3PWUA

An immmunodominant ctl epitope from rinderpest virus presented by cattle mhc class i molecule n*01801(bola-a11)
Total Genus 70
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
70
sequence length
274
structure length
274
Chain Sequence
SHSLRYFYTAVSRPGLGEPRFIAVGYVDDTQFTRFDSDAPNPRDEPRVPWMEQEGPEYWDRNTRIYKDTAQIFRANLNTALGYYNQSEAGSHTFQEMYGCYVGPDGRLLLGFMQFAYDGRDYIALNEDLRSWTAADTAAQITKRKWEAAGEAERQRNYLEGRCVEGLRRYLENGKDTLLRADPPKAHVTHHPISDREVTLRCWALGFYPEEISLTWQHEGEDQTQDMELVETRPSGDGTFQKWAALVVPSGEEQRYTCRVQHEGLQEPLTLRWE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system
molecule keywords MHC class I antigen
publication title Two distinct conformations of a rinderpest virus epitope presented by bovine major histocompatibility complex class I N*01801: a host strategy to present featured peptides
pubmed doi rcsb
source organism Bos taurus
total genus 70
structure length 274
sequence length 274
ec nomenclature
pdb deposition date 2010-12-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3pwuA02
3.30.500.10 Alpha Beta 2-Layer Sandwich Murine Class I Major Histocompatibility Complex, H2-DB; Chain A, domain 1 MHC class I-like antigen recognition-like 3pwuA01
1T0NB 4Z18A 4ELMA 4R4BA 3L3IA 2AXHA 3WO3B 1CGUA 3MRJB 4OFVA 3MA7A 5B8CB 5H94A 4PS4H 4LEOA 3KPLA 2FL5A 4QTHA 3UTQA 1OP5H 3O9WC 1EBPA 3ULUE 3BKML 4X6CF 1I7TA 5FO8A 5IEHB 1K8DB 4GUPB 4Y4KD 1FZJA 2FSEA 3BH8A 3BMWA 3HG1D 4ODSH 5KOMC 2JJVA 4NZTH 4KDWA 5IMOB 4X9FA 5DA4A 3DSNA 3BWAB 1AXTH 1NC2D 4U6HA 3VWKC 2Y07L 5IF0A 5CZXD 1LK3H 1RMFH 3BZ4A 4XBEH 2Y25A 4G8IB 4GKSA 1YEEH 5F6IC 1IM9D 3ARSA 5F9AC 5BMFL 4LAQH 2CO7B 4BQCA 3VXSD 2ADIB 3ARGB 1A6UH 5DWUH 5FHAL 1W8OA 2E8ZA 4K8RC 2FRGP 5EO1B 2ICWI 5DSCB 2WBJA 1IGJA 1FL5B 3UC0L 3D39D 1KEGH 3H42L 1DEEB 2OLDA 4Y8AA 1QNZH 1GGYA 4WI6A 1D7FA 2ZCLL 3CDYA 1DANT 3IRZA 3NCFB 4HZLA 4M9PA 4QT5A 4NZDA 4LF3A 1FBIH 4W4OC 1J5OL 3LEXA 3FT2B 4NUGH 1N5AA 2E6PA 3S97C 3WO4B 4G8GD 4J7RA 5IR1A 2YMXH 1WTLA 4WIQA 4M8QB 3NN8B 3MRJA 2BXYA 4AG4L 5B8CA 1CFQB 2AJZB 4NO3B 5D71L 2E6QA 4L4JA 3QIUC 2FX8H 3F7YB 4TVPE 5HI4C 3QO1B 1J0KA 5SX4I 4X7DC 2AI0L 3NBNA 2X1QA 4GS7C 5IT2L 3QDGE 1R5VB 5IEHA 5HJ3B 4A2LA 4GUPA 4C4KO 2F8XC 3SJVB 1GGTA 1PG7X 4C55A 1EGJA 5HHPB 4O02H 2FATL 3FFCE 2F5BL 2VAJA 5IMOA 3ZL4L 1EO8L 3BWAA 1Q1JL 3L5WB 4OF6A 1VHPA 2NW2B 1CXFA 4QRPB 4G8IA 3RL2B 3VXUA 3X17A 2ZSVB 4FOMA 5DUML 1GGBH 4BFIB 2ADIA 3LKNB 1QRNB 4Q7DA 3ARGA 1FNLA 4FQQB 3IDYB 4Y19B 3VRLF 5DSCA 4LSPL 4JRWA 1FL5A 3JWDH 2B5IC 4H0GA 5DHXB 1AQDB 3MNWB 1N0XH 1DEEA 2BOBB 5J12B 1EHLH 2XIDA 3FQXB 1QD0A 5SWQB 4PRIE 2H8PA 2LFGA 4X8JB 2ZNWA 2E6JA 5CHNB 5KS9E 4MJIE 1FJ1B 1RU9L 3V4UL 1AXSB 3SE8H 1CGTA 3FT2A 3INUL 4RGND 1GZPB 5I75B 1KTDB 1W0WB 4OGYL 1UM4L 4BZ2H 4NZUH 1XGQB 3QHFH 4N5EC 1S7RB 4M8QA 2CUIA 3DRTB 4WFHE 2YPVL 3NN8A 1FL3B 3LQMA 4JFPB 1CFQA 2AJZA 2VQTA 4NO3A 2GJZB 4IOFD 1EBAA 3TO4D 5FM8A 3CPLB 3F7YA 3QO1A 1I7RB 1BQLH 4Z7WB 2QBWA 5E99H 3FZUC 2ITDB 2VC2H 4UV7H 5SV3A 2R4SH 5HJ3A 5GS1B 3SJVA 4JFZH 1RFDH 2OL3H 2YPLD 4TSBH 5HHPA 1MIEL 3QEQE 1WCQA 3PV6B 2YD5A 5CKGA 1SMAA 5FYKL 2NW2A 4ZTPL 5GSRB 4FFYL 5IMKB 4QRPA 3RL2A 3CD4A 1V3MA 4JRXE 4HCRL 3NCMA 4BFIA 3LKNA 4PG2A 1QRNA 3RVUD 4ZG1A 2JCCE 3MYJB 4FQQA 1KG0B 1YPZF 4Y19A 5KZCD 2CH8A 1YMME 3AS0A 4Z7OE 4LPYA 1X4ZA 2J8UF 1IT9H 3MNWA 5J3HD 3WKMH 3MGOB 5EN2B 2BOBA 3LV3B 1MLBB 5SWQA 1OW0C 5EIIB 2BNRD 4X8JA 2P46B 4Z7VB 5CHNA 4XAKE 1FJ1A 1AXSA 3I75B 5HHOD 4PBXA 5JHDB 1GZPA 3NIDE 4F8QA 4EUPH 3ZYOA 3CZFB 2VZ3A 4KPHL 1W0WA 4OLXH 3VXOB 2YD7A 4GXUN 1XGQA 4PJDF 3BIAX 4U6VH 4M93B 2O26U 1S7RA 3DRTA 1W72H 1FL3A 3GK8H 5IQ9A 4JFPA 1NEZB 2IF7A 2VLRE 3CPLA 2LQRA 5K59F 4YDIH 3BDBA 3I02B 4Z7WA 4N0UE 3AS2A 2ITDA 1CZ8L 4LLWB 4V3EB 5E2VL 3D9AH 1SQ2N 1WZ1L 5GS1A 3ALXA 3LD8C 1QLEH 1F97A 4JM4L 3TCLB 3CFKB 4TTGA 4ENED 3OF6A 3F7RA 4JM2D 5D6CA 3PV6A 2DD8L 3QIWB 4KZDH 5GSRA 3HE6C 3MRLA 4NO2B 5IMKA 4F15B 4Q6IB 5GRZA 4YX2H 3NABL 2WNGA 3QXAB 4OLWL 5FKPB 1QSVA 5I15L 2NW3B 2BVPB 2OR7A 5CFHA 4UDUB 3V6FB 3MYJA 1KG0A 2VZUA 1UWXH 3S5LG 1DUYB 1EEUA 5FO7B 2VXTH 4PJEF 5E5MB 4PJ9D 1OD7A 4F57H 2ED7A 2XWJB 4WUKH 5D7LB 5DJ2B 4WNQA 3MGOA 2DTMH 3NCYS 3SCMD 4YGAB 1MLBA 1P5UA 4LHQB 3O2DL 5EIIA 3MYZA 5GRUL 3VD7A 4WUUA 4KZEH 2EDQA 4R0LB 5FYLL 2UY7A 2V7HB 5CBAB 2QKIA 3I75A 3TFKA 1DN0B 1W0VB 5JHDA 1WF5A 4CRPA 1JJUA 3CZFA 3VXOA 3QQNA 4XPAL 1CXEA 5E2WL 5DC4B 4CADB 4HJJH 2VOTA 2KUTA 1F2QA 5SWSD 1QBAA 2WBJC 4MQTB 3VFGL 4BZ1L 1NEZA 3VRJB 3ZDYF 3MA9L 1GPOH 4JB9L 4DTGL 1LO3L 3EO0B 4Y4FB 3EBAA 4V2BA 3DSFL 3I02A 3CX5J 3NZHH 2R69L 2VDLL 5GRWA 4B53A 3W9EA 4HWEL 3P0VL 32C2B 1K8IB 3ESUF 5D96C 5ENWB 2OZ4H 3TCLA 2OXHA 3CFKA 4PJGB 5E9DE 4RISL 5HYQB 5KJRH 1JWSB 3QIWA 1AY1H 3C08L 1O0VA 4NO2A 1FPTL 5ELIA 2C1OA 3N1MC 1QBLL 1QPPA 3QXAA 4OIIH 2XZCL 1RUPH 1OT2A 5FKPA 1DBAL 2BVPA 1S5HB 4UDUA 3V6FA 2HYMA 1E4XL 3QNXB 5E7FA 1DUYA 5FO7A 5ICXB 5JQHC 4PB0L 2H2PD 4R26L 4JZOB 5E5MA 3ARFD 5DJ2A 2XWJA 5D7LA 2P5WD 1RZKL 3X3GL 1U95B 3QPQC 3E6HB 1HCVA 3G6DL 4R0LA 4PRPB 2V7HA 3RVTD 4D3CH 4TRPL 5CBAA 1DN0A 1W0VA 2DQDL 2QV2A 4IMKA 2AEPL 4FFWC 2AQ3A 1HQRB 3ARGC 4CADA 2EICA 1FV1B 2R9HD 3VRJA 4JANB 1S3KL 5JR1H 4L9LB 3HNTH 3D18B 3EO0A 4Y4FA 4UU9B 1LO5B 4ZPTB 4XP9L 1ITBB 2VXQL 2V5YA 4PJAF 1RVFL 3HMXH 32C2A 1TENA 1K8IA 5DD3H 3W2DH 2R0ZH 3FQTB 4PJGA 3WO4C 2XKSA 3V79C 5HYQA 3AROA 4WEUD 2FH8A 5IWLA 3J7HA 2JK5B 5FO9B 4H8WH 3AXLB 2AW2A 2B2XH 1PZUB 3TWCL 4KKNA 1S5HA 2OL3B 4XTRD 3QNXA 2XZQL 4HWNA 3P0YH 3JV6B 1R3JB 4Y5YA 5ICXA 4POZC 5BV7H 2FD6L 1UFUA 2XA8H 1HILB 2FZ3B 4JZOA 4P57A 2QQQA 4ZAKB 5GISH 5J8OA 4DN4L 1CU4L 4KRMB 1U95A 3KHOA 1WSST 1V5JA 3E6HA 1MSPA 4PRPA 4XCNB 3WS6C 2GK2A 1J88A 1QTYT 2X1XR 4PP1D 1EA9C 1TQCC 3W39B 1A1MB 3LIZL 4J2XA 1H3GA 4KHTH 3BKMH 1HQRA 4OCNC 3IDYC 1OT1A 3C5ZB 4GAGL 2GQHA 1FV1A 1VKXA 4JANA 1N3NB 3QUXD 5I1AB 1YNLL 4L9LA 3OX8B 3D18A 3RP1A 1QSED 5J12C 3BPNC 2NZ9D 4EUPB 4ZPTA 2Y07H 4MXVF 1J86A 1LO0L 1U8PB 4K7PX 5D9SB 3WE6B 1FNEB 1RUAL 1P6AB 4XXCC 1D9KD 1JHKH 1AC6A 1CXHA 1IC4L 1IGCL 1A7OL 4OTXL 3C8HA 5FA3B 3T2PA 5TDOA 3LY6A 4UV4H 3FQTA 3M45A 4UOW0 4GLRI 4KWUA 5FHAH 5I75C 1ZHKB 6FABH 3OMZA 5FO9A 1T80A 1MELA 3U1SL 3SPVB 1MFNA 5I19L 1D6EB 3UTSB 3AXLA 3H42H 3V8CA 3QJFB 3QQ4B 3UTTD 5IMMB 3NIGF 2DQGL 1GVIA 3QRFM 2OL3A 4I0PC 1MOEA 4ETYA 4PJIE 1CT8B 1YA5A 3JV6A 1R3JA 2AV7B 2DJ4A 4LCWB 5JZ7C 1J5OH 2FZ3A 5F1KC 3VGEA 5IHZB 4ZAKA 4MVBA 4Y2DD 2VYRE 5GS1C 5HGBA 4XP1L 4GOSA 1V7ML 3DXAB 3K1KC 1HHGB 2YUVA 4I9WD 5CEZL 1CIUA 1J10A 5DURB 4XCNA 4JKMA 1JGLL 3L3KB 4AG4H 1HNFA 3DUUB 3G5ZB 1S8DA 2H6PB 1QG3A 3W39A 1GHFH 1A1MA 5CGYC 2AI0H 3T09A 1AR1D 1FQ9C 5IT2H 1ZEAL 3P4MB 2HRPL 3C5ZA 2IBGA 1MWAL 3N9GL 3DARA 3FB8B 4LCUB 5I1AA 2ATPB 3OX8A 2FATH 4QKXB 2GJ6B 4TUJB 3B4NA 1KCGC 1EO8H 1ZVHA 3KPRD 1Q1JH 4DGYL 3ULUD 1MRFH 1FDLL 1U8PA 5D9SA 4J3OC 3WE6A 1FNEA 4DVBB 3TVMD 5DUMH 3TFKC 3RNKB 5FA3A 4IS6A 1MI5E 5D7IF 1CR9H 3K8LA 1QO3B 4JO4L 4UIMB 1ZHKA 4JZNB 1KPUB 4Z0BL 3ZSSA 1OARH 3PJSB 1B4RA 4A6YB 2DBLL 2UUDK 3QDJB 4LSPH 1T7WA 3EFDH 3SPVA 3IXAB 1D6EA 3UTSA 1NCAL 3OR6B 4BM7A 3ZTJG 8CGTA 3EJYD 3L5XL 3QJFA 3QQ4A 5IMMA 1QVOB 4JO2L 3ZYIA 1KBGH 1JRHI 4LQFL 2D9CA 4NT6B 2DN7A 3VW3H 5E8NA 1CT8A 5I0ZA 4E41E 2AV7A 2FJFB 1RU9H 4LCWA 3V4UH 3SJVE 5F7HA 3INUH 5IHZA 4XHJD 4LBEB 1U6AL 1DLFL 4PJBF 2PO6B 4OGYH 1UM4H 4CW1B 4DWHA 1NBZB 3DXAA 1PDKA 3FB7A 3MLWH 1HHGA 2X70B 2UZYB 4M02A 2YPVH 3QWRD 3QIWC 3L3KA 5FUZL 2D7NA 3DUUA 5HVWA 3G5ZA 2H6PA 4Q6IC 1FO0L 1QRNE 4LPTA 2ORBH 5BRZE 1CDJA 4Y19E 4L3ED 3RFZC 2Y36L 2NCMA 3P4MA 1OAKL 4MWFB 2UYLB 2UWEE 5IMLB 1MQKL 2OP4L 2V5MA 1PY4A 3FB8A 3U4BH 2ATPA 4TVPD 4LLAA 4M3JA 3S35L 2GJ6A 4TUJA 4DCQB 5E2TL 1ZT7A 5L2KD 4YE4L 3BQUC 5FYKH 4CBPA 5EOCL 3SDDB 4ZTPH 2K7QA 4OI7A 4DVBA 4FFYH 4R0LC 3QDGD 5T1DL 1F2XK 2IJ0C 1RIVL 4KI5F 3RNKA 2YKLL 4HCRH 4KMTL 2NY0B 1J18A 1FCGA 1JNJA 4KK5C 3FFCD 4LLQB 1QO3A 4JZNA 5ESVB 1AI1L 1UADC 2F9BT 3PJSA 5J57B 2YWYA 4A6YA 4NQEB 2ZKHL 3QDJA 1DJSA 2WUCL 2APXA 2LAAA 3IXAA 3VI3E 3DTXB 2P5EA 3OR6A 5F96L 4Z0XB 4NT6A 1CICB 4Y4FC 1Z9SA 3O6FB 5IG7A 1ZVSB 3GJEA 3HAEH 4WENB 1JV5B 2YUXA 4RMTA 4LBEA 3LPFA 5I73B 1YJDL 4KPHH 2IFGA 3OKOB 1GIGL 3HUJF 4CW1A 1NBZA 4PRID 4PYGA 5IBUB 2X70A 2NY6B 4YH6A 5IWLC 4MJID 1I1CA 3DYPA 1DSFL 2DM4A 5BV7B 4HGWB 4Y1AB 4R8WL 5J4MA 1T04B 4J3TA 4PP2B 4LSSL 5J7CC 3O6KL 1J0HA 1WBYB 1CZ8H 2AJUL 4WFHD 1DTUA 4XNXH 3ZMRA 1NPUA 4Z78B 4G43A 4H20L 4P2OB 4WHCA 4K3DL 1WZ1H 4MWFA 5T1MB 5F7UA 3DX7B 2UYLA 4MYWB 5IMLA 4UT7H 3EYOB 5CD5C 2XWBB 4DCQA 3B8YA 4Z7VE 2DD8H 5ESAB 3LN5B 4TSAL 3OAYK 5IW6B 3GSOB 4RFNB 3MOAH 2Q7YB 3NABH 5CP3H 3IF1B 4AH2B 5GSVB 5I15H 3VWKD 4EQ2A 4HH9A 3PWJB 5HGGS 4LLQA 3QEQD 3FCTB 5ESVA 4PGDB 4NQEA 2W60A 1G6RL 2YD2A 4OF8A 4AT6B 4P3DB 1DBKL 1FN4B 1AP2B 1WISA 3SQBA 1M71A 3DTXA 3CMGA 4Z0XA 1CICA 1PG7H 3O2DH 4JHBA 4L9LC 5GRUH 1A3QA 4M1CC 3ZKXB 5CAYB 3O6FA 3FN0L 5FYLH 1ZVSA 2J6EA 7FABH 1ZTXL 3FQUB 4NQTA 1JV5A 5IB4B 2V5SA 3BX7C 1AJ7H 1A02N 4XCEB 5HGAB 4UT9L 3OKOA 3QUZB 1WICA 4XPAH 5E2WH 2VDKL 5ERWB 1NCTA 1E27B 1C16B 2VDRL 2XG5A 3VFGH 4JO3L 4BZ1H 3MA9H 4JB9H 5CSZB 5C0EB 1T6VN 4HGWA 4JFYB 4Y1AA 1P84J 1OY3B 1T04A 1AH1A 1DN2A 4ZOEA 4CMHC 4PP2A 4FFVD 3DSFH 4Q0XL 2XWTB 2QLVB 1CLZL 1WBYA 3WKNA 2R69H 2DRUA 1TTUA 3QG6B 4Z78A 3QIUD 1DL7L 4P2OA 4HWEH 3P0VH 5T1MA 3DX7A 2QEJA 3FO0H 2VLRD 1QR1B 4XPHL 4ZAKC 4RWYL 1WTGT 4MVBC 1KCUL 3NCYP 2XWBA 1Z5LB 4RISH 5HYSB 1ZE3C 5ESAA 3THMH 3TNNB 3LN5A 3C08H 5EC2B 4NGHH 5I1DB 5IW6A 3GSOA 1FPTH 2W0LA 3LKRB 2Q7YA 3EYQC 1QBLH 3IF1A 4OZHF 4AH2A 2XZCH 5GSVA 4XNYH 1QHPA 1DBAH 4K7PY 3FKUS 1E4XH 4HGKC 3U7YH 4DEPB 3FCTA 4KTDL 5KANG 5D2LA 3T0WA 4PGDA 3RZCD 2VJXA 2V6HA 4PB0H 1KYOJ 4P3DA 1FN4A 2R1XB 1AP2A 3HE7B 3C5ZC 4PDCE 3X3GH 3T2NL 3JWOC 4WV1A 2D0FA 3S96B 5DXWA 3G5VB 3R06B 1R3KB 3FQUA 2DQDH 1P7QB 4PBVC 4H5SA 1PG7W 2UZXB 5IB4A 4HXBH 5T3ZD 3LHPL 4XCEA 5HGAA 2AEPH 2VUYA 3VMNA 1JWMB 4GBXB 1NEZG 5FCSH 1F3DH 3QUZA 3HNSH 1UCBL 4XCCL 5ERWA 1E27A 3QWQB 4HWBA 5AWNL 4HIXL 4ZUUA 1S3KH 5CSZA 5C0EA 5ALCL 4JFYA 1AIFB 4H1LG 4M7ZC 2FWOB 5CP7B 1WQVT 1YPZB 2EH7L 4XP9H 1IARB 4QRRE 1KB5L 2VXQH 2XWTA 3S9DB 1RVFH 3QG6A 3QIBA 2FJGB 2R1WA 3DHMA 3GSVB 1Q72L 1HKLH 1QR1A 5DVOA 3CVIL 1Z5LA 1EXUB 5GGRY 5HYSA 1I3RB 3TNNA 4F7CB 4H26B 3MRPB 5EC2A 5I1DA 4QLRA 3BGFB 3LKRA 3UPRB 2Q8BL 3D1MC 3H9YA 2VXSH 3TWCH 2P47B 3L95B 5E9DD 3UBXI 4PJDB 5D5MB 2VSDA 1M1SA 3DPBA 2XZQH 5E2UL 1FE8L 4YPGB 4HDIB 2FD6H 2I60H 2R1XA 3HE7A 2VKWA 4JEGB 4OLVL 2YRZA 2ILLA 2CR6A 1CU4H 4M6ML 4DN4H 4NO0D 2ZSWA 3HB3C 1UEYA 4J3VA 2BVUA 4OLUH 3S96A 4R90H 3G5VA 3GIVB 3R06A 3QDME 4HW6A 4K94L 1R3KA 5GGUB 3UP1A 1P7QA 5IJVB 4MB4A 4WJ5B 3LIZH 1Q9WB 4GBXA 2HTKC 1MFEL 5GRXG 1KIUA 3CSPA 4CUCA 1KLUA 4X6BB 2RFXB 4GAGH 5I8EB 1P1ZB 3OKEB 3GO1L 3T0DA 4Y2OA 1YNLH 4HJ0C 1AIFA 1BZQK 4NO5B 2V17L 4JG1L 5CP7A 1YPZA 2GEEA 3VU2A 3OL2A 1LO0H 3DVGB 2IANB 1RUAH 5E6ZA 1GH7A 1IC4H 1IGCH 1A7OH 2JKXA 3MRGB 3T3PF 4OTXH 5FYJU 5JXAL 3BW9B 3GSVA 1LO2L 2HTLC 1P5VA 2GCYB 4RGMB 4XXDA 2VLME 3L3JB 2PO6C 1EXUA 2X05A 4MS8A 1I3RA 4F7CA 4OCXL 4H26A 3UYOD 3O8XB 3MRPA 4OZ4B 3U1SH 4XPTL 2N1KA 4F9LC 4HEME 2XKNB 4ZS6C 1FORL 2AJXL 3L95A 4QRQB 2G75B 2XTJE 4PJDA 5D5MA 5HDOA 3HE6D 1NUGA 4MZ3A 2WWMD 4XVTL 4LOUC 3RVWC 1NAML 1S7WA 3ABZA 5HHMB 4XP1H 1V7MH 1C5DB 5CEZH 2F19L 3R0NA 4JFDD 1AE6L 3GIVA 5KAQF 5BJTB 4FQ1H 3SDDC 5GGUA 5IJVA 4UOJA 4J6RL 1Q9WA 4LHUA 2NY0C 2XOTA 5L88L 1OQXA 3GBML 4KK8C 2IAMD 1PYWB 4X6BA 2ZCKL 2HRPH 2RFXA 3P30L 3UTSE 5I8EA 1MWAH 1P1ZA 4JFOB 3OKEA 4L9DA 3N9GH 1ZA6B 3BUYB 5D7SH 3CMOL 3GM8A 4GQPH 5C09A 4NO5A 4QHUB 2P44B 3NH7L 4LCWE 4MQSB 4LEXL 4DGYH 3DVIA 1FDLH 3DVGA 1T20B 2IANA 4JQIL 1G7JB 3O6FC 3VA2C 2N7AA 2EH8L 3MRGA 3BW9A 3U0WL 2B0SH 1VGEH 4ISVB 3TF7A 1NMCC 1DFBH 2GCYA 5I73C 3L3JA 5A16B 4JO4H 4Z0BH 1FZKB 2DBLH 1W0YT 3O8XA 1YN6B 3VFVB 4HT1L 5LJYH 4OZ4A 1NCAH 2X4RB 1T1WB 3L5XH 4JO2H 3KXFA 2XKNA 1RHHB 4CN4A 4LQFH 5BV7C 4PTUA 4QRQA 2G75A 1X7QB 5IVZB 2QSQA 2DQTL 4K3HA 1NANH 5EU6B 4XP6H 1FNFA 4P2OC 1U6AH 4OV6F 1DLFH 2GJ6E 3IDNA 3ALPA 5JTWA 4PIRF 3UMTA 4YXLL 4JDVB 4X4ME 3AUVA 1C5DA 1OTTC 4PJAB 1HYSC 4KUCD 1IM3B 5D1QB 1G7HB 3S34L 5FUZH 3V0AC 1JGEB 4J12A 5BJTA 4RQQB 4M00A 3QPQD 4YHYC 3MLRH 4P9HH 3RPIB 3T3MF 1AQKL 3IDJB 3OXSB 4RBPK 4LLMB 4TQEL 1A1OB 2MFNA 5TE7L 4TYUA 3QDJE 4R2GD 3WJLC 2GYSA 1U91B 12E8H 1OAKH 1CD9B 4JFOA 2LU3A 3NCCB 1ZA6A 3BUYA 2W0KA 2OP4H 4FFWD 4Z7NF 5LQBH 5IVOA 3ZKND 2QR0B 3ZE2F 3MV01 4FHBD 1C5BL 1ZSDB 4NPYB 3OAYH 5E2TH 5DFTA 4QHUA 1MPAL 4ZO6A 4YE4H 1ZGLP 1T20A 1A6PA 4XCFH 1G7JA 4BSVB 5DC0A 4HS3A 2HLFD 2XPGB 5T1DH 4KMTH 2D7QA 3MLTB 4ISVA 3D69A 5A16A 1KIRB 1FZKA 1JMZA 1AI1H 1MFCL 1SJHB 1MHCB 2ZKHH 1YN6A 3VFVA 2WUCH 2DI7A 1I3VA 4R3SB 2WINB 4FFEX 2X4RA 1T1WA 3A67L 4P46D 1RHHA 5F96H 5HHXL 4F37F 1MI5D 5CJBA 2GUOB 1ZLVH 4U6XB 3MODL 1X7QA 4L4TD 5IVZA 5E08L 1EMTL 1FVDB 4WW1B 1GOFA 4IRJB 4OZFG 3KLDA 4ZO8A 1YJDH 1GIGH 2J7LA 3PHSA 4JDVA 3B9KD 1JZ7A 1J1OL 5BW7A 1NGZB 4NN7B 3JWNC 4E41D 3MLUL 5C07B 1IM3A 1DSFH 1G7HA 3RX8A 4TOYL 5DQ9B 3RY6A 1JGEA 3ISWA 4RQQA 2UV3A 3I50L 4P2RE 3RPIA 1ETZB 3IDJA 3OXSA 4NC1E 4R8WH 4LLMA 4F37K 1AO7B 1CDCA 4UB0H 4LSSH 1A1OA 4OM0L 4ODVL 4NQEE 3MLXL 3S4SB 2EDWA 2AJUH 4DEPC 1U91A 4H20H 4F58L 5F9DC 4K3DH 3WHE1 1QFHA 5GRYA 4G6FD 3K2UL 2QR0A 3HE7C 1ACZA 4AQ1B 3C5JB 2AV1B 1ZSDA 5BRZD 3TYGL 4NPYA 3OHXB 4X6CE 2NY5C 4JPVL 1A9EB 5LGHL 4TSAH 4CGTA 1YEIL 1AC0A 4BSVA 4O4YL 2XPGA 5B3NA 4OZGF 3PIQB 4X9IA 2EC8A 3S6CA 3MLTA 1NBQA 1HQ4A 2OTWB 4DKAA 2Z8RA 1KIRA 1T1ZB 2ZJSL 1FNSL 2VISB 4OF0A 5C0GB 3GKZA 4R3SA 1DBKH 2WINA 4KJWC 3C8KB 4QF1B 2AERT 4GRMB 1RIHH 1BFTA 2GUOA 4O9HL 1QFWI 1VFBB 4U6XA 4CKVX 3GSQB 3FN0H 5FGSA 2NYYC 1L9MA 2WUBL 3ILPB 1FVDA 3TPUB 1VEOA 1FNAA 2YA2A 4I0PD 2YRPA 1U3YA 4UT9H 3DX6B 1TNMA 2VDKH 5AAWA 2YXMA 4POYA 4MS8C 1NGZA 1BZ7B 2VDRH 4HULB 1X5GA 4D9LL 1YNKL 5DQ9A 3TA3B 4KKBC 5CGMA 5D7IB 4PTTB 3G6JA 4P23B 1OTSC 1AO7A 1I4FB 3VG0L 4Q0XH 3S4SA 4YZFF 5J1TC 1BBJB 1UG9A 2CLZB 1DL7H 5I1CH 5E5RB 5CGYD 2F15A 4CJ0A 4XPHH 4RWYH 3C5JA 5DJ8B 2AV1A 5EUKB 1VADB 1CS6A 2BNQE 1IGML 3OHXA 4M48L 1A9EA 1N4XL 1BM3L 4FA8A 3VD4A 1F3JB 5L8LB 3QA3B 3E0GA 2YOCA 4G3YL 3PIQA 4PJBB 1MWAB 2VWEE 1HINL 2OTWA 3QCVL 2AABL 3RVVD 1HSBB 3QZWB 4KTDH 1T1ZA 5EA0L 1ODAA 5C7XL 2VISA 5E6YA 5C0GA 4YK4C 4OSUL 1TITA 3C8KA 4QF1A 4GRMA 3VXQB 5KVGL 1KB9K 4LSTH 3T2NH 4ONOA 3VRLE 2WQRA 3GSQA 1QKZL 4PJXF 3IDGB 3ILPA 3TPUA 1S5IL 4ODXB 1ZS8B 4U2ZA 4KQ4H 3LHPH 3SOBL 1DP0A 3TF7C 1W8NA 4XCCH 3MNZB 4RGMC 1BZ7A 3VGDA 3GZKA 3MZGB 5TF0A 5AWNH 3TA3A 5CLTA 4HWUA 3OJDB 5ALCH 5F9OL 5AG9A 5D7IA 1NGQL 4P23A 5IQ7L 1I4FA 5F70A 5GHWH 1F45A 1OM3L 1KB5H 3MLSH 4OZFH 5CJOL 3KWWB 1BBJA 2CLZA 5ESQA 1V3JA 2AQ1A 5T1KD 1HHIB 2W59A 1FGNL 1JIBA 4ZNEA 1AFVL 3CVIH 1DR9A 5DJ8A 5EUKA 1FO0B 1VADA 2XY2A 3QDAA 4U3XA 5SX4H 4LDLB 1YC8A 4PUBL 3PQYB 4OI9A 1F3JA 3QA3A 3L3DB 1DQTA 4PJBA 2GI7A 2YC1B 3BQUD 1HSBA 3FRUB 3QZWA 3UBXB 5E2UH 1IGTB 1FE8H 2A6JB 1F3RB 5DK0B 2NNAB 4OLVH 3VXQA 4M1GL 1MAJA 1YPZE 3OXRB 4FXGB 4M5YL 3C60D 2Z31C 5FHBL 4K94H 2J8UE 4DFHA 2NXYD 3IDGA 4XVJL 2D4DA 4ODXA 2R2CA 1ZS8A 4X5WA 2NLJB 1A6AB 3WNOA 3O3BB 5DFVD 1JRHL 1PVHA 1MFEH 3ZKMC 2BCKB 4M4PA 3MNZA 4WW2F 4NQCB 4HK0B 4C56E 1F13A 1WC7B 3GO1H 4ALAL 2NXZB 3OJDA 4W70A 4E5XB 3STLB 4PJDE 5DMIL 5JXED 1S9WB 2XQYG 2V17H 4X83A 1HOCB 1DQLL 1FFOB 1OQOA 4JG1H 5JDSB 5JW4N 1KPRB 3PL6B 3KWWA 5FYKE 3KYAA 1HHIA 5JXAH 1EH9A 1LO2H 5DHVB 5K59E 1MCHA 4U1IB 2RHEA 1FO0A 4QHNB 4OCXH 3WDIA 3CU1A 4QRRD 4BK4A 3PQYA 3RKDC 4R7NB 3NA9L 5BW7C 1JTTA 4U1MB 5D1QC 2AEIT 3K74B 3L3DA 3RY6C 3DO7B 1A47A 3W11D 5D72L 2AJXH 2YC1A 3MBXL 4RSVA 4OGAC 3FRUA 3STZA 5EOTB 1HN1A 3UBXA 3V7AG 1RZKC 1IGTA 4ODBD 3S7GA 2A6JA 3W0WB 1NAMH 3WL9B 4YJZL 2VZTA 2NNAA 3K80A 4G42B 1UM5L 5AZEL 3RPKA 4H88H 3OXRA 4FXGA 4GG6F 1NKOA 2F19H 4LPVA 4PJEE 5TQ2L 1AE6H 3SDXF 1D5ZB 4JN2B 5J89A 4RBPH 3WYRA 1CDYA 1G6RB 3L3GB 4J6RH 2HFGH 2NLJA 1A6AA 5F72S 5HY9B 2V7NB 4P5TC 5L88H 2BCKA 3GBMH 2IBZX 3K3QA 1KULA 2ZCKH 5KBNC 3ARDB 4NQCA 4HK0A 4V1DD 3FN3A 3SE3C 3QDMD 4HHAB 5J1SC 1WC7A 1IBGL 3D48R 3CMOH 4L29B 2AQ2A 4MAYB 2E7LC 3A6CL 4E5XA 4O58L 1S9WA 1WJ3A 1HOCA 1FFOA 4RX4A 5JDSA 4D0DB 4LEXH 3D2UD 2Z92A 3PL6A 3R8BB 6CGTA 4JQIH 1WAAA 1JHLL 3ZDYE 3KPNB 2EH8H 1E4JA 2CXGA 1S7XB 3UTZB 1R24B 3U0WH 3MV9B 5HHME 5DHVA 5JDJA 2WSKA 4IRJC 5D1XD 4EVNB 4KVNH 4U1IA 3D85B 3P73B 4QHNA 35C8L 2AK1H 2IQ9L 4R7NA 1WZLA 1R3HA 4U1MA 1QLRB 1I8IB 3QCUL 3DO7A 1G7LB 3VXMB 3TBTB 4F9PA 5HHNB 4OF5A 3BN9C 5DJCB 4D0BB 5HYJB 4FFZL 4K71C 2DQTH 5FYLE 2A77L 2A9MH 1FLRH 3W0WA 3WL9A 1F4WL 4J3SA 3EKCA 3OJ2C 4G42A 2PR4H 1CCZA 4CU6A 4YXLH 3QUYA 1PX4A 3P11L 2XTJD 2Y6SC 1JVKA 4L4VB 5JIHA 4NP4L 4YWGL 4LHUG 3S34H 2Z91B 4JAMA 4JN2A 1G6RA 3L3GA 3HRPA 1AQKH 1CWVA 5AYUL 1A14L 4TQEH 4K7FB 2V7NA 3E3QA 5TE7H 4UMGA 4JRYB 1WWAX 3ARDA 4NJ9H 4L29A 4MAYA 2F8VA 3E1F1 5ISZA 1J8HE 5I1GL 3MJ9A 1C5BH 2OI9B 4QHMB 1MPAH 4D0DA 5EOCJ 4I0CC 4JJ5B 4DKDC 2R1YB 2RJMA 5EU6E 4LKCB 4W4NA 3KPNA 3ERYA 1S7XA 3UTZA 1R24A 1IKFL 3MV9A 1S9YB 4EVNA 3D85A 1WITA 4ZD3L 4EQ3A 5I16B 4J4PD 4AY0A 4PJAE 1INQB 1MFCH 5EO9A 1XAUA 5CMAB 1GRWA 4PLKC 1QLRA 1BQUA 1PEWA 3A67H 5JW4M 2CGRH 1K6QL 1G7LA 3LCYA 3VXMA 4FQXA 5TPWL 3TBTA 5HHXH 5KSAB 4NOFA 5D7JC 5HHNA 2E5EA 5DJCA 4D0BA 1MCEA 4P23C 3MODH 4NUJB 5HYJA 1Z2KA 3EDFA 5E8PB 5E08H 3TIDB 1EMTH 1U41A 1JZ3A 1WFNA 2YA1A 1MJJB 2DWEB 4MNQE 1Q8MA 3V52L 4XI5C 3ZYZA 1IRAY 4L4VA 4KJPD 1J1OH 3F6LA 4P4KD 3BESR 1E6JL 2LE9A 2Z91A 3K0WA 2DLTA 4TOYH 3TEUA 2JLLA 3I50H 2P43B 3PG2A 4LMQE 1CGWA 3QDHA 2XN9E 4Y4KB 4LU5H 4K7FA 4OM0H 1IGFL 2EKJA 2BFVH 3MLXH 5I76B 4U6TA 4JRYA 2E7LE 4F58H 1NC2B 1RURL 1V7NH 2VR5A 2HTKD 5CZVL 5HHVL 1IM9B 3T4AB 4JPWH 4QHMA 2OI9A 4NQDE 3TYGH 4BSJA 4JPVH 3VXSB 1SM3L 4JJ5A 1DBJL 5T5NF 2R1YA 1YEIH 1JP5A 4LKCA 2MCG1 3LKPB 4O4YH 4HKZB 1KXVC 2ZPKL 4HJ0D 2ZZUT 1VEMA 3NACL 1S9YA 3UJJL 1NMBH 3D39B 4ZFGL 4MXVE 5I16A 3A0OA 2CK2A 1INQA 2ZJSH 3T0VA 4W81A 1FNSH 5C07E 5CMAA 2VIRB 3DI3B 5DF0A 2HTLD 4MLIA 3ZSTA 2D3VA 4BQ8A 2PO6D 4TNWF 3VCLB 1AO7E 3IDUA 5KSAA 4MD0B 1G7IB 4G8GB 4NUJA 5E8PA 5IBLD 1G0XA 4YBHA 4EIGB 4PRNB 3TIDA 2WUBH 4ZS6D 3NIGE 2M26A 3VI4F 1MJJA 1IILE 2DWEA 4WTXA 3WIHA 3Q0HA 4FABL 1J0YA 4LOUD 3RVWD 4D9LH 1A5FL 1KTKE 5KW9L 5A2JH 2XYCA 4TNWK 5DRZB 1PX3A 1R0AH 4Y4KA 1NAMB 1A22B 3VG0H 1FSKB 1GC1L 3HG1A 5I76A 3SDDD 4YDLB 4RAUB 1NC2A 1I9IL 5A3ID 1MVUB 4MAUH 4OCWL 4JHWL 5D1ZC 3EOBB 4P2RD 1VEPA 3BPLC 4KK8D 4XZUB 4I48B 3TIEB 1IM9A 3T4AA 5CJQL 5FDWB 1ND0B 4EN3C 1IGMH 3NIDF 4IIQB 3VXSA 5HYIA 1N4XH 3BO8B 2XACC 1BM3H 4IRSD 3LKPA 4HKZA 4BFEA 2ED8A 4YXHH 3CXDH 4G3YH 5EZJB 1FP5A 5T3ZL 2AEQH 4LDEB 1Z9OA 4TPRL 5KVMC 1HINH 3D39A 3QCVH 2AABH 3T0AA 5EA0H 5C7XH 3DBXB 2XXMB 2VIRA 3DV6B 1IQWH 5D2NE 3F6IA 5IGXH 2VN4A 3NAAH 3VCLA 5KVGH 2H45A 1RZGB 1LWRA 1S9XB 1SYSB 5JIKA 2NXZC 4RGNB 1G7IA 2ATKB 4G8GA 3OKKB 1QKZH 3F65A 1YJDC 3KDMB 5CEZE 4XVUC 2OCFD 5DK2B 2Q87A 4ZXBC 5DVNA 3B9DA 4PRNA 3CXHK 1S5IH 4B50A 5JMRA 4Z5RB 3SOBH 2EKSB 2FX9H 3GB7B 5SWZE 3C6LD 2GY7B 3CH8A 2VXVL 1IL1B 5DDHB 3NCEB 3TO4B 1ZANL 2DM3A 1XF4B 1XGUA 1YEHL 2BDNL 1NCBH 5LBSL 3MXWL 2B1HL 4YHLL 4R4FL 3S4SG 2VDOL 3N06B 2DJUA 5DRZA 3SGDI 1NGQH 1BHGA 3OGOE 4OUOA 1HYSD 3W5MA 2BVQB 1OM3H 1ZMYA 5CJOH 4JDTL 4UI2A 2BHUA 2A2QT 4RAUA 2VERN 1RJLB 5I1EL 1MVUA 5MEPA 1XF5B 1H15B 1BD2D 4PGCB 1FGNH 2IBZY 4M6NL 3EOBA 3WV0A 1AFVH 2ED9A 4XZUA 4I48A 3KPQB 3TIEA 1OB1B 5FDWA 1ND0A 4DK3A 2K3TA 4PUBH 5E2JA 2F53E 5D6DC 4ZO7A 5KZCB 2Q8AL 3QRGL 1CQYA 2MTPA 4TUOB 5EZJA 1VB9A 4I1NB 4M7LT 3I3DA 3VXRE 3VFRB 2BNQD 1ED3B 3ARRA 3DBXA 5K9OB 3GJFK 2BNRB 3DV6A 4KI5E 4K2UL 5CZKA 1QUNA 1UJ3B 3EOTL 4GMTL 4UUJB 5IESH 2JJTC 2O5XL 1B4JL 1HKFA 3ZLQC 3E8UL 1RZGA 1S9XA 1SYSA 4MAYC 2ZUUA 4M5YH 4Q74A 2ATKA 3OKKA 3HPJB 4JPIB 5FHBH 4B7LA 3KDMA 1YY9C 5DK2A 2YHGA 4XVJH 3FQNB 5T5FL 4XPFL 2OS7A 3S36X 4Z5RA 2O5YH 4OF3A 2EKSA 2C4XA 3GB7A 5DDHA 1JRHH 3B43A 1JNLL 3TO4A 4RDQF 1XF4A 3RRQA 3BT2L 4MDJB 3ARBA 4OLYL 2ENSA 4PJFB 2DKSA 1MCRA 1GOHA 3SKNB 4OZGB 1CFSB 4ZODA 1INDL 3HUJE 4YBQC 1N2RB 4NRXB 5DMIH 2EDOA 1DQLH 3IU4L 2YPLA 2BVQA 3QFJE 2KPNA 5CINL 3WXVL 1TLKA 1T1XA 2AGJL 4JM2B 1E6OL 3LOWA 1RJLA 3FQWB 1XF5A 1U3ZA 5C0AE 2EYRB 4EXPX 5FV2A 5CD3B 3KPQA 5DTFB 1XGYL 1OB1A 5E03A 4M03A 2EE9A 3BYTA 1LEGB 3UO1L 4I18C 2GHWB 4RFOL 1A4JB 5I8KL 1CVSC 4JR9L 2JJWA 3NA9H 3G04B 3QZWG 4J8RB 1B9ZA 4Q6YA 5IHBA 1H5BA 4TUOA 3LZFL 1IFHL 2XZAL 5D72H 1D6VH 4PJ9B 3I9GL 1MCJA 1QFWM 3UDWA 3VFRA 3SCMB 4OKDA 1ED3A 2DQJL 3M07A 4PGEB 5K9OA 2BNRA 3ZHKA 1UJ3A 4UUJA 4M6AA 4WHTA 5HHOA 1UM5H 1CBVH 3B3IB 2XXCB 3SKMB 3V6BR 2OI9C 4JPIA 4NHUE 5TQ2H 4KJWD 1OVZA 3K4ZA 2IEPA 3FQNA 5FGCB 4XNUL 2H32H 3PWVB 5J06A 1JF6A 5SWSB 2MOVA 4KKLD 4P9MH 1JZ5A 1MY7A 1YN7B 4MDJA 4KKAC 3A6BL 3QWOB 5C0RH 4PJFA 2DOCA 2KQMA 1VSCA 4KXZI 1DUZB 4QWWD 1IBGH 3SKNA 4OZGA 1CFSA 1X9QA 3A6CH 3FAWA 3HC4L 4HLJA 1N2RA 1CD1B 4NRXA 5GGSB 3QCTH 4D0CB 5KSAC 1CGXA 1RZJL 2PW2B 4G6AD 4G59A 4JM2A 1FHGA 4EKXA 1JHLH 1N5YL 4KQ3L 1YEGL 4KKBD 4C56D 3FQWA 3QULB 1OTSD 2EYRA 3C2SA 5CD3A 1UWEL 5DTFA 5EZLB 1LEGA 2V2WB 35C8H 3UYPA 1A4JA 2IQ9H 1BFVL 5FYKD 3G04A 4J8RA 3UBXG 3QCUH 4LLDB 2DMKA 4PJ9A 3RX7A 2P5WB 4KFZC 4Y4KC 2Z35B 3REWB 4FFZH 3SCMA 5C1MB 4PGEA 3SQOL 4OZHE 4X4ZA 4XPGH 1CE1L 3TYFA 1F4WH 3WUWB 5F7LB 3B3IA 3SKMA 4NP4H 2FGZA 3ROLB 3PUCA 4X7FC 1PKQE 4TULH 1IQDB 4ZFOA 2OMBA 3PWVA 2BZDA 5AYUH 2CRYA 1DQQB 1AXIB 5SWSA 3DVNA 4UILH 1A14H 2X1WL 3O2VL 5DRNB 3P9WB 3MMEA 1YN7A 3CGTA 5DUPL 5DJ6B 5LWYL 4HBCL 1DUZA 2RGSA 4YFDB 4KUCF 5C0JB 5I1GH 1CD1A 5E4EB 2ESVE 5GGSA 4WGVB 5JW4Q 4D0CA 1WT5C 1B88A 3MUGB 2G9HB 4HAFA 4FQIL 4D9RE 2PW2A 5SX5H 2UVEA 1EJOL 3DGGA 1BZ9B 2BX5A 3WCYA 1I75A 3QULA 1IKFH 5F88B 1LQVA 3S36L 4ZD3H 1QZ1A 5EZLA 1CLOL 2V2WA 2FBJH 1K6QH 5TFSL 2PYFB 1IAIM 3ARFA 5M7QA 2P5WA 2Z35A 4HZAA 3REWA 1HXMB 1KIQB 3SGKA 2WZPD 1B0RB 2HMIC 2AJYL 4IRZL 5EWIL 3WUWA 5F7EL 3PV7A 2Y9RT 3NPSB 4Z95H 3BKYL 3IFNL 1KJ2L 4JVWA 4X6FB 4DUWA 4LLVA 1L4IA 3ROLA 4IIQC 1LD9B 3L6FB 1IQDA 3DX8B 1MCIA 2Q76B 5C6TL 1DQQA 2Z31D 2C4FU 3PE9A 4OZIB 1KN2L 1IGFH 3QUXB 1EO5A 3DJ9A 3O0RL 5DRNA 1QSEB 3WNNA 4DQOL 3L3HB 3MBEC 5DJ6A 5IJKA 5AYQA 1QYGL 5AUMA 5C0JA 1XFPA 1D9KB 4KAQL 5J9PA 4J3XA 5CZVH 3PP3H 2Y7QB 3HMWH 5EBGA 2G9HA 1DBJH 4DGVL 2H3NB 3CIQA 3R8QA 1BZ9A 3NACH 5F88A 3KPMB 4NKIL 1J8HD 3PP4L 4ZFGH 1SEQL 3UTTB 1TXKA 3GSXB 4QOKE 1Q0YL 1FC2D 3T3PE 1KB9J 3OG4B 1WBXB 2IH1B 3TBSA 1BJ1J 1P7HL 2PYFA 1BPVA 1UZ6F 3PF2A 3VD9A 4Y2DB 1FNGB 1HXMA 4KRLB 3CU7A 5D1QD 3K1DA 1KIQA 3IFLL 2BY1A 1B0RA 3RWHB 5IVXB 2IFFL 4LPCA 1D5MB 1MH5B 4NJAL 4OGAD 4M61B 5B22A 5EU5B 4LRNL 1LDSA 2DICA 5IM7B 3O3DB 5EBMB 2IPUK 4X6FA 1YEJL 2BJMH 2HT3C 3MNVB 1LD9A 3L6FA 3F7PC 3OKDA 1A5FH 3DX8A 3RVUC 2Q76A 3D39E 4OZIA 1F58L 4MNQD 4NC0B 4JFXB 1F5WA 1GC1H 3QUXA 4N0FB 5J3HC 4U1SB 1QSEA 3IAQA 3L3HA 3KPRB 5L7XH 3GSNL 2W07A 4LSDA 1ZHNB 1QFUL 4OCWH 4N8VG 4P5TD 3TVMB 1UJ3C 1D9KA 2H32B 5GS0H 2XN9D 4G8GE 1MRCL 5CJQH 1MEXL 3WN5B 4EI6B 2Y7QA 3VXTB 2W91A 5E56A 3LKOB 2K1MA 2H3NA 5E5UB 3L5JA 1QACA 3K7UA 3ARXA 2B4CL 2YD6A 4ZOCA 5T3ZH 3R1GH 3KPMA 4TPRH 4NYLB 1KN4L 2C3XA 4ONGL 3GMNB 1ZT4B 3Q2CA 1RULH 4NQDD 4KVCH 3GJFH 5TH2B 3GSXA 1IC1A 3QUML 1WBXA 4IRJD 5MI0C 3FB5B 2ADGB 4JN1L 2J4WH 5C0IB 4Y2DA 5CSBA 1FNGA 3LPWA 3MRDB 3O4LA 2FIKB 4ENEC 3GRWL 3RWHA 1BGXL 5IVXA 3MV11 1D5MA 1MH5A 1FZOB 2Y5TB 4M61A 5BVJB 1PBYA 2VXVH 1TZHB 5EU5A 1JPFB 2A6DB 2OXGA 1ZANH 5IM7A 3O3DA 4ODSL 5EBMA 1YEHH 4C83B 5TF1L 2BDNH 5LBSH 2G5BB 3MXWH 3OKLB 4L3EB 2B1HH 2CKNA 2VR9A 4MA7L 3HRZB 1MAML 2VDOH 1RMFL 4L1HA 1NLDL 3PGFH 3DUSA 4XBEL 2VL5B 1RPQA 4WDIB 4MX7B 4WTZA 3HZKB 2D03L 2YD4A 4JFXA 4LAQL 4PJ9C 4ERSH 4LNRB 5BVPL 2EDHA 4U1SA 4N1EA 1R5WB 4OIBA 3SCMC 3KPRA 3CAFA 5L2KB 3QSKB 5I1EH 1ZHNA 5T3XL 3T3ME 3C5SB 3TVMA 4M6NH 3WD5L 3QDGB 2H32A 4Y5XB 3CDFA 4EI6A 1EFXD 3WN5A 5A43C 3VXTA 3LKOA 3RVXC 4YHOL 3FFCB 2Q8AH 4Z7NE 3QRGH 5IW3A 3W9DB 5EUOE 3ZE2E 1FBIL 4NYLA 1MCCA 2BOCB 2Y06L 2ICEB 3RKPA 3GMNA 1ZT4A 2QQNL 5TH2A 5DZNA 1F4AA 4X6EB 1JF5A 5HTSA 1T7YA 4K2UH 3EOTH 4GMTH 1QSFE 4X9GA 4CMMB 2O5XH 5I30L 1B4JH 2DJSA 3FB5A 3E8UH 2ADGA 3DV4B 4HUUB 2FX8L 5C0IA 4B5EA 3SN6N 4PRIB 3MRDA 4JVUA 4XNQB 2FIKA 3T77B 4XPFH 1OP5K 3QWRA 5D7JD 4MA1C 4MJIB 5KS9B 5L2JB 1FZOA 2Y5TA 5BVJA 1TZHA 4RIRB 1JPFA 2A6DA 1SBBA 4R9HA 1RAMA 4C83A 4OLYH 1MF2H 3MRHB 4HGMA 2G5BA 3DYMA 3OKLA 4U7MA 4YBLC 4L3EA 3GSWB 5CEZD 3HRZA 1INDH 3S3PA 3MC0A 3N1QC 4MCZB 4W68A 2VL5A 4AIOA 4WDIA 1X5AA 4YDVB 5SWZD 3ARYA 1GGBL 3IU4H 2F5AL 2H2PC 4MX7A 3HZKA 4WFGD 4LNRA 3WXVH 1R5WA 4WUUD 5IEKB 2RCSH 2AGJH 5LKNA 3BP5B 3CFJB 4XB8A 5L2KA 1FVCB 3CFCL 5EU7C 3SGKC 1KOAA 3C5SA 3UZQA 3QDGA 4KDVA 2GT9B 4Y5XA 3RVTC 1BQSA 1AGFB 1N0XL 3STBA 1XGYH 3VWKB 4RFOH 5I8KH 2D7PA 5IHLB 3FFCA 1KLFA 4NQSB 1BP3B 3W9DA 1EFQA 3QXVA 3LZFH 2XZAH 1UEMA 3AM8C 1B6DA 3QHZL 2BOCA 2J88L 2ICEA 4QHLA 1HWHB 3CDGB 4BZ2L 2DL2A 2DQJH 2GFBB 4X6EA 4WU7B 2JCCB 2F53D 4OZGE 2LVEA 4CMMA 3V6ZB 1ADQA 3IS0X 3DV4A 4HUUA 3HR6A 1RIUL 2I07B 2FX7H 3O6MH 3VXRD 5E4EC 4U3CA 2HT2C 5B38B 4KK6D 4PRIA 4FXLA 2FGWL 4XNQA 3T77A 4KI5D 1SMOA 2YD8A 5KG9B 5JUEH 2AK4E 4YDKL 4MJIA 5KS9A 5L2JA 2WIMA 1F8TL 4RIRA 1WK0A 2MQ3A 1REIA 5J0BA 3DETC 1FIEA 3A6BH 3GSWA 1J87A 5FUOL 2J3SA 3BKCL 4XTRC 4I8DA 1J7VR 5E4IA 3QIUB 3HC4H 4MCZA 3BRFA 5EG6C 4S1SL 4YDVA 4L3CB 1C12B 1ZOXA 2VLRB 4XPBL 4GS7B 3B5GA 1RZJH 1JPSL 3BP5A 3CFJA 4KQ3H 4N90E 1FVCA 2OYPA 3RWFB 5KSBF 4LSUL 3LH2L 4N0UB 5ETUA 5E70A 2H9GB 2GT9A 5KANI 1AGFA 4YZFE 3UZVB 5DGRA 3VWKA 1BJMA 3QFJD 5FGCE 4U1LB 2W9DL 5D1ZD 3QEQA 4FQCL 4NQSA 4BQBA 3RZCB 4K3EL 2AXGB 3MCG1 5C0AD 4EN3D 1C08B 4H25B 1JTPA 3UJIL 3JV4A 3CDGA 4N8PA 2APFA 4M3KB 3QUXC 3SQOH 2GFBA 4WU7A 4TN9A 2JCCA 1OF2A 3AC0A 1KCVL 3VD3A 4M6OH 3CUPB 2MWCA 2A74B 2XFXB 2I07A 3E2HB 1D9KC 1T7ZA 4MXQD 1JL8A 4DOHE 3V0WH 4XX1G 5B38A 3MZTA 5ICZB 3GJFB 5B39B 4W4OA 4KI1A 3WFCL 5KG9A 2NXZD 5ACLA 3D9AL 3NIFF 2JIXD 1BLNB 4P0DA 3O2VH 3P40A 4ZXBD 2C3VB 4WI4A 3VGGA 3QEHB 4PJXE 3PNWB 2ENYA 5LWYH 3RIFF 4KZDL 4F80A 3CVHB 5MERB 1LE9B 3QIUA 2P5WE 1R3IH 4L3CA 3C87A 2VLKD 1C12A 5CEXB 1XEDA 5IB5B 2VLRA 5EU7E 4FQIH 3FHQA 4PRHD 4Y2DC 4D2NA 2V9RA 4WWKC 4Y4HD 1EJOH 3RWFA 2VZVA 2YR3A 4AMKH 4IJ3C 4N0UA 3LKQB 4HC1H 3GMRA 4WUKL 3S37X 3UTPD 5GGTH 3K4DA 3KYNB 3S36H 5EOQH 3SE9L 5GRJL 2DTML 1VPOH 4Z76B 4HIJB 4WU5B 2IPTL 4HIIB 5E9DB 4KZEL 4U1LA 1ROWA 3I85A 2DLEA 4MHHG 1FIGL 3UPAA 2BY2A 3GI8L 1AR1C 5I1HL 4FMKA 5TFSH 1YZZA 1C08A 4H25A 5F97E 4NO0B 3QUKB 3HS0A 1RZ8B 5GZOC 4LSQL 3DLQR 2AJYH 5EWIH 5LGJB 2NY3D 1WIOA 1UC6A 5F7EH 1AD9B 3EO1B 3QHTC 3CUPA 1KIPB 1WFUA 1GPOL 3NTCL 2A74A 4L5FL 3RWCB 3TVMC 3E2HA 1N6QL 1NDGB 3IFNH 3O81A 1KJ2H 4RFEB 3WN5C 4P3CL 5HI3D 1CDUA 5DD6A 1HEZB 1BFSA 3HN3A 4AL8L 5ICZA 1SVZA 1OSPH 3NZHL 4NWUL 3QISA 2FYYB 5CILL 3AMKA 2X4QB 1BLNA 1I8KB 1KN2H 2OZ4L 3LN4B 3WSQL 5BOPA 3O0RH 2C3VA 1C1EL 5MENE 4LCIL 3QEHA 3PNWA 1NBYB 3OTTA 3FT4B 2J12B 5FFLA 1QYGH 3CVHA 1EVTC 5MERA 4KAQH 1LE9A 1OP3K 2Y4SA 1S7SB 3ZHLA 5CEXA 5IB5A 5HBBA 4XHJC 4PJHF 4K9EH 4DGVH 3U4EA 3KHQA 3T0EE 1UWXK 3LKQA 4NKIH 3H9SE 2MPAL 3PP4H 1OWRM 2ESVD 3KYNA 2OMNA 2ZUXA 2D0GA 4Z76A 5A40E 4HIJA 4WU5A 1N26A 4HIIA 5E9DA 2KZWA 5FIEA 1JPTL 3HE6B 5HDQL 3C6SB 3RUGF 3MLYH 2AS5M 1NEUA 2HKFL 1XGPB 1QSEE 3TLRA 3WUWG 3CXHJ 5C70A 2BY0A 4HKJB 3QUKA 4NO0A 1OGAE 1RZ8A 1L6ZA 5D93B 2IFFH 1MCFA 2CLRB 4JFDB 4NJAH 1MCKA 2VMFA 1AD9A 3EO1A 1DZBA 1KIPA 2HVJB 3RWCA 4LRNH 5JR1L 1OW0A 4Y5XC 4QY8B 3LEYL 1NDGA 4RFEA 1YEJH 5FM4A 2ZP0T 1HEZA 2IAMB 4UQ3B 4U05A 1RZIA 4NCC2 2X4QA 3LKSA 1PQZB 5EORL 1F58H 3UTTE 4HLZH 1I8KA 3IKCB 4GG6E 4MNHA 3LN4A 1PJ9A 3IETB 4KDTA 5TJWK 5F7WC 2CDFA 1JI2A 5EULV 3SDXE 4HUWB 1VACB 1NBYA 3GSNH 1QFUH 4H8WL 4UDTB 1AGCA 4MQXD 1QBBA 1S7SA 1MRCH 3L1OL 2UZIH 4YEEA 1JYWA 1KXQE 5ITBL 3B5HA 5CUSH 5DQDL 5I8OL 2B4CH 1E4WL 1BQHG 3GSUA 5D96B 1NAKL 1KN4H 4PJ8D 5GJTL 4ONGH 1G7MA 4S0TD 2BVEA 1X5IA 3L5IA 3LQZB 5IOPB 4HKXB 2EE3A 3QUMH 3HE6A 2IQAB 3C6SA 4QRSB 1J1XL 4JN1H 2PTUA 1IKNA 4X5LA 2A9NL 3CLFL 2ZOLB 3KLSA 1XGPA 5DZOA 3MREB 1JTOA 3KPRE 4HKJA 4KHTL 4QOKD 5I74B 4ZUSA 3KPTA 4PJIB 3GRWH 1BGXH 4XRCB 2CLRA 4JFDA 1U42A 4Z7UE 3AREC 3WFHB 1GGUA 2HVJA 4HS8L 3IRPX 4QY8A 3Q6FB 2HA1A 5TF1H 3GHBL 3ALWA 1AKJD 2WP3T 4MA7H 4R2GB 2IAMA 1MAMH 4UQ3A 2HG5B 1AGDB 1NLDH 3F8UB 1JHKL 4P2QE 2GY5A 3WDHA 1PQZA 4QCIB 4S2SB 2ID5A 3IKCA 2D03H 1HE7A 5BVPH 3IETA 2KZ1B 4UV4L 4IM8A 1EZVX 2JTDA 2YBRB 4HUWA 1VACA 3V9FA 6FABL 5DMGC 3CFIC 4NC2B 2HJFB 5T3XH 3T1WA 3FRPA 3WD5H 1R3LB 4UDTA 3OZ9L 4CAGA 1LNUB 4BH8B 4YHOH 4M8VA 2ERJC 5DT1H 4KK9D 5C8JB 1U8HA 2X5PA 3FB6B 2Y06H 2QQNH 2FECI 2XRAH 2C4FT 4FTVE 4WI7A 4P46B 3V0VB 1T0NA 1LQSR 4L3EE 1MI5B 4U1KB 2QQKL 2A6IB 3LQZA 5IOPA 4HKXA 4L4TB 2IQAA 3RDTC 4QRSA 4ZUVB 4FFVC 5I30H 1DBBH 4CVXB 1TJHL 1T3FB 4YUEL 1GHFL 4MJ5B 2ZOLA 5FKAB 4L8CB 3MREA 2VLJE 4NBXB 5L2KE 5FA4B 5DHYB 3B9KB 3WUZA 4L3AA 3B83A 3MCKB 3VG9B 4PJIA 3BZEB 1BF8A 4XRCA 4FG6C 4E41B 2VRAA 2VL4A 1QR4A 1K8DA 3WFHA 1IAMA 4JY4B 2WLYA 3Q6FA 1F11B 2HMID 3QEGH 1IGIH 1HYRC 2X9YA 4WTZG 1MRFL 1GC1C 5C92A 2HG5A 1AGDA 4NN5B 1TQCB 1TETL 2P1YA 3RZCC 5C2BH 4QCIA 3G5XB 4LHJB 4S2SA 3W5NA 5JW5B 2F5AH 2WMPA 3OBAA 2LAGB 4G6FB 5DJDB 5KVEL 1NCCH 1CR9L 2YBRA 1KELH 5BRZB 4EZMA 1KJ2B 1WWWX 2CXKA 5EO1A 1OARL 1RUKL 3CFCH 3V8OA 2HJFA 4JFEB 4AEFA 4UNVA 3EFDL 1R3LA 3RU8L 2J8HA 2Z8WC 3BPNB 5FCUL 5FM5M 2UWEB 3MBED 1KBGL 3S8WA 1LNUA 3E2HC 4BH8A 3T2QA 5FDYA 3VW3L 5C8JA 1PAMA 5E6IC 5TDPB 1NJ9B 3QHZH 3FB6A 4PY8I 2J88H 1YC7A 4X6DF 3G9AB 4P46A 3V0VA 2BRQA 1CF8H 3KYKL 1MI5A 3PWNB 4U1KA 2A6IA 3MLWL 3MRRB 4L4TA 4ZUVA 1BVLB 4CVXA 5GPRA 2CIKB 4G8EB 1RIUH 1T3FA 4MJ5A 4I0PB 4ZSOE 2ORBL 4GW1B 4AYFA 5FKAA 4L8CA 5C0BE 2DI8A 5FA4A 1X5XA 2FGWH 3B9KA 5DHYA 4BUGA 2QHRH 3MCKA 3BZEA 3MRQB 1QSFD 1R5VA 4YDKH 1CGSL 4UZGA 4E41A 4MNGE 1F8TH 4JZJB 2EEBA 4N0CD 2DWDB 4JY4A 3U4BL 1F11A 2NZIA 3WS6A 3L5WA 5FUOH 1HDMB 3BKCH 3VI4E 3ET9F 3BUTA 1JPGB 2ZSVA 4S1SH 2HT3D 2CKBB 5JW5A 2VB5A 3ULSB 5ITFB 5E1AB 4XPBH 1O7VA 3SDCD 1QLFB 5BRZA 2KH2B 1JPSH 1U8OB 3VXPB 2DLHA 2YN5A 4LSUH 3LH2H 4KMLB 5DI8B 4N8CH 5DMYA 3BN3B 1AQDA 4KJQD 4WHYG 1YMHB 2UWEA 3LB6D 3FQXA 4OFKA 2W9DH 4FQCH 4XXCA 5E7BA 1IGYB 4K3EH 1JZ2A 3FFDB 4UT6L 3HKFA 5TDPA 1NJ9A 1AHWB 3UJIH 1KTDA 2PKDA 1BJ8A 2DI9A 4KDTC 3PWNA 4JQXA 1KTLB 3GM0A 3MRRA 1RUML 3QIBD 1N6VA 2A38A 1PLGL 1BVLA 1KCVH 2HLAB 5DD5L 2CIKA 2GJZA 1VGKB 4CNIB 4I0PA 4GW1A 2PF6A 1HK6A 1I7RA 4JY6B 2E8YA 1OAUL 3WFCH 1YYML 1X5YA 3ARQA 3MRQA 4XNXL 2MHAB 1ZHLB 1CD8A 4UT7L 1G84A 2BHZA 4NCC1 2I9TB 3BOVA 5DJAB 3C9NB 1AGEB 4GRWF 3QQ9C 1HDMA 1OP3H 4BJLA 4FN0A 4X99B 2AK4D 3MOAL 1JPGA 2DQCH 5T1KB 2WWMC 1DQJB 3VMOA 2CKBA 1IKNC 3ULSA 4CDHA 5ITFA 2BSRB 2X2YA 5E1AA 1QLFA 3CLEH 3I2CH 5FEBA 3MRFB 1C7SA 5ID0B 3VXPA 3U36B 5DI8A 3MROB 2APVA 5D93C 5T3ZE 5DZLA 4G80B 5EN2A 5DVMA 3SE9H 3CZJA 5GRJH 1YMHA 4F3FB 4ODHL 3LV3A 5F7KC 5DQJB 1PG7L 3BQUB 2IPTH 2YS4A 3RI5F 3TPKA 1UJTA 1FIGH 4HXAL 4Z7VA 2EIZB 4N90D 4ELMF 3GI8H 7FABL 1IGYA 3BHBB 5I1HH 2IAMC 3FFDA 1K3IA 1AJ7L 1AHWA 3RVXD 1FYTD 4L1DA 1P9MA 2DIJA 4GJTB 2A83B 4HIEB 1KTLA 3C60B 4LSQH 4IHOB 1ZXQA 2CUHA 3BPOB 3DURB 2HLAA 2NXYB 4L5FH 3NTCH 1P7KB 4X4YB 5JOFB 4CNIA 1N6QH 1M7DB 3KYMB 1RJYB 4P3CH 4JY6A 3RI5K 4AL8H 4KGLA 4NWUH 5CILH 4LLWA 3ZKSD 2Z8SA 4Q9CA 2MHAA 5A1AA 1T2XA 4LKXB 1ZHLA 4UBDC 4OAWB 5HPMB 3FO0L 3WSQH 4BFGA 3U6RB 4E0RB 1MIML 3QI9C 2I9TA 1C1EH 4ZO9A 5DJAA 1KCRL 4LCIH 4LVNB 3C9NA 3THML 1AGEA 1XH3B 1SBSL 4MLSA 5JPNB 2VDNL 3HZYB 2KBGA 4NGHL 3DMMD 4X99A 4Q6IA 5T1KA 1DQJA 4M9OA 4I0KA 4R96B 5A2LH 5DJYB 3WHXB 4XNYL 2NW3A 5LGKA 5T1LD 2JF1A 2BSRA 1T03L 1A64A 2E3VA 5K33A 4BH7B 3VFMB 3SEPA 3U7YL 1P4IL 1YQVL 2GTWB 3MRFA 5ID0A 2DB8A 5I74C 4QRRB 3B9EA 3C09B 4X7CC 3U36A 3U79A 3WFDL 2DQEL 3FONB 3MROA 4DAGL 3ORJA 1EZVY 1CFVL 2MPAH 4G7YL 3SGDH 4EI5D 4G80A 5K9JL 4OQ1A 3ULVL 5DQJA 3BQUA 4ORZC 2XV6B 1JPTH 5HDQH 1ULVA 4MDIB 1WLHA 2EIZA 2L7JA 1TQBB 3BHBA 4R2GC 4ONFL 4HXBL 1UKTA 3RBGA 2HKFH 3IFOB 1XIWD 5BO1L 2IADB 1WBZB 3GEWB 2A83A 3ZKNC 3HNSL 3MJ7B 3TESA 3IJSB 3C60A 3M8OL 4IHOA 1D5XB 2Y1VA 4M7KL 3DURA 1P7KA 3H6JA 5JOFA 2HLFC 1M7DA 3KYMA 3LEYH 1N6UA 2FBOJ 1RJYA 5F44A 1TIUA 4X7TB 2FEDD 2NY2D 3B2VL 4V1DB 3REVB 4WEBH 3RWIB 3QDMB 5EORH 4LKXA 3BD5A 1OGTB 2J8OA 4GXUM 2HT2D 3EOAB 1KJVB 1NC4D 5HPMA 5ENWA 1HKLL 4O5LH 4E0RA 3U6RA 3DUHA 2XNAB 4YC2B 2QHLA 4U6YB 5JXEA 1JWSA 4P46C 5D8JH 3ULVF 1I85A 2EYTB 5FGBC 5JPNA 1TVHB 3D2UB 4ZTOH 3CC5B 3HZYA 2VH5L 3EIFA 3ELAT 2ZOKB 3DETD 4R96A 3L1OH 2VXSL 2CRMA 5DJYA 3WHXA 4CMHB 5D1XB 4U2YA 4BH7A 5MEND 3VFMA 5ITBH 5I8OH 2GTWA 4JFDE 5DQDH 2X4PB 4MZ2A 1MHEB 4QRRA 3B9KC 1E4WH 3ZDXF 3H3BC 3VG9C 2I60L 3FONA 1NAKH 5C08E 5GJTH 3Q6GL 1YY8B 1BBDL 3VE0B 2X42A 4GQ9L 4AM0B 2KDGA 1I9JH 4OF7A 4OLUL 5FXCH 4IEFB 1B0GB 4MDIA 4R90L 4DK6A 1FFPB 1J1XH 3T0ED 4UIKL 3IDXL 2PCPB 4NN5C 3H9SD 5H35B 2A9NH 3QEUB 3CLFH 3IFOA 4FQJH 2IADA 1WBZA 3RNQB 4ACPA 2DL9A 3MJ7A 1I1RA 2XTJB 3IJSA 3CJJA 2PYEE 1XF1A 1D5XA 1QA9B 2NY1D 4XB7A 4HS8H 3OG6B 4Y5VB 4K8RH 3GHBH 4UU9A 1LO5A 1UT9A 1OGAD 4F2MB 2BSSB 3QXDB 4X7TA 4V1DA 3REVA 3RWIA 1X4XA 3QDMA 1W72B 4PRDB 2HWZL 2YD3A 3EOAA 1KJVA 2Z9TA 3VRIB 2XNAA 3PABB 1A6ZB 1P53A 4U6YA 3VGAC 1WWBX 1TVHA 3D2UA 2JK5A 3CC5A 1QRKA 4JQXC 2UY6A 1K9TA 3EJZD 4QHKJ 4WHDA 5DJZB 2ZOKA 5H37G 3OZ9H 4M7ZB 5IFHH 3BIKB 4QNPF 1U8MB 5D1XA 4F7PB 1N8ZB 1W2KT 4WO4D 2X4PA 1MHEA 5AAMA 4NRYB 2FR4B 1HILA 1BWMA 1YY8A 2LU4A 3VE0A 1RSFA 4WWKD 2DLGA 4JZJC 5DLML 4AM0A 4X5XB 1I3GL 2QQKH 2IGFL 2DYPD 1B0GA 5L8KB 1OD9A 1TJHH 4FQ1L 2MNUA 2PCPA 3RWGB 1B2WL 5H35A 2IG2H 4YUEH 3HTLX 4ZQKB 2DQHL 3RNQA 2W9LA 5JMOC 4HK3N 3QBTB 4P4KB 5IB3B 1QA9A 4Z7WF 3MJGX 2M2DA 5BS0E 3MX0A 1IZJA 5D7SL 3VDAA 1N3NA 1J1PL 5GZOD 4Y5VA 4PJHB 2XKUA 4EUPA 2BC4B 3WFBL 1XMWA 4F2MA 2BSSA 3RVVC 3QXDA 4HMEA 3DWTA 1MQ8A 1TETH 1W72A 2AAVA 4PRDA 4LARL 4LDOB 2B0SL 3EYFB 1VGEL 3VRIA 3FRPG 3GBNH 5KVEH 1AHWC 3PABA 1DCLA 1DFBL 2FCBA 1A6ZA 1P9MC 4L4TE 4MGXA 1RUKH 3RUGB 3H9HB 1QEWB 2XZZA 1LMKA 3RU8H 1A7QH 4P2QD 5DJZA 4CN6A 5FCUH 3BIKA 3EZ8A 3H9ZA 4A2MA 1N8ZA 1XCTB 4J4PA 5B3JF 5HYFA 3D6GA 3TM6A 2WM0A 4NRYA 2FR4A 4XP6L 3AMLA 3Q1SL 2I25N 4N68A 3V2AR 3KYKH 2ZUWA 4X5XA 5DO2C 5DUBB 1E4XI 3SDAC 3TJHD 4DKFL 1NGWB 2X89D 4JKLA 4PJCF 3TJEL 4LSVL 2ZUSA 3RWGA 3MLRL 4P9HL 1S7UB 5DMKB 4PLJD 2DQIL 4ZQKA 4FTVD 5C86A 4U1GB 5DJ0B 5F1SA 4JFEE 2EXWD 4O2FB 2SEBB 4P4KA 5IB3A 12E8L 5T33H 1CGSH 5FOJA 5JW3H 1UZ6E 2APBA 5LQBL 4APQB 4NBZB 4LCUA 4F7EB 2G5RA 4POUB 5LCVL 4PJHA 5FYKU 3RJQB 3ZE1F 1EEYB 1R6VA 2VLJD 2BC4A 3MV8D 4YDJB 2VQ1B 4RMSA 4X4MA 1H0DB 4XCFL 1UH3A 5F89B 3EYFA 4GW4B 3ARWA 4P2RB 2WAHA 1ZV5A 3JXAA 1EPFA 2G2RB 4OGXL 4UIMA 1KPUA 1N64L 3CFEB 1FG9C 3RUGA 1ZAGA 3H9HA 1QEWA 1TTGA 3C60C 4IRSB 4BQ6A 3MLVH 1ITCA 3BPOC 3HHRB 2NXYC 3F58L 1QVOA 2FO1A 4GRWH 4ZFFB 1D5BB 2OZ4A 5IFJB 1QBML 1XCTA 3H7BB 1Q9OB 4HMDA 3U9UB 5DFVC 4X6CB 2FJFA 4JO1L 4OLZL 4MA3B 4UT6H 4DGIL 3WIFB 4K7PL 2P4AB 5H2BB 1NMCB 3BXNB 2PO6A 3F62A 1OOAA 5DUBA 4LVNC 5FAAA 1RUMH 5JXEC 1Y6MR 3GKWL 4F9LA 1PLGH 1NGWA 1I85C 4U49A 5DD5H 5D7KD 4HUVB 1X5FA 1S7UA 5DMKA 3O3EB 3C6LB 4DZBB 3BRDA 4UB0L 1PW3A 1MCWM 1OAUH 5DJ0A 1U8KB 4O2FA 3BI9X 2SEBA 1YYMH 4GMSL 3C09C 1QFOA 4HK3J 4F7EA 1YDPB 3BVNB 1EEYA 4J1UB 1KXTB 5C0BD 5J13C 4PJGF 4YDJA 3W11C 2VQ1A 2ITCB 5JPMB 1RK1B 2YRLA 1U2CA 3ARED 4WFFD 3RY4A 3TN0D 1HZHL 3SDDA 1H0DA 2QQLH 3EJJX 2B7DT 4YHYB 1RD6A 1TQBC 5F89A 1BD2B 2RR3A 4GW4A 3D5OF 4P2RA 4S10A 3JWDC 4X8XA 2G2RA 1B6UA 3CFEA 5ANMB 1ORQB 1OSZB 5DMJB 4IRSA 3AB0C 4E42B 4LASL 1RIHL 3HMXA 4ODHH 5DMGD 4ZFFA 1D5BA 3CK0H 5IFJA 3H7BA 5IIEB 3QNYB 3U9UA 2BNQB 1D5IL 4HXAH 1ZLVK 4X6CA 4MA3A 3X14B 4PR5B 4YR6B 5H2BA 1FZMB 3BXNA 1P69B 5I2IB 2QADD 1CDHA 1KC5L 2F54E 2IC2A 3PXHA 3IDIB 3ZTJH 4YC2C 4FNLL 1A1NB 3OV6A 3MRKB 3U0TB 5HVGB 3I6GB 3MRMB 4HUVA 3O3EA 1ZLWH 1T2JA 3C6LA 4DZBA 5F7FA 4PREB 3RDTD 5H8DA 5D1XC 1U8KA 5EZIH 1BAFL 3BEVB 3GDBA 2N7BA 1NDMB 2OR8A 1JYXA 1BMGA 5I1CL 4PGBB 1M6OB 3WHE0 3N0PB 3EYOA 1TZGL 4JKWA 1MIMH 4PY7B 1KCRH 1MCPL 4YLQT 1GGIH 4J1UA 4FG6D 5JPMA 1VERA 2ITCA 3DECA 1IAOB 1SBSH 1RK1A 3PDOB 2VDNH 4ZDHB 5KOVC 5T3XE 2O5ZL 4QXUH 2VO5A 1EGJH 3ZDZF 1BD2A 3JWOL 1T03H 1EO7A 3WJLA 1U93B 3PWJA 4ODWB 1P4IH 1YQVH 3FQRB 5ANMA 1ORQA 2DM7A 1OSZA 2XTJC 3WFDH 2DQEH 1A3RL 4AT6A 1F4XL 4DAGH 4E42A 1CFVH 4X80H 2P24B 4G7YH 1OCWL 3D3VE 3ZT6A 5ILTL 5K9JH 1MREL 4OCRL 4LSTL 4XGZB 1I1FB 5GS0D 3ULVH 1LP9F 1U8JB 4KRNA 4Y5VC 5IIEA 3MUJA 5GQBA 2BNQA 1OPGL 3HLAB 2O61B 3WNKA 3AU1B 4ONFH 3U4AA 3X14A 3JVGA 2DS4A 4PR5A 4YR6A 1YNTB 1YEDB 2APTA 4KQ4L 5BO1H 1NFDE 7CGTA 5INDB 1JPST 2NMSA 3K8KA 2X41A 5E6ID 3M8OH 2GSGB 1A1NA 4OCSL 3MRKA 1C16A 2HKHH 3U0TA 3I6GA 4M7KH 3MRMA 1XGTB 4EDXB 2EE2A 2FDBP 1J0IA 2D7TL 2CJUL 3SGJC 2VKXA 5GHWL 4PREA 4PJ5D 5F7NC 3MLSL 4KROD 2XTLA 5ALBH 3BEVA 3MXVL 4J4PC 3B2VH 1NDMA 4NFCA 4O2CB 2J8UB 4PGBA 1M6OA 1MNUL 1E0OB 4RCAA 5MEOB 4WFEE 1CGVA 5HXMA 3KS0H 2BMKB 3RTQC 1IAOA 2HAZA 4JFFD 4U4BA 4ZDHA 1I3UA 2VH5H 2K7PA 5J1AB 3PGDB 2VQUA 4C56B 1KENL 5GGQL 2FHFA 1H3PH 1EHNA 1GSMA 4I2XB 3QG7H 3TH4T 1U93A 4ODWA 4DUXA 1MCSA 3FQRA 3PWPE 3ESVF 2WK2A 4OBSA 4IDJL 4KJPC 2OQJB 4QEGA 4P4KC 3Q6GH 2P24A 4XVSH 1BBDH 3EHBC 4WTWA 1I1FA 3VWJD 1Y0LB 4GQ9H 4AEEA 1U8JA 5KSBE 5IP4A 4EIZC 3U46B 1DBML 2C3GA 4WWID 1CXKA 3HLAA 4V1DE 3AU1A 3PGCB 1H8NA 4UIKH 3IDXH 2ICCA 1YNTA 4HUXB 1KCLA 3SO5A 4NSKB 2D7OA 2X4NB 5INDA 1JWMA 4YK4B 4MA8L 2VAAB 2GSGA 5EFIB 5CKAA 4ZFZB 3LRHA 4U0RC 3HAEB 1XGTA 2EZ0C 4EDXA 1NL0H 4NDMB 4Q9BA 3GI9L 2CLVB 1Q9LB 2FWOA 1HXYB 4YNYB 4C57C 3F12B 3P9LB 3BZFB 1NUNB 5CJXC 4PJEB 4P3WA 3ZTNL 4O2CA 2J8UA 2FJGA 2HWZH 5MEOA 4Q97A 1MJUH 1DQDL 2BMKA 2RQ8A 3DO3A 3KJ6L 3NIFE 5J1AA 3P4OB 2BVTA 3PGDA 3P3YA 1GCFA 5IBLC 3UPRA 4C56A 3QQ9D 3MJ8B 2NX5E 3RJDA 5JORB 4U1GC 5HHQB 1KJ3L 4YPGA 4HDIA 2OQJA 1TJGL 5FO8B 1FZJB 1Y0LA 5DLMH 4APQC 4HCRA 1I3GH 4H88L 3U46A 2IGFH 3EZJB 5BCAA 2W0PA 1P84K 3PGCA 1B2WH 4JHAL 5C08D 4WJ5A 2HFGL 4PD4K 2EDFA 5A3IC 1NQBA 2E27L 3IS1X 4NSKA 2DQHH 2X4NA 2AEWA 2OK0L 1KSRA 1U3HC 4NC1C 4WEMB 2IALB 2VAAA 3AAZB 5EFIA 4X98B 5IVNA 2J6EL 3HAEA 2B1AL 4UTAL 4IRSC 3BD4A 5GS2H 1J1PH 4GRLD 4NDMA 1UWGL 3UAJC 5C0FB 2V5RA 2Z31B 1Y6NR 1Q9LA 1HXYA 3WFBH 4YNYA 3F12A 3P9LA 3BZFA 1JZ4A 2HJLB 2PYED 2MJWA 4PJEA 2C1PB 1YEFH 4LARH 3EDKA 5HDLA 4G8FB 1N5AB 4KVNL 4C58B 4H8WC 1LVEA 4K55A 4OI8A 4UBDD 4XP4L 2AK1L 4H1LH 3P4OA 3LQAL 4FS0A 3QI9D 5I66B 3MJ8A 1J8HB 3NGBC 1A3LL 2VZ1A 3C6LC 3CCHB 5JORA 2R2EB 5HHQA 5IHUH 5C9KA 3RHWF 2A9ML 1FLRL 1S78C 2NTFB 5C0CD 3VGFA 4PJHE 1U8IB 3Q1SH 1FYHB 2PR4L 3BKJL 5CP3A 5HHMA 4OKVB 4XMLL 4U1HB 1AR2A 2VABB 4LFHG 1PD6A 4MMZC 4DKFH 5B4MD 1RZ7L 3TJEH 4LSVH 2F58L 3VXUB 4LGPB 4U1NB 2DQIH 4UQ2B 4QRTB 5TGBB 4U7KA 1FLTX 3RUGE 2IALA 4NKDB 2EDBA 1PYWA 2QTEA 3O2DA 3AAZA 3TGXA 4X98A 4EUPG 3RHWK 3S98A 4NJ9L 1DVFC 4R4ND 1UM6L 2ZUTA 5EUOF 5LCVH 5C0FA 2Z31A 1RK0B 4L8SC 4MNQB 1EUTA 2H8PB 2JJSC 4K23L 2HJLA 1CL7I 3MV7E 4HWBL 5BS0D 2C1PA 1T83A 3JVGC 4G8FA 4P5TB 1UXSB 1U58B 3N1PC 3QQ3B 2XN9B 4OGXH 4DJMA 1WEJL 2VWEC 4JG0L 1N64H 4XC1L 4AZ8A 1NBVL 3RL1B 5D2LF 4JHZA 4LLUB 1WUNT 5I66A 1FGVL 3F58H 3ILQC 2CGRL 2V2TB 2IWGA 4JJHA 1J8HA 2EO9A 3FOLB 1VA9A 1DQML 1QBMH 1BIHA 4NQDB 3CCHA 4TUKL 2R2EA 4OLZH 4JO1H 5HPOA 5GIRB 4DGIH 3EYSL 5EU6A 3X3FL 3Q3GB 4K7PH 2NTFA 1JE6A 4JQVC 5GJSL 1U8IA 1CXIA 2VDML 4R7DB 5HVHB 4OKVA 2ICES 4OFIA 4U1HA 1TCMA 2VABA 3GKWH 4PJAA 3QP3A 5D1QA 4XWGL 3RGVD 1YUHB 4U1NA 4UQ2A 2A0LD 2GJJA 2NY5L 1MVFA 4LU5L 4QRTA 4K71B 5TGBA 2BFVL 1A0QL 1BVZA 4NKDA 3IVKB 1IC5L 4GMSH 5I9QC 2AP2A 4KC3B 3NCJL 1V7NL 4AEIL 4XT1C 1S7QB 4UTBL 4JPWL 1RK0A 3DGCR 3K2MC 4HUKB 4MNQA 1L8JA 2WLZA 4QXWA 1ZK9A 1HZHH 4JFED 4U0QB 2EECA 3DX9B 3T0BA 5KN5B 4MXWH 3HR5B 3LAFA 3OAUH 5TQ0H 3VMPA 2X10A 3C2AL 4HG4K 5BOZG 4P5TA 4EBQL 1NMBL 1UXSA 1U58A 3QQ3A 4RAVB 2XN9A 1EFXB 1T7VA 2H1PL 3SE3A 1SJHA 1MHCA 2VXUL 3RL1A 1NUDA 1I9EA 2KL6A 4LLUA 1XF2B 2AXFB 2E7LA 4LASH 5IQ9B 4D9QE 5EC1B 2XQYK 2V2TA 1UVQB 3FOLA 3MOQA 3ARBD 3MGTB 4NQDA 1D5IH 4KKLC 1A2YB 3BGAA 4G6JL 5GIRA 3R0MA 4WW1A 3Q3GA 4IRJA 3ARUA 4QWWC 2NQCA 4R7DA 1KC5H 2YN3A 3MFFB 3SKJH 4FNLH 5D6CB 5C07A 2W1NA 4OGZA 1DDHB 4G6AC 1BD2E 1CTNA 5D2NB 3MRLB 5D7JB 1ETZA 1YUHA 1R0AL 4NOBA 1CK0L 5KVFL 5ANME 1KLGB 3IVKA 1BAFH 4Y16D 4AIZB 4G5ZL 4NFDA 4MB5A 3EO9L 4MAUL 1TZGH 4R6UA 1S7QA 4G6KH 4WNQB 5SWZB 1MCPH 4NFBA 5LXGL 1U3JA 5JOEA 4WUUB 4OIAA 2O5ZH 3DX9A 5KN5A 1I7ZB 3HNVL 3HR5A 2QKIB 4YXHL 3CXDL 1NCDL 2AEQL 3JWOH 3G5YB 4RAVA 3UPCA 1EFXA 4YEFA 1OP9A 2X1OA 5D5MF 4LGRB 1A3RH 4PJCB 1IVLA 1F4XH 1IQWL 4NRZB 2AXFA 1XF2A 2PXYC 1OCWH 5IGXL 5ILTH 1MREH 5EC1A 3NAAL 4OCRH 2CDGB 3IFPB 1UVQA 3SHSA 1YYLL 1VFBA 3MGTA 2J5LB 1OPGH 4NHCL 1A2YA 2V5TA 5EDXA 2F53B 1CD0A 5IBUG 4H1LB 3W9EB 2FX9L 3AY4C 1F3DJ 5EZOH 3TBWB 3DX6A 3MR9B 3MFFA 3VXRB 4RGOL 1JUFB 1NCBL 4OCSH 3O4OB 1DDHA 1MCNA 3ZE0F 2Y23A 4S0UC 2DQUL 4X6DE 5D2NA 3IDMB 5D7JA 2C1OB 2D7TH 2CJUH 5DO2D 4PTTA 3SDAD 1OWWA 1T0PB 2GW5A 3BFOA 2F54D 1KLGA 2M8XA 5TE4L 4ODTH 5HI5D 4AIZA 4Z7QE 3MXVH 2EEAA 4RMRA 3OKNB 1Z9MA 1MNUH 5BXFB 1T2QL 2NY7H 4U1JB 3FTGB 3KS0J 5SWZA 2EDEA 2ZUQB 4PGJA 1U36A 2X1PA 1GGCL 1I7ZA 5DA0B 1KENH 5GGQH 3GUTB 4XH2B 3MLZL 1MWAA 4GH7B 3G5YA 3HUJB 9CGTA 1I1AD 1INEL 1BOGB 3QFJB 4IDJH 4PJCA 3U83A 5D1ZB 5T3XD 5IESL 4NRZA 4LAJH 3BPLB 4NM8L 5C0AB 2CDGA 3W82A 1HNGA 4EN3B 3IFPA 4Z8FL 3KPSE 1IAII 1MCWW 3NZ8B 1DBMH 4A6YH 3JUZA 2R39A 5E00B 1MFDL 2YA0A 4RNRB 2F53A 2DKMA 4H1LA 2O5YL 3D3VD 1XR8B 5GGVL 1T83C 3TBWA 3MR9A 4MA8H 3VXRA 2HT4D 4P2CG 1JUFA 1MCOL 4PYHA 2LV4A 3B6SB 2L0DA 3IDMA 2H2SD 4I2XE 1U8QB 2JIXB 3WXWL 3GI9H 5B8CC 2V9TA 1D3CA 2VZSA 1ONQB 1QSZA 4ZXBB 4NHUB 1CDGA 5DK3A 3ZTNH 5C2UB 4Y5YB 5HYSG 3OKNA 4I3GA 5BXFA 4P57B 4XP5L 1QPXA 3P77B 4U1JA 1NH6A 3FTGA 2VLKB 1DQDH 4H0HB 1UXWB 3OJMB 3KJ6H 4PRHB 3EFFB 2VLLB 4Y4HB 3BISA 3OWEA 3GUTA 2XI9A 3O45B 4LL9A 4XH2A 3GIZH 1D6VL 4MHHI 4OD3L 4RMVA 3HUJA 4GRWE 1TVBB 4M62L 4OFYD 2CDEB 4WFED 4PB9L 2FHBA 1BOGA 4DVRL 3QFJA 1KJ3H 3ULVC 5D1ZA 1TJGH 3H0TB 5DK0A 4UNTA 3UCRA 4RMQA 3H3PL 2WANA 1CBVL 3GMLB