5AD0A

Complex of a b21 chicken mhc class i molecule and a 11mer chicken peptide
Total Genus 55
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
55
sequence length
269
structure length
269
Chain Sequence
LHTLRYIRTAMTDPGPGLPWFVDVGYVDGELFMHYNSTARRAVPRTEWIAANTDQQYWDRETQIVQGSEQINRENLDILRRRYNQTGGSHTVQWMSGCDILEDGTIRGYHQAAYDGRDFVAFDKGTMTLTAAVPEAVPTKRKWEEGGYAEGLKQYLEETCVEWLRRYVEYGKAELGRRERPEVRVWGKEADGILTLSCRAHGFYPRPIVVSWLKDGAVRGQDAQSGGIVPNGDGTYHTWVTIDAQPGDGDKYQCRVEHASLPQPGLYSW
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Complex of a B21 Chicken Mhc Class I Molecule and a 11mer Chicken Peptide
rcsb
source organism Gallus gallus
molecule tags Immune system
molecule keywords MHC CLASS I ALPHA CHAIN 2
total genus 55
structure length 269
sequence length 269
ec nomenclature
pdb deposition date 2015-08-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00129 MHC_I Class I Histocompatibility antigen, domains alpha 1 and 2
A PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5ad0A02
3.30.500.10 Alpha Beta 2-Layer Sandwich Murine Class I Major Histocompatibility Complex, H2-DB; Chain A, domain 1 MHC class I-like antigen recognition-like 5ad0A01
1KLFA 3T0EA 1KJ2L 3DXAB 5FYKU 1KN4H 3J8F7 2MSPA 2P5EA 3SO3B 1DBAH 4JG0L 4N9GB 2VRAA 5F96L 3GMPB 4J3UA 2B5IC 2EDEA 3TVMC 5I1KL 1J0KA 4H1LB 3QA3B 3WXWH 1Z9OA 5TGBA 1G9NH 3BP5A 4BKLA 1AI1L 4KJPC 3T65B 4Z5RB 4ZPVA 4OD3L 5JXED 2FJFB 5KSBA 5JORB 4NBXB 1IGML 4XC3L 1MAML 1PZ5A 4LLWB 3HUJB 1F00I 1XGQB 3O9WD 3PHSA 1NLBL 3H3KA 1QYGL 3C8HA 4P2QB 3D85D 1I8MA 3FO2B 1MWAH 1HDMA 2R4SH 2Y07L 5FUZH 5IWLA 3SE8H 4GXUN 4KROB 4LK4A 5A2FA 1RIUL 2EZ0C 1PGRB 3GSUA 1XZ0A 1R3KB 1NGWB 3EOBB 1SHMA 3STZB 2FGWL 4NPYB 2XWTB 3L3KA 4MXQC 5I2IB 4R2GB 4KJPD 1MREL 3B9KD 4U49A 3S8WA 2YUXA 1XT5A 4W70A 4L4TA 4NC1C 5HGBB 1KTLA 1HSAA 2AV7B 1ZAGA 3V4PL 1U8LB 15C8H 4WFHD 4DGYL 4OQTL 3IGAB 1BX2B 5CD3B 3SEPA 4U6XA 3MGOA 3QUXD 2AJSH 3GSNH 4LLMA 4XMLH 3BT2L 4RMWA 5DC0A 3RVXD 3ZHDA 4GBXB 4HWBH 4XMKH 4JFFE 4HUNB 4PJAF 3G9VA 4WCYL 1J1OH 1INDH 3QH3B 4HKZB 1R3IH 5I76A 1DE4B 1A6VL 1RZIA 4O9HH 1FNSL 1ZLVK 3FCTB 1JZ7A 3JWOC 4XCEA 1E4WH 3L5XL 3X14B 2ZOLA 4FG6D 4WHCA 5AAMA 2YSSA 2J8UF 1CZ8H 2ZG1A 5IV2A 3TJHC 4PGEB 4JFHD 4JM2F 5EB9A 1WFNA 2ZKHH 1P5UA 4Z7WE 3BW9B 1LO3L 1GGUA 4FXLA 2C1PA 3AM8A 5DUML 2C4XA 4Q9QL 3I3BA 5J6GB 2EDWA 4NKQB 1OTUD 4OCWH 1YEDB 1IM3B 1H15B 5J3HC 5EG6C 4K3GA 3AU1A 1OP5H 1AO7B 1ES0A 1CFBA 1T5XB 2ZSWA 3OKYA 3HR5A 2G75B 3CC5B 3LY6A 1IL1B 4FA8A 4NC1E 3SDCD 5IMMA 3EDDA 1NMCC 1A7QH 3R1GH 1HSAB 1RU9L 5IOPA 1ZE3C 3O8XC 3P77A 4GSDL 3LKRB 5ELIA 4EN3D 3UJTL 1U0QA 3A6CL 4K9EH 5ITFB 5I30H 3MRGA 3P9LA 3EOBA 1PEZA 4FZEL 1X7QA 2AJ3A 3PABB 3C9NA 2HRPL 2Y7QA 2GSGB 5HYSB 3F58L 5IM7A 1J8HE 2AJ3B 4ZUVA 2E9BA 4JZNB 5I1CH 3O81A 1ZANL 1XMWA 2VXVH 1FORL 3TA3B 3ZSTA 4MXVF 2O5ZL 5DVKA 2HTLC 1MCWW 4PJDF 4A6YB 1XGYH 4EDXB 3NABH 4OGYL 4LCUA 4ZUWA 2Z9TA 3N1MC 2VDOH 4QHMA 1BPVA 3CDGB 3ES6B 3MRNA 4JM2B 3P9LB 3GK8H 3T2NH 3BISA 1QQDA 5F9AC 3CUPB 2VZVA 6FABH 3RWDB 1E6OH 1VB9A 2VZ1A 4ONHA 3ZE1F 2AJUH 1DZBA 4UOW0 2ZJSL 2EDBA 1RURH 5J11C 5TDPA 4KPHL 1HHGA 4HC1H 4F7MA 3IYLW 4X0KB 1JWSA 1K4DB 2CPCA 3VWJB 5TE4H 1MFAH 4X5LA 1DR9A 5IHZB 4OV5B 1TJGL 2DWDA 3FT2B 1DL7H 2JJSA 4AJ0A 4OIAA 4QGYA 2V2XA 1RVFL 3T77A 1Q1JH 4XP5L 3KPSA 4HPYH 3MODL 1RJLB 1YEDA 4P5KB 3MR9A 1KPRB 4NRYA 3UZVB 5IEKB 1W8OA 1D5IL 4JM2C 1V3JA 3BHBB 1YEJH 4M6NL 2VDNH 4XMPH 3T08A 1UWGH 4AL8H 1TIUA 4AT6B 3RVWD 5ETUA 2ZCHL 1G7IB 1KCKA 4UILL 4O2FA 1XR8A 4IRZL 4UNUA 2CDEA 2VXTL 4U2ZA 3WL9B 3ZT7A 1G7PB 1QUNA 1AGCB 4RX4D 5HHXH 1OP9A 3IFNH 2VR5A 3C5SA 1T7WA 2NLJB 1MVFA 2VERN 2R23B 1FBIH 4ZUWB 4Z8FL 1NDMA 4KI5D 1KYOJ 2V17H 4DZBA 1AGFA 2VLRD 3QEQB 3O3EB 4XP6H 4ZFZB 3VJ6B 3WS3B 1TQCC 1JYNA 1TVBB 3BFOA 5D7LD 4P9MH 5B22A 3ROLB 5BCAA 5D70H 3VFPB 4N5EA 2N7BA 4RX4A 5I71C 2NY1B 5C0BD 3UBXA 3L5WB 1S7SA 5IFHH 3PP4H 1EAPA 5DK2B 4QXTA 3QDMB 2NY3B 2APFA 4JPWL 4AEHL 1HINH 5FF6B 3ARDA 2XICA 1IGIH 4LARL 4OLXL 1F4XH 1PJ9A 3F7VA 1B0GB 1E4KA 4F2MA 3O2WL 4FQ1L 4YX2H 2YD3A 3O6FB 4ZAKB 1BVKB 1GOGA 4XRCA 5GGVY 5DR5H 4WW1B 2XA8H 5DJZB 5C0AE 1MFCL 1C5BL 4C4KT 3O6FC 4ZAKC 2VL5B 3JWDH 5L0QC 3ARTA 1IKNA 2CO7B 4HKBB 1C08A 1U8PB 4H0GA 1C12A 1GCFA 4HUUA 1AY1H 3VA2C 5IMMB 3WIIL 1A5FL 1S8DA 5C0EA 3MGAA 3PE9A 2X4NA 3S9DB 2BNUA 1JYVA 4NNXB 4G6JL 1V5JA 1AGEB 3ARDC 4KKAC 1YEEH 5JDSA 5BRZB 1HNFA 3F5WB 3G6JB 3ALWA 3PL6B 2XXCB 4KI5E 1CU4H 3H7LA 5ITBH 1N2RA 4LRNH 3PDOA 4NQUA 4LBEB 3HS0A 4GG8A 3VW3L 1DL7L 5E1AB 3MLRL 1G1CA 3T04D 4GRWH 3RX5A 2CXKA 1WITA 3PWLA 4G5ZL 4KPHH 4HQQH 3BJLA 3TH3T 2ZJSH 1KXVC 3HRPA 1KELL 2P43B 1MEXL 3DIFA 4K8RC 4ZUSA 2I5YL 3TP4A 1FGNL 1WBZA 4NN6C 4WIQA 4ZOAA 4HIJA 4KZDL 4XVTL 2IFFH 1QBMH 2HLAB 4GS7B 3UTPE 5MEPA 3TNMA 3MPCA 2FX8L 1WFTA 3NFSL 2BNRE 5C0AD 4OFYA 3O4LA 3FQRB 2ATPA 5FGCB 2YZ1A 4DQOH 3H0TB 3L6FA 2HT3C 3RL1B 4KH2A 1H8OA 1WVZA 3V4UH 1EBAA 3LKPA 2D31B 5FHBH 1UC6A 4JREC 4GRWB 4KC3B 4V2BA 1IVLA 3MRDA 1IE5A 2UV3A 5E6IC 1LK2B 4CGTA 3BPCA 4M9PA 2QQNH 3RTQB 3F58H 2FYYB 1CXFA 4K7PL 4CADA 5FECB 1T20A 3HZYB 4JDZB 3ARGA 1JFQL 3LQAL 2DKMA 2QQNL 3W39A 2NW2A 3A6CH 4AMKH 1L9MA 4GKSA 3CU7A 2K7PA 2YPLA 3BKCH 3D0VB 1YEHH 5FUOL 1NC4D 2FRGP 4BFIA 1YMMB 2HTKC 4GQPH 1ITBB 1OY3B 4P46A 1S8DB 4FFYH 4LL9A 4H1LA 1URLA 2OZ4A 1X3DA 3BZFA 3LQAC 3MRBB 1QTYT 5IUSA 4MJIB 1LO0H 4YHNB 4YQXL 2UUDH 3FQXB 4WI7A 4ODXA 2OLDA 4JY6A 4ODTL 4HZAA 2ICES 4U1GC 1NAMB 2DTMH 4P2RE 2HT4D 2WUCH 4M8VA 2I5YH 3S37X 1CCZA 5FKPB 2WUCL 3RQ3A 3MQIA 3NCFB 1NFKA 4ETQB 4D8PA 3DX9A 1EEYB 3GMMB 3PWVB 1NGZA 3D2UB 5AZ2L 4YQXH 1UM6H 2R39A 3E3QE 4K8RH 4G7VH 5CJOH 3E6HB 5JIPA 1VFBA 4XXCA 4MJ5A 3ZDXF 4QTIH 1CE1L 4U1NB 4MXWH 1XF5B 4KHTH 1ND0B 2ICWI 4KV5F 5BQ7A 4R3SB 1S78D 1CICD 2Q76A 1FNSH 1NLDH 4R7NA 4AMKL 4KJYB 1FSKC 4OZGE 4WCYH 3NFNB 1NBZA 5L6YH 3ALPA 3EFDH 3VXRE 3N0PB 4XMLL 4EBQH 2FB4H 3BKJH 4MA1C 1MJJA 1X5FA 2JK5A 3D39B 3KXFD 4OQTH 4P3DB 5HSFA 1EJ6A 1TQBC 4S0SD 3M1BA 4IIQB 2FHFA 1AJ7H 2EKSA 1WISA 4NRXA 5DRZB 5JXEA 4G9DA 1ED3A 1M6OB 1YQ2A 3W9DA 1YPZB 2X9WA 1RMFL 3B9KB 2FX8H 5JOEA 4FQLL 4X7CC 2XXMB 2YD8A 2FSEA 5DD6A 1HXYA 3MYJB 2BSTA 1G7LA 4C56D 1RD6A 2UY7A 1M7IA 4X8JB 1IKNC 1JJUA 5E5MB 3FHQA 5GGTA 1KELH 4NQCD 4WI6A 4ZOBA 5LWYH 4LLMB 3SHSA 5H35A 5BO1H 4M6AA 3MA9H 4JPVL 4IIQC 3V6FB 4ZOCA 5IB5A 5E9DD 1NC2D 5D70L 2NY0C 5D4QA 2CIKB 1P4LA 1HHHB 1IFHL 5I9QC 1D6EB 2EDKA 3QUMH 2FEDC 4KY1H 5FA4A 5I2IA 1T80A 4LPVA 4PJIB 3PIQA 1MJUL 3MBXH 2VLLA 3P4NA 3RI5F 4DZ8A 4WWKA 1CL7L 5IB2B 3UTQA 3FO9B 4JFQA 4GRWE 3IS1X 3E1F1 1A5FH 3AC0A 4HUXA 1YC8A 4MB3A 5BV7B 4NSKA 4QRSB 4R4BB 2I9TB 5DWUL 3BD3A 2GYSA 3ZDZE 3TNNA 1XF4A 2A0LD 1X5LA 3GBNL 3P73A 4MB5A 3MV9E 4RA3A 1EA9C 1MJUH 2NY0B 2D7TH 4K2UH 1WJ3A 5HD8C 4LKCB 4X7DC 2EDQA 4NN7B 1U95A 4UBDC 2O61A 1N4XH 5DJXB 3TVMD 5FM8A 1AR1D 5FYKD 1GYAA 3CSYA 1AD9B 1PQZB 1KB5A 5GGRA 2H6PA 1N64H 3IJSB 1CFVH 4UUJA 3V4VL 5AD0A 4M7LH 4XCNB 5HI5C 1WV7T 4MAYD 5T1LD 1FPTH 1ACYL 5E2UH 2Z4QA 3EKCA 3HZMA 3BPOC 3HA0A 1NEZA 2NY5H 2OJZL 5CINL 1Q9KB 4HKJA 3IRZA 1IGFH 4GAYA 4EVNA 2FO4B 5C09B 4WWKD 1S5HB 4KGJA 3ARED 3HAEA 1OGAB 4XB7A 1YJDC 5J13B 5JLZB 5LAXA 3QEUB 2QHRL 5BMFL 2BXYA 5HHXL 4Y5YA 5I1CL 3DGCR 3BKMH 1E27A 4HSQA 2BRRL 5D93B 3CX5J 4ZTOH 4UILH 2OTWB 4LIQE 1JMXA 1GGCH 1BWWA 1ZLSL 2YHGA 4PRNA 2DI7A 3HI1B 5L6YL 3B9AA 4ODHH 4BQ8A 3VI3E 2X44D 3HPJB 1TPXC 4JQXA 1LEKA 1QFWI 5C0AB 5IT2H 5IHZA 3MGOB 5LXGH 5TFSL 4KDVA 4PJFE 1A7QL 2E5EA 5GSRB 3U4EB 3KPOB 4HUXB 1UB6A 1N6QL 5IMKA 3C6LD 5IJKA 1I1FB 4QHMB 3HI5L 5TE4L 4U6HA 1KTRL 3NIGF 3Q5YA 5AZ2H 4LMQI 4H5SB 2QQLH 5I6XB 3HE7D 2AJUL 1CIUA 2OSLB 4NIKB 4M6MH 1C1EH 3L9RB 2Q20A 4P23C 4MD4A 1PG7X 4X80H 4NKDA 1CVRA 4PP8C 4R0LB 4PJIF 1LP9A 3HLAB 1A6UH 2J2ZA 5B4MD 1NFDE 1FRGH 3NIDE 3P4LA 7CGTA 5HYJD 3V0WL 4GW5B 4LLAA 4OZHA 5FA3A 4TSCL 5J4MA 2Q3AA 1RZ7L 3LS4L 3CMOL 3EYOA 1JUFB 1Q72L 2HVKB 2XWJA 3CC5A 3E2HB 1MVUA 3VFRA 4WUUB 2HJKB 3MV7A 4JFDB 2HFEB 1Q9KA 5IESL 5TE6H 1IMHC 5IVXB 2AJSL 3BOVA 4MNHA 3P77B 2GCYA 2XA3A 3REWA 3MRMA 5C6WH 5CD3A 4JB9H 2DJUA 4ISVB 1G6RH 4LHQB 4S2SA 4YE4L 3WFDH 3AFLA 1A6TB 4P0DA 3IVKA 4LLUB 1JUFA 4Y4KB 1AO7A 5DEFA 3NFPA 2IFGA 4LPUA 3W82A 5GIRB 1JNNH 1SJEA 2BOBB 1FIGL 3N1FC 5GJTH 2E6JA 5E7BA 4ZSOB 2DJ4A 4EUPA 1T22B 5D1XC 3SE8L 1QKZH 2ZUSA 1CBVH 2CK0H 1RFDL 3O41B 3SKUD 3U0WL 1UJ3C 3RJQB 4OB5H 1HHKB 5IR1B 4R0LA 2LAAA 4XBEL 5HHNB 3NTCH 2HJLA 3MFFA 5EOCL 3RNKB 4MDIB 4GAJH 3ZTNH 5IJVB 4PJBE 4UUJB 5BRZA 1L0QA 2AERT 3UP1A 4C59B 5IFJB 2HMID 4NNPL 1G7HA 4JFFD 4MJ2A 4HLZH 3WJLA 5B39B 3GHEL 4MD4B 4L4TD 4TVPD 1YEEL 3JTTB 1RHHB 2JB6A 3Q6GH 4M1GL 5AUMA 5F96H 3IDIA 2W59A 2D0HA 5IMOA 2FH8A 1U8MA 3Q3GB 2NY3C 2XQYK 3NIFE 4X83A 1FNGA 3IDNA 3LEYL 3L3JB 1O7VA 4E0RA 1YJDL 4LEOB 5KVFL 4XP1H 4JCLA 1OAQL 3FJTA 4Y16B 3TIEB 5EU7C 1UJTA 3OKMB 2IJ0C 1I8KA 1U93A 5DURB 4QRQA 4NWTH 1DBMH 4AZ8A 1I7RB 2BCKA 1WICA 2C9AA 2YUVA 3FONA 4QOKB 4TUKH 3QO0A 3QDJB 5MENA 5FCUL 3QYCA 3WIFA 5INDB 1AC0A 1OSPL 1ZLVH 4CMMB 4F8QA 3L3IA 2BSSA 4JKMA 1F4XL 2FX9H 4O58L 2JELL 1M05A 3ULVE 1MCPL 1MWAL 4ELME 1JBJA 4U4BA 3O4LD 3O3BA 5D2NA 1A6PA 3CK0L 3V9FA 2VSCA 4V1DD 5K59E 1NCWH 4JZOA 3D85A 4W4NA 2O5YH 2DLIA 3ZL4H 1X5JA 4Y2DB 5EZIL 1CR9H 3KGRA 1T7ZA 4HPOL 3MXWH 3O6MH 1FH5L 2PTTA 1GZQB 1UJ3A 1MY5A 2PO6B 1Z5LB 3KYAA 3MUZ1 4PYHA 3QUMB 1CGXA 3MOQA 1Z5LA 1QLRB 4GKNB 3IS0X 1JTPA 3U0TB 5D1QA 5DVOA 2VQ1A 3K1DA 5C0CE 3VFTA 3DHJA 3QO1B 3R4DA 4PGCB 2Q8AL 4TYUA 3X3GH 1N2RB 4O4YL 1IBGH 1KJMB 1ZT4A 1RZ8A 2Y72A 1IEAA 4EUPG 2VQUA 4HFUL 4YO0A 3PWVA 3SDXB 1I1YA 2CK2A 4ZTPH 1U8HB 1FNLA 4PJ7A 4DUWA 5E8DH 3UC0H 2LV4A 3E0GA 2VZ3A 3TM6A 3EW3B 3FN9A 4P46B 5F8QC 1VFBB 3TH2T 2E6QA 1ZT7A 3QQ4A 1D5ZB 4NC2B 3RGHA 3VFVB 1BD2B 4APQD 5FB8A 4OD1H 5GGSY 3SKOB 1ZLWH 3QUKA 1J0HA 1X6LA 3O3AA 4PRIE 2Q76B 4FTVA 5C0IA 4IRSB 1AGBB 4YUEL 1U6AL 4N1HB 1M1SA 2P5EE 1AGDA 3AMKA 4Y4KD 5E2VH 4F9PC 3ECBA 4GMTL 2OL3B 4XZUA 3DETC 1BEYL 2I60H 4PTUB 1BQHA 4R2GD 1I9EA 1EMTH 4NN5C 2NY4D 3CVIH 1MCFA 1J05A 3BZFB 3MRBA 4UQ2A 2E8ZA 3G5YA 4MNGB 3V95A 5IB5B 3ARYA 2LVCA 2VZSA 1XIWA 4QXGL 1RIHH 3NABL 1D7FA 4KKAD 5HI3D 5D7SH 5GRVL 1KCVL 2O5ZH 4PG9A 2FH6A 3TZVD 1RZJC 3D69A 3BWUC 4M7ZB 3IDXH 1WSST 3S3SA 5D2LA 3H9SA 3E6FB 4LLDB 1BQHB 2YA2A 5DXWA 1T3FB 5HVFB 4UNVA 2HRPH 5HVGB 2WWKT 4OLEA 5JW5A 4DUXA 1IGTA 3QQ9D 2A74A 4HIEA 1NCDH 3LN4A 3PWLB 1QD0A 1PX4A 3V52L 5E08H 1RZJL 4NO5A 5J1TC 1F3JA 1IT9H 1NC2B 5KVEH 1A3LH 3MZGB 5D6DA 5FECA 2V7NA 4PJCE 1NL0H 3LVEA 4KJYA 2JELH 1I9JH 3B5TA 2XNAA 2RJMA 3FAWA 4HX1A 1AHWA 5AYQA 4FQCH 1T4KB 4PDCE 5A3IC 3D1MC 4YDLC 1MHEB 3JWDC 1CFSB 3FHAA 4IOIA 5C0GA 4OI7A 4P5MB 3FQRA 4WEBL 1RK1A 4NZRL 2MCPL 1MCBA 1UCTA 1F4HA 2F58L 1G0DA 3BGAA 4KMLB 2H32B 4NO5B 4H0HB 4NWTL 2C3XA 2HFFA 3DO7A 1XF5A 5EOTA 1YJDH 4YXHL 5KVFH 1KGCE 5AZEL 3H3PL 3QXUA 1D6VH 1H3PH 2G5BB 3OJDB 2RCSL 3Q6GL 4M1GH 3HAEG 5C07B 2P48B 2R0ZL 4HKXB 5KSVB 3O6ML 3X3FL 3GHEH 4BSVA 1WFOA 3MV11 2VXQL 2X09A 2R2EB 3T3PF 5CAYB 1MCSA 4JN2B 3KJ4C 1QRNE 5IQ9B 3RPIA 1E6JL 4JM4H 4JZJA 4A6YH 3VFWA 3RZCD 5FO9A 1I8LC 4KI1A 2B4CH 1U42A 4MJIA 2GAZB 5ALBL 2DN7A 3QNZA 4K23L 5EUKA 4QWWD 4PG9B 3CFJA 3V4PH 4PV8A 3LKSB 5E0QA 4Z0BL 1HHJA 1KCSH 1OTTC 4LFHG 5IW6B 2NW3B 5J8OA 4KKLD 2X89A 5MHSD 2F53E 3C5JB 4PLKD 5KSVA 4O2CB 5EOCJ 5FYLL 2XQBH 3UTTD 1FHGA 1JNNL 1Y6NR 2VE6B 3W11C 5DVNA 5IMKB 3DTXA 1UXSB 1P53A 3CFEA 3IU3A 1NUGA 3RWGA 3S36L 5IQ9A 3S96B 4LVOC 4NJAL 2WINB 1M7DB 1CLOH 1N5AA 2DQDH 2CDFB 3C8KA 4H5SA 3WSQH 1AXIB 4BFGA 5KZCB 4HF5L 5HHME 5L8KB 4WFED 1QHOA 3D9AH 3RHWK 1QPPA 4JKPH 1P9MC 5KW9H 3PV6A 1ETZA 1KGCD 4NKIL 4FNLH 4TUOA 4IOIB 5C0AA 2A77H 3KPSB 5JW3L 1RUPL 3P0YH 5J12C 4NKMA 4MAYA 5CZXD 5FOJA 1EHLL 1IAIM 1P6FA 2J5LB 1TCRB 4Y4HA 4I3RH 5D7IF 1PZUB 4JG0H 3QT2A 4MB4A 2DWEA 3GSVB 2Z4QB 3JWOH 4GKZA 4MDJA 5DJ2B 3SE3A 1HYSD 2FDBP 2YD4A 3MROA 3VWKB 4PJXB 1AGCA 1A7PH 4XBEH 1HHGB 4Z7UB 2PTVA 1W72H 3HFML 4EJ1C 1C1EL 2HT2C 5SWZA 4M6ML 1LO2H 1RZFL 5EBGA 1PW3A 3UROR 3TJEH 1T6VN 5DMKB 4HW6A 2RHEA 3RVVD 5K9JH 5GZNC 4MYWB 5HDQH 4APQA 5D1QC 5I8KL 4NC0B 1S9VB 2D7MA 2WBJD 3FCTA 4YHPA 4WGVB 3HB3D 3VFGH 4JY5L 2VABA 4M43L 4OFPA 5D93C 2PKDA 3EYFA 2DQEH 1G6RL 3C08H 5EU3B 4PJEF 1PBYA 5L2JB 2R2CA 5JPNB 1ZHNA 4OV5A 1MHCB 5IEHB 3PXHA 5CD5C 3KAAA 5FAAA 3WBDA 2AXGA 4Q9CA 2CKBH 4G6FB 3P4MB 2NY2B 3FOLB 3FO1B 1H9VA 3ES6A 4M7LT 5DA4A 1CDJA 2VSDA 5IB2A 2BY1A 1BVKA 3G6DL 2YXFA 4ZTOL 3C9NB 3ULVC 5IVNA 1I7TB 4LAQL 3IDXL 4YK4C 4F80A 3UPRB 1JZ3A 4XNXL 1RZ7H 2WBJC 1A7NL 2ZSWB 2WSKA 3UPRA 2NY7H 5D7SL 2A6JA 3N06B 4F7EB 1OL0A 3T8XB 4ZUVB 2W9LA 4NP4L 3GSWA 1P4LB 4HWBA 2E8YA 4WI5A 2P7TA 1BZQK 4C4KO 4NKDB 4LVEA 3I6KA 3SN6N 3U9PH 3NPZB 3CXHK 3NCEB 1KJVB 3PIQB 1SYVA 5K93A 1KPUB 5T5FH 5H2BB 3LD8C 4PJDB 5SWZE 4HWZB 5M95B 2OBGA 1PKQE 2GSGA 2WP3O 1H15A 5IM7B 4Q0XL 4Z7VE 2EYRA 1ZA3B 3BGFC 3NN8B 3QWOA 5I17A 1UWXK 2I9LB 4YUEH 4E41B 2FR4A 4K8RD 2BHUA 1EUUA 1T5XA 3DMMB 2Q7YB 2YA0A 4Z95H 3TFKD 4OD1L 1LEKB 1AP2A 5IFAL 5EU3A 4IDJH 1XIWD 2V2XB 5DD1H 5INCB 5TFSH 3CLFH 3QHZL 4HJ0D 5SWZB 3Q0HA 3KPMB 4OCSH 3DV4A 2QR0A 5GISL 2F54E 1WEJH 3HAEB 1ZK9A 1P4IH 1ZS8B 1JHLL 3ET9F 1MCKA 5KANI 5ADPL 2VH5H 1U2CA 2W38A 4PJGA 1YN7B 1OAZH 4WFHE 1S7QA 2NZ9C 4Y4KA 3MZTA 1DQTA 4PJGB 4MA7L 2YPVH 1FAKT 3MREB 4Y5XC 1RUQH 3RA7L 5EIIA 4XCNA 2QSTA 4X7TA 2Z31B 3G6AB 4EZMA 1A64A 2HVJB 3VE0A 2ENSA 5EIIB 5C0DA 3EYQC 1CFNB 2A83B 5F9OH 1MQ8A 2DM7A 2P7TB 4N5ED 4OKVB 1C12B 3T77B 3KR3L 4A6YA 4HPOH 4MNHB 3VXSD 4MD5A 4K7PX 2VZOA 3QHTC 2Q86A 5LBSL 4YFDB 4KRLB 4WEMB 4AIOA 4C56A 3RL2A 1QLFA 2FD6L 2HH0L 4FQPA 1DSFL 3EO9L 2Z92B 4OZ4A 4KWUA 4ONHB 5F7DA 3VRIA 3RZCC 4QOKA 4RAHA 4XNZC 3HCVB 1MAKA 2R2BB 1RHHA 2JB6B 3ULUH 5DQ9B 4DN3L 1NKRA 4L8BB 2XFXA 4KQ3L 3GNMH 3WS6C 4M5YL 5E6IB 4AEFA 4HMDA 1XGPB 4GLRI 1VFOA 4IS6A 4NN6B 2BVUA 3QUZC 4X6DE 4Q9BA 1OSPH 3DX8B 3U4BL 5FO8A 1KULA 4FZ8H 5C9JA 3LH2H 3UBXI 4B53A 4PV9B 4YBQD 4PJBA 4TN9A 1TVBA 2F54D 3GJEA 5DURD 4PUBH 3OWEA 1DDHB 3C5ZA 4PJXE 4P5TC 3W39B 1FYTB 5DWUH 3SKNB 4U05A 4W6YB 2P42B 1I75A 4PJFF 2QEJA 5A16B 3CX5K 2MJWA 2FB4L 5DHVB 5SWSA 1ZHNB 4OFIA 3AB0B 1S9XB 3MBXL 3VD5A 3W11D 1BQUA 4G6AD 3QNXB 1UA6H 3MJ8A 2CSPA 1ZGLP 2ADGA 2IMMA 5ENWB 4XPTH 1SMAA 3GUTA 3N50A 2NY6B 3O6FD 4ZAKD 4D9RE 3CFDA 4TQEH 1PSKL 4EIGB 3ZDYF 3AY4A 4MJ6B 1KBGL 3AMLA 3O2DA 4HGWA 4CUCA 1KJ2A 1FL3A 4MJ6A 1A1OB 3G9AB 2DKUA 2H9GB 4ZNCD 3MRIB 2BVYA 2HJKA 3MV7B 3HE6B 3REVB 1T0PB 2R69L 1AXSB 1PG7W 3Q6FB 1ERNA 1FIGH 4LKXA 1DVFD 3QUMA 1F6FB 1IAIL 3VRLF 4FP8L 4S1QL 2XY1A 3S34H 3C60C 2PO6C 1RMFH 1Q9OB 5DEGA 3UPAA 5DD0L 4X4YB 2YKLH 5SV4A 2WUBL 4YIQA 3EZJB 1X5AA 3I9GH 4V1DE 3MRFA 1IAOA 1DQLH 4MJ5B 4JFXA 5CZVH 2R0WL 2A38A 3NACH 2XKNB 4G8IA 1QRNB 4KAQL 3EGSA 1GAFL 5JNYB 1IAMA 4JGMA 3ZYZA 4B0MM 1CD0A 2X5PA 3TZVA 5I1LB 3UTSE 1CK0L 1F02I 1MRCH 1FVEB 2EDNA 3SO3C 1F8TL 2BDNL 4X98B 5I66A 5J1SC 4KK6C 4HGKC 3X11B 2AQ1A 3EJYD 5EUOB 3T3ME 1ZT1B 1YN6B 1YYMH 3G6JF 1T3FA 4MVBA 1PYWB 4U1SA 3KDMA 3LS5H 4BSVB 4NKOB 5JXAH 5ILTH 5LVEA 3ARGD 2NX5B 5IMLA 3VWJD 4J3WA 4OQTA 3IU4H 4EI5D 4KVCL 1BM3L 5FB8B 3HMXH 5C3LD 2R1YA 4D0DB 3BPCB 3SKJL 5T3ZE 3TLRA 3LEVL 4OBSA 3MCLL 2FLRT 5L8LB 2Q6WA 1UXWB 4NQDE 3CDCA 1JWUA 2OJEB 1WZMA 2CIKA 4FTVB 4POUB 2ESVB 4MCZA 1FG2B 5DRWA 3SKMB 4NQDA 4HAGA 4BFIB 5T3XH 3MRQB 3ECBB 3M17B 4PRPD 4P3DA 1BFTA 4X6BB 2G2RA 1E0OB 1JFMA 4IJ3B 2IANB 3B6SB 2FBOJ 3MOBL 3WFCL 3LSOA 4LSVL 4U3HA 5EBLA 4V1DB 3WHXB 2V7NB 3QAZC 1E4XL 1BJMA 2AK4E 4C57C 1GC1C 1JGDB 4K7PH 2P24B 1NMAH 4I0CC 5FM4A 3IJHB 5CEXB 1N26A 4FFZL 4PLJD 1HH6B 5CEZE 4U6XB 2CKBA 3CJJA 3P9MB 3MXVL 5MERA 3M07A 1AIFA 4YHKL 3NA9L 3QUYC 1X5YA 5I1GL 1A6WH 3GIVB 3FQUB 2NTFA 2A73A 4FFVC 3LIZH 3RBSA 5IF0A 3GGWA 3O2WH 2EYSB 1R3JA 1OSZA 5E8OB 5I0DA 2ADIB 3KWWB 1FGNH 1V3KA 4QOKD 4K9EC 4I0PA 4M7LL 2BHYA 4NQDD 2JJVA 1LO4L 2VDML 1L7TL 5IFHL 1BJ1J 4Z6AT 1C5DA 1XF2A 1JPFA 2C3GA 3TYFB 1I8MB 3BDXA 2BOCB 1TVHA 2DLGA 4Q74A 5I16A 1NDGA 2VTFA 3PF2A 1J05B 3F12A 4UQ2B 1KN2L 3JUZA 3MLUL 2YBRB 3CFIC 1IZJA 3BSZH 1UEYA 1F4WL 1I7UA 3IFOB 4ZPVB 5DTFA 3OKLA 2H8PB 4CVZB 5IROC 1FBIL 4Z8FH 5B21A 3VWKC 3WFEH 1MFDL 3S6CA 1G6RB 2HLFD 1MHCA 5IEHA 4ONGH 1IJ9A 4KK8C 3I2CL 4G59A 4X99B 1WZ1L 1WFUA 1VACA 4RMTA 3I75A 5B3JE 4FXGB 3BH9B 2NNAA 3OAUH 3DO7B 2Y36L 2FEEL 4LF3B 4Z76B 4GMSH 4M93B 1AR2A 1XH3B 4PJ9D 5I1IL 2BVOA 3LKNB 4KK9D 1JPGB 1T5WA 4X6CF 4NWUH 4TVPL 5E94A 1OW0C 3PWUA 5BS0B 3L1OH 5BW7C 1XF3B 5IK3B 5J9PB 25C8L 5C6PB 5C08D 1HI6A 2V9QA 5D2NE 4OLXH 2OXHA 4HC1L 4NQCB 4X6EA 2NR6D 1I85A 3WO4C 5C2BL 2Z8WC 3J7HA 4F9LA 2X89D 1N5YH 5LWYL 1U91B 3RWIB 2FWOA 4P2QD 3EOTH 3T0BA 1GPOL 5EUOE 2VLJD 3IDJA 2DQIL 3IXTA 1R3LB 3KPQA 4MGXA 2EYTA 3RKDD 1FE8L 1UYWH 2A73B 4NQEA 3UAJC 2CJUL 2WM0A 1GVIA 3BH8A 5DEFB 3NH7H 5LGHL 1GJIA 3MACL 1IAKA 4FQLH 2X4SB 1NBQA 1QSED 3BDYH 2ZOLB 4QHKJ 4Y2DD 4R0LC 5I1DB 4IMLB 5F89A 1KCGC 3QQ3A 3E2HA 1NJ9B 2DRUA 2ZUQC 4G8GD 4P9HL 2UUDK 1KIUA 4K3HA 2C1PB 2ERJB 1FNEB 1MLBB 1YEIL 4P2YA 1J1XH 4WI8A 4BZ2L 2GJ6D 3FFDA 4G6ML 4J8RA 4JANB 3D6GA 2V5MA 2VXTH 2OI9B 4NZJA 2I26N 3HNTH 4IRZH 1JRHL 4CJ0A 4IRSC 4L3EB 5J7CC 4RAVA 1YPZF 4F9LC 3V6OA 2OI9C 4AL8L 3HE7C 4M5ZH 3RVWC 1DE4A 5I30L 4Q2ZA 4TTGA 4ELKA 1XCQA 3QISA 4JZJC 4GSDH 4N1CA 3VXMD 2XWTA 3L3KB 1BFVH 4MNGE 5IVXA 4HBQA 4U6VL 1MVUB 5CILL 3VFRB 4PJDE 3LN9A 5I9QB 1YEFH 3CDGA 5E24E 4WU5A 4DN4H 4R26L 5C08E 4TOYL 4K8RL 4MZ3A 4KRMB 4EI5A 5E6ZA 5DFVD 4HHAA 4ZQKA 3WUWA 2VLJB 1WWBX 3KPOA 3EDKA 4W6XB 1Q0XH 4OAWA 2ID5A 4DAGL 4RRPG 3T0EC 4GBXC 2D03H 1E6OL 1NCCH 3IXAA 3ARFC 1BD2E 3SDXF 2OQJB 4ODTH 2BC4B 2V6HA 1PVHA 5DUMH 5KSBB 4FFWD 3FL7A 3QIWC 4OZFG 5IKCA 2AKRA 4UDUB 5HDBE 5C0DB 1IL1A 1EFQA 2AXGB 1HHJB 1MCHA 5FF6A 5FGBA 3I3EA 4K3EL 1WCBA 5IB4A 3ULVF 2MKWA 4JFZH 2BJML 4M4PA 4RQQB 5EU7E 1NGXA 5JLZA 2R8SH 5F7HA 1HYSC 5JHLH 2CIIA 5K9KB 4JHBA 1HQ4B 1KCUH 1C5CH 1KLUA 1RV6X 1I7ZA 1JFQH 3LQAH 4HWBL 4FZEH 1XR8B 3GSNL 3O3UN 2FIRT 1VFUA 5F7DB 4PGDA 1IZKA 5IFJA 1AP2B 2AEQH 3L7FA 3UJTH 1MLBA 1NFIB 2ITCB 5E1AA 3D3VE 5FHBL 3AGVA 3QCVH 2HFEA 3W81A 2ZUXA 9CGTA 1AD0B 3WL9A 5DK0A 5GPRA 2Q86B 3KLHD 4GAYB 1TENA 3JV6A 3KYNA 5DQJB 2RR3A 2EC8A 2HJLB 4OV6F 3CXDL 2GW5A 32C2A 1MIEL 1NAKH 3KJ6L 4NO0D 2Y6SC 5I73B 1J5OH 5FOBA 4XTRC 1UENA 5EN2B 3DGGB 1DCLA 4KQ4H 4K7PY 5KSAD 2A1WL 4LBEA 4LSTH 1YUHB 2H2PC 5I17B 2GFBB 1FZMB 4E9LA 1ADQH 5HHPB 3L7FB 4Z7QF 4MDJB 5DZLA 2W0FB 4YBHA 5CEYA 1KPUA 2FLBT 3QIBC 5KJRH 4UQ3B 3INUH 3SE9L 1B88A 5DJYA 4KKLC 4QT5B 5CBAA 1LNUA 5K9QI 4ZFOL 2H41A 2VZUA 4EIZC 2X1OA 2VO5A 2AI0H 3WE6B 2IG2L 3IXAB 1K5NA 5I1KH 1HQRB 1T2JA 3I50H 2JCCE 5ACLA 3DMMA 1R3IL 2CUMA 3P3YA 3MLUH 2APTA 4JR9H 4K71C 5B38A 3GKZA 1EAPB 3DBXB 3PHQA 3HE6C 3BT2H 1MHHB 3RGVB 5HDLA 3NZ8B 3VU2A 2AJZB 4KMTL 3RIAF 2EXWC 4HBCL 3WIIH 3R06A 3D48R 1OGTB 2Y5EA 3NIGE 1KEGH 3MMEB 4DVRL 3VWJC 1BD2A 4FQ2H 1TTFA 1EXUA 4YLQT 3CFKB 1RUMH 2B1HH 5C09E 2F53B 1H8NA 1OAKH 2AEPH 4M62H 4PJEE 4UB0L 4OZ4B 1SJVA 4LHUA 5D7LA 3CFBA 3WE6A 1W0WA 3FT4B 4P5TD 4PB0H 3PABA 1TZHB 2HN7B 4N0YH 3VH8A 3VE0B 5I1GH 2ZZUT 5DQ9A 2W0KA 4KTEL 5C08A 4YHKH 5IIEB 4ZS6D 1IGIL 1XGTA 2WY3A 3QFDB 3ARZA 4N90D 2Y07H 1HINL 5FUZL 4ZXBA 4I18C 1JWMB 1A9BB 1FFPA 1HHKA 1OAYH 3D0LB 5IR1A 1IEBB 3QCVL 1NLBH 3PP4L 3RX8A 3GSRB 5L9DL 5C86A 3QQ4B 3BGMB 4XC3H 3KPRD 3QPXL 1AHWC 3QHFH 1N59A 4PGJA 4JHWH 2ICWA 2PN5A 4QY8B 3VG0L 3MRJA 2RQ8A 1C5CL 2PCPA 2AW2A 3C6LC 1IEAB 3VFOB 2AEWA 2P5WA 4BJLA 2FIKB 4UV7H 4O02H 2NXZC 1PEWA 1CQYA 4XVJL 1ZHKB 3LHPH 2IQAA 4RGNB 5LGJB 4WUUE 2Z8VC 4K3EH 4NRZA 4YPGB 3TBWB 3R0NA 4N0CC 4ZYKA 4ODSL 1F42A 1G7JA 2H3NA 4GW1B 3TVMB 3BN3B 3NOIA 3O2VH 1TJIH 2EDRA 1ORSA 3MV8B 1EEZB 3BX7C 2VDNL 4Y89A 4PB9H 4QEGA 5ACZA 3WIHL 2X9XA 1DBJH 3BP7A 5DUBB 2A1WH 2QSCL 3QDJA 3T3PE 4PJ8A 1ACZA 4QF1B 3FZUC 5SWZD 5EU6D 4Z7UE 5F8RC 3VXOB 4EUPH 2DQJH 2JTDA 3KJ6H 2EH7H 1G1YA 1NAKL 2VYRE 5C0FB 1MFBH 5ADOL 3JV5A 1XGPA 2B2XL 1JWUB 1P2CA 2CMRH 4LQ1A 1R24A 3Q3GA 1RURL 1DVFA 4OLVL 1JGEB 1II4E 1Q9LA 1WC7A 4E41D 1GGIH 1BMGA 1VERA 5E8NA 5CGYD 3C5ZC 3MLVL 4KTDH 3BAEH 4XTRD 2RGSA 1MUJA 5DMGC 5F93C 1BWMA 5DD5L 3NIFF 5ID0B 5TQ2H 1BOGB 3GMRB 3SQOH 4NYLB 1DN0B 3GMRA 3KLSA 1QVOA 2UY6A 5EOTB 1I7UB 4H8WH 3DUHA 4P23D 5A40E 1RK0A 2WUBH 3IDGB 1OWWA 1H3VA 2ZOKA 3W0WB 1ZANH 4CW1A 4AEIH 2DI9A 4WUUD 5JORA 5H94A 4QT5A 3FOMA 3IFLL 1WC7B 3DWTA 2P5EB 2VLLB 2OTUA 3DRQA 5M94B 4OZGB 1G7MA 4OLZH 1UGNA 2OR8A 4I48B 4M4RA 4XH2B 1BZ7A 1NCCL 5DJAA 3WKNA 1VA9A 5C3TA 4L4JA 3JZ7A 3QIUA 1FJ1A 4QRPB 1Q0XL 4Z7WA 5DRZA 4KXZH 1B6UA 1M71A 2FGZA 1RU9H 3ZKND 3GGWB 4NCC2 1KBGH 3OX8A 1YYLH 2D31A 1OP5K 4YDVA 2BVPA 2VDRL 4HG4K 1MCQA 5F7WC 3VI3F 4Q9RL 4G8FB 3KWWA 5HYSG 5DMIH 4HJJL 2DQTH 4P5MA 3MRPA 4J3XA 1JHKL 3SGDI 1JCKA 1FO0L 4YXLL 1EO5A 1ZMYA 3AVEA 4HIIB 3L3DB 3QFJD 5L7XH 2OP4H 2IBGA 3HNTL 1WZ1H 5L8JB 1JVKA 2WINA 1VENA 4JY6B 1NSNL 3MV9B 4JHZA 4JKLA 4CJ1A 3OR7B 3ZDYE 3VFUA 1MCIA 1DP0A 3MLSH 4OD2B 4WTWA 1HZHL 4RMUA 3VMNA 4PRBA 5BZWB 1A6VH 4XVSL 5HGAB 3BSZL 4LSUH 1AFVH 2B1AH 3MRQA 3QXDB 1W72A 3V79C 3SDCB 4ELMB 2VDPH 1N7ML 4M1DL 4MS8C 4U1KA 3S5LG 4JO4L 3I02B 1MF2L 4LP4A 2VL4A 1LEGB 1I1AD 4NGHH 5IB1B 1ADQA 1DLFH 2JJTC 5E6YA 5HI4D 3BMWA 3GO1L 1RPQA 5IB1A 4WV1B 5DT1L 3BH9A 5DC9B 1X4YA 2BNRA 1FFRA 3L3OA 3UDWA 1XIWB 4Y2DC 3EO9H 5DHYB 3FOMB 1IM9A 3SGEI 2A2QT 2FD6H 2HH0H 4UV4H 1TMCB 3TO4A 5C70A 3WO4B 4MD0B 2B0SH 3L5IA 3ARDD 4S1DC 3TF7C 1P7QD 3B83A 4JFOB 1MY7A 2DQFA 4XP4L 5BVPH 8FABA 4N8VA 1A6WL 3QSKB 4KROD 1M7IB 3B43A 4U1KB 4X6CA 1RIUH 3EOAB 1I1RA 4GMSL 2J8UB 5T1LA 4ZXBD 4QF1A 3VXRA 2EDDA 4DGIH 4MA1B 2GAZA 1X7QB 1NDGB 2DS4A 3LRHA 4TUJB 5C0FA 3TJHD 3CSGA 4FN0A 4YWGH 1MAMH 4DK3A 4LVNC 1NMAL 1QPXA 2BP3A 2J6EA 2FSEB 3PDDA 2GUOB 1QLEL 5GRUH 1LILA 1T89C 4JFEA 3MROB 1E4XH 3B9KA 4MA3B 2OTPA 3HPJA 5E2TL 2X7LA 3WFEL 4JQVA 5C07A 4JHAH 3E3QA 4LSSH 5DUPL 2W60B 3VFMB 3QHZH 3GM0A 4UTBH 3IDJB 5JOPD 3WDJA 4WW2B 1ZLUK 2P49B 4HS6A 5KSUA 1CG9B 1D5XA 3QRFM 2IANA 2HP4A 4ZSOE 1PY9A 1Z2KA 1JHTA 1SYSA 4J6RL 3VRJB 1Y6MR 2ZCKH 1RZKH 2LAGB 3KPLA 2PXYC 1HKLL 4ZD3L 2EO1A 2JCCB 4HS8L 5F7NC 3LEVH 1OHQA 3B3IB 3B4NA 3MJ7A 5LCVH 4R4NC 3SKJH 2EIZA 2ZNXA 4XAWH 2IPTH 1QHPA 4X6EB 4I13B 1Z9MA 4KVCH 5HJ3B 3WFZA 5F7FA 1UACL 4S2SB 4JQVC 1JPSH 2AGJL 1J11A 5IBTH 3B9KC 1RAMA 1RZIB 4XPHL 5JQHC 1EUTA 4I2XB 1T5WB 4NZUL 3TV3H 1H0DB 2FJHA 2Y5TA 5IGXH 2BMKB 4LQFL 1QBLH 3MSPA 4IBLT 1MI5D 5CGMA 2OR9L 4APQC 3MRLB 2FR4B 3GSNB 3MGTB 5BVJB 5EU5A 5TDPB 4PY7B 1XEDA 4HG4J 5FYJH 5DFWH 4WHTB 1N0XH 1TZGL 2VAJA 3H9HB 1J0JA 3MNZB 4NHCL 3BP6B 3U48A 3MRKA 1INEL 3ULVH 5C0RH 1B0GA 4ELMF 2YEZB 3QDGE 3O9WC 1HCVA 2G60L 3BPLC 4JG1H 4NN7C 4JVUA 5ID1B 4JRXB 3BE1L 4D9LL 1I7TA 3HI6L 3UYRH 1MLCA 5IJKC 5KTEL 2R4RL 4NOBA 4YDLB 1SJXA 5T1DL 1A2YB 1PG7L 1QRND 3PHOB 1MAJA 3ARBA 4YHIA 5B38B 2IPTL 1G7PA 5EIQA 1DQJB 5DJ8B 1YQVL 1LO2L 5HGAA 2W0FA 4P2OD 3OTTA 4DJMA 2XI9A 5HVHC 3K80A 5DVLA 4HWUA 3VFNB 4QOKE 3U0PB 3N1GC 4R2GC 5D96B 3TGXA 4NT6A 1BM3H 1UB6B 3MOAH 5GS0D 5HDBF 4J6RH 4TPRH 4NUJB 1CF8H 3G5XA 3VXNB 2R0KL 5AAWA 4RBPH 4TULH 4XNUH 3HR6A 43CAA 1JIBA 4P46D 4P57A 1UT9A 1DBBL 2JIXB 4WHYG 3S5LB 5IQ7L 4L8DB 1A7RH 1CDBA 1JNLH 1KIQA 2WIIB 5E03A 3MRRA 1HWGB 4H1LH 4PG2C 1Z0NA 3QEHA 4LVHB 4LLVB 1G7QB 2DDQH 2N4IA 4ODWA 4EXPX 3BZEA 2PO6A 5BRZE 3GBMH 4WW2F 1EJOL 5KSAC 1I7ZB 3EO1B 4OCLC 4XPFH 3BHBA 1F2QA 1HQ4A 1KLUB 3OZ9L 4HH8A 5AD0B 4XNMA 3T0DA 5FV1L 5GRWA 1TJHL 4N1EA 2N56A 5BJTB 4DTGH 3BVNA 2ITDA 4QHLB 2DIAA 4WUKH 1BAFH 2BSED 2LTQC 4YDKH 2BSSB 2BNUB 4JO3L 4L3EE 3SGEH 3CPLB 4UMGA 5T1KB 2J5LC 1LP9B 2NY6C 1EIBA 1MRDH 3L3GA 4G7YL 5D7KD 2M8XA 1FNGB 3TWCH 3WJJA 3CFBB 2X4RA 2B8OT 2X4OB 4U7SA 5E56A 3SCMB 5SV3A 5TH2A 2L4OA 4NQTA 4DOHB 2I9LA 4IOSD 1IARB 2NXZB 5GS1A 3EJZD 5TQ0H 1DQML 3OQ3B 3ULUC 3QDME 5GS1B 1AKJB 2X1PA 3KXFB 1MJ8H 2W07A 4RMSA 4OLWH 1QFWH 2EH8H 1A3RH 5T5NF 4MXQA 3U4AA 4PV9A 4ODXB 1OPGL 4X4XB 3TN0C 4ZFZA 4EI5B 1NSNH 1NDMB 4BZ1H 2AABL 1CICB 1U3HB 4HIHB 4YXHH 3QUZA 3QUXA 2ATPB 1T0MB 4OF5A 4J12A 5BRZD 4UDTB 2BOBA 5BS0E 4CDHA 1TDQA 1UWEH 4PUBL 5TJWK 5BOZG 3R06B 4P2OC 5BJTA 3OHXB 2JJUA 1AQKL 2OZ4L 5GISH 3MUHL 4YDIL 1O0VA 4PY7A 5EWIL 2KH2B 1T22A 4LCCC 2P4AB 2DLTA 2VKWA 1OTSC 2QR0B 3O0RL 4C55A 4Z95L 4JRYB 1NCBL 3QXAA 4S11A 3O11A 4QRRD 1P9MA 3ZE0E 4ZFFA 2ICWB 3MOAL 1S9KC 3QDGA 5DZOA 5F3BA 1R3HA 4B7IA 1U3HC 1BHGA 1QOKA 1V3MA 2DIBA 4S1SH 1YUHA 3HG1D 3VXPA 2HG5A 4PJFA 1HE7A 1FFQA 1MRDL 4G7YH 1CFSA 5E2WL 1NCDL 1GHFH 3O9WA 3I6GB 2OCFD 4PTTA 4CRPA 1S9XA 2XT1B 1YPZA 2V9RA 1NANI 4K3JH 4GQ9H 4AENA 5JPMB 1QSEA 1INQA 4M7KH 4X9FA 5HY9B 2O93L 5FK9A 4NNYB 4HXBL 4KMQA 5GSVA 4ODVH 1XGUB 4G8FA 2F8OA 5LKNA 4H8WL 2ED8A 4E5XA 4MHHI 4Y1AB 3T0WA 1RIHL 3SQOL 5MENB 3E8UL 2M1KA 2GT9B 3AXLB 5GRXG 5EPMB 2WBKA 1RUQL 5DD3H 4ZNEE 1HDMB 2V7HA 5F3HA 5LQBH 5IIEA 3F6LA 5ISZE 2R1WB 3G6DH 1TZGH 4LPCA 4NYLA 1M4KA 3PJSB 3QUYB 1NGZB 2JJSC 3BAEL 2IH3B 1CXKA 4L8DA 1FJ1B 3IDUA 2CO6B 1XZ0B 3MLVH 4R4ND 3W2DL 3EFFA 5BOPA 4CN6A 4OIBA 3FB8B 4K3DL 2DM4A 4RBPK 3Q1SH 3EYQD 1WEJL 4LSQH 4FFWC 4AK1A 4CKVX 3JVGC 1AQDB 2V2TB 1NAMA 4NM4H 3TZVC 3T4YB 4I3SL 3L5HA 1QBBA 3QUZB 3UO1L 1J86A 1U8LA 3RAJL 2R0KH 4HMEA 3WD5H 3U2SB 4HS3A 4ZPTB 4OSUL 3D5OF 1SMOA 4P49A 3DURA 1OAUL 2NY4C 3S7GA 5JTWA 4J3OC 2DQHH 3WIHH 2R1YB 2YN5A 1RZFH 4PB9L 4NSKB 4QRSA 5CJXC 1Q0YH 1UXSA 3CFEB 3IU3B 4LP5A 4WV1A 3RWGB 3S96A 3V6ZB 4HS8H 4MX7B 2YD5A 5T5FL 1OAUH 1RZKL 1MI5A 1SJHB 4IRJB 2VAAB 1ZOXA 4G9DB 1T20B 1Q9LB 2XRAL 3ESVF 1FZJA 1FZKA 4PRAA 5EUOA 4ALAL 3HNSL 1FVCB 2NY6D 2AXFB 4POYA 4FTVE 1T0NB 1KLGB 3WNMA 4HKXA 1HNGA 1I1YB 4OZFB 3PNWA 4BSWA 3MXWL 4EN3C 3VGBA 4JG1L 5I75B 1KJMA 1ZT4B 4LOUC 4UTAH 4PJIE 3QUYD 4OGZA 1INEH 3ULVL 4LNRB 5JMOC 3QEGL 2GSIA 3PL6C 1NFDF 4HIIA 4CN1A 3PWPA 3QHFL 5DRNB 5KVGH 5KW9L 4OBRA 2PR4L 2X4QA 4XNZB 1FC2D 4R97C 5LQBL 3EYVB 5IW1B 2AQ3A 1IQWH 2XNAB 5E4EC 4ZUSB 3VFUB 3DVNA 3V5HB 4ZO9A 5IGXL 1DTUA 1HH6A 5C71A 2OMNA 2QJDA 5C09A 1MHEA 5F44A 1N6UA 3KPSD 5ALCL 3A6BH 4JANA 4ETQA 5JHDE 4R4FH 3DXAD 3QXWA 4M7KL 2GSIB 5I75C 2XIDA 1EERB 5KAQG 4PB0L 3I75B 4XAWL 5FYLH 5EBLB 4M02A 1F6AA 2J88L 3CVHB 2FEDD 3TJEL 4QXUL 1RUML 1U3ZA 2PUQT 1F3JB 3ARUA 1VGEL 4X9HA 2P24A 1A7PL 1NC4B 2ZCKL 4MAYC 3RWJA 5J89A 3U30B 4QRPE 4PRAB 4TNWF 1ETZB 4PRPB 4NGHL 4D0BA 4NM8L 4LKCA 1E6JH 3LDBB 4JFOA 2EXYC 2C7UA 4FS0A 1MJ7L 4HCRL 3TC9A 4LSRH 3RVUC 1T83C 1UEMA 4NKOA 4PS4L 3VFWB 3X3FH 2HT3D 2OX5A 3L7EB 4JHAL 2AI0L 2PF6A 3K46A 1VGKA 2R9HD 2C26A 3V8CA 5ACMA 5DO2D 1U3HD 1P7KB 1U8NA 1UADC 1KV3A 1KB5H 3Q2CA 1IRAY 2WLZA 3TCLA 3WMSA 4X8JA 5CKAA 1FO0H 4PJ9B 1HXYB 3MYJA 1UG9A 1C5DB 2HFGL 3UJJH 2F58H 4FOMA 3QXDA 1OLZA 3UTSD 1ADQL 4P4RB 1WT5A 4OLUL 2CRIA 4OF6A 2A9ML 3X17A 3F12B 4NUGH 2AK4A 1GGBH 3WFHB 5CJ8A 3LAFA 4JZJB 5J06A 4X4ME 4YHPB 4HH9B 4S0TD 4DKAA 2B0SL 2XQBL 4U1JB 3S4SB 3M45A 1NBVH 4GG6E 2IH1B 3WXVH 4NCDA 1X4XA 1XR9A 1FYTE 4MVBC 3HZMB 4EQ2A 4M8QB 5DLML 4X7SH 4CDGC 1Q8MA 5DI8B 1T1XA 3H7BA 5KS9E 4RRPA 4D0BB 1R5IA 3WHE0 5LJYH 4PP2A 3QI9D 4LCWB 4MLIA 1BFSA 1FO0B 3MLYH 3SQBA 3UTTA 4X6DB 3P0VL 3WUWG 4XCCL 4PGBA 2YC1B 2E3VA 3KPRB 4HKZA 4JO3H 4PJAA 2A9NH 2G9HA 1J1PH 3LN4B 2LU3A 5JHLL 2J6EL 4I8DA 3U36A 1CGSL 4LHJB 4NQED 1HZHH 1XF3A 3OPZH 5IK3A 5GIRA 4K07A 3W5MA 2FCBA 1FFNB 1D6VL 4R96B 4JPIA 4MA3A 3GBML 5FGCE 1U8KB 1JK8A 4X0KA 5L7XL 2X05A 4GG6F 1LE5B 4DFIA 5IEKA 1XCTA 1CXEA 4KTDL 3RWFA 1JHKH 1FNHA 1X44A 3VXUA 3FO0H 4DAGH 5DGRA 3MLWL 1NEUA 5DMIL 2Z31C 3HB3C 4LF3A 1A7BA 3U83A 4Z76A 5JOPE 3QZWG 1GOFA 5SWSD 5HD8D 1U8IB 5L88H 2GUOA 2I24N 4OFYD 4WUUA 3BZ4B 5CS7A 4UIKL 3OV6A 5DJCA 2APWA 4FABL 5AEAA 4ODUA 5B4MC 2X4TA 3MNZA 3NGBC 3PP3H 2XFXB 1QNZL 4FQIL 3U1SL 1GZPB 4OZFH 1IT9L 3OG6B 5E08L 2YRZA 1LP9E 4RMQA 2F54B 3WS3A 2EEBA 2R2EA 5IVXF 3F7YA 1R3KA 2YOCA 3IDYC 1IAII 1AGFB 5B8CA 4FHBD 2Q8AH 4OCXL 2P45B 3QO0B 4I2XA 5EO9A 3BUTA 4Z7NF 4OFKA 2BZDA 5KTEH 1B4RA 4K94C 3QDMA 2DQGL 2F74A 4GFTB 3O2DL 5EH1A 3DI2B 1J1XL 4NQEE 5TDOB 4BZ2H 4Q7DA 2WMPA 4RNRB 3OKOA 4P9HH 3CX2A 1U8MB 4F2MB 3O41A 2G60H 4QXGH 1OGAD 1WTLA 3P4MA 4JFHE 4X6CE 5EZIH 2Z91A 4NHCH 5MEQB 4JHWL 1EMTL 3QIWD 2EDFA 4K94L 4PREB 3QPXH 4IMKA 3K2UL 4K71B 2I60L 3CK0H 3MBEC 2W0PA 3CFDB 1IC5H 2PYED 3ARBD 1CGUA 12E8L 1CFVL 2GI7A 3K8KA 1N5YL 2R1XA 5BZDA 1OCWH 4AIZA 3ZHLA 3OXRA 3FN3A 2EC9T 1OP3H 7FABL 3KLAA 2ITDB 1JPSL 2ZSVA 5HHNA 3SO5A 1A6ZA 1G7QA 3FT2A 4Q6IC 3MNVB 1OT1A 2HTLD 3JV6B 3KYNB 1QO3A 2BNQB 2QSCH 4YAQB 1ZVHA 4AY0A 5E8DL 3UC0L 4DK6A 3QJHB 5LCVL 1QO3B 3S3PA 2B1HL 4LRIA 3MR9B 3BRFA 2MWCA 5GHWH 1TZIB 1VADB 5JDSB 3RTQC 2FEEI 1PKOA 3GSOB 1IGYB 1C08B 2EDOA 2AJYL 3TF7A 2IH1A 3QEHB 3S35L 5SWSB 1KSRA 3LEYH 4RA0C 4G8EB 1YNKL 3DMMD 5DC4B 1KIQB 3DYPA 2AV7A 4MSWA 2J3SA 2YXMA 3O8XD 4XVJH 1A9BA 4O02L 4J3SA 4NFBA 3TPKA 1AGEA 2M26A 3F7VB 3CFKA 2CLVB 2CKNA 2ENYA 3W5NA 3LMJL 1KN2H 2ICWJ 4Y16D 2AS5M 3WJJC 1HIML 1A8JH 3IFPB 4JZNA 4OF3A 1HYRC 3ZTNL 4GAJL 1NFDA 3PQYE 3MA9L 4JPVH 1C16A 1DUZB 3ME0A 1A9EB 4LCCB 2Q7NA 4L8BA 3QFDA 4L5FH 2GTWB 4QYOB 1DN0A 3VXOA 3DMMC 2IF7A 1EGJL 4OGAD 4UAOB 2GTWA 1J9CT 4I0KA 1CE6B 4NO3A 3MRNB 1HOCB 4MD5B 3HHRB 3WUZA 4S1RL 1VKXA 4QRRA 3KHOA 4U1LB 4PJGE 1W0WB 2EEAA 4MQXC 1EEZA 2GY7B 4C56B 1PX3A 4JRXA 1J5OL 2H3NB 3TVMA 5D7KE 3NA9H 4UV4L 3SCMA 3IF1A 2VQ1B 4TUKL 2AEPL 4UB0H 3OKKA 5EPMA 1YY9C 2QKIA 3WFDL 1A9EA 1AKJA 3DVIA 3IJYA 3NZ8A 1I3GL 5HHPA 4XXDB 1B90A 4Y19D 4OI8A 2XQYG 4L1HA 1IC7H 1G0XA 3GMNA 4OGAC 2WBJB 3V5KA 4O5LH 1YZZA 4ZYKB 3V0AC 5IESH 4AENB 2E7LE 1PKQA 3F62A 4ZFOB 4KROC 4Y8DC 1J8HA 1N8ZA 1NMBL 4FMKA 3P30L 4XPAH 2NMSA 1F58L 1PKQB 32C2B 2IQ9H 1FLRL 1WTGT 1YC7A 5F7EL 3CMOH 3RWHB 2FL5A 4TSCH 3VXPB 4G43A 3H9YA 2VC2L 3NN8A 3QWOB 3UJIH 4KHTL 3V0WH 2H9GA 1FRGL 4QTIL 4XAKD 2YUZA 43CAB 1NUNB 2DI8A 2W9EH 4Y4HD 3PQYD 2YPLD 5BS0D 1UZ8B 4HZLB 3DPBA 4LPWA 3RU8H 4YXLH 1QA9B 2DQUH 5D9SA 3RUGA 4X80L 3UYPA 3VXUD 5HHMA 1QFUH 1JGLH 4JO2L 4UT6H 2N7AA 1I3VA 4CW1B 1KUMA 3GB7A 5IHUH 5GJTL 2D7PA 1V7ML 1YN7A 3TO2B 5D1XB 3CUPA 1F3DH 4IRSD 1UCBH 4G9FB 4S10A 3UTSA 3ZHKA 3CCHB 3O3DA 4FQQA 4RIRB 3LQZA 3DURB 5DHVA 2XWBA 5GZOC 1YYLL 1N6QH 2P8LA 3LS5L 5CILH 2IAMD 2IGFH 3T1FB 1S7RA 1YYML 2NXYD 2NX5A 4YE4H 5IMLB 3SJVE 3HG1E 5DDHA 4U1NA 1MHHA 1A21A 5ICYA 1JWMA 2A74B 1J0IA 1YEHL 4NHUB 2X70B 1HCFX 3NZHL 4M6OH 3LKSA 3QCUL 3FQXA 4JDVB 2IBZY 3D69B 1AC6A 3FB5A 1HH9B 5FHAL 2OS7A 4Z18A 3W0WD 4RFEA 3DROB 2XWBB 3QUYA 3OKEB 4KKCD 5F7MC 4LDLB 1JTTA 4KDTA 1P4BH 5F1IB 4YXKL 1Q94B 4M9OA 4QHNA 4RWHA 3TA3D 4YR6B 5ICYB 4I5BB 5JIKA 1IC1A 1IGFL 3QJFB 2MQ3A 3BDYL 1IEHA 5TQ2L 5FHAH 3QIUD 2W91A 3C5SB 3U6RB 1YEKL 4BQ6A 5JOFA 3L3OB 3UEZA 4WO4B 1T2QH 4HT1H 5DEGB 3WCYA 2C5DC 3ARSA 2AJXL 1NGQH 5BZWA 1AGDB 2EDLA 2CLVA 3I6LE 2D03L 2GT9A 4IRSA 1JNHB 3BO8B 4LGSB 3TBSB 1ZA6A 4LAJH 5HHVH 3SDDC 5CUSL 4XI5D 1F6LL 3AREB 4HQQL 2CMRL 1IC4L 1RK1B 2KBGA 1TVHB 1MHPH 4RAUA 5ICXB 3BEVA 4Q6IB 1RIVL 3GIVA 4R26H 5K9OA 3RY4A 3L1OL 1KCLA 4G9FD 3UZQA 1M6OA 4Y5XA 5ISZB 2CLRA 5IT2L 1KIPB 1FV1B 1DBJL 1B0WA 2JCCA 1QRKA 3DXAA 5ENWA 5I74C 4GRLB 4IMLA 4RWYH 4Y1AE 5F89B 1SY6L 2BVTA 3RDTC 4KRPB 5I19L 5EBMB 2X7LB 4Y4FC 5I1HL 4WHYH 2BVQA 3V7AE 4X6DA 5MERB 3OKKB 3GHBL 4OLYH 4XNQB 1H3UA 2O5XL 3W0WE 4WVRA 2A6DB 4LDOB 4PJ8C 3SDAB 4G6MH 3F7QA 4EQ3A 2AK4B 4BQ9A 3PWPD 2APBA 5IHLB 5IB3A 4UV7L 4G42A 3MRHA 2BVPB 5F7EH 5JMRA 1ZHLB 3SDXE 3LH2L 3VA6A 1FLRH 1KB9J 1CDCA 2J8OA 4JFEB 3AY4C 5CINH 1WAAF 1W0VB 5I71B 4PJ9A 2CJUH 5FYJD 3S3JA 3T0ED 1UH2A 3G6JA 2XZAL 4PRDA 3HUJA 2X6MA 4JRYE 1JNHA 3BO8A 4WW2C 2R15A 4D8PB 4CNIB 2D9QB 2IWGA 4RISH 5D1XD 4RGMC 1JNJA 3M17A 1KTDB 4KVNL 1M7DA 4JN2A 3GJFK 5E7FA 1BOGA 5IBUB 3IFOA 2IBZX 2XTJE 3DO3A 1KNOB 1OB1B 2SEBB 5EU6E 1HHHA 1H0DA 3IKCA 1N0LA 1U8NB 4MD0A 1KNOA 1OB1A 2ZOKB 5CMAA 2MHAA 3MRCA 4OZIF 1G6RA 1YNLL 2ADIA 5DHYA 4U7KA 4F7PB 1JE6A 4NQXB 2L7JA 3GSNA 1VPOH 3MXVH 4A2LA 4PJ7E 3BPLB 4XHJD 1AIFB 4P9HC 5LAXB 3GMPA 2HKHH 1DANT 3QB7C 1BREA 2YPVL 3PGCB 5J6GA 3HC3H 4HV8B 5C0CA 3BKJL 3BP5B 1T04B 3K4ZA 3KXFE 1T1YA 3MJ9L 4Y2OA 5ESQA 5IF0B 3N9GH 2XV6B 3L7EA 2OTWA 5I19H 4APQB 1UWGL 4ZO8A 1EVUA 1XAUA 1UWXH 4GKZB 2ED9A 4D0CA 5ANMB 1JV5A 3K0WA 4XBGA 1FNEA 4KY1L 3P11L 4FFVD 4XCEB 3LKQB 4HPYL 1JPFB 3TYFA 3B8YA 1CE1H 4LCIL 4GH7B 4F15C 1ZGLB 3PUCA 4G7VL 5EZJB 4J8RB 5KOMC 2GQHA 2JJTA 5EU4A 4JRYD 4MQ7B 4ENED 4PR5B 3QRGH 3QQNA 5HHVL 3HG1A 1B9ZA 4HJGA 4GS7C 4BQCA 1RZGB 2XG5A 4KJQD 1B0RA 1JV5B 2DTML 4M8QA 4UNTA 1T2QL 4HT1L 4BELD 4O2EB 1JGDA 1G9MC 1GH7A 1HI6B 4QCIA 2VLKD 5D96C 5IB4B 1FYTD 3MRMB 1A47A 5JIHA 3O6LL 1CDYA 1U91A 3RWIA 5MENE 5D7IA 3GSUB 3ULUF 1MCDA 1A7NH 4J3VA 5FUOH 5HYIA 1WIPA 3DSNA 2YC1A 4JY4A 1F8TH 3FB7B 5DSCA 3T2OA 4DKFL 1G9ML 1VGKB 1T1YB 5ESQB 1I8IA 5ICZB 4ZS7H 1ZA3A 3TN0D 2DYPB 4KAQH 5FA4B 3QFJE 4ZNEA 2EC9U 4XWOD 5ANMA 2YPKA 5T3XE 2R0WH 4BZYA 4LSVH 1NLDL 4WU5B 4WWKB 3MOBH 3WFCH 2PW1B 3C08L 1LK3L 2BJMH 2CLZB 4CU8A 3EDFA 3HLAA 3OJ2C 4DQOL 5DYOA 4AQ1B 4MVBD 4M7JH 5FYLE 4YNYB 2VABB 4JFDE 1P84J 2E7MA 1ZHBA 5IHUL 1S9VA 2FJGA 2XPGA 3S36X 4LCCA 1RUAH 1EBPA 3EYSL 5K9QG 2AJZA 3BN9D 4JRXE 2AAVA 3HMXL 3FO1A 1JP5A 5FO7B 1LO3H 4UQ3A 4L9LC 2W9EL 4TOYH 5F9JA 4LFHD 1FIEA 5SX4I 5ILTL 4DN4L 5JXAL 2X4OA 3SY0A 4UIKH 1K4CA 3QEQA 1MH5A 2P8PB 4LNVA 5CFHA 1EHLH 4XNYL 4Z77A 2MQ0A 4KKBC 3HS0B 4GG8B 5J57B 4X4ZA 3LDBC 1T1ZA 2CDEB 3KPLB 1JF6A 3G08B 3QG7H 2JIXD 2R0LH 3QIUC 3CZJA 4YZFF 3LRSB 2GCYB 4FNLL 1YMHA 3IDMA 5I1AB 1M05B 1IILE 1T1WA 2X1QA 5GSVB 4LCWA 4L9LB 4MJ4A 3REWB 1T7VA 4UT7L 4UU9A 1T21A 1HSBA 1CLOL 5HYEA 4PGZA 3O11B 5EO0A 3U4BH 1DDHA 2JCCF 4LLUA 1OW0A 2XA8L 4FP8H 4F7MB 4XP9H 4JFDD 4OCMC 4CVUA 1U9KA 5D7JA 5A2IH 2QTEA 2R69H 1X5XA 3OHXA 1FDLH 1KCSL 4OM1H 1Y0LA 1D5BA 1U8OB 4PRHA 1K2DA 1QYGH 5GZOD 4JRXD 1CLYH 2Q87A 4PJBB 1QQDB 1FGVL 3JV0A 3DI3B 1DSFH 2C4FT 1CDHA 4GUPB 3X11A 3MLRH 1N3NA 1NBVL 2HN7A 4HUWB 4NQVB 3SKNA 3VGAB 1G9NL 4LRNL 5DJ6B 3HRZB 1Z0MA 4NWUL 2VXQH 5ITBL 1CU4L 2G5RA 2R1WA 2R2BA 4QYOA 2R0ZH 1OGTA 1JTOA 1UM5L 4OUUA 1SEQH 4DZBB 3L3JA 1SJHA 4IRJA 2J8UE 2GKIA 3L3GB 1YNKH 4OUUB 3TZVB 5C0IB 1F5WA 5IMOB 1QLFB 2YMXL 1HKFA 3PGFL 1KB5L 1JGEA 5FK9B 3T4YA 3TJHA 3SDDA 4ONGL 2APVA 3OKMA 3RY5A 1DFBL 4I4WB 3TO2A 2FNBA 5ANME 5JUEL 4X5XB 4OCSL 3CFCL 1F4WH 3CLFL 3T3MF 4PS4H 2E9WA 1HHIB 5IVXE 5IW3A 4XP5H 2YK1H 5H37H 1PY4A 3B9DA 3LN5B 5GGSA 1U36A 3SDDD 3CGTA 4NHUA 4XWOC 2X4QB 1PLGH 1LMKA 3DHMA 4X4MA 5L2KB 5D2LE 1LQVA 1A6TA 5FM5M 2G5BA 2UZIL 3IB4A 4NQCE 3V52H 4X4YA 3RWHA 1R5VB 4PJCF 4HWEL 4QXUH 2J88H 5FGBC 4ORGA 1BZ9A 1JN6B 3I6GA 2QKIB 4KTYA 5B39G 3VD9A 3CU1A 1NANH 3C6LA 1JI2A 4AM0B 2YD6A 4AIZB 4OGYH 1GC1H 2V17L 1FL5A 5F6HI 5KZCD 4GKOA 2ADGB 2CLRB 5C07D 1IEBA 5KVDL 2X9YA 1KB9K 1IQDA 2VN7A 5T1MA 4ODBD 1KYOK 4BUGA 1I9IH 1ZTXL 5CHNA 1OAXH 1UXWA 4CMHB 1R5VA 1WIUA 1WLHA 2CRYA 3SDDB 2VL5A 4G6AC 1F3DJ 5KVGL 4RGND 1F11A 1JGUH 1QSFB 4ENEC 2VQTA 2LABA 4LPTA 2CKBL 1TZHA 2HVKA 3GJFB 2ZNWA 2NXYC 4X5XA 4XMPL 4J2XA 1P4IL 1D5IH 1SBBA 4UTAL 4OF0A 5ECJE 5E2VL 3E6HA 2WBJA 4X7EC 5JOFB 5IFAH 2VJXA 4JY5H 3EHBD 3TIEA 2YPLE 4ETYA 4MLSA 4KK6D 3WN5A 1H3TA 4IDLA 3ZKSD 3GSXA 1KTLB 5I8KH 4OTXH 1K6QH 4DGVL 3UMTA 5KS9A 3P4NB 1F11B 4Q0XH 3ROLA 4G9FA 4RCAA 4GW4A 3SGJA 3MCLH 4HFUH 4K55A 4PJ8B 1NBYA 4GG6A 4O4YH 5H8DA 3T0XA 1Z3GH 4Q9QH 4YHYC 4JVWA 2X10A 1LQSR 3RGVA 2BSRB 3CDYA 3IU4L 1RSFA 3K4AA 3WD5L 3OL2A 3RAJH 1JPTL 4CVZA 3RWCB 3QDMD 5CSBA 1VHPA 2EE3A 3O6KL 4XNXH 5ACZB 2NY1D 4U1GB 5C0BB 4JDZA 4O9HL 2P8MB 5GS1C 2VN4A 4N9GA 1KCRH 3SDCA 4ELMA 1BQLH 3NCMA 4PRPA 5JW3H 2W0LA 2A77L 4N0FA 3C6LB 1GAFH 1T6WA 2CDGA 5FUCC 1A1OA 3AU1B 3KPTA 1QBAA 3NACL 4DKEH 3W9DB 2ERJC 4HJ0C 4DGYH 5DD3L 1L8JA 5CZVL 3D9AL 4URTB 1L7IL 1R3JB 2EO9A 2XTJC 4Y4KC 1YMME 3VWKD 1S7WA 1U58A 4PBVC 1QR1A 1GOHA 1J10A 3GSRA 3R1GL 4JFFA 5D1QB 5T3ZL 3T4AA 5HGDB 3WXVL 3P2TA 2WLYA 2CRMA 2D7NA 4I18B 5AWNH 1OWRM 3S98A 1XGRA 2IEPA 4S1QH 3SBWC 4AG4H 1FL6B 4N0FB 5GS2H 4G43B 2P47B 1HILB 4RFNC 3RX7A 3RI5K 3CZFA 3DYOA 1N6VA 3MV7D 4WI2A 5E2WH 3QIWA 4OCWL 3UTQB 3VI4E 2HFGH 5DRNA 3UJJL 1ONQA 8CGTA 1LDPH 2EDTA 4X9GA 3OX8B 3BESR 2B4CL 2WANA 4YDJA 1PSKH 3L5JA 3HPLB 5E94B 4G9FE 1GL4B 1C7SA 1CZ8L 2PO6D 2ZG3A 1SBSL 4YH6A 4LCUB 5HI4C 1CD9B 1NBYB 3DSFH 5CSZA 5ESAB 5K33A 5KN5B 2CQVA 1RUPH 1P1ZA 1DBKH 1WUNT 2F54A 2R2HB 4XHJC 1INDL 2F8VA 3DTXB 5GS3A 4HCRH 3WFHA 1J0ZA 4DKDC 3WFBL 1DBAL 1ITCA 1KIRA 2AV1A 2MTPA 3FFCB 3LKNA 2FECI 1EO7A 1KJ2H 1OVZA 3KJ4B 2DYPA 4KGLA 1YPZE 3HI1A 4UIMB 2AABH 3S88H 2BSTB 5IW6A 3BZ4A 5J0BA 4P2QA 4OB5L 2BY0A 1A6AB 3VCLB 2CGRL 1OLLA 3KYKH 4N8VB 1CBVL 3TCLB 4JPKL 1IGCL 4X8XA 1FG9C 2VE6A 4CN4A 2NW2B 3NBNA 4ONFH 5IOPB 4PRDB 5E99L 3LPGA 1RJYB 3C5JA 5HBBA 5FYJE 3T0EE 1WT5C 1JZ5A 3CSPA 1DQMH 4R4FL 2NXZD 5TGBB 1FVDA 1S3KL 3VRJA 5DTFB 1EEQA 1MELA 4JY4B 1ZHLA 3MV7E 4LASL 1AKJD 2YBRA 2D0GA 3SCMD 3SKOA 3QDHA 3BP4B 3TWCL 2MPAH 1SQ2N 4Z7VF 5E9DE 3A67H 2FO4A 1UVQA 3PL6D 3LRGA 4AQOA 1H5BC 2DBJA 2BK8A 3SBWA 3SY0B 1F4YL 2VXUL 2C4FU 1Q72H 1J8HD 1MNUH 3WO3B 4FTVD 5AYUH 1R3LA 3KPQB 3M1BB 5I1JL 3O6KH 3QZWA 4J3TA 4NKMB 3NA4A 1CLZL 4TUJA 4N8VG 4PY8I 3V5DA 4XPFL 3HC0A 5BQ7B 1B2WH 1IAKB 5D7JC 1EJOH 3P73B 5TDOA 4MA7H 1A0QH 2ARWA 1DQJA 1WCBB 3CVIL 2R9HC 2DDQL 5ADPH 1KJVA 3IGAA 2KKQA 1Q9WB 2ZG2A 4OJFH 1OP3K 3BPOB 3X13B 2FWOB 4EKXA 8FABB 1WWAX 1BEYH 5EU4B 4G8GB 2J4WH 4WEBH 2DQHL 1FP5A 3KPRA 4OGXL 4PJAB 1EPFA 1CDUA 3GM8A 5J56B 4N9OB 3MV8E 4N8CL 5SX5H 3OGOE 5F21B 2J8UA 5T1LB 1U6AH 3HNVH 4P48A 4YBLC 4DGVH 4KJWD 4UINL 1ZHBB 3P0GB 4X6FA 1NEZG 5T5NG 3C60D 4LPYA 2ZCLH 3EYOB 3TCXA 1I9JL 4UINH 4I3SH 3DARA 3NCYP 2AQ2A 2X4TB 3IAPA 5HI3C 1NL0L 1XR9B 5LXGL 1RY7B 1BVLA 1A3LL 2FJFA 5CBEA 2HJFA 4RNRA 3NAAH 3GRWL 3O4LE 5CP7A 3NCBB 1CT8A 2PW1A 2BNQE 4PLKC 5CKGA 3CMGA 2X4RB 1HXMA 3GZKA 4FQXD 2IADB 4B5EA 2GHWB 1PG7H 1MFEL 3CVHH 3E8UH 1WBYB 4EOWH 2EIEA 5HTSA 3R0MA 1XCQB 3UBXB 3LPFA 2VXUH 2NY5L 3OJDA 3SDAC 4WV1C 3TFKA 3BQUD 2ZUQB 1N0XL 1L6ZA 4C58B 1ACYH 4XVUD 5C0JB 3VDBA 2QSVA 1NCWL 5I18H 4BQBA 2R23A 4PGBB 1LNUB 1VSCA 4GMTH 3OR6B 3NAAL 4LQFH 3EJYC 3VFPA 2E6PA 4NQEB 2A6IA 1MCNA 1MCPH 1S7XB 4P2OB 4F3FB 1F4AA 1ES0B 2ZCLL 3TEUA 3UAJD 3NMEA 3MA7B 3HMXA 2MMXA 3DVFA 3PG2A 1TQBB 4DEPC 2XTJD 4PRID 4WO4D 3PWNB 4Z7VB 1YMHB 5LGJA 2HA1A 3JTCA 3RNQA 3ILQD 3KS0J 2VIRA 4PFEA 1KJ3H 1UKSA 4K2UL 3RUGB 2QLVB 1W0YT 1KEML 4ZTPL 3RY6A 4PPTA 3QNXA 4ZD3H 1K8DA 1N8ZB 1IM9D 3X3GL 1KXTB 1JRHI 4LU5H 4AT6A 2YZ8A 4UZGA 1OAQH 1A0QL 2YMXH 3FQWA 3ARBC 4WHDA 2BFVH 5HYJE 2FL5B 4CU6A 3L95B 5IVZB 3SE4C 2P5WB 1UM5H 1LEIA 4EXKA 3QQ9C 2WIMA 4P57B 3ARBB 4YHIB 5HGGS 4PJHE 1CD8A 1FFPB 1OPGH 5FYKH 4PGDB 2DAVA 2CH8A 1DBKL 2WV3A 3TIDA 3ORJA 3TPUB 3RVXC 4HFWA 2IALB 1RULH 2IBBA 1W2KT 1CR9L 3BGMA 4J1UB 3VXRD 3MUGB 3D25A 3DX8A 4LSDA 1U3HA 4HIHA 1QLEH 5GRUL 4XPGL 3ZL4L 1UB5B 4NKIH 2VUYA 4GRMA 3FB5B 4YWGL 3BQUB 4MXQD 4GRMB 5FYKE 3ZLQC 4HD9A 1LDPL 1LD9B 3RP1A 1GGYA 5ICZA 1KENL 4CU7A 4N0CA 2C3VB 2CK0L 4LASH 3ZE2E 5F7LB 4DVBB 1S7SB 3T1FA 4YC2C 3QULA 4DVBA 1U3JA 5DJYB 3NCYS 3TFKC 1E28A 3RIFK 5I0ZA 3ARDB 4TRPH 5ERWB 3RNKA 3V6OE 3UPCA 4ZG1A 2KQNA 2DOCA 1ROWA 5FO8B 5KS9B 5DJ6A 1GSMA 4MJID 1I3RB 3CH1A 3MLZH 5DT1H 1DBML 4HUWA 4KDWA 5MEND 2KZWA 2NXYB 3GI9H 3RZCA 2X4UA 3ZT6A 4K23H 4H8WC 5SX5K 4X7TB 4IIQA 4AM0A 2K3TA 3GBLA 3VGFA 1Y18A 3QA3A 4XPGH 1QSEB 3EFDL 4M3KB 1N7MH 3QG7L 3EOYG 3ZMRA 5CEZH 2X40A 1IQDB 1KCRL 3BKYL 4I0PC 4YDVB 3BZDA 2DWDB 3S37L 1BIHA 1TTGA 3HE6D 2LTQB 1E4KC 5IQ7H 1LO5A 4MDIA 5DD6B 1I9RL 2D9CA 4XNUL 1G84A 4MXWL 2RCSH 2P8MA 3RKDC 3LEXA 3DYMA 1OGAE 5FM5O 2E7BA 1CF8L 2GEEA 3BP7B 4QY8A 5DUBA 3UXFA 5AZEH 2G2RB 1UM6L 4GXUM 4LVHC 5EC1B 1XGTB 5JW5B 5CIPB 1J7VR 3NTCL 5I73C 3L3IB 3HE6A 4PD4K 1AXTL 4HCRA 1SEBA 1UZ8A 2PYEE 2YA1A 3JV4B 3BJ91 1CXIA 3H6JA 5MHSE 1J8HB 1KJ3L 1WAAE 5HYJA 5D72L 1RK0B 5C6TH 3UTTE 3T4AB 5GRYA 2GK2A 4M7JL 3D85B 4ISVA 2R56H 3QUXB 3Q5TA 2R4RH 5DZNA 3AREA 3UYRL 5T3ZH 5IG7B 3DX7B 3CH1B 4GT7A 4X9BA 3WIFB 4Y19B 4HS3B 1FYTA 5DJ0B 3QUXC 5JZ7C 4JB9L 5KVEL 2FO1A 3PWJA 1ZLWK 5KS9F 2DJSA 3FQTA 2HT2D 4U1HA 5EU6A 2HFTA 2ORBL 5I18L 3D39D 3FFCE 3VG9B 4ODHL 4OCRH 1A3QA 4Z78A 1JZ6A 2IANE 3H9SD 4BH8A 4QXTB 5FYJL 5TE6L 4WNQA 1ZLSH 3IDNB 3GFUA 4WNQB 1WF5A 2OR9H 3T65A 1QFHA 1R5WB 4R8WL 5C07E 3VMOA 1PYWA 4PJIA 4U1SB 4ZUUB 2BCKB 3CCHA 3O3DB 3OKEA 1CICC 3OMZA 4U0QB 5ESAA 4XCYA 1QR4A 3A0OA 3ZSSA 4CNIA 3C8DA 3NFSH 2H45A 3GJFA 5DQDL 2OJZH 3UYOD 3SDXA 1A6UL 1PDKA 3RHWF 3RPIB 1QFPA 4P23B 5DD5H 3BD4A 3IRPX 3BXNB 3MV9A 4LGPB 1FPTL 2H8PA 5GGQH 5EUKB 5CHNB 2OR7A 3KPPB 1WIOA 5EC2A 3LZFL 1MEXH 3MRHB 2YRLA 2NY1C 3VD3A 3T2QA 4JFFB 3I3DA 3RL2B 1IKFH 2P44B 3MRPB 2X1XR 4RMRA 1OTUC 3UTSB 5F1KC 2OI9A 2P5ED 2YN3A 3D18A 2ADJB 1R0AL 3IKKA 3RL1A 5KSAA 3QBTB 3KYOB 1MPAL 4E42A 2FX7H 4ZDHA 1JZ8A 2K7QA 4LHUG 3KYOA 4G6JH 4XC1L 2B39A 4Y19E 4Y5XB 2P46B 5C0BA 3LD8B 1JGUL 2LU7A 3MJ7B 5GJSH 3OJVC 4XH2A 4PP2B 2CKBB 5JR1H 1CL7H 4I0PD 3BYYA 4MCYB 1LP9F 4D9QE 2VLRA 1FH5H 1OD9A 5I1JH 5AYUL 1CYGA 3CLEL 3MV9D 1RUKL 4Z7UF 2X2YA 5KOVC 1IFHH 2HLFC 2DBLH 5E5RB 2EYTB 3B5GA 5GRJL 3RWCA 4N0UA 3VXSA 4NQSA 4R7NB 1R5WA 2OMBA 5TDNB 2O5YL 3CNKA 4UT9L 5J6HA 4D0CB 1FGVH 4YBQC 2PETA 4HXAL 4P4RA 2XN9D 4JVPA 2XYCA 5HHOE 3MLTB 2R2HA 3D2UA 3LKRA 2DYPD 4JO4H 3EAKA 4HWNA 4P2RB 2B1AL 2BNRD 2DICA 2QQKL 3C09C 4U6YB 4XVSH 3B2UC 3V0VB 1N5AB 3RZWA 1VDGA 2D7TL 4P5TB 5FCUH 1S78C 3EBAA 4UT7H 3MC0A 5D1ZD 3SJVD 5C1MB 3NCJH 5CBEB 3VXTA 4FQ2L 2MHAB 3GBNH 3MRCB 5JPNA 5IWLC 3IFNL 1QFOA 4X99A 3F7PC 4UOW1 3S88L 3L3HB 5E5MA 2NLJA 1I85C 2AJVL 2YD9A 3HTLX 3SDAD 1H3WM 2OL3A 3Q5OA 4PJBF 5H35B 5I1EH 4OAWB 3WFBH 2ESVE 1KG0A 2HFFB 1JL8A 1YEJL 4M6NH 2DQTL 4WI3A 3ZKXB 3OGCA 2ICEA 2HYMA 3QNYA 4Q2ZB 1TXKA 1RZKC 1ED3B 3CVHA 3QUML 1U2HA 3JXAA 4H25A 4NNPH 4Y5VA 3VXSE 3MGTA 4W68A 2EYSA 1I8IB 4QNPE 2WIIA 4LIQH 2DL2A 1QSFD 1MFAL 5CJOL 5FDWA 5EOCH 1RIVH 1NQBA 1TVDA 4MA8H 2AXJA 5KJRL 4G8GA 5HYQA 1CLYL 1MRFH 1Q9WA 2F53D 2E7LA 3ISWA 4PJEA 4OM1L 4WO4C 4BH7B 1QKZL 1BLNB 5F88A 1TFHA 1NGQL 1BFOB 1QG3A 3RDTD 1MH5B 3HC0B 1YEKH 1CL7I 1FFNA 4U1JA 1MCEA 4P4KB 4NPYA 4FQJL 3PV6B 3CXDH 3MRRB 1XGYL 3LKOB 3KNBB 4MAUH 5I8OH 1LK3H 3VFNA 1FORH 3GKWH 1T4KA 4TSBL