3PWUA

An immmunodominant ctl epitope from rinderpest virus presented by cattle mhc class i molecule n*01801(bola-a11)
Total Genus 70
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
70
sequence length
274
structure length
274
Chain Sequence
SHSLRYFYTAVSRPGLGEPRFIAVGYVDDTQFTRFDSDAPNPRDEPRVPWMEQEGPEYWDRNTRIYKDTAQIFRANLNTALGYYNQSEAGSHTFQEMYGCYVGPDGRLLLGFMQFAYDGRDYIALNEDLRSWTAADTAAQITKRKWEAAGEAERQRNYLEGRCVEGLRRYLENGKDTLLRADPPKAHVTHHPISDREVTLRCWALGFYPEEISLTWQHEGEDQTQDMELVETRPSGDGTFQKWAALVVPSGEEQRYTCRVQHEGLQEPLTLRWE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords MHC class I antigen
publication title Two distinct conformations of a rinderpest virus epitope presented by bovine major histocompatibility complex class I N*01801: a host strategy to present featured peptides
pubmed doi rcsb
source organism Bos taurus
molecule tags Immune system
total genus 70
structure length 274
sequence length 274
ec nomenclature
pdb deposition date 2010-12-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3pwuA02
3.30.500.10 Alpha Beta 2-Layer Sandwich Murine Class I Major Histocompatibility Complex, H2-DB; Chain A, domain 1 MHC class I-like antigen recognition-like 3pwuA01
4M48H 3DV6A 5EIVA 2XA8H 2B0SH 4Z7UE 2JK5B 4Z9KB 5IB1A 2FGWH 1N2RB 2DLIA 5FA3A 1L7IH 5FUCC 3U83A 1UA6H 4Y16D 4H8WC 2E7CA 1QPXA 1FZOA 3HS0A 2RCSL 1HHHB 1YEIL 4Y16A 1XF2A 5DJ2B 4NQDB 3QUMB 1J05A 5HHME 3D0VA 1BVKA 3BHBB 4WUKH 1VPOL 1N7ML 1ZLWH 5I17B 4HMDA 4MB3A 3CVHL 2Z31A 3JWDH 1OLZA 4OCWL 2R8SH 2VKWA 3PP4H 4NGHH 4HKXB 4GMSH 3ARFB 4XNUL 1AH1A 3QXAB 5F6HJ 4KRMB 4GAYA 5C0BA 1LEIA 4KI1A 5EC2B 5E8NA 4Z7OE 1A1OB 1T21B 1FCCA 1K3ZA 3BPOC 4I4WA 1V7NH 1BZQK 1I85A 2WBJD 4JVPA 2FEEL 2Q8BH 1A22B 4X98A 2WBJA 1CL7H 4J3TA 4U6XA 1FP5A 4K7PL 1FL3A 1R5VB 3BESR 3MLRH 4MX7B 2VUYA 4DKFL 5I1CL 4RMTA 3O45A 1MCCA 4I8DA 5CFHA 3QYCA 3B9EA 2FJGA 1NGWA 5HGBB 3EO0B 3IDYB 2YA1A 1YEFL 1RURL 3HE6B 4H5SB 3OJMB 1F8TL 3C6LD 3ETBF 4GKNA 4EQ2A 1VKXA 4B5EA 5I1GL 4Z77A 1X5HA 3C6LA 1FGVL 3SJVA 3HPJB 1LQVA 4P3WA 1FG2B 4KH2A 5GZOD 3O3DB 3NAAH 3CIQA 4I0PB 2NY0D 4G7VH 2VOTA 1T0MA 3UTSB 5C09B 3NA4A 3SDAC 5I1DB 3QXDA 2VDMH 1MRFH 1XF5B 4U6TA 4XRCB 5F7EH 5IVZA 2BVPB 1N8ZB 3MUGB 4Z0XB 4AQOA 2HTLC 3L3OA 1CFVH 5FYJL 4M1DH 5F7YC 1VERA 4C56D 1FJ1B 3PQYE 4XCCH 1LILA 1UB6A 2VDRL 4IIQB 5FHBH 2EECA 2PYEE 4ZMAT 3HI1A 1SYVA 2BSSB 3NGBB 4NJ9L 4BQ8A 3UTTA 4C56A 2I5YL 1Q9LA 4P23D 2YSSB 3UAJD 2DL9A 5JW4N 4N0UE 3BPLC 4G7YL 1RUQH 3HLAB 4XGZB 3MZTA 1T7YA 3BVNB 5HI4D 4HHAA 1ES0B 4I3SH 3RWIB 1P69B 4PLOB 3ULUE 1P84K 1IGFL 1IM3A 3MJ7A 4U05A 1KLUB 3HTLX 3KAAA 2KZWA 3OKMB 3OJ2C 5E9DA 2D7OA 2XQBH 4P2QA 3RVTD 4UNTA 1EXUA 2NW2B 4JZJC 1QFOA 2X1OA 2VZSA 1IZKA 5FYJE 2BSRA 5C0EA 4MA1C 1RJCA 4MLIA 2QQLL 1Y6MR 1X44A 1ZVYA 3GB7A 1W0VA 3MRHA 2F5AH 1DR9A 4M93B 3OG4B 5L6YH 4DZBA 4OFPA 4YUEH 2DQCL 2JKXA 2ED8A 1JYVA 4ACPA 3RTQA 2EYRB 1T89C 3DMMD 4X0KB 5GJSL 4M02A 3BQUB 4TSAH 1U8JB 4NKMA 3KPNB 3DMMA 2FATL 2W38A 5ERWB 2H26A 2FX7L 4WY7L 3QI9B 2DDQH 4XP9L 3JV4B 5CUSL 2NYYC 1AHWA 4N1CA 3H9SE 3QIWC 1MFAH 2FH8A 3PWPA 1EMTH 2EEDA 2A9NH 3M1BB 4ZS6C 5SWZE 4EBQL 4WFHD 5IR1A 4OF0A 1S9YB 4RWYL 4NHCH 3GSRB 1JYNA 1IAOB 5JW3L 1U91B 4QHKI 4HIIB 3MCG1 2E5EA 3PWVB 3DO3A 4KI5C 5HI5C 5BJTB 4O2FA 4Y2DB 2X4OA 1EX0A 2VXSH 5JXED 3M8OH 4XMKH 4Y4KD 1A0QH 4M61A 1D6VH 4PRAA 4Y4FD 4NHUA 4LPUA 4JPWH 3HZYB 1FVCB 4IOFC 3MRQA 3MUY1 4X7SL 3UYPA 3KJ6L 2NTSP 4HK0A 3CZFB 3S35L 1IARB 1UJTA 1SJEB 2P48B 4ORGA 1PAMA 4KK8D 3PWNA 4WU5B 3KDMB 4XPTL 3OR7A 2XPGB 3GIVA 1ORQB 4YHPA 5CJOH 2J3SA 4WEUD 3CFJA 5DJ0A 3U6RA 4PR5B 3PGFL 3SBWC 2X40A 3GMOB 3VWKD 5FHAH 2X1XR 5DD0L 3VGFA 4KKAD 4QRTB 12E8L 3K8LA 4PJEB 4UB0H 3TZVD 2IPKA 4AIXA 5DWUH 4IRJC 4X4MA 5HGGS 1J1OH 4MQTB 1KT2A 4K3DL 1DBKL 1AP2B 1QSEE 3VFNB 3MLYH 4QHKJ 4KMQA 1RZKL 4MYWB 1BAFL 4QNPF 1KN2H 5F6IC 5DJZB 2PKDA 1GZQB 2VITA 5F9OL 5TH2A 2BMKB 2XNAB 2UZXB 1U8IA 4N8VB 4YDJA 3KYOB 3U4EB 4HV8A 4LARH 2DLGA 1X5LA 2GYSA 4NUJB 1X5GA 4XP4H 4XCNB 3DGGB 3F7VB 4GRLC 3C2AH 1K4CB 4R2GD 3S3JA 3MLVH 3FFDB 3LKOB 3SGDI 5DGQA 3SDXF 1OPGH 4ZUVA 3AS2A 3TIDB 1DBAL 1I7UB 1RULH 2DWDB 3RKPA 3UXFA 3EIFA 1A8JH 2VLKD 2NY4C 1WITA 1U58B 3BPNB 5DVMA 3DXAB 5J6HA 2VLKA 4EI6B 4K94C 3WIIH 1B0RA 3WS3A 4GW5B 2AJ3B 3QJHB 4RCAA 3NIFF 2XA8L 1AGBB 3SDXE 4U1NB 4YFEA 1UA6L 1I3VA 2RJMA 5A2FA 4EDWH 2YK1L 2YXMA 3SDAA 2E27H 4CL7A 3NFPA 5IIEB 4JM2D 3NIFE 2VLJB 1QRND 3GIZH 2E7LE 1KXVC 3QCUL 3QWQB 1NAMA 4JM2A 3P4NA 2DM2A 3CJJA 5GGRB 3O2WL 1DN0A 3JWDL 4FOMA 4F2MB 4ONFL 5F7MC 3IXAB 3GMLB 1KGCE 2R1WB 4BH7B 3SKOB 1XCTA 1D5ZB 1NUGA 4OD2B 3RX8A 4FG6D 1XIWC 4NRYB 4P9HL 3EYFA 4NRXA 5HDBF 2WWMC 3O4OB 3ARBC 2LU4A 4RX4A 1J0IA 2A2QT 4K7PY 4KJWC 3CPLA 2Q8BL 4FNLH 1ZHBA 1U8KA 3MODH 5IJKC 4TOYL 4JZJA 1XGQA 1II4E 2YD5A 4BZ1L 5DVNA 1GOHA 2A74B 2NTFA 2D9CA 2WUBH 4UTBL 3UEZA 3MLRL 2JF1A 4XWOC 1NLBH 2Z35B 2ADIA 1TENA 4KUCD 1KJ3L 4XNQB 3BDXA 4FXLA 3UDWC 1AE6H 4BKLA 3ZO0A 1I7TA 3OAUH 3X13A 1IAIH 1A7BA 1R5IA 4K3HA 2NY2D 3TA3D 1G7HA 4LCWB 3UPAA 4U6YB 3H8NA 5J13B 5HGHA 3PV6A 4UDTA 3FQWB 3BKMH 3OB0K 1MCLA 4LHQB 1A14H 1IAIM 1T89A 4ZO9A 1LE9A 1H15B 4GFTB 4E41B 3C9NA 1G6RA 3NAAL 4X7EC 1TNNA 5EU6A 1WFOA 3KPOA 1G7LA 3QUZD 1Y6KR 2ARJB 5JUEL 5F7EL 1ZE3C 1H3WM 4PJ9D 3DJ9A 3KYKH 4KJYB 4XCCL 3TO2A 5D7IB 1N3NA 4XC1L 5GS2H 4O02H 3TT1H 4G8EB 4UOJA 3DTXA 1FZJB 1GZPB 3ZLQC 1DANT 3WHXB 1R3IH 1BFOB 2HFEB 2DTSA 4OZFH 4YC2C 5HYJD 4NKQB 3C09B 4XC3H 1RU9H 5IUSA 1YNTA 1UM6H 4I3SL 1HWHB 3GM8A 1GRWA 1BP3B 3EUUA 2OQJB 4L8CB 3W5MA 1LO0H 1QKZL 2VZTA 2YPKA 2EIBA 3M45A 5A16A 5HJ3A 1BX2A 5H94B 4OLYL 2KH2B 2DIBA 4HXBL 5EO9B 4WEMB 2OYPA 4HKJB 4U1IB 3UTPE 1P4LA 3LRSA 4EUPA 4X9BA 4EZMA 4FN0A 1G7MB 3T0VA 4D3CL 2B39A 2Y5TB 4JRYB 3SBWA 3S6CA 2VC2H 3ZKXC 4HBCL 3ARVA 5E8EA 3EOTL 4MA7H 2EC9T 4MXWL 3WDIA 4QHLB 3QQ4A 2XRAH 4PS4L 2CGRL 4IOSD 2F5AL 4WV1C 5L6YL 1MH5B 2XTJC 4O00A 3ZE1F 3DLQR 2ZUUA 4RQQB 4ZXBD 4ZAKB 1W8OA 2I9LA 3HC0B 4G6MH 4PJ8C 5SWQB 4R96A 1I9RL 5EOTA 2YUZA 4WW1B 4ETQA 1IC5H 4AIZA 2WQRA 4JGUA 1HHJB 1WBXB 1CTOA 4RNRB 4Z8FH 3IVKA 3K4DA 4S1SH 5MP6L 3LN5B 3MV8E 3UX9B 3ZE1E 1HXYB 3H3KA 5EU3A 1G7IB 3QDJD 3U9UA 1JGDB 4C54A 1CS6A 1W8NA 4H88L 4GRLA 3THML 4EN3B 3S9DB 1NGQH 2BY1A 3O6KH 4NSKB 2XZAH 4ELMA 1S78D 3LEVH 4NHCL 3WEXB 1XFPA 1O7SA 4X4YB 2CJUL 3WLWC 1A6ZB 3LKQA 5DRXB 1N6QH 3AS0A 3TYFA 4AZ8A 1T66D 2KL6A 4XXDA 1ZMYA 5AWNL 5CIPA 4EXPX 4H1LH 5L2KD 1Z0NA 4LLUA 3MBXH 2BSED 2VXSL 3ARGC 2E7HA 3ZKMC 2BY3A 1A0QL 4HAGA 4Z7VF 3VXSA 3ECBB 4K71B 2AJSL 4JY6A 1BFVL 4TQEH 1ZA3B 4OD3H 5JXAH 3KHOA 3WS6A 1A1NA 2A77L 3ZYOA 4PJDB 4GW4A 3V5KB 5D1QC 3UJIH 2W0FB 1E4WH 5E5UB 2W0LA 4CU8A 4YNYA 3FN0H 3CGTA 4YR6B 1HOCB 4Z7VE 2O61B 4U33A 5CJOL 3TT3L 5GJTL 4X6FA 3VH8A 1QHPA 1F42A 2FB4L 5CCKH 4BK4A 4KTDL 4NUGL 3V0VA 3GMPB 5D1XC 1YEJH 4EIGB 1GC1H 1Q9KB 5GZND 1J1OL 3P11H 2EICA 1AIFA 3WNPA 2X4TB 4PRNA 1MFEH 2RB8A 3MLYL 3PGCA 4WNQA 2OJEA 3VMOA 1R3JA 2P5WD 1XH3B 3QRGH 2EDRA 4M1CD 5IFAH 4OFVA 4DGYL 3D3VB 4HAFA 4ZYKB 3LDBB 2P8PA 4DN4H 5CINH 4JO1L 1EJ6A 3IJHB 4Y1AA 4NN7B 4MA8L 5KSAB 1H3VA 1BOGB 4KY1L 2PR4H 5IJKA 1I4FB 4F3FB 4P5MB 4U1MB 5T3ZD 1SMAA 5CMAB 3VXTB 3X11A 4NM8H 5EULV 2ZUVA 2UYLB 4LP4A 5F1NA 2Q7YA 5HXMA 1QP1A 5C92A 4CMMB 2E6QA 1T0NB 2VAAB 4L8BA 4ZPVB 4B53A 5HVFB 4OKDA 2LTQB 4LLYB 1FFQA 4HIEA 3W11C 3GRWH 3RNQB 5TDPB 4XZUA 5E8PB 4PJAB 3KS0J 2X4SB 5IEKB 1JWMB 1BD2A 3ARED 2EDYA 4KDTC 1TTGA 2IBZX 3QZWA 5E1AA 1QSFE 4EI5D 2ZSWB 2I07B 4HQQH 1XEDA 1TPXB 1AKJA 3S36H 1W72L 4YHNB 4EI5A 4EDWL 1PG7X 4X9GA 4YK4C 2DICA 4R90L 1NMAH 2MSPA 2P24A 5GGTA 5T1MB 1FYTE 3DSNA 1KCVL 2GCYB 4IRZL 5JZ7C 1KIPB 2HT4D 1FC2D 4L8DA 3GIZL 4BSJA 5HDQL 2F54A 4PLKD 5FF6B 5AZEL 5JW4Q 3G5VB 3FQXA 2VR4A 5EWIH 5HHQA 1DBJH 5F8RC 2DQFB 2HTKC 2IAMC 5CZVL 3SE9H 5DQDH 3B4NA 3CFBA 5H37G 1A3RH 1P6FA 4L4VB 3L5WB 4JHZA 1XGRB 4H25A 1UWXH 4LPTA 1UXSB 3TN0C 5E00B 4N0CD 4E42A 4P5TD 4L3AA 4U1HB 5DJDA 5KAQG 3I6GB 1DDHB 3SGKA 4A6YA 2YPLE 2FJFA 5KSBA 3FTGB 1T1XA 4TSBL 1DQQB 1N59B 1CVSC 3NCMA 4FNLL 3S3PA 3W39B 4B50A 1K6QH 3EYUH 3MODL 3REVA 1F02I 1QO3B 1HDMA 5IT2H 1J0YA 1TZHA 1DEDA 3FFCA 4MCZB 5F7LB 4I9WE 1NLBL 5BRZD 2Q8AH 1MQKL 4GAJL 1R3KA 1P1ZB 3WO4C 1AE6L 3OAUL 5BRZA 1IAIL 4OM0H 1N0XH 2VTFA 1ITCA 2J88L 3ZT7A 3CK0L 2PXYB 5D5MF 4XNZB 3UPCA 1RUPH 1YECH 2BY2A 1FDLL 2R4SL 5IMMB 3MLUH 3OGCB 4UV4H 3ULVL 5D8JL 1B3JA 1A14L 3CVIH 4KPHH 4Y5YB 3FO2A 1A3LH 5F71A 3P9MB 2VSCA 1D7FA 4F37F 4PJHE 3ZDXF 1WTLA 2VLMD 1BF2A 5K33A 1RIUL 3IDXH 3BPCA 5D5ME 3GUTB 5D2LF 1H3XA 3P77A 2V9RA 2EDDA 1RIHL 4O2CA 4HD9A 5C2UB 3GSVB 3NFNB 4MDIB 3KYKL 4P59L 3ULVF 3S3SA 1BJ1H 3T09A 1OCWH 5C8JA 4PJBB 3R8QA 4LQFH 1A7NH 2J1KA 4O02L 3TT1L 4AMKL 4RRPA 2P7TA 2NY3C 3ZDXE 1VDGA 2VIRA 2HRPL 3ARSA 4CGTA 5EZJB 4GXUN 3NPSC 1FCGA 1IC4L 4G43B 1R3IL 4M7LH 4QRUB 1FFPA 4YJZL 1J1PH 4E9LA 2GI7A 1SJHB 5D2LE 4M4RA 4OQTA 1ERNA 4D9LL 4O9HL 2AV1A 3MRLB 3OV6A 3QIUD 2AJZB 3MV7E 4F7PA 3ULVE 3Q6FA 4J4PC 1A5FH 5GRZA 3AROA 3DBXA 2IG2H 4H26A 5EUOB 1RZ8B 3ARGA 3O4LE 3QIUA 5F88A 5FIEA 5I66B 4WO4D 5FUOL 4GKZA 2IJ0C 4MGXA 1C08A 2DM7A 4KXZH 4LDEB 5F93C 3WFCH 5MENB 4GG6B 1P7KA 2Z9TA 3CFCL 1FNEA 5KN5A 4WO4A 2JB5H 4F58L 1WZ1L 3IFLL 4V1DB 5D1QA 1ZHLA 5DJCB 1AD9A 2M8XA 3QULB 5ID0A 3RWFA 1OAYH 2FEDD 2EDQA 5EBGA 5KVDL 4LPCA 3SY0B 5JQHC 2XZQL 5IHLB 5IW6A 4KVNL 1Z6JT 1JZ5A 2VC2L 1HSAA 1P7QB 1IGYA 3IFOA 1T7WA 5FGSA 4POZC 3BP5A 3PL6D 3OKOA 5D1XA 3UZVB 5EBWA 3OHXA 2P5EE 3NH7H 4LP5A 4ERSH 2QHLA 3PL6A 1F11A 4WHTA 5IB4B 4X5XA 1GHFH 5KZCD 3ILQC 1I7ZA 5DRWB 1CXIA 1IGJB 1J8HB 4D0BA 3A6CH 4LPYA 3R4DA 1UJ3A 3MLSH 4KKBD 1MVFA 5DJ8B 4O58L 1MWAH 4J6RL 1AO7B 4XPAH 3GMNA 3ZKSD 2VDNL 4LASL 1OHQA 5GGQL 4UU9A 4WW2F 3VGDA 5IOPA 3KPLA 5JOPE 4M6OL 4K3JH 3WIFA 5GS0D 4EKXA 1OP9A 1Y0LA 4LSQL 4YXLH 3GBMH 2EO1A 3BD4A 3BT2H 4PJXA 1RHHB 5ID1A 3HZKB 4AT6B 3VG9C 2P46B 5F96H 3T04D 5ICZA 4J3VA 3MBXL 4CJ0A 4G8GA 4FQ1H 1VB9A 4HUWA 2FIKA 3RWDB 1INQB 2IPTL 1SVCP 3VFSA 3C60B 5JXAL 2WZPD 3V52H 5D7LA 1CI5A 3WFDL 4L3EB 4JN1L 3UJJH 1ZHNA 5LGJA 1FZKB 4F33B 1E4WL 3FN0L 5DQ9B 4JFDD 1VFBB 4JM4H 5I75B 1ORSA 3EOYG 3PNWA 5J4MA 4FQLH 1TJHH 4JFDA 4MDJB 3B3IA 5GRJL 3IXTB 5CCKL 3E6HA 2CIIB 4CAGA 2IAMA 43CAA 5T1LB 15C8L 4UDUA 3F6LA 5DFTA 3FO1A 3LSOB 3O9WC 5CP7B 4BH8A 1YEJL 5KSUA 5DT1H 3V95A 2UVEA 1JZ8A 3V7AG 2WINB 3PHOB 3SQOH 2XXMB 5DUBA 3TN0A 3U46A 1MCQA 1MFEL 3OJDA 1RI8A 4LEXH 4XVTH 3KNBA 4MJ2A 1J9CT 2IBGA 5ALCL 5C3TA 1YZZA 1YNKL 5IFAL 3LCYA 1KTDB 3LD8C 5EN2A 2Y23A 3QDGD 4DN4L 5CINL 5DRZB 3CVHB 5C0AA 1BOYA 4KVCL 3QO1A 4CBPA 5HHNB 3QDGA 2Q86B 1MAJA 3SHSA 3P4MB 2ITDB 5CS7A 4POYA 1Q94A 5DO2C 4JRXB 2VDQL 4NM8L 3FB5B 2OS7A 1K85A 3T08A 3T0XA 2QKIB 1FZMB 4XP6H 4JFQA 3F8UB 1ODAA 2R39A 3Q5OA 2P44B 2BNQD 5CD5D 4HF5L 4M7KH 4OV5B 4ODXA 5B4MC 1WWBX 1U92A 4YEFA 3WFBH 4UT6L 1DUYA 1FFOA 4J23A 3CMOH 4XX1E 1MLBA 3LV3B 1FIGH 5F8QC 2RFXA 5I8KH 3WMSA 4YHKL 2MQCA 5EU5A 4X4XA 1LO4H 4FQIL 3B83A 4GS7B 3KLHD 5I1IH 2FBJH 2OL3A 4N0UB 2QQKH 4NWUH 5IB3A 4KKCD 3VXOA 1LO3L 3RHWF 4PRPE 3FT3B 1QTYT 2BCKA 1JNJA 1CD1A 2IH3A 4PJ5D 1HEZB 3L5JA 3O6LL 5EWIL 1DBJL 1N0LA 2K9UA 3MGOA 4OB5L 1AQKH 3L3HB 5EOQH 4PJ5A 1NL0L 4S11A 1A6TA 1GGUA 2EYTA 1NUFA 3SE9L 4B7IA 4J1UB 5DQDL 3OJVC 3QWRA 1BQHB 4LCCB 5FYKU 3DVNA 5AYUH 1T20A 3VFVA 1T04B 1B88A 1Z0MA 2IADB 4MNQB 2BRRH 4J4PA 4YZFF 4YQXH 5K9QI 1T2QH 5B8CB 3MRMA 4JLRB 3C2SA 3U30C 3VXRE 1PVHA 1MRDH 4NQCA 1A1MA 3IDNB 4IDJH 1BQLL 1U8LB 2AK1H 1OLLA 2JIXB 3V4UH 4IRSC 3EYOB 5FM8A 5FECB 4YHIB 4GLRH 2P4AB 3FQUA 2G2RA 1TLKA 4LDLB 2P49B 1CLYL 1BQHG 4QOKD 3EYUL 2F53E 5JPNB 2KQNA 4XNMB 2X9YA 3C8DA 4YZFE 2IPUG 3B5GA 4KUZH 3FT4A 5E4EC 1NFDB 5D2NE 2KZ1B 3QFJE 4HEME 3EHBD 3GSWA 3B2UD 4L9LA 5IF0B 4DVBA 2PUQT 3C8HA 4AG4L 5F7NC 2DF3A 3MV9E 1LEKA 2K1MA 1CCZA 1MHPH 2DBLH 3BE1H 1VSCA 3DO7A 1U8HB 2PTTB 5C6TL 4HPOH 1IAKB 3QAZC 3AXLB 3QA3A 1AGCB 1U93A 3NCCB 1YECL 5FCUH 5DK0B 1JFMA 4LLAA 4PJ7F 5E2VL 3MLUL 5JXEC 5H2BB 1S7QA 3MRDB 4HJGB 4Q9QH 1BM3H 4QYOA 5F9JA 1LDPH 3A67L 4DUWA 5L2JB 3ARYA 4LCUA 3BOVA 5E2WH 4MD0A 3IDXL 4Z7WB 3SCMD 5JDJA 5LXGH 3F7RA 1IGTB 3S5LB 3BJLA 4Y5VA 5D7JB 4Q74A 3RX7A 4PJ7E 5JW5B 5C70A 3QDME 2G60H 1GSMA 4MJ5B 2OI9C 3NACL 1EDQA 2I9TB 5HHOA 4OZGA 3MRPA 4LQFL 1P9MA 2I27N 1A7NL 4X80H 3ZMRA 2O5YH 3G6DH 4Y0GA 4NDMB 3EFDL 4ONGH 4RBPH 5KTEL 4RGMC 5EU7E 4HJJH 1J1PL 4FXGA 1OSZA 5D7SH 1L6XA 5GQBA 3LKRB 3S96A 3W9DB 3S5LG 2R2BB 3MJ9H 2IQ9H 5D6DC 3GBLA 3BSZH 2GFBB 2B4CH 4NC0B 1A5FL 3WSQL 5T1DH 3ZSTA 2IG2L 5IKCA 3FAWA 5C0FA 2H32H 3HI5L 1C1EH 1T83C 3WFCL 2FZ3A 5F7DB 1TQBB 5FFLA 3HG1A 4RDQF 5B39A 3ME0A 2ZKHH 3RVWD 4M7JL 2ZSVB 4PBWD 2G5BA 5DRNB 5E6ZA 2C3VB 4P0DA 1OAYL 4R2GC 4BZYA 1ADQH 3WNLA 1PKQB 3DX6A 1PY4A 3CXDH 1P2CB 1QNZL 5ITBL 4NN5B 3DX7A 4OUOA 4NN6B 2VABA 2YKLL 1UACH 4FTVB 1NAKH 4P2RE 1VACB 3NH7L 3MREB 1ACYL 4ERSL 1UZ8A 3JXAA 1XZ0B 4JPKH 1YEEL 3T4YB 1DSFH 4TUOB 1BREA 5D93B 1WK0A 5C0DA 3FQNA 1P4BL 3MLSL 4QT5B 2VXVH 1KXQE 3FKUS 3Q5TA 5BOZG 1I8KB 1U41A 4WI2A 4NO5B 2AJVH 1HN1A 3C87A 4PLNC 4KU1A 5J9PB 3QNZB 4HH8A 4HC1H 3HMWH 3VFGH 1HXMB 1DLHA 3AM8C 3DVGB 5IP4A 5JOFA 4YXLL 5C0CD 3GBML 4M6NH 4QRRB 4YPGA 4JB9H 1LK2B 3W9EB 3MR9B 5DQJB 1EZVX 1AJ7H 4FMFA 5F96L 5DMJB 5ITFA 5C0BE 2XKUA 4FQ1L 1LD9A 2BXYA 4UV7H 3QCTH 3T0EB 1OF2B 3T3MF 4YDVB 1WICA 3T65A 4MQXC 1KC5H 5GGSY 1LE5A 2XY2A 1J5OL 2HKHH 3QEQD 4OCRH 3V52L 5KG9A 1DANU 4RGOH 3UJJL 2R4RH 3MROB 3SDCD 4QY8B 1A6WL 1KJ2B 4NRZA 1PZ5B 2EKSB 4QTHA 3GSXA 4XP5L 3T3ME 5BMFL 4YFLI 4FQLL 5MI0B 3BIKB 3RVVC 5E6IB 2X4RB 5HHPB 1CGSL 2A6IB 3H7BB 1L0XA 4NT6B 2NY5C 5CSZA 1MJUL 2XN9D 4R97C 3NABH 4QXGL 4M43L 3S37X 3REWB 4D2NA 2XN9A 1OSPH 4MHHG 4NZTH 4F9LC 1D5MA 1KCKA 3P4OB 3C5JA 1YJDL 4MB4A 3SJVE 3NFSH 4IRSA 1JGVH 4UI2A 2EC9U 3MQIA 3WJJA 3IETB 5HHXL 1DE4B 1BZ7A 5CJXC 5JQ6H 1D5BA 4YO0B 1GIGL 1YY9C 4YDIL 4ZODA 4ZTOH 4G8FB 1IFHL 3WL9A 1ONQA 4JCMA 1J88A 4BFIB 1WFUA 4JFFB 4GG8A 1BZ9A 3FB6B 4EVNA 4ODUB 1IT9L 1EEYA 1F3DJ 1IGCL 3UTTE 4C56E 3OKEA 4DZ8B 2YEZA 5LBSH 5HSFA 2IH1A 4RGND 35C8H 2CDEB 4MS8C 3D85D 4PRDB 5EO0B 4WI8A 3C5ZD 4B41A 1T4KA 1T5XA 2ARWA 3CMOL 3ULSB 4HG4J 1F4XH 3VXQA 1FIGL 5E7FA 2IEPA 32C2A 4LU5H 1OM3H 4R4ND 1G7PB 1H3PH 5E9DE 4P2QE 5I1IL 3DV4B 2FBJL 1MI5B 5JMRA 1D5XA 1J1XH 2QQKL 4NWUL 2OI9A 4D94A 4LSVH 5TF1L 3TJHC 2NZ9D 2R69L 4N8CL 1DFBL 2WUCH 3D69A 4I5BA 3VD4A 1S8DA 2ZUXA 2Q6WB 2YD3A 4BQBA 3BPLB 4JKPL 2QR0B 3QJFB 5DMGC 5GISH 5TDNB 5DZNA 2FH6A 3MMEB 2AK4B 3DRQA 2D3VA 5D6DA 4L3CB 3E3QA 1Z5LB 2OLDA 3TVMC 3FB7A 3WLBB 2BRRL 4YQXL 2DWEA 1EIBA 3G9AB 5F3HB 1EEUA 4HX1B 3BGAA 5C71A 3IU4H 5CGYD 2CLRA 5HPMB 1JYWA 1BVZA 1T83A 4FZEH 2ESVB 3S88L 3V4UL 2DLEA 4V3EB 2R0KL 1XCQA 4H8WL 2HH0L 1FAKT 1JF6A 3HNSH 3QIBD 4V2CB 5I1JL 4MA1B 1M05B 2XWTB 5DD3L 1EGJA 1FVEA 5E56A 4V2BA 3PWPE 1S78C 2VZUA 4S1DD 1WAAA 3TIEA 3HRZB 3HNTH 4AL8L 1MHPL 1RK1B 1G7JB 4HPOL 4UINL 1RZJC 2G75A 3RIAK 1AR1D 2GIYA 1REIA 4HZAA 5SWSA 3NN8A 1RZFH 1TCRB 5K59F 4Y19D 4XPGH 4QO1A 5BVJB 3FCTB 3QUKB 5FYLL 5D1ZC 5TGBB 4Q9QL 3CLEH 4HT1H 1X4ZA 1LDPL 3GHEH 3IFNH 1I1AD 4NHUE 5DJAA 2UVFA 1VADB 5LXGL 1MIEH 1LP9E 5INCA 3QIWB 3WKML 5K59E 5KW9H 3VW3H 4KKNA 2G60L 4Z0BL 3S36X 4MQ7A 2DQUL 4NZUL 4N1HB 4X80L 4HUVA 4FS0A 2O5YL 2ICWB 1UEYA 3G6DL 1KNOB 3KXFD 3SDDC 2L0DA 2ORBL 5T3ZH 3AM8A 4KROC 4G9FB 4YE4L 2AXFB 5J56B 4M6MH 5C9KA 5D7SL 5GZNC 4YHLH 2VERN 3MJ9L 2JB6B 2IQ9L 4JFED 4N9GA 4X4ME 1C5DA 3BSZL 2B4CL 3LRGA 5FYLE 5DGRA 5T1DL 3O8XB 4PP2A 3DURA 4N0FB 1KFAL 3NIGE 4UQ2A 3RWCB 4J8RB 1VFOA 2FHBA 4HEPG 4X9IA 2YPVL 2FL5A 5AZ2L 2R0LH 2BNRD 5E5MA 1S7TB 2ZUWA 1XR8A 4YXKL 3MRNA 1ADQL 5CHNA 4TUKH 1JK8A 4ODSL 1JHLL 3MLXH 5IFHH 3BKYH 3QUMH 2BK8A 1OTUD 2P8LB 1E28B 3OKLA 3WFEH 4IRJB 4KRLB 3D9AL 1DQLH 1UYWH 1L0QA 3I3DA 2OTUB 4K3EL 3QDAA 1PKOA 2VLKE 3V6FA 4OM1L 2WIIB 4PB0L 2XKNB 1JN6B 3T0DA 4PD4J 1B90A 4KWUA 3TLRA 5I8OL 3FRUB 4JM2F 4BM7A 3TO4C 1HSBB 3FONA 2VXVL 1IE5A 2UWEA 5CJXA 3HR5B 1TJIH 5I1JH 4QKXB 4HS6B 3MLWH 3J7HA 1J18A 4YH6A 2Z91A 2FLRT 3QNXA 2Z93B 5IVNA 5EZOH 1N5AB 1QBMH 1WZMA 3HMWL 4WU7B 2D31B 4XPHH 3IJSB 4GT7A 3ARFC 3RZCB 1KPUA 4D8PB 2FHCA 4M6NL 3K7UA 2D03H 3EYSH 5FKAB 1WBZB 3MNZB 4YGVA 3GK8H 3TBYB 4CVXA 4OCSL 2X1WL 3IYLW 5GS3A 1ZS8B 4MS8A 3BXNB 4RA3A 1F5WA 3MNWA 3KG5A 2EKJA 2H6PA 5HHMD 3V8OA 1KC5L 4XCYA 3RY4A 3QNYA 5IROC 5JORA 3UYOD 1G6RL 5HI3D 3EOBB 2R4RL 2DLHA 4KUCF 3G08A 3BMWA 3QSKB 4PGCB 3EJZC 3D39B 4Q9BA 3QG6A 3BDYH 3CD4A 3MGTA 2YD9A 3RDTD 3U36A 1Q9WA 3JSSA 2YOCA 4NKDA 3IDYC 5K9JH 4DCQA 1R3HA 3LQAH 4LLDB 4L4TA 4E5XB 1D9KB 5M95B 4UT7L 1XIWB 1H3GA 4LOUD 5DYOB 4OQTH 5FK9A 3TVMA 4QF1A 2AGJH 1EEZA 2R0WH 1OSPL 2CKBA 3QO0B 4NZTL 4RZCB 2HLFD 2XWBB 4MAYC 3ARBB 3U7WL 5IB2A 1XGTB 4GMTL 1PEWA 1BEYH 4I0PC 5ILTH 1CFQB 1C7TA 1R3LB 2C3WA 2OK0L 5F72S 5GSRA 5IBLC 5BVPH 2ADJB 2DN7A 4AH2B 5GSVA 5EU6E 5F7UA 3AU1A 1CICC 4XT1C 5JQ6L 3LQAC 3RVXC 5JA8B 3OXSB 5LJYH 2GQHA 4YBLC 1NCAH 2ZUQB 4KI5F 3T3PE 3BAEL 3MOAL 1C5CL 4M03A 2W9DH 4Y5XA 5FKPB 2DKUA 3MRBA 1FL6B 1A4KB 3R06B 1UM5H 2ZJSH 5FA4B 4BUHA 5IVXA 4PGJA 1ZLSH 3GJFH 1CK0H 5DHYB 3MYJB 3D0LB 1F6AA 4JHBA 3TH3T 3MLPA 3L3IA 2WAHA 3BP4A 35C8L 4KI5E 4P46B 3ARDD 3W2DL 4CNIA 5D1ZA 4CUCA 3S4SG 3IDGA 1A7OL 5IFJA 4LSRL 5TPWL 5E8OB 2PYED 3K2UL 4JFYA 1H3PL 1TZGH 3OB0H 1CF8H 3F58H 4GRWH 3W0WA 1TTFA 2YXFA 1JV5B 3BKCH 3K4ZA 2X5PA 4DJMA 3HUJB 3WN5B 3SE8H 1WT5C 4X8JB 1U8NB 1TVHA 1O5DT 1CIUA 4PRBA 4XXCA 5E1HB 2XYCA 3DETD 3ULUD 1JPSL 5GISL 4M93C 4YC2B 5FYKH 1C7SA 4LKXA 3ARZA 5IK3B 2CSPA 1O7VA 4I48A 5ENWB 2IANB 4FQ2L 2FYYB 4WEBL 5GS0H 4YAQA 3T4AA 4HUMB 4UNVA 3BQUC 5C08B 4HBQA 2HVJA 5FYJD 4CW1A 3PUCA 4PTTA 3RPIB 1MF2H 1QG3A 4ELMF 2NY6B 1OD9A 4KKBC 2NPLX 3QI9C 5EIIA 2BOBA 1QLRA 3HNSL 4TUJA 1NMCB 2E9IA 5LAXB 4OZFB 2BHUA 3NZ8A 1NUDA 5I18L 1P7HL 1UG9A 3BWUC 2CXKA 4AK1A 2IALA 4ELME 4JDZA 4BFBD 5KSVA 1NEZB 2RBLA 3BWAB 3VFOA 4LEOB 4G5ZL 4WV1B 1ZT1B 4WUUE 4OLUH 5CP3A 3LZFH 2J8OA 5EBLB 2YC1B 2Z8SA 3O11A 4Y2DC 4R4BA 1K8DA 5B3NA 4XPGL 2VQ1A 5T33H 5DFVD 4OZFG 1Q0XL 2CD0A 2H2SC 2JK5A 1N2RA 4JQIL 5IM7B 4JQVC 3H9SD 5ABDE 6CGTA 1KB5A 3CLEL 2Q3ZA 3VXSE 5J12B 2PW1B 3CMGA 3GHEL 5SWZD 1AC6A 1NEZG 1HHHA 1MIEL 1VEOA 5I73C 3OXRB 5DJ2A 3BKJL 4HSQA 4NQDA 2DKSA 5D71H 4MVBC 3DARA 5HYIA 3BHBA 1T0PB 5FXCH 2X4NB 3F65A 4QHMB 4B7LA 1KIRB 2FJHB 43C9A 3B6SB 4HKXA 5T3ZL 2J12B 1ZLVH 3TBSB 3ARFA 5J11B 3ORJA 4Y4HB 3QXAA 4I3RH 4YWGH 4YHLL 2J8HA 1WISA 5EC2A 1KEMH 3V79C 1QFWH 1A1OA 1T21A 2V2XB 1IC7H 2V5YA 1DQMH 3WIHH 1PYWB 4GJTB 1S9VB 2ZG3A 1MIML 4XPBH 1MHHB 1QLFB 1JRHH 1RPQA 3KPSB 4N0RA 4IHOB 3N1GC 1YQ2A 4JFOB 1HIML 5IROA 4GBXB 4O5LH 3MRRB 1B4JL 4LSSL 4YFDB 1QFWM 2R0LL 4Y1AE 4X7CC 3VD7A 1T03H 1MFCL 4J3OC 4IMKC 4H1LB 1OW0C 2AEQL 1R5VA 2W59A 4MX7A 5K9KB 3MA7B 3WXVH 3CH1B 5IFHL 1QSED 4XHJD 1U6AL 3HE6D 4OT1L 5HGBA 3G6AB 1TXKA 3WFEL 4CADB 1U2CA 1R0AL 3HE6A 4BQ9A 1JBJA 1DQLL 2Y4SA 4H5SA 5CKAA 1C8PA 3BPNC 4YHOL 3KVQA 1YEKH 4FFVD 3V4VL 1FO0H 2XG4A 5GGSB 4H1LG 1OP3K 3PJSB 1BD2E 3DUUB 5KVFH 1KN4L 2PTVA 2NLJB 2X4PB 3HPJA 2X89D 1FG2A 4X9FA 4QRPB 1EHLL 5CBEB 3O3DA 4I0PA 4D9QE 1OP5H 1CTNA 4A6YL 3UTSA 3EOAB 4XCEB 5C09A 5I1DA 2ZCLL 5FM5O 1AR2A 2C9AA 3JUZA 1XF5A 1HYRC 4XRCA 1TJIL 5FYJU 4K55A 2OR8A 5ESQB 1RUKH 2BVPA 1KCUH 1N8ZA 2XA3A 3MUGA 4Z0XA 3RL1B 5MHSE 1HE7A 5J89A 1A7RL 1FJ1A 4IIQA 4DGIH 2F54E 2XXCB 2VLRB 3LVEA 1WJ3A 2BSSA 3QUXB 4PJCF 1QBML 3I6KA 1U8OB 4XPHL 2YSSA 4U6HB 4LRNH 1SBSH 3KPPB 4WI7A 5KSBF 2D03L 3EYSL 3HLAA 1JPGB 3ZE0F 4XGZA 1CD8A 1JPFB 4YPJA 1NCCL 5HDOA 3CFDB 3BVNA 1ES0A 1EEQA 4P2OB 3RWIA 4PB9H 4X9HA 2A1WL 3O4OC 1KLUA 2E8ZA 3DIFB 3O2DH 4I18A 3TBVB 3MYZA 2HT3C 1I9EA 5C7XH 4YK4B 3D2UD 5KSBE 4OLXL 3ZE0E 2FWOB 3W81A 2NW2A 5KVMC 3VXMD 4LF3B 2ZUTA 3CSBA 1IL1B 3MBED 3LS5L 1XT5A 3O6FB 3O3EB 1KGCD 3VXMA 2JCCB 1M7XA 2EH7H 3FFCE 1MEXH 8CGTA 3C08H 1CD9B 5EBMB 4OGXL 1GYAA 1ZHKB 3BZEA 5DR5H 5T5NF 5BRZE 4Q97A 5B38B 4GXVH 5ETUB 4OZ4B 2XWJB 5J13C 5I0ZA 4M1GH 4QCIB 2XTJE 2A6DB 4OQTL 4R8WH 2EYRA 5JLZB 1PQZB 4OGAC 2HG5B 1A7QL 3BQUA 4LK4A 5E08L 1U8JA 5MERB 1OAQH 3U0WH 1BEYL 3KPNA 1VFAB 2CMRL 5ILTL 5ERWA 3MGAA 5BVPL 1JF1B 4XCFH 3QI9A 3WDJA 4APQD 1Z9MA 3K4AA 3EO9H 3CCHB 2MPAH 1NCAL 3M1BA 4NZDA 3STLB 3S7GA 2C4FT 1GOGA 1OOAA 2AJYH 1BWWA 1S9YA 3GSRA 1IAOA 2GK0B 2NXZD 4OIIH 1U91A 2ZJSL 4NWTH 1ZA6B 4YDKL 2DD8L 3CLFH 3SGEI 1C12B 3IAGC 4HWUA 4NQEB 1E0OB 5BJTA 1ZTXH 3Q6GH 4Y2DA 3VXUB 2R9HD 1EVTC 2ATPB 1KENH 4LPWA 3JWNC 2AJUL 1FC1A 2BVUA 4JQVA 4JE4B 3V5DB 3HC3H 4YXHH 4E0RB 4LIQE 4D0CB 4LAQH 3CZFA 1CG9A 1CF8L 1SJEA 2BFVL 3RUGB 5A43C 1T1ZB 2QADD 2H1PH 5IMLB 5JW4M 3BKCL 4MVBA 4WU5A 3KDMA 1FAIL 2XPGA 1INDH 1ORQA 2GJ6B 3LRHA 4NO3B 3X3FH 2APVA 4PGBB 4PR5A 5FV2A 1K8IA 2NY3B 3GMOA 2D7PA 3NIDF 3NPSB 2W9EH 3HPLB 3H42L 4PJEA 4QRTA 5C0IB 3KYAA 4WI6A 2PO6B 4LAJH 4WI4A 2F58H 3WHE1 1IC1A 2GSIB 2A0LC 2EE2A 3X14B 4ZAKC 5JNYB 2W65A 1AP2A 3L1OH 3VFNA 4ZS7L 1NMBH 4MJ6B 3TM6A 4DFHA 3NIDE 4IMLB 3UTPD 3VG0H 4OI7A 5DJZA 1GZQA 1HILB 4RISH 2GY7B 2A9ML 3QHZL 5BS0B 1U3ZA 2BMKA 3O6MH 2GT9B 4N8VA 5DI8B 4MCYB 3KYOA 1MRCL 3P73B 4XAWL 3RL2A 3U4EA 5DQ9A 4NUJA 4XCNA 3DGGA 3F7VA 4EN3C 1K4CA 5DEZA 4PJXF 3FFDA 3LKOA 2BOCB 2VN7A 3LS4H 1RMFL 4R0LB 3Q2CA 3TIDA 1I7UA 4JANA 1J8KA 4KKLD 2NXYB 2W0KA 2Y72A 5AUMB 4GOSA 1U58A 5E8DH 4NCC2 4PJXE 4EI6A 4GW5A 2AJ3A 3QJHA 5FGCE 5T33L 2CKNA 5C0JB 3MV8D 3VFWB 4ZFGL 1AGBA 1F6LL 4Y16B 3KR3H 4U1NA 4K71C 4G8GE 1HH6B 1J05B 5DLMH 3D0VB 3PDOB 3UP1A 4P4KD 4KTYA 2ZP0T 4JO4L 5D7LE 3ARRA 5I9QC 2FHFA 1DVFC 5IWLC 3IKKA 1QA9B 3EAKA 5IIEA 2ERJB 2VLJA 3X3GH 5IEHB 2J8UB 4HIHB 5GGRA 3U7AA 1OL0A 3FMGH 3NTCL 4HWBH 4JFDE 1WFNA 4R9HA 5ACZB 4F2MA 3BFOA 1SEQH 1OY3B 3IXAA 4JVUA 2R1WA 3UMTA 1YQVL 1ETZB 4BH7A 2VJXA 3SKOA 4C4KO 4RAUA 4QEGA 4FFYL 1KEML 1QFWL 1MWAB 2K7PA 4NRYA 4ONOA 3C6SA 2WBJB 3LDBC 2CO6B 4UILL 4U6XB 2DM4A 1JRHL 3K0WA 5F7WC 4YHZH 1FBIL 4O5LL 3FOLB 2AERT 2EC8A 4WFGE 5KSAC 1NC2D 5C0AE 5C0RH 5IB5A 4OZHB 5A2KH 2A74A 4JPIB 3I3BA 3PXHA 2QSQA 2CRZA 1OD7A 2Z35A 5GRVK 2OL3L 3GSOB 2UZIL 4DK6A 4U2ZA 3WXVL 4XNQA 1EHXA 1UB5B 1ZANL 3PV7A 2LTQC 1VKXB 1F45A 4HJ0C 3O9WB 3IJYB 5IESH 1NJ9B 5FDWB 4LCWA 1TTUA 4U6YA 1QBBA 1JGUH 3FQWA 3F5WB 1FO0L 1F90H 2NY0B 5FAAA 4E41A 1TPXC 4KQ4H 4CN6A 4R4NC 1G9NL 1UGNA 1UB6B 3MJ8B 3RY5A 5I15L 4DOHE 2ARJA 3HI1B 2N7AA 5T3XL 2R15A 3MV11 4C56B 1RUKL 3QBTB 4KJYA 2YMXH 1OAXL 4TNWK 2DRUA 1CWVA 3PIQB 3R0NA 5DD1L 3HE7D 4P23B 1U3HD 3BUYB 4G8EA 4ZQKB 5EOCH 1FZJA 1GZPA 3FJTA 1L7TL 3MA9H 3WHXA 5F1OB 1HI6B 4HHAB 5IW1B 1QSFD 4LRNL 3UC0H 4K9EH 1BFOA 1A2YB 4PJ5E 4KRPD 2HFEA 3MJ7B 2F19L 3QPQC 3L5IA 4Y8AA 1L8JA 5LQBH 2DQHL 5JTWA 5CBAB 5MEOB 4FA8A 1FYTD 2OQJA 1DP0A 1HZHL 2UZYB 3HZMA 4NQCE 2E6JA 1NBYB 1NC4D 2X9XA 5DSCB 2EZ0D 2X7LB 3MO1B 5H94A 1X5XA 5I1KH 5T3XE 2F5BH 4HKJA 4JY5H 1MCKA 4U1IA 5D70H 1ZK9A 1G7MA 2EH7L 3L3JB 2Y5TA 4JRYA 3ALXA 1MEXL 1OT1A 4KK9D 3A0OA 3U7YH 3C08L 4WTXA 1CE1H 2GAZB 1LK3L 1ZGLM 2W0PA 4G42A 3ZKNC 2DKMA 5DR5L 3JWOC 2PXYC 4K7FB 4U4BA 4XNZC 4I77L 1MH5A 2XTLA 4AM0B 5DJXB 4ODHH 1GPOH 4RQQA 4ZAKA 3HC0A 4HMCA 5SWQA 1X6NA 4Y5YC 4WW1A 4XB8A 5HYEA 1OAQL 1I1AC 3QQ9C 3U0WL 3LKSA 4MD4B 1V05A 1HHJA 1WBXA 4RNRA 4RFEB 3UBXB 1OAZH 2OTPA 2DTMH 3LN5A 4TTDD 1HXYA 4RSVA 1G7IA 4IEFB 4FP8H 1JGDA 3EO9L 2DQIL 1PX4A 2MPAL 4EN3A 3AY4A 4PYHA 3ILPB 1M7IB 2LU3A 4NZRH 4NSKA 2WIMA 4HULB 5HHOE 4OZGE 3WEXA 1KLGB 2EDBA 2ZCKH 3CDFA 4X4YA 2YZ1A 3E6FB 1A6ZA 3PABB 3IF1A 5DRXA 1QR4A 4Y2OA 3WUWB 3G5XB 3MOBL 3UBXG 4BUGA 1MJJB 4UQ3B 4Y4KB 4ZD3H 3MRQB 3VJ6B 1Y6NR 3BGFB 2YA0A 4Y4FB 4NO0D 1UVQB 1ZXQA 2VZVA 4FQJH 4KQ3H 3ECBA 3LMJH 4JHWH 3I2CL 4BELD 2DQTH 2I26N 4XNXL 1SBBA 4QHNB 5DF0A 2ZG1A 4PJDA 3WUWG 4ZSOB 3G04B 3V5KA 4M5ZL 3HG1E 2W0FA 1YDPA 5JIIA 1SY6H 3OL2A 2CRMA 5IWLA 3ZHDA 1OAUL 5HGDA 1I7RA 2EIZB 1KJMA 4YBHA 1INDL 4YR6A 1HOCA 2O61A 3VWKB 1FNAA 4H0GA 4CU7A 1OVZA 1X7QB 2VDOL 3TGXA 5FOJA 3E8UH 3MV7D 4M9OA 3TZVB 5IHUL 3ULVD 3M07A 2W9EL 4RGMB 4LBEB 2IPUK 4HK3J 2V9QA 3HA0A 3NVQA 3O4LD 3V8CA 3T1FB 3BGMB 5CJQL 1Q9KA 2F58L 5IQ9B 3N50A 5F89B 2X4TA 4G9DB 5GGUB 1S9KC 4NC2B 1DBMH 1SVZA 3OTTA 1GGCH 5GRYA 1XH3A 1NSNH 1U8IB 1A6AB 3D3VA 4HCRH 3VG0L 3ALPA 3CSPA 4OF8A 3PGDA 1C16B 2COQA 5EA0H 3IJHA 3O6ML 4ODVH 5KSAA 1IGIL 1BOGA 2PW2B 4R2GB 1I4FA 4F3FA 2YN5A 4P5MA 3A6BL 4U1MA 1YPZB 3EGSB 3I9GH 3C5SB 2AEPH 5CMAA 3VXTA 4CJ1A 3T2OA 2UYLA 1BGXL 5E2UH 5DHVH 4CMMA 2VAAA 1T0NA 1EO8L 4ZPVA 2VLKB 1VA9A 1B0RB 9CGTA 2FLBT 2GKIA 2H32B 3LPFA 4LHJB 4LLYA 3UYRL 4PGDA 4AEHH 4HPYL 3RNQA 5TDPA 5E8PA 4PJAA 4JN2B 2EEAA 1EAPB 2X4SA 2HT2D 5IEKA 1JWMA 4JR9L 5CLWA 1I9IL 1WZLA 3BIBX 4NQTA 2ZSWA 4AY0A 5BCAA 3RVUD 3C60C 5I76B 5DLML 2RCSH 3BEVB 3SKUD 4YHNA 1A64A 1HINL 1YEIH 2P8MA 5JOPD 3AMKA 5T1MA 1S5IL 1QRNB 1DN0B 1N7MH 1OAKL 1KIPA 4HFUL 4YBQD 5I75C 4LLQB 2ZOKB 5FF6A 2XZCH 1XCTB 3MCKB 3O3UN 2DQFA 3KPRD 4XNUH 3S8WA 2AW2A 5HTSA 5JR1H 4L4VA 3L5WA 3STBA 3KPRA 4JFPA 1XGRA 3QEGL 4LOUC 4NQSB 1UXSA 4MJIB 1QFHA 5E00A 2OZ4A 2DQDL 3RJQB 5FO9B 4U1HA 4BFGA 5L0QC 2C4XA 2XN9E 3I6GA 1MVUB 1DDHA 4Z5RB 5F9WB 1XGQB 2YWYA 1I1YB 3FTGA 3PHQB 1DQQA 2FO1A 3W39A 2ADIB 3TH2T 5C0RL 4X83A 4K7PH 5F7KC 4HLZH 1I8IB 4HUXB 4KAQL 4DKFH 4MCZA 5BZDB 3VDBA 3LEXB 3RWEB 4G80B 4QWWD 4ENED 3TA3B 4N5ED 1YEFH 3EO1B 2IF7A 3U79A 1RURH 1QQDA 4CVZB 5JHLL 4QTIL 1RJZB 2PXYA 3OKKB 4R97B 5EORH 4N5EA 4MQSB 4WJ5B 1DLFL 1CDHA 2C1OB 3T77B 2GSGB 1RK0B 1MCFA 1G6RB 3GSUB 1CLOH 3OGCA 1KOAA 4PFEA 4DWHA 5DDHB 5I1GH 3WCYA 1FGVH 2BY0A 3ULUH 2QQNL 2VQTA 1A4JB 4Y5YA 5TE6H 4PJIE 2P43B 1GVIA 3P9MA 5BV7H 1KBGL 4ODTL 1WFTA 2XV6B 2MFNA 4OF3A 2CDGA 3B9KD 3QUZB 3BEWB 5C0ND 3GUTA 1N3NB 2VH5L 1F4AA 4GS7C 4PJ9B 2VYRE 1QACA 5T1KD 5FYJH 3SGJC 3GSVA 4Y89A 4MDIA 2VDRH 4N68A 5SX4I 5T1KA 5J3HD 4LLMB 4ZUUB 4FFWD 2DB8A 3RGVD 1LEGB 1EGJL 2QSCL 2ENYA 3OF6D 2ED7A 5EZJA 3MLZL 4QRUA 4G43A 4G7YH 3AUVA 4K8RD 5IQ7L 5HYJB 1SJHA 3LPGA 4FQXD 4LCCC 4U1SB 3OKNB 5DMKB 1J0HA 3MRLA 2AJZA 4XVUC 2BC4A 1IGFH 5EUOA 1INEL 1RZ8A 3E3QE 3LQMA 5CJ5A 5I66A 3ARQA 3R8BB 1YEHL 4V1DD 4GG6A 5MENA 4DN3L 1WAAF 1P5VA 4QXTB 4PUBL 4V1DA 5DJCA 2F5BL 3QULA 4X5WB 4KV5F 1UXWB 2LAGB 3SY0A 4GLRI 4D0DB 5DMIL 4DFIA 3B9AA 3TJEH 2Y36H 1N6UA 3RX5A 1AXIB 3EYQD 2ADFL 4Z6AT 3BX7C 3TFKD 4L5FH 1P7QA 1WAAE 4P57B 3VXRD 1JPTL 4M8VA 1MAML 4ZXBB 2DQCH 4KV5E 3ARWA 1E27B 2QLVB 1ZLWK 3IVKB 5GJSH 1S5HB 5SWSE 2QJDA 5IB4A 4TRPL 2X1QA 1NGXA 2F53D 4W81A 1F58L 5I19L 4OJFL 3SGDH 2FATH 5EU3B 2ENSA 1M6OB 4NNYB 4WFEE 5DRWA 3U0TB 4P3DA 2FX7H 3KPTA 4WY7H 1IGJA 1J8HA 3QFJD 4RIRA 3VGAB 3QDJB 5D7JC 5ECJE 4ODWB 5CLTA 5DJ8A 4DW2H 3MV9D 3PWUB 1AO7A 4R3SB 4U0RC 1EFXD 2CQVA 4EBQH 4JCLA 3FZUD 4WGVB 3KPMB 1FNSL 2Q76B 4HWEH 4N5UA 3WD5L 2VDKH 5JW3H 1YUHB 2C5DC 4ZNCD 5L2KB 2HMID 3MV01 4JO2L 4L1HA 4F80A 3QHTC 1RHHA 3HZKA 4AT6A 4ZD3L 4NQXB 1A1NB 2NY5L 3LIZL 4R4FL 4PREB 1FRGL 1XGPA 3LMJL 3QDMD 4JHWL 3RWDA 3JV0A 1INQA 1EJOL 1JPST 4X7SH 4PDCE 2HFFB 3C60A 3KJ6H 1TQBC 3S35H 1UM4L 4L3EA 2J7LA 4NO2B 4OZIB 4X4ZA 3BD3A 3VH8B 1YC8A 4XPTH 1FZKA 4F33A 4Z76B 2OSLB 5C0GA 1OWWA 1UCBL 1Z3GL 2V6HA 4WWKD 3L95B 1PG7W 2X2YA 3QPXL 3MXWH 5T1LD 4MDJA 5DD0H 1HYSC 3IXTA 3SDDB 2CIIA 5E99L 4NN5C 5T1LA 4NFCA 3HCVB 1K2DB 4NN6C 4KC3B 3GO1L 4NBYB 4FMKA 1OWRM 2AEIT 4PTUB 5CP7A 2HFGL 5DC9B 5FO7B 4K3DH 4LKCB 5F97E 1DBKH 2WINA 3PHOA 2P5WB 1UZ6F 1E4KC 4KK5C 2UWEF 2LABA 1RZKH 3RU8L 4ZFFB 5C2BH 2NR6D 1BAFH 2EDEA 2H2PD 4HCRL 1KTDA 1A9EB 4WCYL 5F9OH 3PDGA 2OMNA 2R1XB 5DRZA 3CVHA 3OB8A 4NNPH 5HHNA 4BYHA 4X6CB 1G0DA 1JNLL 1UZ6E 2Q86A 3CFKB 2UWEE 2ITDA 4JRXA 2MJWA 1RFDL 4X7TB 1JE6A 3VWJD 2QKIA 4HK3N 1DBAH 1XF4B 1RZKC 2R56L 5A3ID 3VWJA 1K5NB 5E1AB 2VN4A 4X6DB 4OV5A 3ZKQD 2R1YB 3ZSSA 3AREB 4LSUH 1D6EB 1TCMA 5FDYA 3X12B 1SYSB 3L7FB 1J86A 3AB0B 1JFQL 1KLFA 3T0EC 4MZ2A 2C4FU 3LV3A 3ZDZF 1FSKC 4OI9A 2CKBL 2V7NB 4N90E 2YK1H 3TO4B 5I16A 5D72H 4M8QB 4CDGC 4DK3A 5GRUL 3RWGB 3TYGH 2EE3A 2LQRA 3FQXB 4ZO8A 3I75B 2DQEL 1I8LC 2Z31D 3SGJA 4Z7OF 2J6EH 3QCUH 3ZZ1A 4F7MB 3GDBA 3ZDZE 3O2WH 5MI0C 1HEZA 2XZCL 3GKZA 5E6IC 2DMBA 5C0BD 3L3HA 4ONFH 5CGTA 2WP3O 2FX8H 3N85L 4J1UA 4PJCB 4MNQD 4LCCA 1BQHA 5JR1L 4XMLL 5ISZB 4L4TE 5HY9B 4P5TB 4GAGL 1NBVL 2IADA 4MNQA 3WO3B 5BW7A 4P9HH 4WI9A 4DGVH 5BZWB 3IU3A 4JG1L 5B8CA 4JLRA 4U3CA 3CDCA 3RNKB 2C1PB 7FABL 3IDNA 1U8LA 2EXYC 1S7UB 4X6BB 4RWHA 3EYOA 5FECA 4YHIA 3VFPB 3JWDC 4APQC 4ZFOL 4TOYH 3JV6B 4HXAH 4OV6F 4BZ1H 2HWZH 5IVXF 3TBTB 2XY1A 2JJUA 4XNMA 4UTBH 4S1QL 4IOIB 1NFDA 1KJ3H 5JHDB 1BVLB 4P9HC 1P4IL 1MCBA 1HQRB 1YNLL 4GH7B 5J1SC 1QEWB 1FGNL 1U8HA 2PTTA 1IAKA 3AXLA 3VU2A 1AGCA 5EORL 5IVXE 5JIKA 3HB3C 4MMXC 4N0YL 5DK0A 2MHAB 3SJVD 5IBTL 1CLOL 1MAKA 4NNXB 1VESA 5H2BA 1SJXA 3ULUL 4MAYB 4HJGA 5TE6L 5L2JA 5BV7L 5KVGL 1BHGA 2RGSA 4Z7WA 5JUEH 1T6VN 1IGTA 3S5LA 1CICB 5D7JA 3K1DA 2X4UB 4YBLB 3W0WE 4MJ5A 3UTTD 4XC1H 2I9TA 3ULUF 2CR3A 2A83B 2BJMH 2LVCA 2WV3A 4OCXH 5HVGB 3D6GA 4XI5C 3LY6A 4NDMA 4F7PB 3UPRB 3SKJH 4F8QA 3LKRA 3W9DA 2R2BA 1BLNB 4X5LA 3PWJB 1PJ9A 1P7KB 2GFBA 4WO4B 2HYMA 5E9DD 4P2QD 1Q8MA 3MRJB 1QKZH 4L29B 3DRTB 3I3EA 3KS0H 3EJYC 5F7DA 1KB5L 1OGAB 4FZ8L 4OLYH 4PG9B 5IW6B 4S2SB 1VGKB 4HXBH 4LCIH 2ZSVA 1H3TA 4DQOL 5DRNA 2C3VA 3GJFB 4HFWB 4I2XB 4D3CH 1WBYB 3DGCR 4UZGA 3SN6N 2YD2A 3IFOB 3TJEL 2Y36L 1PKQA 4HBCH 5EBWB 3EOTH 4MSWB 4MXWH 1NGYB 1P2CA 4L5FL 4PS4H 2CGRH 3PL6B 4HKZB 3UTZB 3DECA 3RTQD 4FTVA 2HVKA 3QT2A 3TNNB 3MREA 4GRWB 1I9RH 1FL5B 5JPMB 5KZCB 1UJ3B 1XZ0A 2BNUB 5E2TH 1DEEA 4JO3L 3U1SL 3T4YA 4P4KC 5CZXD 3PWPD 4TUOA 5MP6H 3KYMB 3DHJA 3TCXA 3KPLB 2AVGA 1DUZB 5DFWH 1BBDL 1EUTA 3L6FB 4M7ZB 4DW2L 1I8KA 4H88H 3THMH 1IM9D 3WBDA 4NO5A 2DQJL 4NQDE 4XMPL 8FABB 1SHMA 3JTTB 4HWEL 5J9PA 1IM9A 1GCFA 2NX5B 3QNZA 2YD8A 3CZJA 3GMQB 2CJUH 2VDKL 3QH3B 4RMWA 3KLAB 1KPVB 1HXMA 3EYVB 6FABL 5IHZA 3DVGA 5AWNH 4C57C 4YX2H 4MNHB 5KVEL 4QRRA 2QBWA 3MSPA 2FECI 2XOTA 1LK2A 3BISA 4MNGB 3W9EA 3MR9A 5DQJA 2CUHA 3N9GH 1L0YA 4UOW0 5GS1C 1AXSA 1T6WA 5LG1A 4PV8A 3O8XC 2VZ1A 1ZHNB 2AJSH 1BFVH 1OF2A 1F2QA 1V3LA 3ALWA 4YDVA 3T0EA 5AAWA 3IDIB 2A77H 1LP9A 3FQRB 1CFNB 2YZ8A 4O2EB 3T0BA 5I73B 3AAZB 3MROA 1AGDB 1FN4B 4QY8A 3BZ4B 1KJ2A 1PZ5A 1I8LA 2AXGB 5E94B 2EKSA 3TT3H 3JBG7 2CDFB 3K1KC 5GJTH 3Q48A 1F3RB 2B7DT 3MXWL 2FB4H 1WVZA 3RIAF 1F13A 3BIKA 1YA5A 4KTDH 3ES6B 5E6IA 2X4RA 4NUGH 5FYLD 5HHPA 4YHML 2A6IA 3H7BA 3PWLB 1K9TA 4JZOB 4NT6A 4DTGL 5EO1B 2AABH 3VFRB 25C8L 1TVDA 1L6ZA 3VMPA 4DGYH 5C2BL 3G6JB 3QO1B 4ZUWB 4HS8L 3QDGB 3GSNH 3P4OA 4OLWH 4DVRH 2C3HA 4JO1H 1JWUB 5DHXB 3P3YA 4LVNB 1BF8A 4MA8H 4KY1H 5DUPL 3IETA 4NNPL 5A40E 5K93A 1DE4A 3QG7L 2OX5A 2XKSA 3UTSE 1LO5B 5C09E 4YO0A 2F8VA 4P5KB 4U49A 4G8FA 4R7NB 4NC1C 2V2WB 2B8OT 2D7MA 1T7ZA 4BFIA 1PDKA 3DYOA 4ZNEA 2BNQB 1TETL 4JFFA 3FB6A 4ODUA 4PRHB 3RZCC 1IEBB 1FFOB 5HYSB 4N8VG 1CFTB 1OGTB 4LSUL 2BDNL 1UH3A 1MFBL 1NCDL 2CDEA 4PRDA 5EO0A 3IAQA 5TFSL 2BRQA 2PNDA 3ULSA 1CGUA 1W72H 3SDAD 4LGPB 4EQ3A 3SE4C 3VXOB 1JHTB 1QFUH 5D72L 1G7PA 2HTLD 1F97A 4FRWA 1CZ8L 4R90H 3TYGL 1KCVH 5HYSG 3DV4A 1MI5A 4IRZH 4Q2ZB 4OCMC 4OIBA 5HDQH 2JJVA 4PJ5B 3TBWB 2J6EL 5AZEH 3MFFA 4UIMB 1I3RB 3Q1SL 1I8MB 3VXME 3ZYJA 1T20B 1FO0B 1RJLB 1DL7H 3BP7B 5CZVH 3VFVB 3ZTNL 1FE8L 2Q6WA 2FX8L 2QR0A 3QJFA 3MMEA 1I3UA 2AK4A 3D18A 1D9KC 4WGWB 2EE6A 4L3CA 1U8PB 4DGVL 3WLBA 2V5SA 4RX4D 5F3HA 3FQUB 2G2RB 4HX1A 1U95B 3VI3F 1BMGA 5HPMA 1JTOA 1NFKA 4TSBH 3LB6C 2ESVA 3LHPH 4C83B 4PPTA 4QOKB 2CR6A 1V3JA 3KYNB 4HXAL 2MKWA 2HWZL 4L9LB 4DVBB 2OTWB 4D9RE 4R26L 3LKNB 1VCAA 4XNYH 3DO7B 2ZUQC 1MQKH 1NH6A 1JL8A 4GAJH 3VI3E 3RAJL 4F7CB 3IT8D 2MTPA 3MACH 3BRFA 3HRZA 2FO4B 4JKLA 2XFXB 2HN7B 4LVHB 1QZ1A 1RK1A 2J88H 2CK0L 3CK0H 1G7JA 3N06B 2CIKB 1FDLH 3O0RL 2E7MA 2R4SH 1UFUA 4QYOB 3ULVH 5D8JH 1TCRA 2AXJA 1JI1A 4NCC1 4P46C 5BVJA 4PG2C 5H35B 5HYQA 3SEPA 3OAYH 3QUKA 5EU6D 5TGBA 3FQTA 4R6UA 4PJGB 4Y5VB 3O3BB 1RIUH 2NYYD 3SCMB 3QIWD 4ISVA 2JELH 1VADA 3U0PA 4ZS6D 1FPTL 1AXTL 3MRPB 1RIHH 3QIWA 4OLZL 1CXLA 4P59H 2H8PB 4PRID 3WN5C 1M4KA 1CGXA 1CBVH 2H45A 4AMKH 4PRIA 2HRPH 2BJML 1IC4H 4OCXL 4KI5D 2ICWA 5TQ0H 1KNOA 5HI5D 3SKJL 3IDMB 5KS9B 4G9FA 4JREB 2AXFA 4D9LH 1IILE 4O9HH 4CN1A 4PJEE 5C0FB 1YN6B 4S0SD 2JB6A 2EXWD 2Y6SC 4Q9CA 4IOFD 3O8XA 5FUOH 2I60L 1YEGL 4N0FA 5INDB 3CFCH 3EDEA 3GI8H 3RWCA 1S7RB 4J8RA 4F58H 2NY6C 1WZ1H 2X05A 1D5IH 3IFLH 3MZGB 4Q9RH 1S7TA 1NMCC 1VHPA 4LCIL 5KVDH 3BH8B 3D1MC 4G6AC 2XZQH 4KVNH 3QXUA 3O41B 4NIKB 2VABB 1OTTC 3D87B 3HAEH 4IRJD 2WLYA 2X1PA 4K7PX 1MHEB 2P8LA 5E4IA 1E28A 4MXQC 1I1FB 4IRJA 3WV0A 4NZJA 5GXBB 5J6GA 3I50L 3TPUB 2BVYA 2OTUA 3T0AA 4JFHE 4TYUA 3FQNB 2AAVA 3FO0H 4BQCA 3CDYA 5E2TL 4M9PA 2WIIA 2XKNA 5J12C 4UTAH 1IZJA 4JDTH 1ND0B 1RIVH 3PF2A 3FRUA 3EDFA 4GRLD 3SDYL 1UH2A 1HSBA 4O58H 4J6RH 2VDNH 3WNMA 1UWXK 4LASH 2VXTH 5GGQH 4HS6A 4KHTH 4U1JB 1DLHB 2HJLB 4WUUD 4FQQA 4OSUL 2VLJE 4M6OH 1LGVA 1E4XL 2IFGA 2NY4D 2Z93A 4KJQC 1Q0YL 4WW2C 4OGZA 1N5AA 4WUUA 2N1KA 2D31A 4WU7A 4LSQH 5C0CB 5L7XH 3IJSA 4WHDA 3VRIB 1YMMB 3RZCA 4YX2L 4D8PA 5J11C 3TF7C 4Y4HC 2NY7L 1XF3B 3VXSD 5FKAA 5GGVL 1WBZA 3MNZA 3TBYA 4QXUH 2YA2A 3N9GL 5F7HA 5KG9B 1OTSC 2VWEE 3P9WB 4X8XA 1ZS8A 3BXNA 2CO7B 2IPTH 5E2JA 3QEQB 1YMHB 3JTSB 4LVOB 2FCBA 5DJYA 2NNAB 1NFIB 3WFDH 1KB9K 4JN1H 1T1YA 4GBXC 3SE4A 2IQAB 1KG0B 3SDCB 5I9QB 1V3MA 2VL4A 1DVFB 3EOBA 4NBZB 4JJ5B 4J3UA 1M71B 1A6UL 3QP3A 4GKOA 3D39A 3UZQA 2FNBA 2OJZL 1NANI 1BQUA 1GGTA 4GKSB 5GRJH 2MQ3A 1NCBL 2ZCHL 1JZ3A 2IWGA 15C8H 3MLTB 1HCVA 2CPCA 2BSTB 5F7FA 5DD6B 1JZ2A 2XN9B 4LLDA 3D25B 1WTGT 1XIWD 4E5XA 1D9KA 2AABL 5FGRA 2VXQL 3VXPB 2C26A 1JWSB 3TPKA 2WWMD 1HHGB 4DKEH 1XIWA 3ARBD 4LCWE 4LFHD 5DYOA 5ALCH 1YNKH 3BO8B 1BWMA 3QO0A 4KJWD 5FM4A 4RZCA 4Y1AD 4HIJB 3ARBA 1XGTA 3GSNL 4OLWL 4DVRL 5DJ6B 2A6KB 1CFQA 1R3LA 4KVCH 4E41E 4BSVB 1KELL 2ADJA 3B8YA 5DS8B 4AH2A 2EO9A 4XWOD 1AGEB 1BIIB 4Z95L 5L88L 3NCFB 5ANMB 3VFUA 4GW1A 4NQVB 5LVEA 1BZ9B 3EFFB 2VDQH 1GC1C 1H5BC 1EEYB 3S4SA 3QB7C 2EEBA 3B5HA 4U1LB 1FFNA 2GITB 1MCRA 3UDWA 4F7TB 5FKPA 3QUXC 3C8KB 4ZPTB 5D7IE 1FL6A 3WFZA 4HF5H 1A4KA 5FA4A 1BD2D 2O5XL 4JFZL 4FABL 1NGPL 4K2UL 5DHYA 3MYJA 3D0LA 4RGNB 3D85B 4TULH 4D9QD 1XAUA 4M5YH 3C5ZB 4UT6H 3CC5A 1AKJD 1E4XI 4P46A 4PG2A 1X4YA 5DTFB 2ITCB 4P2OC 2GTWA 5GIRB 1Z9SA 4J2XA 1U36A 1CDUA 1BBJB 1FORH 4YHKH 5MHSD 3BP6B 2V2TB 4FQIH 1QFUL 5GRXG 2F54D 3VFTB 4YLQT 1ZT4B 1JV5A 3LEYH 3HN3A 1LO3H 3HUJA 3O6FC 3WN5A 3S35X 4KZEH 5HD8C 4J12A 3O6LH 3U2SB 4X8JA 1A6VH 1U8NA 3GNML 4ORZC 4OB5H 3LPWA 1KEGH 4JHAH 1DL7L 4JRYE 1NL0H 3JTCA 4XP1H 4BSWB 3K46A 4F9PC 2DWEB 4OCLC 1A02N 5IK3A 1X5KA 2B20A 3QCVL 3MNVB 1K4DB 2IANA 4XTRC 2FYYA 1WF5A 2Z8WC 3BN9C 1BQLH 3QUYC 5GS2D 5C08A 2DS4A 1IQDB 4KJPC 2ZOLB 3I85A 2R2HB 2PTUA 5FM5M 2DL2A 3RPIA 3LHPL 3FFCD 3QIBB 1CLYH 4G3YL 3I02B 1KULA 2WMPA 4OZFA 4XNYL 1MJ7H 1IMHC 2DQGL 1FIEA 1H8NA 2G75B 4AG4H 4ZTPL 3MACL 5ESVB 2XTJD 3FN9A 5C6TH 4PJHF 3VA2C 1NEZA 3BWAA 3MRKB 1R24B 2VE6A 4BZ2L 3MRIB 1XGYL 4LEOA 3ARXA 4WV1A 1ZT1A 4MXQA 2AQ1A 4PJ8D 4Y19B 5E2VH 5EBLA 4OQ1A 2YC1A 5C6WH 4PJ8A 1FV1B 4JAMB 5EZLB 1ZGLB 3A67H 1FQ9C 5JDSB 1I1AB 3L5XH 3HFMH 1U8QB 1TJGH 2PW1A 4Q6IB 2JELL 2GTZB 1BJMA 4JDVB 2VLLB 3OXRA 4PJDE 3NACH 1E4JA 3MRGA 1IKNC 5J57B 4LRIC 3WLWD 1CBVL 4FQPA 3B9DA 5CSGA 1RD6A 3KXFB 2X4NA 4KGLA 3EFDH 4QHMA 2RAMA 2R23B 3GMMB 5KTEH 1KIRA 4F7EB 2X4QB 5TQ0L 2FJHA 1KUMA 3TF7A 2PO6C 4Y4HA 1QYGH 3ARGD 4JFEB 4PP1C 3S97C 3ZKMD 4ONHB 4K23H 3WSQH 2G9HB 1FNGB 5JIHA 4W4NA 4O51B 1F3DH 2V2XA 4QRSB 3HI5H 1FH5L 1PYWA 1MCWW 1S9VA 3WFHB 3VRJB 1MHHA 1QLFA 5D1QD 4IHOA 3GI8L 4JFOA 3D3VE 2BNRB 1DQTA 1N64L 4GBXA 2E7BA 1D5IL 3MRRA 2IMNA 4M7JH 4Q9RL 3RWHB 4O4YL 1SQ2N 4DAGL 1DQJB 4KHXL 4H1LA 3CDGB 1GOFA 5GGRY 5K9KA 3MA7A 2HJFB 5I8CB 3RKDC 2C7UB 3TP4A 5D1XD 1QNZH 3CH1A 4R0LC 5ITBH 2YKLH 3G6AA 2NXYC 4CADA 3GKWL 1JIBA 1ACYH 2O5ZH 1GGYA 4PJAE 2W07A 4QRPD 4YHYB 4LNRB 3FO0L 3PJSA 4Y16C 2E6PA 3DUUA 1YEEH 3QEUB 2NLJA 2X4PA 4QRPA 2OR9L 5IG7B 4UTAL 1SEBB 5KAQF 2R29H 2VRAA 2HP4A 1LNUA 4JDTL 1XMWA 3RA7L 1P4BH 1RIVL 2P45B 4ODBD 4XCEA 2RIKA 2YBRB 4FFEX 1WEJH 4JKMA 2VXTL 4BSWA 4KHTL 5ESQA 3RL1A 2ERJC 5J0BA 5C9JB 1QR1B 1DN2A 3W11D 4AJ0A 4Y7MA 4G6FB 2VLRA 2Y07L 3IS1X 5GGVY 3QUXA 4Z7UB 1U8OA 2ZNWA 4U3XA 5L7XL 3WUZA 5CEXB 4U6HA 4CRPA 3KPPA 1MCOL 4G8GD 1CR9L 1TZIB 4MAUH 3V0AC 4L4VE 1JPFA 4L8SB 4AEFA 3JWOL 1I85C 3KPRE 3QNYB 4QXUL 2YR3A 3CFDA 1EERB 4KDTA 5D7LD 4R7DB 5HHMB 1EHAA 1MUJB 2WBJC 2Z8RA 5KOVC 1J5OH 3DIFA 3QEHB 3KLDA 3FOMB 3TBVA 1T22B 4BQ6A 5JZ7D 5BQ7A 4RMSA 5DHVB 3MGTB 5CEZL 1A6WH 3U36B 2FWOA 3F7YB 3GJEB 4LF3A 5ESAB 3GRWA 5DD5L 1KACB 2J2ZA 5C07D 4XP5H 1IL1A 1U9KA 5BMFH 3RDTB 2IAMD 3O6FA 3O3EA 2JCCA 5IVOA 2UY6A 5SX5H 5C07A 2Q87A 5EUKB 5IGXL 1JNNL 4OCNC 1CGSH 3TN0D 4PLJD 1ZHKA 3C6LC 1MJUH 3EKCA 4KDWA 2H9GB 5ETUA 4QXGH 4M43H 1KIQB 4OZ4A 5F9AC 2XWJA 3U4AA 5CEYB 4QCIA 5LCVL 3HNVL 4DKEL 3H3PL 3WXWL 2A6DA 3DROA 4WFGD 5HYFA 5GRWA 4K8RL 5JLZA 1PQZA 5L0QB 5KJRL 5GZOC 5C0AD 1SM3L 1U8MA 1YJDH 2NY0C 3AGVA 1QPPA 5MERA 3IGAB 4RBPK 1HKLL 2NMSA 3G5YB 1VFAA 5TE4H 4AENB 1M7DB 4LLWB 3VI4F 1EA9C 5CEZE 3V4PL 5HHXH 4I0KA 4WTWA 4JZNB 2W1NA 1KCLA 5C1MB 1GIGH 3MRBB 4YDIH 1AFVL 1IKFL 1IFHH 3BRDA 3CCHA 3V6ZB 3STLA 1QBLL 4P23C 3UAJC 1F6AB 3EDDA 4S1RL 3HRPA 1G7QB 2GK0A 3VI4E 1IT9H 1IGCH 1YJDC 1PG7H 1ZA6A 3CX5K 3E2HB 4GG6F 5GRVL 1C12A 5HI4C 1HH9B 3U9PL 4TULL 4NQEA 3ARDB 4M5YL 4ZFOB 3VXUA 4X6EB 2ATPA 1UENA 2FIRT 2BVQB 5EUOE 3V5DA 4G6KH 3PQYB 5B22A 1FORL 3RVTC 2PYEB 1IGML 4NKIL 4OKVB 4E0RA 4D0CA 3Q3GB 4GG6E 5MENE 4Q6YA 3RUGA 1T1ZA 5IMLA 1WGOA 3LEYL 4V1DE 5TF1H 2NY3D 2R69H 4N8CH 7CGTA 1DFBH 3VXNB 4KZEL 1NLDH 2GJ6A 5J7CC 3L9RB 4NO3A 1CU4L 1GGIL 4PGBA 3RBGA 1A6VL 3QWRD 1KEGL 1G1YA 4HLZG 4JHAL 4JKPH 4XP1L 5ICXB 4HS3B 5C0IA 4J4PD 5BV7B 2QEJA 5EFIB 3CAFA 2PO6A 3I6LD 4NQCD 5ELIA 2GSIA 3O81A 3DMMC 3X14A 5JNYA 2P1YA 2UUDH 4FXKB 4OLVL 4DEPB 1H0DB 5T3XD 5EIIB 4IMLA 5FEBA 3S88H 1HILA 3MUJA 3VFMB 2R0KH 3V7MA 4H8WH 2D4DA 5BS0A 2HH0H 1F00I 5SV3A 5CD3B 2GT9A 1NGZA 5DI8A 1J8HE 1RHFA 4MCYA 3G9VA 5DD3H 5ADOH 3P73A 2IALB 4ZUTB 1AO7E 1MJ7L 4GSDL 3VFOB 4TTGA 1F3JB 5E24E 2BOCA 2B1AL 4MXVE 4POZD 1ZLUH 2HJKB 3H3BC 5HHVH 4AL8H 4R0LA 4UINH 2VQ1B 3IB4A 4NM4L 4OCYH 1HWGB 3DNKA 5AUMA 2ICEB 1KB5B 1Z2KA 2UY7A 5FUZL 4Y4KC 3ILQD 2ZPKL 3LN4B 5FYLH 3BGFC 3H9SB 3T2PA 5C0JA 3VFWA 4Y4FC 3NCYP 1TMCB 4KZDL 4XBPB 5SWZB 1KPRB 1HH6A 3L5XL 2PYFB 3HFML 1UKQA 4OD1L 1TJGL 3PDOA 2X41A 2OXHA 4LSPL 4S10A 4KK8C 3WKMH 5HHOD 4L3EE 4U0RB 4Z0BH 3V7AE 1QA9A 4HWZA 2ICCA 5FOBB 1VEMA 3PHSA 43C9B 1I3GH 5IEHA 2J8UA 2DQUH 3V9FA 5AYQA 3VWKC 5F1IB 4NZUH 2DJ4A 2M26A 4KKAC 2BHYA 4HIHA 3TZVC 2ORBH 1HHKB 1YY8A 4NP4L 3LH2L 4ALAL 4YE4H 3L7EB 5ACZA 3DUSB 4JY4B 1EAJA 1QYGL 1ETZA 4K23L 1BJ8A 3N1QC 4HH9B 3TNMB 3ET9F 3OBAA 1MWAA 5I1AA 3HG1D 3CFEB 1WC7B 1KFAH 1AY1H 5DEFB 2YRPA 1E6OL 1UEMA 2BZDA 2YPVH 5AZ2H 3FHQA 3FOLA 4YXKH 5CILL 4NYLB 1QFPA 1QVOB 3GGWB 1WCBB 2CLZB 2WW8A 4OZHA 4JPIA 3UTOA 2G5RA 3IRZA 4ODSH 1JHLH 1EHNA 1QSEB 3GSOA 2B4CC 3O9WD 4JRXE 4FQCL 4YFLF 1UB5A 1RZGB 1NAMH 2OCFD 3NCEB 2AJXH 1JI2A 5DC4B 3PP3H 2WSKA 3O9WA 3IJYA 3D9AH 1NJ9A 2EH8L 4Q58C 4PV9B 5FDWA 4K3EH 2O5ZL 1MREL 4XPFL 1FNLA 4OM1H 3F5WA 1CFSB 4YDLB 4PB0H 5J06A 1P53A 4JKKA 2W9LA 4F8TA 5I8OH 2R29L 1G9ML 5DO2D 3MJ8A 1AD0B 1I9JL 4JM2C 1N5YH 5HBBA 1WEJL 3H9HB 3NBNA 4XHQA 3I6KB 2YD4A 2MCPH 3PIQA 4P23A 2PCPB 1TNMA 5B4MD 3BUYA 4HWNA 1KJVA 3CXHK 1RZ7H 4ZQKA 3SDXB 1HI6A 5IW1A 1CT8B 1S7WB 1A2YA 3BIAX 4OCSH 4MAUL 2VR9A 1MQ8A 1LO2L 4FG6C 1KTLB 4I18B 2W91A 3DI2B 2RR3A 3EW3B 4MNQE 1CD0A 5CBAA 3VDAA 2NW3B 3K80A 1W0WB 4WFFE 5MEOA 1FSKB 1RJYB 3L5HA 5F9WC 1NFDF 1ROWA 1NBYA 2GUOB 3D2UB 5MEPB 1AGFB 2OP4L 2Z4QB 1G6RH 3NA9L 5DSCA 3VXMB 1S7XB 2X7LA 2F74B 3MO1A 3MBEB 2FEEI 3X17A 5I71C 5EC1A 2GHWB 3ZL4H 2QSVA 2WBWB 3O2VL 4JGJA 3VCLB 3BZEB 2H3NB 5D96C 3L3JA 4KK6D 1NFDE 2NY2C 2J5LB 3TA3C 3O3AB 2GAZA 4OI8A 2NY1D 2C3GA 3S34H 4OTXH 4K7FA 4XVJH 4NBXB 4UT7H 4YEEA 4AM0A 5DJXA 4Z7WF 1UQSB 1C5BL 4IRSD 3U7WH 3DX9B 4GMTH 4OGYL 2J4WL 3N0PB 2OK0H 4MD4A 4TVPL 5TE4L 1LDSA 4RFEA 3UBXA 3HHRB 3QUZC 4APQB 5DEGB 1JNHB 3IDJB 3HMXA 4PJ9C 4KMLB 4Z7WE 1NDMA 4Q0XH 5D6CB 3BAEH 3MOAH 1C5CH 3ILPA 1M7IA 4U1GB 4EUPH 1KIUA 2NXZB 2DAVA 1U3YA 1KLGA 4G8IB 1QSZA 3E6FA 3PABA 3WUWA 4FQHB 3MCLH 3G5XA 1N4XL 1PG7L 1Z9LA 3DOSA 2HKFL 1B0GB 1EUUA 3INUL 1ZVSB 4ZUSB 5JXEA 2EXWC 4PJIA 1MJJA 4UQ3A 4Y4KA 3W2DH 3VJ6A 4H20H 1R5WB 1A7OH 4Y4FA 1UVQA 1CG9B 4LSRH 3OKYA 5TPWH 4G6KL 4TVPE 3GI9H 3K2UH 2YD7A 4QHNA 1EV2E 2B2XL 2QADB 1Q72L 4ZSOA 1MHCB 3G04A 1VFUA 1K8IB 3H0TB 2WM0A 2AV7B 2SEBB 2FSEB 2EIZA 1NLDL 3VWKA 2IFFL 3HI6L 5EG6C 1X7QA 3TCLB 3ARTA 4UUJB 1T1WA 1J10A 3TZVA 4QRQB 1PKQE 4LBEA 1JPSH 2W65B 3GM0A 3LQZA 3T1FA 4F15B 3BGMA 4ZXBC 1KXTB 1U42A 2VL5B 3FO9B 3QQ3B 1JGEB 3NOIA 4FQ2H 4POUB 4XVSL 5IQ9A 4FTVE 2EE9A 5CIPH 1T3FB 4WEBH 5MEQB 5F89A 4G9DA 5GGUA 1NKRA 3UCRA 4K94H 2KQMA 4IS6B 1A6AA 4NKOB 4XBGB 3RL2B 3CUPB 2ADGB 3SKNB 1C16A 3VGAC 4QNPE 3BDBA 2PW2A 3F7QA 1PBYA 5ADOL 2VXUL 1YPZA 2F8XC 5FGBC 3EGSA 4JANB 3C5SA 5IW3A 5I18H 1NUNB 3MJ9A 1KJ2L 1NBZB 5EZIH 2R0ZL 1UH4A 5HHVL 1T66C 1QLEL 1QOKA 3RIFK 2X42A 2Y06L 5SWSD 5LGHL 3MXVL 1X9QA 1KTRL 3H9YA 1ED3B 4G5ZH 4M48L 2H32A 3FL7A 4RAVB 2L7JA 4OCYL 2B0SL 1NCTA 2OXGA 1LP9F 2FGWL 1UKSA 2VDPH 4LLVB 4WFED 1L7IL 4JN2A 5M94B 2NZIA 1EAPA 3P0YH 3MV8B 4QRRE 3WS6C 2WBKA 3F12A 1Q0XH 4JQIH 4GUPB 2UV3A 1ADQA 3IKCB 4L4JA 4P4KB 5FUCE 3T0EE 5I76A 4GRMB 4HDIB 3BEVA 5I8EB 4WUKL 3BKJH 1IEAB 5K9OB 1QRNA 3F7PC 4AYFA 5IJVB 2R8SL 3PP4L 1I3GL 1NKOA 4NGHL 4XH2A 4GMSL 4LLQA 4MD5B 5EU4B 2NQCA 2ZOKA 1NCUA 3GMRB 4ELKA 3NIGF 4RAUB 4JQXC 3MCKA 4WENB 4NQUA 2CLVB 5I1LB 2HRLA 3EDJA 4MJID 4CMHB 3C6SB 1V7NL 3GHBH 3BRGC 4YIQB 4MQXD 4NQSA 5GS1B 4M1CC 2WNGA 4MJIA 2PETA 3VA6A 1MIMH 5FO9A 3OAZK 4HZLB 4J7RA 4Z7VB 1MVUA 1CL7L 1AY1L 1HIMH 5IB5B 4Z5RA 4U7SA 5D9SB 5L8KB 1I1YA 1B4JH 4LSSH 4HC1A 1NC2B 5E7BA 3ROOB 3GJFK 3PHQA 3PDDA 5HDBE 1MFCH 1TFHA 1PFCA 2AEQH 5GGTH 3FB8B 3RVVD 1I8IA 4HUXA 2E9JA 5BZDA 3DPBA 3LEXA 1LHZA 3RWEA 1U6AH 1A7PH 4G80A 4LGSB 4QGYA 4OT1H 1NAML 3TA3A 2AJXL 5DURD 4N8PA 4ZNEE 3EO1A 1R0AH 1RSFA 4JFFE 4CVZA 3LOWA 1RJZA 3OKKA