5AD0A

Complex of a b21 chicken mhc class i molecule and a 11mer chicken peptide
Total Genus 55
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
55
sequence length
269
structure length
269
Chain Sequence
b'LHTLRYIRTAMTDPGPGLPWFVDVGYVDGELFMHYNSTARRAVPRTEWIAANTDQQYWDRETQIVQGSEQINRENLDILRRRYNQTGGSHTVQWMSGCDILEDGTIRGYHQAAYDGRDFVAFDKGTMTLTAAVPEAVPTKRKWEEGGYAEGLKQYLEETCVEWLRRYVEYGKAELGRRERPEVRVWGKEADGILTLSCRAHGFYPRPIVVSWLKDGAVRGQDAQSGGIVPNGDGTYHTWVTIDAQPGDGDKYQCRVEHASLPQPGLYSW'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords MHC CLASS I ALPHA CHAIN 2
publication title Complex of a B21 Chicken Mhc Class I Molecule and a 11mer Chicken Peptide
rcsb
source organism Gallus gallus
molecule tags Immune system
total genus 55
structure length 269
sequence length 269
ec nomenclature
pdb deposition date 2015-08-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00129 MHC_I Class I Histocompatibility antigen, domains alpha 1 and 2
A PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5ad0A02
3.30.500.10 Alpha Beta 2-Layer Sandwich Murine Class I Major Histocompatibility Complex, H2-DB; Chain A, domain 1 MHC class I-like antigen recognition-like 5ad0A01
3MRRB 2ZSWA 5K9QG 3GMLA 5GJTL 4D9QE 5HHOB 4JANA 1TVBB 5JUEH 2CMRH 1NJ9B 3MRDB 4G6JH 4M03A 3RWJB 4BFGA 1A1MB 1G1CA 1E6JL 2NLJB 1F2QA 5GGRB 3RZCA 1OP3K 3KAAA 4NP4H 1ZLUH 5J6HB 2VABA 1CDJA 4EOWL 1W0WA 3IDMB 4GW1B 4NRYA 3KPLA 5I6XC 4YR6A 1J1OH 3GUTB 4BSJA 1P2CA 3CSBA 4MD4A 3S3SA 2Z8RA 3VMPA 4AMKL 5HYSG 1FH5L 3DWTA 5T3ZD 5F1IA 4X99A 2ARJQ 4BH7B 3VGBA 3BXNB 3NGBC 5CBEB 2CDGA 5SWQB 3PWJB 3LB6C 2RIKA 1SYVB 3RX5A 1BVKA 5GIRB 3VXPA 1XCTB 1FGNH 1ZK9A 3P9LA 1NSNL 3QXWA 5CIPA 3MJ7A 3V5HB 1NMBH 4X6DA 5FV1L 3RWCB 1MFCH 3RY6A 2X10A 5IR1A 4D0CA 3F5WB 5I2IA 3BKYL 2AERT 3V7AE 4XXDB 3LKPA 3V7AG 3KDMB 1FO0A 5KSVB 3PWLB 4ODUA 4OT1H 1XH3A 4D9RE 3I9GH 1SY6L 3KG5A 1IM9B 3RUGB 1OWRM 1UM4H 2VRAA 5MEQB 1ORSB 5E0QA 3S36L 2Z93B 3CDGB 4NPYB 1H5BB 4XCYA 2BC4B 4D3CL 1RU9L 4KJQC 3T0AA 1YJDL 3HZMB 1DUZB 1IAIM 1CDGA 4PLOB 4OFVA 3IFNH 3RWDB 1OAKH 1K8DA 1L7TL 3GB7B 1QBAA 2GJ6A 3BP7A 3QZWA 5E9DE 4DCQB 3G9AB 3D2UB 3FB6A 3VG0L 5HDOA 2EDXA 4PJ9D 5C07E 3MRQA 4PJGB 2X4QB 1FGVH 1OP5H 3GGWA 4G9FE 1CT8B 4QLRA 3QNYA 3C5ZA 4E41E 5FEBA 2FECI 4PRHE 2OL3H 1Q8MA 2IQAA 1I1CA 4GW5A 5B39B 3QIWC 4MCZB 4ELMF 5LWYL 3PHQA 3JWDC 4RWYH 4CVZA 3PQYE 5HYJA 1PFCA 2AJXH 3GMNA 4DGVH 4NZRH 5DD6B 5H35B 4UT7H 4AL8H 4NQVA 2ESVD 3RRQA 1GZPB 5MERA 4HMDA 1JPFA 3N06B 3GM8A 3QBTB 5B22A 1TPXB 4TTDD 1FLRL 2IADB 1JNJA 3U48A 1I7UA 1MAJA 4P5MB 4CMMB 3O3UN 4JN2A 1C8PA 4IOIB 3HMXH 2L7JA 4ONOA 5ISZA 2ICEB 4HGKC 2NPLX 1MF2L 3UO1L 2HTLD 5TGBB 1G7HA 4DN4H 3T0EB 3SY0B 3F62A 5IB5A 3ARGB 1XR8B 4O51B 4LHUB 4OUUA 4XNUH 5SWSE 5TDNA 4ZAKC 4DGIL 3ZT6A 4P23B 2IAMB 3H3KA 4J8RA 1JN6A 2XXMB 4OFDA 4QWWD 1LILA 4KK9D 3FCTA 3PWVB 4HHAA 4N1EA 1OT1A 4WI7A 3W11C 5MEPB 3VFUA 3HZVA 4ONHA 5IEKA 4V3EB 2AW2A 4ZD3L 2NY0B 4D9LH 4QXGL 2MQCA 4NT6A 5JIHA 1DR9A 1DANU 3U7WH 5E9DB 1WUNT 4KPHL 5D1XA 1BQHB 1DBMH 2DS4A 5C07B 3LMJH 4I2XB 4QHNA 5F6HJ 1RJLB 3FQRB 5HHVH 1WIOA 1A7QL 1ADQA 3JV6B 4OAWA 3TP4A 5CAYB 4PP2A 1IEHA 4HPOL 4PRHB 5ADPL 3AMLA 5D2NE 2PN5A 2UUDH 5IT2H 1FV1A 4F7CA 4MNQA 4MD0B 2I60H 3PQYB 1CG9B 3TBVA 5J1AA 1MFEL 4HUXB 1KJMA 2Q8BH 4WUUB 2WWKT 1FFOA 4GBXC 4PGDB 3VXMA 3DGGA 3MLSH 4JY4A 1B0GA 2R0WL 1VFMA 3ZYJA 5JORB 3DBXB 3SE8H 2B4CL 4NWUL 3LD8C 3N1MC 3W81A 1LP9F 1AFVH 4LLDA 4WY7H 3B9KA 3B9VA 2Y72A 3F7QA 4NO3A 3PWUA 3CXDH 5EBWB 3QO0A 1FC1A 1A7NL 5KBNC 1T4KA 2Y1VA 1VERA 3D69B 1PYWA 3MACH 4NO5A 4M7KL 4GUPA 4K9EL 5KOMC 1PGRB 2HLFD 1T6WA 4AIXA 5TE7H 3MBEB 1LK2B 4MAYC 3PNWA 4J12A 4ODHL 4OQ1A 3MRNB 1AD9A 4XPHH 1QNZH 3FOLB 4XZUA 4OLYH 3JTTB 3W9EA 2Y5EA 4JFDE 3VRIA 3BZEA 1B4JH 1FFNA 2ED9A 3LS5L 1WC7A 4WW2B 1JGEB 2VLLB 4N8VA 3GI8L 3U7YL 1NBVL 3NPSB 1AXTH 4UV4L 2FR4A 3DURA 2OMBA 1G7LA 5IFAL 1F4WH 3BAEH 3PL6B 4PRBB 1Q38A 3THMH 4Y19D 3B2UC 3NA4A 2FZ3B 4NN5B 1PBYA 5DJZB 1IT9L 3BOVA 3KPRE 5I1IH 3P4LA 3GSVA 1UCTA 3MNZA 5ICYA 4JO2L 1WAAA 4HMEA 3U82B 1LO2L 3RHWF 2XKNB 5D2NB 1RK0A 1CE1H 1EFQA 3OMZA 2UZIL 4B5EA 4JM2F 5EU6D 4Q74A 4KQ4H 3VA2C 2NW2B 2GK2A 4GSDH 4Z76B 1JPSH 2OI9A 3B6SB 2FWOB 5DHVH 2H6PA 4G8FB 5GSVA 1GRWA 4PJBA 4XVUD 3HPLB 1QSED 1GGUA 3MOBL 4Y8DC 2VDQL 3E1F1 3QNXA 4DVBB 3TF7A 5TFSH 4YE4H 5A3ID 2VQ1A 4IIQA 1F45A 4JE4B 4GAYB 4NDMB 5ITBL 3DMMA 2JKXA 2AK4D 3L95A 4YDIH 1LWRA 1FIEA 1BJMA 1IGML 1FL3B 1KCUL 4LSRH 4IOFC 3DGCR 4YIQA 4MNGA 2P49B 2VXSH 1N5AB 2C7UB 3RIFF 2XWJB 3JBG7 4WU5A 5B3NA 3VGAC 4K94L 1DQMH 4U1LB 2FH6A 4EN3D 5GS0C 2HAZA 5INDA 2LTQB 4LIQH 1AI1H 3T8XB 1YUHA 1U8QA 3IDGA 4WIQA 4ZFZB 5C0CD 3ZSSA 1WTLA 2WBWB 4ETQA 3TZVB 2X7LB 3MZTA 1WISA 3MJ6A 4U1JA 5CGMA 3S35X 1XGUA 3OJVC 4S1QH 3L3IB 3CMGA 2VQTA 4KH2A 4E42A 4U31A 2F58L 3MRBA 4R7DA 1SJHB 1C5BL 2VLRB 3MXWH 1JI1A 4AM0B 1NL0L 1PD6A 5E00A 1S7SB 5GRZA 1ZHKB 1EJOH 3L6FA 3DSFH 2W9EL 3FB7A 4V1DA 2OJZH 5EORH 1YNLL 2H2SC 1QRNA 3RGHA 2P5EA 1WK0A 3RGVA 4ONGH 4X0KB 2DIAA 5DJAA 3V6BR 4MSWA 3G6DL 2VZTA 3UTSD 1MLCB 1P4BH 2YUWA 3D0LA 25C8L 2XWTA 4HIEB 1NGPL 5GGQH 1FHGA 2GYSA 4PPTA 3BVNA 2CR6A 1KCRH 4P46B 1RD6A 2P8PA 1P4LA 4X9BA 5BMFL 3IETA 1JF5A 3GMMA 3HCVA 4FXKA 3JWOL 1KJ2A 3TBYB 4JPVH 4XC1H 3OJ2C 4YXLH 4YHYB 3KPQA 4ZUVB 3KR3L 2GTWA 4GT7A 5CP3H 3ARDB 2BSRA 3GSQB 4JQIL 3KLHD 2ZUQC 5H37G 5I1JL 1CCZA 2CLRA 1E0OB 3KYAA 4Y4FC 35C8L 3DIFA 2LFGA 2ZNXA 3BT2L 1GOFA 2HVKA 2VC2L 1GZQA 3MV9D 4OKVA 4U2ZA 5DJCB 3T04D 5EULV 1RZJC 3OB0K 4HIIA 4Q97A 5BS0D 4GRWE 4O9HH 3V4UH 1QKZH 3UTZB 2DI7A 5D1QD 2DQUL 5DUPH 3SOBH 3RKDD 3CH8A 1D5IH 5DMYA 1JMZA 1A3RH 1BBJA 2DB8A 4UV7H 3VW3H 5IB3A 3CVHH 4X7TA 3EFDL 1KV3A 5C0FB 3DOSA 1B90A 1MJ7H 4HJJH 2E6PA 4LP5A 1OARH 3QPXL 4JR9H 4XBGA 3T0WA 4QOKB 1AGDB 2GY5A 5E95B 4NHUA 5HPMB 1S7VA 4JDZA 1ULVA 5TJWK 3H2WA 5DVMA 3QUZD 4EVNB 1VGKB 4JZJA 3ORJA 4XPFL 4YEEA 5K93A 3KYNB 1EEZB 2AJZB 2DI8A 4G7YH 4R8WH 3BD4A 2JB5H 5HI4C 2H2PC 2YS4A 3FKUS 5HJ3A 4H0GA 1BX2B 1HYSC 3L3JA 2VDNH 5J6GB 2FL5A 2X1PA 3OKLB 1RZKL 4BFBD 3IFPB 2H8PB 2H9GB 4F15C 1HOCB 1FVDA 3OX8B 1INEH 4FQJL 5DDHB 1TTUA 1RK1B 5EBGA 4ELMB 4Q9BA 1KJ3L 2Y06H 1MQKH 1DBJH 2UWEF 3QDAA 1CR9L 5T5FL 1FNEB 4KV5F 5LAXB 5JMRA 1CICC 3EJZD 2IGFL 3OAYK 3CCHA 2ED7A 1Q9LA 2PCPB 3VFGH 1NBZA 4PRIB 4PJAF 1RIVL 3RX7A 4N90D 1UWGH 5C92A 3DV4A 5DD0L 1A6ZA 4XPBH 1JZ7A 1LO0L 5C0AA 1V3KA 5BW7C 3D85A 5B3JF 4I5BA 4JDVB 4LVOB 1NFDA 3P77A 1JL8A 5KSAA 5E94B 4N9GA 2BK8A 3AS1A 2JJSC 4YK4B 2CKBH 2CRIA 1JPTL 5DT1H 4PJ8C 2X5PA 1BFVL 1H3XA 1MI5D 3CMOH 1U3JA 5L8JB 4NKDA 3S6CA 3BD5A 4YEFA 1TNMA 5T3ZE 2FIKB 4FTVD 5ACLA 3GJFA 5A40E 2VITA 4YDLB 1ZWIA 3BQUD 3GMOA 5HI5C 3V6FB 4WWKB 2HTKD 1DVFB 4NUJB 4OV5A 4O58H 1F58H 2J88L 3JV0A 2OZ4A 1AKJD 3VWKB 5DJ0B 5DGRA 2BNQA 2CGRL 5F7FA 4Z6AT 1I1YB 3BWAA 4Q0XH 1KC5H 1Z9MA 2Y9RT 4MJ5B 2GJZA 5IG7B 3SKJH 4R7NB 2K7PA 4YLQT 4HWNA 5I17A 4KVCH 1PKQE 3O81A 3HZKB 1U95A 2EYTB 4UNVA 1UACL 4DGYH 3KYOB 4YWGH 5E7FA 5HI3D 3OTTA 4L3CB 1ES0B 3GSXB 4RBPK 4NC2B 5GQBA 4PTUB 3D39D 3MFFA 5J13B 3ZE2F 3ILPB 3T65B 3TO4A 2HYMA 3O3AA 4KHXL 1PLGH 3G5ZB 3QQNA 4NUGL 2OL3B 2W92A 4WUKL 3TPUE 1IKFL 3WD5H 2V7NA 5EC2B 4XNXL 3VFNB 5DUBB 1S78D 2IBZX 4PRDB 1LP9B 3QHZL 4BQ8A 3LKOB 3MRFB 2CK0L 4IRSD 3ES6A 5GISH 4NM4L 4QRPE 2NY2D 1G9MH 4OCSH 5EZLA 4P5TC 2QADD 4KQ3L 1IZJA 3RY6C 4WJ5B 3UZVB 2HJLA 5D71L 4KUCD 5DD5H 4G8GA 4NRZB 3CSGA 3REVB 2NY7H 2R0LH 1VPOH 2ESVE 5IFJA 5SWZE 2PYEA 4H0HB 3D0VA 1DUYB 3TV3H 1EMTL 1R5WA 4ZS6D 3GJEB 3DRQB 5IVOA 1HHJA 4G8EB 5FECA 3ULVC 1MY5A 2NY5L 4LL9A 1MREH 5IKCB 1D5BB 3ARXA 4WO4B 4M43L 4Z7UB 5F1NB 5MEND 1K3IA 1XGYL 4JRXD 2IFFL 1QQDA 1H8NA 4JHAH 5D7SL 3QG6B 1ONQA 2G60H 2XQYK 3SN6N 4LFHD 1AQDA 4U1NB 5C0NC 1SBBA 1PG7W 5CP7B 4BK5A 2DQTH 1TVHA 5JZ7C 4MA1C 1KB9K 2PTUA 1PKQB 4EUPA 3C5ZC 1CGSH 5IQ7L 5IW1A 2B39A 4BZ2H 1CLZL 7FABH 1KYOJ 3G5XA 1UG9A 3WDJA 4P2QE 5D7IB 4JM2B 3K1KC 3O4OB 4NC0B 2A83A 2Q3AA 3LS4L 4OFYA 3GMRB 2VJXA 1A1OA 1I7ZA 2XI9A 4OCXH 1QFOA 1MFDH 3VD7A 3MRRA 1MRDH 4OZFG 4QXTB 5C0IB 3E6FB 5L6YH 2EIZA 4CJ1A 1JI2A 3DUUB 1TVBA 5JW4R 3H9HB 3MRDA 1NJ9A 1S9YA 2HLAA 5ANME 3RWJA 2NLJA 5KS9A 1NKOA 1J9CT 1KJVB 1QSFD 4AENA 3V7MA 1K4CB 3UMTA 1S9WB 1T66C 4M8VA 5J6HA 3CLFH 2COQA 3O2VH 5BV7H 3IDMA 3QIUD 5BRZD 3RVWC 4GW1A 4W70A 3OR6B 2VDRH 5C6TL 2QSQA 2DWEB 1DDHB 1A22B 4Z7VF 4C59B 5GGSA 1BIIB 4BH7A 3BXNA 1J0YA 2EXWC 5SWQA 1F90L 2ESVB 5SWZB 4LARH 1SYVA 3WFEL 3WNOA 1N64H 2N4IA 3O8XA 5GIRA 1XCTA 2B5IB 1HK6A 5A16B 3QQ4B 4NKOB 1MQ8A 3O4LE 1YC8A 2BHYA 1XZ0B 4LEXH 3V5HA 2ITDB 4PGBB 3RWCA 3EZJB 3PWNB 3HG1E 3F5WA 3MLWL 3U0PA 3DO7B 4CDGC 1NEUA 3KDMA 4O2EA 5C0GB 5KSVA 5JHDE 2JIXD 2YWZA 3SGEI 1IM9A 3RUGA 2WZPD 1A7OL 2PW1A 3MV8E 2HH0L 1ORSA 5ILTH 2Z93A 3CDGA 1H5BA 5EOCL 4PJCF 2D7MA 2WW8A 1OGAD 3HZMA 1DUZA 1L0YA 1R24B 3RWDA 2BRRL 3IAGC 3EDKA 3NZHL 4FXGB 4P2QB 5E8NA 4JG1L 4DCQA 3G9VA 2J3SA 3UROR 4LOUD 3D2UA 5F1KC 4W4NA 2OK0H 1SBSH 3ZE0F 1MIEH 1S7RA 4PJGA 4KHTL 4KTDL 3TIDB 1UADC 1FG2B 4HT1H 1CT8A 3AB0C 4Y19E 1NCBH 3A6OA 3QQ9D 3D3VD 3FT3A 4UI2A 2UWEE 2VXTL 1FFQA 5TPWH 4H8WL 5B39A 4MCZA 5HPOA 5GJTH 2MKLC 5DHVB 4HGMA 3WFBL 5D7LD 1E6JH 5DD6A 5H35A 3BRDA 4NQCE 2YD3A 4L4VE 5EU6E 4EOWH 1EHLL 1GZPA 1A6PA 2W59A 5CD5C 1D5ZB 4OZHF 1ND0B 2MPAL 4OF5A 2IADA 5DVOA 5E6ID 4W4OA 3KPNA 4U7SA 4CMMA 3L7EA 4LAJH 3LPWA 2ZSVB 5E03A 4AMKH 1FH5H 2BVYA 2VZUA 5DD3L 3FQNB 2ICEA 1IC4H 3QULB 4PG2A 5C0BD 3DVGB 1TMCB 3QEQD 4Y1AE 4YBQD 3ARGA 1XR8A 3OXRB 6FABL 2AK4E 4O51A 4LHUA 1H3WM 1NSNH 3EUUA 1U8OB 1IARB 4P23A 1NLBL 2YD7A 1G1YA 4ZUUA 4KUCF 2ENSA 3BKYH 3G6AB 5KVEL 3HNSL 3AY4A 3SDXB 4E5XB 5GGTL 3X3GL 2APBA 3NPZB 1AE6L 3QWOB 5MEPA 2ATPA 1MSPA 2OSLB 3MLYL 1KGCE 1C5DB 3S36H 4F37F 3MLZL 4LQFL 1U3YA 4D3CH 1RU9H 1VFUA 1YJDH 4L8SB 2QSCL 3IB4A 3TCLB 4KK8D 5E9DA 5T1LA 4D0BA 4MQXD 1BQHA 2EDLA 4JO1L 1L7TH 5C07A 2OI9C 3C08L 3IDNB 1RJLA 4P2CG 4U05A 3FQRA 1T5XB 3JV6A 4JFED 4G9FA 1BFTA 2P8LB 4G3YL 4Y19B 5D93B 3VG0H 3G04B 3PUCA 4OGAD 1UEMA 4U1GC 1FYHB 1N0XL 3TF7C 4PRHA 1T6VN 1UT9A 3BPOB 1OTSC 3FFDB 2UWEB 4M48L 5GS1B 4N0RA 3RWGB 4JFXB 1U3ZA 5ERWB 3NABL 4MD0A 3DMMC 3WN5B 3PQYA 2WBKA 3RIAK 4UDUA 1CG9A 3ZE2E 4AEIH 4HAFA 3L3OB 3FRPG 3RVXC 4HUXA 4PJAB 4WUUA 5LWYH 4NQCB 4L5FH 4PGDA 4L4VB 5EU6B 1VA9A 3F7YA 4NQXA 3DBXA 2CIIB 5HDBF 5E2TH 4FZEL 4RGOH 3QQ3B 5FGRA 5DQ9B 3T09A 2Z91B 2ICWI 1AP2B 1FLRH 3CFJB 3VH8G 1UH4A 4MXQD 5EBWA 4YZFF 1JWMB 3SGJA 4TYUA 3VWJC 5JIKA 5I75C 3RI5K 3D69A 4WTXA 1HYRC 4NRXA 3UO1H 2WY3A 2AK4B 3DI3B 5SWSA 2Y23A 1X7QA 1K8IB 1MELA 3BJLA 1LK2A 3MBEA 5DEGB 1I8LA 5FGBA 5J11C 3MRNA 3U36B 3C6SB 4LF3B 3FOLA 4DGIH 3JTTA 3TVMD 4AZ8A 1YNTB 3NCYS 4GLRH 5IM7A 4EN3B 4WW2A 1S5IL 2AGJL 1JGEA 2VLLA 2ZUYA 4FFVC 4QCIA 1CFTB 1XMWA 3T1WA 2ZJSL 3RGVC 3QSKB 4U49A 3P40A 3QFJE 3STBA 4UOJA 4ZD3H 2XZZA 5D5MF 2CUHA 3PL6A 4QXGH 5IUSA 4PRBA 5J0BA 2FZ3A 2PW2B 4RA3A 3MGOB 4KPHH 4WHTA 2XICA 4HUVB 4PP1C 5DYOA 4RMWA 4OF0A 4JLRB 2DQDH 3VGHA 1NGXA 1A7QH 5D2NA 3QB7C 4G6AD 1YEEL 4UINL 3T3MF 2ID5A 3HTLX 2J8HA 3DXAD 4FQLL 4HPOH 5ADPH 4Z76A 5CCKH 3UTSB 2EKJA 2FWOA 3B6SA 2LVEA 5ICZB 3UBXI 4G8FA 2GITB 3U6RB 1MFEH 4ZSOB 4JJHA 4N5UA 4XNMB 1HI6A 1ZT7B 3HPLA 3QWQB 5DRZA 4DVBA 1KEGL 2R0WH 2DF3A 1V8HA 1T1ZB 3K7UA 4GAYA 2PO6D 1ZMYA 4NWUH 1OF2B 4WI3A 4LQ1A 5EPMB 2FX8L 4GG8B 5DMKB 1E4XI 5EBLB 1N5AA 1WF5A 2C7UA 2DYPD 4IRZL 2XWJA 5K59F 5DO2C 4DKFL 4M1GL 4U1LA 4FRWA 4M7KH 4K9EH 4NQDD 3KXFE 2CKBB 1KULA 3ZKXC 4UDTB 4ODHH 4KJPC 1T03L 1JF6A 3MV9B 4F7PB 4ZFZA 3WCYA 4LGPB 3HI6L 4XCCL 5BS0B 2V6HA 3TZVA 2CO6B 2X7LA 2X1WL 1MCPL 4H88L 3CXHJ 5D1QB 3LS5H 3L3IA 3PE9A 4JZJC 5DJ2A 5ELIA 1MI5E 2UZXB 3GI8H 1J18A 1NBVH 4U6XB 1DQJA 2AXFA 2R0ZL 4QT5B 5F7UA 3O2DL 4UV4H 2JF1A 5FYKL 4B0MM 4AM0A 3UAJC 1F97A 1S7SA 4FFWD 5K9JL 5IFAH 3PJSA 1ZHKA 2HJFA 1Y6NR 2YD2A 3PP4L 2HT3D 4U6YB 4JKKA 4M1CC 5DC0A 1IT9H 4X0KA 3WV0A 2YWYA 1AR2A 4FG6D 5GZND 1YEHL 3N50A 1MLCA 3ZE0E 4JO2H 1XGRB 1A6UL 2C26A 5CUSL 1LO2H 1IGFL 4HIEA 3QUMH 4O02L 1ZHLB 2UZIH 2AJSL 4P46A 3U83A 5JDJA 3IFLL 1LO3L 1RZ8B 4OI7A 2K3TA 1BOYA 1EIBA 3EDJA 4R6UA 5GS2D 4F9LC 5KSAC 3S5LB 1SEQL 2VDQH 1CS6A 3JUZA 3MUHL 4Z7VB 2ZUVA 4U1SB 3ARDA 3GSQA 4OZHE 2YBRB 3F7PC 3IAPA 3S34L 4WTZG 5ITBH 3MJ9L 1IGMH 1A14L 1KCUH 2VLMD 2J2ZA 2E9BA 1BGXL 2ZG3A 2YC1B 4HUKB 3VFTB 1HILB 3JWDL 4HWBA 5DJCA 3KXFB 5DWUL 3C6LD 1FN4A 2L7UA 1MCIA 3L3HA 3WLBB 1S9XB 4TNVK 2BOBA 1L9NA 2AEIT 2VXQL 4HKZA 2YA1A 1NAML 3UDWA 4QGTA 5C0FA 1MI5B 2B8OT 1JUFB 3MJ8A 4QKXB 5FHBL 3OKMA 1ZS8A 3VRJB 1Z2KA 2YZ1A 3HI1B 4UU9B 3ZTJH 5CEZE 4PJCB 4FTVB 4QOKA 1AGDA 3DARA 2F58H 3LHPL 4FNLL 1YY9C 2YRLA 1KN2L 1UB5A 3BQUB 1C5BH 1QHPA 5HPMA 4GS7B 3B8YA 1NL0H 4EVNA 5DD1L 2FEDD 1VGKA 1WWBX 2Z0BA 4YDVB 4U7MA 3KYNA 2W9EH 1AKJB 1EEZA 1PDKA 2AJZA 2HKFL 2E7CA 1YNLH 3ARFD 4HS8L 4JRXE 5LCVL 1GSMA 4UTAL 3TO4C 2VKWA 1MHHA 3G6DH 2KZWA 5D2LF 3W9DB 1BX2A 4ZFOL 4ZUSA 5IBUG 4BQ6A 5HGAA 1DQDH 1YC7A 25C8H 3IFPA 4X5LA 2H9GA 1NGPH 3IDIB 1HOCA 2BOCB 3OX8A 1RK1A 5HVHC 4ELMA 4JGUA 2CO7B 4KKLD 1CDIA 1NC4D 2X4OB 4NBXB 1FNEA 1FZMB 1NH6A 5BMFH 5LAXA 5IIEB 2DQIH 1WCQA 3W0WE 4LEOA 4KJWD 2PCPA 1S7UA 5H8DA 4PRIA 3LKQA 3JWOH 1CDBA 3WLWD 2DRUA 4OZHB 3BUYB 3D39B 5HDBE 5GS2H 3ARQA 4NHCL 1ZHBB 3KR3H 4M93B 1IL1B 4JDVA 2D0HA 4JQIH 3ROOB 4URTB 4LAQL 5I1JH 2FHCA 1H0DA 4YBHA 5E94A 1HH9B 35C8H 4K07A 3L9RA 4YZFE 3BT2H 2VE6B 4LCUA 4JQVA 4FMKA 2VC2H 1I8IB 4IDLA 1PX3A 4IRSB 5DQJA 5CZXD 1DEEB 3MROB 5E2WL 3HR6A 2X89A 1JE6A 2QADB 4MB4A 3PIQB 2DQUH 3QPQC 2NXZD 5LG1A 5JOEA 3QIBA 2MHAB 2PXYD 2I07B 1KLUB 3LV3B 3VFOB 3EFDH 3OKKB 3V6FA 4WWKA 4NUJA 1DVFA 3I3EA 1DL7L 2E9IA 5GHWL 3STZB 1FYTD 4EKXA 1H3PL 3AREC 4G80B 4LPWA 1BF8A 4KMTL 3QPXH 3VWKA 3GKZA 1M7DB 5DJ0A 1U9KA 5GJSL 3QEGH 4LLYB 5F3HB 3EJJX 1YN7B 4XMKL 5MENB 4MJ5A 5EN2B 4JRXB 4R7NA 5F7EL 1NPUA 4XPFH 4JKPL 3FT2A 3HI5L 5FKPB 4DUXA 1N2RA 4FXLA 5L2JB 3IYLW 3KWWB 3HZKA 2EYTA 3LQAC 2BJML 3MLTB 2AV7A 1J8HE 4HKJB 3KYOA 3T3ME 1D9KD 4L3CA 2R2CA 1RZKH 3SKNB 3MYJB 3NBNA 4RISL 3LKRB 4PTUA 1TZGL 1MCJA 4FQJH 4OCLC 5KG9B 1KJ3H 3ILPA 4LLWB 4RA0C 3EGSA 5IQ9B 2W0FA 5JPMB 3G5ZA 1CR9H 5T5FH 4CW1B 5DMGC 4M4RA 5DFTA 4OZFH 2IGFH 4L9LB 4TOYL 3VFNA 5DUBA 1OAZL 1QO3A 5HY9B 1RIVH 4PRDA 1LP9A 3O8XC 5TQ2L 5D7JD 3LKOA 3D3VE 2GSIB 1LO0H 4TNWK 1QRKA 4Q6IB 4AT6B 2A0LD 3U4BL 3CU1A 4HKBB 4WJ5A 4YQXL 3S36X 5BRZB 3QIUB 5K59E 5D7LE 4JFQB 4NRZA 3QCVL 4LBEB 3HMXA 4LDOB 3REVA 4M3KB 2V7HB 3I85A 4LSVL 3U9UB 1JPTH 1CL7I 3ZO0A 1MFNA 1BFVH 1SYSB 3ARSA 1DUYA 4IHOA 3H3BC 5MHSE 3EW3B 1RVFL 3GJEA 3DRQA 5D72L 3ESVF 4G8EA 1H5BC 1P5VA 2W0KA 4TUKL 3KS0J 1GGCL 3HLAB 4G43A 2VL5B 5LGJA 4JFOB 5C9JB 4YX2H 3DHJA 4AQ1B 8FABB 5IKCA 1D5BA 4J6RL 4WO4A 4LVHB 5MEOB 5F1NA 3PG2A 5E5UB 3NA9L 5GS0L 2J88H 1ZVHA 1L6XA 1KF9B 3QG6A 5D5MB 1JZ8A 1NBQA 4RMRA 4NQUA 4U1NA 2CGRH 4XAWL 2JIXB 5CP7A 2QSVA 4HK0B 3HE6A 1WVZA 3KPMB 2B1HL 1MWAB 1PKQA 1JP5A 4HULB 1AGEB 2H1PL 3MRHA 5HHNB 1OGAB 4LCWD 4JM2A 4XPAL 1T5WA 1F8TL 2VLKD 1UACH 3OKOA 2IMMA 3NTCL 1MJJA 1OOAA 4NJ9H 2VZOA 4OCYH 4QXTA 5F8RC 1TPXC 3E6FA 3G6JF 3WFCL 4ZQKB 3TPUA 3H9SE 1WBZB 2FDBP 3DUUA 3HAEB 2XFXB 5F7YC 1MHCA 3H9HA 4NJAL 4KHXH 4NUGH 2VH5L 4ZG1A 1S9WA 4WUKH 5DFWH 1IKFH 2EEAA 4P2OB 3D3VB 4XNXH 1GXEA 5KAQF 3C8KB 4U6HB 3OR6A 3QHZH 1DDHA 3ARGC 3IU4L 2CK0H 5CGTA 1EHXA 4NM4H 2EXYD 1BIIA 5D7LB 2OTPA 2RAMA 1DJSA 2BDNL 5GPRA 4P23C 2QQKL 2XT1B 3N0PB 1EUUA 1A1NB 2ESVA 5SWZA 2IAMC 5D71H 4M1DL 5EOCJ 5E6IB 1I3GL 5A16A 1CI5A 4NKOA 2Y6SC 1WFTA 1XZ0A 2H26A 2ITDA 4PGBA 1EMTH 4DOHB 2F5BL 3PWNA 2NY0C 1T1WB 3K81A 4NYLB 5C0BB 1XIWD 3W2DL 1HSBA 2FB4L 1RHHB 3DO7A 5F7NC 4HQQL 1BEYL 1CXFA 3QEQB 4JGJA 2GCYA 4X9FA 5C0GA 3RTQA 2NY1D 5IB1B 3IFOB 2NY5H 1EGJA 2NX5D 5H2BB 3BKJL 5CD3B 5EC1B 3OG4B 1KLGB 4M43H 4PBWD 5F93C 1XGYH 1CVRA 2IFFH 4YXHL 2E7BA 5D7SH 1MH5A 2UY6A 5L2KE 1OM3L 2BY3A 2VZ3A 1K3ZA 3GBLA 1FFPB 4OBRA 1M05B 1I1AD 1FVCB 1R24A 5DZNA 4XC3L 4FXGA 4P2QA 5IQ7H 3ZKND 3C8DA 4OGYL 3ULUC 1CGUA 3U0TB 1CLZH 1WZ1L 1LO5B 1G6RL 1V05A 2ILLA 3TIDA 2V9TA 3RVUC 5C0JB 5KVFL 1YDPB 3S7GA 4XT1C 3GSOB 3LS4H 4NOFA 3F8UB 5CHNB 1DQTA 4KRMB 2H3NB 4APQD 3O9WD 3QJHB 2JK5B 1ITCA 4ZOCA 4B53A 5DJDB 4JFEB 3MV7D 5AUMA 5F9OL 5DHVA 1NUGA 3K8KA 3SGJC 2FATL 4F2MB 2GW5A 1D5ZA 5CMAB 1ND0A 4JZOB 4V2BA 3RWEB 3MBEC 4GW4B 4ZOBA 5DZOA 5C6TH 2E7MA 1I8LC 5FGBC 1L6ZA 2DQCL 4MAUL 4O4YL 2QQLH 3MBXL 3MZGB 4LCCA 3CFIC 1U8KB 2ZSVA 3ZKSD 3TA3D 3K46A 2HG5A 1I9IL 3QULA 1F90H 4WW2C 1PJ9A 3WFEH 3DVGA 4MDIB 2EEBA 1TMCA 3OXRA 2QTEA 1C08B 3NPSC 3JVGA 4M6ML 3HG1A 3QUYA 1U8OA 4ODSL 1T22B 1P7KB 3QDME 3WUWG 2C1OB 4OIAA 4UT9L 4XNYL 3PL6C 3MLWH 2N1KA 1LK3L 4X7EC 2VDML 3HFML 1GOGA 3L5HA 4XCEB 1DLFL 1EPFA 1W8NA 4NN5C 4XNQB 5I16B 3QWOA 2EO1A 5A43C 3N85L 3M07A 5L2KB 3NN8B 2C3XA 2HRPL 1YNKL 2A6JB 2VQUA 2OSLA 1A7OH 4M5ZL 2HH0H 1C5DA 4FZ8L 4K55A 2BMKB 1UXSB 5D2NC 3FO2B 4G59A 3TCLA 3Q6GL 1HQRB 3CSYA 2ZOLA 4MJIE 4Z77A 5D2LB 2X41A 2BRRH 4X6FB 3NZHH 4I0CC 4JG1H 1T5XA 3KPPB 2P8LA 1TLKA 4Y19A 3G04A 2R1WB 1YN6A 4Q2ZB 1S7QB 5F3BB 4KHTH 4KTDH 5I1LB 3JV4B 2GT9B 1WZLA 3OKYA 3FFDA 2D0GA 2X9XA 2UWEA 3FL7A 3MCKB 5GS1A 3ZL4H 3BKMH 2VR4A 2Z8WC 3RWGA 4JFXA 3QUMB 2NY6D 1IGIL 4MCYB 3WN5A 3UBXG 1NC2A 1B88A 4OLXL 4PJAA 4H8WH 4LHQB 4NQCA 5AZ2L 1NEZG 5DJXB 4L4VA 3DROB 5EU6A 4L8CB 1KXVC 3WFBH 4JFYB 2CIIA 3QH3B 5I8EB 5IHBA 3QQ3A 2WUCH 5DQ9A 1EHLH 2Z91A 4UT6L 2DJ4A 2GTZA 1AP2A 2MPAH 2LTQC 2WP3T 1RZ7L 3CFJA 4CMHB 1I7RB 2ZG1A 4QRRD 3IDXL 2MQ0A 1JWMA 2DIJA 4P99A 1GJIA 3GSWB 5DD3H 4F3FB 4HUNB 3L1OL 4ZS7L 5HHXL 2PO6B 4U1KA 4Y1AA 3TZVC 2AK4A 2YR3A 1K8IA 3WJJA 2PYFB 2VXUL 3MLUL 4R3SB 3QDMB 3U36A 6FABH 4K3HA 2DYPB 4BZ1L 4NC1C 4X4ME 1KENL 4WENB 4ZYKB 2AJYL 4GKOA 1YNTA 2X2YA 4GRLA 1YMME 2XNAB 1KYOK 1LNUB 1NLBH 3R1GL 3SCMD 4EN3A 4NQDB 4LRIA 4H25A 5GGUB 4V3DB 5KVEH 3HNSH 4WI6A 4NNPL 5IB2B 1JCKA 1A2YB 5GGTH 4OLZL 1FO0L 3X3GH 1G0YR 5HD8C 1AE6H 2YZ8A 4FQXD 4OIIH 1MPAL 3BKCL 4F33B 1QD0A 3LN9A 5A2FA 1Z9LA 3BE1L 1AD0B 3MLZH 4K8RC 4LQFH 1D6EB 4XTRD 1ZGLM 3S8WA 2XN9D 5TH2A 4HH9B 4P46C 5D6CA 3ULVL 2PW2A 1G9EA 3K80A 4NZUL 5IMKB 5C09D 3L5IA 4HUVA 4WFFE 4JO1H 1BJ1H 1WICA 3C08H 4XVSL 2BHZA 3EO9L 4RRPG 3T3PF 1FIGL 1ZGLP 4G3YH 3VDAA 5BXFB 4CVXB 3VXTB 5J3HC 1N0XH 4EIGB 1QFWI 2C3GA 4M48H 3ARDC 2XTJD 3SE4C 3G6JE 4XMPL 3NABH 5ICZA 1JHTB 5EIIB 3U6RA 5ABDE 5DGQA 4ZSOA 5F6HI 2XZCL 2HFGL 1ZT7A 5DVLA 2M26A 4P4KA 2EDQA 3LSOB 4Q9RL 1FCCA 1KTKE 2BVQB 1U8JB 1QLFB 1T1ZA 1OF2A 3CNKA 4FZEH 1V3LA 4PV8B 2EDDA 5EPMA 5FOBB 4GG8A 3SPVA 5I1CL 2D7TL 4I4WB 3G08B 5DMKA 5EBLA 2HVJB 3TBWB 3UDWC 5DK0B 5CJ5A 3PDGA 3QRGL 5BCAA 3VMOA 5JNYB 1CL7L 1F3RB 2DLTA 2DQHL 4UDTA 1JYXA 4HK3N 4M7JL 4GKSB 5KSBF 3MV9A 2BERA 4F7PA 3ZT7A 1CU4L 4DJMA 3C6LB 3LB6D 2EDWA 4KY1L 5GRYA 3VXNB 5I30L 3RIAF 3OV6A 4JDTL 2GAZA 1S5IH 2AGJH 1C16B 3QFJA 3O6KH 3O0RH 4U6XA 5DJ8B 1J1XL 3GEWB 4QT5A 2AEPH 2ZJSH 4HW6A 1FNFA 2FJHB 5FKAB 3FQXA 1OP3H 4WFHE 4U6YA 5B21A 4KRLB 2D7OA 3H42L 3MRPB 4XCFL 5E08L 5CBAB 5F8QC 4GOSA 4TSBL 2AAVA 3WS3B 4RWHA 5JW4Q 1LE9B 1ADQL 4UINH 1ZHLA 3ARFB 3G6JB 3P11L 4HXAH 3RDTA 4FQLH 5FM5O 2YPLE 1RZ8A 4RNRA 4LVOC 1F6FB 3Q5TA 5C71A 2WBJB 3V6OC 4ZODA 4F58L 2GFBB 5EFIB 4JQVC 5EU7C 3TH3T 3GRWH 4YK4C 4OZFB 4Z7VA 1NC4B 5LXGL 1BD2E 1KEGH 1SEBB 4JG0L 2YBRA 2X9YA 4HFUL 2XQYG 4MS8D 1VKXB 1YEIL 1T7YA 2DQFA 2FX8H 3OF6D 4PV9B 5JO5A 2IBBA 2G9HB 1KNOA 5FV2A 2YC1A 3K8LA 4PRPE 3VFTA 1UFUA 43C9B 4YDLC 2DMKA 4IRZH 3KXFA 1KCSL 5AG8A 2J4WL 4GKZB 1QPXA 4DKFH 2WK2A 4M1GH 4WWKC 1ZSDA 5EUOF 1DVFC 3EJYC 2E7LE 1I9RL 1NDMB 2AI0L 1UWXH 4AQOA 3WLBA 1N3NB 1AHWA 1X5JA 4QXUL 4G7VL 5JIIA 3VWKC 3V0AC 4HK3J 3VFWB 2JCCF 4F8QA 1T03H 1JF1B 1JGLL 4JPKH 3H0TB 1HHKB 1MI5A 4XCCH 2NXYC 4X5WA 1WBYB 1S5HB 2I9LB 1MCPH 3OJDB 5C0RL 2X05A 3R0MA 4H88H 3K3QA 3VRJA 2NXZB 4N68A 3HI1A 4UU9A 3NCBB 4ZAKD 3O41B 2VZVA 2R0ZH 2E5EA 4OM1L 3O2DH 4X83A 5FYKH 1HHGB 4PDCE 3ULVE 2BVTA 3DX6A 4MQ7B 5K9JH 3H8NA 1AKJA 5CZVL 3PP4H 2YUXA 5J13C 3H9YA 1OVZA 3QAZB 3MMEA 4G9DB 4YBLB 3W9DA 4ACPA 3P30L 4TUOB 4WFGD 2Y4SA 1A6UH 3IJYB 5CUSH 1IGFH 3D9AL 3IDIA 2BOCA 4O02H 2AJSH 3IFLH 1NCDL 1JYNA 2X4OA 1LO3H 3KJ4B 3CX5K 1FZMA 3GFUA 2FLBT 5IIEA 3GSRB 2D7PA 1D9KB 4XHQA 4QRSB 2IPUK 2FYYA 1BD2B 4LP4A 4OZHA 3BUYA 4IJ3B 3D39A 4OLEA 3ARUA 4LVEA 1SEQH 3MO1B 4M7ZB 1ZLVK 4I0PD 1ZHBA 1IL1A 1F3DJ 3BW9B 3T0BA 4KK6C 4PRPB 3ROOA 1C12A 3S34H 1A6AB 4J3UA 1W72B 1HH9A 3MJ9H 4GBXD 5ISZE 1A14H 3HB3C 1BGXH 2VE6A 2ZWLT 5D7JB 3D1MC 1I8IA 2R39A 2QLVB 2BSSA 3JWDH 3KLAB 5T1KD 4IRSA 2WLZA 4ZUTB 4QF1A 5DWUH 3MROA 4NFCA 2B2XL 4WO4C 5AYUH 1IAKB 1S7TB 4QTIH 3PIQA 2JJVA 3FONB 1EH9A 1FG9C 4XX1E 2X40A 4XX1G 3T4YB 1A02N 4JFHD 4KRPB 2VXQH 4PFEA 2I07A 1KLUA 3LV3A 5I18L 3VFOA 3OKKA 5K9OB 4CUCA 2JJTA 1JWUB 3STZA 1J0KA 1N6VA 3RBSA 4PREB 5FHBH 4G80A 3QO1B 4ODXA 2AQ1A 2OS7A 1M7DA 4L8DB 3LHPH 1J05B 4FNLH 2R4RL 5C0EB 2AEWA 1KN2H 1IRAY 4JM2C 4NFDA 5F3HA 3U2SA 5A2LH 1B0WA 3O4OC 1YN7A 4KZEL 5MENA 2XTLA 4JRYD 1A3LH 4JRXA 5EN2A 1BZ7A 3AUVA 2B7DT 2EICA 1F02I 1F2XK 4LSUL 4HS8H 5LCVH 1PKOA 5FKPA 4PJIF 1CFNB 1PY9A 1QFPA 3BEVB 3KWWA 4UTAH 3MLTA 2J7LA 4WU7B 5GRXG 4B41A 3SJVD 3LN5B 2GSGB 1HHHB 3B2UD 3SKNA 3MYJA 5INCB 1GAFL 1IAMA 1K5NB 3LKRA 5IP4A 3BPLB 3BP4B 5KG9A 4P5KB 3W0WA 5FCSH 4LCWB 5IQ9A 5JPMA 4CJ0A 2VLKB 4CW1A 5JHLL 4HEME 5BOZG 5HVGB 3QDJD 4L9LA 5HY9A 2W9DL 1UKQA 3QDGD 4ZTOH 1T80A 3O3BB 1Q94A 3AS0A 1MCNA 4TTDC 1KJ2L 4PUBL 3SO3B 3SQOL 2B5IC 2GSIA 4I9WD 3CXHK 3FB8B 4NHCH 3T2OA 1YEDA 4RCAA 4Y4KB 2IAND 1AR1D 3BZFA 4Q6IA 3FAWA 2F15A 2WLYA 2WSKA 2DL2A 3IXAB 1SQ2N 1F4AA 2HTLC 4HKBA 3RHWK 3QIUA 3ZYOA 3V5DB 4LLQB 2J12B 4LBEA 4OCMC 4ONFL 2V7HA 4K71B 3LKNB 5D7KE 2Z4QB 1TITA 3U9UA 3ISWA 3E3QE 1SYSA 1XGPA 5E2WH 4LSTL 3IRPX 4JFFE 2ZOKB 1G6VK 4IOFD 3FAXA 5KSBE 1RMFL 4EEEA 3SKUD 1KTLB 4NO0D 1T0PB 1KB5A 3HLAA 4QWWC 2VL5A 1RURL 2PTVA 4KK9C 1VADB 2EIDA 8FABA 4ZFFA 3MRMA 2DTML 3C5JB 4N8VG 3EKCA 5MEOA 1ZKAA 4I3RL 1DL7H 1RV6X 5GHWH 4TVPD 5T3XD 2XIDA 1H3PH 3C9NB 1Z5LB 3TJHA 1XIWB 4KMTH 4L3AA 5D5MA 3BP5B 5I0DA 2EDRA 3RIFK 2Z35B 5GJSH 2JIXA 5J57B 1G84A 4HK0A 3FN9A 4XMKH 3KPMA 3AFLA 5E6YA 1MWAA 2IF7A 1AGEA 1TETL 5F7EH 5HHNA 1QLEL 2OTUB 4S1SL 4M8QB 4JKPH 3HI5H 1OGAA 4ZDHB 5E8PA 5IW6B 3ARZA 1KFAL 1OW0A 1I1AB 4PGEB 2BJMH 4EI6B 3CFKA 5LJYH 3BX7C 4K3EL 4H1LH 1QFWL 1FAKT 4RISH 1TZGH 2IG2L 1BBDL 4ZQKA 3NFNB 2PUQT 3HAEA 1WBZA 3IAQA 1JV5B 4JFPB 2XFXA 3X17A 2NTFA 5EG6C 1G0XA 4R96B 4P2OA 4TUJB 3D3VA 4TOYH 4HV8B 4TTGA 2J8UF 4YJZL 3O9WB 3C8KA 1OAZH 3DI2B 4U6HA 4KXZI 4FABL 1QBBA 2PTTB 4ERSL 3MV7B 2F19L 1VCAA 5HYFA 4YFLI 5FGCE 2NY4D 3JVGC 4TULL 4Y5XB 5D7LA 4DFHA 1A1NA 4YQXH 4QRQB 5C2BH 1E6OL 3QCVH 5E6IA 4NNYA 4JFFB 3K74B 5KSBB 5B8CB 3ALWA 2QEJA 3O6LL 5M95B 3CK0L 4NSKB 3TA3B 3O3EB 3QI9D 4X7SL 2BNRE 4JHZA 1DEDA 1KSRA 4QRRE 2JCCE 1ERNA 1T1WA 2ATKA 4NYLA 5D72H 5C0BA 1OHQA 1OB1B 4TUKH 1Z3GL 1GGCH 1X6LA 3WKNA 1KLFA 3IKCB 5IB1A 3IFOA 5CILH 5H2BA 4HJGB 5CD3A 1KLGA 1AO7D 4RAVB 3NA9H 1CDHA 5GS0H 2EDHA 4MJ6B 4X5XB 3GI9L 4OF7A 2OZ4L 4CNIA 4TVPH 2G5BA 4OCWL 4X4ZA 5D93C 2V5TA 3NIDF 1M05A 3HUJF 4JY5L 4XAWH 3UTTD 1FVCA 4Z0XA 3BPOC 2Z8SA 1CWVA 4OZ4B 3P0VL 5GS1C 2B1HH 4LLUB 3WN5C 2DQEL 3U0TA 1VEOA 4LU5L 1LO5A 2HKHL 1F6AB 3PV6B 1T1YB 4XPAH 3PGCB 1F8TH 5C0JA 1YDPA 2XN9E 5IGXL 1IC1A 3GSOA 4MQTB 5CHNA 1ODAA 5EUKB 2H3NA 3NTCH 3QJHA 1MCRA 5GRJL 5DJDA 1F42A 3WFCH 1F4HA 4KI1A 1JPGB 2A73A 4XVUC 1HYSD 3INUL 4KAQL 4NJAH 4XAKE 2ZP0T 5A3IC 3QXUA 2VH5H 4F2MA 4JHWL 2GY7B 4P9HC 2NY6B 2AEQL 5BZDB 1XR9A 3WIHA 4I3SL 5FGCB 5CMAA 4JZOA 3RWEA 3WJJC 4GW4A 1X5LA 1A9EB 5CJBA 1J1PL 2JLLA 3IU4H 2XOTA 4YHZL 1U8KA 1RPQA 2BDNH 5EUOB 2QQKH 3VXRD 4PJFB 4EN3C 4EXPX 3BHBB 4LRIC 3QXDB 4MDIA 4M1DH 1C08A 2BNRB 3IS0X 4B50A 4QRRB 4MXQA 2JCCB 3SKOB 2EDTA 1J5OL 1QZ1A 1T22A 1P7KA 3UTQB 2C1OA 4RGND 3WE6B 1KCKA 1NFKA 3W2DH 5HDLA 2FB4H 3V2AR 4HQQH 1BEYH 3PWPD 3IU3B 1INDL 4NIKB 4XCEA 1T20B 4F80A 4XNQA 5I16A 3RJDA 4U1IA 3BKJH 1FDLL 4G42B 5L2KA 3NN8A 3LEVL 2A6JA 4DQOH 4Y4HB 3WFDL 1GOHA 1M4KA 3SCMB 4YXHH 2EIEA 4PJXF 2BMKA 3DECA 3B9DA 3BYYA 4PIRF 1OM3H 3OAYH 4Y5YB 3FO2A 1HQRA 4CN6A 3LCYA 5TF1L 3MREB 4FQXB 4P59L 3VG9B 5D2LA 4XC3H 4X6FA 1I1FB 4PJIE 4JQXA 3TBSB 4RDQF 4OGYH 2VNCA 5K9KB 3HZYB 4XBPB 3KPPA 2XN9B 1WZ1H 2R1WA 1FE8L 1G6RH 5I1HL 4Q2ZA 1S7QA 5F3BA 2AJ3B 5I1LA 3NFPB 1FZJB 5D8JL 5FGSA 3MCKA 3TIEA 2YPKB 5KVFH 5C09B 4GO6B 3SE3A 3QUMA 4MCYA 1NBYB 32C2B 4FFYL 4OZIE 4G6KL 3B2VL 2EO9A 4OD2B 4W6YB 5DJXA 3DROA 5F9OH 1I9EA 3RZCD 4L8CA 3ZKMD 4JFYA 1YPZF 2FATH 3QH3A 4XI5D 3KLHC 3T1FA 8CGTA 4ISVB 2CK2A 3K4DA 1MRCL 4GFTB 4BH8B 1HHIB 2DQCH 4MAUH 4O4YH 2IPKB 3MBXH 2MNUA 5D6DA 5E8OB 3VCLB 3ROLB 3GSWA 2V5RA 4F3FA 1MCHA 4ZPTB 3M17B 4P9ML 5D1QC 2PYFA 1D5XB 2XA3A 2VXVL 4R3SA 2A9ML 4U7KA 3RKDC 1F11B 3NCJL 3BEWB 3NCYP 2BVPB 3QDMA 2FJFA 2DYPA 4RMTA 3EDEA 4IMLB 5T1MB 3TLRA 4M6MH 1OP9A 1KIUA 1EHNA 3F58L 4QHLB 3V4PL 3CFCL 4NKQB 2XNAA 1LNUA 2A38A 2VSCA 1KPRA 3P9MB 4UT9H 4XNYH 5DQDL 5GGUA 5LBSH 1LK3H 2MSPA 5IB2A 2VDMH 3HFMH 3O6FD 1A2YA 4RBPH 4M5YL 1DLFH 3CFDB 5JIPA 3N85H 1J8KA 2HRPH 3U46B 1YNKH 1UJ3B 5B38B 4M5ZH 4FZ8H 3WEXB 4XP1L 5I19L 4X7FC 5ALCL 1D6EA 1RZIB 1EEQA 2BX5A 4N0FB 4MJIA 1TZIB 1UENA 4HH9A 3Q6GH 1NCCL 2CUIA 5FM4A 4PJIB 4LVNB 5IMKA 3GSUB 2GJ6D 2JB6A 3MNVB 3UJJH 3T0XA 3VXUD 1FZOB 1KG0B 2CPCA 3IDYB 1DANT 2HT4D 1LDPL 1WQVT 4I8DA 4LPXA 4M3JA 5BXFA 4CVXA 3VXTA 4WFED 4W68A 2P7TB 4PD4J 4L3ED 3BN9C 2ZUXA 3RJQB 1QP1A 5AYQA 5I1KH 2C4FU 1RSFA 1NEZA 1U2HA 3EJZC 1GGBL 1IGIH 2AKRB 1ITBB 1GGIL 1DN0B 2JJUA 3LAFA 1EV2E 1WWCA 4K3DL 4NM8H 1NCWH 2HRLA 4OLXH 5HYJD 1CFVH 5AZ2H 4WFGE 4A2MA 2ADJB 1MCDA 3LSOA 2BVQA 1CXLA 3RX8A 1ETZB 1J7VR 2NR6C 1QLFA 3KVQA 3UZQA 1EO7A 5FO8A 4WV1B 5EB9A 4UT6H 4DKEL 5FO9B 1RZ7H 2CRYA 2MFNA 2HVJA 3IDXH 5FIEA 5DK0A 3DX9B 3L1OH 4ZS7H 3RU8L 4ZMAT 5HHXH 1LEGB 4Y4FA 2XZQL 5JNYA 4BKLB 4X4MA 3TC9A 2VXUH 3MLUH 1YEKL 2LV4A 4GKSA 4U0RC 3MODL 3QA3B 2H32A 3BQUC 4BZ1H 1KENH 3C6LA 4GS7C 2FH8A 5KOVC 2HTKC 1LD9A 1XCQA 3R1GH 5I1GH 3HNTL 2YEZA 3B3IB 1C16A 3VI4E 4NNPH 1MCCA 4AIZB 5IB4B 4OLZH 2YUVA 4G6ML 2ADFH 4NO2B 4Z7WF 3F6LA 3AXLB 1MPAH 3DNKA 2FJHA 5FKAA 1TQBB 2CR3A 3KPSE 2VN4A 3HUJE 4Y0GA 2V2TB 3RA7H 3MRPA 4EUPG 5D1XD 3V9FA 4KMLB 3ULVH 5CBAA 1SJXA 4NZUH 1HINH 3WSQL 4UUJB 4PY8I 2DLHA 4XVSH 5HI3C 3EO9H 5TE6L 3BGAA 1LE9A 1FIGH 4KGJA 4JRYE 3ARFA 3G6JA 4IOSD 3ARRA 3VD3A 5DRNA 1CFQB 2XA8L 4YO0B 4FN0A 4MNQD 4M93C 3ARVA 3EFFB 2H41A 5HHOE 4UB0L 4XMPH 4FMFA 2ERJB 2WBJA 4GKNA 2J8UB 3VXMD 1S78C 3VI3F 1B6UA 2XZCH 2HFGH 2GFBA 4S0SD 2YUZA 1LVEA 4Q9RH 2LABA 1ZE3C 1NC4A 4IRSC 1SEBA 1CICA 5GRUL 1JRHI 2P5WD 2DWDB 3WIIL 3V0VB 3L5JA 1RIUL 3B9KD 4PV9A 3N9GL 4Z5RB 5I1CH 3UTPE 2QQQA 3PP3H 1JGUL 5JW5B 43C9A 4YH6A 3WNPA 3SDAD 4GKZA 4I0PB 2FNBA 4J4PA 1NDMA 1VEPA 2F54D 3QRGH 4ZS6C 1K2DA 2CRMA 3C5SB 2VDLL 1N3NA 4RMQA 2IANE 4M6NL 2WANA 4K3JL 2OQJB 2DQHH 4PLNC 4M7JH 3VFWA 5DVNA 1JF1A 1KPVB 5DLMH 1CU4H 5JQ6L 4MA8L 1F4XL 1HHKA 3VXQA 1GIGL 1WBYA 4KY1H 1S5HA 2I9LA 5M7QA 1T2QL 5I30H 4JDTH 2X4PB 5EZIL 2YA2A 1P9MC 5IF0B 3MUZ1 1Z0MA 1U8NB 5ACZB 3O41A 3AGVA 1J1XH 4MDJB 3TBTB 1Z0NA 2DQGL 1HHGA 3NACL 3MRIB 2C9AA 4NN6B 3K4AA 3FRUB 3LIZL 5DHYB 2AJUL 1KOAA 3ZSTA 3RNKB 2J1KA 3PABB 1BP3B 4XCFH 5T3XE 5E08H 4QXWA 4MMZC 4G9DA 1U8PB 2Y5TB 4U1HB 5SX5K 3TNNB 4JRYB 4TUOA 2E9WA 4L9LC 5JW3L 3IJYA 1N6UA 2YPLA 4IS6B 4UNTA 1ADQH 3LEXB 2W0LA 4R2GD 1X5KA 2JJWA 3P11H 3MRKB 4X8JB 1AJ7L 4Q6IC 4H1LB 5B39G 3GSRA 3MV01 1D9KA 1CXEA 3SE9L 1OPGH 1LDSA 1EBPA 4G5ZL 1KT2B 4F37K 5GS3A 1BD2A 2HFFB 1P7QA 3QIUC 4HUUB 4WCYL 2HN7B 5ESAB 4F58H 3MO1A 2QKIA 2QHRL 4DZ8B 3BW9A 1HXMB 3A0OA 4PRPA 4HFUH 1A6AA 2D7NA 3QDJB 3RVXD 1W72A 4FQ1L 1YEIH 3IS1X 4YC2C 4ZNCD 4UIMA 1J0IA 1Q9WB 1FRGH 2E7LA 5D7JA 3GZKA 2ICWB 1CIDA 3T0EE 1KCSH 2VDOL 2J4WH 4KC3B 4XGZB 4ZUTA 3FN0L 2IANB 4P5TA 4LVHC 1IAKA 1CYGA 1I9RH 1S7TA 4JKWA 4NQED 5DHXB 3V52L 4LHUG 2GUOB 3FONA 2HA1A 2AI0H 4WHCA 3TJHC 4QXUH 2EYSB 4G7VH 3T4YA 5IVXF 1L7IL 1MY7A 1JGLH 5K9OA 3ZE1F 2F5AL 3ESUF 4CN4A 1JWUA 5C0RH 1ZHNB 4PRAA 3QO1A 4PJXB 2VWEC 1XF5B 2IBGA 3LEYL 4L8DA 4WTWA 2FO4A 4OM1H 1OW0C 3QDHA 5AD0A 5CEYB 3K2UL 4EI5D 4DKAA 1BVZA 1J88A 4KKBD 1BQHG 1ZTXL 1AO7E 2D31B 2PR4L 5CZVH 4I2XE 3S98A 4P3DB 1CFNA 4P49A 4N8CH 5E7BA 1DQLL 4BFEA 4U1MA 4LLVB 1T7VA 3P30H 4U4BA 3GSNA 4WU7A 5HHPB 3LN5A 1CN4A 3QQ9C 2GSGA 3WDHA 4P2OC 1HHHA 4K8RL 1K5NA 3VD9A 3CU7A 3OBAA 5FYLD 2WWMD 4P5KA 1GL4B 4POYA 4LCWA 3ULUE 3AROA 3S35L 1CDCA 4QHMB 4WUUE 2VLKA 4UTBL 3O11B 1YPZB 4L4JA 2C3VB 1T7WA 4FOMA 1KELL 2O61B 1J0HA 2EEDA 3O3BA 3UBXB 5IHZB 5E6IC 3OR7B 4K7FB 4BSWB 2YD8A 3FB8A 3FQWB 4Y4KA 1AC0A 4OD3H 2YOCA 1VGEL 1YEFL 3NOIA 2EDKA 2A6DB 3I3DA 3MRGB 3G5YB 3UEZA 3V5DA 1JMXA 4LLQA 1SM3L 3DUHA 3LKNA 2Z4QA 1KACB 2NY4B 4HWBL 4MA7L 1T04B 1JJUA 2B2XH 4U33A 1OTTD 3ZZ1A 2ICES 5B4MD 1WBXB 1OT2A 4KZDL 2BSTB 1KTLA 1IEAB 4S11A 1M7IB 1NGZB 1IFHL 5J12B 1GGTA 2UVEA 5DO2D 2F53E 4G8IB 5J8OA 4WVRA 4IEFB 5I18H 3C5JA 3STLA 3QI9B 3UC0H 1U8HB 3CLEH 3C9NA 1Z5LA 3DJ9A 3BP5A 3VXOB 4Z7WE 4PJ7B 1A21A 4RGNE 1NGQL 2R4RH 1U8IB 4KK8C 3M1BB 4MQXC 1W2KT 4KZEH 1AO7B 1UGNA 3FO0L 4TRPL 1CD0A 3EYSL 2EE6A 2OTUA 4LSUH 2FX7L 4WDIB 4ZDHA 5IW6A 1MVUA 4OGAC 1JNNL 3UTTB 4OF8A 1I1AA 4HH8A 4PGEA 1UWEL 4XWGL 3P9WB 2E8ZA 3BYTA 1GAFH 2DQJL 2Q86B 2ARWA 3DUSB 2WIIB 3NFNA 4DFIA 3BJ91 3ECBB 4JFPA 3ZT5A 5FYLH 3VI3E 3OZ9L 5JHLH 1FQ9C 4R96A 4TUJA 3ZDZF 1KIQB 3O9WA 2W9DH 5L9DL 2WAHA 5C0AD 1KJ2H 2PTTA 4PUBH 1A64A 3D85D 4QYOB 3SQOH 3TYFB 4MXQC 1IGTA 4K9EC 4XH2B 4DK3A 4Y5XA 3QXTA 3FZUD 2X4UB 5KSAD 3C8HA 4RFEB 4F15B 4QRQA 4N0CA 3VFPB 3E3QA 1D5MB 4ONFH 4JFFA 4NOBA 2IFGA 5KSBA 5B8CA 1FVEB 3BGMB 2P45B 3FHQA 4ORZC 3VU2A 1YYLL 3EYFB 5GSRB 4NSKA 3TA3A 1NGWB 3O3EA 4LSSL 4LSTH 4L1DA 3VXRB 4JN1H 2F53B 1RMFH 3OKNA 3TFKA 1W0VB 3O3DB 1OB1A 4RMVA 3IVKB 1RURH 2N7AA 2A74B 3IKCA 4QO1A 3U0WH 4Z7UF 2IH3B 4HJGA 1U91B 2DTMH 4Z7WB 4LCYB 4I3RH 4NZJA 4Y89A 1MCWM 4RGNB 4NC1E 4MJ6A 2VLRE 4X9HA 4JQXC 4JCLA 1FJ1B 1G7MA 4X5XA 2NZIA 1EFXB 1DFBL 1FL5B 1WSST 3C87A 3PWPB 4E0RA 3TNMB 1JBJA 4YAQB 3HHRB 1BM3L 1T2XA 1A7BA 1INQB 3D25B 3H3PL 2A6IB 4S1DC 3SE3C 3Q0HA 1TETH 4Z7OF 1VFBB 2WINB 1QLEH 4S1SH 3WYRA 3HE7D 4EDXB 4G6AC 5D7IF 1F6AA 3PV6A 1Q9OB 4LKCB 1KFAH 3PGCA 4FQCL 3IGAB 4OM0H 1H8SA 4MVBA 3RL1B 4DK6A 2EKSB 4K3EH 5KANG 1U92B 4XCNA 1QFWH 4HFWB 4UAOB 5TDOA 3VXUE 3TO4D 2IG2H 4A2LA 1JPGA 3V6ZB 3QFDB 1P7HL 5D6DC 5HSFA 4RX4D 2VDKH 4JFZL 1T2JA 2CH8A 4MXWH 2BVOB 1E27B 2PO6C 5BZDA 5IJVB 2O5XL 4L3EE 4PGJA 1WFNA 4C4KO 3GMLB 3PHOB 3GMQB 1DP0A 4FABH 1A9EA 4JANB 1JRHL 4ERSH 2F19H 4YGAB 3RZCB 2BHUA 4RAUB 4TULH 1FL6A 4NWTL 2EH7L 4KFZC 5F96L 1NMCB 5EUOA 2IC2A 1A5FL 1BWMA 3BHBA 2Y25A 3EAKA 4L4TD 2ITCB 3S88L 3QXDA 1E6OH 1N59B 2PYED 3UTOA 2BNRA 3GIZH 3HMXL 3VWJA 4QRRA 4A6YA 2JCCA 3SKOA 2D03L 1RIHL 3O6LH 3CK0H 5I1DA 4PY7B 5T3ZL 3UTQA 4X7SH 5IVXE 2P24B 3QUKA 3WE6A 5F9AC 1BVKB 3VXPB 3P0YL 1C7SA 1Z3GH 1QR1A 3P9LB 3IU3A 4L9DA 1T20A 1PEWA 5T5NF 4PTTB 3GJFH 1J0ZA 1VFOA 5BQ7B 3V95A 4G42A 1PQZB 1J87A 2W0PA 4QOKE 4Y4HA 3S9DB 1MCSA 3SGDH 5I2IB 3SCMA 5FYJD 5E4IA 2LU3A 3LKPB 2E6JA 3GI9H 4PBXA 4Y5YA 3O6FB 4OCWH 4MB3A 1JYVA 3ILQD 1GYAA 4JY5H 2CSPA 4FQXA 4FG6C 5GZNC 3P0VH 3T08A 2BY2A 3HC0B 3HC3L 3TBSA 2J8OA 4Z78B 5K9KA 2DQEH 3I6LD 1R0AL 3HZYA 4XBPA 1T0MA 1S8DB 2YSSB 2XN9A 4LU5H 2HKHH 2R29L 2AJ3A 3R8BB 3NFPA 1RJYA 5JOPD 2GJ6B 4FQ2L 2YPKA 3QZWB 1QYGL 5IGXH 3VXUB 2B0SL 4ELME 5IK3B 1CLCA 4HCRA 2HFTA 1TQCB 5GRJH 4FQQB 32C2A 1D6VH 3GGWB 3JV5A 4OD2A 2X4TB 2Z92A 5CSZB 5CEXB 4PRIE 4L3EB 4KAQH 4KK5C 4HXBL 5E8EA 3SHSA 4JHWH 2IQAB 3HRZB 4Z18A 3ARBB 4HIXL 3GRWA 4ISVA 4LMQI 3PHQB 4HLZG 1PEZA 1JZ4A 4BH8A 1HHIA 1J1PH 3GMNB 3VCLA 4JHBA 4YHZH 4U0QB 3V6OE 4LLMB 3IJHB 4NQVB 3C6LC 5EU7E 4TQEH 4WI9A 4ZPTA 3O8XD 1HKFA 4I3GA 1D5XA 4K2UL 1UKSA 1KIPB 1F11A 4JN2B 4CU6A 5DMIH 4R97B 3BEWA 2BVPA 2I24N 3UPAA 4KROD 1NFDF 5IVXB 1B9ZA 1G7IB 4YNYA 2OYPA 1IGCL 1J5OH 4F7MB 4QHLA 4OZGF 1G7HB 4BFIB 1ZLWH 3CSPA 2AXJA 3SDXF 4OUUB 3ZYZA 2ZUWA 1IM9D 1INDH 2F54E 4OLYL 3ARPA 9CGTA 3CFDA 4Y2DD 2IPUG 1EGJL 1B4JL 3LEVH 3U46A 1EBAA 3WFDH 4J8RB 1CFSB 2DLEA 5B38A 5FAAA 5DK2A 3TM6A 3WEXA 1J12A 2FEDC 3FCTB 5HGBB 3GDBA 4N0FA 4HHAB 1TZIA 5FYJH 3EO0B 3W5MA 3ARFC 4PJIA 2AXGB 3HZVB 4ONHB 1TVDA 4RSVA 5TF1H 3VFUB 1QSZA 4P59H 3MNVA 4I77H 1MHEB 4GG6F 3WKML 1FZOA 1KG0A 4EBQL 5C08E 3TH2T 3TPKA 3THML 4NT6B 2IQ9L 4H0IA 4EUPH 4F7EB 4OQTA 1Y18B 1K6QL 2WBJC 3CFEB 3BRGC 1QOKA 2BXYA 1KPUB 4OCRL 3FHAA 2P7TA 5D1XB 4KKLC 2FECL 3BO8A 4D9QD 2DI9A 5IBTL 4OZIA 2ZCKL 2AKRA 4KJWC 1DN0A 3GBNL 4O2FA 1R3LA 3WLWC 1RUPL 4G6KH 3B2VH 1BWWA 4F9PA 2ADJA 3BI9X 4XRCB 3ZDZE 4L29A 1ETZA 1LP9E 2A1WL 4MNQB 2EZ0D 4J4PC 3Q3GB 3CZFA 4HWUA 4F9LA 2GI7A 2XPGA 3VXMB 5FO9A 2ZUTA 1MRCH 1B0GB 1JVKA 1H15B 3BP6B 1B2WL 5FM8A 1QTYT 5CZXC 4I18B 2P5WB 4NGHL 1LEGA 1QBML 4X6CF 1U6AL 3B9KB 4P9MH 3OF6A 3O45A 2NXZC 2VXVH 2A9MH 1UXWB 1P6FA 3QO0B 4N1CA 3NCJH 3SDCB 4GRMB 3QA3A 4LSQL 3SDAB 3F58H 3V4PH 4D9RD 3CFCH 2DMCA 3NFSL 3BFOA 1N5YL 2F54B 5I74B 5DQDH 3B3IA 4Z7UE 1JGDB 2F8VA 1AD9B 4GMSL 5E99L 2AVGA 5IB4A 4AIZA 1OSZA 2OMNA 4NO2A 3W9EB 3QAZC 4YBLC 1ZAGA 3E2HB 3BZEB 3AXLA 3HR5B 4NCC2 1EX0A 1REIA 4XP1H 5I19H 1T1XB 5ALCH 1JWSB 4CAGA 2V2TA 5E9DD 2DOCA 1X5XA 5T1LD 5F6IB 5C08B 3DURB 1AGBB 4Z7OE 2FRGP 3Q6FA 3ALXA 3RWFA 3KJ4C 4UUJA 5CJ8A 4MGXA 1EJOL 1N4XH 5D7IE 4ODBD 1D9KC 1LDPH 3OPZL 4G9FD 4C83B 4E41D 3BWUC 1HNGA 4I0KA 4PRHD 1IE5A 2G2RB 4IJ3C 1NCAL 4M7ZC 1CFQA 4YO0A 3PQYD 3EFFA 1GGBH 3MUGB 1GGIH 5GGVL 1RK0B 2KPNA 4XVJH 2J6EA 4R2GB 3S4SB 2E7LC 5D7JC 1IILE 3MR9B 2IBZY 1MFAL 5FB8A 4Q9QL 1VHPA 3MNWB 4LSDA 5E4EB 4X6BB 1NAKH 2DWDA 3V0VA 2A0LC 4PJBB 4XC1L 4Z5RA 1A7RL 1Q1JH 4PR5B 3I6KB 5JW5A 5KS9F 5D9SA 4J23A 3WNKA 2VQ1B 4IIQB 4KRPC 4OLVL 1TENA 3FO1A 2VZSA 5SWSD 3RU8H 1IC7L 3MBED 5HHMD 4P9HL 4M61B 2XZQH 4N5EA 3C5SA 5IV2B 4DUWA 2OQJA 1YEKH 4WU5B 1F3JB 1KPVA 3KHOA 3MODH 3WHXB 3L5XH 2OM5A 1R3KB 2DDQL 3FQUA 3JWNC 5I1AB 5IFHH 5E1AB 4NQEB 1XT5A 1Q9KB 3HNTH 5D1ZD 2X4PA 5IF0A 1U8QB 4UV7L 5HHQB 5ACZA 2OJEB 4MLSA 4CRPA 3KPSA 1MJ7L 4YFEA 1P1ZB 4MDJA 3TBTA 3HUJA 4PJHF 3QEUB 1XGUB 1LO4L 4NZDA 3MRIA 3AREA 4JR9L 3FRUA 2R0KL 4Z95L 1KTRL 5DHYA 2MOVA 3ZDYF 3V8CA 3BPLC 5CGYC 4P2RD 2W1NA 1U8PA 2Y5TA 4ZOAA 3KJ6L 4JRYA 4EI5B 4UILL 5F44A 2QHLA 4HBCL 2YKLL 5TE6H 4IS6A 4PYHA 5DFVD 4PJ9B 3LEXA 3DETD 4ZO8A 5HHOA 1R6VA 3SO3C 4S10A 7CGTA 4MSWB 2HMID 2X4SB 3MFGB 3MRKA 2VDNL 4X8JA 1A1MA 1I8MB 1OY3B 4Y4KC 5GGRA 4H1LA 1CDYA 4UB0H 3X13B 1MHPL 1XFPA 1U58B 3GIVB 3ERYA 1KT2A 3BVNB 5ESAA 1GC1C 4HUUA 1B6DA 3GUTA 3VFSB 1KCGC 1FORL 2K1MA 4K71C 4R90H 1P4LB 1AQKL 1AXSB 5L8KB 4DZ8A 3GMMB 1HXMA 5GRUH 4GXUM 3WIIH 5CBEA 4ODVH 1RIUH 3PWJA 1I85A 2NZ9D 3N9GH 5E2UL 3KPQB 1Q9WA 1JGUH 2EH8L 1TZHB 5I8KL 1MAML 4QTHB 1H3TA 2IANA 4MQSB 1MFBL 4ZUWB 2GUOA 3DIFB 2VDLH 1ED3B 4JFDD 5IJKA 4K3JH 1GZQB 2EYSA 1BQLL 4OKVB 4XXDA 4HJ0C 1WEJL 3PWLA 1H3UA 3J7HA 4OZGE 4KMQA 5ADOH 5JQ6H 2IJ0C 4MA8H 1F4XH 3SDXE 2D4FA 1GIGH 5MEQA 1ZHNA 2EDJA 1C1EL 1NFIB 1T2QH 2DKSA 4PD4K 4NPYA 2X1OA 4PJXA 5EZIH 2BC4A 4P57B 4LCIH 3CIQA 3SO5A 4X7TB 2E9JA 1I1AC 1EVUA 1T0NB 3I50L 4K23L 2DQGH 5CEYA 1F58L 5FA4B 3GB7A 3NACH 3KPRD 4PGZA 5EDXA 1AY1L 3ZKNC 3LIZH 2W07A 2AJUH 4NHUB 4Q0XL 2X4QA 4P3DA 4JDZB 2X42A 2APTA 1XF3B 2JTDA 4K8RD 3WXWH 5HHPA 5JW3H 4H8WC 1AC6A 1GPOL 3O9WC 4YDKL 4KV5E 3WL9B 1VSCA 3D48R 5C8JB 1H3VA 4DVRL 2FGZA 5M94B 4PJAE 4QHMA 4Y5XC 2BRQA 1YPZA 4PJDF 3SE9H 4G5ZH 2O61A 5J3HD 5B3JE 3FOMB 4N0CC 4YHNB 4WCYH 5FF6B 3E3QC 4P5MA 4K7FA 3ARDD 5JQHC 4BSWA 1VEMA 5B8CC 2QHRH 4IOIA 4KDWA 4X9GA 4HBQA 1Q9LB 1QSEE 3TA3C 3LRGA 1LEIB 3AU1B 5KN5B 2BCKB 2ZKHL 5TGBA 2A6DA 4FQ1H 3T0EA 3G5YA 1T7ZA 3SY0A 5JTWA 5IMMB 2APVA 1U3HD 3TFKC 5FK9B 5C0AB 3D85B 1NFDB 3EOBB 3AS2A 1T04A 3FN0H 4L8BB 1TXKA 1GVIA 5KSAB 1M71B 1OGTB 4OZGB 3V52H 4GMTL 4HC1A 2IAMA 3HNVL 1WIUA 1TJGL 5IBLC 5ECJE 4UOW1 1KEML 1UJTA 3RPIB 1M7IA 1NGZA 1IZKA 4ZNEE 3PWVA 1L7IH 2V5YA 4G8IA 1SY6H 4N9OB 3QHTC 3MRJB 2KQMA 5D70L 2F5AH 4NKDB 1EA9C 3QI9A 1U8HA 4R4FL 2PETA 4RMSA 5C0CE 5KVDL 3VXOA 3BH8B 3UP1A 1U8IA 2DN7A 1WV7T 1TCMA 4EXKA 1EO8L 1AO7A 4MVBC 1IQDB 4I2XA 4GG6B 3DYOA 4NN7B 2LAAA 1ZTXH 2PR4H 4J3SA 2DQTL 2ZUSA 4POZD 1SVZA 4GH7B 5I17B 2RQ8A 3QYCA 2NY6C 2NYYC 1A6VL 1CZ8L 5HGHB 2NY3D 4K8RH 3UTSE 3DUSA 3HE7B 2WIIA 2IPTL 4IRJD 1HQ4B 3ECBA 4HWEL 4OTXL 5HYEA 4OBSA 4ZSOE 5JORA 1BOGB 3I6LE 4J3VA 2FD6L 4UTBH 5F7WC 1JNHB 4QHUB 1MFDL 5F9WB 4GQPH 1MRDL 1KIQA 1KELH 3MCLL 4JPWL 3TO4B 3TYFA 1FAIL 1QSEB 4QYOA 5IVNA 3AAZB 3L3KB 1S9VB 3EO1B 3U7AA 1VGEH 1YEFH 2LVCA 2V7NB 2X4UA 4BA8A 4YGVB 1MF2H 3NIGF 4RFEA 3CX5J 4B7IA 1JHLL 4X6CB 5F71A 3VFPA 1D5MA 4PLJD 5DTFB 5BOPA 4LRNL 2DD8L 4DN3L 3BGMA 3X11B 2X89D 4HWBH 4MA7H 4UBDC 5GSRA 3EYFA 1YMHB 5I9QB 2WIMA 4Y4HC 1BZ9B 3MV9E 1RULL 3VXRA 3SCMC 2F53A 1G7PB 4KZDH 4L4TB 5DK3A 5BS0E 3QIBD 4HSQA 1W0VA 3CVHB 3O3DA 4Y5YC 1C5CL 1IFHH 3IVKA 2PYEB 3D0VB 3EJYD 3VE0B 4PY8J 2IH3A 5C0CB 4FQXC 3BZDA 1R5WB 4Z7WA 5CEZL 1WZMA 5LQBL 4P3WA 1FJ1A 4M7LL 1EFXA 4XTRC 2R8SL 1DCLA 2X44D 5DJZA 2NXYD 1DN2A 4NNXB 4HG4K 4JB9L 2R1XB 1QQDB 1S3KL 1SVCP 3D25A 3ZDYE 2A6IA 3FO0H 4P0DA 4TRPH 3EYSH 2XKNA 1EUTA 2EC8A 2WINA 3S96B 1SMOA 4EDXA 1P84K 2FX7H 4MNHB 1QPPA 1Q9OA 2VKXA 3LOWA 4LKCA 1JNNH 2NW2A 4JZNB 1DE4B 4JO3L 1UWEH 1DSFL 4XWGH 2Q7NA 5IW1B 3RL1A 1WFUA 2EKSA 3VDCA 2OK0L 2GKIA 2Q6WB 1U92A 4ZXBD 5GGSY 4BJLA 2DQJH 4HFWA 1CK0L 3V6ZA 2A83B 3QFDA 1NCBL 3S5LG 4ENED 2B4CH 3BDXA 4KU1A 4NDMA 2BVOA 1E27A 3PGFL 4S0TD 5IJVA 4Z7VE 4GAJL 5TPWL 4LMQE 1FL3A 2D9QB 3PHOA 2EIZB 3GMQA 5L9DH 1U8MB 3W39B 1RHFA 1S9YB 2HLAB 5H37H 5KS9B 4ODTL 3X3FL 4AENB 1A7NH 4RAUA 4N90E 3QWRD 4HUWB 4HLZH 1MCLA 3FMGL 2ITCA 5TF0A 1N59A 3T8XA 5GGSB 4GRWH 1T83C 4KK6D 1IC4L 2EDEA 1YYLH 5CKAA 3Q5OA 4PY7A 1UJ3C 4LSSH 1N8ZB 2P24A 3HB3D 2Z31D 2ADIB 3O8XB 3U30B 2EDOA 1VDGA 3U7YH 1LQVA 2B20A 1KB5L 4Z8FL 4WO4D 4KROB 4PTTA 1SJHA 2XKSA 1T7XA 5BQ7A 2VLRA 2FO1A 2M8XA 4LVNC 1PQZA 4PJCE 4FTVE 1N6QL 2QQNL 4PJHB 1I9JL 3BDBA 3IDYC 4Q6YA 3U0PB 1MCFA 1V7ML 2X70B 4O2EB 3JZ7A 1DFBH 3O6FA 2HWZL 2C4XA 3HE6D 3RWHB 4Y2DB 3MGTB 2PW1B 1HEZB 1BM3H 5C9KA 1ROWA 1ZLVH 3H3PH 3QUZB 3IRZA 3H9ZA 1MWAL 3HC0A 5LGKA 4AG4L 4Z78A 5D96B 1S8DA 2YSSA 3TJEL 4JM2D 1R3IL 1UYWL 1KUMA 4F9PC 2NQCA 3ZHDA 1UWXK 4FQCH 5E8NB 3VXUA 4JCMA 5IK3A 4LSPL 4UOW0 4N0UB 4FQQA 1CTNA 4WV1C 1S7RB 3TBYA 2EE9A 3MOBH 2X4TA 1WTGT 4PJDE 5J7CC 4ZUVA 5CEXA 5CSZA 5AAWA 4NBYB 4L3EA 4U2YA 4S2SB 1B0RB 4JFZH 3SE4A 1MCBA 3D39E 3FT3B 2XV6B 4AEIL 2O5XH 3HRZA 3ARBA 4MS8C 1DBBL 1J86A 4QRPD 3OKDB 1I8KB 3S3PA 4L5FL 5IOPB 1JRHH 1HCFX 4H5SB 4PJ5D 1KN4L 4NWTH 5E2TL 2EH7H 4K94H 3IJHA 4LLMA 4RGOL 5F96H 3UTZA 5SWZD 5MP6L 5HYSB 4EZMA 2F8OA 1A5FH 5I0ZA 1CD9B 3GO1L 3KPNB 3S88H 1KIPA 3L7EB 1BAFL 1L4IA 5IVXA 3DHMA 3ABZA 4JEGB 2NNAB 1G7IA 3DO3A 4BSVB 1HDMB 2D03H 4F7MA 1RIHH 2XRAL 5I71B 1CBVL 5T3ZH 1MCOL 5EO9B 1TQBC 3RNQB 4GRWF 5CJXA 4BFIA 4OJFL 1LHZA 2EC9U 3P0YH 3RTQD 5HHME 5FXCH 1JIBA 3B4NA 4Z7NF 3TESA 1PAMA 2YN3A 4ZUUB 1WWAX 1CFSA 1ZXQA 1UQSB 4Y5VB 4JKMA 4D2NA 4Q9CA 5MENE 5HGBA 2SEBB 4BELD 3EO0A 1JNLL 2ATPB 2AXGA 1QFHA 1QFWM 2E8YA 4P2QD 4CBPA 1MHEA 1MEXL 4WHYG 3WS6C 4XPTL 3TT3L 5FUOL 1OD7A 5J6GA 3HC3H 4LFHG 3OKLA 3WO3B 4F7EA 2ERJC 2H8PA 1Y18A 3Q2CA 3CFEA 1R0AH 5DDHA 1KPUA 1PVHA 5T1LB 3VJ6B 2R29H 4D0BB 4Y8AA 3VXSD 3LKSB 2KH2B 4FQ2H 3RWIB 1QYGH 2DQDL 2H45A 2B0SH 3V0WL 4C54A 4P2RE 4PJDB 1I7TB 1DBKL 3PHSA 2R2BB 4G9FB 5AZEL 2YMXL 1A6TB 4E41B 2G5RA 1CIUA 5DF0A 3J8F7 4NBZB 2IH1B 1JFQL 4TSAL 4XRCA 5CCKL 4HXBH 4I0PC 5BV7B 4HF5L 5E24E 4UDUB 3Q3GA 1F5WA 1MNUL 4OV6F 4HIXH 4N5EC 4WRLA 5IW3A 1RUKL 3WIHL 3ZLQC 5K33A 3V6OA 1QSFE 4WW1B 2CIKB 2Q8AL 3F7YB 3NIGE 4NQXB 1KBGL 5HYIA 1H15A 3BP6A 5BRZE 3P4OB 4K7PL 1MIML 2NY2B 4I18A 2P1YA 2P5WA 3O4LD 2CDEB 3K8MA 3KLSA 5DZLA 2P46B 2X1XR 4K2UH 2FIKA 3UYPA 1UXWA 4X7CC 3HG1D 3SDCA 3QUYD 4GRMA 3UZEA 3OGCB 3SDAA 1IGCH 4NRXB 2VLJD 5JHDD 5SWSB 1X7QB 2Q87A 5HHMB 4NN6C 2F54A 3AVEA 1JGDA 3MV8D 3D18B 5AWNL 1UH3A 3EYQC 4XNZB 1I1YA 5D5ME 4ZOEA 5IM7B 3E2HA 1EGJH 2HT2C 1X3DA 5IG7A 5GRWA 3HR5A 1CLOL 1CQKA 1A1OB 4QCIB 1T1XA 5D1ZB 1JWSA 3MLRL 3CH1B 2ZG2A 5C08A 2VWEE 1AGBA 1ZVSB 3B9EA 5MI0B 1IGYB 1X5YA 1OGAE 3WKMH 2EDFA 3SBWA 3JXAA 4EBQH 2QJDA 2IQ9H 1ZA3B 4C83A 1ES0A 3GSXA 3P3YA 1K6QH 5IMLB 4MXVF 2G2RA 4UIKL 1ZGLB 4OCRH 2VAAB 4P2RB 3T65A 3ZMRA 4WHTB 3PDOB 4WGWB 3QNZB 5DYOB 2OL3A 3O2WL 1MCKA 1NC2D 4OSUL 4R26L 5IBTH 5ITFB 2ZCKH 1NGXB 5EC2A 3HAEG 3MUGA 3QUML 3GBNH 1CGTA 3D87B 4NCC1 4NQCD 1I85C 4L4VD 5DD0H 1J0JA 4RFNB 1RUPH 5ESQB 3S4SA 3MRFA 3MR9A 4QRUB 1U8LB 4GJTB 43CAB 3MNWA 2A1WH 1QSFB 1AR1C 4X6BA 3BESR 5FCUL 4X80L 1H8OA 4HS6B 4CGTA 1HI6B 5DRZB 5IJKC 4PR5A 2XQBL 3I6KA 2VL4A 4RZCB 5F21B 1B2WH 4Y1AD 4RAHA 4EDWL 5DJ6B 3NAAL 4PS4L 4NGHH 2VZ1A 3SDDD 4Y16D 1QBMH 4M61A 3KPOB 1U6AH 1IKNC 2YD9A 5IV2A 3QR2A 3FN3A 2DM7A 4KRNA 4DOHE 5JXAL 4E9LA 1F3JA 5C0BE 4LSQH 2WUBL 4GRLD 5GZOD 3WHXA 1AGFB 1R3KA 4Z7UA 3QEQE 5I1AA 5E1AA 3NFSH 4P3CL 4NQEA 1N5YH 1Q9KA 5IWLC 5EOQL 4JFDB 1FFRA 1MCWW 4XVTL 1HH6B 1KGCD 4GMSH 5JXED 5E99H 5HHQA 2OJEA 2AQ2A 4CVWA 1P1ZA 5CLTA 3Q1SL 3QEUA 1D3CA 2CUMA 5DJ2B 2PF6A 2Q3ZA 3LY6A 2AABL 1DQJB 2AXFB 2O93L 2JELL 1FZKB 1X4XA 5D7IA 1IC5L 3D6GA 1AXIB 5DR5L 2QR0B 4F8TA 3OAZH 1T21B 4OLUL 3PJSB 5KTEL 4EI5A 3KPRB 3GMRA 2HJFB 1O0VA 3OPZH 4X4XB 5C0IA 4PJ9A 3VFRB 1EK3A 4LLAA 2DLIA 2X4SA 1NCAH 4JFEE 1I8MA 3DRTB 1KJVA 1K4CA 5A2IH 1UA6L 1YY8B 4WNQB 1DQDL 3X13A 1U58A 3GIVA 3PV7A 5GGVH 3C60D 3T0EC 2VUYA 3EZ8A 4P4KD 3VFSA 2DWEA 3QT2A 4KUZL 3MOAL 2VOTA 5EOTB 12E8L 1Z9OA 1AXSA 1Q0XL 2DQIL 2NY4C 1MFAH 1K85A 4Q9QH 1JFMA 3CPLB 3E8UL 4KQ3H 1E4XL 4UNUA 2MMXA 4PBVC 3EOYG 3JUYA 1NQBA 1OL0A 2VERN 1A7RH 1R5IB 1EVTC 4JJ5B 3KNBB 1TZHA 5J12C 3QQ4A 1HIML 4OFPA 4OLVH 1TDQA 4QTHA 4W81A 4KDTA 5E2VL 4PYGA 3QI9C 1IC7H 4ZUWA 1BZQK 4P9HH 1ED3A 5C1MB 4M7LT 2I25N 1U3HB 3FO9B 1T89A 2ZUUA 2GIYA 1FN4B 2DDQH 1RZJL 3DYPA 1VFAB 1I75A 3L3HB 1S9KC 4ORGB 1NFIA 1OTUC 1P69B 3QFJD 5DURD 1A7PL 2BOBB 4Z7NE 4P57A 3HKFA 4HKZB 4HIJB 2J5LB 4XP6L 1T0NA 3X12B 3OHXB 3MJ8B </