5AD0A

Complex of a b21 chicken mhc class i molecule and a 11mer chicken peptide
Total Genus 55
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
55
sequence length
269
structure length
269
Chain Sequence
b'LHTLRYIRTAMTDPGPGLPWFVDVGYVDGELFMHYNSTARRAVPRTEWIAANTDQQYWDRETQIVQGSEQINRENLDILRRRYNQTGGSHTVQWMSGCDILEDGTIRGYHQAAYDGRDFVAFDKGTMTLTAAVPEAVPTKRKWEEGGYAEGLKQYLEETCVEWLRRYVEYGKAELGRRERPEVRVWGKEADGILTLSCRAHGFYPRPIVVSWLKDGAVRGQDAQSGGIVPNGDGTYHTWVTIDAQPGDGDKYQCRVEHASLPQPGLYSW'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords MHC CLASS I ALPHA CHAIN 2
molecule tags Immune system
source organism Gallus gallus
publication title Complex of a B21 Chicken Mhc Class I Molecule and a 11mer Chicken Peptide
rcsb
total genus 55
structure length 269
sequence length 269
ec nomenclature
pdb deposition date 2015-08-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00129 MHC_I Class I Histocompatibility antigen, domains alpha 1 and 2
A PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5ad0A02
3.30.500.10 Alpha Beta 2-Layer Sandwich Murine Class I Major Histocompatibility Complex, H2-DB; Chain A, domain 1 MHC class I-like antigen recognition-like 5ad0A01
3S3JA 1QFPA 5KS9F 2VO5A 4GKSB 3PP4H 2Z31C 3P0GB 2C4FT 5F97E 3V95A 2HFGL 2RGSA 4WUUB 2DTSA 3TH4T 3RWEB 3OX8B 4YHPB 5ITBL 3I75B 3VFMB 1S9WA 1ZOXA 3FFCB 3B8SA 5FYJH 3BIBX 5SWQB 3STZA 4NN6C 5IT2H 2UUDK 1VFBB 2YSSA 3HRPA 3PWPB 5JPMA 5EPMB 3ULVH 1YMME 3TO4D 1Q94B 1JPSH 3QIBA 2Z0BA 3EDDA 3RL2A 3UTTB 5C86A 1CFVL 4P2RD 4J6RL 1L8JA 3MUY1 4JQVA 3VXUB 1CGYA 4FG6D 4PJCF 4MXQA 3SDCA 1PSKH 2IGFL 3P0YH 3MRMA 2YA1A 4N5ED 4OUUB 2NW2B 5I1CL 1T3FA 3RL2B 1EAPB 4TPRH 4X6DF 5FYJD 2QKIB 1W2KT 3MA9H 4L3EA 3GKWH 4QYOB 1MLCA 2J8HA 3LKOB 5J6GA 3EFFB 1RI8A 1AKJB 1KCUH 3I75A 3MV7B 5EOCH 1QRNA 3R0MA 1KCUL 1KIQA 1RUML 3L3HB 5TF1H 4GKSA 3AREC 2FH8A 4R2GB 3DYMA 4XNZB 4U6YA 5EZOL 1EA9C 4M6NH 5DYOA 5GGQL 5DJXA 4P2RB 5C0EA 4N0UB 1WV7T 4YQXH 4ZOBA 3WHE1 4PS4H 3MLRL 2UWEF 2AW2A 1MWAL 4Y2OA 4OFDA 1J1XL 3C2AL 5T3XD 1EEZB 5L6YL 4XGZB 1AGCB 3QDGE 1ZLWH 1OAXL 4KKNA 2GW5A 5HGHB 3RWJB 1U8NA 5IWLC 5EC1B 2YRLA 1QQDB 1LQVA 2NY1D 1NKOA 4U49A 3MX0A 2GKIA 4LPUA 1NDGB 1EEQA 3H3BC 4Y1AB 1NCAL 4HS6A 2GAZA 4KROD 4PJFE 4PR5B 3RIAF 1IE5A 5F7DB 1E4XL 5D72L 1ITBB 1EXUB 4TRPL 4U1SB 4ZD3H 2R2EA 1C08A 1CD8A 1L7TH 3IFPB 3O3DA 1DQDH 5JIHA 3KLAB 2WQRA 3M17A 4WHCA 1CXKA 3STZB 2HVKA 5K9QG 2NY7H 2R2HA 4WWKA 4X9HA 1JMZA 1S9WB 4HXBL 5JLZA 2D4DA 2IAMD 4F9PA 2J4WH 4PJXE 3PQYD 3RX7A 4HXBH 1SEQL 3CMOL 3FO1A 5ICXB 4I0PC 5JZ7D 1P4IH 2FRGP 5L2KE 1BFTA 5BVJB 3FN0L 2BNQE 3MV8E 5DRXB 4QTHB 3MRQA 3KPTA 1CTNA 4QXTA 2HRLA 2XQYK 5I8EB 4YDIL 3P4NB 5T3XL 5H2BA 3RWFB 1C8PA 2O5ZL 1XMWA 4P57A 4YFEA 3VXPB 1FO0L 3C8KA 4FQIH 1JPGB 4Q2ZA 5FECA 4ELME 3AS3A 1MWAA 4R26L 3G9VA 4P49A 1HDMA 2DIJA 4X9GA 3BEVB 4UV4L 1NDMB 4MNQD 4PJBE 3LEYL 1VEMA 1F4XL 3HPJA 1HQRA 2I60L 5TE6H 1CDBA 1T5XA 1F4XH 3KYKH 4LVNB 4JPKL 4AL8L 1BBJA 5GZNC 4QLRA 3ARBA 3HRZB 2X1QA 1MY7A 3V5HB 2DTML 2HRPL 2NTFA 3RVXC 5DR5H 3D25B 4P4KB 4ZDHA 1R5WB 1NCUA 4L4VA 1AGDA 4TUJB 4GRLD 5I1EL 4FMKA 1E6OL 3LRSA 5FA3A 5BRZD 3NAAL 1KB5L 2B2XH 1A1MB 2P4AB 4XMPH 1BPVA 3FB8A 4U6HA 3X13A 2XN9A 1I7RB 4OGXL 1NMCB 1MFBH 3TM6A 4M00A 1LDPL 4JGMA 3WIIH 1JYXA 1LE9B 4M02A 5IJKC 1YYLL 4LASL 1A3QA 1YNLH 4W4OA 4JY5H 4P2RE 5EORL 4QOKB 4BUHA 2XFXA 4ZG1A 3SEPA 3HB3D 4GG8A 5DRWB 1TVBA 3K81A 4LU5H 3F8UB 3LMJL 5D2NC 2Q6WA 4UU9A 3BVNB 1NUNB 2VERN 2VYRE 4MJ6B 3WS3A 1Y0LB 2CQVA 5MERB 3S96A 2AEWA 2M26A 4Z0BH 1EGJA 5GRWA 5E5MA 4NZRL 4Z7WE 5C0DB 4PRHE 4HFUH 3O9WC 3UBXB 1MCBA 2WY3A 3RHWK 4ZO9A 4D0DA 4YHYB 3X11B 5K9KA 3BRFA 4ZTPL 5F93C 3AFLA 2YWZA 1OGTB 4J1UA 1T03L 1B6UA 1RZ7L 1QO3A 3OGCB 1YMMD 1S7SA 4I13B 4CU6A 1JPFA 2VXUL 1Q9WB 4KHTH 4JDTH 1BZ9A 5GSRA 2IFGA 2YD2A 4OV5A 3UTSA 4JVPA 3TO2A 3QEQB 4XXDA 2R29H 4ZFFA 3BGFC 4ZFOA 3RGVD 2R0WH 1LHZA 3FB7B 4UV7L 5HHQB 3LKQA 2CK0H 4G5ZL 3OKNB 2V5YA 3X14A 5ACMA 2AXGA 3ZDXF 5JXAH 2C3XA 3GSXB 2O61B 2W0KA 3FHQA 1N5AB 3U7WL 4JFYA 1ZANL 3TA3A 3FTGA 3UDWA 1MI5E 3QHTC 5HGGS 1ZTXL 2FSEB 1UT9A 1GYAA 3WNOA 1I1FB 5KVGL 3MRDA 2OYPA 3PXHA 3T08A 5F89B 4LAQH 3C60A 3ZTJH 3WO4C 1LK3L 3AS2A 3U36A 5L8JB 5F8RC 3WJJC 2HKHH 4OZIE 1ZV5A 4WWID 5L8KB 2BDNH 3FHAA 1VFUA 1CYGA 4LRNL 5BZDB 2NX5B 1V3KA 3ARVA 2D0HA 4GW4A 4MJIE 4JFPA 3MRKB 4JO1H 4LCWB 3BYYA 2EYRA 4EUPG 2XICA 4HPOH 2C4FU 5FAAA 4DEPC 1FZMA 3VCLA 4NO2A 2GK0B 3MFFB 4WTXA 1HCFX 1MQ8A 4CDHA 5E6YA 2CXKA 4JO2H 4RWYL 4Y88A 1A5FH 3DX8B 1L0YA 4N0YH 3QBTB 5KSBB 5C0IB 1JGDB 3BP6A 2C1PB 5HDOA 2ZSWB 1T2QH 5KSAB 4M4PA 4YDJA 2YUVA 4P9HH 1LK2B 1KN4H 2LVCA 2LQRA 2BSSB 4KMLB 1UXWA 3H42L 4X99A 2YA2A 3DXAE 3B9AA 4X7FC 3RVTD 5KSUB 3SKJL 4OCNC 2E27H 3JZ7A 2R23A 3HFMH 1Q9KB 1JGDA 4JRXD 2E9WA 1BFVL 1UXSA 2Z8VC 2D03H 3O6LH 4LSRL 4CVZB 2Z91B 5ECJE 4CN4A 1JZ2A 1M05A 4WNQA 1WJ3A 2JB6A 1UZ6E 3MRDB 1RHHB 5HVFB 2WBJA 1XGUB 4HIEA 4XPHH 1I8MB 4WNQB 3TJHA 2PR4L 5IW6A 1M05B 2L7UA 5M95B 5EO1B 3MJ8B 3FRPG 3KVQA 1MHPL 4XPHL 4PJDA 4XAWL 3TBYB 3IXTA 1T22A 2X1XR 4PREA 4TOYH 5J7CC 5K33A 4Y8DC 4XP5H 2DLEA 5IHBA 2HFFB 5A16B 4D0CA 2VDKL 5JW4M 3GSNL 5L2KB 4C4KO 1T4KA 2EDEA 2XWBA 4PDCE 1JGVH 1F58H 1F4HA 1JTPA 3DIFB 3TWCL 2R0KH 1KENL 1X5ZA 3TO2B 4Y5YC 5TPWL 4DN4H 3VFUB 3U4BH 1NFKA 5GRZA 1X5XA 4OZGB 3TYFB 3JV0A 1Y18B 2VMFA 3GMPB 5C08D 2WUCH 2VE6B 4JLRB 3SCMB 4E5XA 2AI0H 4NM8L 1LD9B 2WUCL 1KF9B 3GSXA 3DUHA 4HIXH 2FJGB 4MA3A 3WIHL 3KWWB 2VABB 2R0LL 4HWUA 4CVUA 4G6ML 2AJXL 4XNUL 3SGJA 2NY6B 4I9WD 2AJXH 4XNUH 5EUOA 3VG9B 2NZ9C 3STBA 3GMQB 3RVVC 3RJQB 4JR9H 4OLUH 3O2VH 4MS8C 4NO0D 4QWWC 1XR9A 4KJYB 4IOSD 3QEQD 1CU4H 3C60B 4K3EH 5FYLH 1MRDL 4PJAA 1DQQA 2B1AH 1EIBA 4NN7B 5ID1B 2AV7A 5ICZA 4KVCL 3SCMD 4F9PC 4R7DA 2P5EB 4R4BA 3FO0H 2AJYH 3ZDZF 2E7LA 3RGHA 2FSEA 2Y5EA 4YX2H 1AI1H 4EVNB 3I9GL 3WXWH 3BJLA 3RGVB 3C87A 3VRJB 3RY5A 3MRNB 5I19H 4JZNB 3FQTA 5FYKU 5E5MB 2C1OA 4MVBA 3ES6B 3CVIL 4LRIA 1Q0YL 2HMIC 3GIVB 3LKQB 4DKEL 3BP4A 2GUOA 4PG2C 5EDXA 4JM4H 1TVBB 5IT2L 5FA3B 1G0YR 3QUML 4NO3B 2XFXB 5J89A 3ZKMC 3ARDC 3MCKA 4XWOD 4XPTL 4HWBH 5D6CA 1JPFB 3OKMA 4FQXB 1QO3B 4HWBA 3L5HA 3FO9A 3PXJA 1NCWH 2VC2H 5GS1B 2R4SH 4D0DB 3I2CH 1WZ1H 5KS9A 1TDQA 2VDOH 1GOGA 3AVEA 4OZHE 4WIQA 3KXFE 3BPOC 2EYTA 4GKOA 5FM5M 1HDMB 4PJAF 2MNUA 4Z0XB 1F3JA 3BO8B 4M8QA 3SDCC 1AGDB 4XPGL 1E4XI 2QTEA 1IARB 4MJ6A 3VDAA 3WS3B 4F8TA 1H3TA 4NZDA 3FB5A 3KPRD 2H1PH 3VXMA 4JKPL 1BBJB 1Y6NR 2NXYD 5GQBA 3MRQB 1BVZA 1JL8A 2VXQH 3QUZD 1K4CB 1NBYA 1TZHB 2HTLC 2ZSVB 4XP9L 5KZCB 2P48B 3ARQA 4WV1A 3DHJA 2CMRL 3O8XA 3CDFA 4FN0A 4QRRB 4OTXH 4UBDD 2YEZB 2VLRA 5JLZB 4MNQB 4ODVH 3L7EA 3QDJD 4M4RA 5C0BE 4LPTA 3MRCA 1NC4B 5D71L 3PV7A 4R8WH 4YR6B 3IU3B 4IIQA 5HI4D 5BRZA 1NGYA 1D6VL 3O9WA 5FV2A 3TH2T 2GIYA 1OAUH 4WGWB 2PO6C 3MPCA 4F7CB 5AAWA 1NC2D 1F4YL 5ICXA 3V5HA 4HH9A 4KI1A 3C08L 1MCFA 5IW3A 1PJ9A 3QQ3B 2YMXL 3ILQC 1F6FB 1H5BB 4O51B 4Q9QL 4LAJH 3HAEH 2C9AA 2EXYD 2DQUL 1X3DA 1JRHI 2Y06L 1UWXH 4GRWF 3WIFA 1DZBA 5HVWA 3RKPA 5E4EB 5F7DA 3TZVB 1YY8B 5MI0C 1A7OH 4X4YB 4JFEE 4U3XA 3FN0H 1IKNA 1A7OL 4IHOB 1HCVA 1I8LA 3MOBH 4BQCA 5F96L 1XAUA 4I1NB 2BHUA 3WCYA 3TFKA 5BQ7B 3T0EE 1D6EB 3SJVE 2ZOKA 1T7WA 4V2BA 1K4DB 3RL1A 5K9JH 1QQDA 4WFHD 4PB9L 2BNRD 3V6FB 1J0KA 4HAFA 3VFVB 1U8NB 5ITFB 1FDLH 4X4MA 1ZLVH 5IBTH 3O2WH 3V6OA 1LVEA 2DQDL 3FO1B 4YFLI 1P7QD 2OR8A 2XZQH 2FATL 1ZT4A 3K74B 3OJMB 4IRSC 5ID0B 3MRFB 4HSQA 5C0BD 4OLWH 1A14L 3LKOA 5CUSH 3CNKA 4LF3A 5AZ2H 4I5BA 2R8SL 4PJGB 1KNOA 3BQUC 1HNGA 4EQ2A 2DKMA 1CN4A 4GXUM 1BMGA 2NW2A 4Q0XL 3LV3A 3RU8H 3IF1A 2MCPH 2BNRB 4GG6E 4JFDE 5D5MB 4UIMA 5TGBB 2UUDH 3ZTNH 1MFEH 1QYGH 4HJ0C 1E6OH 2FIKB 2RJMA 4E0RB 4YXLL 5J6GB 1W72H 3DMMD 4RQQB 1KELL 3OX8A 5CJXA 1JRHL 3TPUE 2ZUTA 2OCFD 1M7IB 3GZKA 2EKJA 5T5FH 3RZCB 3QWRA 1JRHH 4DUVA 4KK9C 2DM4A 3MR9B 1X5YA 4UAOB 1HIMH 1BOGA 3EJZC 1J18A 4RZCB 2LV4A 3W2DL 2GFBA 1RZJH 4OLVH 2FL5B 4WFGD 2CDFA 4N1EA 1SYVB 3S5LB 4NN6B 5C0JA 2R1WB 4IJ3B 4LCIH 3MRPB 3QUKA 3VFSA 5F9WC 3MRBA 4OGAC 5IB2A 3D85A 3L3HA 3MMEA 4GFTB 4MAUL 3LDBB 3E2HC 1EMTL 3SGKC 4KI5C 3LEXA 1AD9A 2BSED 2VLLB 3L1OL 1AGEA 4MAUH 1CE1H 3SDDD 1SY6H 4A6YA 2HT2C 4PD4K 1P9MC 1NC4D 35C8H 5TQ2H 5JXED 3SE3A 4G7YL 1K8DB 5EN2B 3R8BB 2WV3A 2ZCHL 2XZZA 3QXTA 2PO6D 1D5XB 4R2GC 1NANI 1ORQB 5IR1B 4D9QE 4FQLL 4NJAH 1NL0H 2MQ3A 2HJLA 5HI4C 4ENED 4TSAH 3MLYL 3QEQE 4X6BA 5I1KL 5DJ2A 4X98B 5EZIL 4MA1B 3BZEA 5M94B 2AJSL 4KKLC 4KKBC 2A6IA 2X41A 2NYYC 1CICA 3BDYH 4UDUA 4CUCA 4FZ8H 3BD5A 4AT6A 4U0QB 3IETA 3ZE0E 3O8XC 5ISZD 1KJMB 5C6TL 4PTTA 1RAMA 5DRNA 3QNXA 4WDIB 4MVBD 1C5DB 4Q74A 3HZVA 2OSLA 5C08E 3QUXD 3DLQR 1UC6A 3QI9D 4QHKI 4NUGL 3HTLX 1FNEA 1ZVSB 1RZGA 3L3IA 3KYMB 1A9BB 3D3VB 1IGFL 2BVPB 1A7RL 2XV6B 5IP4A 2PYFA 3FMGL 1RPQA 3B2VL 1ZLSH 5EUOF 1OGAD 5I8CA 3B9KA 1J7VR 3QFJE 5C3LD 2BDNL 2ICWB 3TV3H 4EIGB 4M6OH 5GGVH 1HK6A 1YQVH 2QHRH 5T1DH 3IRZA 4M9PA 3C5ZC 3GIZL 1ZEAH 2IBZY 3GNMH 5C09E 4QKXB 3ORJA 5KJRH 4JY6B 1HOCA 3CDGA 4QRRD 2VKXA 1NANH 3AREA 4HKXA 3NPSC 1ZGLM 5EZLB 3IKCB 4HF5L 2FX7L 2CKBL 1QLRB 1A4KB 3NCFB 3MXVH 4TYUA 5FUCE 3KYNA 2GJZB 3O4OC 4JFFD 3UO1H 4WW1B 3AS0A 1OSZA 2MHAB 3PHOB 1AIFA 2PTUA 3O3EA 4YBHA 3MNWA 5JR1H 4LSUL 1I3RB 5DJZB 3QQ4B 1QLEH 2AXFA 5EZOH 2BVTA 2DI9A 3OAYH 5AWNH 5JMOC 4NO3A 1HILB 1NAMH 2X4OA 4U3CA 4LEXL 4PV9A 2D03L 4LSRH 1S8DB 8CGTA 3V4UL 3MLRH 1P69B 4HBCH 2DWEB 1RD6A 4NQSB 1IEAA 4YH6A 4UT7L 2VDNL 3HC3H 3L3KB 3VWJC 4RBPH 4S1SH 5K9OA 1YJDL 4PJ8A 5HJ3A 5DJDA 4CJ1A 3WFBH 3CUPA 1LO0H 1G84A 2DDQH 2ZCKH 4NM4H 4KJQD 1FCGA 4OZFG 4XBEH 3MRRA 5EWIH 3W82A 5E9DD 5D2LE 5EU7C 4RFNC 1E4WH 4X4ME 2WK2A 4XPAH 2R9HD 1KJ3L 3U1SH 1KXQE 4L3CA 3F65A 4EI5B 2F15A 3P0VH 1KENH 2PUQT 4KJYA 3VXNA 4XNMA 4CL7A 5JQ6L 2P24B 2GTZB 5I9QC 2VISA 1IMHC 5T3ZH 4X6FA 4OQTH 5EUOB 1S7XB 1UENA 2FX9H 2WIMA 2ENSA 1IC4H 4YC2B 4H8WL 3FB6B 1QRND 1N2RA 3MODL 4GBXB 4MSWB 4MJID 1OCWH 1FAIL 1D5MA 1GVIA 2OL3A 5IEHB 3GMPA 3MODH 4H25B 5HHNA 1OSPH 2BMKA 2KH2B 1EJOL 4Z7UE 4KY1L 4OM0L 3HNVL 4Y4FD 2EEDA 4PYGA 4DKFH 2ARWA 2VZ3A 1X5IA 3X3FH 3E6HA 4KMQA 4OM0H 5HYSG 5D7SL 3MRIB 4R26H 4PGEA 3PWJA 4QRUA 4BSVA 1U41A 1FYTE 1U92B 4K3JL 5IROC 1IJ9A 3RIFF 1QUNA 2EE2A 4BFIA 2E6QA 4MVBC 4LIQH 4FQIL 2D7QA 1IC5L 4K3DL 4PJDF 5DQJA 3VWKA 2W60B 1LP9A 2VSDA 4DN3L 1HKFA 3RWIB 2Q20A 3OPZH 5DLML 1P4LB 3WEXA 5CP7B 3STLA 1T22B 4LHQB 4DN3H 2NLJA 5C0BA 2JF1A 1CXIA 5EFIA 4RMSA 1KJ2A 1S7UA 4OT1L 2WBJB 1I8MA 2IFFL 2XQYG 2NYYD 3IFOB 5IVXA 4OD3L 4Z77B 4OD3H 4P48A 2VRAA 3MCG1 4FP8L 3PWNA 4H1LA 3KHOA 3Q2CA 3BX7C 5I74C 5GGRA 1RZ8A 1S78C 5D6DC 1GZPA 5E2TL 2J5LC 5CJ8A 3G6DH 3GRWA 4XNQA 1C16B 1INQA 4QF1A 5IVXF 2BSSA 5DVOA 4TSBH 1RVFL 3CVHB 3MNZA 1D5IH 5E2WL 1BEYH 1JUFA 5JORA 3O6MH 4QGYA 1MELA 5C0IA 3BIAX 3H9SB 2IADA 3D87B 3FQRA 3W81A 1K8IB 2XQBL 4KDTA 6FABH 4HKBA 4Y5XB 3V9FA 4M9OA 3EO1B 3MACL 4DUWA 1Z9LA 5EORH 2BX5A 2N4IA 3BGMB 2R0ZH 1G9ML 3VXRA 1QSVA 2EYRB 3RUGE 1IC7L 1U6AL 1ZHBB 1MJJA 3FQWB 5DHVH 3GJFA 3PIQA 3P40A 5I1GH 3KYOB 4ONFH 1U8HA 5IHZA 2PF6A 3BYTA 4OCXL 5EU6B 4P3DA 4NZRH 3U36B 1ED3B 2F54B 4RFOH 4OZ4B 4GAJL 2Z35B 5D7KD 4CRPA 3MCLL 2E9JA 5KTEH 4GQ9H 3QR2A 3QO1B 4KHTL 5C2BL 1GGUA 1V8HA 3G04B 4O58L 4ZPVA 2IPKB 4NJ9H 4ETQA 1WWAX 3AXLB 5F3BB 1KSRA 1S7RA 5I16A 3ISWA 4HLJA 4FZEL 2CK0L 3K8MA 5GRJH 2LFGA 2F53E 4P23A 4L4TE 5A1AA 3T2OA 3O0RH 1DBKH 1J8HB 1CGTA 4Y0GA 4PV8A 3RVUD 1LO2L 5IK3B 4HGMA 3VGFA 4HFWA 5FA4B 5JW4Q 3NIDF 3NFNA 2X44D 5DMYA 3VE0A 4K7PX 3VMOA 3IJYB 3JV6A 1JZ5A 1YQ2A 4PJ7E 3X3GH 1QA9B 4GRWB 1MCLA 1Q9WA 2L7JA 3PF2A 4KPHH 5ELIA 1D5BA 3H7LA 4GBXD 5DJCA 2MPAH 5SX5K 2OL3L 3N0PB 1DBBL 5DD0L 3NACL 4HC1H 3CFCH 5GZOD 2PXYB 3WD5L 1QFWL 3CFCL 1NPUA 5DUML 2XACC 4X9IA 5KVGH 4JFFA 1IRAY 3SN6N 3LKNA 2A73A 3WXVH 1PAMA 3K3QA 4LSTH 3LKRB 4LSPH 3FT2B 1VKXA 4X5LA 5C07A 1UYWL 3KPRE 1OY3B 1U8OA 4CNIB 2WQ8A 1UYWH 3MTRA 1DN2A 5SWZA 3LKPB 4RAHA 5L2KD 1MCRA 5H37G 3EYFB 5GHWH 2F8XC 5T1LB 3OAZK 3WFHA 4DGVL 3U6RB 4JQXA 3RAJL 3KXFD 5E99L 3GFUA 4U33A 1GAFH 3GMRA 3RWCA 4I0PB 1KPRA 3T4AB 4WI7A 5CIPB 2E3VA 3U2SA 2H9GB 1KN4L 4ZSOE 3RPKA 4EXKA 1Q9OB 3C60C 4M1GL 4YFLF 2ATPA 4WO4A 2MCPL 4NGHH 4PRIA 2WBKA 3EO0A 3GSWB 4QNPE 2Q86A 3S34H 2H32A 4P4RB 2QQNH 1I3VA 3ZKXC 3X13B 3HC0B 3FT4B 5FOJA 4L5FL 2JK5B 5ETUA 5BXFB 4WTWA 2WUBL 5JO5A 1O7SA 4HDIB 1QFWI 2X7LA 2IANA 3MFGB 4XP1H 4L3EE 4KJPC 1IAOB 2VR5A 4M5ZH 1ADQL 1JIBA 4K7FA 1MI5A 4P4KA 3D25A 2XNAB 3CH1B 1CK0L 1HIML 1WISA 2H32H 3FT4A 3PHSA 3AROA 4M1DL 4YGAB 3GJFH 2Y7QA 4CJ0A 4D9RD 3EJYD 3U9PL 1JWMB 1PLGL 3BAEH 4ZOAA 1W0VA 4Z8FL 3SJVB 4BYHA 4DQOL 2OS7A 2DQJH 3H0TA 1KJ2H 1CFBA 1KPRB 1SBBA 3T4AA 3IAQA 1U3HD 2BSTA 4PG9B 3FCTB 3WV0A 4WWKD 4Q2ZB 3SGJC 1UM6H 2RB8A 5CSBA 5J11C 3M8OL 1HZHH 4NQCA 1D9KB 3DX6A 4KDTC 2VUOA 3OZ9L 4QTHA 3UYRL 1N64H 5JDSB 4LLMA 5EU5A 1O5DT 3LKNB 2BNQD 4D2NA 4XAKE 3JWDC 4M7ZB 2CKNA 5T5NG 1W0WA 2X4PB 5D7LB 4NIKB 1EFXB 5H94A 2HVKB 2HJFB 4QOKE 1RULH 3RPIA 2CGRL 3MV9E 4K2UL 1PQZB 4PJ5E 2X05A 3MBXH 3SOBL 5DJCB 3SDDC 1YNKH 1D5BB 3KPRB 3AGVA 1LO3H 2AK1L 4HK3N 2I26N 5ANMB 1BD2A 3L9RA 3S36X 4OFYD 1D5ZA 3A6BL 1ZGLA 4XC1L 3MJ9L 2VUYA 3NFNB 2AVGA 3BJ91 4LKXA 1FC1A 4TULL 4PP8C 2V2WB 1X6NA 3FRUA 2UZXB 2ADFH 2DLGA 5L88H 1KIPB 3W11C 4FA8A 1TJGL 2DYPA 5HD8C 3BD3A 5I75B 3RWJA 3WN5B 2W0FB 2BZDA 4G80A 1AGCA 4PJ8D 4XX1G 1OF2A 4F15B 2EXYC 4HD9A 4K23L 5FK9A 1IAMA 2VR4A 5CWSA 3O45B 3DETC 3EKCA 3QDJE 3LEVH 3V4PL 5GISH 3DYPA 3KXFB 1CLYH 2KZWA 4MHHG 1WLHA 5LQBH 1A8JH 3ULVL 2ZKHL 3SBWC 5GZND 1UJ3A 3VRLE 4OIBA 3CX5J 3I6LE 4PGCB 2ILLA 4X83A 1FZOA 5T1LD 3QQNA 2A74B 4G9DB 3QXDB 2F54E 1FVDA 3FFCE 3SBWA 4NPYB 1EX0A 3JV4A 2I07A 2FJFB 1QRKA 1WZ1L 3WDHA 3LD8C 3WSQL 2X5PA 3FO2A 5A2JH 2XN9E 1XGTA 4QCIA 4YHIA 4P5TD 3W0WE 3WSQH 3MV8A 1QKZH 4RAVA 1RZKL 2YRPA 5D1XC 3GMMA 4CMMB 3B3IA 1NAML 4Z7VE 3FOLA 1GC1C 3IFLH 2HFEA 2WBWB 5F6IC 5HHMA 3E8UL 2CMRH 4DEPB 4KJPD 5E8EB 4C56D 2NXZB 1DFBL 2B5IC 5MP6L 3HN3A 4NSKA 3HR6A 2M2DA 4A2MA 1DVFD 1OP9A 4M6NL 3ARFC 5DEGA 1UWEL 1MCPH 3BIKA 4W6WB 2YD9A 1MCPL 1IKFH 4QXGL 4G43B 2QQKH 1RUAH 3PWPD 4ODXA 4C59B 1JYWA 1J10A 1DANT 4HH8A 2NLJB 2YKLH 5C0BB 2EDYA 4G8GB 1FL5B 4MQXC 1WIOA 1ERNA 5KZCD 1FVEA 5KVDL 4NCC1 4MQ7A 5SWSA 4N0UE 3H9HA 1L0XA 4HIIB 5AZEH 4BFIB 5C07D 2AKRA 3P9LA 5I73B 4MNGE 3BOVA 2P8PB 4RIRB 1P84K 4QRQA 3PNWA 3O45A 4M7LH 3SGDH 5IQ7L 25C8L 3IJSB 4N90D 3T1FA 4NOBA 1MCOL 4DGYL 4OD2B 3VD9A 1KIPA 5B38A 1D5MB 2WLYA 4OJFL 2ZNWA 2E9IA 2VLKD 5ESVB 5E6ZA 5FGRA 1DEEB 1A6VL 1FC2D 5F71A 2PW1A 1G7MB 2IH1A 5GGSY 1DDHB 1OQOA 1ZK9A 1MWAH 3MGTA 4BZ1L 1IAKB 3OAUH 1S3KL 1CQYA 1WTGT 2IALA 4EDXB 3K7UA 5K9JL 3VXNB 2QSTA 3LZFH 2XTJE 4DUXA 2NY1B 1ZT1A 2DMBA 1J12A 1I8KB 2HP4A 1TETL 1PD6A 3J7HA 1DQMH 1GGYA 2OTWB 5IIEB 4MA1C 3GSVA 3U4EB 1OB1A 2FNBA 3VG9C 1ORSA 4UNVA 1JN6B 4AMKH 1JPTH 3TO4C 3DXAB 2ED8A 2VITB 4GKNA 3OB0K 3P73A 3QSKB 4ISVB 1JF5A 2F74B 4XHJC 1SM3H 4HWNA 3KLSA 1Z9SA 4JANB 1ZLUH 3ZHKA 1IEAB 3O6FC 5KSBE 1P53A 4LSQH 1DQLL 1CDGA 3BZ4B 3ARRA 4G7VH 4HMEA 1UACH 1DUYB 3QIUC 3ULSA 5BV7L 1SEQH 2BSTB 5A43C 2HTKC 1MIEL 5GGTL 1LDPH 4JDZB 1NFIB 1A4JA 1ROWA 1FNLA 2XKNB 4TSBL 3VXRD 1S7VA 1U91A 3QQ4A 3F7YA 4O5LH 4UDTB 2WWMC 5ERWA 5I8KH 2J7LA 3JTTA 5F6HI 3SDAC 4LHUA 1SYSA 3FFCD 1X5KA 2N7BA 3IDXL 5DURB 3RIFK 3KPSE 4WEBH 4R96B 2GJ6D 3NZHL 3LN5B 5CJQH 4IOFC 4MS8D 4F57H 1HOCB 4NQDB 4GSDH 5D8JH 3QRGH 4F7MA 1CDUA 1FJ1A 3JWOC 4AL8H 5D8JL 1AGBA 1FGVL 1DLHB 5DMGC 5C92A 1Z5LB 4H0HB 2Q8AL 1OPGL 2H32B 3HMWL 5C8JA 4LLAA 6CGTA 4LEOA 3EYUL 4PRIB 5GS1C 4JO3H 3MUHL 5I2IA 1KN2H 3CFEB 4QTIH 4FMFA 3IVKA 5DWUH 4XCFH 4D8PB 4XC3H 5I8CB 1YEHL 3BPOB 4IMLA 1OT2A 1NL0L 1CXHA 3NAAH 2VZSA 3KAAA 4PJCB 1FGNH 3HLAB 3GSQA 3BMVA 4XHJD 2VQ1B 4LCWE 1L0QA 1EUTA 2EH7H 3AUVA 5DRZA 4BFGA 1ZHLB 3WFHB 4HMDA 5DJ8A 3RNKA 2YA0A 1U3JA 5EU6D 3C5SB 5BRZE 3MYJA 1CGSH 5D7IB 1B2WL 5F3HB 2EDFA 4JDTL 3I84A 1VKXB 4YBLB 4JPIA 2DAVA 5I1KH 1TPXB 5CILL 3SY0B 3VFGH 4POZD 4J8RB 1EERB 4O2CB 4X7TA 4YGVA 3F12A 4UV7H 2ZUVA 4YAQA 2PYEB 4YHNA 5JPNB 2VIRB 1DBML 3X3GL 2NY6D 4I0CC 1EV2E 3OR6B 3GGWA 1G7JB 1RUKH 4UILH 4Z7WB 4PJ5D 4G3YH 2D7NA 5T3XE 2X4NA 4JHAH 2IF7A 1AHWA 2ICWI 4HX1B 3QCUH 4EI5C 4KK5D 4JHAL 4Q9CA 1OW0C 5DUMH 1KEGL 4BFBD 4NUGH 4N0RA 5AYUH 3BXNA 2R39A 4N0FB 1XCQB 3A6CH 2AJZA 3T4YB 3FONB 5DD1H 5I8OH 1NCTA 2H3NA 3BEWA 1J8HA 1ZEAL 1IGCL 3O6KL 2QADB 2OM5A 3B8YA 1H5BC 4YC2C 4ZUSB 2VR9A 2VXUH 4TNWK 3MLZH 4QHMA 5GGVL 4EEEA 4YZFE 3LY6A 4AM0B 3O2DH 3TA3C 1J87A 4ODHH 1I1AD 1E27B 2R29L 2Z8WC 4W70A 3UTOA 1CFTB 4U4BA 2DLTA 1EVTC 3QO1A 3MV01 5E8EA 1AXSB 5ACZA 4LSUH 4OLYH 1BHGA 1IAII 3IGAB 4PGZA 1QD0A 3ETBF 3P30L 4HIJB 4RAVB 5HGBA 1EJ6A 2E27L 3TBVA 4UB0H 3UO1L 4N9OB 1AO7D 3SE8L 1DN0A 4P3CH 2VH5H 2AGJH 2OX5A 3RZCA 2C3GA 4I48A 2GSGB 3VMPA 3HHRB 5AWNL 1RFDL 1B3JA 2CUMA 1AY1H 1WBYB 3ALWA 4CW1A 1FFNA 4MNHA 1AQDA 3WFDL 3BISA 3UZVB 3V4UH 43C9A 4LNRA 3NTCH 5FUOL 3H7BB 5I1JL 2BNRA 3OBAA 4OB5L 5GSVA 1A9EA 2NX5D 1X5LA 4H20L 2VN4A 4KTDH 3TPUB 4PLJC 1OAXH 4OSUH 1KJ2L 1ZMYA 4XNQB 1CXEA 3UX9B 5LGJA 2BCKA 4M03A 4JZOB 5GRVL 4PJGA 1J88A 1GZPB 3HE6A 3O3BA 1P84J 4KK5C 3LKSA 1CVRA 1IAIL 1ZT4B 1T2QL 4PRID 2H6PB 3REWA 3CLEH 2V7NB 3TNNA 3RVXD 4PJXF 3VFVA 1ACYL 4DTGH 1QTYT 5D72H 4U31A 5BOPA 3VXSD 1FL6B 1TJHL 3BEWB 3QHZH 3BQUA 1OTTD 3RX8A 2VDRH 4ZNEA 3T4YA 3EDEA 3TC9A 3VU2A 4S1QH 3SGKA 4YIQB 5F9WB 2R2BA 1NBQA 5B4MD 1EBAA 4JM2F 4AEIH 3ZKSD 4V2CB 4HX1A 2DQFB 1HSBA 1OT1A 4EJ1C 3KGRA 2DMKA 4F80A 4AEIL 4QY8A 2AK1H 4J12A 1OSPL 3CSBA 1RUPL 2KZ1B 3D0VB 4DJMA 2EIZB 3S6CA 4RCAA 2NY5H 3LB6C 4ZS6D 1PG7W 4HZAA 5D7LA 3SDYH 4MB5A 4YJZL 3TNMA 3S4SB 3FO0L 1KXVC 3S4SG 4HH9B 2AK4A 1QBLH 3SY0A 5JZ7C 5E2UL 1MHHB 4GBXA 4MSWA 3CSYA 3P11H 4BUGA 5F3HA 2B8OT 2G75B 1WT5A 1B4JL 5DD6B 5DSCA 1II4E 1KTDA 4OT1H 3ZT5A 4R3SA 3VFWB 3T65A 1UWGL 4EQ3A 4D8PA 3S35L 3O8XB 3IVKB 4JG0H 1SJEA 4PJ9B 5EIIB 1Q0YH 3RZWA 3GMNA 3KPSB 4RSVA 2Q1EA 5SWSE 1D5IL 1HN1A 1UH2A 4YBQD 2MTPA 3GHBL 4F7MB 4KHXL 2BY2A 1T0NA 1OP3H 3I6GB 3MJ7B 3G6AB 4HZLA 4P5TC 3I2CL 4K7FB 3V4VH 4GXVL 1I1CA 2IANB 2XOTA 2BHYA 4HUXB 1MCHA 1NFDB 2LAAA 1T0MB 4Y7MA 2ZOLA 1CIUA 5CJXC 1UA6H 2EDDA 5HHXH 1IEBB 4RFEA 4U1IA 5F1NA 3SO3B 5JOPE 2A1WH 4APQD 2W9EH 3C5ZB 5C70A 5I1GL 2CLRA 3VXRE 2JJUA 1S7VB 4P2OC 1NBVH 1PY4A 2ZNXA 1I85A 4MS8A 3MUZ1 5F7LB 1L9NA 4DAGH 5CIPA 1HHJA 5CEZL 3IFNL 4GAJH 2OJEA 4KRPD 1DBJH 4NKOA 4DAGL 3KLDA 4HFUL 3KPQA 2EEAA 1CIDA 5J6HB 3IYLW 2GUOB 4B53A 2HAZA 3NABH 4LLDB 4LCUB 1T2XA 2AJUH 2R56H 1T03H 1BGXH 1OP5H 4JEGB 2AJUL 4M43L 4ODUA 5EO9A 4BKLB 3U82B 1RJZB 4L29A 4KV5E 1U8KB 1OGAB 4M43H 4XP6L 1JPSL 2GSIA 1QFUH 2EXWC 3CVHH 4JFQB 4ZFZB 3VRJA 2H2SC 1PSKL 4ZTOL 3W11D 1VFAA 5CEZD 3HZKA 3GSOB 5FUZL 1FNFA 4OIIL 5E6IC 4IBLT 4OIIH 4PY8J 1FO0A 3VWJB 4IRSD 3VMNA 4L8SA 1DBKL 4Q9QH 1DQQB 4PJAB 1KCSL 4PJEA 3KS0J 2MPAL 1A9BA 1P5UA 3MRLA 5KBNC 5LWYL 4ENEC 4G6JL 5LWYH 4U1GB 5DK2B 2DD8H 3MRGA 3D9AH 3V7AE 4RGNB 3SPVB 2VLJB 1V3MA 1FORH 1Z9MA 1FIGH 4JFHE 4PBWD 2DQGH 1D9KC 4PB0L 4IRSA 4XVJL 2Y1VA 4P23B 2BRRH 4P2QA 4Y19A 2JIXB 3U30C 3ARYA 5I1IL 4UDUB 4ODVL 1KG0B 5E08L 5JXEC 3HCVA 1Q72H 4BH8B 2NTSP 4ELKB 2V17L 4X98A 5E08H 4M7ZC 5IGXH 3G04A 3HMXL 4FQHA 5T1KD 3P9LB 4OZIB 5IFHL 1NJ9B 1EGJH 3PG2A 4PRBB 1D6VH 1HH9B 1HQ4B 3EYQC 4LKCB 1TVHA 3JWDH 3V8CA 4P3DB 5FUCC 2GITA 5EU6A 1NLDL 2ZZUT 2YWYA 4OFVA 1UVQB 3RAJH 3DECA 1JGEA 5E8PA 1HXYA 2WMPA 3R8QA 1D7FA 2EDOA 4PGDA 4PJDB 3UEZA 5C0NC 1TTUA 5EO1A 2M1KA 4APQC 1JFQH 5B8CA 3MLWL 1CT8A 4Q0XH 5D1QD 1KLUB 3EYVB 3QIWC 5DFVC 1G7HA 3WN5C 2G60L 2NQCA 5HVHC 4OIAA 3QUKB 1KB5A 1P2CB 4GMTH 1QYGL 2IADB 4GMSL 4OCYH 5BO1L 5GS0L 5E5RB 4P46A 1A3RH 1NCNA 2R15A 3QFDB 2X09A 2IANE 4XP1L 1HSAA 1ZVHA 3U9PH 1IGTB 4Y4HB 4FFZL 3N1QC 1YC7A 2EDJA 3VXQA 5L0QC 3DX7B 4WO4C 3CLFH 3S37L 3VXSB 1OP3K 5J13C 1MQKH 2CKBB 4X9FA 4JGJA 4TQEH 3DX8A 3L6FA 5BCAA 1R3KB 5H35B 3QJFA 3TJEH 3V0VB 2XZAH 3U46B 5ADOL 5AD0A 2D2OA 4X0KA 1VGKB 3AAZA 1YEFL 3LEYH 5FYLE 2FIKA 3VDCA 4BA8A 3HUJE 4M6MH 5LCVH 1XF1A 2D7PA 1NAMB 4PRHA 5DK0A 2DIAA 2LTQC 1UB5B 3EYUH 1K3ZA 5CP7A 1HXMA 2HRPH 3RWIA 2IQAA 4W4OC 1ONQA 5SWZE 3QQ9D 5CJOL 4L8DA 4RMWA 1SMOA 1P1ZB 2MWCA 3VFRA 4WVRA 4IRJD 3SOBH 4AZ8A 1MPAH 4J3OC 1KB5H 2B2XL 4KC3B 5DEFA 4B50A 2ZCHH 1BQLL 5CD5D 4QXUL 2OMNA 4NRZB 1E4KA 4M7LT 3NPZB 4LGRB 4TN9A 1OP5K 4YDKL 1U8MA 4LFHG 3ZDZE 5BV7C 2DYPB 4Y2DA 4H5SB 2ZWLT 3VFPB 3FAWA 1JMXA 3ARFB 1K4DA 1A6AB 4XZUA 3RBSA 1Q0XH 2X1WL 3OJDB 4PG2A 5D1ZA 4X6EA 5LAXB 2RFXB 1N59B 1JF6A 2VTFA 4K3EL 5FYLL 2DKSA 5E8DH 3F6IA 1BM3L 4LKXB 4Y5VC 5CJBA 3PGFH 1ZGLB 1XIWC 3TZVA 2VISB 3PGCA 3WIFB 3WXWL 2ID5A 1TJIL 1YEJL 1H8SA 4Y4FC 1EO8H 1XZ0B 5MEPB 3LEVL 4P5TA 3RDTC 2DYPD 1O7VA 2C3VA 4U2YA 2YC1A 4OKDA 1CXLA 4UBDC 3KPOA 4PLJD 1NCDH 3ZMRA 4Q6IC 4EBQH 1HHHB 4RGOH 3GNML 1P7KA 4XTRC 3MLXH 3LHPH 3VDBA 5TJWK 4PFEA 4NNPH 3S5LG 1BQHA 1EAJA 4K71B 4TSAL 4NNPL 1N4XH 5CCKL 1Y0LA 1GGCL 3LQAH 5CEXB 3UYPA 3JTCA 5DHVA 2YEZA 3AB0B 1DTUA 4X6CE 5JIPA 4NNYA 4PV9B 5DQDL 4KJQC 3SJVA 4BK4A 4EDWL 4NQVB 1JJUA 2BNUA 1RZKH 3RTQB 2K3TA 5BZWA 1KTLA 4XPBL 1CFSA 3EDKA 1T0PB 1GSMA 1A1NA 4XB7A 1I9IL 3QA3A 2VH5L 4RA0C 1JWSA 1F3DH 3FB5B 4L8CA 3TVMC 2CDGA 1UB6B 3TT3H 2NY0C 2PYEE 5FYKL 3V52L 4U6HB 4X7SL 4N8CH 3TT3L 1NFDF 1QLEL 32C2B 3WLBB 3OB0H 3IKCA 2PW2A 2VDNH 3HC3L 1OL0A 5I17B 4MJ5A 1J5OH 3TO4B 4FXGA 5IW1B 1CD0A 1CZ8L 4HDIA 5F9AC 3WLBA 5CBAB 2OLDA 3M07A 3H3PL 4ZDHB 1N0LA 5I1JH 4YHOH 4XXCC 1EZVY 2XI9A 2J12B 4HCRH 3GIZH 5F9OH 4XCYA 5KVDH 3OKMB 4FQXA 5IVXE 1A6ZA 4NQVA 1KJ3H 3U1SL 4I0PA 1KEMH 4QRSB 2QR0B 4XBPA 2KDGA 2O5XL 1MY5A 2H2PC 4FQQB 3BPNC 1NCBL 3DNKA 3EYFA 3OG6B 4TRPH 2K7QA 1JPGA 3CSGA 2JJSC 3S3PA 3VD5A 3QHFH 4CNIA 1C5DA 3RWFA 2DS4A 3ES6A 1XF3A 2GCYB 3QHFL 1TFHA 2YMXH 3QNXB 2R1YA 4MGXA 4WU7A 2IC2A 5DRXA 5C0GA 4M7LL 1OAYH 5BVJA 5DQ9A 3NIGF 3RVUC 2JB5H 3GBML 1QHPA 4POZC 1WZLA 2YD4A 3R06B 3GEWB 3WO3B 3VI3E 2P5EA 4OZHA 1HE7A 1TZGL 3C6LB 4F37K 5D9SB 5D1QC 3OAUL 2HVJB 2ADIB 3QJHB 1KCVL 2EKSB 3TGXA 2XXCB 3WNMA 4JFOB 3B6SA 3ZL4L 1XF4A 4CKVX 3L3OB 1LO0L 1CVSC 3FKUS 3QDJA 4C83B 5IK3A 2XZQL 2OBGA 2XT1B 4MD0B 4YK4C 2VLRE 4Y1AA 4MHHI 1TQBC 1N59A 1DCLA 2VLJD 1PZ5A 4GG6F 1G1YA 4OCSH 4E5XB 3KPLA 4FQJL 4Y4KB 2X4TB 1NLBL 3HAEA 5EU6E 1MEXL 4U1JA 4JPKH 5J57B 4FQ1L 2VLLA 1AD9B 5BOZG 2R0KL 1F4WH 4WHTA 1B4JH 3NCBB 3QXAA 4GJTB 3UPCA 1WBZB 1R24A 1XR8A 2VWEE 2VOTA 3VFSB 2FWOA 1AO7E 2EDQA 1HYSD 3DX9B 3VWJD 4JG0L 3PHQA 5I1EH 4JN2A 4BZ2H 4OZ4A 3D3VD 3VFRB 4WY7H 4BSJA 3ZYOA 2OZ4H 5DYOB 3DUUA 2FL5A 1B0RB 1SJHA 2GFBB 4N5EA 1TCMA 4EOWH 1GOFA 3G6JF 4OGXH 4RZCA 2AEQH 4L9LC 4MCYB 4PREB 1NCCL 1XT5A 3GHEL 5MHSD 1UB5A 1M7DB 2OQJA 1NAMA 8FABA 1J1OH 1RHHA 1EHAA 1P6FA 4Q58C 3CPLB 2DRUA 4IRJA 5EA0L 1BEYL 4KUCD 2V5RA 4IOIB 1UJ3C 3V0VA 4NCDA 3QJFB 5I8KL 2IG2H 4K94H 2Y36H 3BD4A 3RQ3A 5E1HB 5ENWA 4MX7B 2F5BL 5EUKB 3IDXH 2IG2L 2ZUWA 1FNAA 3QXUA 3FZUD 3K4ZA 3U7AA 3V5KA 2A83A 5KSUA 4CN6A 2IAND 3ARED 1C16A 3W9DB 3Q0HA 1T7XA 1MREH 5IEKA 4XCFL 2ED7A 3G5VB 1DANU 4I5BB 2JJTC 5DD3H 2QLVB 2DJ4A 1CS6A 4ALAL 3C6SB 4AY0A 4DKEH 3PWNB 2X6MA 1ZT7A 4H1LB 4UZGA 3UC0L 2R56L 1HHKA 1EEYA 1MAJA 1G7HB 1MIML 4UQ2A 1FZMB 1AP2A 3V6FA 2X9YA 1S5HB 4HUKB 4HWBL 3A6OA 4LCWA 4OFPA 1OD7A 1DP0A 3O41B 5B21A 4BQBA 2DM3A 2FO1A 4NJ9L 4P46D 2NXZC 1MCJA 2W1NA 3QUXA 2VC2L 3T0EC 4DCQB 1LEKB 2OP4H 2FO4B 2OTUA 1YEKL 1HHIB 4ZOCA 4ONGH 1HH9A 4PY7A 4H8WC 1PKOA 4PJ7A 4LLVB 1WUNT 1R5VB 2DQIH 1H5BA 4O51A 1BFSA 2B1HH 1QSZA 1RIVL 1M1SA 1FFOB 1YYML 2H1PL 1TTFA 2YOCA 1OARH 1F90H 3NN8B 5HYSA 4WCYH 2VDML 5D7IF 2Z31B 1IBGL 3L5XL 2C7UB 3B2UC 2OL3H 4LSPL 4Y5VA 1FZJB 5D7LD 5AYUL 3AS1A 1MRCH 1S7XA 4HT1L 3I85A 3MRGB 3Q1SL 2JJSA 1V7NH 3FL7A 1YPZF 3RVWD 4R8WL 4RDQG 5JHDB 4JHWH 2VAAA 2P7TB 1S5IL 4X80H 1VPOH 1S7QA 4L3CB 4EI5A 3SDXF 3VG0L 2BVQB 2APWA 3VWJA 3ULUD 4KZEH 5D96C 5FGBA 1NBYB 3QXVA 3HAEG 4I0KA 1C5CH 3IAGC 4E41B 1OAUL 3QUYB 1A0QH 1QSED 4N0YL 4J1UB 1I9JL 4XMLL 3TJHC 4XB8A 4H1LG 1ES0B 5GGSA 4AEEA 1U8PA 1X4YA 4XXCA 5TFSL 2AJ3A 2IWGA 2JKXA 5C0DA 3VXTA 2W0LA 3MLVL 3F7VB 3HZMA 2FECI 3RX5A 1JZ6A 1E0OB 2ENYA 2YBRB 1MFDL 3EGSA 5EIVA 5I71C 1BJ8A 4J7RA 4IEFB 4KMTH 4TUKH 4MCZB 3VXTB 5LBSH 1ADQH 4LCUA 3CH8A 4GT7A 4OCYL 4P3CL 2HTLD 5J6HA 2R4RL 3MRJB 2ESVD 1BIIA 5ANME 1IGJB 4S11A 3WXVL 5FYKE 5C0ND 2HG5B 3HI1A 4PLOB 3TCLA 4R9HA 1A02N 4EUPB 1PX4A 1S7QB 3D6GA 3MCKB 5D6CB 2QJDA 5JOEA 1CK0H 2DQJL 1BIIB 1K5NB 3T04D 1MUJB 1WZKA 4PJIB 5LVEA 1BZ7A 2P8MA 5BJTA 2ZOLB 3KPSD 4HUMB 2EDBA 4WENB 2W9LA 1IKNC 1K5NA 5F72S 5IWLA 1YUHB 3LPGA 4WHYG 5CP3A 2DBJA 2FCBA 4J3WA 4WW2A 5EO0B 1TJHH 4GUPB 5EBMB 5DUPL 4MNGA 4FQPA 1JGLH 4PGJA 1QSEB 4ZODA 5AUMA 3EDJA 3PDOA 2M8XA 4OCWH 1IGJA 5JQ6H 3QDGA 2A0LD 2ZJSH 3SO3C 3CLEL 3QAZB 1SVZA 1VESA 5JTWA 2R1XA 1SJEB 3P4MA 4PJ9A 2B4CH 2DMCA 3V5DB 1KCGC 1IGML 2HMID 2P7TA 3OKOB 1UM4L 3F7VA 4M3KB 1IQWH 3BSZH 5FECB 1PX3A 4BH7B 4TVPL 2JCCE 1EJOH 3Q48A 1BOYA 1DUZA 5EU4B 4DOHB 3HZVB 3GI9H 5GGSB 1A7BA 1DBAH 1ES0A 2G75A 3MBXL 3O41A 2VABA 4MZ3A 2VXSL 4U6VL 4MA3B 3ULUC 1UFUA 4KROC 2AJYL 5HHME 3QNZB 1OAQL 3A6BH 4NN5C 1EEYB 2ARJQ 2Q8BH 1YJDC 4BQ8A 3BMWA 1FIEA 1NSNH 5T33H 3ZYZA 2VXVL 3LIZH 2NZ9D 3NBNA 1J1PL 5E6IB 2DQFA 1P7QB 4YBLC 4PTUA 1MVFA 3W0WB 4LVOB 4LPVA 2KPNA 4DCQA 3AC0A 4O2FA 4JFHD 2DBLH 3L5WB 4P9MH 1EDQA 2FHFA 5DVLA 3UTSD 1NUGA 1ZSDA 1G0XA 4IOIA 1FFOA 5BVPL 5CD3A 3PGDB 4WEMB 3MOAH 1CFVH 1NMCC 4DZBB 3BKJL 4WFEE 1GZQB 5IB3B 4K7PL 1R5VA 4BQ6A 5DT1H 5IMMA 8FABB 3REWB 4CN1A 4HUWB 4YE4L 3MMEB 2XTJC 4KUCF 3HS0B 3U30B 3MRBB 1MFCL 1AO7A 1ADQA 3EYSL 5HHXL 3C6SA 1LEKA 1G7LA 1QFOA 4JG1L 4KGLA 5DDHB 1RJYA 2CDEB 2BCKB 3DSFL 4QRTB 5C0AA 2ADGB 5C0JB 3L3DA 1AC6A 1X9QA 4FFVD 4U6YB 3NCEB 5AAMA 1G7PB 3KLHD 1S5HA 2Q3AA 3C9NA 2FX8H 4P9HC 1RIUL 1WBZA 1M7IA 2IBZX 4ZYKB 1AQDB 2X4RA 4MNHB 4WHTB 4P2CG 4YHYC 4RQQA 4ONFL 3VCLB 1MAMH 1MLCB 5GJSL 1AE6L 3BE1L 3CD4A 4N5UA 5LGHH 4QHUA 2RCSH 2H26A 1DFBH 4JFXA 1J8HD 3VGBA 4Z76A 3AY4C 1R3JB 3FZUC 3EDFA 4LOUC 4OUUA 1WIPA 2NX5A 4O58H 4I3SH 5F9OL 1QACA 3GO1H 2SEBB 3VXUA 1ZS8B 2CUHA 3SQBA 4Z95L 3BGFB 1Q94A 3UTTA 2PNDA 2HVJA 5J9PB 1I8LC 1NAKH 4FQ2H 3WNLA 4IRZL 4YHMH 4FQ2L 3R06A 3TVMD 1V7MH 2IBBA 5L8LB 1U8JA 2AEPL 5B22A 2DD8L 1QKZL 5BS0B 3EOYG 3EZJB 1B0RA 1MHEB 1T1WB 2IQ9H 2G2RA 4NQED 2HA1A 3MZGB 5C0RH 5I1LA 3NFPB 4IHOA 4YQXL 3SKOB 1HYSC 1FRGL 1YDPB 4JQIL 3QI9B 4K9EL 4DZ8A 3WO4B 1XCQA 1JV5A 2LTQB 4JQIH 3HNTL 4UINL 4ZFOB 3P4OB 3RNQA 3WD5H 4D0BB 3HNTH 4UINH 4UT7H 4OJFH 5IGXL 4NO5A 3ULUH 4RAUA 2BXYA 3U83A 3IDJB 1A6ZB 4QXGH 5I30L 2X4TA 3MRHB 3OGCA 3BWUC 3JWDL 2FATH 2VIRA 1B0GB 4AENB 2WP3T 3CAFA 3BP5A 5FF6A 2YKLL 4F7CA 4NQEE 2PYEA 4YHNB 1IM9D 1FG2B 4JB9H 4XBEL 2YHGA 3WUWB 4JRYE 3IDGB 1NEZA 5FKAB 4DGIH 4JB9L 4CADB 3B6SB 2B4CC 4KRNA 1PDKA 2AQ1A 4GW5B 4HGWB 3QDGD 3U79A 4OZHF 3INUH 3DRQB 5D7IA 5IFJA 1MH5A 1ETZB 1RURH 2P49B 4NNXA 1SM3L 4I18C 5FOBA 4PJAE 2W9DH 4NQTA 1JZ7A 25C8H 2QQNL 1JPTL 1XIWB 1Z3GH 3GKZA 3HLAA 5DRWA 2WSKA 3G9AB 1KACB 2PO6A 2OTPA 2WUBH 3T0VA 2ZSVA 4NRXA 4XCYB 4XMPL 3UCRA 2VSCA 1W72L 2AV1A 3DV4B 1YNTB 4NFDA 4LSQL 3TP4A 1XIWA 1QR1B 1CBVL 2GCYA 4M5ZL 1XF3B 3CU1A 2CLZA 4M7JH 3H9SE 4GMTL 3I3BA 4NQDD 1AGBB 5T5FL 5CEXA 1XH3B 3I02A 4LASH 4M1DH 1MH5B 3DVNA 5A3IC 3T0BA 1M71B 5DJYA 2OK0H 3O4LB 4K3JH 1E6JH 4XNXL 2J8OA 3TO4A 5I17A 3CFBA 4PJ9C 3HB3C 4LU5L 4ZOEA 5GS1A 1JP5A 5HDBE 3C2SA 1SYSB 1T7ZA 4AENA 3ARBB 2QQLL 1A1NB 1U0QA 2DWDA 3AB0C 2IFFH 3M8OH 3WNNA 4P5TB 3WUZA 4UTAL 2ZPKH 5LCVL 2NMSA 1BQUA 4F58L 3N85H 4MJ5B 4ZO8A 3P4OA 3QB7C 3RNQB 4OLXL 1ZA6A 3PV6B 2MMXA 2Q76A 3SQOL 4MDIA 3B4NA 4WGVB 4FQLH 4FFWD 4QWWD 2EICA 3WFCL 1MHEA 4IMKC 5ACLA 2X89A 3WFCH 4CBPA 3MROB 1QSFE 5CEYA 1AGFB 3DHMA 3ROLB 5IB4B 1E28A 4M62L 1BJ1H 3GSVB 3U4EA 1ZHKB 4KI5F 2XPGA 3CFDA 1FV1A 1HYRC 4R7DB 4ONGL 2F58L 1CR9L 5ID1A 4WEBL 2XWJA 4UILL 3VXME 1ETZA 1CDHA 3VFGL 5L9DH 4PRDB 1NKRA 1XR9B 4L8DB 4Z7NE 3RGVC 2FBOJ 4HG4K 4GAGL 1AQKH 4R7NB 3NFSH 3S7GA 4YLQT 5IJKA 1NEZB 5FKAA 1T1YA 5GGUB 4PR5A 3QWQB 1H3XA 4MA7L 1G7MA 3FMGH 2WNGA 2X70A 1FYHB 2RFXA 3KPOB 1AH1A 1EVUA 2DL9A 1G7QB 2OMBA 4ORZC 4JLRA 3SCMA 1JZ4A 3EO9H 1XGPA 1YEDA 2D31A 3B9KD 5AD0B 1DLFH 4GQ9L 4OZGA 1UCBL 1R3KA 5H35A 5EZJB 2EH7L 2YPLE 2IPTH 3VFUA 1R3LA 4KKCD 5DD1L 5I8OL 3IJSA 4LCWD 3QG7L 1AR1C 2QHRL 5T1DL 4DKDC 3MLXL 5I1CH 3VG0H 3N1FC 4N0UA 4NKMB 1UEYA 5D70L 1TMCB 3NFPA 2FECL 4HIIA 1RMFH 4JM2A 2YD7A 5D1ZB 4XBGA 3ARFA 3RWGA 1RUQH 4Y2DB 3S36H 4LQFL 3IXTB 3TBYA 3ZLQC 3HC4L 1NGQH 3T2QA 1B88A 3FQUA 5IW6B 1CICD 1KIQB 5CGYD 4S2SA 3DTXA 4GQPH 5IB3A 5JR1L 3EFFA 1WZMA 3AAZB 2HN7A 4XPFL 3HFML 4Z5RB 1QBMH 4N9GA 4UB0L 4IS6A 4PGDB 1G7IA 1QBML 5DD5L 1QFWH 5H37H 3MRMB 1A6UH 2IQAB 2WLZA 2V5TA 3PQYB 1MCNA 4KK6D 5A2LH 2I27N 4NHCH 1CZ8H 4PRBA 4APQB 4NT6B 3PWPA 3GMMB 3VW3L 1FLRH 4P2QE 1PZUB 4FQHB 1MFAL 1NQBA 1RJLB 4M48H 3O2DL 3VFMA 1K9TA 3CFIC 1A6PA 2UWEA 2X4RB 1KT2B 4L9LB 3QISA 3MFFA 4NO2B 1KIRB 4HUVB 4Y19D 4LDEB 4L9DA 2JLLA 3VGHA 1JGVL 5C09D 1KEML 3TFKC 4G8FA 3DYOA 3CSPA 3C8DA 3ZE0F 2VLJA 4GW4B 4Y4HC 3EJYC 3U4BL 2ADGA 5FO7B 3EJZD 1YC8A 1DUZB 5EU4A 1UJ3B 2QHLA 2FB4L 4JVUA 1JGEB 1U58B 4B7IA 2GI7A 1I9RH 3LS4L 4F7TB 5T3ZL 2FB4H 3OHXB 3ULUE 5E4EC 1UZ6F 5MI0B 1PYWB 5JHDD 1CLCA 5IHUL 5F89A 2R0LH 2ADJA 4JRYB 5T5NF 4MWFA 3B9DA 2RBLA 2Z31D 2NR6D 1UM4H 4K3HA 5F7KC 1OAYL 2BVUA 4RDQF 5F88B 5I1DB 5I1HL 4F33A 4I4WA 1FAIH 2EDNA 4JPWL 3BH9B 3K0WA 3HCVB 3ZL4H 4LSDA 1DBAL 1TZGH 4G80B 5E8PB 1N5AA 4LGPB 2B1AL 1PKQB 5D7SH 4IRSB 4XMKL 1JWUB 3QZWB 5EO9B 1KLGB 1X6LA 2FYYB 3H6JA 1MHCA 4JFDB 3RVWC 1YA5A 5DGQA 3PDDA 3BW9B 5I19L 3MRLB 1A3LH 5E70A 5DO2D 3QEHB 4PJ8C 4PJHA 1DVFC 2X4SA 1B0WA 5DJ0B 3KR3H 2AI0L 3CFKA 4G8IA 4LCCB 3RPIB 1S7SB 3RJDA 3OZ9H 5KSAC 1G9MC 3OG4B 4JN1H 1U8QA 1ND0B 3T3PE 4EUPH 5M7QA 4M8VA 2NY2D 1LO4H 2KQNA 3FT3A 3GK8H 1WICA 4EOWL 4RFEB 4AQOA 4JZJA 1FBIL 4KHXH 4G7VL 5E56A 1M7XA 1T21A 3RWHB 1U8KA 5GGTH 4C4KT 1JNHA 3HZMB 4KK9D 3RBGA 1LEIA 3MV9B 2O5YL 2DI7A 4LLWB 4OI7A 1XFPA 3VA2C 3B43A 1CG9B 1NGXB 3HE7B 2A6DA 2AEQL 3P4MB 2R1XB 2XQBH 3BFOA 6FABL 4PRPD 2A0LC 3W9EA 4S1RH 1BLNA 3O6ML 1C7SA 1JHKH 2F5BH 3IKKA 4GG8B 1L7IH 3HZKB 1YMHA 2BY1A 4GS7C 3UTZA 3GMNB 3KPSA 1L7IL 3ARWA 1A7NL 5EA0H 1JHTB 4DW2L 3QDMD 4LFHD 2FHBA 2DJSA 4IMKA 1R0AH 1MREL 2D7TH 3D3VE 1RJZA 4L29B 4FG6C 3PP4L 3UAJD 3U9UB 3CK0L 4OZGF 4ODUB 5CEZH 3PABB 3F6LA 4M61A 1MI5B 3LQZB 4LIQE 1AXIB 2WINB 1RZ7H 3RY6A 1X5HA 2F53B 4NQCD 1KUMA 4IDLA 1R5WA 5KVEL 2V2XB 4MQSB 4EUPA 5JO5B 1IM3A 3TCLB 4JHZA 5ETUB 2NTFB 2AK4B 1PG7X 2C26A 1T7YA 3CVHL 1FP5A 2CLRB 1D9KD 3FQXA 3BZFA 2D9CA 5CZXD 4FZEH 3TVMB 3O8XD 5IKCB 1WSST 5FO9B 1B2WH 5BS0D 1T20A 3BEVA 4ZNEE 3DPBA 4U0RB 3FFDA 3T65B 1NFDA 4G6AD 2OTUB 1CDYA 4HUNB 1QFHA 3MREA 1URLA 1KBGL 1MF2H 3S8WA 4YUEL 2GHWB 4AIZA 2AEPH 1MF2L 4MJ2A 5T1LA 2BNRE 4NN7C 4P57B 1H3VA 1EPFA 1U8PB 2W07A 2X1OA 2DLFH 1UM5L 2BJMH 1WTLA 1T6VN 4AH2A 3S37X 1HWGB 5TDOB 3C60D 2DLFL 1X5JA 1KCKA 1IFHH 1RU9L 1SBSL 4LPCA 3QULB 3PP3H 4OZFH 3VWKD 2A6JA 3FOMA 3TCXA 2GJ6B 3P77A 2VAAB 1LP9E 3QNYA 4R3SB 3MA7B 4YZFF 1KTDB 3F7PC 5KOVC 3NCMA 1BVLA 5DSCB 3G5YA 3HE6D 4HXAL 4JZOA 3JWOL 3F58H 2BRRL 5SV4A 3DBXA 2V9RA 1FDLL 1FZJA 1QEWB 4RGMB 2A83B 1QVOB 3ARDB 1IGYA 3Q3GA 3MLPA 2F5AH 3QIWA 2Z31A 2AS5M 1IT9H 1KFAH 2VLJE 3T09A 5FA4A 3NN8A 43C9B 2B0SL 4HS6B 2VLRD 5D1XD 4HULB 4ZD3L 3TNMB 2NXYC 2DB8A 1VB9A 1GAFL 4KRMB 2MFNA 2DQTL 5EC1A 4LLVA 4PJ7B 1I9JH 3HR5A 3WMSA 4OZFB 1HHIA 5HYQA 1DN0B 3BPCA 2WAHA 1JHLH 3P3YA 1KC5L 3MOBL 5CSGA 4R97C 4YXLH 1CL7I 3MV7E 4HJ0D 2ARJA 4S10A 43CAA 3DOSA 5IROA 5E95B 3UJJH 1CFQB 5LKNA 1TCRB 3D18A 4Y4KC 4OKVB 1KOAA 4HV8A 1A9EB 1A6VH 4I2XA 3RIAK 1M6OA 5DUBB 1XR8B 3UPRB 4XWOC 1E27A 5F9JB 4XCEA 4Y5YA 1HHKB 1F8TH 2K9UA 3LKSB 2C4XA 5SX4H 4U6TA 2X9XA 2MQCA 4Y4KA 1FNHA 3NMEA 2GSGA 1K3IA 1W72A 3FQNA 2YD6A 2H3NB 1R3HB 1U3HA 4RFNB 3MBEB 2LVEA 4HKBB 3FONA 2UYLA 2DLIA 5HYEA 2DKUA 3FQRB 5GSVB 5D2LA 4UUJB 3MLSH 4PJGF 4JFED 4ZUUA 3H7BA 4HIJA 1FNSH 5EPMA 1JFQL 1H15B 2PETA 5CJOH 1INQB 1AHWB 4RMUA 5MEQB 2X4NB 3ET9F 4IRJB 5T1KA 1G7JA 3ULVE 3SDAA 1FAKT 4L3ED 3V6ZA 4HHAB 4I48B 3K46A 4UOW0 1DSFL 3PUCA 4GBXC 5C7XH 2OQJB 5IBUB 3BRDA 3D39B 4Z7QF 1OTSC 2KUTA 2AQ2A 3TZVC 3VFNB 4M93C 4WTZG 3CZFB 4NYLB 3LPWA 1U8LB 4XCCL 5HHPB 5DGRA 3CJJA 4Q9BA 3OKEA 4J2XA 5EFIB 4AEHL 3STLB 1WC7B 5D7JC 2FGZA 4Z78B 2ITDA 4YWGL 5KN5A 1I8IA 4QRSA 3BHBB 5ADOH 5DJAA 1NSNL 5T33L 5HGDB 4NWTL 3T3ME 2VXVH 4Q6IA 4TULH 4AM0A 1I7ZB 3OAZH 4PBXA 4U1JB 5SX4I 5IESH 4F57L 3P11L 2NY3D 3LPFA 1F6AB 3CXDH 1MSPA 1T89A 2WZPD 3E6FB 2F9BT 3JBG7 5AYQA 5F7EH 1DLHA 1FJ1B 4WRLA 5DK3A 5EG6C 4ODTH 3KNBB 2VDPL 2BMKB 4JM4L 1NCDL 4N0FA 3BXNB 3C5JA 5FYJL 5I74B 3NZ8A 3ZYIA 4JFOA 1QHOA 2ZKHH 32C2A 1A1OB 5E1AA 2ADIA 3QJHA 2ITCA 3QG7H 1F2XK 3SDCD 2P44B 3C6LA 4KI5E 4LHUB 3DV6A 1UKSA 1JWSB 4L8CB 3QI9C 4U1HA 5DRZB 2VQ1A 2HT3C 3GHBH 4U1NB 3RZCC 1YMMB 5DQ9B 2C3HA 2Y25A 3DROB 3M45A 2Q7YB 2CKBH 5C0CE 2BY3A 1F45A 2XKNA 4Y5XC 5CKGA 3KG5A 3MLUL 3LN4A 3L7FA 3GJFK 3OXRB 5E8DL 3GI8L 4XPBH 5TDNB 3S36L 4LEOB 3VFOB 3VH8B 5F7NC 1DUYA 3DURB 4JAMA 1Z5LA 5TF1L 5DQDH 5E94A 1S7TA 4YDVB 1PVHA 1H3PH 4QHLB 2J8UF 4X7SH 3V6BR 2F74A 5GS3A 3JUZA 5D5MF 3RUGA 1WEJL 4LAQL 5K59E 4IMLB 3E2HB 4WI6A 3MLTB 1KCRH 1Z9OA 4YXHH 3SE4C 2CXGA 3IFLL 3REVA 4W6YB 5IMLB 3PJSA 5CGYC 4EIZC 4HWEH 4PS4L 5ILTL 1KYOK 4I8DA 2FEDD 5D2NA 4WW2F 1J1XH 3QPXL 1ZT1B 1MFAH 1YMMA 3ZYJA 5DI8B 1JNLH 2X40A 4FABH 1CDIA 2DDQL 2F8OA 3LN5A 1N4XL 2LU4A 4JO2L 4RWYH 3WBDA 2GJZA 3SDAD 1G9EA 3T0AA 1F4YH 4KVNL 4Z95H 2BHZA 1UB6A 4XPAL 2ERJB 5J12C 2YD1A 5ESVA 1MLBB 4POUB 4X6EB 4CVWA 2RQ8A 1GL4B 3OJDA 1VCAA 3B9KC 4RGNE 5CGTA 4YFDB 4F2MB 4P5KA 4PRPA 1S9XB 3KPPB 1QRNE 1A6TA 4OD2A 3SE9H 2BVYA 4LEXH 2HTKD 1B90A 1DE4A 5CSZA 5IVNA 4JDZA 4YEEA 1VFOA 2VL4A 3CMOH 2X4QA 4HS8L 1FZKA 3GSRA 1P4IL 3HPLB 1OCWL 5CZVH 4HS8H 4S1SL 4G8EA 4PRNB 1FORL 1GC1H 3TT1H 1KCVH 4BELD 2DQGL 1LGVA 4ZFOL 1ONQB 5T3XH 4F9LC 2VXTL 3C09B 4GAYB 3GBNL 2O5ZH 1MCDA 1HHHA 1JN6A 3DRTB 4EN3B 4NM4L 1GIGL 3UZEA 5C9JB 4ZPTB 3HKFA 3QAZC 1OM3L 2AK4E 4MJ4A 5DTFA 1XF5B 3L7FB 1OM3H 3BIKB 1T7VA 4X0KB 4R0LB 5D6DA 5DEGB 3TWCH 3IETB 2NY3B 3D39A 4FQ1H 4U6XA 2D7MA 4GRLB 1PY9A 4ZUWB 1UJTA 3ZE2F 2IALB 1CICB 5F7UA 5KVFL 1Q9LB 3NPSB 2HWZL 3DX7A 2FX9L 3DUSB 1T83C 5EBWB 4BFEA 4RX4A 4Y2DD 1CD9B 4QRPA 5MEQA 4DTGL 2HJLB 3O4OB 1H15A 3EFDH 1U9KA 1W8NA 3JVGA 1KYOJ 2J8UB 1BQHG 1N26A 5LAXA 5CFHA 5J56B 3UROR 3WKMH 4JE4B 1N6VA 3BKCL 4KROB 1WWCA 2EECA 3VJ6A 5ISZA 3VGEA 2CRMA 2OR9L 4Z7OF 5B38B 1UACL 3WKML 4NN5B 5IF0A 5CS7A 4KKBD 3MBEA 5ESQB 2IAMC 3JV4B 1JTTA 4HLZH 4JCMA 5HDLA 1W72B 5BO1H 4ODXB 3QXDA 2BOBB 1WFUA 1WWWX 4YHZL 2AERT 4ONHB 4X6DE 3O6FA 4HW6A 2ZUQC 4LCYB 2HH0H 1TQCC 5FCSH 4LVOC 3SDYL 3D85B 3D2UB 5A3ID 1M6OB 2AJVH 1BF2A 4Z78A 5EBLA 1UVQA 5IMKB 5CP3H 1FL5A 2GITB 3K2UH 2CSPA 4DW2H 1CFQA 1UQSA 2XZAL 4ZXBA 4PRHB 2LE9A 4GAFB 4NZTL 3BP7A 5CHNA 3RA7H 4Z0BL 1NJ9A 43CAB 2ARJB 3CVIH 5J11B 3HI6H 4D3CH 1NLBH 3T3PF 1U8LA 3GDBA 3GB7B 5HYJB 3CZFA 4I2XE 4YNYB 3NCYS 3SDXA 5HTSA 1JYNA 4BH8A 4OGAD 5E5UB 4LPYA 1OF2B 3QCVL 2A6KB 4RBPK 5E8OB 3VXSA 1VADB 1FVDB 4HHAA 5I9QB 5F1OB 4MD4B 1FGNL 2D3VA 3WHXA 1X5AA 1R3IH 4EZMA 4UIMB 5TGBA 5DK2A 3SDDB 4P46B 3LQAC 4QXUH 1WWBX 2FR4A 3BDYL 3WIIL 2YK1L 2I07B 5F21B 4HKZA 4QRPE 4PJFF 3AM8A 4E42B 1I7UB 3RUGF 3IJHB 5F9DC 3CDYA 1Z2KA 1U2HA 4KKLD 5IVOA 4QOKD 1IC7H 3O11B 1UZ8B 2Y36L 2FEEI 4N8VB 4UIKL 1FN4B 2E7LE 1JFMA 2NY4D 3TJHD 5JXEA 1ZWIB 5KS9E 2W0FA 4TNVF 15C8H 3F5WA 4PJ5A 1DBMH 4JQVC 4NWUL 4X4ZA 3BT2L 1TCRA 1N6UA 4PRHD 3NACH 4HC1L 5HHOE 3WKNA 3BT2H 3NFSL 4HG4J 2HT4D 1HQ4A 4H26A 3MC0A 1DLFL 4C56A 4HK0A 4X7EC 1V3LA 3VI4F 1YQVL 2VDMH 3UTPD 2YPKA 3F7QA 2R2CA 3KPQB 1IGIL 5ANMA 5IB5B 3BPCB 3F58L 4NKOB 1LNUA 5BMFH 1BFOA 2QEJA 4OZFA 3NCJH 5BW7C 3ME0A 3NVQA 4JO1L 5FO9A 4HQQH 1W0VB 4HT1H 2BNQB 4R90L 1NC2B 1OQXA 1UGNA 3NIFE 2V2WA 3EOTH 5EC2A 1I1AA 4I77L 1VA9A 4PJEE 4L4VE 2IGFH 3MJGX 3OR7B 1IM3B 4N1HB 1H8NA 3NH7H 1CLOH 4LOUD 2DQTH 3I50H 3Q3GB 5E0QA 1VFMA 4RRPG 3SE4A 1FNGB 4AJ0A 1QVOA 4ZAKD 4HUXA 1RMFL 4WV1C 3U4AA 4NGHL 5JDJA 3O3AB 1D9KA 4PRIE 3LQZA 1YEIL 3DBXB 4NKDA 4U1LB 1FO0B 4YR6A 3QP3A 3G5YB 4P59L 1RZIA 4LHUD 2BVOA 4PJFB 4PG9A 2XKSA 5F6IB 4M3JA 1I3GL 4ZFGL 2GJ6A 5CBEB 1TENA 4HKJB 4XVUD 3RWDA 5CIPH 1JHTA 4WFGE 4ZFGH 2H9GA 4U1MA 4KQ4H 3UTZB 4NHCL 3IDNA 1F13A 3VFWA 5TDOA 4JFZH 3DX6B 4XNYL 1A6UL 2LABA 4I18B 5IVZB 3T8XA 4WWKC 4LLDA 5HHVL 4TOYL 3EOBB 3D69B 4LLUA 5HHVH 2YPLB 1I1RA 4TNWF 4C54A 4M8QB 1U8OB 1INEH 5LXGL 1MAKA 3VW3H 3IDNB 1HHJB 1N8ZB 4KZEL 1S9VA 2DI8A 3MSPA 1FE8H 1A0QL 4HKJA 5FV1L 1FE8L 4PJXB 5IQ9B 1I1AB 5I73C 3O81A 1Q1JH 4OD1L 4PJFA 3EO0B 3GSWA 4CVXB 4TUOA 3KJ6H 4RA3A 1Q9OA 3PE9A 2VQUA 4MD5A 1QSFA 4G8IB 4LCCA 3U0WH 5DJ0A 1T0MA 4WJ5A 3GRWL 4F8QA 1BFOB 2B4CL 3O3AA 1C12B 4HIXL 4O4YH 5LBSL 3BW9A 4PJIE 3LRHA 3PL6C 5I1AA 3QUZB 5FO8B 4LSVL 3I6GA 3MJ7A 4HZLB 3MUJA 2JB5L 1T0NB 3BP4B 3L5IA 4I18A 2P5ED 5IVZA 3ARBC 3PABA 5EC2B 4P4RA 3E3QC 2W65B 1FL6A 2BNQA 5SV3A 5F1IB 2CK2A 4QXWA 4U1MB 3ARDD 4XI5D 4JCLA 3E0GA 3MRNA 1AKJD 3MV7D 2MJWA 1RUPH 3LVEA 5I18L 5E2VL 5JOFB 3AXLA 4HWZB 2NY1C 2UZYB 2YPKB 1D3CA 4XP5L 3W9EB 4R4BB 3TIDA 1EMTH 3HE6B 3L1OH 4MWFB 2ADJB 4JRYA 3H2WA 1PYWA 5D7KE 2Z8SA 5DZOA 5SWZB 2DF3A 3ULVF 5HI5D 1FL3A 1YEGH 4XWGH 5L7XL 3VGGA 4ZS7H 1T66D 3A67L 1WGOA 3FT2A 3IJYA 4WFHE 2EDHA 5E4IA 1MJUL 5DURD 4OF0A 5DC0A 1MVUB 5FEBA 1PG7L 4LNRB 4OCWL 3V4PH 2EZ0C 2O26U 5GZOC 4N8VA 5ADPL 3KR3L 4NFCA 3CCHB 3L5JA 5LQBL 1OVZA 2XTLA 3QIUB 4ZXBC 1IGMH 1VADA 1OAZH 1SY6A 4QY8B 1ZE3C 1KIRA 4U7KA 5DF0A 1RVFH 4WI8A 4Y5XA 1HSBB 2UWEB 5F3BA 5F6HJ 2Q87A 4TVPH 2FR4B 1RHFA 4YIQA 5JW4R 4JFDA 1NCCH 3GHEH 3UBXG 4NT6A 3MACH 2Z93B 2O5YH 1T4KB 1T6WA 1NGZA 2FIRT 4WHDA 4Y16D 5ALCH 1YNLL 2CLVA 1WCBB 4J3XA 2CRZA 1TJGH 3QCTH 4JJHA 1OHQA 2CO6B 1JGUH 4XVUC 5IFAL 1U8HB 5IHZB 3AMKA 2E6PA 3PIQB 5LG1A 2DQEH 2Q8BL 4PP2A 4FFYH 4IS6B 4H88L 3HG1B 4JKPH 3IDIB 1L6ZA 1UZ8A 2H8PB 5FB8A 2HN7B 4G9FE 4OCXH 1ZLSL 4YNYA 3SDXB 3VXRB 4OF5A 2VXQL 2XG5A 4KAQH 1R6VA 4S2SB 1GPOH 1VHPA 2RHEA 3WLWC 4KAQL 3B9EA 2LAGB 5JIKA 4CVZA 5D1ZC 1S9YB 1K8IA 1VERA 3UDWC 4KH2A 3KDMB 5D93B 4ZTPH 1U58A 5GJSH 2VDLL 3AU1B 3VRIA 2Y6SC 3V79C 5GRJL 2CRIA 2WBJD 3WHXB 5HY9A 1MJ8H 1U92A 1XGYH 3K80A 3DVIA 2G5RA 4P4KD 4LGSB 1KPVB 2BOBA 1XGYL 5GGRB 2VKWA 5FUZH 5ABDE 5KSBA 1R3LB 4Y4FA 3EO1A 2V9TA 4ZUTA 3ILQD 3F12B 4D9LL 3DSFH 4YHLH 4JPIB 2C5DC 1ZVYA 3BP7B 4X5WA 5C9JA 4JFPB 5HDBF 5D1ZD 1BECA 5DC9B 1AXSA 3P2TA 5ACZB 5C0RL 1CGWA 5EBWA 3DUSA 1ZHLA 4N90E 2Y5TA 4NHUE 4HBCL 2A77L 1Q9LA 4R4NC 1FIGL 1LQSR 1ZTXH 4N8CL 5F7YC 4U6XB 2EYSB 3GSNB 4PRDA 4K8RH 3ZDYF 2PCPB 4Z18A 1EHLL 5J4MA 3ULUL 1AHWC 1DL7H 4JQXC 3GBNH 1EHLH 2GTWB 1CQKA 5TDPA 5KG9B 4Z7UA 3IFOA 5IVXB 3H3PH 2GY5A 1I7TA 3RKDD 3C5ZD 5CSZB 4PYHA 5IB4A 5IF0B 4HXAH 4FTVA 1V7NL 2ZG2A 2EDLA 3TA3B 1AGFA 1S9XA 3IB4A 3FJTA 1BAFL 5ISZB 1ACZA 2IMNA 4EI5D 5I30H 3WS6A 5GRUH 2QSQA 5DXWA 5KVFH 2O5XH 3OKKA 1IQDA 5TH2B 2DWEA 3S35X 4X8JA 1FZKB 3GSRB 5HHQA 1SMAA 5KVMC 4DGIL 3E6HB 4PLNC 3OJVC 5BW7A 4UDTA 5D7JB 4N8VG 5L2JA 4L5FH 1DE4B 1IC4L 5DI8A 3BPLC 1BZ9B 1Z3GL 1KULA 3IT8D 3LD8B 4O2CA 4X7TB 3INUL 4YGVB 2EIBA 1I3RA 5DJZA 3H42H 1G7QA 3IRPX 1NFIA 4PY8I 5D1XB 4GMSH 2YUZA 4WHYH 1PKQE 3ULSB 1MIEH 5IM7A 4JFFE 1A4KA 3CXHJ 3TIEA 2QL1A 3TH3T 3RNKB 1NGPH 2Y07L 5J1AB 4PJ8B 2P24A 3W2DH 4XNMB 1DVFB 5D7JD 5CLWA 1AJ7H 1AXTL 1M71A 4LCCC 4OQTA 1HH6B 2YN3A 3S96B 5MERA 4Z7UF 4OFIA 5HYJD 3HPLA 5TQ0H 1MQKL 4UU9B 1QLFB 4JZJC 4LLQB 5DLMH 2WIIA 2R69L 1FV1B 4NQEA 4XAWH 1CF8H 3MRRB 3SE3C 5JHLH 3VGAB 1QLFA 3OAYK 3RA7L 2ICES 1SJVA 3E1F1 3ARGB 3WJLA 1CE1L 3MLTA 4NQDA 4Q7DA 4F2MA 1FFRA 1HHGA 2Y23A 4OM1H 2ATKB 5TQ2L 4Z7OE 5K9OB 3KYKL 4AIOA 2XY1A 1IAKA 4KI5D 2ZCLH 4NRYA 1G6RB 4WW1A 3RU8L 1QNZL 4QHLA 4G9FD 4R96A 1I7RA 2HLFC 2P47B 5INDB 2OI9C 1SJXA 4MB3A 4JAMB 2OSLB 4K07A 5DWUL 4J4PD 2ZPKL 3NZ8B 3VFOA 3VH8A 4N8PA 4GS7B 4LBEB 5I66B 2OZ4L 4L4VB 4O5LL 1FG2A 3AMLA 1OAKH 4G6MH 2DWDB 4X7CC 4YDKH 1IQWL 3BSZL 5A2FA 1F6AA 3PNWB 1G0DA 3CFJB 3DV6B 2XN9D 4X8JB 1T5XB 5B38G 3QEGL 1E6JL 3MV11 3TN0D 1G9MH 3CIQA 3CFBB 5D7LE 5KN5B 2J6EL 3Q5YA 3AREB 2F54D 2XIDA 4JY6A 1RZGB 4NFBA 1JV5B 1WC7A 3ZTJG 5E94B 4N5EC 5MEOA 4FTVB 2XRAH 3SKOA 4C55A 5I1LB 3I6LD 2P46B 5FHBH 3E6FA 4QTIL 5HHPA 5DRNB 1YNTA 5AG9A 3RRQA 4NRXB 3B9KB 4ZQKA 5IBLC 4U0RC 3QRFM 1U8JB 4HUUB 4U1NA 1YZZA 2QSCL 1TITA 1I8IB 5E7BA 2ITDB 3D2UD 5B3JF 4KDVA 3L3IB 3JUYA 1J0IA 2V5SA 1WAAF 5DS8B 2IH1B 2DQHL 2H41A 4X5WB 3VFTA 3I3EA 3LHPL 4CMMA 1SHMA 1UCBH 5CILH 4O02H 3BKJH 3JV5A 4LSSL 5EZIH 4KUZH 3MR9A 3RY6C 4ZUTB 3MXVL 2KQMA 4YHKH 2WP3O 2J88L 2BC4B 4JFXB 4NPYA 3BWAA 4YPGA 1ZLVK 3ZHLA 4JG1H 4WUKL 2OR7A 2WW8A 2JJTA 5C0CA 4TPRL 3SDAB 2OJZL 1FSKC 1K6QL 4EDWH 2G9HB 1I7ZA 3QCUL 3ESUF 1FHGA 1AQKL 5DJAB 1EEZA 5EOCL 1KPUB 4R0LC 2DIBA 5H8DA 3V6OC 1RIVH 3H9HB 2E8YA 2HT4C 2X4UA 4I2XB 3HUJF 4GRLC 4F7PB 5D2LB 3CXHK 4HK3J 2JE8A 4NC0B 1C1EL 2BSRA 5FDWA 4P2RA 5C0EB 4LSTL 3L3DB 4JM2C 3ZHDA 1C1EH 3OXSB 1UWEH 2NXYB 3BUYB 4W4NA 3U0TB 1QOKA 3SGEH 4G6KH 4QRTA 5C0AB 12E8H 4PJHE 2VL5B 3NIFF 3DJ9A 3NTCL 4TSCH 12E8L 5GHWL 1BBDL 4HPYL 4PJEF 5HGAA 5ID0A 4MDJB 5D2NE 2EE9A 1GHFH 4HUWA 3UXFA 5EIQA 3P0YL 3V6ZB 1S5IH 1GZQA 5D70H 1OLZA 2EDXA 4HV8B 4LQ1A 5J9PA 5EOQL 1QBAA 2QKIA 1NGZB 2Z93A 5B3NA 3TEUA 5KAQF 3L5WA 1T3FB 1TQCB 1NCAH 2SEBA 3E3QE 1CI5A 1BOGB 4WI9A 3HUJB 2APTA 5TE4L 1R3HA 3VH8G 3V7MA 3QHZL 5T3ZD 1RFDH 5JPMB 4QHUB 1JBJA 1X44A 1MFDH 4W68A 1VFBA 2EE6A 4O4YL 3F62A 3UTPE 1BZQK 3S97C 3BKML 4LF3B 2FLBT 1FH5L 2WM0A 1WBXB 2YUWA 4M7KH 1FH5H 4OF7A 5F9JA 1C7TA 4M7KL 3UPRA 2GY7B 5JW5B 2XZCH 5IHUH 4H20H 3CMGA 4OI9A 4I3RL 4AEFA 3T0WA 2ZOKB 4Z7VA 5I1HH 4ZO6A 1HINH 5KANG 3IU3A 4IIQB 4H0IA 3GUTA 4OLZH 1NC4A 4MXVF 3MRCB 3TIDB 5DDHA 1BVLB 1FO0H 1G7LB 1U36A 1YY8A 1AO7B 3MRFA 3FFDB 4JHBA 5CD5C 3HS0A 3HR5B 3OF6A 1QZ1A 1EFXD 3WN5A 1MJ7L 4XH2B 3R0NA 4UV4H 5C08B 3NGBB 1XCTA 2CIKA 2I60H 2YS4A 4JGUA 4PJBF 2J2ZA 5HDQL 3ESVF 4N0CD 1D6EA 3BZFB 3BKCH 4S1QL 1QSEA 4W81A 1MCWW 3MV8D 1DQLH 4MNGB 5EBMA </