3PWUA

An immmunodominant ctl epitope from rinderpest virus presented by cattle mhc class i molecule n*01801(bola-a11)
Total Genus 70
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
70
sequence length
274
structure length
274
Chain Sequence
SHSLRYFYTAVSRPGLGEPRFIAVGYVDDTQFTRFDSDAPNPRDEPRVPWMEQEGPEYWDRNTRIYKDTAQIFRANLNTALGYYNQSEAGSHTFQEMYGCYVGPDGRLLLGFMQFAYDGRDYIALNEDLRSWTAADTAAQITKRKWEAAGEAERQRNYLEGRCVEGLRRYLENGKDTLLRADPPKAHVTHHPISDREVTLRCWALGFYPEEISLTWQHEGEDQTQDMELVETRPSGDGTFQKWAALVVPSGEEQRYTCRVQHEGLQEPLTLRWE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords MHC class I antigen
publication title Two distinct conformations of a rinderpest virus epitope presented by bovine major histocompatibility complex class I N*01801: a host strategy to present featured peptides
pubmed doi rcsb
source organism Bos taurus
molecule tags Immune system
total genus 70
structure length 274
sequence length 274
ec nomenclature
pdb deposition date 2010-12-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3pwuA02
3.30.500.10 Alpha Beta 2-Layer Sandwich Murine Class I Major Histocompatibility Complex, H2-DB; Chain A, domain 1 MHC class I-like antigen recognition-like 3pwuA01
2OYPA 4X6FA 4BA8A 1BF2A 4CVWA 3WFDL 3O2DH 2AJVL 4KUZH 4KRLB 5D2NB 1XGRB 3UTZA 4EDXA 1FLRH 2HTLD 2DOCA 2YD5A 4H5SB 3ULVC 1NC4A 3R06B 4LLQA 3HZYB 3LRSA 2EZ0D 5I1DB 5E8OA 3BFOA 5DR5H 5DQDH 1KN4H 2FECL 3FQXA 4NZTL 1JWUA 5D9SB 2X70A 3IYLW 4YGVA 4ZD3L 1YMMD 4JDZA 2Q8AH 3QG7L 4M6ML 5EPMB 1XT5A 2AVGA 4O5LH 1X6LA 4I5BA 4DEPC 1C7TA 3OXSB 3UTSD 1EGJL 3V6FB 5GS0H 1AC0A 5L2JB 2WUCL 4PB9H 1UJ3B 4PJCA 3O0RL 2P7TB 4TSBH 4JG1L 1IGFL 2GUOB 4I2XE 4U1GB 2GTZB 1T7WA 3TWCL 1JJUA 3MV8E 1O7VA 3IT8D 4KRPD 4ODWA 3V5KA 1F4YH 4GW4A 4LKXB 2X1WL 2Z92B 2WBJC 1E4WH 3MRNB 4HIHB 1V05A 1UGNA 2VZ3A 3O6FD 1BJ8A 2P5WD 5I74C 3GMQA 5CMAA 3MBEC 4Y5YB 3N0PB 5I2IB 1S78D 4KC3B 1P4BL 2PXYA 3C8DA 2DF3A 3ULSB 2G75B 5DMIL 1DQJA 3F58H 4MNQD 4MQXD 1S7TA 1Z9MA 4ZFFA 4JLRA 2E5EA 3V6OC 4AQOA 3QEQE 2YUXA 1NPUA 1K8IB 3O4LD 1G9EA 4I9WD 1QBLH 3AMKA 2DS4A 4GMTH 2ITCA 1Y6KR 4HIIB 3VGBA 4O58L 3ZE2E 3WJJC 2NX5D 2AKRA 3SN6N 1ZGLB 2AJYH 3PP3K 2ZNXA 3UJTL 1PKQB 1J8KA 4PJBA 5ID1B 4POZD 1EJ6A 4DCQB 4ZTPH 4OZGE 3CFCH 1MHHB 4JRWA 5DGQA 4ZO9A 2F74A 1IGMH 1JWSA 4Y4HB 4X5XA 3JWDC 5E8EB 1HHHA 4BH7B 5E08L 3IFOA 2FZ3A 1R3JB 5F72S 3A6CH 3RAJL 4Z7UE 2C1OA 1OPGL 2JIXA 3KLAB 3L3OA 2E27H 4LSRL 4E9LA 1X4YA 4OF0A 1MJ8H 4P49A 5GZOC 1HCVA 2G9HB 4K3EH 4M5ZH 2CR6A 4G43A 1AGFB 4GG8B 4KROD 2I9TA 1OWWA 4JM2D 3HAEB 5KVFH 4GKNA 1VKXB 2B2XH 4CU7A 1OHQA 2ICWA 1DFBL 3EJZD 5CINL 1NFDF 3IJHB 2VOTA 4XCNA 2FJHA 3BISA 1S7WA 4P5TD 1ZLVH 4Z78B 2J8OA 3QWOB 1DCLA 1D6VH 4MLSA 1T21A 4X4YB 5KSAB 1MFAL 2E7LC 1QYGL 1DBMH 1PYWA 4ZS6C 1KULA 1CICA 2DLHA 1VADB 4FQ2H 4G59A 3MLSL 1NDGA 1AGCB 2X7LA 4LSVH 1BFVL 1IQDA 3GSWB 5CEZL 4PS4H 1OF2B 2VXTL 2VQ1B 3ZYIA 5D96C 1YPZE 4KJPD 3N1GC 1V7NL 4TVPE 3OAUH 1DSFL 4G9DA 4P23C 1R5WA 3U0WH 3SOBH 3RZCA 1RU9H 4XP1H 4X80H 3EO9L 3MRBA 2P8MB 3JV4B 4PJAA 2VDKH 5ICXA 5E6IA 5JNYB 1T83A 2GSGB 1F4XH 2ZOLA 2DQUL 2YEZA 3DYOA 4PTTB 2Z8VC 5A2JH 3EDFA 3BEVB 4S1DC 1SVCP 3WLBA 4NO3A 3N85L 2ZJSH 4O51B 1SVZA 5EG6C 4LHQB 4N5ED 5FHBL 2CJUH 4ZUWB 5HHMA 3GEWB 1CLOH 1HHJB 3VJ6A 1RULH 3MRLB 1XF3A 4H20L 4JZJA 3FT3B 6FABL 5L2KE 2B1AH 3ZT7A 5DRNB 3QDMD 3HE7A 3BRFA 1CD9B 2ZCKH 4X8XA 3KHOA 4TVPH 3VGAC 5FYJH 4JFQA 4H0IA 4XPFH 1LILA 4M8VA 1FYHB 1MWAB 4BZ1L 1IEAA 4HWZA 4L9LA 1KBGL 4UILL 5IF0A 3CLFL 5K59E 4Z9KB 2C5DC 1UZ6E 2NW2A 2X1OA 4JZNB 5C7XH 5HYJB 4HKBB 2RJMA 4Z7NE 5DWUH 3V79C 1VB9A 1BFOA 2FH6A 3VXRD 4LLDA 4GKSB 2V7NA 4GOSA 3QPQC 4LQFH 5E8NA 4HKZA 1PKOA 4Z7WA 2HFTA 3HE6C 4KZDL 3IXAA 2VIRB 3RTQC 3UBXB 3VXPB 1I1RA 1RK1A 4DQOH 5H37G 1L7IL 4P2RB 3I9GL 3MYJA 3QUZA 1S3KH 3IETA 1AXTL 3BXNA 2V5MA 3BWAB 5C8JA 3QUKA 2HJLB 3RU8L 2VLKD 2A9NH 3KPOB 1YY8A 1H3UA 2YN3A 3RWIB 3AREC 4WU5A 1XR9B 4OLEA 5D1XD 5JA8B 4PREA 5KVDH 4LCCA 4HGWA 5C0JA 1NEZB 5BRZD 3IVKA 4WO4A 1ZHBB 1MCWM 2BVOA 4JFZL 1FFOA 2IPKB 5HY9A 1FLTX 3U0TA 3BOVA 3FTGB 2W07A 2CKBA 3TM6A 4PRIA 1A1MA 3HTLX 2NLJA 4EVNA 3TA3B 3CZFB 4ZFZB 2DWEB 3TVMD 2OZ4L 5EU5B 5IR1A 2WWMD 1B6DA 3KR3H 5ALCH 3VH8B 4UTAH 4HS6A 4PJEE 4PV8A 2GAZA 2FGZA 3MX0A 3GMOA 1LP9F 1INDL 1RZFL 4HUXA 2ADFH 3TO2B 3MLRL 3OQ3B 1QLFA 4OZHB 5ESAA 1ZANH 2XA8L 4P2QD 4AH2A 1CBVH 2NW3A 1DTUA 3VG0L 5FV2A 4Z6AT 3UO1H 3BH8A 3QA3A 4WWKD 4ISVB 1YEKL 5TDPA 4AIZB 1NSNL 3HUJE 1XR8A 1BEYH 2H3NB 4RISH 1NC2A 1PLGL 5E8PB 4JN2A 4GKZB 4MWFB 1S9WA 3FQUB 1QSFD 3LS4L 5JW4Q 2UYLB 3U1SH 3THMH 2QR0B 1I7TB 1O7SA 3TBYB 5C0CA 1GAFL 2MJWA 2DQFA 2F15A 4X0KB 3KPPA 4XMLL 5F89B 5K9OB 1T5XB 5IMMA 4QXTB 5ITFA 2IPUK 2NXYC 4S1RL 4LLYA 3O6ML 3WUZA 2PR4L 5I66A 2YWZA 3MOBL 5HD8D 3ZL4H 4RQQB 4UIMB 3EYVB 4Y19E 5C2BL 1I9IL 4XVJH 1BD2D 5F7UA 3S88H 5D2NC 3LZFH 4N0FB 1BJMA 5I19L 1G7QB 5JIKA 2AK1H 4V1DA 4NQVA 3RIFK 4X5WB 1OAYH 4YZFE 3ARDD 1EPFA 1G1YA 1UKQA 4LGSB 5ICYB 2OI9A 2XTJB 4ETYA 4PIRF 1BPVA 4TULL 2X4RA 3RL1A 4YFLF 1LQSR 5E9DA 1CE1L 1JPGA 4UNUA 3IDNB 5EU4A 5ITBL 3VW3L 4U6HB 3ZE0E 4QRSA 5HYEA 4XPHL 4QTHB 2XZQH 1UJ3C 2E6QA 2P5EB 3QNXB 4GRMA 5GGRB 4PP2A 4M6AA 5HYSG 2X41A 5EFIA 2X4QA 3IGAA 4U1GC 1X5FA 4KHTL 3VWJB 4XB8A 2X4NA 5A40E 5B4MC 4PFEA 1GGCL 3P4MA 3MZTA 3IJSA 5DMGD 5DI8B 1DQLL 5CGYC 3WMSA 5HDLA 1J8HB 1T03H 5K9QI 1NBZB 4OJFH 5GRUL 2ZZUT 4M8QA 3U7YH 1CD1B 1P84K 3CSBA 1FG2B 3FJTA 5CJQH 4E41B 2V7HB 4GRWE 1LNUB 2W60B 4Y5YC 3ULVE 3PV6A 4H1LH 4F37F 1F8TL 1SMOA 3IU4H 5EA0H 4A2MA 3L3DB 3MLUH 3QJFA 2R4SL 3O9WD 1LK3L 4MXWH 3T3PF 5F7MC 1QR1A 1U8JA 5FGCE 1VGEH 1J1XH 5AYUL 1G0YR 3P73A 3PGFH 4X6FB 1CDHA 3ZYZA 2R23A 4EDXB 4IMKC 3EYFA 1JUFA 1KELL 5DMKA 5LGKA 3D5OF 1QKZH 1J05A 2ARJA 4TUKL 1MH5A 1NC4B 2FIKA 3A0OA 4EZMA 1GC1L 4GRWH 4LLQB 3ULVH 3LRSB 3BKCH 5E8OB 2ESVE 2HKFH 4YHLH 4MZ3A 3KGRA 4YHPA 3FQXB 3TH4T 5HPOA 4KXZH 1JWUB 2X70B 4YGVB 4JDZB 3N9GH 4XMPH 4RGMC 4X9IA 4Y4HC 4I5BB 3QFJE 2P1YA 4K8RL 1DBBL 1Z2KA 1IILE 3NACH 4NQCD 4FXKA 3BZDA 3X13A 2DTMH 5DF0A 2J3SA 4PJCB 4HMEA 4EI5D 3MXWL 3B6SA 3CK0L 3AS2A 1G9ML 3OB8A 3C09B 3NFPA 4N1EA 5IW1A 1DQDL 1CFTA 3Q48A 3K4AA 3LEYH 4IIQA 4OFVA 4XVSH 3V6OE 4ODWB 3V5KB 4GW4B 3VD4A 5LG1A 1JNJA 3FONA 4WTZA 3MRDA 2WNGA 3GMQB 2QKIA 5CMAB 4P46D 3W9EA 1QA9A 1A2YA 5DHYA 2PXYB 1GGIL 5KSAC 3UC0L 1OGAD 3D3VA 1UCBL 1CDJA 4XCCL 1QPXA 5F7WC 1DQJB 1A6UL 5T33L 3EDKA 5SWZD 1TNMA 1S7TB 4HKXA 5D2LA 1BBDH 4ZFFB 4JLRB 3OAYK 2YA2A 5D72H 4Y2DA 1YNKH 5D1QD 4X7TA 2FBOJ 1QBMH 5E8DL 4I0KA 2DIJA 3WNLA 1OT1A 2ITCB 4X9GA 2KL6A 5EUOE 2UV3A 3LN4B 4NBYB 4PTUA 4FFVC 3BQUD 2AKRB 4JQVC 1DL7H 4B0MM 4FQLL 4I18A 1OCWL 1FPTH 3WLWD 4PRBA 4G42A 1FNHA 3UJIL 2DQTH 4QRRE 1OW0C 3GRWA 4J6RL 3WFCH 1NBVL 1ZLWK 4G6JH 5C0NC 4PJ5D 1QFWM 4KAQH 2F74B 1FNSL 1JWSB 5F97E 5C1MB 4X5XB 3ZKND 1HHHB 3DWTA 4OI9A 3IFOB 2FZ3B 5IB4A 4F33A 4JRXE 4Z0XA 2C1OB 2JIXB 3L3OB 2MMXA 3LQAC 2WBKA 2E7LE 1HH9A 5LBSH 1L7TL 2BRQA 1NLBL 4UI2A 3O6KL 3T0WA 4G43B 3ROOA 1OAKL 2I9TB 3KYOA 1MRFL 4JO4H 2VERN 2Y4SA 4GKNB 2ICWB 4X6DA 4BM7A 3RGVA 2PYED 1U91A 2J88H 2FJHB 5AWNH 1WWCA 7FABL 5EU6D 1S7WB 1NBYA 1AY1H 5TQ2H 5IT2H 1DLFL 5DJ6A 4HMCA 4OZFG 2DQDL 1T21B 4PJ7E 3PWPE 4FTVE 2BZDA 3FO0L 1PYWB 4PG2A 1CICB 3DMMC 1G6RH 1A14H 1I1YA 4JO1H 4P3DA 1KB9K 4O9HL 1X5IA 2D7MA 2O93L 2ICWI 3SDCC 4LPVA 4I77L 5CP7A 5AZ2L 1NDGB 1FFQA 4KTDH 5JQHC 1NMCB 2X7LB 3NIFE 4MXVF 5MEOA 1IQDB 4DJMA 2AXFA 3MUJA 4ZSOA 4NKOA 3IB4A 2R0LH 4G7YH 3QPXH 1J0IA 2EKJA 3Q0HA 1R5WB 4FQIH 3ZYJA 3LH2L 3MRBB 3RFZC 1M71A 2GY7B 3QI9D 5E2JA 2K7PA 5CUSL 4C55A 4PJAB 5ICXB 1RJZA 5E6IB 5TE6L 2ZOLB 2YEZB 2DQHL 1BJ1H 1KT2A 3R1GH 3X3FH 4LSSH 3WLBB 4NO3B 2XKUA 4K7PY 3ARGA 2FEDD 3CC5A 1R3LA 1X9QA 4N0UA 5A16B 5ISZA 1MLBA 3D9AH 3WKML 5HHMB 5DVMA 3QQ3A 3GIVA 3HPJA 4OCRH 4YDVA 3VJ6B 5E1AA 4Y8AA 1XF3B 4JZJB 1MUJA 1W72A 5JHDD 1MIMH 1U6AH 3TA3C 5DEFA 2F53E 1A5FL 3HE7B 3S96A 4TTGA 2VXQH 4EIZC 2QSCL 4ZQKA 1R3IL 1ZEAH 5HYQA 4JFQB 2CQVA 3B5HA 2GJ6A 5ILTL 3LY6A 1IFHH 4LPCA 2UZIH 4AENA 1IEAB 2WQRA 4HWZB 4L9LB 1OM3L 4YHML 3LQZA 4OFYA 1XCQA 5IF0B 4PJIF 4LL9A 3MLVL 3EOBA 4BSJA 4S0UC 1UH4A 4MD0A 3CH8A 1FQ9C 2DI8A 2YSSA 1KIRA 2AEQH 4IDJH 1BFOB 3WO3B 2R29H 4DK6A 4LLDB 4NO5A 2V7NB 4KRNA 2VC2H 2QSQA 5E8NB 2AK4B 5HHPA 1EFQA 1E6OL 5FUOL 1UADC 5GRJL 3IXAB 1H0DA 3G5ZA 1G84A 1RK1B 1E28A 4YC2B 4P9ML 2HG5A 3MYJB 3QUZB 4Y4FD 3IETB 3MJGX 3BXNB 2EDOA 4L4JA 3BD3A 4D9LH 3QUKB 4Z0BH 2L4OA 4NZDA 3RWDA 3UTTE 3V0WL 1HSBA 4CNIA 5GGRY 1FYTE 4MAUH 1DBKL 1I8KA 2FD6H 4J23A 1FL6A 4IOSD 4WU5B 1IC5H 4XAWL 1GGBL 4PREB 4PGEA 1Y6NR 4LCCB 4HGWB 4JDTH 3UTQA 1AKJB 4ODUA 4WVRA 5C0JB 3BUYA 5L8JB 3IVKB 3MODL 3QQ9D 2J8HA 1BQLL 2L7JA 2BVOB 2ZUTA 2WUBL 5H35A 2EEAA 1FFOB 1YDPA 5HY9B 3U0TB 1ZHKA 3JVGA 2Z4QA 3GMRA 2CKBB 5T5FL 5BZWA 3FN0H 1JZ7A 2JCCF 1NCDL 4PRIB 1A1MB 4RMVA 4PGBA 4RWYL 2NLJB 2CO7B 4EVNB 2VZVA 4KQ3H 3G9AB 2OS7A 3K7UA 2D3VA 3SDDA 1HYSD 3DGGA 3BIBX 2MCPL 5CZVH 2XTJC 1B2WH 2RR3A 1P7QD 3ZKMD 5KAQF 5IR1B 1SHMA 1HN1A 5IQ7L 4YBQD 5DJ0A 4HS6B 4MX7A 4UQ2A 4FZ8H 4PV8B 1WISA 2P43B 2X6MA 3GMOB 5IVXE 1CR9H 4QOKD 3B8SA 2ZCLH 5ADOH 4HUXB 1WT5C 3RX7A 3WS6A 1QLFB 1T0NA 4YHKH 5JDSA 1KCUL 4M9OA 3ZLQC 5ESAB 2C7UA 5DZLA 3KLDA 3IXTA 2NW3B 3BH8B 3QA3B 4RMTA 3GM0A 3VWJC 4MVBA 5TDPB 1XR8B 4MHHI 2BSTA 1NC2B 2IG2H 3SJVE 4JN2B 1U8MA 4Z7UF 2YXMA 5DFWH 3L3HA 5FGRA 4EKXA 5LGHL 1S9WB 1LE5A 2OK0H 3K0WA 5T3XE 2Z8SA 5D2NE 3NBNA 5FO8A 3P0VL 2E8YA 3A6OA 4PP1D 2Z35A 1ES0B 5C0CB 2DQFB 5CSBA 4IRSD 3W0WD 3KPPB 3I3BA 5IMMB 3RIAK 5A2LH 5ITFB 3C6LA 1L4IA 4G8GD 2IJ0C 4LLYB 1T1ZA 3HRZA 4NO2A 2KQNA 5I66B 4XI5D 3KLHD 5L0QB 2JKXA 1L9MA 5ACZB 3WL9A 4LSPL 5EBWA 3E1F1 4HS8H 2YUVA 3BKJL 3MV7E 4UB0L 4FRWA 1NCTA 2VDPH 4V1DB 4NQVB 5FYLE 4P3CL 1DDHA 4PUBL 1RZIA 4LLVB 2OI9B 3N1FC 3D39A 2Z0BA 1DQQA 1FNEA 4N9GA 2AI0H 1U2HA 1KTLB 1GHFH 1MHEA 4JY5H 4HWNA 1EIBA 2X4RB 2BFVH 1P7KA 5E9DB 4PB0L 4BZYA 1MSPA 1JPGB 1YPZF 3T0XA 4BK4A 4F3FA 3IAPA 5LGJA 2DL9A 1KB5H 4HQQL 5EU4B 4OB5H 3ZDYE 5FFLA 4JM4H 3HMXL 4QRSB 4LHUA 4L3EA 1TITA 3TYFA 3ZKXB 3KWWA 3EW3B 4GRMB 3AUVA 3ARFD 4PP2B 4I0PA 5DURD 3ULUC 4PR5A 2UY6A 5EFIB 3C09C 3L9RA 2C3VA 2XKSA 1XIWD 4CL7A 2X4NB 4Y16A 3P4MB 3MACH 2ZUUA 4LLUA 1T80A 5I1IL 3IJSB 2WWKO 2IWGA 2AJSL 4OCYH 4FABH 1A3QA 4M8QB 4V2BA 3OPZL 3PV6B 2X4UA 5KAQG 2PXYC 2R2EA 3VD7A 4G7VH 1MJJA 5C09D 15C8H 3S8WA 3BSZH 3QEHA 3EYQC 3DPBA 3QJFB 5AZEL 4FQ1L 1EBAA 1LO2H 1UZ6F 4PLJD 3RWGB 1QR1B 1U8JB 1GIGH 4KDWA 4Z7NF 1OWRM 4HPYH 2Z8WC 4WUKH 3EFFA 3U4AA 4FQJL 3L95A 1ZVHA 3CX5K 4O02H 1TJGL 3P73B 2DMCA 2F58H 1AO7E 4ZPTA 1FGVL 4JAMA 2R23B 4TPRH 3EYFB 1JUFB 3U79A 4HFUL 5DMKB 5DO2C 1KLGA 5DJDA 2BCKA 1J05B 1JNLL 2ARJB 1U3HA 1MH5B 2FIKB 3BT2L 3O41A 1BJ1J 1T0PB 3CVIL 4DFIA 4YHPB 3V0VA 1FFPA 4KKAD 4G6MH 1QNZH 5CLWA 1E4JA 1MRCL 5DK3A 4K2UH 1G7HA 1OTTC 4X6EA 4B7IA 5F6HJ 4NQDA 1JTOA 2MTPA 2BOBA 1CL7H 5FUZH 3PDDA 1DP0A 1SEQL 5HI4C 1N5AA 2D9QB 4FXKB 3X13B 4Y0GA 1L0XA 1OTSD 1R6VA 3B6SB 2XWTA 3WFDH 2AJVH 4G6AC 2IAND 5HHOA 4PRNA 3RUGA 3EOYG 3NFPB 4JGUA 4W6XB 1UKTA 1CFTB 2G5BA 4GT7A 4K3GA 4IIQB 5DTFA 3VMPA 3QHFL 1KGCE 2PCPA 3OF6D 3FONB 4LK4A 4NUGL 3WNOA 2QKIB 4G9FA 4NZTH 4LSUL 4ZD3H 1A3RL 3QIUA 3QUYA 1QA9B 3D85D 3W9EB 4APQA 3QG7H 1A2YB 1BIHA 4M6MH 3CFDA 5DHVH 2X4SA 5DHYB 5E95B 5IBTH 2EYRA 3HI1A 3WUWG 3KYMA 3D3VB 4QRPA 5IG7A 1EGJH 1CICC 1WCQA 4UAOB 1BZ7A 3I3DA 1MLCA 1HKLL 2HA1A 3O0RH 4HKXB 2AJXL 4JG1H 3IAQA 1IGFH 3FT4A 5D2LB 1GL4B 1NMCC 1S5HB 3TWCH 4Y2DB 4X7TB 5GISL 3BIKA 3CCHA 1GZQA 1HH6A 3LPWA 4PTUB 1L8JA 1RZKL 5D5MA 4I18B 5GQBA 2VDQH 3RZCC 3SKMA 4OGXH 4PRAA 1KTRL 4RRPA 4PRBB 1NAML 4BUGA 4G42B 2QADB 2YA0A 2IFFH 1H3PL 1P4BH 5E6IC 1T83C 2DQIL 1LEGA 3HG1A 3CH1A 3OKEA 5DMIH 1RZJL 4NBZB 3RKDC 3O2VH 5IB4B 3F7QA 2HTKD 3EDJA 2EH7H 4JZJC 4F33B 4Z0XB 2OBGA 1HH9B 3LQAH 3HE7C 1D9KD 2D7QA 2XT1B 4KGJA 5DVLA 4O58H 1IAKA 3ROOB 2OQJA 3MOAL 4P2RE 3KYOB 5JW4M 3QXAA 2J6EA 1U8OA 2V2WA 4L9LC 5EB9A 1BZ9B 4X6DB 1FNAA 3RGVB 1U91B 5C0AE 1UZ8A 5DJZA 3FFCD 1TZHB 4MGXA 3T1FA 4PV9A 3P4LA 3EYUL 2V2TA 2APVA 2AQ1A 4N90E 3O8XD 5EOCL 1NBYB 4LCUA 1VFBA 5T3ZD 2E9JA 5IBUG 2GYSA 1ADQL 5E08H 4PJDF 1I1YB 4P3DB 2N4IA 1OPGH 1ZLWH 4GS7B 4HWBA 4LSRH 2HLFD 2VRAA 4YC2C 5JW3H 1BQSA 2F5AL 4YUEL 5CP7B 1OSZA 3QUZC 4K3JL 2NY2D 1FV1A 5MEOB 2LU3A 1I3VA 5CEZE 2AXFB 4ZSOB 5TFSL 2BNUA 1DFBH 3RGHA 5CINH 3QDGD 4NKOB 4CBPA 1V5JA 3RVUD 1AC6A 2BY1A 3SE9L 5JOFA 4ETQA 3PP4L 3P3YA 1M71B 4N9OB 4LCCC 3JV0A 3LHPL 3MLZL 1VA9A 1CGSL 3CSYA 1AGDA 1T4KA 4RGNB 4ZXBD 1RJZB 3FZUC 4WO4C 2R8SL 1XCTA 1JGVL 1KT2B 3SDAD 1MFAH 3BZFA 1QLRA 1QYGH 4OLXL 4L4TA 5FKPA 3WNPA 3ARGB 1ZLUK 3AFLA 3CC5B 2KZWA 4N0UB 4LRIA 5ISZB 1MLBB 2IH3A 5D1ZA 4EDWH 3QQ3B 3GIVB 3HPJB 3MLSH 4OZHE 2OL3A 4YDVB 5E1AB 3SCMD 3MUZ1 2F8OA 1IKNA 3KAAA 2AW2A 1MUJB 3DIFB 3MA9H 4C56A 1BFVH 1W72B 4JFFA 3TBWA 5CEZH 2I24N 5DEFB 1NCAL 3S96B 4J4PD 1PFCA 1YJDC 2YOCA 1JWMB 2X4PA 4ZQKB 5IGXH 5HYQB 4GG6A 2H2PC 2GJ6B 1DSFH 4K3DH 2AJ3A 2BXYA 5KW9L 4D8PA 4F8TA 4AENB 3EO9H 5SWQA 3LQZB 3RHWK 1XCQB 3EOBB 2P46B 1A02N 4MD0B 1MFNA 2DQUH 4WI3A 2YSSB 5IW6A 1MI5D 2MQ3A 1U3YA 2NY3D 5F96L 4NKDA 1IZJA 5E6ZA 3N85H 5HHNA 4NO5B 1MCKA 5FHBH 4Y88A 5HHPB 3Q5YA 4YXHH 2C4XA 3GJEA 4LAQH 4H20H 4OF8A 2CGRL 1H0DB 3G5ZB 6FABH 1E28B 1KFAH 2B7DT 4V3EB 4ZPVA 2FX7L 5HBBA 2MSPA 4NOFA 3PWUA 3N1QC 1BBJA 1A1NA 3NTCL 3RWDB 3DX9A 1HSBB 4CNIB 2EDNA 1KBGH 4UILH 5BV7B 2OX5A 1HOCA 4NYLA 3T0AA 2D31A 1I8KB 1UJTA 4HV8A 1YEFL 5I1JL 1UACL 1FL6B 2XTJE 1JGUL 4HEME 3SQOL 3OAZK 4PGEB 3B2VL 3AVEA 5IUSA 3UTQB 4JM2A 3C5SA 2X42A 3MXVL 4ODUB 1REIA 2BDNH 5E4EB 3BUYB 1MJ7L 3Q5OA 5L0QC 5T5NF 4ZAKA 3KPSA 4YHNA 4HXAL 1JZ6A 1YYML 4KZDH 2D03H 5H35B 1F2XK 1YDPB 2B5IB 5F7DB 1CXLA 1ZHKB 4TNVF 2Z4QB 3GMRB 3V8OA 3S4SA 4YXLL 2P5EE 1L7IH 4MSWA 1OD7A 4P5TA 4PGBB 3VI4E 1UM4L 4U1KA 5HGGS 1NUDA 3RU8H 1QTYT 2OI9C 3SDDB 1ETZA 5JW5A 3DGGB 3GSNL 1G7PB 3PHQA 4K7PL 1X5ZA 4BJLA 3O3BB 4X7SL 1MCBA 4PGDA 1P84J 1GRWA 3EKCA 5EUOF 2KH2B 5CD5D 5DJ0B 1X5YA 4UQ2B 4MX7B 4M03A 1DBAL 4IOFD 5C0RL 3CVHL 4E41E 4JE4B 2XN9D 3VXUD 4PBXA 3F8UB 1K3IA 4P4KB 3SKOA 3SE8L 1T0NB 4JFZH 5JDSB 1YEEL 2YBRA 2DLTA 2C7UB 3DECA 1JF5A 2ID5A 3FFDB 4E42A 4RA0C 5KZCD 2BSTB 3NAAL 4DUXA 1HQRB 4R8WL 1U8MB 2JB5L 4HHAA 2NQCA 2UUDH 3L3HB 1FJ1A 4P48A 2D0HA 1IL1A 2V9RA 3MV8D 5CIPH 2XICA 4EJ1C 1LE5B 4N5EA 1C5BL 2Q7YA 5FO8B 2XY2A 2Z35B 3OKOA 3RNKA 3EYSH 1N6QH 2H1PL 3GFUA 5KSVA 4JY4A 1IGIL 2VLRA 1EHAA 2C3XA 1A6PA 1UA6L 3C6LB 1INDH 3IDXL 4S0SD 3MLRH 1T1ZB 2MKLC 3BP4A 1MREH 2VN7A 4XMKH 4NQTA 3HRZB 4NO2B 4R4FL 3GI8L 4JG0L 1EERB 2R69L 4YHIA 4EN3D 3JUZA 2B39A 4HUVA 2XA8H 3VG0H 3WL9B 5EBWB 1HXMA 1YC8A 2M1KA 2RFXA 4PJGF 4XVUC 1YEKH 1MHCA 1NSNH 3NOIA 4PJ7F 4NFDA 3QEQD 3NCYS 4PJCE 1UCTA 4X7DC 4UTBL 1K5NA 4Y2OA 3ULUE 4RAHA 4MA8L 3KNBA 2WW8A 3LS4H 4H0HB 4ODTL 1MCLA 1AI1H 4Q9RL 1K3ZA 1DDHB 1RZIB 5F1KC 3DVGA 5E94A 5BXFA 2PKDA 3D39B 1GAFH 1DQQB 1FNEB 4N9GB 1MHEB 3JWOC 5HYIA 4CDHA 1P7KB 3O3EA 3PWNB 43CAA 1XEDA 1A0QH 4RMRA 4K94L 4WHYG 3O6MH 2HT3C 2X5PA 4JRYA 5IBLC 4DAGL 4F3FB 5LGJB 3BN9C 1RZGA 1TQBB 2PR4H 4XNXL 3MOBH 4LHUB 1MY5A 4NCC2 5C2BH 5I9QB 3TYFB 1GYAA 3KWWB 1CDIA 4LARL 3BHBA 3RKPA 4I0PB 4HIXL 4PR5B 1F2QA 1YN6A 3T2NH 3L9RB 5AD0A 2C3VB 5I19H 3RPIA 5F7LB 4DGIH 4IIQC 4Y16B 4GFTB 4LLUB 2R4RL 4ONGL 1XGQA 4R2GD 2F8XC 2XI9A 3DO7A 4TULH 2Q76A 2IQ9L 4U6YA 3EFDL 1RUPL 1T2XA 3VFWA 1CE1H 4Y5XB 2X4UB 4QXGL 4PJBE 4TNWK 2R2EB 5ITBH 1MJJB 3VW3H 1WTGT 3QEHB 1IC7L 1T7YA 1OVZA 2O5XL 4XPHH 4UAOC 2H6PA 1EEZA 2KQMA 1KNOA 3BKML 1KCKA 2WLZA 4PLKD 1Q1JL 3DXAA 4NM4L 5TDOA 4FOMA 3EFFB 1LEIA 4Y2DC 2NYYC 3DETC 3L95B 3VGGA 3S35H 1Z0NA 4JPWL 3RWJA 1GGCH 1TZGH 2EDBA 4ZPTB 4JAMB 4XC1H 1DQLH 1KLGB 5DJDB 1A7NL 2BCKB 4I18C 5CZXC 1U3HB 2OLDA 2EKSA 5GRVL 5L9DH 3O41B 3T4YA 4WENB 5CP3A 2QADC 1FRGL 4ZOAA 3V0VB 1FFPB 3NIGE 2FX9H 1EXUA 3VXSD 4X6CB 4AM0A 1QSFA 5BVJA 3ALPA 1G7HB 4X6EB 4NQDB 2BOBB 1DZBA 1N5AB 1KB9J 1IM3A 4ZOBA 2ZNWA 5L7XL 2P45B 4KJQD 2BSSA 2XWTB 5HHOB 1OLZA 2AXGA 4PRNB 4XP4L 3RUGB 8FABB 2G5BB 5DTFB 4TUKH 4TVSa 2PTTA 4J3XA 4WDIA 4JR9L 5DD5H 1GC1H 2NY6D 4BQCA 4UOW0 1Q72L 5BMFH 1X5XA 2PCPB 1RD6A 1T5WA 3RGVC 2ATPA 4FZEH 3P4NA 4G9FB 4L8BB 3T0VA 4AMKL 3TZVD 2HMID 3QIUB 3QUYB 4APQB 3CFDB 2X4SB 1NUGA 3K3QA 2EYRB 3HI1B 3KYMB 4K8RH 4M1CD 3F7RA 3FB8A 1DBBH 5I73B 3NFSL 4GO6B 4PJAE 2WK2A 4QRPB 4WI2A 5IG7B 4PG2C 1EAPB 1BZ7B 5IVXF 4GS7C 1MLCB 4DN3L 3IKKA 4XH2A 3MXWH 3CK0H 1Q9WA 3FT4B 1T04A 1G9MH 4L8SA 5HHME 1DQDH 4MXQA 4FQCL 3QZWG 4OQ1A 1F3JA 2NY1B 5FM8A 3BIKB 4KKLD 3CCHB 1GZQB 1HH6B 3W82A 4ZODA 4Q9BA 1X5HA 5D5MB 5I15L 3RNQA 3SKMB 2RCSL 4PRAB 3MJ7A 3DHJA 1DBJL 4LVNB 5I8CA 2XACC 1DUZA 5DJCA 5GS1A 4RGNC 5FM5O 1LEGB 5L2KA 3HG1B 3CH1B 3UC0H 4AG4L 1UCBH 4XAKE 1OP5K 3OKEB 4U1LA 4UDTA 4IRJD 3ARGC 5KN5A 5IM7A 4XCCH 2QQLL 4TYUA 4JPKL 5T33H 1CDUA 3FB7A 3WJLA 3ARWA 2NTFA 4NKIH 4V2CB 3G6AB 4UV7L 1IM9A 2HT4C 4GQ9H 4Z7WE 3T8XA 2Y06H 2P49B 1I1FA 3KVQA 5E8DH 4ZNCD 5M94B 3B3IA 2ADIB 3WFEL 1G6VK 3AM8A 1IAKB 2OQJB 3QXAB 2VLJA 2H9GA 4FQLH 1OCWH 1U8OB 5E0QA 1YEJL 1AFVL 3VFNA 4ZUTA 3UJIH 4N0CD 1BWMA 2HH0H 2R56L 4J6RH 1UZ8B 4RZCA 5DJZB 1NBVH 3BYTA 3CU7A 5EIQA 3T1FB 4PV9B 2V2TB 5MEQA 5I0DA 1FNSH 4LCUB 3GJFH 1VFBB 1NGYA 1RHHA 3QP3A 1UC6A 4RBPK 4RSVA 1UB5A 4Y4KA 3V7AG 4JN1L 1ND0A 1EFXA 1J87A 1L7TH 1NLBH 4R4NC 4G8IA 3BYYA 1OSZB 1FV1B 4PRIE 1OAKH 4S10A 5DUPL 3TPKA 3WS3A 1RZ7L 3JV5A 4O2FA 3U48A 1MHPL 3EGSA 4M7ZB 5EOTA 5BV7C 2BNUB 3BX7C 3MRQA 4EI5A 3WKNA 5JOFB 1QFOA 4ETQB 4F7CA 3KYKL 7FABH 4KFZC 1OARH 2FL5A 3CSYB 1AGDB 1T4KB 5E4EC 4FFWC 1DLFH 1XCTB 4W6WB 3J7HA 3FHAA 4XPTL 3BZFB 3TBVB 3FO0H 1QLRB 4L4TB 5FKPB 4U6XA 4O9HH 2B5IC 5DJAA 2IH3B 3JVGC 5D1ZB 1JFQL 5AZ2H 4Y89A 4Y19D 2L7UA 4C56B 3TJHA 3ETBF 4JFFB 3TBWB 3Q6FA 4XRCA 3SDDC 3L5IA 2X4PB 1BVKA 3RRQA 5HXMA 5ELIA 4NCC1 4GG6B 5DZNA 2AJ3B 4D8PB 3LH2H 5SWQB 5ABDE 3MNWA 5CUSH 1MFEL 4O4YL 4FQQA 5TE6H 5C0CE 3OB0K 2DQHH 5GJTL 3WS6C 5T1LD 4Z95L 2DLFL 4MQSB 2HWZL 5B8CA 4NKDB 4D0BA 5HHNB 2X4OA 4MS8A 5LWYH 3GJEB 4OI7A 4WI5A 4MVBC 3ECBA 4R0LA 1ORQA 1JVKA 1OAUL 3PXJA 3EJYC 4BKLA 4GAJL 4QHUA 1D7FA 1A5FH 3EO0A 3PWVA 4KY1H 2AS5M 3QXVA 4XP5L 4ZPVB 3TYGL 1R3IH 3ROLA 3RWFA 3PWUB 5I1EH 5ILTH 3ZSTA 1A1NB 4V1DE 3DX9B 5GGVL 3K80A 1E6JL 1LE9A 2B4CL 2IPUG 3IJYA 1OM3H 4YHMH 1HOCB 2D31B 2WP3T 4HV8B 3INUL 3MLVH 3C6LC 2D7OA 4D9RE 3QIBA 4FG6C 2P8LA 1UQSA 3TV3L 5E9DE 3C5SB 3MCKA 3SHSA 3D25A 3P9LA 4ZAKB 5SV3A 1E6OH 2FCBA 3KPSB 5FUOH 3FQNA 4YHNB 2PYEA 4U6VL 5GRJH 3MLWL 1KG0A 2PW2A 3ILPA 3S4SB 4P9MH 3AS1A 4OFDA 4P5TB 4U1KB 1HEZA 4YHYB 3WFZA 4H1LA 3S35X 3LRGA 1HCFX 4IDLA 1ETZB 4KU1A 3V0WH 4HG4K 5JW5B 3DSFL 1IGCL 3PHQB 4DGVL 3TPUA 2AP2A 1DBKH 4YFEA 4PGDB 1MRDL 4KVNL 4XAWH 1S7XA 2ESVD 2WBJD 2M2DA 4ACPA 4U31A 3EO1A 1TQBC 2P48B 3TCLA 1J11A 1BQLH 3SKOB 5KBNC 5DD1H 2VUYA 2WUBH 3QFJD 2XZAL 4UT6H 4JFYA 2J4WH 5T1DL 4I0PC 3BKYL 5D7IA 1NCDH 3ARBA 1BQHA 2R15A 4YXKL 3CX5J 4E42B 1ZAGA 4IBLT 4Y16C 3CNKA 3H3PH 4HHAB 1FJ1B 2DQJH 3HNVL 1IL1B 1U92A 2MCPH 4RX4A 4PGZA 2XQYG 5D93C 2Q7YB 4HJGA 3D48R 5IQ7H 3OKOB 3RNKB 4RAVA 2VE6A 3F6LA 2Q1EA 5KSVB 4JY4B 2VLRB 3Q3GA 1VGKA 5IEKB 4KK5C 1S7QA 1NAKL 3GSXB 3L3IA 4LVHB 3BP4B 2DM7A 2P24A 1D5IL 4ZO8A 5IOPA 3HAEG 4OQTL 4YHIB 4HUVB 4LCWD 1FGNL 5E2VL 1ZLSH 5DVNA 1CK0L 1HXMB 5HJ3A 2RFXB 5HI3D 5B38A 4GAGH 1MHCB 4JO3L 4LGRB 4WCYL 4NN7B 2XZCL 1K5NB 5LGHH 4M62L 5HDOA 3KNBB 3AS3A 4KI5F 1U3HC 3MBEA 3SQBA 3DVGB 3LKOA 4LIQE 4PPTA 5E94B 5F70A 3ZTJH 3WDHA 5BXFB 5GZOD 1JZ3A 3V6ZA 2X89D 5IHUL 1ZA3A 4X4ME 1N4XL 2XA3A 3MR9A 3O3EB 3JWOH 4K55A 1HNGA 43CAB 3V6BR 4JRYB 4QRRD 3RX8A 1ACYL 4D3CL 4I2XB 1RZGB 5GRWA 2AEWA 3KLSA 4LRNL 3H0TA 4LSPH 5MERB 1U8NA 1YQ2A 4KMLB 1I1AA 1PEZA 3D3VE 1GOHA 3C60A 3QBTB 3BHBB 1F3RB 4JRXD 3BKJH 5DFTA 1NCCH 1YN6B 4PLNC 3RPIB 4ZS6D 5D2LE 3BPNB 4OZHF 4LIQH 2ILLA 4PUBH 3C2AL 3QXTA 1T0MA 1FN4B 4OZ4A 4CVUA 5JZ7C 5I1KH 3DO7B 1NFKA 1MPAL 2YPLA 4KMQA 1LDSA 4U6YB 3VFWB 1S8DA 3QIUC 3QUYC 4APQC 4JHBA 3QULA 4HQQH 3BP6A 3MBXL 5I73C 5GZND 1CLCA 4P23D 1FC1A 1R3KB 1IQWH 5HGAA 5LAXA 2H6PB 3KJ6H 1EEZB 3WXWL 3HNTL 2CK0L 2OP4H 5EC2A 3PWPD 4FTVD 3DXAB 1BOGA 5TDOB 3VFUA 4U49A 2R39A 1CWVA 1LEIB 3ES6A 5DHXB 2NY1C 4QOKA 1I3GL 3RWJB 3R0NA 4OZIF 5D8JH 5FKAA 5I1IH 1M7XA 2H41A 2AJSH 5T1KD 2EKSB 3PQYE 3QCUL 4ODXA 3OPZH 3MGOA 3T4YB 5GHWL 1KJ2L 4LVNC 2F8VA 3UZVB 4FFZH 3UBXG 1KSRA 1G6RA 1B0WA 1L6ZA 1MCDA 1EXUB 1FSKC 2FLRT 4AM0B 2LAGB 2FO1A 4WTWA 5AZEH 3N1PC 4FQ1H 3OKKA 2NY5C 1WICA 4XPBH 3QDJD 4QHKJ 1E27A 4AT6A 5ETUA 3F65A 1IM3B 1DEEA 2NXZB 4FQJH 5F1OB 4QGTA 4QRUA 1TJGH 1QBAA 1WVZA 1KEGL 3LEXB 2BSSB 1FGVH 3QPQD 2AXGB 1JNHA 2BHZA 1A6WL 4HFUH 3HE6D 1WITA 3RTQD 1B9ZA 1NEZG 1JNLH 2F53D 3QNZA 1MFDL 2PTTB 5J56B 4NP4L 3VI4F 4YLQT 2MWCA 1T5WB 2ATPB 4FFYL 3CVIH 5FEBA 3S3JA 3P4NB 3HZMA 3RDTA 3BRDA 4M3JA 1MRCH 1RUQL 3VMOA 5JXAL 4U7MA 5L6YL 3VFOA 2OMBA 1KTDA 5FM4A 2EZ0C 3ARED 3BDBA 4RGNE 1SEQH 4MJIA 4M61A 4WFGE 5ALBL 5DMJB 4TOYL 5IJKA 5E2WL 4ZO6A 3O3AA 3FT2A 4LDLB 3QHZL 5EZJB 5EULV 4XH2B 1Q9WB 4N0UE 1SY6A 1T04B 4OLVL 3U83A 3VA2C 3VH8G 3LDBB 1UWXK 4KKCC 5FO9A 4LQ1A 4LASH 4EIGB 4UT7L 1WZ1L 5DYOA 3QHFH 3RVTC 3QJHB 3RNQB 4NUGH 3UTTD 2CUMA 2HRLA 4LOUD 3MJ7B 5I17A 2ZKHL 1CYGA 3GZKA 5CHNB 5I8CB 1DUZB 5DJCB 5GS1B 3G5VA 3RY6A 1K4CB 3CPLA 4W4NA 2XXCB 5L2KB 2FGWL 3MFFA 5TGBA 4U1LB 4UDTB 4Z8FL 5IM7B 1T6WA 4LRIC 5DUBA 1HKLH 5D1ZC 4G8EA 4OM0L 3BP5A 2DBLH 4CJ1A 3FB7B 4WI9A 3RL2A 2AJXH 2VDLL 1IKNC 2NTFB 3QQ4A 2AABH 1IM9B 5E2TH 3T8XB 3CLEL 2OJZH 1I1FB 3OTTA 1W72H 5GISH 5H2BA 5KOMC 3V2AR 3B3IB 4NM8L 4S1QL 4EQ2A 2VL4A 4OD3L 5JXED 1S5IL 2X1XR 1RZKH 4MQXC 4AL8L 2VLJB 2H9GB 2HAZA 4LPWA 4WWID 4K71B 1EHNA 1NAMH 5C71A 3ULUF 3VGHA 2MKWA 3CDCA 2Y25A 3VFNB 4ZUTB 1H3PH 3PL6A 1S7VB 2DQIH 4GXUM 4RZCB 4IRZL 1MFBL 3GMPA 1A7BA 1WQVT 5MEQB 1RZJH 3OR6A 4U6TA 1NGYB 1RHHB 1UB5B 4Y4KB 3C5JA 3GKWL 1KPRA 2NXYD 2XWJA 2IFGA 3SDYH 1RURL 1OP5H 1ND0B 1EFXB 1AQDA 3GB7A 4G8IB 4X9HA 4QXWA 3RY5A 1WFUA 3MOAH 3WS3B 1CGVA 4O2FB 5K9QG 5T3XD 3EGSB 4DUVA 2NR6C 4WI7A 2YPVL 3MRQB 3MRMA 5BV7H 2V5YA 5DEGA 3V52L 5FA3A 2J8UA 4F7CB 1JN6A 2LU7A 4MA3A 3CXDL 5BW7A 5I18L 1BX2A 2ICEA 3PHSA 2YC1A 3EYUH 1U0QA 1U8IA 2EE3A 4JM2C 5EOCH 2FL5B 2I9LA 4NCDA 4ZAKC 5TJWK 1ADQH 3GHEL 5DJ2A 3U0PA 3EJZC 1UM5L 4U6XB 3VRJA 1MF2L 5DJAB 1LDPL 2F5AH 4YUEH 4P5TC 1FO0L 1F45A 4RBPH 4YHYC 3Q6FB 5C6PB 3FB6A 3MA7A 4LMQE 3TCXA 4XRCB 5D7JA 5TFSH 3IRPX 1BVKB 25C8L 5FYLD 4I3RL 1CFBA 4WFEE 3MGTA 4HIEA 5B4MD 3SE9H 2O5ZL 2EIDA 4ELMF 4OUUA 3LHPH 3MPCA 3MLZH 1CGSH 3MNWB 2AXHA 3W11D 5CGYD 4LLWA 1DR9A 3W5MA 1INEH 4Z5RA 4FQQB 4ERSL 5KVEL 2R8SH 4G6KL 3HUJB 4NWTL 3SJVA 4D94A 3QH3A 4IOIA 4OLWH 1CIDA 4B53A 4NN6B 5B8CB 3NIGF 4NHUA 4D0BB 5I8OL 2X4OB 3BD5A 4QEGA 2CXKA 2GEEA 1HE7A 2JK5A 4R6UA 1H8SA 1VFMA 2W9EL 3ECBB 3T2OA 4R0LB 1ORQB 3RVWC 2MOVA 4I8DA 4BKLB 4QHUB 1NCAH 3EO0B 3PWVB 4U7KA 1G7JA 2HFEA 3DV4A 1T2QL 4HF5L 4N5EC 4OLUL 2ZOKA 5GGQL 3ROLB 3RWFB 4EQ3A 5FCSH 1KB5A 5KW9H 1LE9B 2VXUL 3IJYB 3BO8A 4U2YA 2IGFL 5GS0C 4MNHA 5DK2A 1D9KA 3D39E 1H9VA 3QO0A 3AU1A 3NCYP 5D71L 3B8YA 3QIBB 1FH5L 4LVHC 3ZT5A 2P8LB 1UQSB 3MV7A 4YNYA 3SPVB 5F96H 4NQEE 3MCKB 3X12A 1JP5A 3D25B 3P9LB 2AEPL 1YY9C 1WBXA 3FCTA 3FQNB 3BAEL 1B4RA 4OM1L 2GITA 2CGRH 2I60L 4U0RB 5IW3A 1KG0B 1KCVL 4X4XA 2WSKA 4L3EE 4Y4HD 2PW2B 2Y5TA 3ILPB 5GS2H 3E6FA 3CFJA 4NN7C 2IQAA 3O8XA 3PF2A 5DLML 4BFEA 3S3PA 2FX7H 1XGUA 1HEZB 3JUYA 1LO0H 4H1LB 1FAKT 3VFMA 1BLNA 3T04D 1VSCA 4YQXL 1DANU 3TPUB 1UB6A 1YEFH 5I1JH 1UACH 1T7ZA 3S34L 4NPYA 1JGUH 3SQOH 1S7XB 3B2VH 3EO1B 1B3JA 1EJOL 3MXVH 3EOAA 3TCLB 1ED3A 1MJ7H 1WUNT 4NKMA 4HXAH 4MLIA 5MENA 3L3JA 5ENWA 2XFXA 4JFYB 2DB8A 3GNML 5D7IB 5KSAD 3ARBB 3QUML 4GBXA 1BQHB 5FDWA 2XPGA 1HIML 4GRWB 1UM4H 3BPNC 4OSUH 3KYNA 2A9MH 3VRLF 4CN4A 2VB5A 3GSNH 1U92B 2DM2A 5C0BA 1MCNA 3X17A 4HJGB 4X7SH 1AE6L 1KGCD 1YEIH 3S36X 4RAVB 2VE6B 4X8JA 2V5TA 4RFOL 4XWOC 1DBAH 3Q3GB 1VGKB 5C0RH 3CVHH 5FAAA 4FFVD 3ARQA 1S7QB 3B9AA 3FOLA 5HVHB 4GW5A 3L3IB 4UDUA 4QRQA 4JHAL 3B9DA 2P24B 3PNWA 4XHJC 5IOPB 4KXZI 1FZKA 4RAUB 4NQDE 3C5ZA 2WAHA 1IARB 5HJ3B 4RMWA 5C0ND 5B38B 3M17A 3NAAH 3ZZ1A 4N1CA 3IDGA 4R8WH 1JF6A 2JB5H 2EDLA 1FZJA 4B50A 1ZTXL 3LKPA 3OGCA 1C5BH 4R7DA 5HHOE 3RUGE 1XF1A 5DHVA 1BHGA 3AY4A 3MBEB 2V5RA 4MD5A 3LKOB 2ZUQC 4PBVC 3R0MA 3V6ZB 2H1PH 1ZA3B 2H45A 1EGJA 1IGIH 1UA6H 3MR9B 4UQ3A 3IDXH 5BO1L 1MNUH 4G9FE 1PZ5A 1WF5A 3G5XA 4R4FH 3GI8H 3L3KA 2HJFA 4KK9D 2R69H 3ORJA 3H0TB 3GSRB 1U8NB 5HYJD 3CFEA 1I1AB 4QRPE 4KK8C 3C60B 3VXTA 1PG7L 4JKWA 4LP4A 1U8LB 2Y7QA 5SX4I 2R2BA 4YHZL 1FZOA 4UTBH 3DVNA 4AEIL 4MA8H 5J12B 4Q9RH 3GSVA 5E5UB 4OZ4B 4QHMA 4BZ2L 1CFQA 2LAAA 5F9OL 4P2RD 3QQNA 2VDML 2YPLB 4JY6A 1RAMA 5D5ME 3U2SA 1S8DB 5FHAL 4K94H 3QULB 1Q9OA 3BP6B 3BGFB 4XNXH 3SKJH 1XGTA 4N90D 4W68A 5HGAB 5LAXB 2BNQD 1JTTA 3HG1E 1DJSA 5EC2B 5HDBE 3P0YH 4LARH 1IAOA 4HIXH 1BOGB 1F97A 5IEHA 4L8SC 4HGMA 5JOPE 4L4VE 4MXQC 3VXUA 1RJLA 5ANME 3RHWF 5FKAB 2R4RH 4ONGH 4JFEA 3D87B 3DJ9A 2IQ9H 4JVPA 3EFDH 1FNFA 3MGOB 4ODXB 3T3ME 3JSSA 3TA3D 4DUWA 5GS1C 4QXGH 4WUUA 2ENSA 2DD8L 1G6RB 3T2PA 3LCYA 4XPAL 5B3JE 4HKJA 1IC7H 1WV7T 2O5XH 3OKKB 3EOTL 4U1MA 2OMNA 2CMRL 3M07A 3TNNA 3WJLC 3MLYL 3IDUA 3VXOB 5GS3A 3UJJL 1E27B 4AT6B 3UDWA 2BVPA 2JJUA 5ETUB 1IT9L 4X6BA 1DEEB 1FVDA 4QRUB 1TCRA 2XG4A 1QFWH 4JPWH 5DA4A 2BSED 5C0AA 5I76A 5D96B 3M1BA 3AM8C 1JNHB 1MCWW 1KF9B 2UZXB 3NCJL 1A7NH 3HNSL 2JCCA 3QNZB 1JBJA 4YDIL 4K71C 4QY8A 3GO1L 3VCLA 1RIHH 2F54A 4JVUA 5I71B 1AR2A 3VDCA 3UYOD 3B2UC 3LMJL 1NGWA 3HKFA 3HZMB 3RDTB 1EMTL 2XNAA 4GMSH 2PNDA 3JXAA 3VFOB 1KTDB 3D2UA 1H3GA 2VH5L 4Y4KC 2EE2A 4MJIB 4M61B 1X3DA 4L3CA 3FT2B 3BZ4A 4L4TE 7CGTA 2IBBA 4JFPA 4C58B 4XP4H 2Y36L 1FP5A 5ECJE 2JJWA 1WAAA 4C56E 4JR9H 4JFFE 5DYOB 2H26A 4HT1L 1Q72H 1TNNA 5EUKA 5C07A 1UWGL 5E5MA 4XC3L 4EI5C 1CTNA 1JHKL 3I6KA 4QYOA 2CLZA 5I17B 1F90L 4AEFA 5CJ5A 2HJKA 4XBEL 3G5VB 2VITA 2XTJD 3CPLB 3RQ3A 1ZS8A 4LEOA 1TCMA 3NFSH 3MFFB 1U9KA 3RP1A 5TGBB 4JFHD 4GRLA 3C08L 4H8WL 5DUBB 5KVGL 4UU9A 5EIIB 3DV6A 4G8EB 4DN3H 3BP5B 5D7KD 3QWRA 3RL2B 4GXVL 1BREA 4G5ZL 2QL1A 3TJHC 2OL3H 3FN3A 2R0KL 3QQ4B 2QHLA 4JHWL 4FQCH 1KEML 3VWKA 2P5ED 5H2BB 3RY4A 1K8DA 35C8L 3DUSA 4HUWA 4HWEL 3SKNA 3VWJD 3MJ6A 5I15H 1DANT 1UWXH 1PSKH 4JHZA 4ZS7L 4RMQA 5KSBE 3F6IA 1J8HD 2IALB 3PL6B 5E2UL 3VI3F 5HVWA 2X9YA 4AG4H 2EYSA 2J5LB 3GMPB 2ZUSA 4E41D 4NN6C 5B8CC 2EIBA 2NTSP 3OR6B 3WUWA 4LSQL 4XWGH 4MS8C 2QQLH 3V4VH 4JPKH 5FA4A 1IVLA 2DDQL 3C5JB 2CDGA 1KPRB 4S2SA 2XWJB 4HC1L 4R0LC 3KPSE 4OIBA 4UV7H 3WV0A 1FYTB 1BGXL 1T20A 3VXSA 1NMAL 2Y5EA 4TRPL 5C0DA 3GB7B 2A6IA 2X1PA 1ITBB 1P69B 3VFVA 5T3ZL 1A7RL 3AMLA 1FFRA 3GMMB 3WHXA 3P11L 3KPQB 2Q3ZA 4HG4J 2EE6A 1KCSL 1MCIA 1YEJH 1S9KC 1AFVH 4HLZG 1HYRC 5J6GA 3MRMB 43C9A 4XBPA 5DEGB 2Q87A 2HVJB 2R56H 3RWCB 5FA3B 3QIBC 2J8UB 1CE6A 1NC4D 1JN6B 4MA3B 3L5XL 4YWGL 2ICEB 2YC1B 1U8IB 5FCUL 4P0DA 2I9LB 1DE4A 5CLTA 1UT9A 3VG9B 4M7JL 5DJ2B 4G6FB 1U8QA 3U0PB 3H3BC 1J0ZA 3OJDA 4U0RC 1CVRA 1BAFL 3DROA 3VRJB 1BVZA 1Z6JT 4JN1H 5ESQA 5CIPA 2OZ4A 1AHWA 1NLDL 1P6AB 3PGDA 2IAMA 1ULVA 3IRZA 2K7QA 3K74B 3AAZA 1MCPL 3MA7B 3UTPE 1RZ7H 5D7JB 1SMAA 5FYKE 2APTA 2WV3A 3ULUD 1MHPH 2EDRA 5EH1A 2AJUL 3MGTB 3E8UL 4HIEB 1OAQL 2O61A 1OP3K 4OUUB 5SX5K 2YWYA 2ARWA 4LLWB 4Z5RB 1F58L 1ZE3C 4PJ8A 1I1CA 1JYXA 4LHJB 2VLRE 3QB7C 3QDME 3SJVB 3QH3B 4IOIB 1JYVA 4RFNB 1HHGB 1QRKA 2DI9A 4TUOA 5J1AA 1N8ZA 1AGEA 4K9EC 4NHUB 4X6DF 5DJXA 4ZUSA 3B9KA 1WIUA 3ZKSD 2PXYD 3ILQC 1JFQH 1H3TA 3O45B 3ARBC 2JK5B 2VXSL 4QHNA 2H32H 3EYQD 4Q6IA 3K4ZA 1RJCA 1NEUA 4YEEA 5FYKH 2HFEB 3DV4B 1JFMA 5EO9A 2WIIA 4Z7QE 2ZOKB 3DOSA 4MA1B 1KB5B 4RMSA 1KN2L 5CJOL 1NCWL 4J8RA 3BO8B 5J4MA 3IAGC 3MUY1 1MFEH 4O4YH 4FMKA 5DK2B 5DO2D 4U1HA 3AU1B 5F9JA 5HVHC 3MJ9L 5GJTH 1K6QL 2AV1A 5EO1A 4XTRC 4Z95H 3MV7B 4YNYB 3P0GB 2HWZH 1V7ML 2Q86A 4YX2L 3X12B 3V5DA 2HN7B 4JRYE 3ZO0A 2AQ3A 1WBXB 3O2DL 1RUKL 3FCTB 4NN5B 5BVPL 2GITB 2KDGA 3LB6C 2QTEA 4NQSA 4WTZG 4CAGA 5BQ7A 1OAUH 1OTTD 1J1PL 4X4XB 2BC4A 3E6FB 4GAJH 2XV6B 3CFJB 2IQAB 1Q9LA 3REWB 3HMWL 4XP5H 3TYGH 5HI4D 1XGUB 2JIXD 3OR7A 5F7YC 5FF6A 1KYOK 1LGVA 1CCZA 4I3SL 2Q8AL 5GGVH 1BLNB 1E6JH 2B4CH 4G6AD 3HCVA 3ZHLA 3INUH 2KPNA 4MJ2A 4NPYB 1RK0A 5EDXA 5CILL 3QO1A 1RUAH 3CDGA 3TV3H 3KXFD 5GGTL 5F7HA 5IWLA 4L8CA 1ED3B 1NKRA 1H5BA 3VFRA 4NKMB 4U6VH 5MENB 1QFHA 1I1AC 3MLWH 3L3JB 5ENWB 3C60C 1QRNA 2BVEA 2XFXB 3P30L 4P4RA 5BCAA 5F7EH 2X1QA 1UM6H 4GBXB 4L8DA 5FDWB 1VDGA 2XPGB 3HB3C 3DXAE 1CICD 5J12C 4BK5A 2LABA 4GAYA 1VEOA 4WEUD 4FQHA 3DSFH 1IGCH 4DGVH 5C0BB 3U6RB 1C5DA 1J1OL 1D3CA 1MRDH 2DJUA 4WGVB 4KVNH 1DN0A 1CS6A 4X8JB 4RGMB 5DVOA 1E0OB 3BGFC 1CG9A 4NZUH 1MAJA 3FOLB 4GW5B 1AO7B 1QO3A 3O6LL 4UDUB 5SWSA 1CZ8L 3GSQA 1SM3H 2XZAH 3NN8A 5B21A 1QSFE 3BD4A 4UMGA 5T1DH 1FZKB 5E6ID 3BKYH 2D0GA 3C5ZB 2E9WA 3IFLL 4FXGA 1M7DA 1YUHA 2VL5A 4YXKH 4EXKA 1MCEA 3KS0H 5D6DA 3MLXL 4P9HL 2AJYL 1BM3L 3M17B 1HSAA 3NPSB 1CL7I 4OCSL 4PJDA 3IDGB 3RKDD 2GQHA 5HHMD 1ZXQA 1FZJB 3HNVH 4NRZA 3LKPB 3OGCB 4NRXA 4R7DB 5DHVB 2EH8L 4MD5B 1I85A 4J3UA 3OKLA 2GY5A 3HE7D 1R24A 4PRDA 1IGML 5CP3H 2RIKA 5DZOA 3TFKA 5DQ9A 4MAYA 4KPHL 2QBWA 4UQ3B 1NAKH 1H3VA 1F6AA 1PZ5B 3WE6A 3G5XB 2EDEA 3L3KB 2HJFB 1HHIA 2LTQC 3IFPA 4XAKD 5E2VH 5GJSL 4AJ0A 4N8CL 3GMLA 3OX8A 3CFEB 3ZDZF 5LCVL 2QJDA 4JO3H 3VXTB 5KVFL 5EBMB 5CWSA 2Y7QB 2B2XL 2R2BB 3IDMA 4WCYH 1FZOB 2AK4D 3V5HA 4MNGE 4CMHB 5FYJE 4HPOL 3S98A 3DVNB 3ZTNL 4M62H 4U1SA 2MPAH 3TT3L 3GSVB 4QHMB 1CFQB 1KCLA 3GIZH 5IHUH 3QUZD 5I71C 4YIQA 3ZDXE 1I8MA 2JB6A 5IMOA 3GSOA 4JY6B 1N4XH 3U2SB 4QCIB 3RDTC 4POYA 4ZFOL 3TO4D 1GOGA 5A3IC 1GXEA 1ACYH 1Q9OB 4D3CH 2Z31A 4QO1A 1XGTB 5J6HA 4LRNH 5IJKC 1AKJD 2ORBL 3FZUD 1IAOB 5DT1L 4QNPF 3TBSA 4PJXE 5IEHB 2CUIA 1UVQA 1JPST 1FG9C 3VXUB 3PE9A 3U0WL 1RJLB 4W6YB 3C2AH 5D70L 4PRID 4JFEB 3AS0A 2F9BT 1MPAH 3GJFA 4M48L 2VLJE 1FORL 4WUUB 3RY6C 1A7OH 1BIIA 2CJUL 3MBXH 4XP6H 4HKJB 3DMMB 2BVQA 1W2KT 4FQXA 4U1MB 3HNTH 2CK0H 3L5HA 3SDCB 4M6NL 2W92A 3TNNB 3S37H 2Y9RT 3DNKA 2BVPB 4X6BB 1FVDB 1IRAY 1X5AA 1I3GH 2DYPA 5C0AB 5I76B 1S9YA 2AAVA 3M1BB 3I75A 4Z7VA 2BNRA 3MRGB 1BF8A 4XNQB 3HC3L 2ZPKH 3UBXI 5E4IA 2AQ2A 2JCCB 3FMGL 1NC2D 3QCUH 4OCWL 3WHE0 4QY8B 5E70A 1K4DA 3VCLB 1KJ2H 1ZT1A 4NQCE 2DWDA 2F54B 4KQ4L 3PL6C 3I6GA 4LQFL 1LEKA 1NGWB 2J5LC 2A2QT 2LE9A 2XNAB 5C0CD 2FHFA 5DDHA 5D6CA 1Z9LA 3D2UB 1JGLL 1WCBA 3AROA 4L3CB 4OKVA 3VXMA 1F3DH 2DLGA 3VE0A 2VWEC 2CH8A 1AJ7L 3ARPA 4JFPB 1I8LA 3TBTA 3UPAA 2EDYA 1PQZA 1MFDH 5J8OA 3LRHA 2H26B 5J11B 2C3HA 5EUKB 5C07B 5E5MB 2GK2A 1OTSC 4LEXL 1IAMA 3CFBA 3I6KB 4PJHA 4QYOB 5BW7C 2CLZB 1TVBA 2HJKB 3FO2A 4Z7OE 3U7AA 1RUQH 3H9YA 2VITB 4D9RD 1EV2E 5L6YH 3VG9C 1DEDA 4LEOB 4AEHH 3VGDA 3PV7A 5E9DD 5ALBH 3K8KA 4TOYH 2JJTA 4R4BA 4GRLB 4UU9B 3DV6B 2OJEA 4CDGC 3QHZH 5DUML 3HA0A 4UBDC 4OLVH 1RIUL 2A38A 1C12A 4X6CF 2I27N 4JB9H 3VWKB 1DUYA 1INQA 4MA7L 3PJSA 4UT7H 3KR3L 1K8DB 1WZ1H 4Y1AA 5D7JC 4PJGA 1EO7A 4NOBA 4HS3A 2GSIA 4HUWB 1U95A 3G5YA 3SKNB 2VR5A 5BJTA 2ZKHH 4PD4K 4PRHA 5CKGA 2UZYB 4NNYA 3WDIA 3RUGF 2NZIA 4JQIL 3V8CA 2VSCA 2N56A 4RFNC 4DTGL 4EI6B 4Z8FH 4C4KT 3WUWB 2IMMA 5FOJA 4KMTL 2G60H 2VDLH 2CDGB 5DC4B 1N5YL 4S2SB 2PYEE 2Y07L 1T20B 3CLEH 3K81A 3MV11 3UYRL 5C0DB 4NM8H 2A6IB 4S1QH 4LSTH 2WWKT 1S5IH 4MA1C 3VFVB 4XVUD 2HTKC 3J8F7 5DGRA 4AL8H 2BMKA 3WHXB 2XG5A 5H94A 4R7NA 3U36A 4TSAL 4LHUG 5JORA 2CD0A 5J6GB 5I75B 43C9B 1D9KC 1WIOA 4XBPB 4OUOA 3FOMA 3TPUE 4HZAA 4IRZH 1CE6B 1J86A 1MFBH 2DQGL 3RBGA 5HHVL 5ACMA 1C1EL 1JZ5A 2DM4A 1DE4B 3KS0J 3QCVL 3T0EA 4NN5C 1IKFL 1U8QB 1F6FB 1CTOA 4M1DH 3W39A 2AK1L 3OJDB 2AEIT 3DROB 2HT3D 5H8DA 5IBLD 5ESQB 1RURH 5C2UB 2ZSVA 3IS0X 5CIPB 1EUUA 1M1SA 3UCRA 1TZIA 1KLUB 1AHWB 2N1KA 2PW1A 3O8XC 3BE1L 3PGDB 2IAMB 5KS9F 1N3NA 3ARXA 3NVQA 5D7IE 1QBBA 3AAZB 3WYRA 5IIEA 1BMGA 1GPOL 3ZSSA 4CVZA 2BHYA 4L1HA 4OD2A 2HLFC 2XZZA 2YPVH 1CGTA 2DLIA 1MEXL 5HTSA 1H3XA 3V52H 3WIIL 1G9NL 3CXDH 3X14A 5D7LD 4FMFA 5I18H 2O61B 1UENA 3PGCA 4NFCA 2Y72A 5F7KC 5J1TC 4PJ8B 4WU7A 2YPKA 1T22A 1J9CT 5JHDE 1ODAA 3HC4H 1UM5H 1GOFA 4TUOB 5J1AB 1N8ZB 1AGEB 4ZUSB 5DJXB 5GSRA 1MF2H 5C0GA 3B9KB 5IBUB 3D0LA 5B3JF 3UTZB 4K9EH 1FIEA 3H9SA 4JFOA 3D3VD 4GBXC 3H8NA 5F7FA 2XYCA 4Q6IB 4OT1L 3QXDA 4PJ9A 2EDDA 5H37H 4BELD 4XHQA 4LSDA 25C8H 4B7LA 5EO9B 4I3RH 2WIIB 3BWUC 1G0XA 1HXYA 2IC2A 2NYYD 3DETD 4Y2DD 1W0WA 3IU4L 4OBRA 1KCGC 4U05A 3MLUL 4J8RB 2O5ZH 1MY7A 3W81A 4ERSH 5KVEH 4U1HB 3ISWA 5F9JB 5EO1B 5JXEA 1J1XL 3IU3A 1GCFA 5DC0A 3G6JA 5BS0A 2AERT 2Q86B 3PGFL 2QADD 3V5DB 1OP3H 5SX5H 5I8OH 1UEMA 3NABH 3C5ZC 3O2WL 3L7EA 2W9EH 4F7TA 4NQSB 3HC0A 4O2EA 4HJ0C 3NPSC 2C3GA 5BQ7B 5J9PA 2BC4B 2CK2A 4X4MA 4XVTL 2ITDA 1Q9LB 3BKCL 1T2QH 1TDQA 4HF5H 5J3HD 3BH9A 4OLUH 3OR7B 5GGQH 3X11A 5FF6B 1IGTA 3AY4C 1K85A 3RVXC 2VXUH 3HMXA 1I75A 3HCVB 5E24E 3H9ZA 2HLAA 4RMUA 4URTB 5D71H 1RK0B 3GGWA 1ZV5A 3MO1A 1FH5H 2YPLE 5M95B 3QO1B 3CDGB 2UY7A 4BQ9A 4XCEA 3RGVD 4L8CB 3G6DL 4GG6F 2AEPH 5C9KA 3VFRB 1XGRA 1X4ZA 2A0LD 4NT6A 4OM1H 2XQBL 2I60H 1WTLA 1QRNB 1KCVH 1Q0YH 3S37X 4P4RB 2HT2C 2A6JA 4RRPG 5DLMH 1UWEL 2OR9L 4CMHC 2O5YL 1AR1C 4L8DB 4WGWB 3I6LD 1RZ8A 3QIWA 1CDBA 4GAYB 4PJBB 2FNBA 1DVFA 4QOKE 4JFDA 4FQHB 5DEZA 2ED9A 1C5DB 1NFIA 4U3XA 1HINL 3S34H 3W9DA 4KI1A 1DN0B 4ODVH 4M02A 1CXEA 1CG9B 4ZDHA 5KVMC 3H2WA 4KJWC 1F3DJ 1BBDL 1QO3B 4JPVH 5SWSB 3LKSA 2GTZA 3GSQB 3NN8B 4EBQH 5CD5C 1FFNA 4RGND 5ICZA 3GNMH 3PQYA 1MVUA 4IOFC 3QUMH 4FXGB 1M7DB 1MAML 1YUHB 2VL5B 1HIMH 2DKUA 3ARGD 1WK0A 1HSAB 3BVNA 4PJDB 3DURA 5ISZD 3S7GA 4XCNB 4NRZB 4N0YH 1PDKA 4BFGA 4HBQA 4NRXB 1A3LL 3Q1SL 1AE6H 2HT4D 4G6JL 1T7VA 3OKLB 2HP4A 1R24B 1EZVY 4PRDB 2PTUA 1JPTL 1UXSA 2GJ6D 4MAYB 5DQ9B 4EOWL 3JWDL 4UNTA 5B22A 2BX5A 1F6AB 4ODHL 4JHAH 3WE6B 2FX8H 5MI0B 3KPTA 4OFYD 2V6HA 3JTCA 1HHIB 3GSUA 3IFPB 1E4KA 4X99A 3GMLB 3UDWC 2ZSWA 4JQXA 2BP3A 1JL8A 4HAFA 4MJIE 5F1SA 5I1GL 5CWSB 3IDMB 4RDQF 1O0VA 3V5HB 3QEGL 2APFA 4G9DB 1ZTXH 1QP1A 4U1SB 2QLVB 3RZCB 5AWNL 1MHHA 4DKFL 2VDOL 3NIDF 4YBHA 1I8MB 1HWHB 2JB6B 5IMOB 3GSOB 4BUHA 5E99L 1Q38A 1IAII 2GIYA 1H3WM 5BO1H 1G0DA 4JO1L 3REVA 2Z31B 3CD4A 3BESR 1YN7A 5J6HB 1TVHA 1M4KA 1C16A 3HI5L 2XRAH 3E2HA 4W81A 1X5JA 4KK6D 1SEBA 4FFWD 4PJFA 1P4LA 3TBSB 4YHZH 4HCRL 2Q7NA 1SY6H 4G7YL 1UVQB 2R0LL 1NAMA 1I4FA 4FQIL 3V4UH 5C09E 4F7PA 5J11C 4V3DB 4BZ2H 5F9OH 1QOKA 2DAVA 2NW2B 2VDMH 3HZVA 1LD9A 3GJFB 3TH3T 3TLRA 4ODSH 4Z7QF 3SDDD 4Y8DC 1TPXB 4M1GH 1BIIB 3UMTA 4HKZB 4P2OA 4CU8A 4Z7WB 1I7RA 3QISA 2IPTL 2BVQB 4F2MA 4FQXB 4GRLC 1N6UA 3LKRA 3ARYA 3MRRA 3MGAA 4R97B 4P57A 2VXQL 2W0LA 4Q58C 4J3TA 5C8JB 12E8L 5CCKL 4P4KD 3VWKC 4EUPG 1MCFA 1WWAX 2DYPB 1YY8B 1IFHL 1S9YB 3KPNA 3I75B 1A4KA 4Z7VB 3SGEH 2BNRB 2EEBA 3HHRB 2VWEE 2M8XA 4MVBD 4PTTA 4IHOA 2AEQL 4IDJL 1N0XH 3EJYD 1WC7A 1K4DB 1ZT1B 4A6YL 1ADQA 2DWDB 1KJ3H 1ZMYA 4WO4B 2YRPA 3I6GB 4ZUWA 1JPFA 1LEKB 3S4SG 3H9HA 4OGAC 2UUDK 4WW2A 2J8UE 2FH8A 2CMRH 3MC0A 5IV2A 3LAFA 5D6CB 4YDKL 4YAQA 4UNVA 3DX7A 5IB2A 4N68A 3MLYH 3C6LD 3UJJH 5TQ0L 1WCBB 2IBZY 1QSVA 4FG6D 3VXMB 3GK8H 2FBJH 4HIJA 4XXDA 3TJEH 3VE0B 2Q8BL 4BQ8A 1QSEA 3RJQB 3VU2A 5DD0L 3TBTB 4KUCF 5EZIL 3NCJH 1CD8A 4HMDA 3ZE2F 5GS2D 1PQZB 4RDQG 4YDIH 5HYJA 2GAZB 2KKQA 3GO1H 4JDTL 3BZEA 5I75C 4GW1A 4KJQC 3CFBB 4OCLC 3LMJH 4PJHB 3OKMA 3WNKA 1MFCL 3TF7A 1TVBB 1AXSA 1EMTH 3F62A 4OZGF 4WRLA 3FO2B 2VZTA 3D39D 3ZHDA 4B5EA 4AH2B 5DD3L 4KZEL 1NGQH 2VH5H 2YN5A 4R90L 5K33A 3U9PL 1OSPL 2X4TA 3MFGB 4WTXA 5MHSE 2GK0A 2OJEB 1AHWC 4NHUE 2IAMC 1LK2A 1C12B 4XBGA 3U7WL 2Y36H 4LHUD 1UH3A 1DUYB 3KPRA 1INQB 3TN0A 3PJSB 4Y1AB 2BNQA 1T1XA 4I0PD 4PJGB 4HT1H 2Y1VA 4HS3B 2GSIB 1UWGH 1U95B 1R5IA 3G5YB 1JZ8A 1F4AA 2Y23A 4Y16D 5BJTB 1JHLL 3LV3A 1F90H 4PRHB 4XNUH 4NNYB 3TGXA 4XBEH 1KIUA 5F88A 4PJ8C 3MRIA 1F02I 3GHBL 3ET9F 3MUHL 4Y5VA 5B39A 3QFDA 4ONOA 4H8WH 3B9KC 2IG2L 2AGJH 3KPLA 3IFNL 1NL0L 4OZFH 4KK5D 4GXVH 4G5ZH 4Q6IC 1U36A 2R0KH 4JHWH 5FUCC 5CD3A 2WMPA 1KEMH 4F9LA 4FP8H 3QUXA 4HUUA 2MQ0A 3EIFA 35C8H 1EX0A 2PO6A 1FBIL 3RL1B 2DBJA 4HWEH 4M5YL 1BZQK 1KYOJ 2BMKB 4NQEA 3BN3B 5H94B 4R7NB 3U36B 1BFTA 4ZS7H 5JORB 5T1MA 3GBML 5C70A 2VISA 3FOMB 5E2UH 3Q2CA 1U3HD 3R8BB 2BY2A 3L7FA 2GT9A 2A77L 3ZDXF 3C8HA 3NZ8A 3T0EB 2X4QB 3IGAB 2DDQH 1P53A 5T3XL 3W39B 3FQUA 3BDYL 4HC1H 5EOQL 3VDAA 4OV5A 1EO8L 3GSNA 2ZSVB 1CFVL 1BGXH 1ORSA 4UOW1 5MENE 1R0AL 1NMAH 4NQDD 4TRPH 5EO0A 3U4EA 2PW1B 1CLYL 1N6VA 2I07A 1J0YA 1N3NB 2AI0L 1C5CH 3FQTA 2VLLA 5F6IB 4QXUL 4NZRL 5K9OA 1A6ZA 1A7RH 3NGBB 3WFHA 5IIEB 2QSVA 1XGYL 1IGJA 3P11H 4CVZB 1YMHA 3CVHA 1OQOA 1KCSH 2FHCA 4OD2B 3EDEA 2BRRL 1IEBA 5HHOD 5HDQL 1QLEL 4OZIA 2A1WL 5C0BE 3B9EA 5TH2A 4M4PA 4WV1A 2B1HL 5K59F 4NO0A 3L5XH 5JZ7D 4PGJA 2YRLA 3S9DB 5IWLC 4WU7B 1RMFH 1T22B 1U41A 1H5BC 4M7JH 3UZEA 4G9FD 4AQ1B 2BJML 2GW5A 1WLHA 3QIUD 3QUYD 4APQD 5E03A 5FYLL 1BAFH 1OTUC 5GSRB 5C0GB 3D0LB 3CX2A 2YK1L 4H88L 3H9SB 1NLDH 5C0FA 4JFOB 4QRPD 1D5MA 5J57B 3MOQA 3CSPA 4N5UA 1MCPH 3QXDB 4PJ9B 1IC4L 2Z91A 5TE7L 1VESA 2AJUH 4NQXA 2DQCL 2NY1D 3BSZL 1W0WB 3E8UH 1QD0A 1OAQH 3FL7A 1XF2A 1RPQA 4OV6F 4MXVE 1F58H 4LPYA 4WUKL 1XGPA 3IU3B 3I02A 4O02L 3G6JB 5BS0B 3HRPA 3FO9A 1N7ML 3NFNA 4OIIL 5IW1B 5DI8A 3L7EB 2VXSH 1J8HA 1GC1C 1XFPA 5D6DC 4X9BA 3HC0B 4O2EB 1MCHA 5J9PB 5JOPD 2V7HA 2W60A 2ITDB 1IJ9A 4HUNB 2FDBP 3MRDB 2QSTA 1CU4L 1WBYA 4M43L 3BH9B 1JYNA 2J2ZA 2YUZA 3X11B 4QLRA 1IGTB 1I85C 1KN2H 1FVEA 1FNGA 4K8RC 1CGWA 4K2UL 2Q20A 3WFBL 3TFKC 4PJEF 4MAYC 3CMOL 2HLAB 4Z77A 3MJ9H 1K6QH 4GLRI 3GGWB 2PF6A 3MO1B 4DK3A 2WUCH 5MI0C 4XCEB 2P8PA 1V7MH 1G9MC 4YX2H 2EDXA 1RUKH 1KLFA 5BVPH 4Z7OF 4YHOL 4NT6B 5SV4A 4PJIE 1J1PH 3HUJF 3MV9A 2A6JB 4DVBA 2A6KA 3HMWH 4XNYL 1RZ8B 3QIWB 4AY0A 1KENL 3GJFK 1HK6A 3S6CA 4I3SH 1DVFB 2XN9E 4JFDB 3VXUE 5IBTL 3SE4A 5ESVA 3T1WA 1NFIB 5K9KA 4KKCD 4HUKB 4JFEE 3W9DB 4G80A 4YK4B 3B5GA 1F4WL 3JWNC 5CILH 3RVTD 2CRZA 3WIHL 2Z31C 4L4VA 5GGTH 4ZDHB 3MQIA 4XGZA 4WUUE 5ANMA 2H2SD 3MRKA 4PRPA 2FATL 3LKSB 3O11A 4NRYA 3HN3A 1FFNB 5ICZB 5AG9A 3P30H 3P4OA 3PQYB 1MVUB 4N8VA 1PY4A 2LU4A 4TNVK 2WINA 4KKBC 5C6TL 4L4TD 3UJTH 2VDQL 3BVNB 4OGXL 3DURB 4ZO7A 3DGCR 3K8MA 5D1ZD 4YZFF 2IFFL 3R4DA 4MJ6A 4C56D 4ZNEA 1J1OH 4JFFD 4D9QE 1SBSL 2R1XA 2JCCE 1TPXC 5DJ6B 5C08D 3LOWA 3O2VL 5J06A 1UXSB 4FHBD 2F54E 3RAJH 1G7LA 2EH7L 3HLAA 3O6LH 1CZ8H 5F1NA 4FQXC 3ZE0F 1YMMA 4RFEA 1CN4A 3O3UN 1YNLL 3LQAL 3GSUB 4R97C 4X99B 2YR3A 3IFLH 2ZSWB 3LN4A 3UTSA 3MLXH 4P9HH 1C08A 3EAKA 3SGJA 1BM3H 4OCSH 1PD6A 1MWAL 1I3RA 3STBA 9CGTA 4XT1C 4LLMA 2DIBA 2EH8H 4ELKA 2HVKA 5HI3C 3NZHL 1D5ZA 3OXRA 3K2MC 1WAAE 5D7IF 2C3WA 2R0ZL 4GRWF 5C07E 3ULVF 1NCBL 1NANI 4KPHH 3O6FA 3QRFM 4OD1L 2P5WA 1R3LB 3REVB 3M45A 2NR6D 4DGYL 3EYOA 5JW3L 1XZ0A 2X2YA 4ELMA 1YN7B 5GJSH 1TVHB 4N8CH 5EU3A 1C16B 2RGSA 3E2HB 5LCVH 1SEBB 2VXTH 4F15B 3FAWA 1RJYA 4U0QB 4PJFB 1P4LB 4ZMAT 4ZAKD 1V7NH 2D7TL 2R9HC 1A4JA 3KXFA 1I8LC 3KPSD 3MCLL 4HPOH 3ZTNH 4MNQA 4MD4A 1NAMB 4PYGA 1I4FB 4WI8A 3TT3H 4KDVA 4UT9L 5GSVA 4F7PB 3O4LA 3S5LA 4GJTB 1KIRB 2GTWA 1CXKA 3HZVB 1LD9B 2NX5A 3VMNA 4PD4J 2EECA 5KSUA 1K9TA 1BECA 3BMWA 2UWEA 4EDWL 2W1NA 4P2OB 1I7RB 5CJXA 1UFUA 4LPXA 3MA9L 2JJTC 4F2MB 3LKRB 4M7KL 2HG5B 1DQTA 4WNQA 3MRRB 2ORBH 4OF6A 5DT1H 4P57B 1MCRA 5IGXL 1CQYA 4K3DL 5GZNC 4R96A 5KSBA 4WI4A 4BZ1H 4PP8C 3KPNB 5D70H 1A4KB 4JEGB 3VXSE 2WQ8A 3CLFH 1ACZA 5IB1A 3UTPD 5TDNA 4IHOB 5FYKD 3T0BA 3RVWD 5CFHA 1WC7B 1K2DA 4M48H 1FORH 1ZGLP 5A16A 4J1UA 4OAWA 1JPFB 1H8NA 4YXHL 1CLZL 1S9XA 1Y18A 3DBXA 3H9HB 4LAQL 5IHLB 1Z9OA 3OKDA 3QNYA 4FXLA 4WW2B 5BZWB 4CW1A 1KFAL 5IV2B 2VLRD 4YAQB 4M6NH 3FRPA 4H1LG 3I9GH 3DX7B 5GS0D 5IB2B 2VNCA 1AXTH 4OBSA 4HIJB 5I16A 4XP9L 4TTDD 1AQKL 4XXDB 3VXNA 1N59A 1YY9D 1OP9A 1QSEB 2I26N 4PYHA 3MRHA 3HC3H 3P9MA 1JMXA 2EXWD 3FMGH 3NCCB 4OCWH 4NSKA 2R1WA 3BZEB 4KQ4H 3FAXA 2BDNL 4GW1B 4RGOL 2AK4A 3OKMB 2VLME 3UAJC 3LSOA 3E3QA 1AXSB 2D03L 4J12A 1BQHG 4X98A 1PJ9A 3QRGL 3IXTB 2H32A 4ZUVA 3T0EC 3V7MA 3TIEA 5I8KL 1NJ9A 2IADA 1JGLH 5IROA 4JRYD 2X4TB 4NHCL 5K9JL 2GK0B 3TO4A 1KPVA 4OF7A 4PLOB 2OZ4H 1LK2B 4U1IA 1AJ7H 4XBGB 5F6IC 5GRXG 3KPRB 3NGBC 3TN0B 5FUCE 2BNQB 1T1XB 2E7CA 4M7LL 1LQVA 3QDMA 5EN2A 1AKJA 3ESVF 1R5IB 1AIFA 4LMQI 4LEXH 1RZFH 3LV3B 2X40A 3SDXA 1A7QL 4UOJA 5B38G 1T6VN 5F88B 1HILA 2MQCA 2W0FA 3JV6A 3MRIB 2YD4A 4QWWD 3FHQA 1P7HL 1QR4A 4I4WA 1RVFL 1CGUA 4Y5VB 5B39B 3QFDB 1WEJL 5GXBB 1PLGH 1RIVL 4LOUC 4XWOD 1V3LA 2PTVA 4WY7L 3KPLB 8CGTA 5DUMH 2CRYA 2EC9U 3VXRA 1RIUH 4UZGA 3CFIC 5CD3B 4KUCD 4PJ9C 3NIFF 4MA7H 4XCYA 4XHJD 3QUXB 1U58A 4HUUB 4JGJA 5CGTA 3EYSL 3DXAD 2A83A 1N6QL 3WN5A 2PO6B 2VDNL 4XMLH 5DRZA 2AJZA 4NQEB 5IJVA 2YMXL 4S1RH 2D4DA 4XNZB 4XMKL 3MROA 1MREL 2VLKA 4X83A 5T1MB 4JQIH 1ROWA 2FB4L 2VISB 5JXEC 2ENYA 4L3EB 3L7FB 2GT9B 4DTGH 1I9IH 4HK3N 5D1XA 1ZK9A 3NZ8B 1N0LA 3O3DA 5HI5C 4E0RA 4KMTH 4K7FA 1GSMA 5BRZA 1N5YH 3IDYC 1VENA 1IMHC 4GKOA 3F7PC 2G5RA 2HFFA 1AI1L 4OV5B 3GSNB 3CIQA 2Y07H 1ORSB 4MDIA 3UYRH 5C6WH 5EO0B 3U4EB 1ES0A 1NUFA 1QRNE 5D93B 1T66C 4WHTA 5FV1L 2I07B 4BSWA 2OTWA 1EO5A 2VLLB 3FQTB 1VCAA 4LBEA 1B0GA 2NXZD 1A6ZB 5DFVC 3WFHB 4KK8D 1IGJB 1YMHB 1A0QL 3CVHB 4U3CA 4HSQA 4TSAH 1IEBB 2GHWB 4OZIB 1A1OA 2VXVL 1P1ZA 3TVMA 5TH2B 4DWHA 4WV1B 5ACZA 2DQGH 4NFBA 4NO0B 4M6OL 5HHVH 2NY4B 1C1EH 5HHQA 2CKNA 3C9NA 3I50L 3F7YA 1CFNA 3QCVH 4NUJA 2YRZA 1IKFH 4KHTH 3T2NL 3ULUL 3ARTA 5EU7C 4F7MA 1YA5A 4DGIL 3H42L 3E0GA 2FJGA 3VA6A 2P44B 5SWSE 1W8OA 4LLVA 2WANA 1UKSA 3BE1H 5C0FB 1D5MB 4M3KB 3U9UA 4P2QA 5KTEL 3OL2A 1IZKA 1KTLA 3ALXA 3QIWC 5GRUH 3GI9L 2NY0B 4TVPD 1MIEL 4WWKA 1DVFC 1GPOH 5FYJD 4ZTOL 1FE8L 2Z91B 4PJDE 1F8TH 2XTLA 2V9QA 2A6DA 4NQXB 4MXQD 4OGZA 1MEXH 4ENEC 1SBBA 4YK4C 2R4SH 2OR8A 3WIIH 1G9NH 1LK3H 4S0TD 4OQTA 1XF2B 3M8OL 4C83A 1Q0XL 4JFXA 1XGPB 5AYUH 4JCMA 1I8IA 3I02B 2VQUA 1HWGB 5GGSA 3FO9B 3S35L 3NFNB 1TZGL 3ZT6A 5JR1L 1YEHL 2VR4A 4MQ7A 4XC1L 5L2KD 1KELH 2J8UF 3W11C 3MUGA 2XOTA 2J1KA 5CEYA 2FHBA 4OT1H 5L9DL 4JZOA 4LCYA 3LKQA 2XQYK 1XF4A 1EZVX 1BD2A 1WBYB 4Q9QL 4O00A 1V3JA 1IM9D 1BVLA 2FX9L 2ZUVA 1FVEB