3CC5A

H-2db complex with human gp100
Total Genus 68
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
68
sequence length
276
structure length
276
Chain Sequence
GPHSMRYFETAVSRPGLEEPRYISVGYVDNKEFVRFDSDAENPRYEPRAPWMEQEGPEYWERETQKAKGQEQWFRVSLRNLLGYYNQSAGGSHTLQQMSGCDLGSDWRLLRGYLQFAYEGRDYIALNEDLKTWTAADMAAQITRRKWEQSGAAEHYKAYLEGECVEWLHRYLKNGNATLLRTDSPKAHVTHHPRSKGEVTLRCWALGFYPADITLTWQLNGEELTQDMELVETRPAGDGTFQKWASVVVPLGKEQNYTCRVYHEGLPEPLTLRWEP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Design of agonistic altered peptides for the robust induction of CTL directed towards H-2Db in complex with the melanoma-associated epitope gp100.
pubmed doi rcsb
source organism Mus musculus
molecule tags Immune system
molecule keywords H-2 class I histocompatibility antigen, D-B alpha chain
total genus 68
structure length 276
sequence length 276
chains with identical sequence D
ec nomenclature
pdb deposition date 2008-02-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00129 MHC_I Class I Histocompatibility antigen, domains alpha 1 and 2
A PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3cc5A02
3.30.500.10 Alpha Beta 2-Layer Sandwich Murine Class I Major Histocompatibility Complex, H2-DB; Chain A, domain 1 MHC class I-like antigen recognition-like 3cc5A01
1U8QB 2HJFA 4LCIL 5IVZA 2EKJA 2DD8H 2BNRB 3RY5A 5I66B 5F7UA 2XI9A 2EIZB 5C09A 3HG1A 3H42L 2IANB 1I7UB 5DJAA 2FJGA 5DTFB 2MPAH 4Z95H 3WFCL 3IU3B 5FAAA 3WHXA 2GQHA 3S37L 5SWZA 3CFDA 3ARYA 4JO3H 4OZ4A 5D1ZB 3L5WB 1IILE 3O4LA 4Q9QH 3HMWL 3BAEL 3RZWA 4HWEL 1SM3L 1ADQH 1F3RB 1MHCB 1S7WB 4YDKH 4V1DD 2LU4A 2DQFB 3SDXB 3VE0A 1KSRA 3UEZA 5ADPH 1NGYA 1MPAL 2OZ4A 4ODBD 4XMLL 1FQ9C 1UZ6F 4YPGA 3VXQA 3QG6B 2EXWC 4XPHH 4C56B 1UB6B 1KUMA 2FX7H 4POUB 4ISVB 3RX7A 3KYMA 4ORZC 4PGBA 1MLCA 3F12B 1OSZA 1I3RB 5K9QG 2A9NH 3GNMH 4UUJB 2DQCH 3FFCA 4L5FL 4P2QD 4I77H 4GUPB 1CQKA 1RJLB 1CGSH 3SGKA 2ADGA 3ROLB 3B2VL 3GJFK 3FFCE 3C60C 3ARWA 1QYGL 4RDQF 1GGTA 3B9KC 4UQ3A 2V2TA 2JLLA 4LRIA 4PRNB 5JLZA 1J86A 3RWGA 4WIQA 5D72H 1T7ZA 5IROA 1ZLUK 1M71A 1FL6B 1BEYL 1G7LA 2JELL 3QFJB 1MI5E 4XC1H 1ZEAL 1TMCB 1YECL 3MLUL 5HDQH 5BV7C 1D9KB 3LB6C 4ZAKA 4NFCA 2YD7A 4G6JH 1MJ8L 4OM0L 1TPXB 2A77H 5IWLC 1AIFB 2YS4A 1DANT 2A73B 3UJJL 1U8KB 1VB9A 1W0YT 2F74A 1H5BB 3T2NL 1KPUB 1PY4A 2HJLB 3AREA 3TWCH 1XR8A 2H32A 3CCHA 2F53B 3Q6FA 3Q3GA 4S1QH 4FTVD 1BD2A 4OTXL 5GSRA 4LNVA 1RUKL 5GS0H 3OAZK 4TPRH 5F9OL 1I3GL 4MCZB 4YXLH 4ZUUA 1FIEA 3FQRB 3QFDA 2QSCH 4FQPA 1FVCA 4JGUA 4Z7QF 1OWWA 1R3HB 4M5YL 5JIHA 1MQKL 2UZIL 2WWMD 2IAMA 4TSBH 3HTLX 2ZNWA 5C09E 1EGJA 4MXVF 5EZIH 4RZCB 2W9DL 3QRGL 5BS0E 4ETQA 4EI5C 4FFYL 4PLJC 3GSOA 4U1HA 1KNOA 5BRZE 1K4CB 1I7UA 4Y8AA 1YJDH 5MP6H 5DJDB 1J10A 2NY7L 5D6DC 5CLWA 3O3BB 4PGZA 4XX1G 5LG1A 1NL0L 3RL2B 2R69H 2JCCB 3RWFA 5BRZA 3IYLW 1OSPH 1HK6A 4LEXH 5GIRA 3GEWB 5I16A 3QPXL 4AEIL 3DX8B 2R56L 3KLHC 1JPTH 4F3FA 2WM0A 2Z9TA 3A67L 3NFNA 4OJFL 3VFWA 4YC2C 4DOHE 4PP1C 4HHAB 3MNWB 3LDBB 3PHOB 1WBXA 1T2XA 5D8JL 3ES6A 4EZMA 3SDCB 1KFAH 3MV9B 5KSBE 3MNVB 4OI7A 3U4EA 4UOW1 1A7NH 1I1AB 2G9HB 2M1KA 2E27L 1IFHH 1TJGL 4OLXL 3K46A 1XR9B 3ECBA 1TCMA 3DRQB 4PJFF 3TIDA 3RVUD 2NY4C 5F3BB 3O41B 4CNIB 5HPMA 4D9RD 4ZMAT 4U1LB 3RL1A 1MPAH 2X89A 2IBZX 5C70A 3L3GB 5J0BA 4JO4L 2F54B 3ZYZA 2X4QB 5CWSA 4FP8H 3MBED 4Q0XH 3H42H 3JWDH 1IKFL 1FHGA 2X44D 4P23B 4OLZH 4PLOB 1GXEA 1R3JA 2R56H 4Z7WF 3JBG7 3U1SH 5DUML 5I15H 1JWMB 5H2BB 2Z31A 5E6YA 4NQED 1PG7W 1Z2KA 1CFVL 3DV6B 3U7WH 4QWWC 1JNLH 4XC3H 5HD8C 3LEXA 2CO6B 1YMHB 3NA4A 4EI5A 4DTGH 3G04A 4MSWB 3LHPH 5DDHB 5C71A 3ULVL 3NPSC 2H2PD 3ALPA 2NCMA 3FRUA 5DT1L 4I18C 4OGXH 3OXRB 3BPLB 3IAQA 1OGAD 1IQWH 2C7UA 5FV1L 4BKLB 1RV6X 5ALBH 1JMXA 5I1EH 4FQLL 3DVGB 4GW1A 1N8ZA 4YHPB 2EDTA 3NN8A 2CUMA 4XCFL 5B39G 5IB4B 3MR9A 1NEZB 2C1PA 5IG7B 1JPFB 4NJ9L 2AGJH 1QRNA 1HNGA 3MODH 5D1QD 3QRGH 4LOUC 3ILPA 3TWCL 3VH8B 1CZ8L 3VFPA 3FRPG 4MA7H 5IFJA 3PXJA 5MENA 5I1LA 2ZG2A 3CGTA 4ZOBA 2YPKA 5JHDE 1EA9C 1U8OB 1UXSA 3ARGC 1OAZL 1QSFB 1WISA 4XHQA 1JWUA 3BYTA 4R4BA 4H26A 4FQJL 1Q72H 1G7PA 1YQVH 1MAJA 3TEUA 1NMCB 4LHUB 3G6JB 3BT2H 3GMMB 4LIQL 4Z7QE 3VXMA 5HI4C 3GMQB 1WVZA 3F7VB 4PD4J 2NY0C 3T77A 3IDIB 1XGQB 2DTSA 2A6KB 4YHNB 1NEZA 2C1PB 3DSFH 2A6DA 1HZHL 5IM7B 3QT2A 2GAZA 4PLKD 5DJZB 4PJ7B 4XGZB 1ZVHA 1CGSL 5HYJA 1FZJB 2EDKA 4OGAC 4I77L 1LO4L 4CAGA 5C0RH 4GRLA 2AJYL 4LDLB 1Q9LA 4L4VD 4ZUTB 2A83B 5JMOC 3EJYC 1QSED 2R8SL 3BO8A 3BH9A 3NCYP 5I1HH 4JREC 5CMAB 3WS3B 4HK0B 5DI8A 5HJ3A 5DEFB 1K5NA 2A74B 1U8JB 3V8CA 1RAMA 4IRSA 2R23B 2W65B 3QI9D 2Z0BA 4AT6B 3EJJX 2GUOA 2DKMA 4KH2A 3VXTB 4RFNC 4LKXB 2NNAB 1G9NL 4BUHA 2OMBA 3GBLA 5IJVA 3DHMA 1DQJA 2Q7YB 3WFDH 1BJ1J 1G9ML 3ALXA 4LSPL 4O51A 2RBLA 4YNYA 1OWRM 3OKDA 4M7JL 3B9VA 4P59H 4BZYA 2AI0L 3BW9A 12E8L 1RZIA 4F9PA 2X4QA 2ILLA 4JFPA 5FCUL 3V0AC 5FYLD 4G8GB 4HS3A 3RL1B 3FO1B 2VZ3A 1AO7D 2FBOJ 3HAEB 4KZDH 2W07A 3BP4A 2J5LB 4NGHL 4X7CC 3TT1L 4HKZA 2R8SH 2AJ3B 1MCRA 3W81A 3VRJA 4WI9A 4LCWE 2FX8L 2XWTB 3PWNB 1FLRH 4LCCC 1EEUA 4U1IA 2G9HA 4JO1L 1JZ2A 1T5XA 1MFEL 4Y4FA 5DVNA 4HWZA 4OQ1A 2XICA 3R8QA 3HPLB 3QEGH 5GGVY 5T1LB 3SDCA 1BX2A 1UC6A 3O8XD 3AY4C 1QG3A 3QHFH 5IVXE 2EIBA 1D5BB 2MKWA 4HFUH 3B9EA 3DECA 5E4IA 2HVJA 4HWBA 3Q1SL 5E9DE 3I3EA 4MDIA 4JKLA 1I75A 2YD5A 5EO1B 3C5ZC 2CK2A 1IEAB 4LPYA 5F1NB 5MENE 1OAZH 1QSZA 4FTVB 1QACA 1MOEA 4MJID 5IFAH 3KPMA 4YUEH 5EUOA 2G5BB 3RY4A 4OCYH 1KJVB 3ZKNC 4O4YH 3VA2C 1A6ZB 1FBIH 4OLYL 1GGIL 5CKAA 5T3ZD 4ONHA 5C0GA 4O00A 1MAMH 1KB5B 5AAMA 3GHEL 5FCSH 3U30B 1RUML 5JOPD 3VG0H 3MO1B 3OKDB 4PJAA 1RZJL 3DV6A 1NBYA 1VACA 3V0VA 1XF5B 1RZGB 1NCDL 4P9HH 4OLEA 4UV7H 4NHUB 2O5XH 5GHWL 4HV8A 5D1XC 1JGVL 5GSRB 1CZ8H 3ALWA 4N9GA 3MJ9L 4RRPG 4AIZB 4QF1A 1RHHB 3U79A 3W39A 3GJEA 4M4RA 1GZQA 1X5ZA 3VG0L 4N0FB 3FONB 3QI9C 3FCTA 4DN4L 4OFYA 3KYAA 4NBYB 5ALCL 4ELME 1F4HA 3VFSA 5K59F 4PYHA 4KTYA 1F3DH 5KSAA 1I1AA 1BLNB 1FZJA 5HGBA 2VQUA 4UQ2B 5D7KE 4WFGD 1D5XA 2GAZB 4LF3A 1TNNA 4J3SA 4UQ3B 4GSDH 3ES6B 1OD9A 2X4PB 4ZS7H 4YHZL 4IDJL 5C0BE 3TCLB 4WO4D 3MBEA 3HS0A 4LSUH 2NW2A 5HYEA 4JR9H 1H0DA 2IPKA 4HK3N 4P2RD 1UM6H 3DX8A 2HT2C 4NPYB 4X4XB 1GIGL 5BRZD 4I48B 4XVSL 3MRMA 1RZ7L 1QLFB 4TNVK 3D3VE 1I7ZB 1E6OL 3MRKA 4NWTL 3F7YB 1BQHG 5I1LB 3V6ZA 1QFOA 3FB8A 4HXBH 3NCBB 3ILPB 4M48L 2AK1H 1QD0A 1ZGLB 4B7IA 5B3NA 2YSSA 4NNYA 1QNZH 3EYOB 3IDYB 2FH8A 3D18B 2EEDA 1S9WA 3WNNA 4NC2B 2QADB 3MRLB 5HHMA 1J88A 3C5ZD 4G5ZL 5BQ7B 3FT3B 3R4DA 3OXRA 4X5WB 1PKQE 2NLJB 5C0AA 4F9LA 4M7KH 4DZ8B 1QLRA 1BFTA 1C08B 5FGCB 4FRWA 2FSEA 5HY9A 2DTML 1JHKH 1SYSB 1QOKA 1NCWH 1KCSH 2YK1L 1DEEB 1N5YH 3NTCL 3GIVB 3QUYA 3A67H 4OJFH 4YE4H 4QHLA 1GYAA 3LEXB 2LTQB 3I75B 4M4PA 1FORL 1DL7L 1RURH 4OFVA 5HD8D 5F1IB 2B1AL 1P7KA 2Q1EA 3D6GA 1U8NA 1MCHA 1AJ7H 3UYPA 5DC4B 4P57B 1MRDH 2FRGP 2OQJB 5EU4B 1FC1A 3ARDC 4NQVA 4YEEA 3DMMD 1T21B 3LRGA 2KPNA 1IKNC 4QOKB 1IC4L 1R6VA 4WW2F 4K9EH 5EZIL 2HN7A 2EDLA 1DSFL 2YA0A 1DFBH 3FOLB 2LAAA 5CZVL 4RCAA 1YZZA 2A77L 4UTAH 4KQ3H 1NAMA 4TUJA 1TZHB 3TNNA 4NQSA 1MCJA 4OD3L 1C7SA 4PRHA 4V3DB 1HKLL 1NUDA 3S96A 4C57C 3GMNB 3R0MA 4JM2B 2X09A 2WIIA 5DS8B 4C56A 4P2CG 1OAYL 4DQOH 2D0HA 2VLMD 5ANMB 3QDJB 2ZG3A 5HHNA 5JW4M 5TQ0L 5EBLB 4FG6C 4PP1D 5FO9B 1GGUA 3KYKL 3GJEB 4LVEA 2FECI 3TN0C 2FX9H 3UZVB 1Z9OA 5I74C 3KJ6H 4UIMA 5IHUL 1EAPB 1QP1A 2OM5A 3WLWC 1BLNA 3WV0A 1BZ9A 3JV0A 2EYRB 4ODVL 4UINL 2EE2A 2NQCA 4OB5H 5I6XB 1JZ8A 1HHJA 2X5PA 5JXAL 1G6RA 4S0UC 1ZV5A 2IFFL 2UZYB 5C2UB 1CT8B 2DDQH 3ARGD 4HGMA 1MHHB 3ARVA 4XP4H 5CJBA 5GPRA 2X4RA 1GGBL 3QIBD 4U1GC 5MEQA 4PRDB 1G6RH 4N9GB 1MIEH 1IEBB 1ZHKB 7CGTA 3DXAB 4PB9H 5GS0C 1SVZA 4Q9BA 4FTVA 3STLA 5HDBF 4Q6IB 1NAKH 5TDNB 1QEWA 1QVOB 2AABL 4JZNB 4ONFL 3HMWH 1REIA 3RWHB 3VW3L 1P7QA 3SDDA 3ZHLA 5EO1A 2LU3A 1NBYB 1VACB 3THMH 3V0VB 5D1QB 3WNMA 1MCWM 3CFJB 3MJ6A 3WIFB 1A3LH 3MFFB 3BZEA 1WZ1L 3CLEH 3ZKXC 3MACH 4PRID 1D5BA 4JM4L 1JZ6A 1JNHA 1UYWH 2ADJA 2ED8A 3PJSB 4G9FE 3MRNB 1NFIA 3QFJE 5TE7H 1IMHC 5FFLA 4GKNA 4JQIH 3QNYB 1FZKA 3ZDXE 3K3QA 1OQXA 5EO0A 1BOYA 3RZCB 4HFWA 4RAVA 3BIAX 3GRWH 2YPVL 3QFJA 4R7DA 1TITA 4NZJA 1H9VA 5H35A 2F8VA 4ZTOH 1FGVL 4F57H 2BCKA 2BVOA 5LCVH 3VMNA 1RJLA 1SBBA 3MGAA 4H8WC 1DQDL 2GHWB 4XCFH 3IDXH 1S7TA 3G6JF 2GJ6E 4U1JA 1NMAH 3U0PA 4NRXB 5J8OA 1GHFH 3VFRA 3LV3A 2BMKA 1INDL 5HHOA 1VCAA 3IDNA 3EBAA 2D7PA 2P45B 4JLRA 3S5LB 2NY3C 5E2WL 5D2NB 5DVLA 5D7JC 1CWVA 3TH2T 2B0SL 4NZUL 1ZTXH 4FZEH 4GW5B 2IALB 4I2XB 3PDDA 2VXSL 1ZLVH 1RD6A 4LAQH 4XMPH 2QLVB 5D1XA 2AV1B 3T65B 3V5KB 1JPGB 1MEXL 1OAQH 5D7JA 2EKSB 4UT7L 3MV7A 1OB1B 4YAQB 4YNYB 2Z35A 4QXGH 5F7MC 1TIUA 4JFZH 3O4LB 1BBJB 1UWEH 2UV3A 3SEPA 4PBWD 5KJRL 4DCQB 4ZO7A 1NGQL 4GJTB 3O3AB 2OR9L 1PDKA 3EOAA 4MA8L 4JO4H 4DKEL 3RX8A 3UTQA 1IC7L 3HI6H 1S7VA 4OM1L 1HKFA 2R2EB 3PDOA 3PWPA 1CLOL 2VLJA 3O9WB 1Q9OA 5EBWA 2OL3H 1MWAB 4JKMA 1A7PL 2DLHA 1W72A 3KPNB 1URLA 4YO0A 1V3KA 3CVHH 4N90E 1YPZF 1MCOH 1QSEE 2C4FT 5IM7A 1U36A 4N0YH 3LN4B 3VXRB 1S7XB 5TDOB 3DX7B 5DSCA 4HH9A 3KPSE 2B4CH 1DQLL 8FABA 5I1CL 2EDHA 1AKJB 1B6DA 4NQVB 1K4DB 3MRJA 4XNXL 4ZS6C 4ONFH 4OB5L 2FX8H 3QEUB 1I8MA 3QEQE 4Y4KA 3RA7H 2DMCA 4C54A 3PDOB 5KAQG 3WE6A 5C0ND 4WU5A 3ESUF 2FO4B 2VLRE 4TTDD 4M1GH 4MNQA 4KQ4L 3OF6A 1C5CL 1X5LA 1T22B 3RTQB 1TNMA 5SWSA 1CD8A 1E0OB 2QTEA 1SYSA 3QJFA 3VXSD 4P59L 2Y7QA 1NCTA 3H2WA 1OGAB 4JVWA 1YEHH 5IJKC 4OQTH 1C08A 4JVUA 3IFNL 2APBA 4X5WA 3OMZA 4F7MB 4F37F 3EO9H 3PF2A 3LKNA 1FV1B 1HHIA 2L0DA 4LHUG 5LXGH 2AK4B 4PREA 3SN6N 1BECA 3SO5A 1GGIH 4NNYB 3P3YA 5GS1A 2KQNA 1Q1JH 5BCAA 4HJJL 4UT9L 4NDMA 2IALA 1YMHA 1A6UH 4I2XA 2GK0B 5HHMD 3S37H 5J11C 1Y0LA 5D2NA 5C0CB 3ULUC 1G6RB 3M07A 1F90H 3HUJE 3BJ91 4HJGA 3U83A 4TN9A 2W60A 3I6LD 5E8NA 2WY3A 1FAIL 4YH6A 4IHOB 1Z0NA 3RVVD 4XP6H 3UO1L 5LQBL 4GAYB 1S9KC 2ZPKH 4JFOA 4P23A 5F3HA 1MCCA 1H3XA 4NPYA 1T2QH 4XPBL 4WW1A 3FFDB 1KJ3H 1S9XA 4Y5XC 2DL9A 1GL4B 3PHOA 2IPKB 2NY1D 3L3GA 5HHNB 3VFWB 5L2JA 1MFEH 1MAKA 1TVHA 3JV6B 1LEGB 4Y0GA 1BPVA 3GBML 5IHZB 3RVTD 1A5FL 4F2MA 3C6SA 4GXVH 1FJ1B 4P23C 2DWDA 5KSAB 4NWUL 4Y5VA 1QFUL 3IAGC 4I5BB 1T66D 3BDYL 3ARSA 4R9HA 5EC2A 4FXKA 1P9MC 1NAMB 2DI7A 1J8HB 3I2CH 5GRJL 2DIAA 4BK4A 4ZPTB 2VKXA 4PJ5E 5FM8A 4QEGA 5E2TL 2IAMB 1KF9B 3F7QA 2EIDA 3NFNB 5T5NG 3B5HA 3SE8L 3S9DB 4M8QA 3ULUH 3BZFB 3VFOA 1BBDL 2OR8A 4ZPVB 1AFVL 1QEWB 5F8QC 4MCZA 2BSSA 1OM3H 3REWA 4O2CB 1E6OH 3SJVB 3RWEA 3O3BA 3UPRA 1IEBA 3NFSH 4G8GE 4JANA 1BP3B 3VFUA 4K3HA 5TE6L 5FB8A 5J1AB 3CCHB 5EZJA 3VI3E 2NY5H 2YHGA 1HHGB 1QPPA 1QBBA 5CD5C 3GSNA 2JIXB 1MCSA 1I85A 2F53D 4LCWB 4MJ6B 1AIFA 1QFWL 5L2KE 1R0AL 1IAOA 3MA7B 4NNPH 3BUYA 4DKAA 2BZDA 2H1PL 2EE6A 4KKBD 5HHMB 4HF5L 4UIMB 1IKFH 5EZOH 1CF8H 1KBGL 1TDQA 5IVXB 1GIGH 2D0GA 3AS3A 4ZFFA 5LAXA 3S5LG 1TVHB 3KLSA 5FO9A 1XR8B 3ULVD 3DTXA 4JZOA 5A2IH 4CMMA 4OD1L 3RIAK 5LGHL 3O6FD 5ISZA 4OKDA 5GRZA 2FYYB 5DRNA 4NNXA 1RJYA 4RWYL 3WKNA 1DBBH 4FTVE 1XZ0B 3TBTB 5EH1A 1KT2A 4E5XA 4LNRA 3Q5OA 4NQUA 3QUMH 4RGOL 4IBLT 4JFQA 2X7LB 2VISA 2BVEA 3BMVA 1NMCC 1ZT4A 3TT3H 4IMKC 3TZVD 1ZHNA 4LLDA 3QIUD 2GK0A 2NY5C 5EN2A 2HN7B 3BPOC 4CMMB 1L0XA 4JVPA 4E41D 1JPST 2CMRL 4QOKA 3S3PA 2V2XB 4PFEA 4FQLH 3BZ4A 3G08A 3QUZD 3X3FH 2JJTA 3GSRB 2P5WA 4JPKL 2X4TA 3T3ME 5DT1H 1JK8A 4OF0A 4UV7L 4F7MA 4XP6L 2Y4SA 9CGTA 2WBWB 3R1GL 1UXWA 3HZYB 4HUMB 5C07E 2XPGA 1P4LB 4UTBL 4WV1B 4ELMB 1ZHBB 4N5UA 1TJIL 1FN4B 3AXLB 4OI9A 5FUOH 1MCPH 4IRSB 3MUJA 3QCVL 4U1GB 5LXGL 2CKBL 3BWAB 4YHIA 5D7LA 1R24B 5JA9A 2WUCH 2NMSA 4TUKH 1J1XH 1Q0YH 3MRJB 3MRRB 2F8OA 5SWSE 4OQTL 4C83B 2EC8A 3WXVH 1U8HB 3QCUL 1A47A 1N3NA 1JI2A 2CGRL 3QXDB 2ESVD 2ATKA 1X7QA 5TDOA 1XGQA 4ZTPH 3SDYH 5J6GB 3VXMB 1V5JA 1ZLSL 1BQHA 4LCCB 5CEZL 2BY0A 4FFWC 1MWAA 2A38A 3LRSB 1JHLL 1E6JL 1R5IA 3C6SB 1Q9OB 5BV7H 2OBGA 4I48A 4M5ZH 3GKZA 1T0MB 1LO5A 2HVJB 3TFKC 3VH8A 1X6NA 2DQJL 2QKIA 4JM4H 5ACMA 4MZ3A 43C9A 3QDGB 3T8XB 1VEPA 4PJBB 4LLMA 2AS5M 1DBML 3NZ8A 3ARBB 5F3HB 2OYPA 1G9MC 2HT3C 4L3ED 5I1GH 4Y16A 2CXKA 1UA6L 4U3CA 1UZ6E 1E28B 3MPCA 2C7UB 4TYUA 4JO2L 2FX9L 5E2UL 1XCTA 1CBVL 4QHNA 4PJDE 4K3JL 4DK3A 4YK4C 4X5XA 1FSKC 2GSGB 1GOHA 1A3RH 4HS3B 2MQCA 5FA4A 3V95A 4KRPB 1NC4A 4JJHA 2V7HB 3H6JA 4HZLA 3MOBH 4JQVA 1VERA 1A6PA 3RAJL 2EDYA 3LKNB 1U92A 4NHUA 3P4OA 5T1LD 3KLDA 2YD4A 3CXDL 2JK5B 4PRAA 3X14B 4KK5D 4PJFA 5HYJD 1RSFA 3U0PB 4JFFE 1N59B 1Q0YL 5EA0L 3ZO0A 1JFQL 4I3RH 5JUEL 4PLKC 4UOW0 4KROD 3MV8B 5K9KA 2AXGA 4ONHB 5KVFL 1YPZA 3SE9L 3V4UH 2W65A 3SQOH 1MFAH 5DYOA 4BSWB 3SGDI 4YR6A 4H0IA 1I8IB 4MWFB 3BD3A 4XPTL 2JTDA 2AQ2A 2OI9B 4XC1L 4QRRD 1DBAL 2OK0L 2KL6A 2XN9B 4R6UA 4L4TB 1D5ZB 1PSKH 2IBGA 1G0YR 2VDNH 5D2LF 3EFDL 1DN2A 3B9KA 4PP2A 5DA0B 1U8MB 3B43A 1J11A 2P44B 5C0BA 4J3VA 2VIRA 4KU1A 3RNKA 5GJTH 1J1PL 1ZHLB 5HGHB 4N0UA 1BGXH 2DJSA 3C6LB 5JXED 3CSYA 3HPJB 1L7TL 3LKSB 4X4ZA 3MYZA 1TTGA 3SGJC 3BRGC 2NYYD 3PP4H 1ZT1A 1KN4L 3HMXA 4NC1C 2WMPA 1Z6JT 3H3PL 3O45B 4JRXA 4KHXH 4PJHA 5T5NF 4DGVH 4M03A 1XF4B 4GO6B 1AGEB 3VXPA 3G6DH 5CSGA 1NGPL 3MCG1 1R5WB 4OLVL 3HR5A 4MD5A 3H8NA 3PL6D 1CXFA 3SOBH 5C0JB 3B9KD 1QRNB 4WNQA 1N7ML 4LHQB 5DMKB 1EFXB 2B4CC 4FQIH 4MJ5A 2DLFH 4U6VH 4GXUM 5L6YH 5IB5B 3UCRA 5IQ9B 5I1DA 4FG6D 1CU4H 4E0RA 3R8BB 1BFOB 2ZUSA 32C2A 4KVCH 5E4EC 3NCMA 4K3EH 3VW3H 4MAUH 4XPFH 2I60H 3CXDH 4XCYA 1C5DA 4ENED 4PJGA 4H88L 4RMSA 3C2AL 4XNZC 1YMMA 4Z7OF 3K4DA 4Z0XB 2EDJA 3BPOB 5F7WC 1T20A 3MBEC 4XB8A 4DGYL 4AYFA 3B8SA 2X70A 3VI3F 2WWKT 2OZ4H 2OLDA 4QY8B 1MI5A 2A73A 1IM9A 3TJHD 4QRPA 5K9QI 1CVSC 2ZSWB 3HZYA 2BNQB 1A21A 3HRZA 2BMKB 1IFHL 1IGJA 3MRQB 4HBQA 4TVPH 2X1XR 4Y89A 3F58L 4Z7UE 3U0TB 1U2HA 2ITDA 2YZ8A 5CZXD 1ZLSH 1PEZA 5KS9B 5ETUB 4XZUA 5E5MA 5I8KH 1I1AD 1CGTA 4ZS7L 3L1OH 3HKFA 4KVNL 5GRJH 3BKJL 1RK1A 1K8DB 4UILL 4UIKH 3UYOD 4XP4L 5B3JE 4N8CH 4GUPA 1FDLH 1NEUA 5ICYA 4L3EA 5E1HB 2YEZA 5IBUB 3S3JA 3IJYA 5C0DB 5DK0A 3QPQD 4U05A 1FNSL 1RIHH 1LK3L 4RAVB 3IETB 5L9DL 2YPKB 3X13B 4N8PA 5KSAC 3BDYH 1RFDL 3O6FB 3ZDXF 1RUKH 4NKMA 4O2EA 1J12A 5GS0L 4J3WA 4YHOH 3HE7A 1T89C 5I6XC 3W11D 1UB6A 3DIFB 1J8HD 3EYVA 3VWJB 3WXWL 5EIVA 1A4KA 4KK6D 1INEL 5LVEA 4EQ3A 4JZOB 5T5FL 5B39A 3BP6A 1NGYB 4IRJB 4AQOA 5GGTH 4Z0XA 3DVGA 4GW1B 1CGXA 2N7BA 3SO3B 4G9DB 3BP5B 2HMID 2Z91B 2EH8H 1UZ8B 3RWFB 3B3IB 1HCVA 4X7TA 4HG4J 2H8PB 1K3IA 3DXAA 1ORQA 4JRYD 5ICZA 2ESVA 3L5JA 4JRXE 4PJHE 5DHVH 5DRXA 4UBDD 5MEQB 1KNOB 2ED7A 1MUJB 5DDHA 4HBCH 4HS8L 4JCLA 2YSSB 4Y5YC 2X4RB 3SQOL 1AGBA 5DMGC 3SDCC 1ZGLA 3WHXB 5JDJA 3MRBB 1UQSA 1Q94B 4PGDB 3GMLB 3RWIB 1KELL 1RUAL 1MJ8H 3F7YA 5J12B 1OP3K 1NUGA 1AGEA 4M7KL 5CEYB 3VXPB 2EYRA 1CD1B 3D1MC 4RGNB 3P30L 1T1ZA 1IVLA 1D9KD 3P4MB 4WHTA 4UDUB 2F53A 2F54A 3RKPA 1JGLH 1E27A 4MQTB 5I1IH 2WAHA 4U1LA 2HJLA 3IXAB 3DI3B 2H32H 3T0AA 3LKRA 5CCKH 2IC2A 2F74B 3BUTA 4M7JH 3RNKB 2XTJC 5JHLH 3QEQB 3VFGL 5DRWB 3PQYE 1U8MA 4JG0L 4TNWK 3SDXF 1KENH 2XG5A 3O2VL 5CJ8A 1A14H 4ZO9A 2XZCL 4PRHB 1OARL 2VLRB 2VQTA 2A6JB 4E42B 3U4EB 1H8SA 4F2MB 1W72L 4DUVA 15C8H 1IT9L 1VGEL 3MV9A 5E08H 4LSVL 3AB0B 1QFWH 4YR6B 3MNWA 1D6VH 1G7QB 3FCTB 2J7LA 3Q0HA 3RJDA 2V5RA 4GQ9L 5LGHH 1F42A 2YR3A 4R2GC 1EO5A 2GEEA 3UP1A 5C7XL 3NPSB 2C4XA 2R0KH 4LVOC 4RIRA 3T1WA 1CF8L 1KBGH 2CD0A 2BNQD 4K3EL 4X8JA 4JFOB 5C0RL 1U3HA 2XRAL 2WUBH 4PJFB 1EEYB 1JP5A 3F58H 4BSJA 5L6YL 3KYNA 4JQVC 5BZDA 3BQUA 5FYKE 1T1WA 5ESQA 2R4RH 5ALCH 4M9PA 4MB3A 2UVEA 1AY1L 5DJ6A 3AGVA 3HZMA 3AVEA 3VXOB 15C8L 1IT9H 1R3KA 4I0PC 3ARGB 1U42A 3LEYL 1NPUA 5EU6D 5T3XE 4Y16B 1NCDH 1KB9K 3HC4L 3N0PB 4P5TB 2ICWI 5KZCB 3K2MC 3SOBL 1M05B 1KIRA 3HRPA 5GRUH 1S7QB 1IGYB 3ZKMD 1ZVYA 2EEBA 4OZIA 3FZUD 4MMZC 4DWHA 3DIFA 3CX5J 4QHKJ 5ALBL 4Y2DA 2GFBB 2ZJSH 1U91A 1U9KA 2J1KA 5T1MA 2EDEA 5CJ5A 5I74B 1T66C 3IETA 3PWNA 2IFGA 2BOCA 3T2PA 5MHSE 5J9PB 5KSUB 3TBYB 4OCMC 1CE1H 3CH8A 2QQNL 4NZUH 3VA6A 3GUTB 4FHBD 2ARJQ 3QO0B 1J5OL 3VXRA 1FGNL 3EFFA 4XZUB 3TF7C 1UKSA 2I5YL 3BEVB 3O6KH 1NMAL 4OV5A 2BFVH 2DQUH 4ORGA 1JGEB 1RZJC 5DUPL 5EUKB 2DQIH 2IAND 1RIVL 1T6WA 1J1OH 1HHHB 4FQHB 3O9WA 2AJSH 4OZGA 4ZO6A 3TF7A 4K23H 5GGTL 3WFEL 2ZOLA 1GOFA 4YBLC 2ZCLH 4PS4L 4KAQH 1M7IB 3MBXH 2E7HA 1NLBL 4WGWB 4G80A 1CGUA 3SKOA 1QSFD 2YBRB 3O3AA 5A2LH 3PE9A 4H8WH 5CGYC 2VH5H 1EGJH 2A83A 3BDBA 1W2KT 2QADD 4LASL 4K3JH 3RIFF 1T4KA 1MJJB 2XQYK 5ID0B 1TPXC 3UPAA 4OV5B 1A1MA 2WBKA 2EKSA 1S7SA 2VXQH 2BOBA 5FKAB 4IOFC 3MRHA 2ZUWA 4KK8D 1WEJL 2A6DB 4MNGB 4TQEL 4LIQE 5I8EB 3PHSA 1IGTB 3WIIL 1I9IH 1B90A 5C6WH 4JFDB 5J3HD 5EZLB 4KUZL 4M5ZL 3ZKQD 4K8RD 4LOUD 4X6EA 3MLYL 3UBXA 1A7NL 4MAYA 2PKDA 4DKFH 3OJDA 5FF6A 2ERJB 4JE4B 5DHYA 4ZFGH 5AD0A 1KT2B 5MENB 4F7TB 4HLZG 4JG0H 4HJ0C 4JDTH 3U46B 3F7PC 1EIBA 4R4ND 3OKOA 1WSST 5INCA 2BY2A 1FNEB 1NSNL 1Q9KB 1S7QA 4JB9L 3MR9B 4RRPA 1OTSC 4IRZH 2E7LC 5HVHB 4JY5L 1DE4B 1JF1B 3GI9H 1JUFB 4WUKL 3CZFB 3T0DA 3S37X 3H9HA 3CH1A 4FABH 1EXUB 4NZRH 5FGBC 3UJTL 3PNWA 3KYKH 1KENL 3O2VH 2O5YL 2CQVA 2VL4A 4PJEB 2FHCA 3TBSA 2X4UB 4U1NB 3VGAC 2WBJD 2FGWL 5HVWA 3T0EC 5E7BA 3BEWA 4MS8A 3REVB 2FEEI 3BW9B 2IGFH 4OZFA 3ZLQC 3LEVL 5AUMB 3ZTNH 1A7OL 3BQUB 4P46B 1DVFA 2KDGA 5E2JA 4D3CL 3CDGB 4HLJA 3GIZH 5F7YC 4O51B 2FWOA 3UPRB 4JFED 2K1MA 3HCVA 4XVTH 3WJLA 4K8RL 3EDEA 1ZE3C 1YUHB 1JV5B 3EYFA 3VDCA 4Y19A 2XKNA 4MA7L 4NQCD 3NTCH 3ZE2E 1ERNA 1DBJH 4BFIA 1P9MA 1K5NB 2A74A 4JFDD 2CK0H 3I9GL 4MDJA 4EBQL 3GGWA 2DYPA 2IH1B 4FXKB 3WUWB 4K7PL 1CE1L 1P5VA 1T3FA 3EO9L 4WWKC 3QUZB 2IADA 2VLRA 4AENB 3IJHB 5CKGA 3GJFB 1Z5LA 5KZCD 1I7TB 5DJ0B 1JYWA 1YEHL 1FYTB 2PYFB 4KI5F 3DHJA 5MERA 3IKKA 4QT5A 5JO5B 3LEYH 4OUOA 2KUTA 4QCIB 1D5MB 4UILH 1ORSA 4PJ8B 3NCEB 3VCLA 3C60A 5D7LD 4HF5H 1SBSL 3HE6C 3FFDA 3OKYA 1F58H 1X44A 4LSRL 1A3LL 4CVXB 3QDME 1ZANH 5EOTA 3GMNA 1JWUB 3RVTC 5B4MD 1U3HC 4AENA 5CEYA 3KJ4B 3TNNB 3KNBA 4HIHA 5E0QA 4PYGA 4HC1L 3FQXA 3NIGF 3ZE0F 3G5XA 1GPOH 5FGCE 1U6AL 5CINH 1FYHB 3WO4C 3C09C 1U95A 3MCLL 5CJXA 3IT8D 3UTZB 2EDWA 4Y4HD 4YGVB 3JTSA 2R2BA 1T0PB 2D7OA 4JAMB 1U8LB 1N8ZB 4XT1C 4X99A 1BBDH 2DM3A 4JG1L 4GSDL 5GGUB 2QJDA 2ZCKL 1FL5B 5I1GL 2XIDA 4KI5C 4JM2C 2WSKA 3QCTL 3CZJA 1HEZA 5BS0A 2YUVA 4RWHA 1KG0B 2NY0B 2NY5L 3HI6L 1BM3H 2I07A 3REVA 3BXNA 5A2JH 4CN1A 1UENA 2P5EE 4X7SH 1YYLL 3GSVB 2XN9E 5AZ2H 4XP5L 1MIML 2VXUL 1QR4A 4LLQA 5CLTA 1YEGH 5FYJL 4DZ8A 2CSPA 5E6IC 5IFHH 3MRGA 3WFZA 3L3HA 3GSRA 5GHWH 3PL6C 3S7GA 2YWYA 5IGXL 3EOBA 4OUUB 4GQPH 3NA9H 4KDWA 2ADGB 3ROLA 5A1AA 5HPMB 5SV3A 4XAKD 2DICA 5J06A 4IS6A 4U1MB 5T1DL 3E1F1 1YN7B 3SKJH 1MHEA 4PRPB 2FEDD 1MLCB 3F12A 4BSVA 5IP4A 5EBWB 1UCBH 1XZ0A 2Y1VA 2JJSA 3KS0H 3OGOE 1RJYB 1SY6H 1VHPA 1FNLA 3E8UL 1YEKH 2YC1A 5JNYB 2XYCA 3PIQB 4U2YA 2X70B 1YEIH 4ETYA 2AJXL 5KVFH 4KROC 4YHKH 2F5AH 4M7ZB 2Y06L 4ZFZB 1N5AA 1HH9B 4LVNB 3QZWA 1VGKB 1YEEL 4HBCL 2PW1B 5HGBB 4XBEL 1KGCE 1I7TA 4XCEA 5F9DC 3CU7A 5GRVK 2C3VA 3V6OC 4GS7C 3V6FA 3DXAE 3G5VA 3C5ZA 4OCXL 5E7FA 4NN6B 3CFDB 1V8HA 3SKOB 3O2DH 2B20A 5T1DH 2YMXH 3ULSB 1DUYB 1EEQA 3E6FA 4M9OA 5ESAB 5EOCL 2CIKA 1YYLH 2ZOLB 3D2UA 3EOYG 1JYNA 5EB9A 1KB9J 2ENYA 4Z7UB 4LRNH 4Z7VA 4EN3A 4HKXB 4YHLH 4PJ7F 4YDVA 1RFDH 4P5MA 35C8L 2DBLL 3LKSA 3RHWK 3L1OL 4KQ4H 2D4FA 1PFCA 1FH5H 5IT2H 1J87A 4JPIB 1EDQA 2R29L 3IAPA 5E00B 3GSNH 3D0VB 1Z3GL 4S1RH 4WFHD 4X6DF 1H5BA 2QHRH 1OAUL 3WFCH 2BCKB 2BVOB 4N5EC 1I3UA 2XA3A 3BI9X 5F88B 1RQ5A 3WUWG 4Q6YA 1TTUA 4NUJB 2G5BA 2VABB 4WI5A 1HQRB 5JXAH 1XIWB 5D93C 2D7TL 4DAGL 5EORL 3OL2A 4GRMA 1UA6H 1EXUA 3LB6D 1JN6B 2V9RA 3BSZH 3EOTH 3QR2A 3QYCA 3DUHA 5HVGB 2NXZD 5HHOD 5GS2H 1NFIB 3SDAD 3V6BR 1V3MA 3SDYL 1CIDA 5CILL 3VI4F 4IRSC 4MXQD 2VXQL 3D9AL 3LOWA 1AQKL 3I6KA 3V4PL 1GPOL 1FG2A 5HYSG 5JHDA 3RWHA 1TCRA 1NDMB 2V17H 4JZNA 5E4EB 4GBXD 1OF2B 4MNQD 2DLFL 4WO4A 4CDGC 1EHXA 4MAYB 3O4LE 2G75A 5D7IB 5ICXA 3N9GH 1XGRB 4ZUWB 3VXNA 2HFEA 3ARRA 5EZLA 1XAUA 2HRPH 1MCFA 4KAQL 5FA4B 2ZCLL 4PS4H 4G8GA 5KJRH 4MJ4A 3O6MH 3C2SA 5GQBA 4OBSA 1F3JB 4JFHE 4HIXH 2P8LB 4OLVH 4QRTA 3GRWA 3ZHKA 2RCSH 3IFOB 2OSLB 1BWMA 2Z92B 4PG2C 5EFIB 5FHBH 4L9LA 2NY1C 1NCBL 1O7SA 3V5HA 4OZ4B 1FORH 2OTPA 5EBMA 5I18L 5IW6B 5E03A 3VXTA 4OGXL 3GHBL 3T3PE 3AAZA 3KGRA 4K3DH 4P2OC 5TPWL 4LLUB 2Z4QA 3UTTA 2HMIC 2PR4L 1INDH 3PV7A 4KJWC 3ZKND 3BKML 1G7HB 5DD6B 1MJUL 4L8BA 5GJTL 2IEPA 4WTWA 2CR6A 4O2FA 5DZOA 1UM5L 5DA4A 2DQGL 3WFBL 1MFBH 4FQXB 1WZMA 3KG5A 4LGSB 2J8UE 1DBKH 3QEUA 5EDXA 5ENWB 5I8OL 4W6YB 5TJWK 3EFDH 4HUVA 1WZLA 2ZJSL 3NZHL 2FATH 4KZDL 5F9JB 3UYRL 1TETL 3QHFL 3DUSB 1T7YA 3KR3H 3RKDD 1AI1H 4Y1AA 4PJFE 3TYGH 3TVMB 4W6WB 3FB6B 4P9MH 2VNCA 2Z8VC 3FMGL 3BN3B 2R1WB 2OL3B 1IGMH 1IM3A 2FHFA 2Z31C 3QUMA 3GDBA 3MJ7A 2E7CA 4BZ2L 1UG9A 3ULVC 4C56D 5HBBA 2NY2D 3I75A 3H9SD 1C1EH 3LVEA 1CTNA 3OBAA 4M02A 1JPTL 3FO9A 3T0VA 3PWPE 3ULSA 4JB9H 5HHXH 1KN2L 3AUVA 5EBMB 4PRHD 4A6YB 2J8OA 1II4E 4O58H 3BH8A 3G5VB 2F15A 3WIIH 1M1SA 5IV2A 3VXUD 4QXUL 1E4XL 2E9BA 1U3ZA 2XRAH 2XZCH 4RBPK 3QIBB 4KDVA 5M94B 4BELD 1I8LA 1WC7B 1JPGA 4RMWA 1ZGLP 3GI8H 2W91A 3D18A 3KPRA 1QRND 3Q6GL 4R8WL 5KSBA 4EI5B 3MV7E 4HKBB 2CLVB 4KMTH 5GS2D 2V9TA 4YQXH 3EYVB 3VWJA 4WW2B 1H8OA 2A6IA 4GOSA 4P5KB 3ARPA 4EUPG 3IDNB 4LGRB 5JZ7C 2XXMB 2Z31B 4R90H 2G60L 5H94B 5F89B 2AJSL 1KEGH 5CEZD 1QTYT 1P7HL 1A1NB 1WFOA 1HWGB 4X8JB 2RJMA 4X9FA 3SDAA 1DANU 2N7AA 1WF5A 2GT9A 4JREB 5TQ2H 3N1PC 2CXGA 1K8DA 4ZYKB 4HIIB 4ELKB 1G7QA 2GSIA 4WDIB 5C9KA 5E5MB 2R1YA 3RWJA 1BEYH 4G42B 4JFEB 1CN4A 4AEHL 3ARFC 2GJZA 4WU7B 4QTIL 1HSAA 1IQWL 4WI7A 4NN7B 1XIWA 2UY7A 4IOSD 5ESVB 2GTZA 3P77A 3SJVE 4PJCE 4Y4KD 3K7UA 4OKVB 3KPQB 3WHE1 4QY8A 4POZC 3IXAA 2P43B 1HHGA 3IDYC 1E27B 1P1ZB 3AMKA 1D6EB 3MV01 4JN1H 4CN6A 3QQ4A 3CFJA 1ZVSA 2CKBA 4L8CA 4XPAH 2HH0L 4L9LC 1BFVH 1F4AA 1IBGL 4HKXA 5B21A 1N6QH 1I8LC 3CFBA 2H2PC 5T1KB 3U9PH 3V7AG 3JWDL 4G6KL 3EYUL 3SJVD 1G1YA 4Y4HA 2CIKB 1M7DA 4HIXL 3GMLA 5EUOE 1FPTH 2VZSA 3DPBA 1YDPA 3S4SG 2OS7A 3HUJF 4NWTH 4XNMA 1AP2B 5CSBA 1JGDA 3L3IB 4TUOB 1SJEB 4KI5E 1Q8MA 2ESVB 4MD4A 2AK1L 4QKXB 2ADIA 2DWDB 4NO2A 3OB0H 5IB2A 2E27H 4P5TC 4RWYH 1IEAA 5CZXC 1QNZL 1WCBA 4XRCA 5J1TC 1HILA 3RQ3A 4L8DA 4XAWL 3RWJB 1QO3A 2XZZA 4XXCA 4P9ML 4W68A 4CVZA 2YN5A 4JDZB 1CQYA 4LLWA 5EU5A 4H1LH 1CFBA 1H3TA 1KIUA 2DD8L 4HWZB 2H1PH 3NIGE 2V5YA 4ZSOE 4BFBD 4U49A 2E9WA 3B9AA 2BVPB 1P6FA 4KKAD 2Q8BH 1G7MA 3U36A 2A2QT 3LKQA 5EZOL 2B2XL 1O0VA 2VQ1B 1BAFL 5TGBA 3EO0A 1ODAA 3QUXC 1LO3H 4P5KA 1YJDL 5I1CH 1OPGL 3UBXG 4OT1L 3W11C 1YA5A 1WTGT 5DEZA 2MTPA 3MGTB 1V7NL 5KSBB 2AXHA 5C0FB 3PP3K 3AREC 4JZJA 3WMSA 1QFWI 4OIAA 3NCCB 2PN5A 4PV8B 4MYWB 4DGIH 3JWDC 4H88H 5GZND 5L8KB 1MSPA 3EKCA 5DGQA 2Y5TA 3LMJH 2OL3L 4NYLA 4LK4A 3EYQD 2KKQA 2VDKL 3HCVB 2VDLL 4Y16D 2BHZA 3UJIH 3KYMB 1X5HA 4N1HB 1DLFL 3U2SA 3DO7B 5CHNB 4CW1A 1N2RB 2A6IB 4MX7B 4QRQA 1GC1L 1LE5B 3SE3A 1W8OA 4V2CB 5EO9B 1J9CT 1HCFX 4JRWA 4XP1L 5I71B 1OD7A 1JWSB 5IMLB 5I75C 4XWOC 2GCYB 4V2BA 3VXME 3MLZH 5GSVB 4ALAL 1KTDB 4RMTA 4O5LL 4KHXL 4DGVL 1C5DB 3NBNA 3HG1D 32C2B 4NZTH 3RU8L 1QFUH 4UB0L 4XXDB 1MRCH 2YXMA 1F11A 1PKQA 1JPSH 4YDJA 3DV4B 4MS8C 5SWZB 2H26B 2DLGA 2R0WL 1U95B 4N8VG 5GRWA 3MLRL 1ZWIA 4K9EL 1A6VL 43C9B 5I73B 4F57L 3O11A 4P5TD 1D5IH 1B4JH 3HR5B 4Q9RL 3IU4H 3NH7H 3CFKB 1AGDB 2FGZA 3ULUE 4NBZB 1KJ2A 5B22A 4GG6E 3W2DL 2VR5A 3PGDA 1WBZA 5HHPA 5L88H 2BOCB 2YPVH 5IJKA 4OZFH 1DR9A 2P8PA 5FO7A 4L8BB 2X4OB 3PABB 5A43C 3HUJA 1JNJA 1DLHA 2O61A 4MNHA 3A6BL 1FRGL 1QSEA 4IRJC 3C6LA 1OAUH 3QDMA 1CD9B 4HGWB 4LSSH 1N0LA 4NFBA 4XVJL 2ATKB 2MHAB 4XMKL 3MLVH 1HXMB 1IZJA 1Y6KR 4ODTL 5FKAA 3STZA 3ZT5A 4YX2L 5KW9H 5B8CB 3B9KB 5EFIA 4I9WD 4UT6H 3GRWL 1VEOA 1T3FB 5I2IA 4YAQA 3MREB 3WBDA 5L9DH 2EDDA 4TVPL 2VR4A 3EGSB 4MDJB 4NN5B 3O4LD 1FO0L 4PG9A 5AWNL 3EYSL 5FHAL 3QULA 3ZT7A 5FUCE 1S9YA 4QRUB 4MSWA 1TVBA 1YPZB 4XP5H 1ZLUH 1VEMA 4I3SL 4WY7L 3KYOB 4NBXB 3RIAF 5C0EA 2YRLA 3C9NB 4QF1B 5J13C 2DM7A 5DQJB 2DQDL 1MELA 5DD1L 2WP3T 5CBEA 4H5SB 5MEOB 4OZGB 4GKZB 2NR6D 3SKUD 2BRRH 1UACL 5HDLA 3M45A 2OP4H 4JDVB 4LAJH 3ZYJA 1J0ZA 1RZ7H 3RUGF 2FWOB 2IJ0C 3P4OB 3TH4T 1PBYA 5A2FA 4JN1L 4L4TE 3MLYH 4HIEA 5GZNC 5JA8B 3TO2A 5F7KC 1MIEL 1HYSC 3I3DA 2Z31D 2Y6SD 3O3DB 4KPHH 4YFEA 1F4YH 2FZ3A 1LO4H 4MVBA 3ARED 2V7HA 2X1PA 4JZJB 3I6GB 4YHKL 1RPQA 1VFOA 1MCKA 2C26A 4NO3B 2F19H 2HFEB 2G2RB 3OKNB 4PJEF 3D3VA 3O41A 4D9LL 1S3KL 3MOQA 4R7DB 3QWOA 3UTSD 1A64A 1W0WA 1A7QH 1E28A 5IMMB 3H9HB 5EIIA 5DR5L 2BVTA 1JF1A 1X5GA 1NFDA 3BHBB 1JRHH 1FZKB 5DF0A 1KACB 2R2CA 2DM4A 1FE8L 1HXMA 4U7SA 3O3EA 4MXWH 3P4LA 4UT7H 2VC2L 1SJHB 4XP1H 4GAJH 4LLWB 4Z9KB 1XGTA 3WN5B 1UB5A 1UWEL 4QGYA 4B5EA 1LWRA 1EK3A 1UCTA 1F8TL 3HI5H 3SE3C 3TVMC 4ODXA 3LZFL 4LPXA 4DW2H 5I1JL 2WUCL 3LRSA 3STLB 5KOMC 2YPLE 3PGDB 3K2UH 3H9YA 1SEBA 1AGDA 4PRDA 4DGIL 3QZWG 3KDMB 2E7MA 4P3DA 5F88A 3C09B 4K7PH 1RUQH 4PTUA 1NBZB 4QRPE 1C16B 1U8IA 1KGCD 3L9RB 3RBSA 4EIGB 1CFVH 3U7WL 1S7RA 3ULUD 3LCYA 1F11B 2CUHA 4PJXE 4XWGL 5JMRA 1PKOA 3HI1B 4U1SA 3VD7A 2QQKH 4XCEB 1TQCC 2JJVA 3LHPL 4D0DB 3EDJA 4G9DA 1N5AB 1E4XI 3D39D 3PGFH 1X5AA 3NACH 1JTOA 3AROA 2YUWA 1VPOL 4WWID 2W92A 6FABH 1DQQB 4MXQC 4JQIL 4Z78B 5JNYA 1WAAF 2IGFL 2FCBA 4BQBA 5BMFH 3NPZB 3PGCA 2H6PA 1ROWA 1FNHA 4DFIA 3FQTA 4P23D 4PY7B 5BV7B 5TH2B 4RFEB 4XAKE 1W0VA 4GKOA 2IPUG 2WUBL 2ZCHL 1YMME 3HNVL 1ZS8B 1AXSA 2NR6C 4HW6A 1I1RA 4JO2H 1TZHA 4NP4L 4ONGH 3ABZA 5F9WB 4QXWA 2C3XA 3QWRA 4YHNA 4HGWA 1IQDA 1OAXL 5IUSA 1NKOA 2O61B 4GLRI 2XWBB 4OLXH 3SDCD 2ZCHH 3PABA 3E3QE 4TTGA 1LDPH 1MF2H 4UBDC 3S8WA 1EVTC 2MKLC 2C3HA 5GJSL 1G7MB 4LLQB 1ONQA 1BQLH 4ISVA 3V52H 3VFPB 5BOZG 2ORBL 3C08L 4BZ1H 2ZUQC 1UQSB 4F8TA 4OGZA 1AGBB 3QA3B 4N8VB 4PJBF 3ZDZE 1T20B 5D9SB 3EOBB 4U7MA 5FGRA 4CUCA 3MJ9H 3CDYA 2QV2A 1MNUH 5J6HA 4RAUB 5FYKU 3FB7B 4XRCB 2XQBH 4U6XA 3VI4E 4OF8A 1AFVH 1IBGH 1MY5A 4WTZG 5DK3A 5A3IC 2UY6A 1RY7B 4F33B 2WK2A 3KPRD 5TE4L 4OZIF 1SJEA 4JAMA 2H41A 2VC2H 1DJSA 3V0WL 5IHUH 3MLWH 3UTZA 4ODWB 3RTQA 4I13B 2BDNH 4K94H 1EFXA 1OCWL 1PQZB 3BE1L 5DR5H 1HQ4A 3ARDA 5IMOA 2J8UB 3FQXB 4KI5D 4U3HA 1KIQA 3KS0J 5JW4Q 4MCYB 1CTOA 5LJYH 1N0XL 2F58L 3PQYB 3V4PH 5H2BA 1YC8A 1F6LL 3REWB 2BSTA 2DQHH 2Y5TB 4L29A 1U3HB 1RK0B 3TV3L 1MRDL 1RIVH 1PX4A 3TH3T 1JNNL 2Y06H 1LO0H 1EAJA 4H20L 4L3EB 3OJVC 5CP7B 4DK6A 3CSYB 2CJUH 1YNKL 4YGVA 3VD4A 2NW2B 5JW3L 3QIWA 1A6TB 1JMZA 2NTSP 4PJIE 1L7IH 2ZZUT 2VSDA 4IOIB 3G6AB 5CFHA 1T89A 4G8EB 1SY6L 5FDWA 5ETUA 1J8HA 1L9MA 4PJ8D 4UQ2A 2Z8WC 5TE4H 3P77B 4V3EB 1N5YL 1CXIA 2EICA 2PNDA 1T03H 3BIKA 3QXUA 4L4TA 4EDWL 4YDLC 2BNQA 4NT6A 4MQXC 1I4FA 2P49B 3CLFL 3QEQA 2ZUTA 1KCVL 3PL6B 3RWCB 3BKYL 4BFIB 2UYLB 1BIIB 4QWWD 3WXWH 3IFPB 1CXKA 5DC0A 5IK3A 2XY2A 5I17B 1EHLL 1NCWL 2YK1H 4WTXA 4HV8B 4MQSB 3GJFA 2YD2A 2Z92A 1LK3H 5C0AE 2FEDC 4XPHL 4NM4H 4KC3B 1R3IL 3G9AB 1CK0H 2L7JA 2ZUUA 1V3JA 4U7KA 3QDJE 3RWIA 1F3JA 1Y0LB 2BHUA 2EEAA 4G7VL 2OZ4L 2IQAB 3MBXL 4KVNH 1O7VA 4DN3L 3UAJD 4Y5YB 1UGNA 4G8IA 2B5IB 3KDMA 1U41A 1A0QH 5JOEA 4WFFD 4KV5E 1N26A 4Z95L 5ICZB 4OLUH 5D1ZD 5ADPL 3UC0H 2NX5D 3D0LB 2P24B 4YEFA 4ODXB 1JUFA 4IOFD 4EXKA 4YIQA 4HLZH 5A16B 4LLYA 3BP6B 4IRJA 2R0WH 1HE7A 4F9PC 4Z7NF 3S6CA 1T22A 5C3TA 3LRHA 1X3DA 2L7UA 5K33A 1CDIA 2HJKA 2J8HA 3HE7B 3WIHL 1N4XH 4GKSB 3WNOA 4PJEA 5I18H 5C1MB 3O8XB 3WNKA 4AL8L 4MAUL 4XPFL 2QQKL 1M4KA 1SJVA 1MY7A 3PWPD 5B3JF 3NFSL 5ITBL 1J0IA 3MRCB 7FABH 1IC5L 4KKCC 1G9EA 2PXYC 4OM1H 3FB6A 3QNXB 1QKZH 4FS0A 3ZZ1A 1RZFL 2KZWA 3D0VA 1CS6A 1RUMH 3MMEA 1JNHB 4S11A 1XH3B 3MRHB 3QXDA 4MNGA 3STBA 1MQKH 5ISZE 4A6YH 2HTKD 4ZUVB 3FFCB 2EH7H 4P5MB 4O4YL 4X9BA 1LP9A 2UWEB 2ERJC 4FZ8L 4PRAB 4ZO8A 5C07A 5JQHC 4GLRH 2V17L 3OX8A 2XKUA 4NQDB 3OJDB 1TJHL 4K8RC 3FQTB 3QDGD 2VDRH 3UO1H 5LQBH 1EBPA 4HWBH 4L3CB 4S1QL 5F7DB 5IQ7H 3O6LH 2YBRA 3LSOA 4OLYH 1IL1B 4LDOB 2GUOB 4TSAL 2VXSH 1WV7T 4X6CE 4ZSOA 3T4YA 3OTTA 3QCTH 2NW3A 4AK1A 4POYA 5GGRB 4NO0D 5GGQL 3RZCC 4GW4A 2BOBB 1XCTB 2DKSA 3QIBA 5CIPH 5GGVH 5ID0A 3LQAL 5HDQL 3PUCA 5I15L 4P2QB 1BZ9B 4ORGB 3RBGA 2MOVA 4MAYD 4GMTH 1BF8A 3OZ9L 4ZFOA 4CDHA 1XF3B 1YY9C 2LABA 3CX5K 3MOBL 1LHZA 3RVXC 2DQDH 1F90L 2E7LE 2R9HC 4FXGA 43CAB 4JM2F 3OAYK 4ZSOB 1MQ8A 1LO2H 5EBLA 4WGVB 3I85A 5F97E 5TF1L 3SO3C 5DJ8B 2IANA 5DJAB 1XGRA 1E4WH 4JFHD 2EIZA 2RIKA 2YD1A 1CIUA 5AWNH 5C09B 5E08L 4I18B 1SMOA 5I66A 1OF2A 3UTTD 4OLWL 3O45A 2R4SL 4RGMC 5CD3A 4P3CH 1C5BH 4EOWL 3MLXL 1I1YA 4NO5A 3T3MF 4NQSB 4NRYB 3BGFB 4G8FB 4D2NA 1UJTA 4ONOA 4JY6A 5LGKA 2JCCE 4U33A 3LIZH 5D2LE 4JGJA 2QR0A 2XTJE 4PRIA 3GUTA 4XAWH 2GK2A 1M05A 4OAWB 3DETD 3OAZH 2WBJC 5E5RB 4AEIH 4PJHF 4DZBA 2HKFH 4MQ7A 4AIOA 3DJ9A 3MRCA 3TGXA 4P57A 1NL0H 5INDB 1P7KB 4TNVF 4OF7A 1I3VA 2OI9A 4ODTH 3TN0A 3VXRE 1T7WA 4X4ME 2XFXB 1XF2A 4WUUD 3UBXI 2B4CL 3HE6B 4F7CB 1IC1A 4MX7A 4QRQB 3FN9A 1F5WA 5EZJB 4J2XA 4M43H 3MFGB 2X42A 3WIFA 3EO1B 3BZEB 2R1XA 4PY8I 1UFUA 1BVLA 1PX3A 1H15B 3CPLB 4ODHH 5D6CB 1LD9A 2IH3B 3CU1A 4LHUD 1OP5K 2NLJA 5AEAA 4WFHE 2JK5A 4PPTA 1FL5A 1CDUA 4NYLB 4HG4K 5KG9B 2CDFB 5SX5H 3D0LA 3NABL 5SWZE 3S35H 3BGFC 3MOAL 4D9QE 1A7RL 3KJ4C 2X9YA 5JPNB 4PV8A 2K7QA 2EYTA 3EYOA 3IF1A 5CWSB 2R2BB 1FYTE 2AJXH 4IJ3B 4JJ5B 2GITA 3CFIC 4DQOL 3LN5B 3BESR 4LGPB 3DYMA 2MCPL 4QHNB 1RU9L 1A7RH 3DRQA 4QXTB 1DQML 5D6DA 5DUPH 3FAXA 4NM8L 2HT2D 2JELH 3FHAA 4BYHA 3MODL 3HC3H 3C87A 4U6HB 5ILTL 1VA9A 3MLSH 5EOTB 3VMPA 4WI8A 5CZVH 4M61B 3B5TA 4LLMB 1OP9A 1J8KA 3ZKXB 2X4SB 2J6EH 1TJIH 4MNHB 4RMUA 4UI2A 1X9QA 2QKIB 3L3JA 3HUJB 3K4ZA 4GG6F 1FZMB 2Y07L 2DTMH 1P53A 2QADC 3GMRA 1Y6NR 1LK2B 3AM8A 2PYFA 1KIPA 3RDTD 4NKOB 4WW2C 3TO4D 5ELIA 3UTSB 4NT6B 1MF2L 4ZTOL 1OGTA 1ZLWH 3TYFB 1QRKA 4NO2B 3O8XC 3ZSTA 3JVGC 1UEYA 3SE4A 3B5GA 4Q58C 1X5JA 1DL7H 1IEHA 4PV9A 1UKTA 1AP2A 3O11B 4BZ1L 5J6GA 1LDPL 4Q7DA 3OGCB 1HXYB 2P8MB 3B2VH 5DJXA 4BJLA 4NP4H 4ONGL 1RZ8A 1LO3L 4IMLA 1NGXB 3SE4C 5E95B 3HC0B 1RK0A 2EXWD 3KXFB 4EOWH 4ZUUB 1T5WB 1S5IL 5C92A 3K81A 4HUWA 1CD1A 3N1FC 1A3QA 2R4SH 4L1DA 3BPLC 1ZLVK 3CJJA 2PXYB 1J8HE 3DI2B 4YHIB 1NCCL 5D96B 4QRSB 1QLEH 4FFVD 5AAWA 5IMLA 1F00I 4OI8A 2EZ0D 2Y7QB 4PRPD 2BVQB 3HE6A 3T0ED 4Y1AE 5TE7L 1IGIH 1RIUH 4MNQB 5JZ7D 3IDJA 3B9DA 4XH2B 3HN3A 2AERT 2Z8SA 3O6FA 2FB4H 4HMCA 2FEEL 5T33H 3X13A 5AG9A 4Y1AD 5DLML 5C08A 1I8MB 1F97A 4UDTA 3RVVC 3LY6A 4PRPE 2VOTA 3QZWB 4KFZC 3CMOH 4B41A 1EFQA 3MGTA 2WWMC 5HVFB 1A4KB 3JTCA 4FFYH 1M6OB 1H3VA 5TGBB 1ONQB 3DARA 2RCSL 4JFQB 5C8JA 3MXVL 2PUQT 4BSVB 3ROOB 3MRQA 2C3GA 4YBQC 4U1IB 5DVOA 5E8NB 4P9HL 3HRZB 4AM0B 3VRJB 3D69A 4PIRF 1CFNB 3AB0C 3F5WB 4QRPB 1E4KA 3PHQB 5IW1A 2YEZB 1MCDA 2PW2A 3UZQA 4D9QD 4PJGF 4D94A 3ZYOA 5F6HI 3VRLF 4PD4K 1AR1C 1IAIL 3DROA 2MCPH 5FECA 5CSZA 2BNUA 4OCYL 3MROA 1GCFA 4EDXA 4G7YL 5DMGD 1WCBB 4XCYB 4QRPD 4KWUA 5E9DB 5FGBA 4C55A 2ICEA 5DGRA 4E0RB 2VLKA 2PTVA 3RI5F 4R2GD 1OB1A 1KELH 2XOTA 4XH2A 1MNUL 2FL5A 1IM9B 1N4XL 2AV1A 3T65A 4MJ6A 3V5KA 5IB5A 4U31A 5CJOH 2NW3B 3TNMA 4ODHL 5ADOH 5HYIA 2VDQL 5KTEH 2N56A 4G6FB 4AT6A 1FFRA 3KLAB 1L4IA 4OIBA 2FJGB 2IBBA 5HJ3B 2YA1A 1YMMB 5IHBA 5F7DA 3WIHA 5B38B 1CLZL 2J5LC 2VLLB 5DD0L 5E70A 5I76B 1CICB 3EYFB 3G5ZA 4R96A 5HGAB 2XTJD 5F1OB 3KXFA 2HLAA 3IDMB 4ZUSA 3P40A 1G9NC 4Y16C 2J88H 4ZUVA 5C7XH 2IMNA 4M93C 5D4QA 3TVMA 5DJZA 3C5SA 4JZJC 4MAYC 3O6FC 3N85L 3JTSB 5IQ9A 5BOPA 4OCLC 3P9MA 1TZGL 4TSCH 4XNUH 1OP3H 3VD9A 1HYRC 3QO0A 4JQXA 4R8WH 4U1KB 3UTTE 1QFPA 5IOPB 4ZODA 1GRWA 3WL9B 4XP9L 2E3VA 5F71A 3RGVB 2X4UA 3TFKA 4I5BA 4OSUL 1WQVT 4LPWA 1A14L 1I9RH 5DLMH 1JHLH 1H3UA 4WUUE 5JHLL 1P5UA 4WY7H 1T6VN 4C59B 2FJHB 2VRAA 1DQLH 2HFFB 2DLTA 3VGEA 2WQ8A 3LKPB 1C5CH 2X4SA 4HEPG 2Y5EA 1IGCL 3INUL 1VPOH 3FO0H 4UAOC 4EN3D 3MLVL 2CO7B 4EJ1C 2LVEA 1BMGA 3QXTA 5DFWH 5GZOC 4M62L 4U6HA 1FL3B 4M48H 3EZ8A 3BPCB 5DHYB 4IIQA 4NQEA 4R3SB 1UVQB 1QVOA 2KQMA 1B4JL 2VDML 2NY2C 4HKZB 2BNRD 2CKBH 4KKCD 3D3VB 1HZHH 4NQXB 5KN5A 1U0QA 1IGFL 3QDGE 4XVSH 3FO1A 1YEKL 1R0AH 4NDMB 4NO3A 4OGAD 3EHBC 1IAMA 5JPMB 2EYTB 3IF1B 4M1DH 4O9HH 1JZ4A 1CT8A 3QJHB 2NY0D 3GK8H 2NPLX 1CFQA 1MCLA 1SEQH 1LD9B 2IH3A 5J7CC 4KZEL 3LAFA 4CU6A 4W4NA 4PJIB 3NZ8B 4YXHH 3QJFB 4PJ9D 4F7CA 5HSFA 3FQWA 1KTLA 2EE9A 3KYOA 3QIWC 2NTFB 3A6CH 4QTHA 5KTEL 25C8L 3LPFA 3QDJA 4LQ1A 3MGOB 5E2TH 5D2LA 5GRXG 1YQVL 5ITFB 1GZPA 5CGMA 5H37G 4TSAH 3MZGB 4Q6IC 4ZQKA 3D48R 3VJ6B 3QUMB 5EU7C 1S5HB 1EZVY 1HHHA 4K3GA 3HA0A 4M6NL 2ITCB 5I1JH 1A7QL 2YOCA 3QP3A 3CUPA 1FNGA 2H45A 5F9WC 5AZ2L 1QSVA 2GY5A 5SWSD 4NN5C 1CDGA 1GAFH 1LEKA 1EUUA 1VESA 3BQUD 3RY6A 3EJYD 4GAJL 3RPIB 5LCVL 1A6TA 5D71H 4N1EA 2NY6B 1DLHB 1GSMA 1K3ZA 3V5DB 5C0IB 2ED9A 1SY6A 3K1KC 4WFFE 2AP2A 4KTEL 4ESKA 1KC5L 5FYJH 3DRTB 3W9EA 3MLPA 1CI5A 4ZUSB 5A2KH 4EUPA 3P0YL 4FA8A 3V4VL 4DUXA 3UBXB 3P9LA 2EO1A 2M8XA 1U91B 3X17A 3VWJC 1UWGH 5C07D 3BFOA 4LU5L 5FOJA 4MLSA 3S36H 1CICD 1B3JA 4JFDA 4DTGL 4LLUA 4IEFB 3DGGA 3RDTA 3TO4A 5FYKH 4R4NC 1FN4A 1Z3GH 3AXLA 5LWYH 2Y36L 4POZD 1KIRB 2VDOL 4IRSD 1MH5B 3VFVA 5I8CB 3NGBB 2XT1B 2Q8BL 2VLKB 5EC1A 3V6FB 2D31B 3AU1A 4E41E 2OMNA 4F33A 3FQRA 3QFDB 3IFOA 4NCDA 1C12B 2AV7B 4UV4L 5HDBE 1MCIA 5M95B 4JFYB 1M7XA 2CIIB 4JN2B 2PTUA 4NN7C 3T4AB 3QG7H 2D2OA 2BNUB 4HS6A 3SE8H 2NY1B 3L3DA 4LPVA 2H2SC 3CSPA 5T3XD 3DROB 5DJ6B 1NCAH 2EYSB 6FABL 2NX5E 1JZ7A 3OV6A 4DN3H 1QR1B 2IFFH 3FT2B 1T04A 1NGZB 1U93B 2X7LA 4PJ9B 3IB4A 4GXUN 1CXEA 1EBAA 2K3TA 3VWKB 4KMLB 1JGEA 4KK5C 1MHEB 4I3GA 1UEMA 4BFEA 5FGSA 1KFAL 5EU6B 1XGYL 2V2XA 4BM7A 4PJCB 1MFDL 5C0AD 1H3PH 5ISZB 2NXYB 4JM2D 1KB5L 2J88L 2W38A 5HI3D 4LLDB 2BNQE 4NSKB 4Z5RA 5KSUA 5J9PA 3T09A 5L2KD 3D87B 3IVKB 3RGVC 1UH2A 2CJUL 1FCCA 1ZS8A 1GGCH 2VDPH 4YDLB 3FN0H 3LKQB 4YXLL 1I3RA 1ZT7B 5KS9E 2X40A 2VXVH 3MA7A 4HT1L 4Z7WB 5JR1H 1CGYA 1K6QH 2EDBA 5I1AA 4RISL 2ICWA 4HCRL 1AQDB 4K07A 4ZTPL 4XBGA 3JZ7A 1INEH 1DQQA 4PR5B 1U3HD 3BE1H 2Z8RA 5HY9B 1XIWC 3ZE0E 3SDXA 4MGXA 4ODSH 5D1QA 5DQ9A 5F21B 5IVXA 3E6HA 3VMOA 1N0XH 1A6AB 2F58H 2JJWA 2PXYA 1QFHA 1NBVL 2P24A 2BSSB 2EDQA 2Y9RT 4BH7B 4NOBA 3RFZC 3MRLA 3TV3H 5E8PB 2PYEE 3ARGA 5A3ID 2D4DA 4KV5F 2HWZH 3GKWL 3OPZL 3B4NA 4G9FA 1VFUA 3T1FA 4ZNEA 3F7RA 4OBRA 5IBLD 4I4WA 5CD5D 3MLWL 5HHVL 3V0WH 4LCWA 3GMPB 5T5FH 2Z93A 3QNZB 4WNQB 5DMKA 2YN3A 5E2UH 4KMTL 1TLKA 4OT1H 4WO4C 4NKQB 2AXJA 4L4VB 4XCNB 4EVNA 4OD2A 2C4FU 1R3HA 1P6AB 1WWBX 2AVGA 2C1OA 4JRXB 4PJHB 3RNQA 1JL8A 1VADA 3PWVA 3GSXA 1UZ8A 1A6AA 3DRTA 3MRDA 3W9EB 3QQ9C 2CDEA 3O0RL 2J3SA 2EIEA 4OCNC 3SKNB 3AREB 1YMMD 1BIIA 1JRHI 2J2ZA 3LH2H 4QCIA 3CVIH 4HIJB 1KJMB 1EV2E 4BQ9A 4CJ0A 2DJUA 5E99H 1KN2H 2WIIB 5DS8A 3E2HC 1FYTA 2BSRA 4BQ6A 4QHMB 5C2BL 1KEML 5HI4D 2FB4L 3S96B 4RGNE 4KGJA 1B0RA 5D5ME 4S0SD 4NZDA 1D5ZA 3ZE1E 2EDOA 1AI1L 4ZQKB 1S78C 2AJ3A 3TPUB 3JTTB 4MWFA 4N5EA 3LKOA 3JV6A 5D5MF 1OHQA 4LSSL 3PWUA 4MJIB 4LSUL 3NZHH 4JQXC 5DD3L 5K9KB 4BZ2H 5D8JH 2DKUA 4FQ2L 5JQ6L 3FQWB 4PRHE 3O3DA 4F80A 3U0TA 5BVPH 2DQGH 3WFBH 1YUHA 1U8NB 2BP3A 5J12C 4YBQD 3VWKA 2ICCA 2W60B 4LCIH 3FOMA 2Q7YA 4MZ2A 1EZVX 4PJ9A 1U92B 1KC5H 3H9SE 2ZKHH 3L7FB 3CX2A 1KPVA 3FT2A 1RMFH 1P2CB 4AG4L 3UYRH 4WW2A 1WICA 3C9NA 3MRBA 2R15A 4YPGB 3BXNB 5HGDA 1EHAA 1MUJA 3F6LA 1WT5C 4X7FC 3CLFH 1CDHA 3PV6B 3DSNA 1L9NA 3I50H 4OZIE 3MUY1 3BH9B 4EXPX 4DW2L 1RUQL 4R26H 1DN0B 1BFVL 1N6QL 4K7FB 4IIQB 4NQEB 5DQDH 3L5WA 3GIZL 5GGSA 2JB6A 1MH5A 3O81A 2X1QA 2QQNH 1DUZA 3DETC 3KJ6L 3QA3A 4N8VA 4MJ5B 5DWUL 4PRIB 3UTSE 1FNFA 5J13B 3WO4B 3GMMA 4OCSH 2V6HA 1BQUA 4Y7MA 2FJHA 4WU5B 2LVCA 4HQQH 4HWNA 4L8SB 1UM4L 3KPNA 5IBUG 3TM6A 1FE8H 1AQKH 4FZ8H 3ELAT 2NY4D 4XCCL 4XTRC 5ECJE 2R2HA 3GMOA 2IBZY 4OQTA 2Y25A 4NCC1 2A9ML 3QQ3A 4LLAA 3V5DA 3SY0A 1G7JB 4DVRL 3WDIA 2DBJA 3TCLA 1RZIB 1NGWB 2NXYC 3KXFE 1DUZB 3K80A 3N1GC 3T2QA 4DCQA 5IFAL 2I25N 4RISH 1BBJA 4YO0B 5BXFA 1XGUB 4PJAF 2GYSA 1EMTH 1IGJB 5ITBH 1ZXQA 1NKRA 2HVKB 5DZNA 5K9JL 1K2DA 5IJVB 3GNML 4JY5H 1GGCL 1WGOA 2AJVH 2WLYA 4QYOA 3T0EB 4MNQE 5EORH 1JHTB 4AMKH 5K59E 3T4YB 8CGTA 4I9WE 3FO2A 3QUYC 35C8H 2B39A 3LSOB 1HH6B 2DDQL 2VZVA 3CFEA 4DFHA 3U2SB 3P4NA 3NAAL 3FOMB 3X14A 1G9MH 2UWEA 4F9LC 3CXHJ 3CSBA 2Z35B 3DGCR 4X9HA 2XZQL 5FUZL 4Z7VF 4OLWH 3WJJC 1WAAE 4L4TD 3O2DL 2OCFD 3HZVA 5C0GB 1OAXH 3V8OA 3OKLB 5EN2B 4LSTL 1AC6A 4CVWA 1J0KA 4Q2ZA 4UOJA 2BC4B 2YD6A 3EO0B 4Z77B 4LLVA 5IR1A 2NZ9C 3LV3B 3ARZA 5L2KB 3OZ9H 2SEBB 3O8XA 4TVPE 3MLXH 1TQCB 1G9NH 1LDSA 1KLUB 2YMXL 1YEIL 5B4MC 4BQCA 1B0GB 5DO2D 4J3UA 5K93A 5F93C 5HGHA 4HIJA 5L0QB 5FUOL 3HE6D 4EIZC 2O5ZH 4W70A 4F3FB 2JB6B 2XWJB 4N0CD 1LO0L 1NFDB 3BHBA 4P3WA 3CVHL 1NCBH 4PTTA 5EIIB 2YD3A 1A6WL 4HKJA 3BRFA 4WWKA 3PWVB 1DBKL 2XWTA 1EO8H 2QEJA 5ID1A 1I1AC 1VKXA 2BC4A 4Z77A 4NZTL 3BUYB 1FFOB 3CK0H 4OGYH 2VABA 2JE8A 1T83C 4NQDD 2KH2B 3WL9A 4HMEA 1YNLH 1CLYL 2FO1A 2AXGB 3QNZA 1X7QB 5F7EL 5IEKB 5HI5D 2AQ1A 3TO2B 4LCYA 2RHEA 3C5JA 3WJLC 1F4WL 3ARFA 5IVOA 5IESH 3HMXL 4BH7A 2IPTL 4UB0H 3G5ZB 2DYPD 1HIMH 1ADQA 5D7LB 4JPKH 4P2RB 5MEOA 3BZFA 4GAGH 3OR7B 5GGTA 3VFOB 4LKXA 3X3FL 3D2UB 1ND0A 3OKEA 3SCMD 1EFXD 4MD0B 3VFNB 1WK0A 3S3SA 3U0WH 1YEGL 5CILH 3QXAA 2R9HD 1KPUA 3OKKA 3HE7C 4RGND 4XBGB 3HFML 3PL6A 1EERB 5DZLA 2COQA 2XPGB 3DVIA 3EJZC 1VFBB 5HVHC 1UXWB 4LMQE 2OI9C 2X10A 5ACLA 3ZT6A 2A6JA 3GSUA 1HSAB 3MNZA 1B0RB 2LE9A 3U1SL 3UJIL 1G7LB 3U48A 3MJ8B 4QHMA 2X4TB 3TIEB 4NKOA 1WT5A 4HDIB 3RIFK 3VGAB 4EDXB 3G08B 4HC1A 3EFFB 4AZ8A 1U6AH 3DX9B 4DEPC 3RHWF 5L2JB 4L4JA 1MVUB 4FXLA 4M1DL 3DNKA 5ANMA 5I75B 2C9AA 5C86A 5T3ZL 2IG2H 4NIKB 5CP3H 3PHQA 3GSXB 3MA9H 4YZFF 3OB8A 4OLUL 1CLOH 3HNVH 2P5ED 4S1SL 4PJIF 1OTUC 1N64H 2CUIA 1EUTA 3ETBF 2FHBA 4NM4L 4LCCA 4M8VA 3WD5L 3ILQD 1MCBA 4Q0XL 2R0KL 3AC0A 2O26U 4QHLB 1MHPL 2PYED 2FYYA 3MRIB 4UZGA 1CL7I 2R29H 1OVZA 4PJXF 3MXWL 5GS1B 4B0MM 4ZFFB 3MUGB 4C83A 1WC7A 3DO3A 3NCFB 1FVCB 1ZA6B 3KWWA 4EI6A 3ORJA 1KCLA 2PO6B 4NWUH 2HKHH 2AEQH 3VFTB 4YHYB 2CK0L 4YX2H 5KW9L 1BD2B 3NIDF 2WWKO 1WIUA 2HT4D 4WI6A 1IAII 1FFNA 3S97C 1NCUA 3E3QA 3GSVA 1RJZB 5TDPB 3UTPE 4JHWL 3D39A 5E2WH 4PJDB 4RBPH 1U8KA 1QUNA 3PG2A 4Z8FL 1PZ5A 4NKIL 5DTFA 5MEPB 2WNGA 4Y5XA 3O9WC 4ZAKD 5JW3H 3P9LB 3KVQA 2Q87A 5CJOL 3PP4L 1EH9A 4G6KH 2V5MA 3MJ7B 1I1FA 4JHZA 3QO1B 4U3XA 3TA3A 1MWAL 3FT3A 4FMKA 1QLFA 1KCRH 5EOCJ 3UTPD 1T0NA 5C0BD 3VDAA 2YZ1A 2BY3A 5EWIH 3QWQB 4XPAL 2AAVA 2BXZA 4CGTA 3QXVA 4JFFB 1BVKB 3B2UD 1YY8B 1CVRA 5DJXB 4CMHC 1JFQH 2E6JA 4F37K 2DQHL 5F3BA 4NZRL 1D5XB 4LF3B 1MRFL 3QSKB 3TPUA 1S7UA 5ADOL 2E6QA 4OIIH 4W6XB 5DJYB 1LVEA 2IF7A 4XNQA 2Q86A 1YECH 5EUOF 3HB3D 1OGTB 4PY7A 1KEGL 3UDWA 2R2EA 4XX1E 2QQQA 1LK2A 4G6AD 5FYLL 4RFOL 4TOYL 1BWWA 3MX0A 1F2XK 3MGOA 1A6UL 3QEHA 1AGFA 5I9QC 4J8RB 3QIUC 4S2SB 5FCUH 4E41B 3P4MA 1PY9A 1A02N 1NANH 4AEEA 1E4XH 2VL5B 2OJEB 3ZKMC 4JDTL 3GI9L 4DKFL 1FIGL 1HNFA 5DMIH 1ZEAH 3AU1B 1QHOA 4LCYB 5DJDA 5HYFA 1JF6A 3E0GA 4XNXH 3GGWB 4X98B 4HCRA 4C56E 4P4KB 3CFCH 5CEZE 4Y8DC 1C16A 2NXZB 4TNWF 5JPMA 3DGGB 3RDTB 3TO4B 2A0LC 4PTUB 1I8KA 3GSQA 5J1AA 2AKRA 1IL1A 4J4PA 5DRXB 5T1KA 1ND0B 3OKEB 1FFOA 4XTRD 4QRRB 5I1HL 4J3OC 1ORQB 4LASH 1B6UA 2O93L 4P2OD 4MB4A 4X6CF 4P3CL 1LP9B 3BPCA 5GJSH 4AY0A 4KJYB 1OTTC 4GRLC 2FX7L 3L3OB 1UJ3C 3RVXD 3LQAC 4P46A 4QXUH 1I9IL 4FNLH 1AO7A 1EGJL 3MMEB 3QIUB 3DLQR 4GFTB 4HK3J 3RPIA 1LO2L 1B0GA 3JV5A 4LCWD 5DD5L 1LEKB 3RKDC 4DVRH 3KPQA 4CRPA 3OSKA 1IRAY 2ARJA 3QHTC 2HFFA 1I9EA 4Z18A 4JPWH 5I0ZA 5AZEH 3FL7A 5FDYA 5GXBB 2Q8AH 5EOQL 1D9KA 1N64L 4RX4A 2I60L 2W59A 5L88L 4WWKB 2I5YH 2DIJA 5C0DA 2PR4H 2VLRD 1HDMA 4WHYH 3SBWA 4NQDE 5E2VH 2V2TB 1F58L 2HFGH 2HLFC 4GKNB 1J0HA 2YPLD 3D85B 3LDBC 4HH8A 2QR0B 5MI0C 1V7ML 1KTLB 1AO7B 4X6CB 1YEFH 1CL7L 4PJCF 2HT3D 2X89D 3NVQA 5KAQF 4PJIA 3BN9D 1I1YB 2UUDK 3IDUA 1W72B 3SDDB 5F89A 3SQBA 2CRMA 5TDNA 5IR1B 1CFQB 1FAKT 3MCKB 1T04B 4NM8H 4I18A 4YE4L 4QRRA 2ATPB 1A7OH 1YEFL 1LMKA 3UZEA 4TVPD 1TZIB 2EYSA 4L4VE 1DBJL 2CDGB 2R23A 1AR1D 5I1KL 4C4KO 3VE0B 3KPRB 4KK8C 3WS3A 2JJSC 1MREL 3HAEH 2CIIA 4JN2A 3T4AA 2VDRL 4ZFOB 5E2VL 2UZIH 1LEIA 1A1MB 3IS1X 2I26N 1C12A 2AV7A 1ZK9A 2WQRA 2APWA 4R3SA 5IB3B 5BXFB 4Y2DC 5HHOE 5KBNC 1VFAA 3ZHDA 3MLTB 4PJ7A 4XGZA 3ZTNL 4BH8B 2HRPL 1UWXK 4GG6A 5CSZB 3W0WB 5DD3H 2B1HH 1U3JA 2V2WB 2DLIA 4G59A 4LHUA 1K8IB 3SGEI 1XT5A 5D5MB 4R7NA 3WE6B 3BO8B 5EA0H 2VZOA 3MUHL 5DFVC 1I4FB 3FT4A 3U6RA 3D2UD 3RWDA 3DVFA 3LPWA 4XNQB 4ZFOL 5DJYA 1K4DA 1RULL 3RX5A 5IROC 3UXFA 4JKPH 4HXAL 5AG8A 2P4AB 1AD9B 3JV4A 1IM9D 4D9LH 2BRRL 3TJHA 4RMVA 1EPFA 5KS9F 3QIWB 3BQUC 2F19L 3RTQD 2GJ6D 1W72H 2D3VA 3NN8B 2APTA 3GI8L 4RDQG 4R4BB 3KXFD 2HLAB 4L9DA 2VZUA 3MRGB 1U8PB 2R69L 2HAZA 5J4MA 1KTDA 3HFMH 3RVUC 1G7HA 3NIFF 4LSRH 3IDJB 2F5BL 1I9JL 3EYSH 5FHAH 3UTQB 1WFTA 3WDJA 4M6ML 4OZIB 2NTFA 3D39B 1A7BA 1VGEH 1JGVH 2HYMA 4ODWA 5GS3A 2I07B 5E5UB 1F13A 4XMLH 1FFNB 4BH8A 4PJ5A 2NY6C 4RFOH 3L3OA 5DUBA 1CFTB 3GKWH 3RI5K 3OG6B 2VITB 5DJ2B 4B50A 2QSCL 3VFTA 3L5XH 1PVHA 1JK8B 1DN0A 2LQRA 3VXSB 4PRIE 2V7NB 3I3BA 3SPVA 3S4SA 3GBNH 4FQXD 3MUGA 3HZMB 1AXTH 1RZ8B 3E8UH 2EC9U 1T2QL 4XPBH 2VDOH 3EHBD 1OL0A 1JE6A 2Q6WA 1OLZA 4P4KA 4K94C 4Y2OA 2VZ1A 3SKMB 3PQYD 1ETZA 3IRZA 1KPVB 3F5WA 5JR1L 1Z9SA 4XBEH 2DI9A 5FEBA 1YEEH 5DMJB 4G6MH 2QL1A 1IAKA 1CR9L 4LNRB 5D7IF 3MRMB 1TJHH 3IDGA 4P4KC 2CLZB 4XB7A 1RVFH 4HJJH 4UT9H 3NA9L 1KJ3L 2VAAA 1H0DB 4PJ7E 1MRCL 1AGFB 1FFQA 3QQNA 2PCPA 1CR9H 3QUXA 1Q72L 1JHKL 1MJ7L 1QO3B 3JTTA 4U6YA 3SKJL 3ARUA 2XN9D 5DFVD 1KJ2H 4QTIH 3T0EE 4GRMB 5HYSB 2VLME 1XEDA 2VXUH 2RGSA 1DVFC 4HQQL 4RFEA 4LSQH 1RURL 4OZFG 3V2AR 4KKLD 4IOIA 1IZKA 1AY1H 4ZOEA 2GITB 1PW3A 4JPIA 4JFFA 3GMPA 2ICES 2VDLH 1YC7A 4H1LA 4A2LA 3TJEH 3HB3C 3TT3L 2FR4B 4CVUA 5GIRB 3C60D 3BGMB 1T0NB 4Z7NE 3RNQB 4EUPH 1MIMH 3C8HA 4J1UB 7FABL 3MQIA 4LPTA 1H15A 5SV4A 1H8NA 5H8DA 4N0RA 1DBBL 5IW3A 4OFPA 2APXA 2LAGB 2FDBP 2RQ8A 1X4YA 5TF0A 3L9RA 4ZXBC 2DF3A 4RZCA 4HUUB 2J12B 4ELMA 1H5BC 4I4WB 4J6RL 1KJVA 3FJTA 1QLEL 4Y4KC 1IGFH 4KDTC 3DURB 2C3VB 5CGTA 3HNSH 4K2UH 1BAFH 1ZA6A 1VGKA 4F8QA 2VH5L 5JLZB 5IHZA 4NKDA 1AHWC 1S9WB 4MA3A 5FOBB 4ZFZA 3TBVB 1NC4D 1RIUL 3TJEL 2H3NA 2BVUA 1KYOJ 1NFDE 2QHRL 1BREA 4JKWA 2BHYA 4WHDA 2FLBT 4Z0BH 3LD8B 3O3EB 1ZHNB 4L8SC 5JIIA 5EU6A 4XHJD 3I2CL 2DBLH 2FATL 1A1NA 3MTRA 1T5XB 4JFDE 4UUJA 1ZANL 1I1CA 3KLHD 4PRPA 1I7ZA 4MQXD 1TMCA 4FQXC 5T1KD 4QXTA 4OCSL 1BFSA 4TUJB 3IJYB