3CC5A

H-2db complex with human gp100
Total Genus 68
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
68
sequence length
276
structure length
276
Chain Sequence
GPHSMRYFETAVSRPGLEEPRYISVGYVDNKEFVRFDSDAENPRYEPRAPWMEQEGPEYWERETQKAKGQEQWFRVSLRNLLGYYNQSAGGSHTLQQMSGCDLGSDWRLLRGYLQFAYEGRDYIALNEDLKTWTAADMAAQITRRKWEQSGAAEHYKAYLEGECVEWLHRYLKNGNATLLRTDSPKAHVTHHPRSKGEVTLRCWALGFYPADITLTWQLNGEELTQDMELVETRPAGDGTFQKWASVVVPLGKEQNYTCRVYHEGLPEPLTLRWEP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system
molecule keywords H-2 class I histocompatibility antigen, D-B alpha chain
publication title Design of agonistic altered peptides for the robust induction of CTL directed towards H-2Db in complex with the melanoma-associated epitope gp100.
pubmed doi rcsb
source organism Mus musculus
total genus 68
structure length 276
sequence length 276
chains with identical sequence D
ec nomenclature
pdb deposition date 2008-02-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00129 MHC_I Class I Histocompatibility antigen, domains alpha 1 and 2
A PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3cc5A02
3.30.500.10 Alpha Beta 2-Layer Sandwich Murine Class I Major Histocompatibility Complex, H2-DB; Chain A, domain 1 MHC class I-like antigen recognition-like 3cc5A01
4F37K 1XEDA 1BWMA 3NIGF 1GC1L 1I8LA 4ZFGL 4NPYB 4XP5L 3WKNA 1MCIA 4QHLB 2W9LA 4KQ3H 3PG2A 3LKOB 5ID1A 4FG6C 5ANMA 3GEWB 2KQMA 4OCSL 2GK0B 1RJLA 2J6EH 3I2CH 3S4SB 4LCWD 4TSBH 5H2BB 5TF1H 1WV7T 5EU6D 2A77L 2XG5A 2YPVL 4H8WL 1RJYB 2CO6B 5E2VL 3B6SA 3P11H 1JWUB 3VXRD 3VE0A 5T5FH 3VGAB 1HINH 2P5WB 2F53D 3QO0A 4I9WE 1MCKA 2EE3A 3C60D 5CJ8A 1QYGL 2Y36H 3S9DB 1WC7A 5EU5B 4NN7C 5BOPA 3DXAB 1G6VK 3MUGA 5MEOA 4KQ4L 1B90A 1Z9SA 1GPOH 4HAFA 4Z7VB 1VGKB 1BBDL 4YDLC 3S37L 2DAVA 1IGFH 3KS0H 2PYED 5FUCC 1WTLA 4UU9A 5TDPA 2VLKD 4WV1B 5D7LA 1JP5A 4YAQA 3NIDF 5CKAA 1MCCA 3KHOA 3CDCA 1ZHKB 3N9GH 1T1XB 4WO4D 4Z77B 1ZE3C 1GGCL 4NKOA 4RBPK 1BBJA 1K5NA 1K4CA 2ESVB 2R9HC 5F6IC 1UXSA 1GHFH 5CINH 1BVKA 5AZEL 3E8UH 1NLDL 3OR6A 1HI6A 1X5ZA 4GKZA 5E03A 4F3FA 1RU9H 2HG5B 3UTPD 4XVSL 4QRRD 1WFTA 3O9WC 4OZGB 5EWIL 4P0DA 4PB0L 2XN9B 2ZCHH 4NC0B 4LU5L 2N1KA 5E8OB 2YR3A 3GSUA 2LU4A 3SE4A 4FTVD 5C0GA 5IK3B 1T1WA 4K71C 4RIRA 4LVNC 3KLAB 2XXMB 3QI9B 3CVHA 3BEVA 1P1ZB 1RZIA 1ITBB 1PKQB 5GSRA 3VWKD 5C1MB 1NMAL 2MOVA 1FL6B 4JR9L 3EOTH 4G8GD 3BZDA 2HTKC 3UTTD 2VLMD 2ZOLA 4GRLB 4RWHA 1TMCB 1EEZA 3ARFD 5FYLE 4EBQH 1B0GA 4M5ZH 1CDCA 3ZHLA 3V0VA 2GW5A 4HUWB 4NJ9L 3OKOA 4WEUD 1Q0YH 4WHDA 3BIKA 3FN0H 1MCOL 4HKXA 3CFKA 4C83A 2MSPA 5FA3B 4ZXBC 1NEZB 3F6IA 1IZJA 4J7RA 4KTEL 3LKPB 3D9AH 1CICC 3EBAA 5D6CA 4EVNB 1IEAB 5BJTB 1P7HL 2EDYA 3QEHA 4M5YH 4Z0XA 2VITB 3L7FB 3UPCA 4X7SL 1S7UA 1NC2D 4MQSB 2NY5H 3TN0A 4PJCF 2FO4B 2NY1B 3KR3L 5JDSB 4LPUA 4KUCF 1BIIB 5A16A 2D4DA 1YJDC 5J11C 1ZANH 1B2WL 3SY0A 1DEEA 5GZNC 1S7TB 4MAUL 5FCUH 4OB5H 4PJBB 3BD5A 4IJ3B 4HGKC 3HI6L 3RWHA 3H9SD 2VLLA 4OIAA 4X6FA 3FT2A 1A3RH 4H1LB 1LO3L 3QNYA 5HJ3B 4C56D 5IM7A 1CE1L 4IS6A 1NGZB 3BHBA 2Q6WA 3O4OC 1LK3H 2QSCH 3PL6C 4YZFE 3QSKB 5D71L 1CGVA 2MMXA 1GZQB 1JNNL 4EKXA 1MJ7H 3HUJE 1A6PA 1FNSH 4ZFOA 1YEHL 5ESQB 3FHQA 3NH7H 3VXQB 3VFWA 5DJ6B 5JOPD 2JB6B 3MR9B 3B9KA 4P57A 1CK0L 5E8DH 4PGDA 2J8HA 4NZUL 5C0JA 1YN6A 1JNLL 3MNWB 4LOUD 1AHWC 3IKCA 3ZT5A 3BP4A 3QDJD 5JUEL 4NCDA 5ANME 1HHKA 1G84A 3V4PH 2MQCA 5C0EB 4TNVK 3RIAF 4P2QB 3MV7D 3JWOH 5CZVL 1AGEB 3VXTB 2IALA 1QR4A 3QAZC 4A6YB 2YUVA 4D9RD 1UEMA 1NCCH 4X99B 3RWGA 5A1AA 1VFUA 4LLYB 3O2VL 2IPUG 4U0QB 1HYSC 1A6UH 1XGPA 3U2SA 5D7IF 5CJQL 1GIGH 4KRLB 3PQYD 4FXGA 5JQHC 5HI4D 2J12B 2KDGA 3MJ9H 3BD4A 2FSEA 5JIPA 3ECBB 1F3JA 5D2NB 1J88A 1NCBH 4Z95L 5D7LE 2E7BA 2F5AL 4K2UH 2VZOA 4Q74A 4YC2B 3WFEH 5EO9B 1NFIB 2DBJA 1KIPB 3GM0A 4YO0A 4JRYA 4F7CA 1J1XH 1AQKL 3G5ZB 3S3SA 4PGEB 3TO4B 3QIWD 1R3KA 1JPSL 3BZ4B 3WBDA 2R0KH 4R4BA 4M6NL 1OF2A 3BPLB 2FX7H 4U1HA 5LWYL 3O3AA 3CMOL 1H8NA 1J0IA 3C9NB 4ODVH 5JO5B 2DQGH 4CVZA 4V1DB 1WBYA 3P40A 4HLZG 3HZVB 5BRZD 5EBWA 4HGWA 2ED7A 3MRRA 4WW2B 3RWCB 2WLYA 3ESVF 4DQOL 4YUEL 1W72A 5DGRA 4PTUA 1EBPA 1LO2L 2J4WL 3RX8A 1QRNA 2GTWB 2V7HB 3HZYA 1UGNA 1TIUA 1BREA 2VZ3A 1H3XA 1AIFB 1QEWB 1Q1JL 3ZKXB 1CZ8H 4YE4L 4WI6A 1R3JA 4TULL 4KI5F 5I6XC 1ED3A 1I9IL 2D31A 3AAZB 2ZZUT 1K9TA 1U3JA 1NAMH 1AO7B 3LEXB 3HE7C 3DGGB 3T4AB 1ADQA 4JFDD 1FVEA 1HEZA 1T7ZA 3RVTD 1OTSD 3EOYG 1N64L 4LKXB 3GBNL 3IDJB 4JFXB 2VWEE 1XGQB 3GIZL 1N5YL 3P4OB 1A6WL 1KEMH 4P2OA 5DC9B 1MVUA 3CK0L 3F12A 2P8LA 1J05B 4KJPC 3A6CL 1DQJB 3U0PA 5FYKU 1HXMB 4U6VL 4JY6B 4LSPH 3AUVA 5FXCH 1OGTA 3LZFL 4GS7B 2Z31B 1FAIL 1FNEA 2OSLB 4OZHF 1MWAL 1BJMA 2NX5D 1H3WM 2ZCLL 3V0WL 2B1AH 4ZS6D 3MLSL 2CDFA 1QFWM 1FZMA 2VXQH 1ZV5A 1GOHA 1G9ML 4QRQB 4OD1L 4RMRA 3WKMH 3IETA 5TDNA 3W9EB 3OWEA 3VMOA 1NC4D 3LRSB 1MFCH 3L7EB 3TA3A 4M48H 2GYSA 3TT1H 3S3JA 2NNAB 2HLAB 2QR0B 5KW9L 3X3GH 1NMCC 2D7PA 5T5NF 3F5WB 2EXWD 1OB1B 1KELL 1N4XL 2HFEB 2ZKHL 2EIZB 3JV5A 3S98A 1CFVL 5E99H 3VXUA 4YX2H 1I1AD 2ED8A 4AQOA 4H25B 3TYGH 2EDBA 5I73B 2X7LB 1G7PB 1XF4B 2WUBH 3T0VA 4GG8B 5C9KA 1QVOA 3VFMB 3LEYL 2NTSP 4PJ5B 4FZEL 1MF2H 1BD2D 2EYRA 4OQTH 4CRPA 3Q2CA 1DBKH 1I4FB 2HYMA 3D5OF 4I3SH 3HC4H 4KK9D 1DBJL 2QHLA 2ZCKL 4MB5A 4HDIB 2C1OB 1UEYA 2PR4H 3MGTA 2WBKA 4N9OB 1R0AH 3LKQB 1OM3L 3MNVB 4NO2A 1SMOA 3SO5A 5ALCH 2PXYC 1IM9D 2RHEA 1J1PH 4L3AA 1U8LA 4YFLF 4MVBC 2IMNA 2PW2B 4FQQA 2BJMH 3O3BB 2H1PL 5KANG 1Q8MA 3U48A 3DUSB 1DQMH 1LNUB 4POZC 5F7DA 4XVTH 3WFDH 5AEAA 5HGHA 4JFEB 2C3GA 2G2RA 5EU7E 1H8SA 3QWOB 3QDMB 5GS0H 5D96C 3S6CA 3MRMA 4QRTA 5MI0B 1B6UA 5JXEC 4IMLA 5B3JF 1GOFA 1MCEA 1C08A 2C3WA 2YRPA 3QUMB 4PG9A 3D0LA 1B0RB 4JRYE 1WT5C 1P9MA 1FVDA 1FFOA 3QIBC 5F7FA 1NKRA 5T1DH 1U3HC 1F3RB 2WAHA 4MCZB 1MUJB 4X4MA 5EN2B 4MCYA 3T1FA 3WHXB 1D9KA 1P4BL 3ARGA 1JMXA 1GC1C 3I84A 3QH3A 4LVEA 4HUUA 1TLKA 5GRJL 3PABB 1EUTA 4L3ED 1A4JA 5ERWB 5DTFA 3RJDA 2WIMA 3FQWB 4Q7DA 2ILLA 5CIPA 3LSOB 4QXTB 4K8RH 2PTUA 1MWAA 3NA9L 2QQLL 1V3LA 3QFJB 1R6VA 1LO0L 1RUKL 3IDXH 4CJ0A 2YEZA 4HUNB 3FMGL 5HYIA 1WAAF 2BHUA 3SKMA 3ZDZE 5TGBB 2JJTC 5I1EL 4CADA 2XIDA 4P23D 2W07A 3LQAC 1CI5A 2DQJH 2OI9B 1IAKA 4WFFE 4F33B 4HPYL 2DTSA 5F6HI 4NM8L 4KXZI 1HQ4B 4DUVA 3QCUH 1ZT4B 3QEGH 2P45B 1M7DB 4C59B 1MFNA 1N0XH 3TJHA 5T33L 3OAYK 3FO9A 4HIEB 3RTQC 2AP2A 2GSGA 3M45A 5JPMA 2IBBA 1G0XA 5IEHB 3LQMA 3NPSB 4HUXB 4U6TA 3MCLH 1BEYH 3O8XD 4P5TD 1ZLSL 1A1MA 1I3RB 4ODWA 4LLAA 2LABA 5FB8A 1MFAL 5FGBA 4NN6C 1T04A 1LEKA 5DQDH 5HGAB 2H45A 5CBEA 2Q8BH 1A1NA 2IBZX 5C0DA 2Z4QB 3ILQD 3MREA 4HFUH 4M43L 2NY0D 1L6XA 3B5HA 1KULA 2ZWLT 2IFGA 4IIQA 5F1NB 5EBGA 1MAJA 3RBSA 4KVNL 5IBLD 1PAMA 1N7ML 5I18L 4U2YA 1FL3A 1UACL 5AZ2H 5JMOC 4PJDF 3GB7B 1JF1A 4OUUB 5J89A 4P2YA 4Y4KC 1ZOXA 1DL7L 3W81A 4Y4FA 1HHJA 4L3CB 1RUQH 1MIML 1JMZA 1JWMA 3BXNA 3QFDB 2D7QA 5CEYB 5IBTH 3RL2B 3EDKA 2L7JA 2VL5B 3VW3L 1TETL 5CUSH 5ITBL 5AUMB 2DMCA 3VXUE 5DUBA 3TZVB 5EU7C 4JZOA 1BIHA 4PJIA 3Q5TA 1NLBL 3HFMH 2YHGA 2W60B 4OAWB 1OGAB 1I9JH 5IGXL 4DVRL 1N26A 4JY5H 4Y19A 2BC4B 1MEXL 4MHHI 2ARJB 4WUKL 1QLFB 1UYWH 3MNZA 1SEBB 4J3XA 4UOJA 5D6DA 1U92B 1ONQA 1SJHB 3TYFA 3AXLB 4WW1A 2XTJD 2D9CA 4MSWB 3CFEB 1UKTA 1KCLA 2R4SH 1RURH 4NQEA 4MS8C 5HDQL 1A7QH 2FEDD 5L8KB 2A73B 1LK2A 1WIOA 5IHUH 4JE4B 1U93A 3HNTL 1NCWL 3CXHJ 1BLNB 3U0WL 3O6FD 3UYPA 4PP2B 3MOBL 1L9MA 4RMSA 4J4PC 4RMTA 3KPRD 4GG6A 2OL3H 4MQTB 2M26A 3R1GL 4KROD 3EAKA 2WANA 3SKJH 5GRVK 1ZVSB 3MFFB 2BVTA 4R26H 2YA0A 5DO2C 3L3GA 1D5ZA 4FFYH 1EJOH 4LLWA 4POYA 3P4LA 3D2UA 1XCQA 1U0QA 5C6TL 4OFDA 5BMFL 3ARBC 4FQXA 4JO4L 2HFTA 3G9VA 1EMTH 1NBZB 3EDJA 4X4ME 4GW4A 3RA7L 2HH0L 3QUYD 5DRWB 5B21A 2Y06L 4R9HA 3FQNB 2X2YA 1VA9A 3JTTA 4GXUN 2F8VA 2AJSL 3UJJH 4UIKH 1YEFH 2AV7A 2YZ8A 4NUGL 5EO1A 5FO9B 4NQCB 4XPBL 5D7IB 2RAMA 3MBEB 1OT2A 3P3YA 1M7IB 2YXFA 3WFHA 5F7HA 1MJ8H 3HI5L 5L8JB 4J23A 5CGMA 3I02B 5HD8D 3ZE0E 1MAMH 1E27B 3LHPH 4I13B 1HDMA 4NN5B 3TVMC 4O4YL 3V5DA 3NCFB 5B38B 2E6QA 4PY8I 1I3GH 5DEZA 5BS0D 3ZLQC 1ND0A 1NKOA 2BXZA 1FYHB 2DRUA 4XX1E 4PRAA 3CCHA 3VXMD 3CX5J 1E4XL 3FN9A 5F7EL 3VDCA 3T2OA 3SKOA 4C4KT 5GGTL 4ORZC 1U8HB 2VZ1A 2AK1H 5D5MF 1VKXB 3EYOA 2YK1H 3H3KA 4C56B 3JWDL 3C5ZB 1KOAA 1RHFA 3TBTA 5JW3H 4IM8A 1QFOA 4Y5XB 4ZTPH 1S7SB 1ZTXH 1R3HB 2W0FB 3WUWA 4BH8A 4LVHC 4GLRI 5DRZB 3T3ME 3OKKA 2E6JA 1XIWB 5INCA 1S9VA 3E6FA 5EPMB 1KCRH 2FJFB 4U05A 5EZJA 1RUAL 4NNPH 4QKXB 3HNVH 3IDMB 1N8ZA 4KKNA 2X4QB 2EE9A 4P3CL 4DGYL 3BJ91 1B88A 4LLMA 4PJ8D 5H35A 4Y16A 3DV6B 4OIBA 3PWVA 2V17H 5TH2A 3OB0K 2Z8VC 2XKNB 4GBXB 4WGVB 1A6ZB 5GS0D 3DTXA 4I18A 1E0OB 2V2TB 4JDTH 2Z91A 1EV2E 3G08A 2YXMA 4NP4H 3W9DB 5I1AA 5ID0B 3MROB 3MSPA 2B0SL 1RK1B 5F3HB 5GS1B 3H42L 4HS8L 4RZCB 3DSFL 3DX7B 2VXSH 3VXOB 4PJIE 1B4RA 4X7FC 5EOTA 2OTWA 4Q6IA 4OSUL 1T83C 1CXKA 5SWSB 3SDCB 4PLKC 1IGCL 2I60L 5JHDA 4XZUB 3CLEL 1JPGB 5GHWH 4Y19E 1AKJB 3UDWA 1QSFB 2NZIA 1F4YL 3U0TB 3RWIA 2DKMA 4YHMH 4BK5A 4LQFL 3U30B 3T1WA 1A5FH 4OZHB 1E4KC 1EK3A 4S1RH 3HG1D 1YNLL 2CQVA 4LRIA 2IFFL 4O58L 5IBUG 3T2NH 4ZUUB 5D93C 5E8EB 1CDJA 1RZFH 3QPQD 4F7PB 1S9YB 1EAPA 3CNKA 4K8RD 4NQEE 4OZIB 4JHAL 3EYVA 2VDOL 3U4EA 1F4XL 4GKNB 4PJ9D 5J06A 4R90H 3BH8B 4WTXA 1XZ0B 2AXGA 5AD0A 3P73B 3IFNL 2ZSWB 3E0GA 5DJDA 1DE4A 4GAGL 1K6QL 4EI6B 4OKDA 5F3BA 2YPLD 3GK8H 1LE9B 1BGXH 4RFEA 1MHEA 4GG6E 4XBGA 3HC3L 3PJSB 1G9MC 4L9LB 1UJ3C 2C7UA 2W0KA 4XNMA 3WE6B 2FGWH 4YR6A 2PTTB 4G7VH 5K9OB 3IFLH 3VGBA 3ARDB 1CDHA 5FYLH 3OKLB 4GXVL 1NL0L 5GGTA 2VTFA 5DK3A 5D7JC 4PRPB 4APQD 1YNKL 3MC0A 1OD9A 3LKNB 4RQQA 3TJEL 4AENB 3I75A 4LSTH 1X4YA 5F9JA 5L8LB 4ODUA 1R5IB 5K9KA 1IC4H 3INUL 5MEND 2WY3A 4E41D 3OHXB 3QIUA 1T0MA 4XC3L 5F88A 5E0QA 1KGCE 5HDBF 4FQCH 3QP3A 4JFFD 3IF1A 3IU3A 3V6OC 2VXUH 4PGCB 1X3DA 1RFDL 1ES0A 4XP9L 3OKNA 1H3GA 1BZ9A 1S78D 3LN4A 3PHQB 4PDCE 3MJ8A 4LARH 5F1IB 5BVPL 4LVOB 1WWAX 4OCMC 1I8MA 4H5SA 3I85A 3V6FB 1KTLA 8FABB 2RQ8A 1QFUH 4FFVD 4NQVB 1H3PH 5CWSA 3Q3GB 4XTRD 1S7VB 2BHZA 4JJ5B 4L1HA 4Y7MA 5F89B 1NDMB 5EC2A 1PD6A 3CC5A 3MV8E 4YPGB 1MVFA 1BFTA 3ZE2F 5I1DB 4OJFH 2EYSA 3BKYH 3PUCA 3B9VA 3C6LB 4MXVF 5HDLA 1PG7H 4D9QE 3G6JA 4U1MB 3CFCL 4KRPC 4CMMB 2AJUH 5DJ0B 1ZWIB 1EHAA 3SDDA 3VCLB 4XRCA 2WNGA 3QUXD 4WI8A 3RRQA 4AEEA 1RY7B 4J6RH 5CD3B 5KJRL 1KB5A 4RWYH 2W0LA 3L5XH 5I2IA 3HI1B 4U1IA 4UDTB 2C1PA 3L3IB 4S1QL 4LCUB 4HKJB 1LMKA 5BZDA 2EKSB 4JZJA 4JVWA 1T2JA 4YHZL 4RGNE 2J8UA 2XNAB 4OCWH 1KJMA 2R0ZL 2VN7A 1RVFL 1T03L 2AJVH 3H0TB 1U58B 4PUBL 3BN9D 2CDEB 3QWQB 4ZYKB 3W11D 4JO3L 4DKFH 2R39A 3DVNA 4F58H 4NZTH 4L1DA 5JIKA 4L29B 1YEKH 3MLWH 3OAZH 2FLBT 1AGFB 1G7JA 4MAYA 3RIAK 4U1LB 4ODTH 1XF2B 3AB0C 3WXVL 1FYTD 3ZT6A 1IC5H 1P2CA 2QQNL 5J4MA 4PYHA 1WBZB 3RJQB 3WNLA 1MHPL 2EO1A 2CK0H 3TWCH 2C4FU 2IG2H 5JHDE 5C2BH 4D0BA 3QJFA 5I30L 1FZKA 4U1JA 4P4KB 3TCLB 1TVBB 3LV3B 1IC7L 2I5YH 5DRXA 5F9WC 3HE6A 2MNUA 4HKZB 5D7KD 3Q1SH 3RL1B 1QSZA 2WMPA 5D1QD 3VWJA 1I8IB 3QJHA 4HPOH 3TV3H 1EO8L 3I6GB 5B22A 2EXYD 1IQWL 1X5FA 2XA8H 3CFJA 5GGRA 1M71A 1QLRB 1X5AA 4B7LA 1JGDA 1QLEH 4LPCA 4OLUL 4S0SD 2BOBA 2MKLC 4PJ7A 5SX5H 4M7LT 2X70A 2B20A 1NCAH 1A0QL 2HP4A 2ADIB 3NA4A 3NIFE 4I3GA 3CVHH 3FCTA 3FT3B 3Q5YA 1M05B 3CFBA 2OM5A 1U91B 3PV6A 3W0WD 3QDGB 3SDAC 6FABL 2VLJB 3JUZA 3FZUD 1D6EB 3P30L 3GHBL 3CPLB 1EHLH 3F7VA 3VRLF 5JXAL 4XVUD 3ARXA 2FH6A 2HT3D 5HI5C 1T4KA 4K3JH 2ZUQB 3BPCB 4NNXB 3QT2A 3ORJA 4KXZH 1D7FA 4XVJL 1FP5A 5KVMC 5FYJL 1WIPA 1PQZB 2CJUL 2PCPA 5HHQB 2HWZL 3FKUS 4KK8D 3PDOB 4OTXL 2F5BL 4HV8A 5KG9A 2QQKL 4QF1A 2YC1A 3LKRB 3REVA 4R0LB 1D6VL 5CEZL 3D39D 2XRAH 3FQXA 3GBMH 3P2TA 4ZFGH 1ZT7A 2LU7A 1F11B 3TF7C 4OFPA 3Q6GL 4JQXA 3OX8A 5FYKD 4GQ9L 5MERA 2DI8A 3EOBA 4RAUA 5CCKL 2RR3A 3ARPA 5KS9F 1K4DB 2C4XA 1U41A 3F7YA 4YDIH 5BOZG 4K55A 2R23A 1YECL 4PD4J 5IV2B 4Q9QL 1VFBB 4KY1L 1K85A 5L2KA 2A77H 3TBVB 4H8WH 5E2VH 3ZTNH 3QNZA 2WP3T 4V3DB 2X4UA 3M07A 5D1ZA 2GK2A 2AJ3B 4I9WD 1QYGH 2ICWB 1Q0XH 1WWWX 5IWLC 1KXVC 1IC1A 1R3IL 3PGDB 4ISVA 1OAZL 3WXWL 3G6JE 3T2PA 4ENED 2AEQH 3T0EB 4A2MA 1BBDH 3S37H 1EDQA 1BOGB 1G7LB 3L3KA 4XNQA 4WUUE 3FB6A 4YGAB 5GJSH 3ZE1F 4F7EA 5KSUB 1QP1A 4M7ZC 5D4QA 2BDNL 5ACZA 1P5VA 1T21A 5JZ7D 5L7XL 5E4EC 2KUTA 3BO8A 5IIEB 3LY6A 2H41A 4EI5B 4HJ0D 1GGCH 1FFQA 1TJIH 1RIHL 2R2CA 4O9HL 1C5CL 4LSRL 3P77A 5E1AB 1NLDH 5CLWA 4N5ED 3RQ3A 2VMFA 4UTBH 3EJYC 3DMMD 1N6UA 2HTLD 3U7YL 5CJXC 5DWUL 2Y4SA 4UOW1 1JZ6A 2OQJA 3TIEA 4JGUA 2ZUYA 4U0RC 1HSBB 4X5XB 3HR5A 3VJ6B 4QHUB 3ULUE 3OG4B 4F9LC 5JW4R 2ZUVA 1NMAH 3QEUB 4JR9H 5FF6A 2YBRA 1A9EA 2NTFA 2YSSA 3E6HB 3UAJD 4BZ2L 5FYLD 3TIDB 5D5MB 1H5BB 2GAZA 5F7NC 4NJ9H 3KPMB 1CWVA 1ODAA 3VRJB 3ZYZA 1AD0B 2VDML 4MLSA 3B43A 2L4OA 4GW5A 3DETC 4FNLH 1MRDH 1P4LA 2HT2D 4B0MM 4HSQA 1CT8A 3O11B 5HGBA 4Z76A 4GRMB 4KTEH 3RWDB 3D85B 3EO9H 2RJMA 2R1WB 3RZCC 4NO0D 3TPKA 3UYOD 2X6MA 2APVA 4W81A 4HK0B 1ZVHA 4X7SH 3NGBB 4WHTA 2P47B 5DEFA 2GT9A 5CMAA 3V7AG 3KR3H 4XP6L 4PJ7E 2Q8AL 3D87B 3TPUB 1G7QA 3AS2A 4MWFB 2Q1EA 1UG9A 4FFWC 1B2WH 2ICES 2PNDA 4MAUH 3AGVA 5HY9A 5FDWB 1Y0LB 1CF8L 1FZJB 1DVFA 3HI6H 5K9QI 1FH5L 2V5RA 5SWZA 4H20L 3CU1A 1CE1H 2HKFL 1TQCC 1CGXA 3VFPB 1NFKA 5JLZB 4OFYA 5D71H 1WWCA 4RGOH 3WS6A 3QA3B 3R06B 2QLVB 3LRHA 5ITFB 1JV5A 3KPQB 3AU1B 1DUZB 1MCDA 3T77B 4Y4HA 1SJEB 4P3DB 5J6GA 1A7OH 4OV5A 2AGJL 4LHUD 3I50L 1E4XI 4KWUA 5E94B 4NC1C 5KZCD 3QUZC 1PZ5A 1UM4L 4JFPB 1ADQH 1CK0H 4L8SB 3L5JA 4QO1A 2EICA 2YOCA 4HCRA 5C09A 5HYEA 4PY7B 2VDNL 4GLRH 5JUEH 1YNTB 3AREC 2A74A 4Y2DC 5L6YL 2DM3A 2HVJB 3RNKB 5T1MA 1A7PL 1HILB 1M6OB 4NFBA 5CZVH 2XOTA 3K4DA 4ZODA 3VXSB 8CGTA 5AAMA 4G9FB 5L2KE 3O3EB 1S9WB 2HKHL 2PYFA 4WEBH 3VD5A 2GJZB 3DYPA 4QWWD 4BQ9A 1JE6A 2D7NA 1EA9C 1TZHA 4R3SA 5KSAC 2K7QA 4Z7WA 5CJQH 5F1OB 1MHCA 2I9LA 3RFZC 5CZXD 2VUYA 3O45A 3QQ4A 2RFXA 2NLJB 2A1WH 3FT4B 4NQDD 5T1LB 1U3YA 1FNHA 3X12B 4B53A 2MKWA 4OCLC 4BSVA 1A6VL 3MTRA 5DLML 4ZTOH 3KDMA 1II4E 1MOEA 5CSZA 1TENA 1HHIB 2F5AH 4HQQL 5D7LD 2BFVL 2FJGB 2X1WL 4EN3A 3PP3K 2IADA 3NFNA 4CDGC 4D0DA 1GVIA 4XMKL 2OJZL 4UMGA 1NGXA 4JM2A 4OF8A 5T3ZL 1AQKH 2Q87A 1UH3A 3UTZB 3FONB 3CAFA 4JKPH 4LCCA 1JPSH 4NRYB 5FM5M 3S96B 5HYSG 3FFDB 5IF0A 2R1XA 2MTPA 4QRUB 3KNBA 5LWYH 3CMOH 1SVCP 1RHHA 2D03L 2YD1A 1KPUA 5FHAH 2C4FT 3VXPA 3OKEB 4U2ZA 4GUPB 3WLBA 3D25A 5FCSH 1QUNA 3OXSA 3HUJF 4BZ1L 1W2KT 1DQQA 2HJFA 5GZOD 3O3DB 4YUEH 5IMKB 5I8CA 4E0RB 1LO2H 2J4WH 3RPIA 1U8KA 5FYJE 3H9HA 4I0PC 3HG1B 5LVEA 2HFGL 1KENL 4QOKB 4FQHB 1UZ6E 1I9IH 1SYSA 1EPFA 2AXFB 2IPUK 4ZS7H 4HXAL 4ONFH 3HA0A 3ULVL 3MRLA 3PNWB 1Q72L 3RGVC 3JWNC 1V5JA 1N64H 4OM0L 5IMMB 3GBNH 4V2BA 3GIZH 1JL8A 1X6LA 3TN0D 3KYOB 25C8H 4G9DB 2PO6B 2WSKA 1UZ8B 3HKFA 3O4LB 1UQSB 3A6CH 5E1HB 4U6VH 5KVGL 1ZHLA 2R0LH 1AY1L 3DRTB 4PRDA 1RZ8B 2BMKB 4AH2B 4P46B 3OJMB 1KB9J 4KUZL 1J0ZA 1CN4A 1T22B 5CIPH 4MQXC 5SWZE 1MWAH 4QHMA 3ROLA 5C8JA 3P4MB 5IQ9B 2VDQH 4BH7B 2DQEL 2H8PA 2VABA 3MLSH 2VLRA 3B2UD 1S7QA 3CJJA 1F58L 4HWZA 2D4FA 1CE6B 4CMHC 5DHVH 2XI9A 2K3TA 1TVDA 3TBYA 3BZFB 1IBGH 5B39A 1OVZA 1LE5B 4ETQA 1ORQA 2NXYC 1FNGA 4ZPVB 1UM6L 1MCLA 3GSNL 4NKQB 5I1KL 1FO0A 4ZUTB 1N4XH 3B9KD 3H7BA 1A6TA 1JIBA 5C09E 1CFVH 4EIZC 5T1KA 5FO8B 5JIIA 4ZUWB 5C0AB 4QT5B 3GMLB 4IRJB 4RISL 5BVJB 1T3FA 3U36A 4WFGE 3IU4L 3GSRB 1BZ7B 3LEYH 4WWKD 4FZEH 1T5XA 1URLA 5GQBA 5FKAB 1WZMA 2W9EH 2YPKB 3RVWD 1DBJH 1RIUL 1J12A 1ETZB 4PGBA 2ZCKH 3S35X 3KLHD 4U1GB 3RWJB 3L3OB 3NMEA 1XR9A 5JW4M 4PRNA 1A2YA 4Z7WE 5I1LA 4BJLA 3ME0A 1OM3H 4MDJB 2G5BB 1OTUC 1JZ8A 1AI1L 2H1PH 1QQDB 3NACL 4YC2C 3VXRA 2H3NB 4C55A 5LGJB 3MRFA 2QJDA 1OTTC 5TDOA 1WEJL 1WICA 4ZFZA 4RX4A 5BV7L 3V6ZA 2P4AB 5DMGC 4L4VA 4WI5A 4FQPA 4G43A 4NN7B 1INEH 1T5WA 3U7WL 5LGHL 4U1NA 2FBJL 3CZJA 5JPNB 5EA0L 3MYZA 5E6IC 2PW1B 2DI7A 1I3UA 3GMRB 5D1XC 5KS9B 2IF7A 1RZJL 3OGCA 1KBGL 5TFSL 4ELMB 4YDLB 3MRPB 1CLYL 1FL5B 5EIVA 5H94B 4U6HB 5GRJH 5DMKA 3HPLB 4WW2C 4DN4L 1AP2B 5EG6C 4TUJA 1UXWA 2J1KA 3TP4A 5JOFB 3PP4L 4YHNA 4F80A 2QQLH 5F6IB 1RUKH 3OV6A 3WD5L 1DN2A 2X4SB 3MRHB 3PE9A 3JTCA 3FMGH 3C2SA 3MV9A 1DFBL 3F7RA 2VIRA 2NXZC 4I48A 5I1EH 1QRND 3O9WB 4GMSH 4X6CF 4HZAA 1N59A 4YFEA 2H2SC 3VRIB 1IKNC 3KPOA 2X4RB 1LEGA 2Y6SC 4BQBA 3FTGB 4WFFD 2EDTA 4K71B 3O6KH 4LVNB 3QRGL 2XZAH 4NM8H 5HI3D 2HJKA 2BY0A 3L95A 2B4CH 1YYML 2R4RH 5DEGA 4D9LL 3GSQA 4P2OD 4QEGA 1S9KC 2MPAL 5CHNA 1CYGA 2BVYA 3FFCA 4GS7C 1ZLSH 5CFHA 2IJ0C 4QXUL 3VI3F 4YDVB 3UX9B 5ENWB 4ZXBB 3BRGC 2W91A 3VGHA 4P9HC 1DP0A 5CSBA 1HQRA 1BQLL 4OZFA 3GSVA 4I0CC 4KU1A 4MNQA 1CICB 4NRZA 3AM8A 2VLRE 3V79C 4JZNA 4JN2A 1E6OH 1N7MH 3M1BB 4I77L 5I18H 5ADPL 4N8VA 4WCYL 2YD7A 3F58L 5HYFA 5DK2A 4Y8DC 3WHE1 1OQXA 2EIBA 2OTUB 2BY2A 4PREB 4MNHA 5ISZA 1AC6A 3DYMA 3Q48A 3QISA 3LPFA 2Y9RT 1XH3A 5DMIL 5J11B 2HVKA 4HJGB 1MIMH 3D3VA 5HYQA 5JNYB 2LV4A 3GJFB 4HX1A 5FIEA 3SPVB 4AK1A 1FVCA 4ZUSA 3U4BL 1H0DB 4YDKL 1FG2A 3VW3H 5ITBH 3O4OB 1N3NB 1KIQB 3VXUD 1FV1A 3PL6B 3BEWA 2GY7B 1NLBH 35C8L 3LPGA 2WBJA 5T3ZE 3X3FH 5DSCB 5IBUB 3BQUC 4M7JH 2CXGA 1KCKA 3BDYH 1FFPA 5IGXH 2ADFL 3ULSA 4JFHD 3FQTA 3QXTA 3RVUC 3DIFB 4WUKH 3GM8A 4TUKL 1LQVA 5EUOA 1I7UA 1FJ1A 1G7IA 3QDJA 4KQ3L 5D2LE 2W9DH 4U31A 3DURB 2R1YB 2EDHA 3N1PC 3CDGB 2DYPA 2DIAA 1AHWB 5TF0A 2BERA 3STLA 2X4OB 2J6EL 3MJ7A 5HDQH 5E6ZA 3C5SB 1O7VA 2EZ0D 3HNTH 3VXRE 3UBXA 4L8CB 1NCWH 1ZA3A 4J1UB 4Y0GA 3KXFB 3QZWA 4KFZC 3QAZB 5LG1A 3MOBH 4CW1B 1IM3A 1NGWA 1YEEH 4R97C 4NHUE 3BZEA 2IAMB 1KJ2B 4L4VE 4O2FA 4UV7L 5FM8A 3R1GH 4S2SA 4ZAKA 5I1GL 3AY4C 3BYTA 2FHFA 3FQUA 4Y5YC 3ULVE 3UPRB 3UTOA 1DQDH 4OIIH 1AR1C 1U8PB 4Z7OE 5C6TH 5J9PB 4JO4H 4MGXA 1EFXA 3TGXA 3LN9A 3VH8G 2Z35A 5IEKA 3RA7H 2HH0H 1NGYA 3N9GL 5J56B 1D9KD 4DKEH 2W38A 1H15A 4IRSC 5IESL 1GHFL 2VZVA 5CINL 3E8UL 1ORSB 1I1YA 3WV0A 1QO3A 4CN6A 3T04D 4XPBH 2CKBB 1RU9L 3SCMA 5J0BA 4JM4L 3EJZC 5IUSA 2X1PA 3HI5H 4JAMB 3QEQB 3H8NA 1OHQA 4DW2H 3MV9E 3LEVL 1T7VA 3K3QA 1A64A 3EO1B 4IHOB 3QO1A 1YA5A 1JCKA 2HT4C 3ZHKA 2BSTB 3QNXB 4NSKB 3PGFL 1LQSR 1U42A 3SBWA 1JPFB 1QSEB 3WNNA 1J5OL 3QQNA 1E4XH 3BP7A 5F7EH 4U6XA 4EBQL 2AKRB 1P5UA 1QFHA 2I26N 4XWOD 5GGTH 1NCDL 1NJ9A 4ONHB 1ZK9A 5DK0A 3TJHD 1KYOJ 2BVPA 3WS3A 3IFPA 4P2CG 4JRXA 5L88H 4NHCL 4OD2B 4TUOA 3FFCE 4U1KB 2DLHA 4N0FB 3JWDH 4U3CA 3P9MB 4CVXA 5I8EB 2GJ6B 4MJ6B 4O2CA 1FSKC 3BRFA 3GI8L 4JFYA 3OJDA 5DT1H 3ARTA 1X9QA 3C08H 4M5YL 3JV4A 5IHZA 4MJIB 4JY4B 2IANB 3PWUA 5HPMB 1N5AA 5FGRA 2NY5L 3EDDA 3HE7B 2XXCB 4MNQE 4MJ5B 1RUAH 3KPNB 1IFHL 4NO5B 3PGCA 1PG7X 5IG7B 2VDPH 3P4NA 2ITCB 3S8WA 4OB5L 3U46B 3U6RA 4P3CH 4DGYH 5ISZE 3CZFB 4YGVB 3IRPX 4Y4FD 1U6AL 3WO4C 5FV2A 3GIVB 2JCCA 3D3VE 3MRIA 3O2DA 5CJBA 4GRWE 4KV5E 2QSCL 2O5YL 1CTNA 3EUUA 1YDPB 1SEQH 2B0SH 3BN3B 2H26A 5DD3H 3H42H 1MJ7L 3DSFH 3C60C 3GGWA 4FQLH 1CGSL 1K8DB 2I24N 4UNVA 4M4RA 2BNRB 1HSAB 1IEBB 2DQDH 4OSUH 5JOPE 3KG5A 3VDBA 3VXNB 1IGCH 2I60H 1TXKA 1KB5H 4M3KB 3CLEH 5E8DL 2Y7QB 1NDGA 3G5YB 4FABL 3WFCL 4ZDHA 1ZGLM 5EUOE 4W4OC 1FCCA 3QDJE 1NMCB 4AEFA 3NABH 4CN4A 2EECA 1BVLA 5EC1B 2D9QB 1YNLH 4PGJA 4FZ8L 2IFFH 4O58H 5DI8A 4X0KB 4WO4C 4M02A 2P48B 3K4AA 3JWOL 4QXGL 5GRWA 4UU9B 2Y07L 4NQED 2VC2H 2VDOH 1FC1A 2EDDA 4HHAA 1JBJA 4HIIA 4B50A 3TO2A 1NCCL 4L8DB 5A2KH 3FJTA 3IFNH 1WFNA 5DD0H 1OAXH 4E42A 4GAGH 1K6QH 4G6ML 2X44D 1D5XB 2ZOKB 5IB2B 3ULUH 1A3QA 1HXYA 2CLVA 4LKCB 3BSZH 3HC3H 4X7DC 3WMSA 5I66B 3Q6FA 4QTHA 4KKAD 4LSQL 3IXTA 3IDGB 4X80H 1FGNL 2IWGA 4YHPB 1GXEA 1X5YA 4GXVH 4P99A 2CLZB 2PXYB 3VWKC 4DCQB 4YIQA 3D2UD 3G5VA 4YXLH 4FQXD 3IDNB 2QADD 1Q9WA 5J13C 5HHMA 4HK3J 5J3HD 3ARFC 2AEWA 1GYAA 3T3MF 3INUH 1XGUA 4NRXA 3DX6B 1KGCD 5D96B 3MRDA 1LO4H 1RFDH 4XP9H 1EEZB 4MA3B 5HYJB 1T20B 2J2ZA 4M8VA 1T2XA 3OKOB 5GIRA 3HMXA 1TTFA 4K7FA 3OL2A 5BVPH 1QR1A 5E4IA 5A40E 1KNOA 4XHJD 2VL4A 3ARZA 2CH8A 3L3JB 4I4WA 3QIBB 4ODVL 1G7MA 1U3HB 2DQGL 2O5ZL 2V5MA 2DKSA 3BGFC 1A22B 5C70A 2F54A 5B8CC 1FN4B 1T1YB 1XGYH 3TCXA 2GTZA 1P6AB 3QEHB 3C8KA 3QQ9D 2YD2A 4M1GL 3MRBB 2ADJA 5C3LD 1BFOA 1H3UA 4PJIF 4PJFA 1Z0NA 2EDKA 4ZOBA 3BESR 2H9GB 1IVLA 2P7TA 1UB5B 3SY0B 2D0GA 4IOSD 3RWEA 1AFVH 1ZS8B 4D9QD 5DJAB 4AM0A 4JRXE 3CFCH 1S8DB 4NPYA 1WWBX 4EZMA 4QHLA 1Z9OA 1NGQH 3QNYB 1JI2A 5IM7B 3VFRB 3LKOA 1NAML 2SEBB 1R3LA 3BHBB 5KJRH 5E08H 2VR5A 4S1QH 1G9NL 2JE8A 2GK0A 2X1QA 4PRHD 1FLRL 3S4SA 1OAUL 2NY4D 4FG6D 5H2BA 3MODL 3VGDA 3MZGB 1D5IL 2A6KB 2ATKB 1RZJC 2O5XH 4YHZH 4AT6A 1RJYA 4XAWL 1JWUA 1X5HA 4LOUC 2YWZA 2P5WA 2VDKL 4XMLH 1RVFH 4MA8H 3SKNB 4B5EA 3RTQB 3FO2B 4PUBH 5EU5A 4X6CB 4BFEA 3IJYB 2XA3A 2PUQT 4Y16D 3QCTH 1F4HA 4ZPTB 3IKCB 2JCCE 4NN6B 4XC1L 3O6MH 3E3QA 3DHJA 2MCG1 1DBMH 4Z7VA 1VGKA 3ZKQD 4G6KL 1UFUA 3V7MA 5HGDB 2P44B 1ZT1B 2E8ZA 4WV1A 1T1ZB 3U82B 2V2XB 4U33A 4LRNL 2QQNH 1XR8B 1MFCL 1ZHKA 4Z77A 1T1XA 4M48L 1MHPH 1BECA 4MB3A 4X6DB 1A3LL 2R2HB 3X3GL 5HI4C 3LS5L 5I30H 3TNNB 5JHDD 1XGPB 4Y4KB 3U2SB 4N9GA 3D0VB 5FKPB 4G8IB 1IC7H 2HG5A 3DVFA 3M8OL 3WIHL 3L9RB 4A6YL 2XN9A 1CQYA 2R9HD 5E8OA 4JPWH 3TYGL 1EO8H 2BNQB 4U7SA 1S9XA 1IQWH 2BNUB 5IK3A 4PJAB 1I8KB 4EJ1C 3KLAA 5F93C 3QI9A 4OQTL 5J1SC 1P1ZA 4BQ8A 2DLFH 1FL6A 1A0QH 4HG4K 5IVZB 2ZG1A 1ZVYA 3QIWC 1DQTA 4GRLA 1TMCA 3T08A 5KOVC 3I6KB 1UVQB 1ZMYA 3STZB 4FRWA 4PTTA 4JRYB 4HUWA 4F7CB 5ALCL 6FABH 3UC0H 1U8QB 4PP8C 3GHBH 3P30H 5ILTL 4JVPA 3IRZA 3UBXI 1R3KB 1CDUA 1MSPA 2VB5A 1KLGA 3AMLA 5FA3A 1NEZA 1JWSB 2ID5A 1UCTA 1ZGLB 2VQ1B 3LKPA 5FYJH 2GJJA 2CJUH 4EVNA 1IEAA 2OJEA 5BJTA 2GITB 2BOCB 1WBYB 4OTXH 2QSQA 4HBQA 4OGAD 2VITA 3L7FA 4OFKA 3QIUD 5I76B 1WZ1H 1D6VH 1CFQB 4KKBD 2EDXA 5JDSA 1BIIA 4KVCH 2FYYA 5E7BA 4G6AD 4UT7H 4XHQA 1S7TA 4AL8L 4QCIA 1F4WL 1I1FB 2JB5H 3MXWL 4PJBA 4WFHE 5T1DL 4GQ9H 4RNRB 2BCKB 3TNMB 3ROOB 2YD6A 5CCKH 4OZ4B 4HF5L 4H1LA 3EGSB 1OAKL 3RVTC 1OTSC 1NGZA 1NFDF 1ED3B 3ARBB 4C54A 1QBML 4H88L 1MFEH 2F54E 4XCYB 2V5YA 5ICYB 2HLFD 4M93C 5ESAB 4PJHB 1ERNA 2BVEA 4NO3B 3HTLX 1RJCA 4PJFE 3IDXL 5L9DH 1F2QA 5AYUH 5ESQA 3VXQA 4N90E 5DJ6A 1R3IH 3MR9A 1OAZH 3WXWH 4ZS6C 4DK6A 4ERSL 5IKCB 1LDPL 1YMMB 3MNWA 2L0DA 3TVMB 4TN9A 3SDDD 1U8OB 3SDXF 3FOLA 2AABH 2BDNH 3QCUL 5C0EA 1P53A 2CDFB 5GXBB 2NY2D 4P2QA 5HYSB 2C3VB 4HCRH 1HWHB 1N0XL 3WJJC 3ALWA 1AGEA 2I25N 2H32H 3WIHA 3VXTA 4A6YA 4O9HH 3WUZA 3IETB 1C5CH 4LSRH 2NY6D 1E4JA 2EXWC 1BEYL 4X99A 3U83A 4LLYA 3TA3B 3VFNB 2P5WE 4P59L 1FIGH 3QULB 43CAB 2W92A 1I1AC 5DWUH 4OI8A 3HLAB 3F65A 4Z7UB 1F90H 1F6FB 3LVEA 4HFUL 1EVUA 2DF3A 3E3QE 5DURD 4G5ZL 5SX5K 4R7NB 4Z7VE 1UWXH 3M17B 3ULUD 2XQBL 4LVHB 5D2NA 5CLTA 4MAYD 5DA4A 4KK9C 2QTEA 1IAMA 4GO6B 5EZOL 5AZ2L 4K7PY 4G6FB 4BZ2H 2FB4L 4S11A 1RJZB 1NFIA 1S5HA 1AGCB 3RUGF 1RUQL 3OKMB 1KIPA 5IBTL 3S35L 1OWRM 3MGTB 4OGYL 3ARVA 3BE1H 3WJLA 1NBVH 3BP6B 3DX9B 3TO4A 3HE6D 2CRYA 2XN9E 3VA2C 4FQQB 3VWJD 3KYMB 4P9MH 2E7LA 4K9EH 2OS7A 1KG0B 5JO5A 3C9NA 5HGHB 2X1OA 4V1DA 1I9JL 3HZVA 4XP6H 3H7LA 4XB7A 2Q8AH 1UYWL 4DOHB 1DANU 5SWQB 2DMKA 3U1SH 1YEIH 3RWCA 1CF8H 5IT2H 4MXQC 2NY5C 2FATL 3GMQB 3A67H 3HC0B 2ZUQC 3PIQB 1FH5H 4FHBD 2GTWA 4H20H 2V7HA 2HKFH 3G6JF 1P84K 1T66D 1RURL 1AIFA 3CH1B 1QEWA 1A7QL 4D3CH 2EDQA 5E2WL 5D93B 3AAZA 3LKSB 2Z9TA 3ARGB 4R0LC 4HUUB 4UILH 4EDXA 1AO7A 3LEXA 3DGGA 3T4AA 1YN7B 5C0CB 1YY9D 4XH2A 1LEIB 1G1CA 2VZUA 1V3JA 4LKXA 4WGWB 2OL3L 3GMMB 4HT1L 3IDJA 4JFXA 3I3EA 2AGJH 1XGQA 4NJAH 3I50H 3P4OA 3NZHL 3B5GA 2HN7B 1MWAB 4P23C 4PRIB 3TT3H 4F9PA 3UMTA 1J05A 4FFYL 1DQJA 4R4ND 4U3XA 1HXMA 2YEZB 5E9DB 1UJ3B 4JY6A 4PJBE 4UI2A 5DHVB 2GKIA 4DAGH 2VDNH 5I17B 1EMTL 1CD9B 1HHHA 3MRGB 5IJKA 2Z31A 4HH9B 5L6YH 1IGYB 2OSLA 1GJIA 5EU4B 4W6YB 2ZUUA 3UTQB 5MEQA 2AK4B 1A7PH 5D7JB 1OW0C 4QHKJ 4HULB 4UIKL 1YEFL 3DI3B 2A6DB 4QRQA 2HKHH 3O8XC 4P5TC 4EUPG 2QSVA 3PHSA 2B1HL 4D0CB 3W9EA 3RIFF 3JWOC 1MJ8L 5IVXA 3LRSA 3H2WA 3RY6C 3L7EA 5D1ZD 4WU5B 2EEBA 2NNAA 5ETUA 3T0EC 1MAML 2HLAA 3G6DH 2NY0C 1QA9B 5J6HB 3TEUA 5K93A 4F8QA 4GOSA 5FB8B 3F5WA 1OB1A 3MRKB 2HFEA 1U95B 4UTAH 1CFSB 3P0VH 4HWEH 1A6VH 5DLMH 2DL9A 3FB7B 4NQSB 4JGMA 2EIZA 3LD8C 5IBLC 4ELKB 2CIIB 2AEPL 3MREB 4L8BB 4N8CL 1YMHB 4HQQH 4H25A 1FO0H 1G7PA 5E2UH 5EOQH 3ZT7A 1XF4A 4GG8A 4P2QE 5IFAL 2Q7NA 3VFMA 1BQHG 1CGYA 4PJ5A 1E4WL 4XMKH 2AK1L 1I4FA 1CFBA 2OJZH 3KLSA 1I85C 3T0XA 5T3ZH 2C1OA 3MRQB 4KKLD 1P7KB 3CMGA 3BPOC 4KRPB 3W39B 3LKQA 3MOAH 3MNVA 1KTDA 1BF8A 3RBGA 1RIVL 4ODXA 4DTGL 5FYKL 2D03H 2CR6A 5B39G 1KCRL 3DUSA 3SKUD 5D2NE 2AV1B 3HNVL 3UPAA 3PWNB 4JFEA 2R2BB 4NT6A 5LAXB 4BZ1H 4GW1B 5DR5L 3QWOA 3QDMA 1YQ2A 5KBNC 3GMPB 1VPOL 4Y19B 2XTJC 1BJ1J 3K7UA 4AEHH 3MNZB 2P8PB 1QTYT 3RHWF 1B0RA 4OF0A 1EHNA 2B2XL 3ZDYF 3TYFB 4JDTL 3V5KA 3MGAA 1QOKA 4LFHG 3UZVB 5JOEA 3O6FC 2ICWJ 4HXAH 5DHXB 3ULVH 4WI7A 4ORGB 2VXSL 5EN2A 4PJEF 3WHXA 1Q72H 2E7LE 4JHWL 3ZDXF 1HH6B 4OM0H 4R2GD 3PABA 2D7OA 1XGTB 2V9TA 1AGDB 4V1DE 4TQEL 5ERWA 5GHWL 4HMCA 3FQWA 5C7XH 3LSOA 4QXTA 2ITDB 1T7WA 4NYLB 2G9HA 5KVGH 1AY1H 3QFJA 5IROC 1DVFD 2VKXA 4KUZH 3T2NL 2XKSA 4ZNEA 1HYRC 3QUYC 3W5NA 5F9WB 2VJXA 4LLWB 4RFNC 2H6PA 5SWZD 1XCQB 3QXVA 2DQEH 2E9IA 4QGYA 2OI9A 4R90L 4OFYD 4F57L 1F58H 3FQRB 4GW4B 2DOCA 4F33A 1NUDA 2P5EB 1AO7E 1HQ4A 2WW8A 4GH7B 1ZT4A 1S7RA 1F45A 3WL9B 4Y4HD 1BGXL 1M7DA 3WNKA 5HD8C 4HIEA 1ACYL 1UM6H 2H2PD 4WY7H 5IEHA 5I1KH 4HUXA 3IFLL 3PWLB 4P3WA 5CP7A 5MHSE 1BMGA 2EDJA 3SDAB 1I3RA 5DJ2B 15C8L 4L4JA 5C09D 3V9FA 2FJHB 1WLHA 1UCBH 5HGAA 3NCEB 4RISH 2MJWA 3MGOB 1YC8A 4M4PA 4WFGD 3IU4H 2X9YA 4PR5B 3D39A 3OGOE 2CRIA 4DZ8B 4LDOB 5D7SH 2EDNA 3MV8B 5F1NA 4PG2A 4QXWA 3BUTA 2IPTH 3ZO0A 2Q86A 3EO0B 4Q58C 4JG0L 4K07A 4OZFH 1TNMA 5IB4B 3GB7A 4OUUA 2APBA 4WWID 5IVXE 1E28B 1W0VB 2V5SA 3HB3D 4L3CA 1SHMA 1CDYA 5TE6H 3QFDA 3EOAB 1RZGB 5CEYA 1AI1H 4FOMA 3VFOB 3RL2A 1UZ6F 3LH2H 1QFUL 5EFIA 2A6IB 5INDA 1OPGH 1Y6KR 2CKNA 2VL5A 2YS4A 5CGYD 5AUMA 1KN2L 1OAQH 1IGTB 1HHGB 3OKKB 3TZVA 3K8KA 4GRWH 1S9VB 12E8H 4L4TB 4M00A 4RGNB 5BV7H 4PJ8C 1IARB 2W60A 4OAWA 3VH8B 4EN3D 4QTIH 1OGAA 4PJ5E 4F7TB 1EXUB 1PG7L 3MLTB 2CO7B 4FXKB 1JGLH 2BC4A 3EYSL 2ARJA 5GS0C 1QLFA 5LGHH 3U7WH 1EX0A 4KDTC 2FBJH 3HCVB 4JM2D 4OZFG 1SEBA 2GSIB 1FPTH 4IRZL 1U92A 1SJHA 1NFDB 1XF3B 1KBGH 3L5XL 3AXLA 5TFSH 2YZ1A 3P9WB 4K23H 4MSWA 3BH9A 2QKIB 2YUZA 3CFEA 4O02L 4UQ2A 1JK8B 1CLYH 1T2QL 4N8VG 3G08B 1MCBA 5I75C 2FWOB 4M7ZB 4WENB 2A73A 5KVFL 1Z2KA 3QUKB 2KZ1B 5E4EB 3PP4H 1BLNA 5TE4L 4I5BB 1JNHB 4JFEE 4PP2A 1FE8H 5DMJB 3WD5H 4DKFL 1WGOA 1DFBH 3QPQC 2EC9U 1YEKL 3X13B 3MLWL 4MMZC 4K8RC 4UB0L 4ALAH 3BGMA 4NQXB 1ZVSA 3MFFA 4PJ9C 4QRPB 2BRRH 3SDXB 1ZEAH 4Y5VC 4IBLT 4JPVL 4U0RB 4TTDD 3PDDA 4FQIL 1DANT 1NBZA 3QRGH 2IPKB 1BQSA 5DRWA 3BJLA 3SGJA 3BT2H 3FQNA 2WIIA 2CK0L 2IBZY 4MZ2A 2IG2L 1AE6L 5DJDB 5C3TA 4D9LH 3ELAT 1NCTA 2MPAH 1RUML 5FO9A 5D7IA 2I5YL 1T7XA 3MBEA 4X7TB 4APQC 3QFJE 4Z7WF 1TTGA 5J8OA 2JJSC 2E27H 3U9PL 3TV3L 4RBPH 3I02A 2DD8H 1CD1B 1E27A 4RDQG 1SY6A 2B39A 1FCGA 3NPZB 5B38A 1PVHA 2CMRH 1QLEL 5ECJE 2Q76B 3RZCB 2G75B 5F9JB 1UWGL 3T0WA 2VLRD 4XI5D 3MZTA 5K9KB 2OMNA 1S78C 3QIUB 4NDMA 2Z93B 2CGRH 5ADPH 4WCYH 1PYWB 3F58H 4NZDA 4MX7B 4XBPB 3RUGB 4JCLA 4DN3H 1ES0B 2JLLA 2YD8A 2NY7L 1BZ9B 3SE9L 5H37H 1U8HA 2K9UA 3FL7A 1KV3A 3FAXA 4IRJC 5I16B 2AAVA 4FFVC 3MLZL 4IOIB 3C5ZA 3U4BH 4YDKH 4XTRC 4N0CC 3QYCA 1RMFH 4TSAL 4Y5XA 5T1KD 1P7QB 2BSSB 1S7SA 2W0FA 1R3HA 5LBSL 5DRZA 1XIWA 2ZG3A 5T3ZD 2WWKO 5EPMA 2A83B 3BDXA 1AXSB 3D39E 5EC2B 43C9B 2FJFA 4QRSB 4JKMA 2ADFH 3GBML 2AW2A 3FRPA 4JJHA 4TUKH 4H0IA 3QUXC 1CXEA 1PDKA 3QUZB 5FYKE 4HGMA 3VU2A 1F13A 3G6JB 3DV6A 3VFUB 4YDIL 4WUUB 2X4NB 3EFDH 4GBXA 3AREB 1A6ZA 4Y2DB 3BW9B 1LP9A 2V2TA 3W9DA 5ID0A 3MROA 3ZTNL 5GS1A 5BZDB 4RZCA 3O2DH 2JIXB 1X7QA 2IH1B 1JTTA 3BN9C 3W11C 4N1CA 2F58L 1Q0XL 4RX4D 2ZP0T 3LS4L 3SDCA 5SWSA 4NQDA 4UV7H 1OGAE 4L4VD 3TBWB 5I1GH 4XZUA 3BFOA 1JPGA 5KSAB 2AEQL 3ULVD 1AKJA 2XZCH 1QSFA 4OCXL 4GAYA 4ZFOL 4NWTL 1UB6B 4QLRA 5GJSL 3V8OA 4OZHA 3UJTH 4UQ3B 4ZUUA 5E8EA 4OF6A 4F7PA 1S9YA 2Q7YB 2GCYB 4OZIA 1TJIL 3GMNB 1MJUH 4GKNA 4S10A 5IESH 1GAFH 3BH8A 3GSOA 1XZ0A 4ZO7A 3P73A 5DDHA 4H0GA 2ZSWA 4UTBL 7FABL 1PZUB 4EI6A 4BZYA 4JM4H 5DZLA 4EIGB 2E9WA 1MHHA 2NY3D 1LE9A 5D1QC 3QG6B 2EXYC 4U1JB 1B0WA 3PJSA 4L9LA 5DD1L 3LEVH 2WUCL 3MV9D 4U6YB 5DRXB 3IAGC 2CLRA 3WE6A 1FC2D 5K9OA 1IL1B 3ARDA 1M1SA 3OKLA 5C2UB 3GMOB 5F7YC 5JTWA 3PGFH 4PRPA 3BWUC 5KVDH 3CFJB 4AENA 1J5OH 1CXHA 4XNUL 1QD0A 1R5IA 1Z3GH 1GCFA 1J86A 2ZUXA 4G80B 5GGSY 3OHXA 5EOCH 3FZUC 1NCDH 4XVUC 2PN5A 1KIUA 2HT3C 3SGEI 4NHCH 3K46A 4FNLL 5DRNB 5D7IE 1LD9A 1HOCA 3E2HC 3FFCD 1MRDL 5D2LF 2AJXH 3PHQA 3GI8H 4I0PB 5F1IA 5ACMA 3EO9L 2LVEA 4KK8C 3RDTA 4OLXH 3VFSB 4GKSA 4XGZA 5HVWA 3MJ6A 4P5MB 3V6FA 4MA7H 3HMXH 8FABA 4NQVA 4MNQD 3Q3GA 1IFHH 5C0BB 4YHIB 3RGVB 3FB8B 4ODSL 4HIXH 1S7VA 4XXCC 5KG9B 4JJ5A 5F89A 1NDMA 4N8PA 3DARA 5IMLB 4YPGA 3MRJA 3T3PE 5F9DC 2FO1A 5GJTH 5I1DA 5ISZD 5DYOB 1U6AH 1ZT7B 3C6LA 5BZWB 1Q38A 3ULVF 3ARWA 4U1MA 5I1JL 3D3VD 4CMMA 2O5YH 5DJ0A 3MCKB 3EOBB 1W72L 4RAUB 3FRUB 3VCLA 5ESVB 1KCSL 4RGOL 4PJEB 3F7YB 5CD3A 5C0IB 2X4PB 5C08B 1I7ZB 3HI1A 5HHPB 4UDTA 1CGSH 3L3IA 3FO1B 4LCUA 1V3KA 4HKJA 4JO2H 5L2KB 1G7HB 3GO1H 4LNVA 1A7OL 4CMHB 2EKSA 5JHLH 1DBAL 2WBJD 4TVSa 5IJVB 1VENA 4ENEC 2XNAA 4X6BB 1ADQL 4JGJA 3O0RL 3SE3C 4FABH 3ISWA 1BF2A 3WFCH 2NXYB 3H0TA 1U58A 1WAAA 1H3VA 4HXBL 2CDEA 4ZYKA 3D18B 3P0GB 5ELIA 4P2RB 3UTSD 3IDYC 1N2RB 2CIKB 4FZ8H 5JZ7C 1IE5A 2DYPD 4HIJB 4L29A 4HJ0C 4KI5E 4QXGH 4WWKA 2YD3A 3ARRA 5KSVA 1AGFA 2Y07H 4WTWA 2AQ3A 3H6JA 1LP9E 4R7DB 1HCVA 4N5EC 2IAMC 4WEBL 3SJVB 3DMMC 2LTQC 4G6MH 2FX9H 1WBZA 3RI5F 5FO7A 5SWSE 2A1WL 4NQDE 2ZNWA 4ZAKD 4PBVC 1OOAA 5FGSA 2UWEA 3WIFB 2VKWA 4LSQH 3PHOB 4P4KA 3TCLA 2AERT 1FGNH 1QSFE 4ZTOL 3SDYL 4HKZA 3OKDB 4YBQD 4OLVH 3RL1A 4OZHE 3MUY1 1I8IA 1GH7A 1EFXD 3HAEB 3FOMB 3UAJC 5GGVH 1OLZA 2QQQA 2FECL 4LPVA 1QLRA 5GISL 4OZIE 1QFWI 1FZOB 3X14B 1T89C 2EC9T 2NTFB 2DQHH 3SGKC 5KSBB 2JJUA 4U4BA 2HT2C 2ADIA 3SCMD 1WZLA 1VHPA 4JKPL 4NZRL 5IMOB 3FT3A 5GGUB 1C5BL 1M05A 1U91A 3QDGA 2NW2B 3VD3A 2VLJA 4JFQB 1D6EA 5E6IB 3CPLA 4GRWF 1CT8B 5D1XB 3S88L 5FHAL 2XV6B 5DD6B 2O5ZH 4R8WL 4K3DL 4N68A 3BPCA 4NNXA 1SYVB 1G0DA 5E2TH 4N0UB 4PRPE 4M1GH 5BW7C 1OAYH 4WVRA 2X9WA 1PQZA 3OQ3B 2VISA 3BUYB 2FL5B 4ZFFA 1X5IA 2EC8A 3LKRA 3B9DA 4J8RB 2ICCA 2UYLB 4XPAL 5C07B 1J9CT 4JRXD 4NUJB 1F11A 3KGRA 2NXZB 3L3HB 3RGHA 1W8OA 2COQA 4ZS7L 1O0VA 4ONFL 1CVSC 3KYNB 1K4DA 3CDYA 4ZO6A 3L5IA 1G9NH 1WF5A 3OJ2C 1HZHL 5IV2A 1FLRH 4ODHH 1OAUH 3MODH 1VFBA 3DVIA 25C8L 1D5IH 4JHZA 3TBVA 1F2XK 4H1LH 4XAWH 3V4UL 4RDQF 4B41A 1CLZL 1I8LC 2VDKH 2R0LL 5C0FB 3ZYJA 3UYRH 3CGTA 4Y1AD 2AJ3A 5B3JE 1NEZG 2ICWA 1SBBA 2GI7A 5I8OL 1TFHA 3PGDA 2OTPA 2VDQL 4XC1H 4EXPX 2H32B 1WFUA 5HHNB 4KDWA 1INQB 3QPXL 5ALBH 1V3MA 4G6KH 1BOGA 1G7LA 3LDBB 3ALPA 2EDLA 5KSUA 1EEUA 4QWWC 3QHZH 4BQCA 1IBGL 2JTDA 4LRNH 1HNGA 5IIEA 3RP1A 5CZXC 4EI5A 2P24B 3S3PA 1A3LH 2CUMA 3RIFK 2YRLA 1ULVA 5DS8A 5E1AA 1QBBA 1MQ8A 3LS5H 4FMFA 4RMUA 1I9RL 4KZDL 1IEHA 5DUPL 1JF6A 1WAAE 3M8OH 2M1KA 3WIHH 3HR6A 4A6YH 2CD0A 4IEFB 5DJXB 3O6LL 3OAYH 1DDHA 3V0AC 1HSBA 4X5XA 1NBQA 1KCUL 3PWPB 4QHUA 3NN8B 1J0HA 1FGVH 1IGIL 3PDGA 2W9EL 3WYRA 4RAVA 3BQUB 5DJ8B 1ZLUH 1KN4L 5IW1B 3FHAA 5DGQA 1AQDA 2DQTH 3E6HA 4UOW0 3BKCH 4POUB 3TIDA 3KYKL 5D5MA 1H5BA 3LPWA 3FAWA 4JEGB 1OP3K 3KPMA 1JGUL 1UKQA 3SE4C 3VRJA 4KJWD 1AD0A 2FX8H 5ILTH 3W2DL 2UWEE 9CGTA 1VFMA 3V2AR 3VD7A 2DIJA 5I1HH 1JTPA 3BWAB 3RVVD 3O11A 4FFEX 3KNBB 1HKFA 2V2WB 4GRMA 1OD7A 1RHHB 3RWDA 3D85A 2VZTA 2R1WA 5GZOC 1I9EA 1MCWM 3DETD 5HHOB 5HHMD 4XCNB 1OSZB 4HK0A 3S7GA 4Z7NF 4FQ1H 3WFZA 3HZKB 4LAQL 3TPUA 3OZ9L 4R97B 1INEL 4MWFA 4AL8H 4EQ2A 4ETYA 1KLUB 3MXWH 1F4WH 1U2HA 1Y0LA 5FDWA 4U7KA 4EUPB 4WFHD 4Y5YB 3RHWK 3FO0L 2NW3B 2O61B 4OT1L 2XTLA 3MA9L 4HF5H 3QDGE 2VLJE 1OAKH 3T4YB 1RK0B 1J8HB 4OCNC 1DBBL 3VFPA 1QBMH 4H88H 5JLZA 1XF1A 2VWEC 3TN0C 4HIHA 1TCRB 2FBOJ 4M1DL 3R06A 2F54D 3TFKA 2EH8L 2X40A 3KPQA 3AU1A 1DUZA 4IRSB 3T77A 2NZ9D 1J11A 1TVHB 5IFJB 1SJEA 5HHVH 4P3DA 1G0YR 5E94A 2P1YA 3I9GL 4H8WC 5ICXB 4ACPA 1QRNE 3TM6A 5I19L 4N90D 2BP3A 4GMSL 4JFPA 4W6WB 4L8SA 5JW5B 3S5LG 4ERSH 1NQBA 5A3ID 1BQHB 3B2UC 3WDIA 2L7UA 1LDPH 2XY2A 3JVGA 4R4FL 4OKVB 4RFOL 2RIKA 1OQOA 1KPRB 4PY7A 3EZJB 3O6KL 3ROLB 1YNTA 4JLRB 2XZAL 5FK9B 1KJ3H 2HVJA 3RNKA 4NFDA 1M6OA 2B4CL 3KPSB 2R4RL 3VXSA 4G9FA 4UINL 2A0LD 3KVQA 1JUFB 1EGJA 3O3EA 4UT9L 4OGXL 3B9KC 2PTVA 5B39B 1WCQA 4MYWB 5GSVB 2ZUTA 4YFLI 3VI4F 4KRMB 5IB3B 4P59H 4ETQB 2P5WD 5FM4A 3SQOL 2DM2A 3G04A 2NLJA 1MCRA 3FT4A 4TVPE 5T1LA 2RGSA 2DLGA 3DXAD 3X12A 1QSVA 1FSKB 4LEXH 4G5ZH 1OP9A 1A1OB 2UVEA 4KK6D 1V7ML 2XZQL 4IOFD 2XQBH 4M9PA 2IBGA 3RVWC 5GGQH 1E6OL 1KCVH 3KLHC 1KACB 1JGEB 1HHIA 4BFIB 5EZOH 2FJGA 2LAAA 5AWNL 3MO1A 4HZLA 1OCWL 3GUTB 3HHRB 2CPCA 2FB4H 2E9BA 2FIKB 3GSXB 1EAJA 3STBA 5D2LB 3S35H 4XXDB 2QEJA 4PP1C 4OGYH 5I1LB 4P5KB 5TPWH 5E8NA 3UTZA 1TZIB 3FONA 3WO4B 4S1SH 4NRYA 4HS6B 4RA3A 3S96A 3FFDA 2XN9D 4LCWB 5TQ2L 4Z7QE 5EU6B 3MBXL 5T3XE 4KDVA 5EZLB 4PV8B 1GGTA 4PJCB 3BPNC 3VXRB 3X3FL 3NCMA 4M7JL 3WNMA 2BVOB 5DD5L 2F53B 3BDYL 4DK3A 3OKEA 5TDOB 3AVEA 1REIA 4GUPA 3C60B 4JFHE 3QI9D 4I0KA 4OM1H 4JQVA 4NHUB 4UUJB 4PJFF 2W9DL 3O3DA 4GRLD 4BKLB 2FATH 5FUZL 1JYVA 4E0RA 5D5ME 2UZXB 2PYEB 1EUUA 2CR3A 3IAPA 5IB1B 5DFVD 2VLKB 4JPKH 5B4MD 1BX2A 4Q97A 5DJZB 1JHTA 2RBLA 4QOKA 3OGCB 5E2WH 3B3IB 4WO4B 2AXFA 2ATPB 3LMJH 4OF7A 4DFIA 4QNPE 4Z78B 3C6SB 4NGHL 1PX3A 5JW4Q 3PNWA 5HHXH 1YEEL 4MNGA 3OB0H 3DUUA 4NKIH 2EYTA 5IMMA 1G6RB 4HT1H 4QHKI 3NZHH 2NPLX 1Y18B 4QRRB 2X89A 3KYOA 4G9DA 3ES6B 2PO6A 1UZ8A 2NY1D 3TPUE 1DQDL 3O4LA 4MD0B 1UQSA 4OIIL 3OAUL 3NZ8A 4FTVB 1LGVA 4XWGH 4OGZA 1U8MB 4LEOB 1T0NB 3X11B 3SN6N 3DRTA 2QSTA 1RZ8A 4I48B 2BMKA 4AH2A 2Z8RA 4P46A 5HI3C 4YHOL 1KTRL 4HFWA 4YK4C 2VR4A 3SE8L 3KPOB 3VWKB 3CXHK 1KSRA 5IQ9A 4BH7A 4DKEL 4G8GB 4Z7VF 2DWDA 2DWEB 3UTTB 2EEAA 4DVBB 1CL7I 3GSNB 5J13B 4P2OC 1F5WA 3ARFB 1CE6A 2ZPKH 5M95B 2B1HH 4X9FA 1IMHC 4MDIB 1S5IL 3BZFA 4MD5B 4YHYB 1KEGL 3VFTB 1LE5A 4DW2L 4LPTA 4ZPVA 1B4JL 1UWXK 5F96L 4YBHA 4KAQL 4ZUTA 4X5WA 4KK5D 4F15C 4WFEE 1IILE 3QWRA 1CCZA 2AEPH 2CSPA 1WK0A 3WN5A 1NC2B 5FO8A 1MI5A 4N8CH 5C0AA 3GMLA 1MNUH 3BGFB 5BVJA 4NRZB 3RKPA 1TZGH 5B8CB 2XQYG 3TA3C 4G8FB 4O51A 5IFAH 4P2QD 3GSRA 4GT7A 4YHKL 3VXSE 2OK0L 2VQUA 4G9FE 1E4WH 4N8VB 3H9SB 5L88L 5DK2B 4Q9RL 2HJLB 2EE6A 2YPKA 3K0WA 1YPZF 5GGSB 1ETZA 1UM5L 4HS3B 3RWJA 3L3OA 4L5FL 1P6FA 1PKOA 1BJ8A 4GRWB 5DT1L 1CU4L 2R15A 3QHTC 3C08L 2GUOB 2G5BA 1RIVH 2I9TB 1R24A 4PRHA 4DTGH 5FYKH 1KF9B 1QQDA 2G60L 4F8TA 1DLFL 1PW3A 2H3NA 4A2LA 2OX5A 2ICWI 2VDPL 5DR5H 4HBCL 3RWFA 2IC2A 3T65B 5HDBE 3ULSB 3FQTB 1MCWW 1OY3B 2YN5A 1VPOH 3C5JB 4HUVB 3K1KC 3EKCA 4JPIB 2JJVA 1N6QH 3P9LB 3QDJB 3DHMA 4YLQT 2E7MA 3K2UL 2MCPL 2ZJSH 1GZPB 4HC1A 1Q9KA 2B2XH 2X4TA 3MFGB 2EZ0C 4Z5RB 5HPOA 1C8PA 1CFTB 5F8QC 4HWNA 2PW1A 3BKMH 4X6EB 5KS9A 3GMRA 3MV7B 1SEQL 3TO4D 1FDLL 1TQBC 2WLZA 5DD3L 1LO5B 3MRNB 4FQLL 2Y5TB 4ELMA 1QFWH 3RKDD 3WEXA 5DA0B 3CSYB 4JHWH 5H94A 2DQDL 4U6HA 1MJJB 3HPLA 4RSVA 1AP2A 2Z92A 2VAAB 4TQEH 1KB5L 4V1DD 2FECI 5JOFA 3A6BL 3PQYB 5JORB 1P9MC 3K2MC 3I6LE 1K2DB 3KPPB 3NABL 1KXTB 2X4SA 3MRHA 5LCVL 1YUHB 3DROA 1AD9B 4KTDH 1D9KC 2K7PA 3O9WA 3ARGC 1HIML 1X6NA 2VC2L 1ZAGA 4QOKE 2XKUA 1F6AB 2X4RA 4PS4L 5BQ7B 4F57H 3VFVB 3FTGA 3O81A 1MCSA 4V3EB 5DD0L 1OAXL 3TH2T 1D5BB 3L6FB 2R8SH 2DJSA 2H2SD 1H15B 4CNIB 1AO7D 1F97A 1YEDB 4CGTA 3ULUL 4MNGE 2XPGB 2AJZB 1OP5K 3BSZL 5DVLA 4LLVA 3QIWB 1ACYH 5EBMB 5DJCB 2FZ3B 4LNRB 4CAGA 4XCEB 2AQ1A 4H26B 4X80L 3O4LE 2DLEA 5MHSD 1FFNB 3JBG7 5I15L 2DJUA 15C8H 4YXLL 4YDVA 2V7NA 3LRGA 5ENWA 4G3YH 3N50A 2MHAB 4ZXBA 3RU8L 2Z31D 5BRZB 2CKBL 2YN3A 4XWOC 5K33A 4NNYB 4QHNA 3IFOB 3HS0B 3TJHC 4YFDB 1CICA 1PY4A 1LO4L 2C3HA 3DO7B 1V7NL 1SY6H 3M1BA 1PEZA 4PYGA 5F21B 2IQAA 4KMQA 4JG0H 1U9KA 3HZMB 5FGBC 2OTUA 1MLCB 4FS0A 3REWB 1MLBB 1IAIL 4ZUVB 2D3VA 4HJGA 5JNYA 1DLHB 2OP4L 3GJFA 5FOJA 3SPVA 4AG4L 4JFYB 5D9SB 4JFDB 3DVGB 1XGYL 4IIQC 1H0DA 5KN5B 1HH9B 4X98B 3JV4B 1KN2H 1N3NA 1MI5E 5C0AE 3JV0A 1ZLWH 3PL6A 3WHE0 1MFDL 4ONGL 5DSCA 1WIUA 3DUHA 4M1CD 4Y4FC 4M93B 3TC9A 3IGAB 4PJ5D 1AFVL 1FORL 3B8SA 4IDJH 3EYSH 1AC0A 3DIFA 4JFOB 5B38G 1NGQL 2NX5B 5LKNA 4IRZH 1CTOA 3DURA 3UJIL 5E08L 5F9AC 2R1YA 3QXDB 4CVUA 1AHWA 4O02H 4XPHH 3FB5B 3VGGA 1T2QH 4PRHE 2X4OA 2AJYH 4JKKA 1AXIB 1C7SA 5KVFH 3C5SA 3Q5OA 5KANI 1NC4B 2O5XL 4L8CA 4GJTB 4ZQKB 4PJXF 3ZKMD 5TE4H 4J1UA 3KXFA 4XMLL 4MA8L 4JFED 4UZGA 5K9JH 4CW1A 4NOBA 5F1SA 3QDMD 5D6DC 2A6JB 1C5DB 1KJ2A 2E3VA 3QCTL 4UDUA 1HKLL 3UPRA 3O6ML 4UB0H 1I1AB 1JZ4A 4NWUL 1DBML 4UV4L 4LHUG 4E5XB 1U8PA 2F19L 1MREL 3O3UN 3BP5B 4JPVH 3OR7B 5J9PA 1PFCA 3K8MA 2D7TH 4FQIH 1BD2B 2DQCL 4CVWA 4ELME 3NCYP 2OR8A 2DQFA 1AR1D 4HKBA 1KIRB 4UAOC 5D8JH 5FUCE 3TO2B 1XCTB 1AE6H 3HN3A 2FHCA 5JQ6H 4KKAC 1ORSA 3T0DA 1RUMH 3RI5K 2XWJB 1JFQL 5TE7H 2CKBA 1IM9B 3UP1A 3U7AA 5IVXF 4YQXL 2B4CC 3CVIL 2K1MA 1RUPH 3QFJD 4FQXC 4I1NB 2QADC 3LOWA 1W0WB 3QEQA 4JPWL 3U9PH 5J3HC 1I7RB 4XMPL 3EO1A 4IHOA 3G5VB 4YHLL 3ZE1E 4X9IA 3NTCH 2DLFL 2EDWA 4J3WA 3IS0X 1UWGH 3QNXA 1PBYA 4NSKA 4PRBB 1YC7A 4PJDB 1XGUB 1JPFA 1QSEA 2ZSVB 4ESKA 3BDBA 4PJGF 2NY7H 3UC0L 3LQZB 4ONHA 4XHJC 3MYJB 3SE9H 1CQKA 1TJHL 3O41B 2Y5EA 4U1KA 3MLZH 4N0FA 3P9MA 2JKXA 5I8EA 2GJ6A 3QQ9C 4MJ6A 4TSAH 4X4XB 3NCYS 4AIZB 4L3EB 1WBXB 3EYFB 5C0NC 4M7LH 5LBSH 4MJIA 4JY4A 2IANA 5HPMA 2GTZB 1MRFL 1WZ1L 3HE7A 1BFOB 2DBLL 3KPNA 4NO5A 4KVCL 1A4KB 5IG7A 1F8TL 4UT7L 2ITCA 4MA1C 1TPXC 2JB5L 3MUZ1 4P23B 2ADGB 1A14L 2VOTA 1IGJB 1MCPL 1D5MB 3CZFA 4YGVA 4X8JB 3GIVA 1ZXQA 2MQ0A 2NY4C 4YWGH 1R3LB 1MFEL 3CFDB 2UVFA 1YDPA 3SO3C 5GS3A 4RGNC 4TSCL 1WTGT 1JPTH 1K8DA 3TZVD 3ZKND 1X4ZA 5L9DL 2BNRA 3O8XB 4P5TB 3V5HB 1HSAA 1IEBA 5AYUL 4AT6B 5CBAB 2F58H 5E00B 3LS4H 4Y16C 3VXNA 4KUCD 1OGAD 4X4YB 3LQAL 2Y7QA 4GAJL 3G5YA 4OCXH 3N0PB 3ZYIA 4I18C 4NWTH 2NY0B 5CKGA 5EC1A 4PD4K 5F9OL 2AABL 1NBYB 2BZDA 4X0KA 3LD8B 1DQLL 2GFBB 3T09A 4HCRL 5C92A 1SVZA 4Y88A 4HD9A 4QY8B 4FN0A 4Q6IC 1UA6H 3GDBA 3MACH 3EZ8A 5EU3B 4L8DA 2J8UE 3L3DB 7FABH 3UDWC 4Z0BL 3KXFE 3ESUF 2UZYB 4BUGA 1FIGL 1D5XA 2ZOKA 1FAKT 5IB2A 4LP5A 5CD5D 4LKCA 4M7KL 1NGPL 4LRIC 1Q9LB 4N9GB 1F90L 5DD1H 1GGUA 3B83A 4KJYB 2WUCH 5I66A 5DZNA 3GRWL 3IDGA 3BPOB 1OARL 4K3EL 3LB6D 4G6JL 3AS1A 4YHPA 2Q3ZA 4AMKL 3GKZA 3NFPA 2CLZA 2PXYA 4DCQA 1S9XB 4CJ1A 4MVBA 5F8RC 1LILA 3IDNA 1ZHBB 4XNUH 1MQKH 3ARSA 2NYYD 3DX6A 4MHHG 1JN6A 1YPZB 4LGPB 4Y8AA 2EDOA 1TDQA 3C2AL 2F74A 4MA3A 3BE1L 5HYJA 5JXEA 1NBVL 1T20A 2XTJB 4NQCD 3AROA 4PTTB 3SOBL 3MBED 1NCNA 4O2EB 2IH3B 3PP3H 1WITA 2HRLA 3EDEA 5DVOA 3QEQE 1WT5A 2IMMA 4P9ML 1KLGB 1XF5B 2BXYA 1FRGL 4OGAC 1CL7H 4TNWF 2DDQL 3DX8B 3L3JA 4K9EL 5CEXB 3QIBA 3IDIB 4K7PX 3QIUC 3JWDC 3O6FB 1U3HA 3UCRA 4KKBC 2OJEB 1FN4A 1T1YA 3KPRB 2E7CA 3JUYA 2WINB 4ODSH 4G6AC 5HVHC 3MRBA 3U1SL 1FHGA 1YEIL 4KROB 1QSEE 1GSMA 4G7YL 5IT2L 1NAMB 3DECA 4E9LA 3A67L 4G8EB 2W1NA 2H9GA 3WLWD 1UH4A 1UB5A 2E5EA 2FYYB 4DGIL 3DV4B 4P4RA 3U9UB 4QCIB 1ZS8A 4LBEA 5I1JH 5DJAA 4D3CL 1S8DA 4U49A 2XFXA 3QXAB 1W72H 4GMTH 1KCSH 3A0OA 3QUYB 3VFRA 1CFNA 2JJTA 2HLFC 3C5ZD 4RFNB 2GJ6E 2SEBA 5E8PA 3N06B 1BFSA 4UILL 1GL4B 5GRZA 4PLJD 3L5WB 3D48R 4MJIE 2IANE 1DBAH 4NJAL 4JKLA 3UO1L 2QHRL 1XIWD 2DMBA 1DSFL 3TT3L 2A6KA 2ATKA 5C9JA 1UT9A 2X42A 5FUOL 4NBZB 3O0RH 1C16B 4XNXL 1RV6X 1KT2B 2B8OT 3BMVA 2GQHA 4MD4B 2W65A 2VNCA 3SKNA 4JDVA 3SDDC 3RTQA 1BJ1H 3FO2A 2CRMA 5TQ0L 4EDWH 4HXBH 4DAGL 2XT1B 4X6CA 5BS0B 1JFMA 3IJYA 4ZPTA 2NY2C 1TTUA 2EH7L 3ARYA 4KI5D 4FFZL 4JZJC 2P8MA 3VXMB 3FOLB 2NY6C 4GBXD 5FHBH 5EOCJ 5HGDA 1ZT1A 2A2QT 2J5LB 3IJHB 5FGCB 1T1ZA 4TVPH 2V2XA 1AJ7L 2EE2A 4NKDB 5BXFB 3GRWA 1XR8A 2BNRE 5IR1B 5LXGH 3G6DL 2OLDA 4X6DA 2DTML 5JDJA 2R2HA 3SDCD 5SWSD 1RZKH 3WO3B 4QGTA 3TNNA 4Y4KA 4UTAL 2WWMD 3P0VL 3D0VA 3L1OL 4HWEL 5FKPA 4G8IA 1AKJD 2HRPL 2N7AA 3ULUC 1QSFD 5ICZB 1FIEA 3SDYH 1J8KA 4MAYC 3L9RA 3ZSSA 1FO0L 1OSPH 2BNQA 5E2UL 4ZOEA 5EOQL 2BNUA 5DVKA 4PJAA 4HLZH 1A6AB 1I8KA 2B7DT 5GISH 3THML 5IVOA 3PXHA 5T3XH 4PJ8B 4KHTH 2FR4B 3AS0A 4J3VA 5IVZA 1S5HB 3T3PF 2J88L 3HE6C 3LIZH 4NZRH 3I6KA 1UVQA 2MWCA 3STZA 1C5BH 3MOAL 4HEME 3VWJC 5IB5B 1JGVL 1SJXA 1EEQA 1U8QA 3GSWA 5DF0A 4ZSOB 5DQ9B 1A7NL 3S88H 4YZFF 3PF2A 4R8WH 4K3DH 1VGEH 3ARDD 1JWSA 2JJWA 1KFAL 3CUPB 4JG1L 3G5XB 5J1AA 2EDRA 4CU7A 1ZGLA 3S5LB 2VQ1A 4PRPD 2VE6B 5I75B 4MS8A 2GITA 2BOCA 4NBYB 1FG9C 2P46B 4JFZL 1OL0A 5I76A 1U8NB 4AEHL 4JANB 1CFQA 3WIIH 1T66C 1I7TB 4XPAH 1UADC 4YDJB 4LCIL 4J4PA 1JHKL 1LHZA 4D8PB 4FQJL 5HYJE 4EOWH 1MH5A 1I1FA 4V2CB 4U1SB 4WJ5B 3MA7B 1P4IL 4RNRA 2YWYA 4HEPG 4F2MB 2BCKA 3TNMA 4PJ9B 3ROOA 3T8XB 1YY9C 4OZ4A 5E56A 3EGSA 3RDTD 2Q3AA 4M9OA 2XWBB 4Y5VB 3SQBA 4LL9A 3ARBA 1CVRA 1HZHH 4FP8L 4PJXB 1N0LA 1LP9F 1MY5A 4EDXB 2YPLB 4XCYA 4XH2B 5ICYA 2VN4A 3GKWL 5C7XL 3RY4A 3V4UH 4DZBB 4R4NC 1CLZH 1EZVX 4LCYA 5ESAA 32C2B 2ICEB 4PJHA 4C57C 4NO3A 4JQXC 3A6OA 3BMWA 4N5UA 5I8OH 1YEJH 5EBLB 1IZKA 3RNQB 5I1IL 5CP3A 4APQB 3C6LD 1L7TL 1IAII 5IKCA 1CR9L 1VFOA 1HHHB 1YMMA 3QPXH 4K94H 1CG9A 2Y25A 1KXQE 3MV11 3TVMA 5MENB 4E41B 5F7UA 1U8OA 5MEQB 5FDYA 1H9VA 5I1CH 1XMWA 1A7BA 4JFFB 5D1ZC 5E5MB 5HYSA 2C3VA 4OZIF 3GI9H 4BUHA 4WY7L 4F7MA 2HMID 2AEIT 5FOBB 2C5DC 4LPYA 1ZLVH 1KB9K 2Y23A 4S1DC 5IVXB 1I9RH 4KZDH 3EIFA 3VFNA 3D69B 5ETUB 5I74C 5DUPH 4HJJL 3QULA 43CAA 5FV1L 1UCBL 3HLAA 1EGJH 3O6LH 2A9ML 4X6CE 4Z7UA 4KI1A 1KTKE 1KCUH 4UBDD 3B2VL 4G42B 2FNBA 2HFFB 4KHXL 4R7NA 2YKLL 3M17A 3IXAB 3DPBA 3DRQB 5D7SL 5EUKB 1IGIH 2IPTL 4X9GA 3EFFB 5EH1A 1KN4H 4U3HA 2CUIA 4KKLC 5DHYB 4JN1L 4PJGB 1VSCA 4PV9A 4XNZC 1RJZA 3KYKH 4XX1G 4X6DE 1HK6A 1AGCA 2GHWB 3QUXB 1JGUH 5TE6L 3OKMA 5EZIL 4Z18A 1K3IA 1WCBB 3W2DH 3MRCA 3JTSB 3LH2L 3BP6A 4P4KD 3AFLA 3CSGA 3VI3E 3V7AE 1KTDB 1OPGL 1S7WB 3DX9A 3ZSTA 4ODXB 1OAQL 1KJVB 4I3RH 3S36H 1L0XA 12E8L 1F3DJ 3MX0A 3KYMA 2BNQE 4WDIB 2ARWA 4LSUH 4QYOA 1KG0A 1YEGH 4PJAE 5D70L 3TBSB 4QTIL 3WFBL 4NT6B 5KVEL 5GRUL 1JGLL 4LAQH 2OXHA 3OZ9H 4WI3A 3GJEB 1T83A 5SWQA 3KHQA 1FPTL 4AZ8A 5EIIB 4MQ7B 3FO0H 3GMQA 4OT1H 3HC0A 3PIQA 4K23L 5FA4B 3MA9H 3ABZA 3QDGD 3VFGH 2VLJD 4H0HB 4R2GC 5K59E 2OL3B 1DBBH 1K8IB 1ZHNB 4ODBD 3V5KB 5FECB 1FYTB 1E4KA 3QCVL 3CH1A 3MLRH