3CC5A

H-2db complex with human gp100
Total Genus 68
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
68
sequence length
276
structure length
276
Chain Sequence
GPHSMRYFETAVSRPGLEEPRYISVGYVDNKEFVRFDSDAENPRYEPRAPWMEQEGPEYWERETQKAKGQEQWFRVSLRNLLGYYNQSAGGSHTLQQMSGCDLGSDWRLLRGYLQFAYEGRDYIALNEDLKTWTAADMAAQITRRKWEQSGAAEHYKAYLEGECVEWLHRYLKNGNATLLRTDSPKAHVTHHPRSKGEVTLRCWALGFYPADITLTWQLNGEELTQDMELVETRPAGDGTFQKWASVVVPLGKEQNYTCRVYHEGLPEPLTLRWEP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords H-2 class I histocompatibility antigen, D-B alpha chain
publication title Design of agonistic altered peptides for the robust induction of CTL directed towards H-2Db in complex with the melanoma-associated epitope gp100.
pubmed doi rcsb
source organism Mus musculus
molecule tags Immune system
total genus 68
structure length 276
sequence length 276
chains with identical sequence D
ec nomenclature
pdb deposition date 2008-02-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00129 MHC_I Class I Histocompatibility antigen, domains alpha 1 and 2
A PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3cc5A02
3.30.500.10 Alpha Beta 2-Layer Sandwich Murine Class I Major Histocompatibility Complex, H2-DB; Chain A, domain 1 MHC class I-like antigen recognition-like 3cc5A01
2WUBH 1LK2B 1BVLB 2A83A 2F53E 2I9LB 3EJZC 4WO4C 1NLDH 4YR6A 4K2UL 5JUEL 4JRWA 5B3NA 1J8HA 4O58L 1F4XH 3VWJB 1YEDA 2BK8A 5DJ8A 2X4TB 4KK8D 4ZNCD 1UJ3A 5D2NB 4K94C 5CJOL 2V9RA 5E1HB 1DQLH 5GRJH 2Q1EA 3LEXA 3LKRB 2BRRH 4WW2B 2VLJE 5E7BA 4NOFA 4JY6B 1P2CA 4PBXA 3VFGL 3DYMA 5BVJB 3M8OH 5GRWA 2I60H 2R2BB 3PGCA 4J3VA 5F3HB 3U30C 4WI5A 4NZTH 5FUZL 5DGQA 5BV7B 4DW2H 4CJ1A 1ZVSA 3JUYA 1ED3B 5J6GA 4P0DA 3RWCA 1TTUA 4I3SH 2VXVH 5K9QG 4QHKI 4ZTOL 4Z7UB 1HILB 3NCBB 5GRUL 4ZOBA 5KG9B 4HUKB 4S1SL 3IDYC 1S7SB 3E6FA 4F2MB 1TCMA 3THML 3GNML 3H0TA 5DRWB 5I16A 4M61B 3ARFC 2XKNB 2HG5B 3NACL 4KZEL 1DVFB 2IC2A 5EU6D 5M95B 5DS8A 3W9DB 1GC1C 1DQTA 2FHCA 3MR9B 2H2SD 4EI5A 1U8QB 3H9HA 5EOCJ 4XWOD 2AEQH 3VDBA 1JHTA 1UYWH 2W9EL 2B1AH 4LCWE 1KG0A 4YGVA 3FONB 3NIGE 3UMTA 3VFNB 4L8SC 1A9EB 2UZIH 2XN9B 4R4BA 1OAQL 4IRJB 2BVUA 3ALXA 3TPUA 3NCFB 1K4DB 5E0QA 1HHJB 4B50A 3VFTA 3P0YL 1K6QH 4Y5VB 2ZWLT 1I1FA 4NZDA 3VD3A 5D2NC 2BOCA 3PWVA 5I8EB 5E08L 1FAIH 4G43A 3ULSB 2VAAB 2OP4L 4WW2C 3EOAA 2G9HB 3CSYA 3O2DH 4HK0B 5ANMB 2NR6D 3LKNA 1BQHG 5IBTH 5JXEA 4ZUVA 3MACH 2VXUH 5F9DC 4MSWA 3C8HA 1MCFA 4JHBA 3HC3L 4OCSL 2QJDA 4P3CL 4IMLA 5BV7C 5J3HC 1UQSA 3VXQB 43CAA 4R7DA 3AVEA 4I48B 2GFBB 3MUY1 1NAMH 1RUML 4UAOC 5TDPB 3P11L 2F9BT 3ARBC 3KG5A 3T77A 4U1MA 4HHAB 4HLZG 2Q8AL 1K8IB 5LGHH 2VLMD 4LKXB 2JF1A 4W68A 3DJ9A 2B39A 3BPNB 4PRID 3C2AH 3B8YA 3QRFM 3PWPD 3B9EA 1JJUA 1KXVC 4PRPE 1MY5A 5B38A 3TNNA 2NNAA 3T0EB 3OXRA 1H3GA 4NDMA 5CZXD 3MJGX 3WLBA 4Y19D 1XR9B 1QP1A 2F15A 2WBJD 4IRJC 2QSTA 5FYJL 3S88H 1CLOH 3QDJB 4JY4B 4YX2L 3D2UB 5HVWA 3TN0D 2X42A 3P4MA 2O93L 5J6HB 4MJ5B 3LKOA 1UJTA 5JNYA 3O4LB 5EU6A 1J18A 3MCLH 3PWLA 4M7LT 3REWB 4LPWA 5IW3A 1FVEA 3RUGB 4GLRI 5D7KE 4GJTB 3GI8H 3FTGB 4M43L 3H3BC 4Z0BL 4IDLA 2BJML 3EZ8A 5KSUB 1M71B 3ULUL 1KTDB 1Z5LB 5EZJB 3BKCH 1NGYA 2AVGA 2P7TB 4H1LA 5IEHB 3FB8B 3P30H 3BHBB 4X9HA 3RVVC 1EAPB 1X4ZA 3U36B 4FFVD 3FOLA 1LO5A 3UAJC 4PJ8B 5F9JB 3OJVC 3GBML 1NANH 4G80B 2AK1L 2YUXA 3FB5A 3SE9H 1H15A 3ISWA 5DD0L 5F96L 3L7EA 3I3BA 1ZA6B 4EN3B 5D7SH 3TIEA 2YN5A 2A73A 3C5SB 3ZT5A 2HVKA 1JRHI 4PP1C 4OLYH 1OP5H 2PYED 3E6HA 1I1RA 3G04B 1JF1A 1YY9D 1V8HA 1A7PH 1KTLA 3UYRL 4JKMA 2BVYA 5EZOL 5EO9A 1G7QA 1VENA 1CD1A 3JWOH 2CIIA 4UT9L 2WNGA 1OQOA 4HF5H 1SVZA 1Q0YL 3U0TB 5CJQL 1W0YT 4PRIA 3RL1B 5I74C 3BSZH 4LHQB 2QR0B 5IEKB 3HAEB 3PWPA 1I8LA 4OZHB 1A6UL 1CIUA 3N9GH 3TJEL 4HX1B 4I77H 1QYGL 4P49A 4RFEB 3FQUB 4Y19A 2WBJA 1ZEAH 3B6SB 1RJZA 3GMOA 4NN5B 2WLZA 1B3JA 4QF1B 2NX5D 1PBYA 3TBTA 3TN0A 4X4YB 2WY3A 4Y0GA 2Y07L 4AMKL 1UEMA 1OTTC 4PJGB 2R0LH 3ULVH 4QO1A 4F57H 2MJWA 3EZJB 5TE6H 3O3BA 5JHDD 5TFSL 3DUUA 1FO0L 3DIFA 4WIQA 4I3GA 4JFEE 4YQXL 5ALCH 1IBGH 1S8DB 4CVWA 4DVRH 3ZDXF 1SJXA 2HT4C 4EN3C 4PJEF 3O6LH 5GGVH 4O9HH 3K46A 5GRVK 3IVKA 4POZC 3QZWA 4HS3B 1ZHBA 2CLRB 4XC1H 4HWZA 1MHHB 2VDML 2PR4H 1UWGH 3BGMB 2DWEB 2YS4A 3SKJL 1EA9C 4ZUTB 1NMCC 3TT1L 5AWNH 3HC0A 2A74A 3O8XC 1QEWB 4B5EA 2BC4B 4KDVA 5E8EA 3GBLA 5DRNA 3OKOA 3IFPA 1MHPH 2DWDB 1CGSL 3V4VH 2ATKB 3NA4A 1MHEB 1T0NB 2NZIA 2DBLH 2EYTA 1JHLH 2MPAH 5MEOB 3C5JA 1X5IA 4YXKH 2PYEA 1HIML 4WWID 5DUMH 4AEHH 1HQRB 1MAMH 4NN5C 4HUWB 4P5KA 4ZSOE 1L0QA 4HQQH 3BISA 4JQVC 1NBYB 1RVFH 3CNKA 5HGHB 1INEH 1KB9J 4M4PA 3L3GA 2EZ0C 5HPOA 4NKMB 1OARH 2C1OA 4M62L 1M7IA 1XGUA 5IMLA 3VFWA 1RK1B 2YBRB 3GRWA 5ID1B 4HKJA 3B5TA 3GZKA 1S5IH 5ITFB 2DM2A 2AKRA 1JFMA 5GISL 4M7LH 1O5DT 3ARPA 2VZTA 2V9QA 1NC4D 5TQ2H 2BSTA 3QUMH 2NX5A 4ZG1A 3PDOA 1JGLL 2X4OA 4OF0A 3MJ9L 1AH1A 1JWSA 2XYCA 2NY2B 4C83B 3LV3A 3EO1A 2DJUA 4ZOCA 3P0VL 5FDYA 4IEFB 3QDGB 4WUUD 5JHDA 3T0AA 2KUTA 3VXME 1LO4L 4PDCE 4FXLA 1WCBB 4QRPD 5EU7E 2R1XA 3UEZA 1OF2B 3Q0HA 1BX2B 5EG6C 4GH7B 1SBSL 1BLNA 2I5YL 4HIJA 2A0LD 3R1GL 3RU8L 2OR9H 4L8BA 3NCYS 5EH1A 3VG0L 2F54E 5EBLB 4PJDA 5EU3A 1I3RB 4G59A 1PYWA 4PGDA 4QRTB 4G7YL 2H8PA 3IDIB 1YA5A 1IGTB 1I3UA 3O41B 1A64A 4F7EA 5GS0H 2XZZA 4QHNB 2EDXA 4KPHH 1BM3H 1KN4H 1Z6JT 1G9NC 4QOKD 4NCC1 5DJCB 4P2YA 5TF1H 1FO0A 1H3XA 4LLDA 3L1OL 4N5EC 2E9JA 2X4PB 3MLYH 3V5HA 2ZCKH 3MJ6A 5FUCE 5CEYB 4JFED 3DO7A 3SDAD 3HI5H 2O61A 4Z78A 3CSBA 4R4FH 5EU4A 1L8JA 2XA3A 1MIEL 1T5WA 2W1NA 3GB7B 4Z0XA 3UX9B 4GAYB 4K55A 1PQZB 1WQVT 4NM4H 4ONGL 5M7QA 5D1QD 1NAMB 1WBZA 3PIQA 4P23B 3SJVB 1J0KA 1MJ7L 2EXWD 3Q1SH 3HPLA 3O6FD 1AQDA 2FLRT 4Q9QH 3MRRB 2DL2A 5D9SA 1IQDA 1P7QB 2MKWA 1QVOB 1NC4A 3H2WA 1BAFL 5GJSH 5KVDH 3KPRE 4Q9RL 4BK5A 3PHOB 3S4SG 4LPVA 3MZGB 4TUJA 3L5WA 4N90E 1B6DA 5MEQA 3L95A 3IGAB 3JTCA 1TNMA 2FWOB 4NKOB 4L4VE 3WUWG 5SX4I 3P40A 1EHNA 1TJIL 4WUUA 2CQVA 4LLYB 3WHXB 1B6UA 5J57B 1VESA 4LGSB 2XQBL 1YDPB 1YEEL 4QRPA 5INCA 1RZJL 6FABL 5C70A 3FO1A 4F37F 2J5LB 1NFDE 4KI5C 4NBYB 3FB7A 5D1ZB 5CGMA 4PRBB 1HHHA 1X7QB 1S9XB 3CSPA 4NQDE 4G8EB 4NKDB 5EUOB 3DVGB 5D7JC 3OAUH 4XWGL 3U0WH 3MJ9A 3R8QA 1SJHA 4QWWD 4OLUH 4YPGB 1H3PH 4QOKA 2H3NA 2VUYA 5JIIA 2Q76A 4FTVB 1J5OL 2EDFA 3VDAA 2X4UA 2KH2B 3QXDB 1PEWA 1FNEA 3BGFB 1RK0A 3K4ZA 4Y1AB 1M7DA 1OCWH 2DIBA 1OT2A 3GKWL 3VFMA 1T1YB 2IQAA 3VXMD 4JFEA 5BMFL 1G6RL 3RWHB 3SDAA 1T80A 3EO0A 2BHYA 5HGAB 1T0PB 5AAWA 2R29H 3ARYA 4NPYB 2GJ6E 1G9EA 3EFDL 2EXYC 5ABDE 3UC0L 1KF9B 5D1QA 2HKHL 3QI9C 5DRXA 4JDVA 3DX7A 1DJSA 3O6FA 3REVB 4Z7VB 1EX0A 3DETC 3WDHA 2GW5A 3I6LE 2OL3B 2NY6B 2HTLC 5D1ZC 3X3FH 1I1YB 2FB4H 3QHFH 4A6YH 1CDUA 4PJ7F 3L9RB 4K7PY 1WZKA 1H8NA 5DMGC 3CVHB 4J4PC 2R2HB 4LGPB 4BUHA 3QIUD 4MJ6A 2AK4E 1O7VA 3M1BB 1OAZL 1JZ5A 1FFNA 1KXQE 4DOHE 2APWA 3BPOB 4PGEB 2OK0L 3PWNA 2E7HA 4CN4A 1LMKA 3VFRA 4WFHE 1WUNT 4TUKL 5MENB 2CLVB 4FHBD 4X6EA 5FGRA 4OZIB 1CF8L 4PLKC 4MD4A 3G6JA 1A3LL 3ARSA 3C08L 4OFYD 3ROLA 3P2TA 8FABA 4L1DA 4KY1H 1W0WB 4XNUH 3MXWH 3H9YA 1N7MH 2DDQL 2PO6B 4P59H 5CJ8A 3WO3B 4W4NA 2BVTA 5CINH 3RX5A 4X6DE 1NL0L 5JTWA 2PTTB 3F7QA 2BMKA 3DMMB 1N5AB 2PKDA 4HAGA 1T2QL 3JWOC 2R4RL 3CGTA 2E7LC 3VXMA 3U7YH 4AEFA 4CN6A 2CDGA 1WIOA 3ET9F 1B88A 5IVZA 2J88L 3I02A 1JHKL 1II4E 4QHUB 4OV5A 4PJ9B 3AXLB 3P4OB 5GRVL 3FT3A 4OF5A 4YFEA 4OKVB 2HFFB 4WDIA 5E24E 1QR4A 5LG1A 1WEJL 4NRYB 4LLVA 2LU4A 1OW0A 2P49B 2IGFH 5EO1A 1N5YH 1URLA 2VLRE 1IFHH 3FRUB 3ULVC 5FCUH 2A6KA 4M7JH 3MA9L 3BPOC 3HN3A 5GPRA 3B2UD 4ETYA 3QJHA 5T1MA 4L4TD 3O9WD 4PG9A 5L2KB 4DEPB 5KS9A 5IJKC 1ZT7B 5C0GB 4WW1B 4OZGB 4ZUUA 4KKAC 5ITBL 4K23H 5E8OA 3MRCA 1IAIM 2J6EL 3RWGA 3P73A 3SE4A 4QXGL 2C3HA 2VSCA 3QIUA 4O00A 1D5ZA 4PJIB 2PO6C 2UWEA 1SY6H 3ZL4H 5C0FB 3T3MF 1GGUA 2XWTA 5DMKB 4G6KH 1T21B 4S1DC 3Q6FB 4LAJH 5B38G 5BS0B 2R56H 4OZFG 4MVBD 5C0EB 2RFXB 4TOYH 1IGJB 1ZWIA 5LGKA 4LU5L 2F58H 3V6OC 3ZZ1A 3X13A 2V2WB 4OFYA 1CE1H 4XPAH 2W91A 4HKZB 3KYMB 1CCZA 3RBSA 3IU3A 1E4XI 2H9GB 4ZD3L 5GS3A 4L8CA 3FO9B 4Y5YA 2J8UB 5IG7B 5DLMH 1P4IH 1HYRC 2B20A 2B5IB 4M8QB 4LLMB 4P2QB 2OM5A 2VDPL 1TCRA 4HMEA 3U6RB 4N0YH 5I1HH 5B22A 2EDYA 4JO1L 3LD8B 1IGIL 1O7SA 3S96A 1DDHA 4H1LG 2NY0B 5HJ3A 2WQ8A 3QIWD 4IHOA 4TSBL 4NN7B 3BXNA 2HTKD 4ZDHB 3PL6B 4AM0B 2NW3A 4ZAKD 5I1AB 4WFHD 3QCTL 4UDTB 4FQCH 1RZGB 1NAKH 1RIUL 4GG6E 5JOEA 5IMKA 3LHPH 3RKDC 5IOPB 3MREB 4K7PX 2HFEA 3EYSL 3MRFA 4HUXB 3LS4L 4KJQC 3IETA 4ODBD 1SEQL 4KKBD 4JO2H 2AQ2A 4L4TA 3O9WA 5KAQG 4L3ED 5I1LA 4LLWA 4XP5H 4J23A 2ITCB 1ZT4B 4FMFA 5H35B 5HHNB 1DN0A 5HHQB 3VD9A 1EFXB 4P4RA 2NXYB 4HDIB 4XAKD 2WIIB 4PJHF 3ZE0F 3HKFA 1AGEA 3VGBA 1MFAH 3E2HA 4P9HL 3JWDC 4EJ1C 1N0XH 4PRNA 4LRIC 4X4XB 5IMMB 4NQXA 2VAJA 1B2WL 4M1GL 3QO1B 1INQB 5HHPB 4J3OC 3QCUH 4U0QB 4XPBH 4MVBA 5GS0C 4LBEA 3LKPB 1IGYB 5CKGA 1XGPA 3LKSB 4PTUB 2PXYC 3MO1B 1AGDB 5TPWH 4TTDC 1I7UA 3PL6C 1MI5D 1PG7L 4HC1L 3LMJH 1DN2A 1R3LB 1I7TA 5FA4B 5KVEL 3RIFK 4EQ3A 4DGIH 3TV3H 4MCYB 2Z31C 5E70A 4XXCC 2PCPB 2PETA 1NGQH 3BJ91 4MQTB 1UXWB 5ID0B 5IB5B 4HWNA 2X40A 5C0DA 5DJAB 1OM3H 3QIWA 4JG1H 5FO7A 3MRJA 5CJ5A 4C54A 4R9HA 4H8WH 3KPQA 3LQZB 4ZAKA 2Z93B 4LSUH 5F7DA 4RMRA 2B2XH 2CRIA 4GG8A 4D0BB 5JORB 1VCAA 4ZNEE 4PRHB 1BD2D 3TLRA 5EU5A 4MXVE 4ZFOA 1I8KA 4FZ8H 1KIRB 3D39E 5DD6B 1VSCA 3WJLA 1TFHA 3TWCL 4NJAH 4XI5D 3OB0K 4JQIL 3RJQB 1Q94B 5T3ZE 1TQBB 1CXKA 1FNFA 5FB8A 4BFEA 2NMSA 3GMRA 5D72H 1ZSDA 2FJFA 4L3EA 4LVOB 2N1KA 5JDJA 4X9FA 5DQDH 2HJKA 4I2XB 1GRWA 4Z7OF 3VXPA 2A1WL 5K9OB 1U2CA 4XCYA 3A6CL 4R8WL 3QWOB 1YNLH 2VWEC 2VDLH 1MHCB 1F45A 1XH3A 4S0UC 3QDMB 1MFEL 5D2NE 4TVPL 3ZKXB 1WK0A 4LCCC 1N4XL 4UV7H 5GGSA 1RJLA 1KB5H 3SGJA 1JN6A 4MJIE 2AABH 1BBJA 4D9QD 3O2WL 2W92A 2FJGA 1CLYH 5DO2C 4OLZL 1IQWH 1EJOL 3MGOA 2WV3A 2JCCE 1MI5A 2APBA 4I5BA 4QT5A 4HBCH 4Z7UE 1DEEB 1VADA 2R69H 4EDWH 4Z5RB 1KIQB 2FX9L 1KCUH 1QLEL 2QLVB 2CK0L 5DD3L 5IVXF 2D4DA 4OI9A 5HDLA 1MEXH 4TVPD 4JFXA 2AAVA 5CEZH 3SE8L 3VFPB 3F58L 3RWDA 2UVFA 1XR8B 4KDWA 3L3IB 2VDNL 3MRPB 1J0JA 4M4RA 2YC1A 4WCYH 3HB3D 1G7MB 5IFAL 1YEKH 4XP4H 4NQVB 1ODAA 4WI3A 4PRDB 5DZNA 1BD2A 1HKLL 4FP8L 3QQ9D 4ZS6D 1RZ7H 4DN4L 1YECH 2DB8A 3NPSB 4HSQA 2UUDK 3ZKXC 2R2EB 2H32A 4HIXH 5EOQH 3P77B 5E5MA 1A6TB 3BKJL 4HWEH 5ANME 1JK8B 4W4OC 4J6RL 4PV9A 4NZUL 4YWGH 1N2RA 1AD9A 2DQCH 4MAYD 3TYGL 5K59F 4KFZC 1JNHB 4KRNA 2ADGB 2BVQA 4M1CC 2VABA 1QFWM 4Q58C 1J86A 2ADFH 5KSBA 3N0PB 4XBPB 5DWUH 3LY6A 4F7MA 3UPRB 1AKJD 3MNZB 4YHLH 1A4JB 3W11C 1TNNA 5C0AB 1MNUH 2W0FB 3TZVB 2CLZB 5GGUB 5FKPA 2JJSC 1ZLUH 1T5XA 3T04D 4MA3A 4F9LC 4HLZH 4EOWL 1P4LB 4UB0H 4KROD 1D9KD 1BGXL 5F1NB 3H9ZA 4LVHB 3LVEA 4POYA 3OQ3B 4G8GD 4ZOEA 5E1AA 3QPXL 4BSVB 5GHWH 5IBLD 1NMAH 1JVKA 2BXYA 3QDJE 4QHMA 15C8H 1YQ2A 3GMQA 5DI8B 5CEXB 4C59B 2JB5L 3E8UH 3FRPA 3VXNA 3WNNA 2G5RA 3NPSC 1XCQB 3IRPX 4XB7A 1Z9OA 1U8MB 3O4LE 1MIMH 1OT1A 2PYFB 1DP0A 1HCFX 2XFXA 5GS1A 5TDOB 5E9DE 4ZO9A 2C3VB 5SX5K 3RUGE 2JJVA 5DMJB 3DUHA 2QBWA 9CGTA 1RUPH 4WENB 2QHRH 2F74A 1MELA 3BEWB 3KJ6H 4PJEB 1P53A 2Z8VC 3AMLA 5ISZD 3ELAT 3MLWL 3CMGA 5IHBA 2D03L 2HJFA 2AJUH 4YDIH 1VACA 4XBEL 5JOFB 3FAXA 3RWFA 3GIZH 1QBMH 3N1GC 3TZVC 4OD2A 1F00I 5MP6H 5CCKL 2ZCLH 4DZ8A 5I1CH 1C5DB 4Q97A 5LWYL 1JZ3A 2VL5B 1HH6A 4XC3H 1W72L 2V7NB 2V5MA 3VFVA 4MAYA 2W60B 2PW2B 3MRMB 4ELMA 1WLHA 3HE6B 1NCCH 3L5HA 2CDEA 1AKJA 4S10A 4AH2B 1JGUH 4ZQKA 3CK0H 4HT1H 2BXZA 1A22B 4NNYB 1B0RA 4OFDA 1NEZA 3WEXA 4YZFF 2XN9D 4Q0XL 5I1JH 4HLJA 1I9EA 1NCBL 3E0GA 1W0VB 1S7RB 2DTML 4LQFH 5KW9L 1D9KA 5DVMA 2NZ9C 5IHUL 5L7XL 4G8GA 12E8L 3JWNC 4S1QH 4LMQE 2K9UA 5D5MA 3PWJB 4YHPB 4GRMB 1A9BA 3IFLH 3TM6A 5IESL 5EC2A 1DBJL 1KEGL 3BZEB 2X4SB 1IT9L 2I9LA 5C8JB 4GW5B 4MAUL 2VNCA 5HYSB 1MWAB 4KQ4L 1LEKB 1MJUL 4MWFB 3VGGA 4PJGE 3CVIH 4U1IA 2A6DB 2Y5EA 2X4TA 1RZ8A 1I85C 3VWKC 3QG7H 1LEGA 3O2VH 5FK9B 4M5YL 2YUZA 3WN5C 1IAKA 5F71A 4XP9L 3JSSA 3LKRA 2IH1A 4OM1H 3SN6N 3GSRB 5L0QC 2XY1A 4H26A 1N6VA 4L29B 5BVJA 5IB2A 1BFOB 3SDDB 3I85A 5ISZA 2EDHA 3HE6C 4ODHH 4H5SB 4PY8I 5F3HA 4M5ZL 3S5LB 1I1CA 1ED3A 2H2PD 3JV4B 1UZ8B 3HUJE 3HMWL 3T0ED 1Z2KA 2NTSP 1AGCB 4KVCL 4LASH 5C92A 1EHAA 1LQSR 1U3HD 4BFIA 5DJXA 1B9ZA 1TVHA 2QTEA 2XIDA 4P46B 1Z0NA 2W9LA 5I15L 5A1AA 4NRXB 4HXAL 4FXGA 4FQLL 4K3JH 3W9DA 1BMGA 4PJXB 1NCTA 3MR9A 1RD6A 1YN6B 1SM3L 5KAQF 1R24B 2O5YL 2JB6B 4KAQL 4NN6B 5IV2B 3FONA 1A9EA 5DMYA 4U0RC 4L9LC 2XN9A 4WHDA 4MNQB 1JTPA 4X7TB 4HFUH 3MNWA 4Y5VA 4BSWA 3QNZB 5F7HA 4MD5B 5I8EA 3VXOA 4U1NB 1L0YA 3PQYD 3T2NH 3ULSA 1WAAA 3SPVB 4PJ8D 1HOCB 2G9HA 1LE5B 5FF6B 1NCWL 2RIKA 1Y18B 4Y4KB 1DBAH 1CGVA 4F7PA 1I1AD 1UKQA 4JFQB 4J8RA 3SE3A 2J8OA 2NY4B 2ILLA 3VRLF 4PP8C 4OLXL 4JY5L 1B4JH 1JMXA 5EULV 2NTFB 3O3AA 4PTTA 2VZVA 5GSVA 3QDGE 1MRFH 2CR3A 3S36H 5KVGL 4HHAA 2C1PB 3DO3A 3U83A 1I75A 4P46C 2V17L 2WMPA 2ZUTA 1LO3H 1Z9SA 4RGOL 3TESA 3MGAA 3WIIL 1NDGB 1K8DB 4LSSH 3RGVD 2HFGL 1JPST 3K0WA 4RMVA 4YFLI 4NN6C 3T0EA 4CU6A 3UTTB 3K8KA 4L8DB 3CJJA 1XR9A 4MA1B 3BP4B 1QLRA 3L5XL 1ZA3B 4N0CD 3HHRB 4GKSB 1B4RA 1U3HA 2F19H 3D0VB 3ARGD 4P57A 1C7SA 5IFHL 3N06B 1QNZL 4AIZB 5J6HA 4RX4D 4OGAD 1IRAY 4KI5E 3D3VE 3OR7A 3NH7L 2DQJL 4OF8A 4HS8H 5F6IC 4R0LA 3FTGA 4Y4KC 3TVMB 1ND0A 1X5FA 3MV8B 4J12A 2Y5TB 1G6VK 1BQHB 3G08A 2VZ1A 1T6VN 4HG4J 5KSUA 5E7FA 3SGKA 2ICWB 1Z5LA 3RNKB 5KN5B 3NIGF 4UILH 2P42B 1WICA 3FB8A 2ADJA 4HUUB 3BHBA 4OCXL 1YJDL 1UKTA 4S11A 3U2SB 3PQYA 3V6FA 3DURB 2XWJB 2ZG3A 4PJ8A 2W0KA 3ZSSA 3U9PL 1UACL 1BHGA 3KYNA 1TETH 4JKKA 1NGWB 3DSFH 3LQMA 2X9XA 1I1AA 4CVUA 1FVDA 1ZA6A 4NQUA 1Q38A 2HVJB 3C5SA 2P8PA 5GIRA 1A1MB 5IROC 3NFNB 4MB4A 3HR5B 5BO1H 3MRKA 4NQCE 3G04A 5LJYH 1F90H 4MA1C 1CL7L 25C8L 3UZVB 3S34H 5E2TL 1UADC 4FQXB 4FFYL 3TF7A 3AGVA 3G6DL 5DK2A 1R3JB 1IC7H 1JF6A 5ICYA 5GGRA 1UA6L 3X14B 1NUGA 2VDQL 5E00B 2QR0A 3RGVA 4OZHA 5I73C 3TVMC 3H9SB 4ODSL 5EUOE 5I76B 3GSNB 4N0CA 5HYEA 2F8XC 1AXTL 3FN9A 2I25N 3G5ZB 2OZ4H 4X7FC 2GUOB 2Z4QB 1T89C 3ARGA 1IKNA 5GGVY 4RX4A 2NY2D 4PJGA 3KPOA 1WZ1H 5DR5L 5HHVL 1MCQA 4Y1AE 5C07B 3QDGD 4GKNA 3CDFA 2X7LA 3WFDH 4G6ML 2WAHA 1U95B 4JHWL 4NCDA 5KSVB 5CIPH 1TZGL 2ORBL 1F4YL 2LE9A 5KZCD 5EIQA 1QFUL 1TQCC 4D8PA 4W6WB 4YH6A 3DV6A 1XF2B 5JA9A 1BIHA 1IAIL 1FGNH 3MRHA 5KOMC 3CFBB 1U8NA 5SWSD 2AJVL 1ACYL 3BH8A 1MHHA 4ZFZB 3UTZB 1A1NB 4HXBL 4ZUTA 1G7LB 4JKLA 3HMXH 2BC4A 5B4MC 5DJYB 3DVFA 5M94B 2E7LE 5TE4L 4XNXH 1NDMA 4HV8B 4M9PA 1A6AB 1DBML 1R5WB 4ALAL 2FD6L 1UM6H 3VXRE 4G9FE 5EBMB 5MEOA 5I75C 1DSFH 3BIKB 5DQ9B 1KJMA 4OKDA 4GW1B 1J0HA 3T0VA 2R0KL 4HUWA 5I0ZA 1JPSH 5HGHA 4DKEH 1N6QH 4M48H 4NKMA 4DK6A 2I24N 1ORQB 3ULVE 4K3EL 1RK1A 1JZ8A 5ID1A 4P23D 3SJVD 4CDHA 2JK5B 4OLVH 3BAEL 5DJ0B 4OZIE 3VW3H 1A6VH 5ITFA 4UQ2B 4MCZA 5KSAD 5EOCH 2QQKL 3BDYH 3CMOH 5AUMA 4YHMH 5DK0B 4HK3J 3N1FC 5E6ZA 4MA7H 2O5XH 5DFVC 1UKSA 3EYOB 3ARDD 3SKNA 3U4AA 1G1YA 1DTUA 4HW6A 3AAZA 2DQIL 1W8OA 1EEZB 4C83A 3MBEB 4NSKA 5FYLD 4E42A 2A77H 3L3HA 3I50H 2YUVA 3QDGA 3MNVA 4XNQA 4KMQA 2R23A 5TQ0H 2AQ3A 2AEPH 4LDEB 3V6OE 1WCBA 2X4NB 4PJFA 1CXLA 4I9WD 5JIPA 1T7ZA 1A4KA 3HZYB 4MB5A 4B41A 5ACZA 2VERN 3IDUA 2IG2H 4MX7B 1CICB 5SWSA 5KOVC 4HBQA 1OL0A 4CADA 5T5FH 4X5XB 2OX5A 2WSKA 2AJSH 3WLWC 3PJSB 4MS8D 1A3RH 1QO3B 1KLUB 1U9KA 3HFML 2FGWH 4K9EL 1IGTA 1MQ8A 5K9KB 3O0RL 3CIQA 4P99A 3FMGL 2BHZA 3MLUL 4QHNA 2HKFH 4RWHA 4DKFL 1IM3A 5TH2B 4OM0H 1DLHB 4D9LH 3PP3K 5L2KE 4FTVD 2OLDA 3IDGB 4DVBA 2FO4B 1MUJA 5LGJB 5JQHC 4G3YL 1NBQA 5HI3D 1HSAB 1LP9A 3IXTA 1NEUA 4LKCB 4LF3B 1IC4H 4PJIE 4PJHB 4AYFA 5JR1H 1OSZB 3QT2A 4RNRA 4OLWL 3FO0H 4CRPA 3MBEC 1HZHL 5BS0E 1E4WL 4P23A 3SJVA 1QBBA 4KUCF 4LIQL 3QRGL 5A2LH 5F6HJ 3QUZD 4HUVB 4JKPL 1GIGL 5KSAA 4H25A 4L1HA 2DLTA 3MRRA 3FRPG 3RL2A 4GRWB 1F6AB 4MB3A 2A9NL 3MLPA 3EW3B 4Y4HC 3ARDA 3PDGA 3TH2T 1DUZB 1IC5L 1QA9B 1CICC 4I0KA 3VH8A 3IFOB 4X6CA 1T0MB 4JFYB 5CJOH 3T4AB 1E4KC 4EIGB 2FHFA 2FWOA 4NKOA 2D7TL 7CGTA 4EKXA 1FNGB 1NUDA 2Z8SA 2AEWA 5C0IB 4ZO7A 1KNOB 1CFVH 4JLRB 4PRAB 4X8JB 4EI6B 3S98A 1YDPA 2GAZB 2CRYA 5HYJB 5FEBA 2BX5A 4I0CC 4M3KB 1U8IA 4H1LH 2FX7L 2YPLB 2VDOL 4P2OB 3SO3B 3MUGA 5MEND 2Q8BL 1DZBA 3UJIL 4BELD 1QSFE 5BZWB 5B39A 2K1MA 4S1SH 4OSUH 3BN9C 3FQWB 4RAUB 4MS8A 4QY8A 2OSLA 1UM5H 3NACH 3UTPE 2BZDA 1A0QL 4RBPK 1G7IA 3VXTB 1OWRM 3PXJA 4YPGA 4CNIA 4FTVA 3O45B 5T1DH 3DXAB 1HYSC 2ATPA 3QXDA 3DMMD 2YD3A 2NXZB 3K3QA 4LLUB 1ZLWK 2O5ZL 4HWBA 1NEZG 1T1YA 5F89A 1CDJA 4E0RB 2BVOB 1OB1B 5HGBB 3IT8D 4JRYD 4BH7B 1MCPH 5FV2A 2XZQL 5E2WL 5HGAA 2IAMB 3MLXH 3GBNL 1JI2A 3FT4B 3GSOB 3EUUA 4XMPL 3S4SB 3FJTA 4RQQB 3C6SB 3ESUF 3ZKQD 4YEFA 4G8IA 4PJ9D 3DX6B 3VXSE 3QUYB 2FX8H 3U4BL 4Y16B 3Q2CA 4LDLB 1VB9A 3QUZA 3EGSB 4Z7VA 1AR1D 1DR9A 1Z0MA 3EDFA 1PY4A 2VWEE 3HLAA 1HHGB 2GSIB 1UCBH 4M7KL 4MQ7B 2AXGA 3MFFA 4UUJB 3VXUB 3ZE2F 1TVDA 4PG2A 1FLRL 5L2KD 4E41D 3Q5TA 3GJFB 4I0PB 2GEEA 1I1YA 4URTB 2DQUL 35C8L 4KHXL 3WIHL 3ARZA 4NO0B 1YN7B 4J1UA 2VR9A 3TJHC 1DBBL 4FQHA 1MOEA 3QR2A 1OPGH 5IVXB 1ZGLP 3WKMH 4MXWH 2QQLH 3CVHA 5TDNB 3QJFB 1GZQA 4PLJD 5GJTL 4OD1H 1NCDH 1ITBB 3RZCD 5IR1B 4MDJA 3MOQA 2BNRE 3PNWB 4HIEB 4TPRL 1RFDL 1WZMA 2DICA 5JW3H 4AENB 3WFCH 5MENA 2CLVA 1QFWL 4PRHE 4HPYH 4B53A 3PV6A 4YX2H 3T65A 4X4ME 2YD4A 4GAGH 4OQTA 2ZG1A 2LTQB 4IIQB 3MYJB 4U2ZA 5DEFB 1MCDA 5E6IB 3HCVB 3QUYC 1CL7I 2BNUA 3EO9L 3QFJB 4QLRA 1AI1H 3DMMA 2WBKA 1N5AA 4P2QD 2OXGA 4I2XE 4LHUD 1W8NA 2R9HD 1JFQL 2A83B 4JRYA 5FGBA 3RJDA 2NY0D 2QQNL 4MA8H 4I0PC 3QDME 5BRZD 2OMNA 5H2BB 1MFNA 1J8HB 1RSFA 3RP1A 1A6ZA 1YEDB 1RQ5A 3HNSL 3MXVH 4X80L 4QHUA 3GRWH 1T1ZA 1UJ3B 4PJ9A 4JJ5B 3AXLA 1HDMA 2P24A 4XHJC 2VOTA 4OKVA 4DTGH 5C7XH 4JDZB 3VGDA 5F96H 2EIZB 2EO1A 2W0PA 4YHYB 4JG0H 3VGHA 2XZCL 1RURL 3PGCB 4RCAA 5DTFA 4PFEA 2P5ED 5L2KA 4E41A 3DLQR 4WW1A 1PGRB 4OZGA 3SDXA 3DUSB 2WBWB 1F3RB 1ZVSB 5J6GB 3HNVL 2OMBA 3RWCB 3VA6A 3IU4H 4B0MM 1QBAA 2HT3C 3BMWA 4FABL 2IPUK 1A7OH 1IKFL 1EFXD 3E6FB 5DVOA 4IIQC 3H0TB 3P3YA 1BBDL 2XA8L 4FQ1H 5C0FA 1IAII 5HHXH 4NM8L 3RZCA 1RUQL 4XP6L 5DMKA 1PZUB 1T21A 1V3JA 4F9PA 5BQ7A 1C7TA 3TJEH 3WFZA 3VFSA 3H9HB 2BSSB 5C0EA 2RFXA 1IGJA 2WINA 5FYKD 1I3GH 4OD3L 2DQHL 4WTZA 2DLFH 3TPUB 4NHCH 5HI5D 1BZ9A 5EOTA 2NY1C 2AJ3B 3VFTB 2XZAH 4XCCL 3WHE1 1UJ3C 3PWVB 5I8CA 1QKZL 2AERT 4P5MB 3ILQC 2J8UA 5IG7A 4QRRD 4M93B 4BK4A 2CKBL 2GCYA 3CSYB 3EOAB 4KRPB 4LLMA 4P2QA 2HRLA 3SY0A 2FCBA 4LHUA 5C6TL 2NY5H 1WZLA 2VXTH 4X7DC 3SOBH 4XRCA 5EBGA 2FL5B 5BRZA 1L7TL 3QPQD 4ZDHA 43CAB 5JO5B 5C0AE 4OTXL 2G75A 1KFAH 1KENL 4ZO6A 3O4OB 5D1XD 3T0DA 1F8TL 3T77B 4OIIL 2IAND 3VG9C 4F33A 4UINH 4YUEH 5GGTL 3MREA 4HCRA 2EH8H 3V7AE 4HUXA 1L7IL 3KYAA 1PX3A 2VDRH 1V3LA 4PB9L 3CPLA 5EIVA 2P5EA 3TH4T 3BD3A 1KCLA 4LSTH 4EI5C 1E4XH 5GZND 1MRDL 1UFUA 2AJYH 3SQBA 1IJ9A 1QFOA 2ITCA 2NNAB 4OZFB 4NDMB 2DM3A 5F3BA 3KGRA 1ZT4A 4XMLH 3WLBB 1JTTA 2AGJH 1EFXA 4P2CG 1WWAX 4PS4L 2VSDA 1AE6L 3AB0C 2VYRE 4M62H 1YEJH 2WIIA 2IADA 2JLLA 5I1KH 1KOAA 5DGRA 4CMMA 3P4MB 2W38A 3VI4E 5T3XE 4X4XA 5C08D 5EU6B 4NQED 1YEIL 3X12A 3PWLB 4M93C 4ZTPL 4YHOL 1R5IA 4KRPC 5HHPA 5IW1A 1FVEB 1IZJA 4NJ9L 2J2ZA 5JXEC 4G7VL 3WUZA 3ZDXE 2UYLA 4PJEE 3MODL 1IZKA 3QEQE 1IGYA 1BOGA 2DI7A 2EDRA 4PTUA 1NGYB 5L2JB 3MO1A 4JO3H 4KI1A 3C9NB 4H1LB 4KK8C 4TSAL 3P0VH 3VD5A 3WXWH 1LO5B 1PKQB 3OPZL 4Y2OA 3S37H 5ETUA 2ZJSL 4R96B 4U3XA 4QRRA 3LIZH 1JZ4A 1LO4H 4MCYA 1X9QA 2PCPA 3FB5B 5JZ7D 4XVSL 1H15B 1XFPA 4DKAA 4LHJB 1SJEA 1BEYL 3TIEB 2A73B 5KSBF 4Y88A 2HVKB 4KZDL 1T83A 4R3SB 2Z93A 1QPXA 3E6HB 4D0BA 1OTSD 5JORA 4G7YH 5D1XA 5HYQA 2IANA 4AEEA 4D94A 5EO9B 5JQ6L 1KIRA 3H7LA 5KJRH 1FE8H 1G7QB 5K9JL 4GG6F 5A3ID 3SKUD 5CZVL 2DKUA 1Q94A 3JXAA 1INDL 2CUHA 4RGND 1VHPA 1EAJA 2WUCH 2CKBA 2H2SC 3MMEA 4XWOC 1VFAA 3PWPB 3V52H 4TNVF 2DS4A 5HI4D 3EOYG 3DVNA 4I2XA 3MA7B 2WBJB 1FL6A 1RJZB 2G60H 5EUKA 1YEGL 5E56A 5IT2H 3U1SH 1KEML 3TN0B 2HT2C 3FFDB 4G8FA 3L7FA 2YN3A 4CKVX 5C08A 4NQEA 4LEXL 1HINL 2BDNH 5EORH 2NR6C 1DCLA 3O3BB 3DUUB 3CZFA 3RVXD 3H8NA 2EDDA 1MCBA 2DQEH 5I1IH 4GXVH 4XPGL 5F9WB 1I9JH 3IVKB 3QHZH 1GGBH 3K4AA 2XKUA 1ZHBB 3MLRH 3SEPA 1FFQA 4HWZB 1DEEA 2VLKB 3QCVL 5K93A 4N0FB 4Z5RA 1J11A 3D85B 3OV6A 3WO4B 5HDQH 4R97B 1NGPH 3HC0B 3VRJB 3ME0A 4EUPB 4XNYH 5E8EB 1YEEH 4LSVL 2UY6A 3L3KB 4KQ3L 1X5XA 6FABH 1P1ZB 3OKOB 3IFPB 1NQBA 4K94L 3VFPA 3T09A 4ELMF 1U91B 2A2QT 1FGVL 2M1KA 4PJXE 4DFIA 3L3IA 1CXIA 4KTDL 3MRPA 2EYTB 1I8LC 1G7MA 3C5JB 4DKDC 4G6JH 2PYEB 5CZXC 3INUL 2X70A 4MLSA 4PRDA 2WBJC 4J7RA 3VU2A 4MNQE 4P5KB 1OSPH 1WJ3A 3PGFL 5E2VL 4O2EA 3UTQA 1OHQA 1GL4B 2ZOKA 1FL3B 3CU1A 3TN0C 2C1OB 2EDJA 1P5VA 3W9EB 1ZAGA 1M7IB 5IMLB 1U8KA 3G9AB 3TO2A 5F1SA 3UZQA 4HZAA 2V6HA 4EXKA 1MRCH 2PF6A 4HKJB 1CXHA 1JK8A 1CQYA 5D5MF 5JPNA 1U8LB 4H20H 1NLBL 2OBGA 1GC1L 5D70H 2DLIA 2NX5B 2GT9B 5CSZA 3PDOB 3BE1L 4FFVC 1FZMB 1J1OH 1I3VA 1SEBB 2HKHH 1QFWI 3BOVA 1JWSB 5DFTA 3MNZA 2ZCHH 1A4JA 3LV3B 3WO4C 3EO1B 4R97C 1S3KH 3PV7A 5C9KA 2COQA 3KPTA 4UNTA 5JHDB 2VQ1B 1C5BH 1HK6A 5CEZE 2VH5L 2DLHA 5F1NA 4GMSL 2R1XB 3VH8G 4MQSB 1GGCH 3WMSA 4HIJB 1FC1A 3UTTE 3QUXD 1YY9C 5AZ2H 4L8BB 3UJJL 2WM0A 2HH0H 5EB9A 2Z91A 1J9CT 4PJDB 5EU3B 1EZVY 4U7MA 1PYWB 5DI8A 2H8PB 4HMCA 5BV7L 1CE6B 3NABH 4XP1L 2Q7YA 1BFVL 2PYFA 2X4QA 4WU5B 3NCJL 3V4UH 4LVEA 1FO0B 2M2DA 5IQ7H 4P4KD 4LLDB 5B39G 4UT6L 3K1KC 5DJ2A 5D96B 2X44D 3V5HB 4JFOB 4RWYL 5CJXA 4QGTA 3BEWA 3RA7H 1GGYA 3FQXB 4P2RD 4S1RL 3VJ6B 2O61B 1UENA 1FNLA 2MOVA 5EU4B 4U6XA 4U7KA 3DROB 1T5WB 3HRZA 3JV5A 2FBJL 2I9TA 2YD8A 1WBZB 3EYUL 1P5UA 1C8PA 1WAAF 5FM8A 1C12A 2R4RH 3F7PC 3BVNB 1LD9B 4LAQL 2VL5A 2OR7A 3HPLB 4DGVL 1KTKE 2V7NA 1AQDB 4GXUN 4JHZA 3MRMA 2OJZH 4PYGA 5B21A 1H8OA 4NZRL 4HULB 1A7RH 1AFVH 3L5WB 5MEQB 5LCVL 3L95B 1CQKA 4AT6B 5CBAB 4NNYA 4W6YB 3WL9A 5C0BD 4WUUB 1EMTH 2Y36H 5L9DL 5AYUL 4WHYH 4HJJL 2YKLL 5HDOA 3AS1A 3C6LD 1AQKL 3WS3B 3IDNA 5INCB 4XAWL 3EYQD 3S35L 3LZFL 2H6PA 3FO1B 4FOMA 3N50A 2HLAA 1EEYB 3H9SE 3PWJA 4YHZL 4YHPA 3FB7B 3QUXA 5D96C 3A67H 4LPUA 1VGKA 2NY5C 1AJ7L 4LNRA 3BZEA 2X1XR 1HHHB 2P4AB 4L3AA 1GHFH 3O81A 3IB4A 4FFEX 2NY4D 2YSSA 5FUOH 1MWAA 5AG9A 1YUHB 4MWFA 1LEKA 4NHUA 3BKMH 1MPAL 1SJHB 4K3HA 4QOKB 2H3NB 4TRPL 2Q76B 3PABA 5C07E 1S5HB 2X4UB 4QXTA 4P4KA 1FNEB 3F7VB 3RUGF 5HYQB 1RK0B 4QNPE 3GSRA 1CVRA 2IQAB 4L29A 5E4EC 1YEFL 3I6KB 2P44B 4P2RA 3H42H 1X5JA 3OAYH 4QRQB 1TZHA 1OP5K 1T04A 1UZ8A 5IGXL 2WWKO 4QHLB 2VXQH 4PJ5B 1AGCA 1AY1H 4JDVB 4C56D 3KVQA 3DX7B 4TNWF 5J1TC 2D7PA 2WQRA 4FZEL 2WANA 4TYUA 4RFNB 1EHXA 1HSBA 1Z3GL 1KIPB 2A0LC 1NMBL 3FHAA 5CUSH 1K4CB 2HRPL 1S7WA 2EDWA 1R24A 1LK3H 3CLEL 1MF2H 4C4KT 3MV8D 4NP4H 3FN0L 4XPHL 1ZTXH 1AHWB 3MRBA 5FHBL 2YMXH 3MLTA 3R06A 4OT1H 5C0BA 5IB3A 2GSGA 2VIRA 3GK8H 1S9VA 2ID5A 3GMPB 4WHTA 3C6LA 2EIBA 3SO5A 3FQRA 1LWRA 3O6KL 4MD5A 3GHEH 1ITCA 2JELH 2CMRL 3BWAA 1FIEA 1R3HA 4Z7WA 4MNHA 3PWNB 5F7EL 2XTLA 2OS7A 3VFRB 1Q0XL 4TULL 1Y6KR 3TBYA 3ZSTA 4OZHF 1L6ZA 3WD5H 5FF6A 2HP4A 2EC9T 2D0HA 1BREA 4X6EB 3I2CH 4YXLL 2ARJA 3SDAC 4KHTL 4JFQA 3G6JB 2J12B 2IPKB 1NSNH 5TF0A 5HVFB 8FABB 3CX5K 4YBQD 5DRZA 4Q2ZA 2AW2A 4V3DB 1GGIL 2NTFA 5D1QC 4OBRA 2J8HA 4PJGF 4QTIL 1CLZH 4WEBH 2EXWC 4AL8L 4KRLB 2BMKB 4FQXD 1BVKA 2DBJA 2W65B 1XZ0A 3O6FC 4EBQH 2C1PA 5I8KL 4RFNC 4WTZG 4D9RE 4YE4H 5JIKA 3O3EA 2CDGB 1NDGA 1PG7H 3O8XD 4YBLB 1S9YA 4FQQA 4HIHB 3W2DH 5IVZB 4CW1A 3LS5L 1G0XA 3PWUB 1F2QA 4GKZA 2H32H 4OV5B 2YD5A 3FT3B 1FFOA 3BP4A 5GSRB 1ZA3A 3KPSB 4C56A 4NWTL 4LHUG 4WDIB 4NWUH 5C2BH 4YHIA 1OGTB 1PDKA 1GH7A 2D3VA 2V2XB 1KT2A 2A6KB 5EO0A 5T1MB 3ZYJA 2CSPA 5KS9B 4JHAH 1JYNA 3QUKB 1MLBB 3NCMA 3MV8A 1Q72H 5E8OB 1ZANL 1H3WM 1FJ1A 4PJHE 3ZE0E 3MRCB 4L5FH 3MZTA 5JXAL 5C0JB 3RNKA 3CXDL 3RWGB 4WTWA 2QV2A 1J0IA 3BUTA 4QWWC 1JE6A 1D5ZB 5GGQH 2UWEB 2WUBL 2BOBA 4JFZH 4XVJH 1D6VH 2XWTB 1HHIA 1NLDL 1MJJA 2XWJA 3IRZA 3MJ7B 3ZHDA 2MCG1 2Q86B 1F4XL 2FJHB 2G2RA 3ECBA 4GRWE 2ICWJ 3A6CH 4F58H 5IHZA 1ORSA 3L3OA 4UIKH 3X13B 5GS2H 3C87A 1DQLL 5AG8A 5GRJL 4YBLC 4LSDA 2BRRL 4JREB 4HMDA 4TVPH 2HVJA 4HGMA 4XZUB 2RAMA 4O02L 2OQJA 4L8CB 2IMNA 2I60L 5GQBA 4Y5YB 4OGXH 3TA3D 4YC2B 5CD3A 2CXGA 1IGFH 3EDJA 3CXHK 4FQXA 4NZTL 1L6XA 4DW2L 1OW0C 3K2UH 2VKXA 1KCKA 4YNYB 5HYJE 4I3SL 2VXVL 1R3JA 3NIFF 5DUPH 3S96B 3X14A 1DANT 4BJLA 4PJFF 1DDHB 1NH6A 5T1LD 3IDJB 2YPLE 3O8XA 2E9IA 5HJ3B 4RAHA 4IHOB 3BXNB 2NW3B 5I76A 1X5KA 2DD8H 1CR9H 3MV9B 3FT2A 3B9KB 2DLEA 3SE4C 1HNFA 4JM4L 3VDCA 5IMKB 2AQ1A 4QYOB 3QIUC 3QP3A 4HH9B 3D18B 4NGHH 2AEQL 1L9MA 3QB7C 2HFEB 1UYWL 2B1AL 1ES0B 1MCIA 4JFHE 2VDNH 3IETB 2UZIL 5CKAA 3HPJA 1CD8A 4GUPA 5DFWH 4L4TB 3UBXI 4OI8A 2D7MA 3WFEH 1K6QL 1WT5A 4Z7OE 1IAMA 5I1LB 3BZFB 4KI5F 4LLWB 1XT5A 1LP9F 1GVIA 5DC4B 1MFDH 4R7NA 1C16B 4V1DB 1TMCB 1DQML 4P4RB 5CP7A 4JREC 3O2DL 3CH1A 2APFA 3SGDI 5IBTL 1AGEB 1KACB 3MACL 3E2HB 3ERYA 1PG7X 4PRNB 4Y5YC 3MYZA 5AZEH 2XRAH 4YC2C 4NQXB 4ZUSB 5T3ZH 3RZWA 3STZA 5LBSH 5FDWA 5C86A 3IJHA 4PJCB 2HLFD 4NC0B 4D0CA 1QRND 4WFGD 5DJYA 1NAML 1XGPB 3VXUE 1A6AA 2EDQA 1NFKA 43C9A 3P9MB 4NQSA 3VE0A 3B2VH 5EBMA 2KL6A 2CO7B 4KMLB 1FVCB 3H3PH 5MHSE 1MFBH 3DYPA 3KPMA 5LGHL 2ZG2A 1JWMB 5IVXE 2EE2A 5E99H 3TA3A 1I7TB 1J10A 1QOKA 3C2AL 3LRSA 2AXFB 3S3SA 3B9VA 4JM2D 1ORQA 3BI9X 4AG4H 3B2UC 3RI5F 3S88L 5LAXB 5T1LA 3OKKB 1CLOL 3O9WC 3QIWB 4PPTA 5FO7B 3MRJB 2JK5A 5DJ0A 3KPQB 5A43C 1K3IA 4OUUA 4NO5B 3NTCH 4UQ2A 1WFTA 4GG8B 3MCLL 2GK2A 5HHMB 5EUOF 3QWRD 4HFWA 4X99A 5ESVA 1BPVA 3GI8L 5GXBB 3E2HC 3MOAH 2JKXA 2V9TA 1EEZA 1FORH 1XF3A 3QFJE 1KCRH 1RZIA 1Q1JH 3BKCL 3H7BB 3GMRB 4U6YA 4YK4C 5DJDB 3P30L 2E9BA 2FJFB 4L3EB 1KJ3H 5K59E 5JOPD 4JFFD 3EHBD 3AY4A 3V95A 5F1KC 3VXPB 1E27B 5HD8D 3AUVA 3V7MA 3GMNB 3UPCA 4CVZA 1J8HE 3ZKND 3T0BA 1F58H 1XH3B 2ED9A 3SE9L 4P2OD 3J7HA 4AIXA 2VL4A 5DEGA 5GGSB 1RJLB 3K4DA 4OCRH 4X5XA 5D7SL 1JN6B 5F21B 1QO3A 4AIOA 1MFCL 2ENYA 4OLYL 1MCWM 1QRNA 2X09A 4BFBD 2FJGB 4EDXB 5K9KA 4Z7VF 3SDYH 4D3CH 1A7PL 4TQEH 5ADPH 3QIWC 3MGOB 4I13B 2HTKC 3AFLA 3D25B 3DXAD 1MI5B 4ZAKC 2NXZD 3KLDA 4HF5L 1JNNH 1VADB 5HGDA 1J1XH 2ADIA 1IEHA 3BSZL 1CDIA 4PV8B 5EBWA 1NCBH 4U1LB 4MHHI 3D0LA 4LF3A 3WJLC 4MNGB 2IAMD 1OSZA 4JM2A 4I77L 4JFXB 5L7XH 4KKBC 1JNLH 1ZEAL 3RWDB 4OLEA 1S7UB 1A7QH 3A0OA 4Y16D 4HZLA 3NFSH 1RIHH 3QIBB 2Z8WC 1VA9A 3ULVL 2R0LL 2OTWA 4OZIF 3WDIA 3TPUE 4F57L 3DHJA 3QWRA 5TE6L 4BQ6A 3IAPA 1KJVA 5F88B 32C2B 5EZLB 1NGXA 2E5EA 3B9DA 1QA9A 4KKCD 2NYYD 3ARTA 3IFOA 5ALCL 1IBGL 4DVRL 3T4AA 2H32B 4M5YH 2ZPKH 2AV7B 4NO0D 4ZFFB 5GGVL 5E5MB 2OYPA 3PGDA 3SGJC 5DT1L 3W5NA 4ZODA 4Z7NE 4UT7L 5C0IA 3QEGH 4JFFA 2ZUVA 1KNOA 4XC1L 1IL1B 1N2RB 1AD9B 1ADQA 4PRAA 4X8JA 5I8OH 4EI6A 2PR4L 1BP3B 1UWGL 2GAZA 3ARUA 3RDTD 1JZ6A 2BVQB 2VABB 5AWNL 2VDKH 3GMLB 5KSBB 4Z76A 1ZK9A 1HHKA 1QHPA 2KDGA 4XVUD 4P2OA 2JIXD 4F7MB 1MHPL 4YZFE 3V4VL 3PDDA 5BZWA 2BVPA 5CGYD 2DBLL 4RAUA 2Q3AA 1JHLL 3OZ9H 2E7MA 2JTDA 4P9HC 3S7GA 3ZT6A 4YXKL 1CN4A 4LMQI 1T5XB 5H37G 3GKZA 5DUML 5F7NC 1MAML 1ZHLB 5E6ID 4HQQL 1RVFL 1LDPH 1INEL 3O45A 3DXAA 1OARL 5J13B 4KAQH 1N6UA 4OZGF 1P84J 5D2LB 1KYOK 1FBIH 2BVOA 2E8ZA 3NAAH 2DKMA 4QHMB 5HGBA 5I30H 5I71B 4BH7A 3MJ8A 5DHYB 1S5IL 1FQ9C 2DN7A 3KAAA 5DVLA 2IAMA 4FMKA 4XI5C 1ZGLM 3WCYA 3GSOA 1SYSA 4KTEH 4PJIF 4M7LL 4X7SL 5EU6E 4IMKA 2NQCA 4NNXB 2XFXB 5TQ2L 5KTEH 3QUML 1SMOA 3SKMA 4Y16A 1NCWH 2ZUSA 1OP9A 4M6MH 3BRDA 5DK3A 2YZ1A 3MQIA 1A7BA 1FFRA 2EKJA 1P6FA 1A8JH 1CIDA 1LO2H 3HC4L 2GSIA 3A6BH 4MQ7A 5E6YA 4U31A 2FIRT 2HJFB 4XH2A 3UBXG 1OAXH 3BP5A 3RWFB 4H88L 4NO0A 1YN7A 2RR3A 3SGEI 3UP1A 1OP3H 5F1IA 2J8UF 1XIWD 3JVGA 5FOBB 1D5IH 1HH6B 2ERJB 2OR9L 3QXUA 3BIAX 1D7FA 4RGOH 3VFVB 2J1KA 3RDTA 5IR1A 4IOIB 4DQOH 2HFGH 4FQJH 4WV1A 5J13C 4XTRD 2CDEB 2EDNA 5GS0L 1FC2D 2RJMA 2JIXA 1AKJB 4KPHL 1BM3L 1KN4L 4ZQKB 1B0RB 3ZYIA 5TF1L 4OJFH 1AIFA 2IPUG 4WEMB 1AO7B 2VLME 3MLYL 2ZCKL 3KPNA 3TBVA 3MLVH 4LVNB 5E6IA 1U92B 5GS1C 4PRIE 5KANI 4KROB 1D9KB 3OB8A 3HCVA 5IIEB 2Y7QA 3HI5L 3PWPE 3HB3C 2DQJH 4G8GB 1T7XA 3QXVA 1VPOH 1XAUA 4R4FL 1EPFA 4OFKA 5GRXG 1VFUA 1A9BB 5HBBA 4TSCH 4Y19E 5EC2B 3QDHA 1LVEA 4NM4L 5D6CA 3JTSB 3B3IB 3RQ3A 2E6JA 3QQ9C 3VRLE 1MH5A 4ZS6C 4PJBA 5CP3H 3Q1SL 5FHAH 5H2BA 1T1WB 3QFDA 4K07A 2CRZA 4PJAA 4OB5H 4U1IB 4Q9QL 3WS6A 1RZ8B 2VN7A 4Y4FC 3W39B 1G9NH 5KVDL 1LEGB 4JJ5A 5GJSL 3U9PH 1FLTX 2UUDH 2GQHA 4TTDD 4JDZA 1IAKB 4RDQG 4ZOAA 2ERJC 2IH1B 4O5LH 3SBWA 4MAYC 2EIZA 5ICZA 4H26B 4PUBL 5IB2B 4TUOB 5ISZB 3OL2A 5CILL 1HQ4A 4FQIH 1XGRA 3DUSA 4X0KA 1RULL 1CL7H 5FYJE 3B43A 4LL9A 5FGCB 2BRQA 5IB4B 1SYVB 3EYFA 1XIWA 2YOCA 4FFYH 4MZ3A 1DBKH 1BWMA 1VEMA 4BFIB 5DJXB 1TVHB 1D9KC 1CWVA 3QUMA 3C8DA 4FXGB 4XCEA 3OAUL 2PYEE 3U0WL 1LNUA 3JZ7A 5IBLC 2BSSA 4OLUL 1H3PL 4JVWA 3QNYA 2SEBA 5JDSB 3AC0A 5HVHB 2DKSA 4U49A 5F44A 3C5ZB 1LILA 1UB5B 3T1WA 3RBGA 2OJEA 3B9AA 1OCWL 3MNWB 3VWJC 2AJ3A 4BSWB 3FZUC 5IBUB 3EOBA 3VXOB 3FQTB 5C9JB 1J1PH 4P5MA 4UNUA 1NPUA 5EPMA 1CDBA 3HG1D 3UDWA 3GO1H 4G6MH 2R29L 1W72B 5SX5H 1N64H 2ED8A 2EKSA 4Y5XA 1KLFA 1AGBB 4F7PB 4WTXA 2ZOLA 2NX5E 1WC7B 4J8RB 4ONFH 2FL5A 3CD4A 3BUYA 5JO5A 3IDXH 5CGTA 3O3AB 4PTTB 5GSVB 2CIKA 1WGOA 5JHDE 1YMMB 3KR3H 2R0ZH 1YQVH 3X3FL 3F12A 3QHFL 4A6YL 3GM8A 1FZOA 2AP2A 5DQJB 3MTRA 3VI3F 1DVFC 3M17A 4U2YA 4F37K 2EH7H 1UM4H 4PIRF 1BZ7B 3C2SA 1JUFA 2R0WH 4GAJL 4PJDE 4Z95H 2YEZA 4OZFA 5FYLH 2GITA 4U1SA 1QLRB 1KN2H 1NANI 1T2XA 4LOUD 2IF7A 4Y5VC 1U3HB 5C0CB 3O6MH 4NZJA 4P57B 1G84A 2FIKA 2VXSH 4DJMA 1VGEH 3J8F7 4ODXA 4HGWA 5F7YC 4APQD 5DA0B 3AU1B 3OR7B 4XNUL 3MXWL 1MAJA 4I8DA 4JEGB 4R0LB 2QQKH 1N7ML 4P59L 3X3GH 1ND0B 1KBGH 1A6PA 5CINL 5H8DA 5I6XB 3G08B 1MCCA 3SE3C 3EJJX 3T3PF 4DK3A 4DN3H 3CLFH 4R4ND 5L2JA 2BVEA 1X5ZA 4R2GB 4A2MA 3C9NA 3ZTJG 2ADJB 3EOTH 5IHLB 3U7YL 3LCYA 3PQYB 1PKQA 2VLKD 3V6FB 5FYJD 3HG1A 4R96A 3D85D 3KYNB 1YMHA 4HWBH 3LRGA 3OJDA 1I1AB 3C8KB 4M3JA 1OGAD 2VR4A 2BCKB 2PN5A 3BPNC 4ORGA 3NIDE 1FVDB 1E28A 2P5WD 2P8PB 5GIRB 2H2PC 2IGFL 3T0EC 4R3SA 1N5YL 1J05A 3MRKB 1IFHL 5FCUL 3LAFA 4M7JL 3ULUD 4WUUE 1MREH 5I1GH 4NO2A 2FEEL 3HFMH 4ZFGH 1U3HC 2GYSA 4QRPE 4K23L 5J8OA 1CI5A 1KPRA 5DK2B 3BH9A 5ICYB 3DGGA 5GGRB 5BOPA 2OL3H 3RGVB 1A14H 1SY6L 3ZL4L 1RU9H 1CDHA 4XHQA 3MA7A 4G6KL 3SGKC 1F3JA 3MLSL 5IW6A 3MV7B 4Z8FH 3CVHH 1LO0H 1N3NA 3KNBB 1QBLH 5JIHA 3N85H 4TOYL 4QOKE 3PG2A 3ARGB 4I4WA 5GZOD 1HZHH 2F58L 3FFDA 4J3UA 4U6VH 1CE1L 4XPAL 3KPOB 4PJ8C 4XNZB 2F5AH 3VI4F 4APQA 5ILTH 4GKNB 1FN4B 2X7LB 3KXFD 3CFCH 4X7EC 1I1AC 3KPPA 1BQLH 3NN8A 2IBZY 3CH8A 1P4IL 4UMGA 3TO4D 4OQTH 1RMFH 4D8PB 1QSVA 3DV6B 4N0YL 2VLJB 5I1HL 4I18A 4P9MH 2OI9A 3MRHB 1U8NB 3PE9A 2VLKA 3BH8B 5IVOA 2FATH 2VITA 4N0FA 1H3UA 3D85A 1X5AA 2YD9A 4ZS7L 5D4QA 4ODVH 4YHKL 4N8CL 3DPBA 1S9KC 3VRJA 3TF7C 4EUPA 3RY4A 4U7SA 3L3KA 1P1ZA 1SJVA 2CGRH 1OGAA 4HGKC 4FQCL 1NDMB 1NAKL 4O2FA 1U91A 3LHPL 3RGVC 2P5WA 5ALBH 2Y1VA 3CFEB 1C5CH 1CGXA 2H26A 1KJMB 2X41A 3PHQB 4N0CC 4JO2L 3SDCD 3ZYOA 4UIMA 3VFUA 5E03A 3RX7A 4X7CC 3ARGC 2QSCH 1X3DA 1FL3A 1IKNC 4XP5L 1RV6X 1CZ8H 3W9EA 4OGAC 1JCKA 4IOSD 1FPTH 4OGYH 1KCSH 5FFLA 3BT2H 2EE3A 1MFAL 1JYXA 4OIBA 1N0XL 3ARVA 1U8LA 4MCZB 4LLQB 1AP2A 3G6JE 3VWKD 1J8KA 3OKNB 4WJ5B 5AUMB 3QCUL 2A9MH 4XPBL 3SKNB 2GT9A 3AAZB 4GRLD 1FZMA 2V2TA 3RKPA 1SEBA 3QISA 4NFBA 1DLFH 3Q6GH 4E42B 4NSKB 3L3HB 5TPWL 3MNVB 3KXFA 4XNQB 1LQVA 1YYMH 2R23B 2VQ1A 3LMJL 1A2YA 1A47A 4PJFB 5KZCB 3TO4A 5DYOA 4DGIL 3TV3L 3CDGA 1A4KB 5ACZB 3LEVL 1NGQL 1Y6MR 4W6XB 4WUKH 3JWDH 5SWSB 1DBBH 1GAFH 1Q9KA 3OG6B 3WFBH 1N59B 1MCEA 1OM3L 4CADB 1CXEA 4JG1L 2YA2A 1CE6A 3GHBH 4H8WL 1FNSH 3LN4B 3TIDA 2B2XL 2R4SH 1IM3B 2XPGA 4N8PA 5KS9E 4WU5A 1T3FA 5SV4A 4DVBB 1MUJB 4PJXF 2LQRA 4NJAL 5CBEA 1LP9B 4RISL 4JFOA 4LSRH 3IXTB 3FO2A 3SDCA 3DX8A 5D72L 3FQXA 2GJJA 4CUCA 3VJ6A 3OSKA 3B4NA 1Q9WB 2UWEE 5DQDL 4HCRH 1JTOA 3DROA 2HN7B 4MYWB 2NY2C 4RNRB 1ZXQA 4LCIH 4UV4H 4N1CA 1YNLL 4U1JA 2VN4A 2DM7A 4O51B 5MI0B 4PJ5D 4C58B 2VDLL 5E8PA 2QL1A 3BVNA 1LD9A 1JFQH 1HI6B 2Q6WA 3VWKA 5KSAB 4H25B 4RDQF 1M7XA 2UY7A 3QQ4B 1KB5L 4WWKD 3RL2B 4JRXD 3ZE2E 4G42A 3WN5A 1Q9OB 1FRGH 3ARDB 5F9AC 2AABL 3IS1X 4GRLA 1CLYL 4XT1C 3VH8B 4X6CB 4U1KA 1E4JA 1IQWL 5I1EH 1RHFA 2C5DC 4AT6A 5CBAA 1MCHA 4XPFH 1TJHH 3KLHD 2EYSA 4QTHA 1BJ1H 3NZHH 4L3CB 4UU9A 4HBCL 5FYKH 3WS3A 2R69L 4EDWL 1RURH 3DTXB 3E1F1 3OHXB 1CGUA 2C3XA 2P8MA 5JLZA 3IFNH 4BYHA 1PLGH 1CTOA 1U8IB 1EEYA 3OKDB 1NCAH 1K3ZA 3HNVH 1MEXL 2FSEA 1JPTH 1N0LA 3MV9E 3MUGB 3RVTD 2YRPA 5CEZL 5B39B 2BY2A 4PD4K 3L6FB 3AS3A 4WCYL 4QY8B 1JZ2A 5SWZB 4GW4A 2OSLB 3BGAA 4XP4L 1C1EH 1FL5B 3T1FA 1YUHA 1G7IB 5DUBA 3RY6A 3ZDZF 3RTQB 4CNIB 4L4TE 4P23C 2AI0H 1RZ7L 1WBXA 1S5HA 2DL9A 1YECL 2ATPB 4NO3A 3OG4B 3F7VA 3QQ3A 3S9DB 5KSAC 5E5RB 1QFPA 5D71H 1G1CA 5F89B 3T8XB 4PR5A 4V1DE 3I6KA 4RZCB 3CFIC 4HWEL 3I9GH 3ARDC 4YWGL 3HE7D 4QRQA 4WGVB 1XMWA 1PVHA 4G8IB 4QHLA 4BZYA 4LRNL 2CKBH 3MCG1 4N8VA 4PJ5A 3GSVB 2ADFL 4YXHH 3KPSD 5DWUL 3QUZB 2N7AA 3ESVF 3U7WH 4JVUA 1G7PA 1E6OH 5JW5B 4YHLL 1EDQA 1MNUL 4WWKA 4JRXA 4PBVC 2AJXH 5IM7A 1AR2A 2J5LC 1L7TH 3FCTA 3HLAB 1G0YR 2I27N 1YEHH 2AXGB 3HNTH 1KIPA 3MFFB 5IK3B 3MRIA 4HWUA 1F4HA 2ZUQB 2JJTA 4IBLT 4UOW1 1K4CA 1RZFH 3C09B 1GPOH 1DQDH 4OIIH 5EWIH 1AHWA 4J1UB 4FQHB 4MS8C 4G6FD 1P69B 2X1OA 3GMPA 2NW2A 1GZQB 1NMAL 5D8JH 1V05A 1UWEH 3FN3A 4JB9H 4X6FA 15C8L 5MERB 4HJ0D 4MDJB 3E8UL 3BGFC 2E6PA 5HI3C 4CU7A 5C09D 3PP3H 1MIML 1R0AH 4POUB 3RAJL 3MCKA 1JPGA 3PV6B 3T65B 2IPKA 4AJ0A 4K7PH 3NFPA 2WP3O 1RUPL 2HJLA 2RQ8A 5FECB 2QHRL 3BD5A 1QPPA 2W07A 1YEIH 4AQOA 4FG6D 2BNUB 4L3EE 3QUZC 2AJUL 2W65A 1TJGH 4YDIL 4M7ZB 2NLJA 3GIZL 4XAKE 4IOFD 4QNPF 4JRYB 5MP6L 2NY6C 2EC8A 2ZCLL 4PG2C 3W0WD 5I1CL 3OMZA 1A5FL 3HE7A 4XC3L 4Q9CA 4HIHA 3OPZH 3ARED 1A6ZB 3C09C 3PWUA 5IF0A 3Q3GB 1T1ZB 3MV9D 3MPCA 4B7IA 3B9KD 3R0NA 1HDMB 2P24B 3KPSA 4K8RL 1NCCL 5GSRA 5IROA 4WRLA 4LEOA 4JKWA 4KK6D 3LPFA 5F9OL 1OGTA 1JGUL 3CK0L 4HT1L 2V2XA 1CFTA 1MI5E 5I1JL 5DTFB 4XPTH 5DEZA 4E41B 4R26H 3D69A 5CD5D 3C60D 2AS5M 3QUKA 4OZ4B 1MLBA 3SDXB 3MOBH 4EIZC 4LQFL 1A7NH 1G6RA 2VQTA 3QNXA 2UZXB 1KPVB 4V1DD 1U2HA 4S1QL 5C0JA 3S97C 1R3KA 3IFLL 4OCYH 3LOWA 5FO9A 4JVPA 1T66D 4YPJA 3LKQA 1U8OA 3U7AA 3RZCB 4BKLB 3K74B 2X1PA 5FAAA 5J4MA 3SQOH 4K8RD 1OAYH 3DMMC 2GJZB 3BO8A 5BQ7B 3MJ7A 4KVNH 4PGCA 1FCCA 5C09A 2Q86A 3MUJA 3VFSB 2FJHA 3CVIL 5FXCH 3MRQB 1NCNA 3F6LA 1BD2E 2WINB 3QG7L 5FGBC 3KPLA 3O2VL 1CFBA 1FH5H 4JR9H 5T1KD 1BZ9B 5EOTB 4OM1L 4XZUA 4G9DA 5L8JB 2HMID 2CD0A 4PJ9C 5HHOB 5I8CB 5DZLA 3QO0B 4UQ3B 5T3XH 3BX7C 4ODHL 2IBBA 3KPRB 4U6HB 2GCYB 3IKCA 3SY0B 2J4WH 4PJ7A 1AR1C 2Z8RA 4LHUB 4YNYA 5I66A 3N1MC 4XCFH 3WLWD 4KJPD 5KSBE 3W0WA 3IDJA 4XRCB 4DEPC 5BRZB 4PGZA 5LQBH 5KVMC 3AREA 2R8SH 2IPTH 2Z35B 4GMTH 5D7LD 1HXYA 2ZNXA 2EE6A 4OCLC 2G75B 3MV9A 3NGBB 4M9OA 2CR6A 3B9KA 4K3JL 1CFQA 1ZE3C 1NFDB 3LH2H 5HHMD 4D9QE 2XY2A 4F33B 4QYOA 4PLJC 4MZ2A 2X05A 1KV3A 4HH9A 3D18A 4F80A 5H37H 3RZCC 1ES0A 3GI9H 4F9PC 3CPLB 2P5EB 4HFUL 3C60A 4WFFD 3BZFA 5IQ9A 3T2NL 5F3BB 1G7JA 1C16A 4V1DA 2DQDH 1TMCA 1HWHB 4ERSH 4TVPE 4YDVA 3DRTA 3CDYA 2FGZA 2I07A 1NC2B 2MCPH 1QZ1A 2IADB 3GIVB 1DBAL 4JM2F 2GK0B 2L4OA 4CMMB 2Z92A 3ES6A 2EDKA 4ZUSA 3X12B 2B5IC 1R5IB 4OCMC 5IW1B 4MJ2A 4PJCA 1A3QA 1B4JL 1WIUA 2R9HC 3GUTB 2UYLB 3BP6A 1NLBH 3IF1A 2C4FT 3LD8C 4KMTH 1SQ2N 4NQTA 5D7IA 5T1KA 1MRFL 1A6WH 2NY0C 4GRWF 1BOGB 3P9MA 3WIFB 3S36L 4NN7C 4G5ZH 1MWAH 3VGFA 3BJLA 2JJWA 1FVCA 4KUZH 5L6YH 1K2DB 1LO3L 1KULA 3NGBC 1JWMA 2X89D 3MRDB 1MCRA 2QSQA 5ETUB 2J6EA 3HI1B 4QRRB 5A16A 2GY5A 4HUMB 2FECL 2AXFA 2XTJD 4ELME 5IJVA 4BH8A 5DJ6A 2EDOA 4YO0B 5LAXA 3OKKA 1AGFA 1S7XA 1SJEB 4J2XA 4KJYA 2WK2A 4NC1C 2F19L 3UJJH 3DNKA 1J0YA 3G5VA 3QIBD 4NO5A 1EGJL 5D7LA 1KJ2L 5J1SC 3KYOA 3D9AH 2YD7A 5D1XB 5IP4A 3BQUB 4XX1G 2NXYC 5MEPA 2IANB 4EUPG 5HHMA 3U48A 1EH9A 4HS8L 4OAWA 1JGVH 4S2SA 2C3GA 3LEYH 1EO8H 4G8GE 5DMIL 2Y23A 2ZUXA 2ESVD 3F6IA 4U4BA 5D5ME 3H7BA 1MLCB 2CKBB 4UILL 3MMEB 5DJDA 2N4IA 1VFAB 1G9MH 4U1HA 4PLNC 2I26N 5EC1A 4M8VA 3DVNB 4X6DB 2QADD 2XKSA 3CFJB 1E27A 1FL6B 1A21A 5HI5C 2VC2H 3GMNA 5EUKB 1TETL 3DV4A 4GSDH 4KKNA 3DSFL 3E3QA 3TT3H 4G8FB 3L7FB 5C08B 4H0GA 4NQEB 3ALPA 2GTZB 1YNKH 4DGVH 3LPGA 3CZFB 5BO1L 2ITDA 3G6AA 4K3DH 4HH8A 1F90L 4EDXA 5ISZE 1OAKH 5C0RH 3OR6B 3S34L 4GBXD 3OXSA 1F13A 3QPQC 3D25A 1EERB 3MROA 1T83C 5J9PB 5FGCE 1KCGC 1QHOA 1IC7L 1ZVHA 1JGEB 2X89A 3FAWA 5D1XC 4M6NH 3ZDYF 3CU7A 4AEIH 1EJ6A 4YHNA 1I7ZA 4PV8A 4NKIL 4U1LA 3QEHB 5TE7H 4MNGA 1T03H 1KB9K 1TQBC 3S35H 4N5UA 4TVSa 1S7UA 5GZNC 3SCMB 4LK4A 4LVOC 3IJSA 3QA3A 2DF3A 1NJ9A 3QIBA 4F7CB 2X70B 1FV1A 2AV1A 1DFBH 2XN9E 1WZ1L 3KJ4B 1UWXH 1KELL 3WFDL 5F88A 1H3VA 32C2A 4O2EB 2HAZA 4HC1A 5EZLA 3UTQB 2ZOKB 1XCTB 2PNDA 3FOMA 1DQQA 2XQYG 4TRPH 1CFNA 1WAAE 3RVUD 1YZZA 1U8KB 4KXZI 4RGNB 3TO2B 4JN1H 2AV7A 4ZFFA 2ESVA 3VD4A 1OD9A 2APTA 5C6WH 2FRGP 1FGNL 1IL1A 3KDMB 5JPNB 1UXSA 1P9MA 5BXFB 4PBWD 4JO4H 1DUYA 3HMXL 4PJBF 1J0ZA 3GMLA 2VZ3A 5CSZB 5A2IH 2D7NA 3RHWF 1EGJA 1KJ2A 5IMOA 4XNXL 1RIVH 4PJAF 3VA2C 2FZ3A 2MQ0A 4HK3N 2KKQA 4JPVH 3VFOA 2XWBA 1UM6L 4LPYA 1DSFL 5JZ7C 1AO7D 1EV2E 3F65A 4LSQH 1VKXA 1ZHLA 4GBXA 1MJ8H 1F42A 1JPSL 1F6LL 3EDDA 4WNQB 4DKEL 1N6QL 1TZIB 4M48L 2DOCA 1KGCD 3T0EE 3CLEH 3FN0H 1EIBA 1OTSC 4C57C 1UEYA 3KJ4C 5D2LA 2Z91B 3L5IA 1CK0H 5DHYA 4OLVL 1FIGH 5BCAA 1S9WA 4N0UA 1A6VL 1IARB 2CMRH 4ONHB 4ZXBB 2Q7YB 3L3JA 5EOCL 3BDYL 1CVSC 4RGNC 3CMOL 4YHML 4NNXA 4LARL 5DSCA 4MA7L 2O5XL 1Q0XH 2X4QB 2IEPA 5HI4C 5F7UA 1OVZA 2Q87A 5DJ2B 5DHVA 2V5TA 1PZ5B 1J87A 4DWHA 2IFFH 3GSNH 4L4JA 2A77L 3I50L 4U3HA 4MD0B 5TQ0L 2BNQD 3K8LA 2AEPL 4U6XB 3PQYE 1OAUH 2X10A 4P5TD 2APVA 4JPWL 3ZTJH 5JMRA 3CX2A 3HRZB 4WO4B 2YR3A 5C0ND 3DVIA 2I9TB 4H0HB 1VFBA 1W2KT 3V0WH 4X6BB 1ZMYA 3RVXC 1C12B 4Z7QF 5E5UB 5FOBA 4W70A 4CVXB 5IKCA 3P4NA 4Z7NF 3NZ8A 1I9IH 1RJCA 4ETQB 5T5FL 1GGTA 4LVHC 2AJSL 1FG2B 4IOIA 3WE6A 4AY0A 1A3RL 5ECJE 3S35X 2UV3A 2P45B 5DD1H 1ETZA 2FGWL 4IDJL 1JYWA 2HKFL 3K8MA 4N8VG 4D9LL 1MQKH 3WL9B 4NBZB 4UTBH 3C5ZD 4U33A 1V7MH 2GIYA 5CIPA 1T22B 1AO7A 4MXQD 3OGCA 7FABH 2X1WL 3IDNB 1U92A 2UVEA 3HA0A 1HE7A 1AC6A 5IIEA 3MGTA 3Q48A 2H6PB 2GHWB 2DQFA 4OZHE 1IC4L 2HLAB 4HKBB 3D39B 1NKRA 2D2OA 5JR1L 3QUXB 5CJXC 2YA1A 1VGKB 4LNRB 3RVWD 1RUKH 2WWMD 1M05A 3JTSA 3B3IA 3DBXB 1ZHKA 1LEIB 1CBVH 2YSSB 4BZ2H 1T1WA 4NHUB 4IS6B 4L8SB 3LQAH 1TITA 4GAFB 4HJGB 3WSQH 5BVPH 1F5WA 3W39A 3PABB 1EVTC 3UBXB 4I1NB 1YMMD 4QXTB 4P4KB 1WWWX 1IAOA 1QQDA 3FFCD 2FBOJ 4FNLH 5J7CC 4P3DB 4P2RB 4TUOA 4XMKH 3UCRA 3V0VB 4O02H 3NPZB 2BNQA 4MJIB 3UJTH 1CFVL 4P5TA 1TZHB 3BDBA 1T04B 2B0SL 3ARXA 1RPQA 3ZHKA 3OAZH 5IB4A 1SYVA 3QXTA 1EEUA 2JCCB 4DFHA 3P9LB 1HEZA 1RZKH 1WBYA 4WFED 5C0CD 2V5YA 1R5VB 4UAOB 4OSUL 3ARBB 1HSBB 1QSED 3FKUS 3VMOA 3WFHA 4GQ9H 1CU4H 1UM5L 3QUXC 2YA0A 1TXKA 3NA9H 1S7WB 2B8OT 5JDSA 4JM4H 3MRBB 3MLTB 3R06B 4NUJA 5C0BB 5T1DL 5IB3B 2GSGB 2VIRB 3C5ZA 1FYTD 1S9VB 1UB5A 4MXQA 4WHTB 2B1HH 3C6LB 2XG4A 3JUZA 4R2GD 3FQRB 1C08A 2DMCA 1XGTA 3FQTA 4F3FB 3BWAB 5C9JA 2P48B 1MCPL 1R3HB 2PTUA 4YDLB 4Z7WB 4MNHB 2YK1L 4P4KC 1PEZA 2A38A 2FECI 3MLXL 3TBYB 1W72A 2HT2D 3AM8A 3GMMB 4ODTL 1AGBA 2C4XA 3SDDC 1DQMH 2ARJB 3ROOA 2EICA 2FX8L 1WC7A 1S78D 2KBGA 5T33L 5EN2B 3CAFA 5I1DA 2F5BH 5DRZB 4Q2ZB 4DGYH 5I19H 2HWZH 4UTAH 2BSRA 2YUWA 1UCBL 1WISA 1YMMA 3MBXH 4R90H 5AEAA 1BVKB 1XZ0B 1IEBA 2DQGH 4RIRA 3NIFE 4CGTA 4PJFE 3FFCA 5DQJA 4GRWH 3TCLA 1H0DB 1OPGL 3MLZH 5EFIB 3W82A 3O3EB 4KK5D 2QQLL 4MXWL 3WKML 1BZ7A 1G9MC 1S9YB 5SWSE 4FQQB 3WKNA 3STBA 4OD1L 4CW1B 1NCDL 1XGYH 1QLFB 1DQJA 5E8DH 4GKZB 3VD7A 3HZMA 5DD5H 1FFOB 3WJJA 4C56B 4G6AD 1CDCA 3C6LC 5JW3L 3MV7D 1NBVH 3WFCL 1WF5A 4RMUA 5C0CA 1ADQH 2P8LA 4YHIB 2LVCA 1GOGA 4HPYL 3EYQC 1QSEA 4WI8A 2F53D 1HWGB 2H1PH 1KT2B 4YDLC 4GAGL 3CC5B 5EO0B 4CN1A 3AU1A 1LP9E 3TBWA 1HNGA 4V2CB 4N9GA 4QXUH 4ZMAT 5E9DB 3ULUF 5I74B 1FJ1B 3QXAA 2NY4C 1AI1L 4WGWB 1FYTA 1J88A 2VLJD 2BOBB 3SJVE 1HHIB 1PJ9A 1MJJB 4PB0H 4MA8L 1V7NH 4J3SA 1NGZB 2PW1A 3MXVL 2G2RB 3ECBB 1OQXA 3GRWL 3C8KA 5IHZB 1ORSB 2BCKA 3L3OB 1OTUD 4DTGL 5C7XL 4LFHD 6CGTA 1U3ZA 4Q6YA 4X6CE 2ICCA 1OY3B 2OQJB 4JGMA 4M1DH 5FYLE 4JG0L 2HA1A 5JPMA 1UH2A 4Q6IA 1IEAA 1IGMH 1R3IH 1MFCH 2CUMA 4GLRH 5CD3B 1U6AH 2Y4SA 4GKOA 5LXGH 2XI9A 3BPLB 3IU4L 4I9WE 4LCWD 2XV6B 1NMCB 3KWWA 5ENWA 1A7OL 1I9RH 1PX4A 3O8XB 3GJFH 1OOAA 4JN2A 3RIAF 4FQ1L 1WIPA 5HHXL 4PP2B 4V2BA 4Z9KB 3FT2B 4HPOH 4PJDF 5SWZE 3O11A 1JL8A 4WU7A 5GRYA 3MV7A 1S7QB 3KNBA 4O4YH 2QEJA 5INDB 4FTVE 5HY9B 1KCVH 2F53A 3QAZB 4KKLD 1I3GL 3L5JA 2DLFL 3HPJB 4GUPB 4NHCL 1JV5A 2R15A 1JRHH 2E7CA 2C26A 4GT7A 1FN4A 2XZAL 1IGCH 3DI2B 3U79A 2XOTA 4XGZA 5EZIL 1SMAA 4XVTH 3ILPA 3T2OA 4YAQA 4R7NB 1MCOL 3WHE0 5CP7B 1PSKH 4NUGH 4YBQC 3F5WB 3CH1B 5C1MB 3HI6H 2VLJA 2FR4B 3RWEA 2YRLA 3QDAA 2NY5L 2VXTL 3ARQA 5DT1H 2WZPD 4WI6A 3BP7A 3SOBL 4UT7H 4Y8AA 4FQXC 2K3TA 3STZB 1NFIA 5FDWB 5DURB 5HPMB 5JW4Q 3IJHB 3IDMA 5SWQA 4Z7VE 2CRMA 3BPLC 4PRPD 4D0CB 4Y89A 3HUJB 4ORZC 4ESKA 1JMZA 1FCGA 5CMAB 4BA8A 2Q20A 3OKMA 1KFAL 43C9B 1EEQA 4UINL 1S7TA 4NQSB 3VE0B 4YUEL 1U3JA 3CFEA 3NIDF 2EH8L 1P4BH 1EHLH 1H8SA 2NY7H 3KPMB 3PHQA 2VDRL 1YYLH 3TA3B 4DAGL 4I3RH 4LSTL 1E4XL 5ICXB 5D7KD 3LRSB 2AJYL 4JDTH 5HYIA 3RPIA 1H9VA 2IQ9H 2OTUA 3QAZC 4LCWA 4LCUA 5L88H 4XMLL 4LIQE 2AGJL 4OCWH 5T1LB 1NKOA 1N8ZA 1Z9MA 1YEJL 1WT5C 5MENE 5I1KL 3OGOE 3WXVL 1RUAH 4OUUB 1D5MA 4LLQA 3WNOA 4Y8DC 3OKNA 1EBPA 4WJ5A 4HFWB 1BZQK 4X99B 5ESVB 2DQTH 4X7SH 3OAYK 5I18H 5JHLL 1E6JH 3FB6A 1XF3B 1RZIB 2ZKHH 3PP4H 4JO3L 3ZO0A 4U6YB 3JTTB 2FHBA 2NCMA 3X17A 4JRYE 3WXWL 3S37L 3HC4H 5FM5M 4GQPH 1I7RA 4CVZB 3LIZL 1CFSB 2VMFA 4FFZH 4LPTA 4MJ4A 2RHEA 1ZLVH 2YPVH 2MMXA 4H88H 1U8HB 2CKNA 3TA3C 5B8CA 1N59A 4JFPA 5DEGB 1D6EB 5BW7A 4IRSD 1MCWW 3HZVA 1BJMA 2XXCB 5SWZD 4KWUA 4PRPA 3ARRA 1QRNB 3LN4A 4NNPH 3LQAC 3RTQD 5KVFH 4BZ1H 2VO5A 4E41E 4OZGE 3SDXE 5KJRL 1FE8L 1CGYA 4FQ2H 4ODUA 2C9AA 1Q9LA 2ZZUT 1HXMA 5HGDB 2VISA 2B4CH 2WUCL 2ADIB 4EEEA 3D3VB 5EBWB 4OV6F 3V52L 3D0LB 1Q9WA 3V5KA 3UO1H 1DL7H 4JM2B 2HN7A 4EVNB 2VE6A 1QR1A 2YPKA 2G60L 5IWLA 5D7JB 4O51A 4X5WB 5IT2L 2IJ0C 1RZKC 2D7OA 4HZLB 3U1SL 5FO8A 2DYPB 3AY4C 4JZJA 1EO7A 1HI6A 4OZFH 2OTWB 2BDNL 3QQ4A 4Y7MA 5EORL 5C3LD 4K2UH 1JGDA 2MQ3A 3G6JF 2GTWB 1Q9OA 4OF6A 5JUEH 1KJVB 4UBDD 4O58H 1KXTB 4JPI