZYIA 4TYUA 4U6HB 4F7TB 5E9DE 3OGCB 3U4EB 4UQ3B 1BD2E 4NN7B 3RUGF 5INDB 2ICWJ 3MLTB 4EI6B 3QNZA 3PXJA 3KLHC 1EAPB 3TV3H 1NC2D 5D2NC 3LZFL 3Q6GH 5FFLA 2QQKH 4JDZB 3EYSH 3K1KC 5HVHB 4HIHA 1L8JA 3B9KD 1EZVX 4NQXB 2NLJB 3MA9H 3DARA 4Z7QE 5CEZL 4R26H 3REVA 4B7LA 2NY4D 1GGUA 1FL5A 1N5AB 3BPOC 2AW2A 4JY4B 4L29A 4HK3N 4GS7B 1WITA 3BE1L 4XPGH 4Y16B 4EN3D 1SVCP 3RU8H 4HIJB 3S88H 5GJTL 2AKRA 5E8OA 5C8JB 3O45B 4XXDA 4MJIB 4YBLB 5F6HI 3X3FH 2HWZH 3H9SD 3EGSA 4Y2DB 2X1PA 5C0JA 5IW6A 4WI8A 4YZFF 4UBDD 1CLYL 3W0WA 1NCBL 3V9FA 1T5XB 4NFCA 2ZKHH 3RJQB 1WUNT 4GMTH 4KTEH 5DJZA 5JIHA 1QBMH 4U6XA 1JPSL 5DMYA 3C5ZC 4DWHA 1TZGH 3BYTA 4QWWD 3RY5A 1D9KA 3ARXA 5KS9F 1Q9LA 5F8RC 2V9RA 4R0LA 5AWNL 4QOKB 4LK4A 5JQ6H 1S3KH 2VDLH 4RFNC 3HAEG 4NO5A 4M6OH 3C2AH 1P4BH 3IJHA 2CK2A 4D9RD 1ZT4B 4G8FA 4P3CH 1KSRA 3D85B 5TQ2L 4X4MA 1GXEA 1QD0A 1H3TA 4PJFF 2PW1A 1SY6L 2AEPH 1AJ7L 4NNYA 4JN1H 3OMZA 4FQLL 3RP1A 1I1FB 2K7PA 4TSBH 3L5XH 1LGVA 2J12B 32C2A 4NSKB 5EUOA 1YN7B 2XG5A 2GY7B 15C8L 3PABB 3WN5A 4QT5A 3KYKH 4TVPH 1AFVL 4GOSA 5CJQL 1Q0YH 5D5MB 1I8IB 4U1MA 5J1AA 4GG6B 3FO9A 5I19H 4TVSa 4PR5A 4XWGH 4HGMA 3OKEB 3FO2A 3U48A 4BSVB 5CBEA 2NY2D 4ZSOE 1YEEH 3VDBA 5BV7H 1MJUH 1QFWM 5ID1B 4P3DA 1S7VB 4UILH 4G8GD 1J05A 2UY7A 3LD8B 4ZO6A 5C08E 4HFWB 1TCMA 1M1SA 3JUYA 3O41B 2XG4A 1LEIA 4WW2C 1AIFB 1AP2B 2A6KA 4C56E 3CFBA 1WEJL 2ICWB 1MIEL 4XCCL 3ULVF 3L9RB