3CC5A

H-2db complex with human gp100
Total Genus 68
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
68
sequence length
276
structure length
276
Chain Sequence
GPHSMRYFETAVSRPGLEEPRYISVGYVDNKEFVRFDSDAENPRYEPRAPWMEQEGPEYWERETQKAKGQEQWFRVSLRNLLGYYNQSAGGSHTLQQMSGCDLGSDWRLLRGYLQFAYEGRDYIALNEDLKTWTAADMAAQITRRKWEQSGAAEHYKAYLEGECVEWLHRYLKNGNATLLRTDSPKAHVTHHPRSKGEVTLRCWALGFYPADITLTWQLNGEELTQDMELVETRPAGDGTFQKWASVVVPLGKEQNYTCRVYHEGLPEPLTLRWEP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords H-2 class I histocompatibility antigen, D-B alpha chain
publication title Design of agonistic altered peptides for the robust induction of CTL directed towards H-2Db in complex with the melanoma-associated epitope gp100.
pubmed doi rcsb
source organism Mus musculus
molecule tags Immune system
total genus 68
structure length 276
sequence length 276
chains with identical sequence D
ec nomenclature
pdb deposition date 2008-02-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00129 MHC_I Class I Histocompatibility antigen, domains alpha 1 and 2
A PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3cc5A02
3.30.500.10 Alpha Beta 2-Layer Sandwich Murine Class I Major Histocompatibility Complex, H2-DB; Chain A, domain 1 MHC class I-like antigen recognition-like 3cc5A01
4Z95L 3S97C 2NLJB 4FZ8H 1H5BB 4R4FL 5C0DA 3RL1B 3S9DB 1F4WL 3ECBB 1A7QH 4JHAH 2EDHA 2ORBH 1FLTX 5D7LB 1D5BA 1FYTD 1WTGT 4KK8D 3EJZC 3S98A 2OR9L 5H35A 5HI4C 3OJDB 1JV5A 3U46B 3RTQA 1A64A 2Q6WA 1VGEH 2XZAL 2CXKA 4X6DE 4JM4L 5DMJB 4ENEC 4ZNEE 3TP4A 4DWHA 5I1LB 3V8OA 4KVCH 4WEBH 1EVUA 2E7CA 4K55A 5CJOH 1XF5A 3GSRA 3QPQD 4P5MA 4LHJB 4PIRF 4JRXB 4KTDH 2UZIL 1MRFL 4PG2A 4PGBB 3MLSL 5GSRA 3OKEA 4PJEA 3H9HB 3ARDA 4XPAH 1MHCA 4Q9QL 4MDJA 3WLBA 5C2BH 1MSPA 1MFBL 5J12B 5DF0A 4X8JB 2NW2A 2WIIB 4G7VL 2DQUL 1YY8A 3SDDC 3LDBC 4G6JL 1T0MB 1VFOA 1RSFA 5MERB 1UYWH 4GMTH 4LK4A 5IQ7H 4Y5YB 2VE6A 1JZ3A 4GBXD 5FKPB 3BN9C 5DS8B 4BH7B 4WW2C 2L0DA 4NO5A 5EA0L 3VWKB 2D2OA 3VCLA 4H25A 4RZCB 1S9WA 3QUML 2K1MA 4BFIB 4M02A 2R0ZL 3ULVF 2J7LA 4W6XB 3ES6A 1NGWA 1U8NA 5IMKA 3MA7B 2WBJA 2GSIB 3QIWC 1OSZA 5D2LE 3G5VB 5IIEA 4WDIA 2YK1L 5TE7H 5EC1B 1EPFA 3MRNB 4OD3H 3MV8A 4XPTL 4LSDA 1MIEH 3OPZH 2EH7L 2Q76A 1GZPA 5SWSB 4XB8A 4HUKB 3D6GA 4EI6A 1FIGH 4Y4KC 4W6YB 1BAFL 1S7QA 5C6PB 4LVNC 4BZ2L 3L7FA 4KDVA 4OGXH 5D7SH 1CGSH 5DD6B 1QFWI 2VQUA 3HZKA 4KJPC 5B39G 1MFCL 3LQAC 3AY4C 4PY8J 1U42A 3GMNA 1VGKA 3P3YA 4WU7B 4PJFE 2DM2A 2J5LB 3QEGL 3OZ9L 2AQ3A 5I1IL 4YHYC 4JFZH 1QBLL 4XPGH 2BZDA 3S35L 2G5BA 4X7EC 2Z4QA 1J87A 4Z7WF 5DHYB 5T1DH 1I8KB 4IIQC 3BKJL 4XP6H 4GS7B 3IFNH 2WLYA 5D7LE 1E6JL 3QQ4B 3H42L 2ZUQC 5JHDE 1X5XA 3OKNA 5GJSH 3WIHA 1CTNA 4OV5B 1JYNA 2RBLA 5JDJA 1R3IH 1A6TA 4I18B 2HFGH 2AKRA 3B9DA 1XGQB 1MAMH 4NRXA 3T4AB 2FRGP 4UNUA 4YWGL 2IG2L 1XZ0A 2KKQA 4UDTB 1G7JB 2X4OB 4TSBH 1BVZA 2GJ6D 4HAFA 1MAKA 4DVRL 5C2UB 2JF1A 1KLGA 1DVFC 5DEGA 1QFOA 5HYEA 1BWMA 4LLQA 2WQ8A 1EJOL 5IVZB 1YNTA 3BDXA 3O41A 4OIAA 1ZGLM 2DKUA 2D31A 3ZE1E 4JRXE 4KQ3L 1MCFA 3O8XC 4OLXL 1IVLA 4JPKL 3E6HB 5EU5B 3WEXA 2QKIA 4DKFH 3BQUD 1CDJA 5CZXD 1ULVA 5DDHB 1DQML 1RZIA 4X80H 3BPCB 2X4RA 1KJVA 3O3AB 1KXQE 1NMCC 4OM0L 4H88H 4FFVD 3D3VB 3LRSA 1VKXA 4ZFFB 3FO9A 1Q1JH 1ZEAL 1IAKB 4WHTA 5JIHA 4D9RE 4BZ1H 1WQVT 4P4KA 4POYA 1AGDB 3ARPA 5CBAB 5E6ZA 2B4CL 2D4FA 3T08A 4L8BA 1UEMA 4X6CA 3IU3B 3WS6C 1FPTL 2Y7QA 4MA3A 2DF3A 4OIBA 2J8UE 5C08A 2KQNA 2DL2A 1C7TA 2ICES 3TWCH 4U1IA 4ZFGH 4NNPH 5ENWA 4OLYH 3BVNB 4JHWH 4Q2ZB 4RMTA 2VAAA 3GBNH 5T3ZE 1C08B 4O9HH 3V8CA 1PQZA 3A67H 1BF2A 3V5KA 2RQ8A 1IGJA 2DDQH 3HPJB 4FQCL 3FCTB 1B2WH 3X14B 4DKEH 3F7PC 2NY3C 2DYPB 3AXLB 2B5IC 3E3QC 5ANMA 4XI5D 1ACYL 4TVPH 4V3EB 3OJVC 3WIFB 5HHOB 5JO5A 4P23D 2ARJA 3C09C 2EDNA 3MCKB 5IK3A 4XCFL 1VFBB 1QSED 4NO3A 3WJLC 3JUZA 1U93A 4I3GA 1I3GH 2AEQL 1DVFA 5L88H 3QB7C 3LCYA 4FHBD 2DQGL 1IKFH 5CUSH 2IBBA 3QUYB 4NZDA 1W72A 3MRHB 2OQJB 2BY0A 4BSVB 5I15L 3JTCA 3JWOC 3O6LL 2ADFL 4HV8A 2X4UA 3KXFD 2B1AH 5E8EA 5DJ0B 3EFDL 1OTSD 2NYYD 3ULUE 2ZPKH 4Z5RA 4UUJB 4BJLA 5DHXB 2NY4D 1MVFA 2EKSA 4FTVB 4QOKB 3LOWA 2EE3A 3I02A 4NM8L 3LY6A 5F71A 3BP6A 1KCKA 2IPTH 1IGFL 4NWUL 1BOGB 1Z9LA 1EBPA 5GIRA 4HWUA 3SGJC 4GLRH 4KRPC 3HE7C 2NPLX 4AEIH 1GC1C 5MENB 3LPFA 3RWGB 2J88H 3K3QA 3GMLB 3QHFH 4LAJH 3K8LA 2P46B 2X42A 2AEPH 5IW6A 3DURA 4CDGC 1AGCA 3EYSL 4G3YL 1NMBH 4OIIL 2LAGB 4NFCA 3RY6A 1WCBA 4FRWA 5I71B 4ODSH 4QTIL 3V9FA 2FJGA 1HQRB 1BP3B 3IT8D 1P53A 1WAAA 1JWUB 1TETH 4YH6A 3WNLA 5CP3A 4HH9A 3KLSA 2IGFL 3MUGA 1TNMA 4GAGH 2R2HA 4NYLB 4PJ9B 2ZG2A 5D72L 3E3QA 4FFZL 3MRMA 3D3VE 4NQCA 3BESR 3FT3A 3IU4H 3JTTB 1T6WA 4LPTA 4F2MB 4MYWB 1BECA 2DQEL 2OTPA 2VABA 4Y5VC 2FH6A 4FFWD 1TMCA 4XCYA 1TQCB 3FKUS 1PYWB 5J8OA 2JIXB 3RVWD 2QEJA 3QDGD 4FQJL 3TN0C 1NL0H 1A1NA 1C5DB 2XN9A 1N6UA 1IGIL 3BJ91 2A73B 1Y18B 5IB3B 3INUH 4YHKL 5L8KB 1CBVH 2FO4A 5J11C 2FJHB 2RR3A 1HQ4B 2YHGA 5IBTH 5GRJL 2IBZX 5ACZB 4K94H 1JYVA 1NUDA 3QPXL 2EE2A 2FD6L 4F7TB 1UQSA 4JRYB 1T0NA 3O2VL 5I19H 4WI2A 4OZHE 4NQSB 1G7IB 4M6NL 4X8XA 4QHUB 5IHBA 2F54D 3LKSB 2W9DL 5HHOE 5CS7A 1BHGA 2CMRL 2BP3A 2Z93B 2ADGB 4EI5A 4R9HA 1I1AB 3DUSB 1F90L 4Y0GA 4IRSD 3A0OA 1IZKA 3P2TA 4I48B 3FZUC 4TTDC 3HE7A 5C7XH 2XQYG 1HKFA 3MLTB 1UC6A 2F8XC 3GMMA 5CJ8A 1Y0LB 3WLWD 3FFCD 5GS1A 1L9NA 1J05B 5E6ID 3VFVA 5DRXB 3NH7H 2HFEB 2P8LA 1CDYA 3TJHD 4H8WL 5HY9B 4UTAL 2OMNA 4P99A 4O02H 3V6OC 3CC5B 1RIUL 1NSNH 2MTPA 2PTUA 2DQFB 1UCTA 4TUJB 3FHQA 2PO6B 5D7IE 3KPQA 1JWSA 3MBED 4D8PB 5HYSA 1N2RA 3GBMH 4GAJH 4JFFD 4PJGA 3E2HA 3VXMD 3UAJD 2ENSA 1FP5A 5I66A 2FIKB 4FTVE 4QOKE 1RUKL 5CEYA 5D7JC 3S96B 1NLBL 4MJIA 2XRAH 1MH5A 1KB5B 1KTDA 4ODVL 3BH9A 3MGTB 4G9FA 5F6IC 1J5OH 2Z35B 2KH2B 5MENE 3KPOB 1CIDA 5CEZD 3NABH 5GRYA 3KPSA 5HHXH 2MPAH 4EUPG 4LDEB 3TN0A 2QR0A 2PF6A 4XNUH 4JJ5A 5ISZB 1R5VA 5GJTH 3PWUA 4GW1B 3L7EA 4Y4FD 2OMBA 3V6FA 4YHNA 5K33A 3BKCL 1P7KB 3RU8L 1QACA 5D6CA 4PJAB 4IRJC 1A1OB 5EZOH 4X6BB 4KU1A 4EQ3A 2EO9A 1RUML 5I8CB 3TNNB 1P1ZB 3LKQA 2DQDH 5JIKA 3HR5A 5EIIA 2FGWH 5GS3A 5ICZB 5JIIA 3I9GH 4PLJC 4PJCF 5I16A 3ZKSD 1G7MB 2BSED 3S34H 3ARFC 5I1AB 3SCMD 1RJYB 1OTUD 3KPMA 1N5YH 4TVPD 4U1NB 2B2XH 3GSNH 4MS8C 2C1PA 1Q72H 1D5MB 2GUOB 3WO4C 4IJ3B 1AO7D 1FL3B 1RU9H 4M1GH 4KDTC 1LDSA 7CGTA 3U0TA 1A6WH 5F9WC 3VRIB 1UH2A 1UA6H 4PR5A 4H1LB 5GGSY 5EFIA 1XIWD 2LV4A 4MNGB 4E41E 2F53D 3IJSB 3U1SH 4APQD 2NXYB 2EDWA 2Q7NA 4JY6B 4P3DA 3RAJH 4CGTA 4WIQA 5DD5L 5EU3A 3LIZH 3S8WA 5T1MA 2PW2B 1IBGL 3H3KA 4H5SB 1CQYA 2AXJA 4RISL 1N6QL 1M71B 3SY0A 3Q1SH 4DTGL 1CLOH 1WJ3A 4K3EL 3QEUA 3MA9H 1IGCH 1N64H 1E4XL 3A6CL 5EORH 3ZKND 1HE7A 1EJ6A 4Q0XH 1XR9B 3CJJA 4LHUB 3QISA 3B9KD 1NC2D 3Q5OA 3WUWB 4YO0B 1ZSDA 5JXEC 2FEDD 4RFEA 3I3EA 1T21B 3RRQA 4NQDA 2NY2B 5KOVC 3ZKXB 2E6QA 4IDJH 2M1KA 3GEWB 3M8OL 3KPRB 1P4LA 3QNXB 4E5XA 2R23B 2A6IA 4G8IB 4OLUL 1KXTB 4NQEE 3TO4B 4IRJA 1RZGA 2ICEB 1VFAB 3HPLB 2DLFL 4F37K 1GVIA 1RY7B 4OUUB 1ONQA 2XPGB 3PNWA 4KROB 3FHAA 5HYJA 4AT6A 4Z0XA 4LLUA 3IJYA 1IL1B 4KZDH 5ERWA 15C8L 4LIQE 3LEXB 5E5RB 2VXQH 5DK0B 3VGBA 2YMXH 3VXNA 4X6DF 3DLQR 3DVGA 4UZGA 4MS8A 3CLFH 4JDVB 2BSSA 5IVXA 1U3HA 2LU4A 3BGAA 3T0WA 5B3NA 5KSBB 5ISZE 4KDTA 2OXGA 3OGCB 2EEBA 2GITB 1HI6A 5HXMA 1MPAL 3GIZL 4QWWD 3I6GA 3HHRB 5D1ZB 4PJAE 5GS0C 3QXUA 1AHWA 3T2NL 1EEQA 4OFVA 3MO1B 3RVUC 3QO0B 4CAGA 3O3DA 1VPOL 1VFMA 1FAIL 1BFVH 2Z8SA 3RUGE 3O4LE 1QA9B 1FE8L 1JNNH 1NEZB 3C2SA 4N0UB 2P8PB 5CKAA 4NZRH 2IALA 4MCYA 3QJFB 4YX2L 5JMOC 4BA8A 1MCRA 2AVGA 3RPKA 3KWWB 2CLVB 2LU3A 3AROA 4FQXB 1DLHA 3T3PE 2EC9T 3ROOB 4CMHB 4HF5L 4E42A 1V05A 3G6AA 2X05A 1ZT1B 1I7TA 3KYKH 4PJBA 4Y16C 4K3HA 3HAEB 5EOTA 3MLVL 1ETZB 5IHUH 2OCFD 1B0GA 2AV7A 2X44D 5B4MD 3PHSA 4P5KA 4ZFOB 5T3ZH 3GM0A 4HCRL 4CKVX 2A0LC 2VLJA 3DX9A 1QLRB 2DLGA 4JKPL 3SN6N 4JY5L 4BQ6A 3ZHDA 3U0PB 3VRLF 1ACZA 4JKMA 4PRIE 5BRZB 4OCXL 5KJRL 1PKQE 1FZKB 3NFPA 5AAMA 3C08L 4BFBD 4JG1L 4MQXC 1F4AA 2H2PD 5ID1B 4ORGB 3TJEH 4PJFF 1Z9SA 1JNHB 1LE5A 1QQDA 1K9TA 3D0VA 3UBXG 1MJ8L 4MXQA 1WBYB 1JTTA 1WIPA 1X5FA 3P9MA 2MCPL 3WKNA 4XCNA 5FYKU 3MRQB 4L8SC 4HWNA 4XP9H 3ARWA 1P9MA 4EDWL 3EOAB 1EEZB 2VDKH 12E8H 1CDGA 1MQ8A 3HS0A 1J9CT 1P7HL 1YJDH 3IXAA 3SDDB 2A83A 4ZXBC 3LDBB 2A9NH 1DBJH 1BD2A 5TJWK 1I1CA 1WVZA 2YRLA 2R29H 1YEEH 2X4QA 3KYNA 2UY7A 1A6AB 4ELMA 4EZMA 1NBQA 3CFEA 2Q7YA 1KELH 4WW2B 2VH5H 3PWNA 5L7XL 4P2OB 4QCIB 1T66D 4NCC1 4JFOA 3L3IB 3OG4B 2GK2A 2FBOJ 2DMBA 3MRFA 3L5WA 4LARL 3PF2A 3N1GC 4ERSH 3VFSA 3ZE1F 1J1XH 1XGRB 4S11A 4YEEA 3QI9D 5E8PA 3MV9A 2AGJL 1LEGB 1WFTA 5CCKH 3QIWB 2HKHL 1XGTA 3F7VB 4AIZB 1FVEA 4I2XA 3ALPA 5EIQA 3HZYB 3CH1B 4WUUB 1MWAB 3IKCA 5D2NA 4N0UE 3THMH 3P4NA 4NM4L 5C0GA 1R6VA 4Y4KB 4Z7UB 2P8MA 2K7QA 4LVNB 4OCSH 5DEFA 1I1RA 4NHUB 2QADD 3G6DH 5D96C 2DB8A 5EBWA 1B0RB 3EO1B 2ADJA 3U9PL 4XMPH 4ZMAT 2AP2A 1VSCA 4HQQH 4G8FB 2J8UF 2VZTA 2DIBA 1DL7L 1A3LH 1IC4L 5E08L 1LO4L 4F8TA 4YHYB 2DD8H 5FO7B 3TYFA 3NTCL 1OSPH 5GGRY 4IIQB 4J4PA 3WNNA 1UM5H 4LPUA 3D87B 1A6ZB 2P5WE 5JR1H 2R0KH 1JL8A 3GKWH 4A6YB 2ZUQB 5HHQA 4I3SH 4LMQI 1NBZB 3K0WA 2HJFB 5FV2A 2JE8A 2ESVB 2V2XB 5T1KD 5BMFL 1BREA 1BWWA 2IJ0C 5ICXB 5BRZE 2WMPA 4PRPB 4NP4H 5JW4Q 1IC1A 1NKOA 3HB3C 3FOLA 5LGJB 1YEJH 2UUDH 4NRYA 1A7OL 5I1CL 2DLHA 3VW3H 3V5DA 3OG6B 3L95B 4KWUA 5GRWA 3DO7A 43C9B 4JFHE 1FGVL 1G7HB 1R24B 4JJHA 4POZC 2JJSA 1KFAH 3O8XB 5C0AA 3U82B 1LILA 3GK8H 3FOMB 1F00I 1K2DA 3CZFA 5CWSA 1ORQA 4N0FB 4N0RA 3B2UD 4NUGH 1I8MA 3KPPB 3LEVH 1HN1A 4P2YA 3CAFA 5ETUA 5JNYA 1TTUA 2VR4A 2IQAA 4AG4L 1J1OH 4J12A 3P4OA 3ULUF 4OCNC 1GAFH 3ULVL 4LSSL 1CE6A 4H0IA 3C5ZB 5HGHB 3U30B 3L9RA 4JRXD 4GOSA 3TC9A 3GKZA 2ZUSA 4BK5A 1ZLWK 3BEVA 4HIHA 1KLFA 4X7TA 3X12A 2D0HA 2FNBA 1K4CB 2FX7L 1SEQH 3QXAA 5KSUA 2L7JA 3PV6A 1Q9OB 3FQNA 3M17B 3O11B 3KDMA 3CUPA 4XNQA 3UO1L 3IDJB 5GGSB 4JFQB 3F5WA 4PJ7A 5IKCB 2UVEA 4BH8B 3TFKD 2NTFB 4XXDA 2F9BT 5EC2B 3RWEA 3TT3H 3VWKD 3LD8B 5AD0B 4QF1A 1X5LA 1X5JA 4WUUE 5DTFA 3FN3A 1RULL 1FFNB 4HBCL 3IJHA 4KTYA 5T1LA 2IPUG 2B5IB 4Z7UE 2H32A 3RWDA 2Y23A 4Z7VF 1LP9B 2W1NA 2WSKA 3C09B 4OQTA 4ZODA 5T3ZD 3HI6H 2R8SL 5EUOB 3TO2A 4PJDB 3BP4B 1W0VA 1NAMA 1NGQH 5EO1A 2OTWB 1Z5LA 1P4IL 2WV3A 3OF6D 2HRPH 5E4IA 5F96H 2VXTH 3MGOA 5SWSD 5BJTA 4J3UA 4LLDB 4NQVB 1HWGB 2BMKB 1WF5A 1CI5A 2OL3B 2VLLA 4M6ML 1CXIA 2PCPA 4NWTH 4JO3H 3K1DA 5DURB 1UXSA 3MRLA 3HLAA 1AQKL 2ZKHL 3WL9A 3FT4B 2Q86B 3T0EB 1CFQB 1NEZG 3RX8A 2V5TA 1IT9H 5CZVL 1RJCA 4KK5C 3W0WB 4JZNA 1KG0A 4H26A 4XHJC 3PWPA 3HZMB 4S1RL 2FX8H 4KKBD 1CZ8H 4OZHF 4AQOA 5C0IB 1FZMA 1CD9B 1TVDA 4CMMA 3DGGB 5I8EA 2VDMH 4U6XB 1GPOL 5MEPB 1FFPA 1A2YB 3HUJB 4XWGH 3NZHL 3UYRH 4F57H 5JIPA 3QWRD 3U48A 4MDIA 3DV6B 3Q6FB 3HAEG 1UWGL 1FNGB 1RZ8A 2QHRL 3QULA 1BQUA 2VXVH 4PRAA 1RZJH 1JFQL 1M7XA 4JY4A 3SBWC 4LDLB 3FRPA 4JM2B 3WXWH 2O5ZH 4OLWH 5DSCA 5D71H 2P7TA 5FV1L 3ARXA 2H9GA 2CK0L 3DSNA 5D7IF 4PDCE 5F9JB 4JZJC 3EDFA 3P0YL 4JO1H 1EXUA 3EDDA 3IETB 2X40A 2YKLH 1XCQA 4LBEB 3VH8A 4HXAH 4X9FA 3FB7A 1UZ8B 2F74B 1YECL 2BNQA 1EEUA 3TYGH 1RZKH 4LVEA 2X4PB 1VENA 1M7IB 3H9SA 1MJJB 4Y5VB 4AMKL 3UYPA 5LQBH 2HH0L 5KS9E 3MOAL 1N4XH 1KB5H 3O6FC 1TQBB 4Z9KB 5I1JH 1LDPL 4OT1L 1BMGA 4XMKL 2B7DT 4L9DA 4ONFL 4LIQH 5I1KH 3JWDH 5IT2L 2BVOB 3D3VD 2E6JA 5J11B 4AYFA 2FJFB 2AQ2A 2NY6C 4JO2H 1EO8L 4UQ3B 4I0KA 4QXTA 4U1GC 1QSZA 1UXWB 5E2VL 3BT2L 3FONA 1HHHB 1KJ3L 1LK2B 2D7NA 4X0KA 1IFHH 3RGHA 1PKOA 1LP9E 1VADA 1ZA3A 3JV4A 4U1MB 4X6EA 2LVCA 2W07A 5EUOE 1J18A 1X4ZA 4MAYB 2IPKB 3BSZL 1BIHA 2Q3ZA 2KBGA 4XP5H 1OGTB 2PW1A 3O9WC 2QSVA 4YE4H 5IHZA 1TZHA 1BBDL 3QRFM 4NKIH 3HE6C 1H3PL 2H8PB 1QHPA 3WXVH 4ELKA 1A3RL 4S1QL 4RQQB 1DBKH 3SBWA 1EZVX 4J3OC 3QSKB 3PP4H 1E4XI 3T0EE 3MBXL 4NOFA 3W0WE 4XNYH 4B0MM 5IFJA 3LS5L 1MCJA 1ZANL 4UINL 4CVUA 4JB9L 4XRCB 3T0AA 3VGDA 5H2BB 3D39A 3RWHA 1AIFB 4H1LH 3WFZA 4YHML 5SWQA 3GNMH 3SDCB 4PGJA 3KYOA 3GJEA 3QUYD 4HMDA 5D7JB 1IGML 3OB0K 3GI9L 2ZNWA 1S5HA 3HUJE 4U7KA 3T65B 2WBWB 4I3RH 2QV2A 5KVDL 4XGZB 5F6IB 2Y07L 1TVBB 4HIIB 1XF4B 5DJ8A 4LASH 3VG9C 1RJLA 1ZHLB 4MJ6A 1U8OB 1UB6A 3B5HA 2XA8L 3QUKB 3CFDA 2O5XL 3T09A 1XR8B 2HG5A 5KVGH 1IC5H 1QO3A 3KJ4C 4ZDHA 6CGTA 1IZJA 4G6FB 3NFSL 3CCHB 4FZEH 3VJ6B 4RFOL 1CLYL 4QXUH 4XBPB 5INCB 3BE1H 3P4MB 5MEND 3ABZA 2QBWA 4LKCB 3ZDYE 2FBJL 2YPLB 3KVQA 4HWZA 4JFPB 5E4EC 3OKKA 4C56A 1QNZH 1SVCP 1AE6H 4PRBB 3Q6GH 3QDJB 1INEL 4N5UA 4LP5A 1JMXA 3BRFA 3P9WB 2KPNA 1E27A 3ARFB 4D9LL 2J6EH 4DFHA 4QRUA 5F9DC 4DGVH 1YPZA 4Y4HA 3WO4B 4QRRB 4PJ9D 5DQJB 3HE6A 5DJ6B 5FYKL 1WBZB 2DBLL 4PLKC 3IAPA 5JW4N 1U8QA 1U58B 4HUMB 1BM3L 3GHEL 1NANI 3C8DA 4HT1H 2IH3B 4RBPK 1OTTC 4G80A 5F9WB 3KLAB 3H9ZA 3KNBA 1KTLB 5GGRB 1V3JA 3ILPA 1UGNA 2E27H 1F3JB 4LAQH 4LLMA 5SX4I 5DHVB 3PXHA 1PLGH 4M6AA 1YEIH 5TH2A 2ERJB 2Q87A 4QRSB 1A22B 1JPST 3NIFE 5C92A 4NO2A 2BOCA 1GGTA 3RUGF 1JPTL 1X9QA 1M7DA 3OX8A 3P0VH 3FQTA 5L2JB 4UOW0 4P9ML 3ARRA 1D5IL 4JRYD 1NUNB 3TH2T 3REWB 3C6SB 1FL6B 3V6BR 1I7UA 3ARGC 1QEWA 4CADA 4MJ2A 1VDGA 3CFIC 4HLZG 4V1DB 4ZUUA 2FIRT 3T3PF 5SWZA 5ICYA 3I3BA 4DK3A 2EDQA 3V6OE 1ZXQA 1OF2A 1YC7A 2IANB 3TIDB 3EYOB 1VERA 2X4TA 4HULB 4R0LA 1NCUA 1ZOXA 5H94A 1H0DA 5I1GH 3CXHK 2W65B 3HAEH 1L9MA 4LKXA 4BSWB 1DQJA 4LVHC 3GMRA 5I8KH 5ALBL 4LPCA 3RNKA 1IAIM 3C5JB 3DX9B 4HS6B 2GT9B 2UWEB 3L3DA 4HIXH 3ARBA 5LCVL 3LHPL 5ADOL 3TF7C 3U7AA 1CGXA 1KCUL 3K4DA 1WIOA 5J1TC 2FSEA 4HXBL 1I9RH 4J1UA 1OAYH 2FB4H 3QJHB 5TE6H 1GOHA 4JFDA 4NZTH 4P59L 5LG1A 3IB4A 2DWEB 3DIFA 4NSKA 1XGUB 1LGVA 2MHAA 2D9QB 3P9MB 3NACH 1W0YT 1QYGH 1QP1A 3MGAA 2YPLE 5C07A 4QGTA 1YN7A 3ROLA 5IB5B 3QUXB 5HD8C 1Z3GL 5K59F 4XPHH 1GIGL 2R1YB 4K9EH 1FAKT 1DUZB 3QDJE 5FB8B 1U95A 4ODWB 4X7SH 2VUOA 1IEHA 4K3GA 1MFEH 3BYYA 4CW1A 4OQTL 3LRGA 5IGXH 4RGNE 4LGPB 2HLAB 2V9TA 1FFOB 2RIKA 3S37H 4HPOH 4K8RL 4QRRE 3SDXA 5E5MA 5HDOA 5L6YL 1SBSL 4UU9B 3ARGA 2C1OA 3O3BB 2C3XA 4PYHA 4Y5XC 1YDPB 3RPIB 4FP8H 3LKOA 5DMGD 3HNTH 2ZUVA 1CD0A 2VIRB 5KTEL 3BDYL 3MNZA 3MRDA 1JGDA 3PWVA 3O2DH 4YEFA 5KZCB 4G8GB 4PJHE 4Y16B 2XKUA 2A74B 4RWYH 2HA1A 5JTWA 5BV7C 4KZEH 4MVBA 1JZ2A 1WBXA 1EAJA 2DBJA 4YGVA 4O2CA 4L9LA 2L4OA 1WV7T 1I3UA 1YEDA 1MCIA 3K4ZA 4GSDL 3M1BA 3QIBC 4R90H 1S5IH 1TITA 5GISL 1AXSA 4Y19B 1ZT4B 2G75A 3CFKB 3G6JA 1MWAH 3PWJB 3MJ7A 4QRPE 3K8KA 2CGRH 5DEZA 3T8XA 5I1DA 2CKBB 4V1DE 1P69B 5I73C 2NXYD 4JREC 2AK1H 2OI9C 3E8UH 2PN5A 3T4YB 4WFEE 2DAVA 4HFUH 1NFIA 4FG6C 4TNWK 5L2KE 3QUMB 1CD1B 3PGDA 1HH6B 4YBLC 4M1CC 4NDMB 3RX5A 3LQAH 1A7NH 4DGIL 5FGCB 4BYHA 2YC1A 3IDNA 3FQXB 5ESVA 5F7WC 5F1NA 1MUJA 3V0WL 4IHOB 1YEHH 4LHUD 4F7MA 1UWXH 4L8SB 5ESAA 2IBZY 4LSUH 4M5ZL 1IGTA 4NNXA 3LV3A 5FUOL 1OLLA 5T5FL 2UV3A 4W70A 4ZQKA 1XGYH 1FYTA 3QQ3A 2FLRT 3MZGB 4ZXBB 3KPRD 3R0NA 1BJ1J 2OR7A 1I8LA 1QLFA 4A6YH 4L4TE 3TO4D 1G9NC 4ZS6D 5FGBC 1X7QA 2FEEL 4KROD 4Y2DC 1NGYB 3CLEH 1HILA 2W9EH 2X1OA 1AC6A 4KVNL 4M7KL 1FGNL 5D9SA 4AEHH 4IOIB 3RTQD 3JV6B 3LQZB 4EVNA 3EHBD 4YNYA 2VSDA 5TDNA 4YHOL 4C83A 2AABL 4GG6E 3QH3A 3O45A 2OSLA 4JQXA 3GMOB 2EC9U 1CIUA 1IKNA 1AGBA 3MLRH 5C0CB 4PRHB 4B7IA 4XNZC 2ZCKH 4M61A 3UXFA 3UPRA 2ZCHH 3P77B 5D1ZD 4HK0B 1GGUA 1J8HB 2VWEE 1IEBB 1LHZA 5HTSA 4IMLB 3CVIH 4LNVA 1FNEB 5D96B 1NBVL 3RVXC 2D03L 3ARDD 4Q7DA 1P2CB 3AS0A 3D85B 1EUTA 1G9ML 1H15B 5D70L 4JQIH 3S88L 1YUHB 4G8GE 1JF1B 5GGVY 4YDJB 1D6EA 2EXWD 5H37G 3BO8A 1B0WA 3LEYH 3TA3C 3QEQB 1NMAH 1AXTL 1DR9A 2VAJA 1RZ7L 4UBDD 1FRGL 4ZD3H 2WINA 4HKJB 4MA7H 4TULH 4HLZH 4XBEL 3HG1A 1KCVH 1MCNA 1U8HB 3FT2A 3TIEA 4KJYA 4Y19E 1DEDA 3QUZC 4ZUTA 2B0SH 3D25B 2VXSL 3NCFB 4U4BA 5J7CC 3G5ZB 4L1DA 5B38B 3LS4H 4MA8L 3EOTL 2IAMC 5DD3H 3QO1B 4WHYG 3SKOA 5I17A 2R56H 5FGBA 4NQXB 4DK6A 3MV8D 4CDHA 2G2RB 5JQ6L 1UZ6E 5KN5A 1AD9B 1OPGH 1DLFH 4GXVL 4M7LL 5HI4D 1GSMA 4G43A 5FGCE 5KG9A 1NDMA 1I8IB 2GIYA 3OAUL 1R0AH 2XIDA 5BRZD 3VWJC 3HA0A 1MF2H 3TH4T 4ENED 4K7PY 2OL3H 4LPWA 4LGSB 2X6MA 5JPMB 1GL4B 5FYJD 4WO4B 2I07A 5FYLD 1FO0A 3GHBH 4KK9C 4WUKH 1L0QA 3JWOH 4WU5B 4BUGA 3GB7B 5E8NB 1R3KA 1YEFL 3VGAC 3RGVB 1OAUH 5ID0A 4MQSB 1IM3A 1OOAA 5EBLA 1MFDH 4WTXA 3SKNB 1NFKA 2W9LA 3PGCB 4HX1B 3ULSA 3QR2A 4CN6A 1ZHKA 2A6KB 1A7RH 4Q9RH 2A1WL 1Q9KA 3MXWH 2OJEA 1N7ML 2I9TA 2CK2A 1UVQB 2YPKB 4UT9H 3SDDD 2VRAA 5F7NC 3FRUA 2DI8A 1GC1H 3QIUC 4F58L 4BSJA 1MHPL 5CD5C 3BN9D 4P9HH 2B1HH 3DMMC 1E4KA 5C0FB 4XB7A 5C0CE 5IWLC 3GSVB 3W9DA 3LZFL 1I9IH 2F5AL 5TGBA 1MCOL 1QZ1A 2MMXA 3O6KH 5IJVA 3LN5A 2ZOKB 3QUZA 1QPPA 3W39B 5EZIH 1J8HE 3LH2H 3RJDA 4CNIA 2XA3A 4YQXL 3FQRA 3BPNC 4B7LA 3DRQA 2IAMA 3QIWD 4X99A 2IFFL 1FNLA 4Q97A 2P42B 2XWTA 5KS9F 1ADQL 4FNLL 5J3HC 4EXKA 3AREB 1F11B 5TPWH 1UKQA 4X7CC 4Y4KD 3VFTB 3FQWB 1JTOA 4Q6IC 3SGKC 5JXAH 5T33L 3PABA 2ITDA 4EOWL 2IBGA 1IGYB 1HEZA 2AK4A 1EHLL 1P6AB 4KJPD 3VWJA 3CMOL 1D5XA 4MQ7A 2P43B 4OZGF 4XT1C 3MODL 1K4DA 4HHAB 3CFJB 1JRHL 2NXZC 5I74C 1Q0XL 3VD4A 1ZA6A 1CD8A 1VFUA 3RZCC 1EGJL 4JRWA 1J0KA 1SJEA 1R3LB 2DTML 4P23A 4YUEH 2YA1A 3C8KB 5FA3B 4YPGA 3U2SB 5JW3H 3K4AA 4ZPVA 1QSEA 5E2UH 3HI5L 5IB2B 3KYMA 3JZ7A 2DKSA 4XVSH 3V0VA 5E8DH 4J3XA 2R69H 5AZ2H 3QAZB 3BWAB 4MLSA 1HXYB 2AXGA 2ESVD 1DDHA 5EO9B 3O6MH 3UJJL 4DUVA 5AYUH 4PRPD 1AC0A 3E6FA 1A4KA 1PFCA 1S7VA 5CHNB 5IBUG 5INDB 1BJMA 4YDIH 2LAAA 3KXFA 4DEPC 2CUIA 4HS3B 3FFDB 4W4OC 1DVFD 1FLRH 1OGAB 1FG2B 3U7YH 4JZJB 4EN3C 5SWQB 3QDAA 1DBMH 5FGSA 1GXEA 1SYSA 2HVJB 5HYIA 2OJZL 5J6HA 4X5XB 2CJUL 3O8XD 1MRDL 4JCLA 3RDTB 1HH9A 1NCAL 1PAMA 2K3TA 4JLRB 3OKMB 1TNNA 3HUJF 2X4NA 4GRMB 1MLCB 4NFBA 4QTHB 3D0LB 1RK0B 2V9QA 4ZAKC 5F1OB 2DM4A 4TQEL 4FFYH 4MJ4A 2A77H 1BGXL 3MACL 1EEYA 3O6FB 3KLHC 4UNVA 3TJHC 1U8IA 5EG6C 3IGAB 4MZ3A 2VDPL 3T1WA 5FOJA 4G8EB 3S5LB 2DWDA 4GRWF 1KPVB 1T5XA 5GGUB 1EBAA 4KQ4L 2C4XA 4LMQE 4MAUH 43CAB 5F7FA 1M05A 1PZUB 4EBQH 5TQ2H 5C70A 5IESH 4U1GB 5E56A 3TCLB 5BVPH 3BP7A 4I0PC 2ZSWA 1LNUB 3L5XL 1VHPA 4YHIB 4UOJA 1FQ9C 4XC1H 4OF6A 1KGCD 3ZDYF 2HWZL 4KHTH 3RHWK 2FECL 5FK9A 1XH3B 1CFVL 1YMHA 1MCWM 2ICWJ 4U1KA 1L0YA 3DOSA 4CVXB 5FO8B 3BKMH 2VB5A 4QGYA 4UILL 4M5YH 4W6WB 3O9WB 2Q1EA 4G42B 3QDGA 3QA3A 4K3DH 2NY3D 2APBA 3SPVA 3HI1A 1MEXL 1WZ1H 2Z8WC 3VXUE 3VRJB 3ELAT 5HYFA 3ZYOA 4LCYA 3NIDE 4WJ5B 2BNRB 5DWUH 3J7HA 4O4YH 4Z8FL 5ADPL 2Q8BL 5IMMA 4FQ2H 3ZYIA 4GLRI 1OAKH 1UWEH 2XN9D 4PB9H 1NCCL 2JCCB 3GSUB 3W5NA 5IFAH 1OAXH 2Q3AA 4MB5A 4KPHH 5SV3A 5DHVH 2YUWA 2EIEA 5DURD 2C4FT 3SDAC 1UCBL 2ICWI 1GGBL 2ZOLA 4IRSA 2HN7B 1LEKB 2PKDA 1L7IH 3W0WD 1WWBX 4NZUH 2YS4A 5KSAC 1IM9B 4ZTPL 3VG9B 5DJYA 2O93L 4F9LA 3FFCA 3VG0H 1RMFL 4PJIE 5E6IA 2EDXA 2PR4L 3NFNA 3VXTA 4GRLC 3TJHA 3QCVL 1FBIL 5DUPL 2JTDA 3SJVE 3PHOB 4AEFA 2F58H 3KHQA 3IDYC 3KJ4B 2BJML 3QCTH 5EPMB 5CEXB 3RIAF 3BW9A 4KRPD 3A6BL 1R5WB 3QBTB 3AU1B 4P2QB 1MIML 4JPVH 3MBEA 4J8RA 1V7MH 5B38G 4JFFA 4OZIB 4Q74A 4UIMA 4FQ1H 1I3RB 1J1PH 1A9EB 5E4EB 5E2JA 4MWFB 5A3IC 3LPWA 4J7RA 1FFQA 4WI5A 4DN3H 1S8DB 3JVGA 1HINL 2AXFA 4JDZA 5ITFB 3MYJB 3VGGA 4ZTOH 1OD9A 4PB0H 2XNAB 5DD1H 1NFDA 4QRTB 5HHPA 4ODXB 1DQDH 2BDNL 4U6YA 4HUWB 5HI3C 1ZHBA 1OWRM 2GCYA 3B2VH 5DQ9B 3BZEB 2HVKB 3BGMA 1I7RA 5GSVB 4U7SA 2GK0A 1PG7L 1NCTA 4G9FD 3VXSA 4FABH 1TJGH 1CR9L 1OCWL 5SX5K 3LRHA 3FB6B 3CU7A 2HLFC 1JNLH 5ILTL 3I85A 3KPSD 1GZQB 1VEMA 2AJVH 2EIDA 3F7RA 1JPGA 4S10A 2Y5EA 4XC3H 1PEWA 2WZPD 1NDGA 5CMAA 3M07A 1RURL 1H3UA 3K81A 3FAXA 3L6FA 1F4WH 2H2SC 2JKXA 3SCMA 1EO7A 4PJ5B 4IBLT 4RWHA 5JUEH 1FJ1A 4NC0B 1F3RB 3TZVC 4ZG1A 1AO7A 3AUVA 4GKZB 4U6TA 2IMNA 2APXA 4JPIA 1KEML 4FQIL 1F6LL 4GRLA 4JM4H 4XH2A 5DI8B 1F58L 5DUML 4XMLH 1ND0B 1KJ2B 4PJHF 3FZUD 4TTDD 2GQHA 4NKOA 5K9QI 1XIWA 1K8IB 1S7WA 2F53A 1M1SA 2W60B 3CDGA 1FO0L 1BLNB 3QXVA 4GKNA 4RCAA 2UZIH 1AY1L 1KT2A 1MRFH 1Q9WA 3MLSH 2ITCB 1QVOA 4M00A 1AJ7L 2NY7H 1PBYA 4Q9QH 3C8HA 2BSRB 1KOAA 4G7VH 2DQUH 4M03A 1CICC 3VE0B 3R06B 3G9VA 4OZFB 5D5MB 3ALWA 4LCWB 1YMMB 2D7TL 3B9KA 3W2DL 1NC2A 5D7JD 5J4MA 3MR9A 4FQHA 1V8HA 4OI7A 2CKBH 1M6OA 3H8NA 5EA0H 3TBVA 1HCVA 4ETYA 3D2UB 1KB9K 3I6KB 3B6SB 2FEEI 4HKXB 1R3JA 4P2QE 3QUMH 2ARJQ 1NUGA 1MJ7H 2R0ZH 3B5GA 4XAKD 1CQKA 4OZIE 4M1DL 3LSOA 5E8OB 1ZKAA 4LPXA 4ZUSA 4LGRB 2V7HB 4MMXC 2HJLB 4FXLA 4KI5E 4WW1A 2YK1H 3ORJA 1T7YA 1CT8B 1ZV5A 4CVZA 3UTZA 4QT5A 4OSUL 3V7AG 3HMWL 3VXOA 4IRJD 2YPLD 4FXKA 3WE6B 4XZUA 2YEZA 3QFJA 4KK6C 1A14H 2XFXB 1BAFH 3TZVA 5BCAA 3MMEA 3H6JA 5JOFA 1MFNA 4Y5XB 4WFGE 4V3DB 4PLJD 1MFCH 2X4SB 3ARFD 4N5EC 4WENB 3ZL4H 2WW8A 2CKNA 35C8L 1O0VA 4HJGB 5DJXA 3QEGH 2AJXL 3OZ9H 4GG6F 4DUXA 5I1IH 4HGWA 5CILL 3TVMC 1OVZA 1QBLH 2YBRA 1T04A 3WFCL 4PV8B 5HGAA 1IC7H 3GO1L 4OFIA 5B39A 1REIA 3BZ4B 3BKJH 3QIBB 3LKNB 2WWKO 4DCQA 1I1YA 4PJ5E 4QHLA 2QHLA 5LKNA 5BQ7A 1E6JH 5D6DA 3TPUA 3H42H 1IRAY 4LRNL 4YHZL 1CICA 3V52L 4Y88A 1BBJB 5C08E 5I73B 2MQ0A 4JQVA 3B8SA 4JREB 4HUXA 3FB8B 2OI9B 4YWGH 2IG2H 2HTLC 1MELA 1PY4A 4YBLB 4DVRH 1UB5A 1I4FA 3DX8B 4RGMC 1ZLUK 4X5WA 4U6VH 5HGBB 1X4XA 3QG7L 1KIQA 4KVCL 1X5ZA 1H3GA 4J6RL 1EJOH 5F1IB 3FO1B 3S4SA 5FIEA 4KQ3H 4V1DD 3W82A 4LVOB 3UROR 4JPKH 1CG9B 8FABA 5IJKC 3JWNC 5JXED 1U8KB 3H0TA 5ANME 3LKRA 2ZUWA 2E7MA 1UM4L 4JANB 2CRYA 4LLVB 2IAND 2KZ1B 4FA8A 1BZ9B 4F33B 3QZWA 4HGKC 4N8VB 3PHQB 4PS4L 1DQMH 1VESA 5DYOB 3NIGE 1YMME 4KRMB 2FO1A 1TCRB 3DJ9A 3JTSA 3NN8B 4OM0H 3BN3B 4GMTL 4Y2DB 5IQ7L 4TSAH 1UZ6F 4DZBB 2VDOL 1MHEB 3X11B 1ZEAH 5IB4A 5I9QB 3L3OA 1EIBA 3EYQC 1B88A 2B4CH 2CIKA 4LSVH 2JB6A 3CPLA 5I30L 3CVHB 4N5EA 5E95B 4ZFZA 2EIZB 5DMYA 3QCUL 4ODBD 4X6DA 4UNTA 2RCSL 4ZNEA 1AD0B 1EZVY 3U6RA 5FUCC 2W92A 3DVNA 5FM4A 4XNZB 2IADB 2C3VB 2CIIB 2ZSVA 5HVGB 4I77L 4FQCH 2GTZA 1VB9A 5EOQL 5GS0D 3FO2B 3OPZL 3U7WL 1PG7W 3HCVB 4MSWB 4DVBA 3PG2A 5CLTA 2AJZB 1FIGL 3RVUD 3QUXD 1K3IA 3P4LA 1EFXB 1FVDA 2BRRH 4ODTL 4TUKH 3GSNA 3MV7B 1NCWH 1TZIB 4AEEA 4ZSOB 3DX6A 1BQHA 2AEQH 5T5NG 3QI9A 3L5HA 1UFUA 1WAAE 5F3BA 2DQGH 5FF6B 1JHKL 2VN7A 1U91A 3TA3B 5L9DL 3QT2A 5DA0B 5EU6B 5MHSD 3RWIB 3VFOA 1NC4B 3RIFK 5I15H 2E8YA 4NQCE 5IJVB 3O6LH 3OXRA 2ADFH 5KZCD 4Y16D 2EYTA 1RHHB 3EFDH 5DRWB 3WHE1 3EGSB 3KYAA 1U8MA 4N0CC 5B21A 2MQCA 2VZ1A 1JRHI 4L8DA 5D2LA 4OKVB 3ZTNL 3OR6B 3PQYB 4HK3J 4NM8H 3JV5A 1N6VA 3Q5TA 1J11A 4ZO7A 4NWUH 4YK4C 1C12B 2A0LD 4HFWA 4GW5A 2F8OA 4Y5YC 3DX7A 1D9KC 1MFAH 2RFXA 1CLCA 4JPWL 1WISA 3EYSH 4NZJA 3CXDL 3SKMA 4QTIH 3NAAL 4MQXD 1WFNA 3P11H 1JI1A 4DUWA 3NCMA 2QSCL 4K7FA 3ZE0E 5CD3B 1U8PB 5TF0A 1LK3H 3VGAB 1ZE3C 4Z7WB 4DAGL 2NLJA 1H5BA 5D72H 3C5SB 3RL1A 4FFZH 5CEZL 4HWBL 3ECBA 1WFOA 1FYHB 1Q1JL 3GFUA 2DQEH 5D7LA 1H3WM 5GPRA 2W0LA 3PDOB 5BS0B 3OJDA 3U46A 4ZXBD 1MI5B 5DMKB 3WFBL 3H7LA 4KAQL 4NUJB 1UH3A 4FQJH 3QIUB 4KY1L 3BEWB 5HJ3B 4ZYKB 3N50A 4NNPL 3DMMB 2HFTA 4YHKH 4JHWL 2XQBL 2J5LC 5I1LA 5GRJH 5FGRA 4KUCD 4OD2B 3QPXH 4O9HL 3BD3A 1JHLL 2FD6H 4NBZB 5GGQL 2I27N 1A5FL 2DDQL 4KJQC 4MJIE 4JRXA 5C0AD 4HG4K 2Z8RA 4PGBA 2VITB 4M6NH 4GS7C 4NBXB 3TPKA 1YJDC 3N85L 1NQBA 4N0CA 3EYFB 1HHKB 2FECI 3H9HA 2CXGA 2CDGB 5F93C 5LAXB 4PRHD 3ULUC 4R7NB 1LO5B 2WIIA 3MV7E 4X8JA 5IFHL 3EO9L 1F90H 1TJIL 3IXTB 1T0MA 1I3GL 1J8HD 3MLUH 2FR4B 5MERA 3BAEH 5L88L 4Q6IB 4Y5YA 4HGMA 4Z0BL 5FKPA 5DZNA 1IKFL 3SQBA 5DS8A 2BSTB 2NY0B 3OKDB 3VWKA 4H8WH 4UTAH 3D85D 3U4AA 3QFDB 5EU6E 4RZCA 1CGTA 4L3EB 2CRIA 4BFIA 3ULVE 1RIUH 1NCBL 1UJ3C 3FTGB 4OZ4B 5FHAL 2NXZB 5I74B 5HYQB 4WEUD 3RZCB 1R3HB 3MA7A 4MB3A 2GSIA 3I6LE 1QSFB 3QEQD 5LVEA 1BVKB 4AENB 4JN2B 1DBAL 3G5VA 3HNSH 2GTWB 5EC1A 1RUKH 3MRNA 4UDUB 1NLBH 5JW4R 1MCHA 2IPTL 4KV5F 1HKLH 3OF6A 2VLKB 5T1LD 4D9QD 4ODVH 5SWSA 2EH8H 5I0DA 2Y5TB 2NZ9D 4AEIL 4HMCA 5H8DA 3TBTB 2J88L 3QHFL 3WFEL 4IRZL 5DD6A 5FFLA 4NQTA 3HB3D 2EDTA 1FSKC 4WU7A 4DEPB 1XFPA 3SDYL 4OJFL 2EKJA 4UI2A 1QR1B 4ZO6A 3BKCH 3RU8H 4H0GA 4EN3B 1B4RA 4POZD 4XCEB 4Z7WE 4ZNCD 5DHYA 1I8KA 2FHCA 5I76B 4NGHL 3IU4L 1T03L 4ZAKB 2DI7A 3QQ4A 4HEPG 4FMKA 2FZ3B 3DTXB 4M9PA 1MI5E 1AP2B 4OV5A 5HHMB 4PJIF 4FQLL 4RMQA 2E6PA 4WHDA 4NQDE 4I18A 3ZT6A 1XGQA 1NL0L 3T4AA 1I9EA 4UDTA 1G7JA 2X4OA 4U31A 2CLZB 1CBVL 5F7YC 5IBTL 4LPVA 4I0PB 1IE5A 5IVZA 3S36X 5HYJE 5I19L 1A9BB 3AMLA 4WY7L 4WRLA 3E6HA 2AI0L 5EU5A 4WNQB 4G7YL 5IVXE 2IF7A 1IBGH 5DDHA 1J0YA 3BPCA 4RISH 1N6QH 4TNVF 3O3AA 2ZCLL 1T1XB 3V79C 4K3EH 3D3VA 1E4XH 3A6CH 4ZFFA 5HYSG 3PJSB 3ZKQD 3H9SD 1IAKA 3UBXI 1ZS8B 1AGDA 2NR6C 2YXFA 1HZHH 2XG4A 5DK3A 5CBAA 4N0YL 2OYPA 3IU3A 4LPYA 2R2EB 4L3EE 4JKKA 5IEKB 1EH9A 1NSNL 4PJEF 3CX5J 3IRZA 2APFA 5C6WH 5I71C 3BVNA 3REVB 4LF3B 1QSFE 4Q2ZA 4D0CB 1NCDH 4MD0B 1MCKA 1JPSL 1C08A 3LVEA 1U6AH 4Z76B 2GAZB 3LPGA 3SDAB 3HPJA 1L4IA 3FCTA 1F2XK 3X14A 1YQVH 4KK5D 1ERNA 4G59A 2VLKE 2Z92B 4XHJD 5K9KB 1TXKA 5KSAB 5K9JL 2DYPA 1J5OL 1JHTB 3AXLA 4IS6B 4JKWA 3WIFA 3BXNB 4M8QB 5HHOA 3SQOH 3MCKA 5HHXL 4PJBE 2MPAL 3SHSA 1DN0B 1T1ZB 1VFBA 4XNUL 4U1SB 4YFEA 3BIKB 5B22A 4PFEA 3CD4A 1MPAH 3GIZH 3RI5F 4XP4H 1R5IB 1KJ2H 1SEBB 2MSPA 4XVTL 4Q6YA 3T2NH 3S36L 3MOBL 2VLJE 3BFOA 3QUYA 3RJQB 4PTUB 3MRHA 3WNOA 2OQJA 5EZOL 4BSVA 4P2RB 2DQDL 5DGQA 1VPOH 5E94B 3V4PL 3CXHJ 2FYYB 3I9GL 3IS0X 5DJ0A 3TBYB 1HYRC 3I50L 1FE8H 2IFGA 3RWFB 1JZ6A 1OGAD 1AFVL 3MRPB 4UUJA 5BVJB 1W2KT 4HS8L 5HHME 3UJIL 5GRXG 3KPLB 1NANH 3V95A 4FTVA 4QOKA 3RDTD 3JXAA 1TENA 4OZFH 4O51B 1I1AC 2R0LH 1BOGA 3KJ6H 5SX4H 2APTA 4WGWB 1LO3H 1RZJC 3GMQB 4HF5H 2OP4L 3IS1X 3RWGA 5MENA 3GMLA 3O6FD 1UA6L 2ICWB 2J4WL 5TDOB 1OM3H 5T5NF 1UM6L 3MLVH 4ZUWB 3EO0B 2NX5B 4M4PA 1K85A 1S9VB 5BZDB 3DYPA 1UENA 1BD2E 1YA5A 1B3JA 5B8CC 4KI5F 4R4BB 2NY6D 2HRLA 1S9XB 2OZ4H 1HQRA 3MZTA 2PO6C 5CIPB 4ELME 5KVEL 1JWUA 4HCRH 1CXLA 1ZVHA 1RZKC 2GEEA 1N3NB 3Q1SL 4NYLA 4PJ9A 3MA9L 1IGCL 1N64L 4PJCB 3JTTA 4F2MA 5EORL 5KJRH 2HKFL 3C08H 4KC3B 4JG1H 1KBGL 5D93B 3L3JB 2R4RL 1GGIL 3O9WD 1PYWA 3O2WL 2JIXA 1UACL 3FQUB 4I2XE 4IDJL 4KUZL 1C5DA 1MJ8H 3HE6D 1KC5L 5TDPB 2A73A 1Y18A 4QYOB 5IB3A 5D2NE 2FJHA 1HQ4A 1I1FB 1T6VN 3WMSA 4HUNB 3DROB 5ACZA 2BNRD 5T3XH 2C7UB 1IQWL 4F7TA 4XCCL 1U2CA 4JRYA 3FMGL 5DC9B 2R9HC 1HOCB 4OKDA 2HJKB 4NQSA 4NHCH 4X6CF 3T0BA 1G7IA 3F58H 4QHUA 4M48L 4X6FB 4ZS7L 3LKSA 2BVEA 5FYKE 2Z93A 4DOHE 2ADGA 5JHLL 5IW1B 2G5RA 1I1AA 2DM7A 3DUSA 2FHFA 2Y25A 1Z9OA 4NN7B 2Z31B 4I48A 5L7XH 3SGEI 1IM9D 1OLZA 4IJ3C 3MLTA 1G1CA 1CXEA 1Y0LA 1AI1L 4JKLA 4QHKJ 1J05A 2YZ8A 2Q8AL 5DRXA 3EOYG 1UWXK 2HFEA 3BKYL 1QG3A 5HY9A 2AGJH 1A4JB 2C3HA 2EDOA 4DN4L 2XI9A 2HKHH 2AJYL 3CC5A 3NOIA 5DR5L 1ZWIB 2DQFA 1OT1A 1I7ZB 4TUJA 2PO6A 4R7DB 4M3JA 5TQ0H 1JNNL 4D8PA 4CU6A 3NIGF 4NM4H 5TE4L 4NZRL 2FIKA 3S96A 4HDIB 4AQ1B 4RA0C 3ZLQC 3N06B 1YZZA 1KB5A 3U9PH 3MGTA 2Z35A 3MCG1 1Q38A 5BXFB 3KPOA 1GOGA 5EZLB 3P30L 5C71A 1DL7H 1KJMB 1QR4A 2XG5A 1IC4H 5E08H 1LO4H 3TVMB 1W8OA 3CVHH 2NX5E 3GSQB 2N4IA 3RKDC 4WHCA 4WFGD 5ISZA 4PLKD 4PJ8C 3NTCH 2NY2C 1NUFA 3SO5A 3ZKXC 4JFEB 4GW1A 1CL7L 3WSQL 5IROA 1OTTD 1NAKL 3QXDB 1P7KA 4MD4B 3UZQA 4OCYL 4PJAA 5T3ZL 4CVWA 1AKJB 5DA4A 2XICA 1A1OA 2DQIL 5M7QA 4X6BA 5DJDB 2XZZA 1KLUB 3TNNA 1P1ZA 5I8CA 4E0RB 5F7DB 5DVMA 5BMFH 5ICZA 3RA7L 1C16B 2ZJSL 1G7MA 3MUJA 3ET9F 5I1AA 1RJYA 2FLBT 1A7OH 5IF0B 3TJEL 4RGMB 5I1CH 1QLEH 3C6LB 4U1NA 4L3CB 2H6PB 4HPYH 5IG7B 1D5MA 1WAAF 2GUOA 4LSQL 5IMOB 1A6UL 1FL3A 3ARGD 1FGVH 5BZWB 1G6RL 4MNQB 4LCIL 2JLLA 2Y06L 3BISA 2RHEA 3VRIA 4YZFF 1S9YB 3ALXA 4H1LA 3WNMA 3WDJA 5EU4B 4YAQB 4AG4H 12E8L 4OAWB 5F6HJ 3ULVH 1W0WB 4LSSH 4MNGA 3IJSA 2VISB 4OF3A 4JY6A 1T1WB 4F9PC 2PW2A 4DQOH 1KELL 1X6NA 1EAPB 1IARB 1XT5A 2VH5L 4H5SA 4J23A 1M71A 4S0UC 4LRIA 2WK2A 2CRZA 4OF8A 3VXPB 3FB5B 4LCWD 4FQXC 1XR9A 1YMMD 4LHUA 4HKZB 1WGOA 3UO1H 3WUWA 1RV6X 4ODHH 4YO0A 3CNKA 4LEOB 1UJTA 5IOPB 4NJAL 1T21A 4DZ8B 4PJFB 2I25N 3EYUL 3EDEA 2KZWA 1Y6MR 3D2UD 3KPRA 5TF1L 4LFHD 3QNXA 3ZE0F 4LQFL 1RULH 2R23A 4G8IA 1NKRA 3TO4A 5F89B 2ICEA 1CFNB 1VFAA 2YRZA 3UTQB 2YD2A 3HPLA 3GJFB 4OUUA 5HD8D 1BX2B 2XPGA 4OCSL 1HSBB 4B41A 3G6DL 2J6EA 3O4OC 4YDLC 5JHDB 1IL1A 3PL6C 3T2PA 3K2UL 5DFVD 3LEXA 5DK0A 4X4XB 3OQ3B 3ILQC 5IR1B 3MRGB 4JDVA 3MRJB 1JUFB 2HFFB 5DC4B 4PJGF 4XNMB 4M6MH 5KSBA 3OGCA 4ETQB 4JFEE 2YA2A 1HHGB 2GITA 5E7FA 4KKAC 1OSPL 3HC4H 1AQKH 3S35X 2ZKHH 2EDYA 4F8QA 2BNQE 5D1ZA 5CZVH 5AAWA 1DANU 1V5JA 5JR1L 1JK8B 1N0XL 4K9EC 1YC8A 3MO1A 2BC4B 5IB1B 3QO0A 1KIRB 3VGHA 3ZKMD 5T3XD 2XTJE 1GPOH 3QIBD 1QA9A 2P47B 4P3CH 3NZHH 4YK4B 5I18L 1QRNB 3C60B 1NEZA 4N0UA 2P8PA 1FN4B 2AV1B 5C0BB 2VL5B 1F4XH 3K74B 1UWGH 3QJFA 3VW3L 2QHRH 1D9KB 1ZLSL 3KWWA 2CLVA 1JFQH 4FQXA 1KFAL 4L4VB 1TTGA 4MNQE 1WLHA 4OQ1A 5E1HB 3HRZB 3ROOA 3GK8L 4P2OC 3QEHB 1KN2H 4FG6D 1JE6A 2J8UB 4M1CD 1ZT1A 3GSXB 3L1OH 3LEVL 3HAEA 2YZ1A 1ETZA 3RWCB 1J1OL 3GIVB 4M62L 3P0YH 1PX4A 3WIIL 3WS3B 4JR9L 3VFRB 3AM8C 4TUOB 5D1XB 2OS7A 1HWHB 3ZTJG 2RJMA 4XBGB 5DK2B 1YECH 3HG1D 4ZFOA 3NCYS 4M9OA 4AMKH 1QLRA 4JHZA 2HH0H 4XVJL 5EN2B 3MOAH 4X4ZA 1F3DH 3VRLE 3U0PA 2DOCA 1LDPH 4OT1H 4LL9A 4XMKH 5BRZA 4ONFH 1FZKA 3VMNA 5IT2H 4Y2DD 1X44A 5FUCE 5ID1A 2AJUL 4ORGA 1UADC 3BD5A 1WUNT 1EO8H 1JNHA 2XXCB 5E2VH 1WBYA 1CFSB 4GG8B 2Y36L 4EUPB 3VFNB 1KJ3H 3MFFB 2VQTA 3DGCR 3MRQA 3OKOB 4B53A 1KNOB 3KS0J 3EOAA 4HZAA 1EEZA 3RVVC 3IF1B 2WP3T 3BSZH 4UV4H 1A47A 5HVHC 1A6PA 3SDDA 1D5ZB 4XXCC 2VXTL 1C5BL 4YIQB 1A6AA 1BBDH 1FG9C 4JFYB 1H3PH 5JPNB 4WW2A 2AS5M 1TJHH 3RVXD 1LQVA 2VZSA 2QQLL 5E6YA 1A3RH 3MX0A 1EFXD 3O2DA 4S1QH 2J3SA 4LCUB 4PY8I 4P2OA 1S7RB 2I5YH 4QCIA 4Z7OE 4C56E 3L3IA 4KKLC 3BWUC 1UJ3B 3G08B 2Y9RT 5GZOC 4R8WL 3MBXH 1T0PB 3LS5H 1XGRA 2BVQB 4UINH 5JA8B 4JB9H 4LLYB 2FX8L 3C2AL 3RX7A 1DE4B 5K9QG 1LEGA 4LCCB 3RWJB 3TA3D 3MXVL 5I1EH 4HW6A 2GJZB 3P73B 1HHJB 3QIWA 3F7VA 1OP9A 4AIZA 3QHTC 3AM8A 1YPZE 3HZYA 4YXKL 5F97E 2VDML 3CH1A 4WUUA 3GI9H 4YPJA 1MWAA 1NC4D 3FRPG 5IVXF 1QRNE 2YWYA 4XWGL 3QUZD 3C5ZC 1T5WB 3U30C 5KVDH 2Y07H 2ZG1A 5C0BE 2DLTA 2VDNL 4K71C 4OBRA 4Y4KA 4Z7UA 3VDBA 4Z7VB 3OAZK 2IAMD 4N9GB 2AERT 2NY1B 4NHUA 3SE8L 1GH7A 2R4SL 3VFGL 2PYEB 1B0RA 3EO1A 4L4VE 2XA8H 3PQYD 4U3XA 2UYLB 3AY4A 1ED3B 4AL8H 4RIRB 1FSKB 4G8FA 1J10A 4W81A 5EU7E 3ZSTA 4Z6AT 3MV11 5DXWA 3STBA 3NFSH 4RFOH 1CLYH 4O2FB 2DQJH 5FO7A 2ED7A 4N8CL 2VQ1B 2AK4D 4JDTL 4JO1L 2QTEA 3VWJD 3LD8C 3MCLL 2V5RA 4IIQA 2R0WL 1S9KC 1A6VH 2Z8VC 2P44B 4DFIA 4KKCC 1A6ZA 3TNMB 1SJXA 4A6YA 5SWZE 4KK9D 4OZHB 1NBZA 4D9LH 3RKPA 2HJFA 4MD5B 5DVNA 2V2XA 2ESVA 1N4XL 3EBAA 1PX3A 4DGYL 1KB5L 4AH2B 5I1JL 5ICXA 1N26A 4PJBF 4PRPA 1X5YA 3R1GL 4RAHA 3U4EB 5LGJA 2WNGA 1YEGL 3JWDL 4M7LT 4PUBL 1EMTH 5FYKH 5DLMH 2DBLH 1BM3H 3GHEH 4OM1L 4X9IA 5F8RC 1OL0A 5BS0D 3L95A 4YHPB 1MI5D 43C9A 2ADIB 5LGKA 1G7HA 1R24A 4PGEB 5C86A 2K9UA 3O8XA 3QIUD 2P5EB 3FOMA 1JI2A 5IQ9B 1E28B 5CD5D 4OI8A 4N0FA 4IOFC 5DZLA 3DMMD 4KMLB 3T0EC 1CFTB 3KPPA 5J9PB 2WWMC 5D7IB 3G5XB 2DIJA 1JPTH 1RVFH 2F19H 4P9MH 2PETA 4WI9A 1D5IH 5HGHA 3C5ZA 3WBDA 2EE6A 4GT7A 1GOFA 4YE4L 1K4CA 1MCSA 5C07E 2P24B 2X1PA 1T2XA 3GGWB 1MCLA 3I3DA 1F6AB 1F8TL 3WS6A 5J3HD 1F4YL 1RJZB 3BI9X 4P9HC 5E99L 1Q9OA 3M17A 3O11A 5E2TL 3V7MA 4TRPL 4X4YB 4XPFL 1JZ4A 3IDJA 5FAAA 5HHVL 3DETD 4JM2C 2E9WA 4FMFA 4JFQA 2VKXA 5GGSA 4D0BB 3LQMA 5IKCA 4BH8A 2NTFA 5EC2A 5AD0A 4ELMF 1JJUA 2J8HA 1U9KA 3IRPX 4GBXB 3SDXE 2F15A 2X9WA 3DV4B 1FFNA 1RI8A 1KPUB 2X41A 4EKXA 2NXZD 4I3RL 1DSFL 5CIPH 4JFXB 3LHPH 5C0NC 5ADOH 1KCUH 3RZCD 4Z7VE 3O3EB 3IDIB 4S0TD 5FA4B 1LP9A 4LASL 5JW5B 1QSFD 5CBEB 2PYEE 5EUOA 1NCNA 4PJDA 3N1QC 3BP4A 4P59H 4PTTB 3WJLA 5KVGL 1CXFA 1IC5L 3CFCH 1Q94B 2OTWA 4CN4A 1TQBC 1CK0L 1DFBL 5GS2H 4LLDA 4NQVA 3BE1L 2EDRA 5HPOA 2BMKA 1K5NB 1KTKE 2OL3A 3DUUB 3CSGA 1NBYB 2I9LB 1N8ZB 1AXIB 3FT4A 2MCG1 1QNZL 2Q86A 1KULA 1T1YB 5F7MC 1CFQA 3T0EA 2ICCA 3W0WA 3EOBB 3HZMA 3UBXB 4MZ2A 4E41B 3AAZB 4EN3D 5C0IA 2J6EL 4PP8C 1DCLA 2V5YA 2X9XA 3DGGA 2BVYA 4MAYC 4K8RH 4U6XA 2Z0BA 4ZO9A 5MEPA 1SBSH 4OGZA 3OAYK 1A2YA 3HUJA 3K7UA 4Y1AB 4PY7B 3SGJA 4OLVH 4ZAKD 1DEEB 3DV6A 3UDWC 5D7KD 4EEEA 5FM5O 3Q6FA 1FNGA 5KTEH 3BDYH 3KPTA 9CGTA 3DO3A 5HHMD 3KLHD 1RIHL 4WI6A 1FYTE 4CL7A 4LAQL 2HAZA 3IDXL 2P5EE 3D48R 3TBWB 1YEIL 1UKSA 1KB9J 4JM2A 4PP2B 2VDQL 1OHQA 5B8CB 1QBBA 2V2WB 2Y6SC 3BP5B 3BDBA 3RNQB 4U1HB 3ZYZA 4I0PD 2G9HB 3DHMA 5F9JA 4P49A 5GISH 3P0VL 4NQEB 2GJ6B 1XEDA 1WT5C 3MLYL 3SDCC 3WDHA 4LU5H 1RK1B 1CL7I 3IETA 2BCKB 4LBEA 1LWRA 2R1XB 2R2BB 1UZ8A 2F74A 3EYVB 1ZTXL 2X4PA 1M7IA 1MOEA 1EK3A 1MJJA 2VN4A 4JEGB 4Y5VA 3OJMB 2MKLC 1G7PB 1E4JA 2DI9A 3ZYJA 5A2FA 1XCTB 4DGIH 3BQUB 5JORB 1VACB 2QSTA 2BVOA 2IWGA 2V17H 3V0WH 2FJFA 3VXSD 5D1QC 4M5ZH 3BH8B 4UQ3A 1UXWA 5I6XC 5T5FH 4WTZA 1HHHA 1HSAB 3R4DA 1MY5A 3PP3K 3B43A 1KCRL 1LK2A 3MRRB 4HIXL 4QHNB 4Z78B 4ZFOL 3EDJA 4U1MA 5C0RL 2EECA 3TBSB 4OFYD 3RUGB 3O4LB 1YEKL 4RAUB 1OD7A 4MAYA 2IPKA 1NGZB 3SDAD 4PJ7F 3WDIA 1OGTA 4RGNC 4KTEL 2GKIA 5DO2C 1H3VA 2BVUA 3HMXA 4KVNH 4Z77B 2FATL 4M7KH 5KSAD 5HVWA 4DW2H 5FYJL 3U4BL 5E1AB 2H8PA 2AABH 1QYGL 4GRLD 5FYLL 5FYKD 3OHXB 4RQQA 4HIJB 3V6OA 2EDBA 1P84J 3NCYP 4NO0B 3MNWB 1HXMB 1QFPA 3QWOB 4P46C 1DQQB 2PXYC 2ERJC 4XRCA 1MFEL 5H2BA 1AIFA 1G0YR 3SDCA 3I84A 3WIHL 2QQNL 5D7JA 4HPOL 5A3ID 4P2RD 1NBVH 3KG5A 2D03H 4Y8DC 4Y1AE 3T65A 5GRVL 4C4KT 4XGZA 1KENL 1TVBA 4HIIA 1QKZH 3HNTL 3L5JA 1RUAL 4L29B 4QO1A 2VZUA 3W11C 1XF4A 5EO0B 3SE4C 4YR6B 4M93C 3S88H 2AJ3B 4PRIB 1ZHLA 3O2DL 5CSZB 1U8OA 5MEQB 5E2WL 4EIGB 1PKQB 2WY3A 5HI3D 2EYRB 2VR9A 3OR7B 1SYVB 4RWYL 3QUKA 2VC2H 3HN3A 4TOYL 1XR8A 4YXHL 3OKLB 1U2HA 4F37F 2NY4B 4PJ8B 1FRGH 1BFOB 2DS4A 4MCZB 3P0GB 3VJ6A 3CCHA 5AZEL 4XBPA 5INCA 4QY8B 4XBEH 2HLFD 3EZ8A 3P4MA 2NY5L 4GAYB 4LKCA 2GJ6E 2YPLA 2VXSH 4WFFD 4U6HB 1WSST 4JFPA 2NX5D 3RBGA 3UTPD 4MA8H 5HDQL 2P1YA 3VFWB 4PRBA 3QDJA 2LVEA 1T80A 3GJFH 1QFUL 2YPVH 5HDBE 4PRNB 1YYLL 2H2SD 2XKSA 3E8UL 3KPNB 3ARFA 5IMLB 1U0QA 1WITA 3EDKA 1U92B 1CDCA 2AJSL 4M7LH 1RFDL 5J1AB 5BOPA 4OGYL 4RGOH 3QFJD 1U3YA 4MJ5B 4E9LA 3LQAL 4G6KL 2VKWA 3TZVD 5ALCL 4QRRA 4MHHG 5J56B 1K6QH 5DQJA 4ONHB 5DJ6A 1ODAA 1WBZA 1U58A 1YEHL 3JSSA 4HWEL 2IH3A 3KLAA 4DKAA 3T3MF 1KTLA 3F8UB 5GGRA 1AGFB 2OTUB 4TYUA 5CGYC 1F3JA 5DHVA 4HUVB 4HIEB 4X98B 3OJ2C 3QUXC 4LEXL 2EYSB 4QRSA 3IYLW 1JGUL 1YEFH 4FOMA 3WJJC 5DJ2B 2HYMA 1OP3H 4GQ9L 2MWCA 4NT6B 1IAMA 3QNYB 1JGEB 5L2JA 1ZMYA 3MTRA 2A1WH 2VWEC 3UTTB 1MJUL 3REWA 1N7MH 1YY9C 3C6SA 4D0DB 2NW3B 1AQDB 1FL6A 1L7TL 1CICD 4FXGB 4G5ZH 4URTB 2AW2A 3ZHLA 5FOBB 4V1DA 3HZVB 7FABH 2EXYD 4GMSL 4NKQB 1BPVA 4P3WA 4RSVA 1MHPH 5JXEA 2QQKH 3DRTB 2F54B 1W72L 2IANA 3TIDA 3AC0A 3EYOA 4ODUB 5JOPE 3MLRL 3LZFH 1C7SA 2F5AH 1MCOH 1QSEE 3SE9L 5JOEA 2W65A 2K7PA 1Q0YL 1QFWL 5D8JL 4BSWA 2WAHA 4YQXH 4DKDC 1TFHA 4U1LB 2X1XR 2P5WB 3C5JA 5JMRA 5CINL 2IFFH 4HS6A 2A6JB 3O4OB 3L3HB 2GT9A 2UWEA 4YDLB 1WWCA 1L6XA 3ZE2F 3PL6B 3MRCB 4R3SB 1ADQH 4S2SB 4FNLH 3F7YB 3X13B 1X6LA 1QOKA 3KXFE 3MLZH 4JQIL 2GFBB 4KK6D 4N1HB 1YNLH 3QJHA 5FHBH 5T33H 1IEAB 1OQXA 5F9OH 4EOWH 1MCQA 2DWEA 3VXMB 1XGUA 5EZJB 4GUPB 1Q9LB 3CMOH 4MX7B 3OTTA 2W0FB 4N5ED 4TULL 3MODH 4JN1H 3OSKA 3U9UB 2YOCA 1JRHH 4PGDB 1QHOA 3I2CL 1Q0XH 3OXSB 3VA6A 3L3GB 3TVMD 5K59E 5IB5A 1EGJH 3QUXA 4EUPH 3QRGL 4ZOCA 2OM5A 3WHE0 2R1YA 5DD3L 1YNKH 1DUZA 4G6ML 5FB8A 4ODWA 4WEMB 3HI5H 1FNSL 3WV0A 3UJTL 1AKJD 2HLAA 4Y4FB 1CGWA 1FFOA 1S7TB 3ULUH 4N68A 1S7UB 4P4RB 4UU9A 3O3BA 1YDPA 2UY6A 4M6OL 4XNXL 3RPIA 4I4WB 4UT7H 3UJJH 3WFDL 4Z7OF 5DJZB 2VIRA 2HTLD 5DVKA 3DYOA 1J7VR 2OL3L 3RVTC 1S7XB 2VYRE 4G8GA 4Y16A 2A74A 2VOTA 2EZ0C 3EJYC 2YSSB 1J0IA 1ROWA 3JWOL 3IVKB 5FEBA 1YPZF 2CJUH 3QDGE 1MRDH 5KSVB 4MNQD 1NCAH 1QFWM 3TT1L 4ZOEA 4Y19A 1ZT4A 3UTTE 3CFKA 3PWJA 1JCKA 1BGXH 1G1YA 2DRUA 1G7LB 2CKBA 2G60L 4P5TB 2VDPH 3VFUB 3T4YA 1FL5B 4WTWA 4PRDB 3GI8H 4GW4B 3QUMA 5DJAB 1CD1A 1HH6A 2F54E 3LAFA 2F8VA 2R15A 1NPUA 4NDMA 5LXGH 4APQB 2X2YA 4KDWA 2V7NB 1OW0C 3EYQD 5ABDE 4PLNC 4K3JL 5EWIH 5F8QC 3TEUA 1P4BL 4AIOA 3FQXA 2E7BA 5E24E 2HWZH 2DQHL 1VCAA 2PYFB 4IHOA 5DVLA 5JZ7C 5HHNB 4L8SA 3O0RL 1FCGA 4M7JL 1CFVH 3P40A 1G9EA 1V7NL 4EDXB 5HVHB 4ZXBA 2NZ9C 4UILH 2XWJB 5K9OB 1EO5A 3ARYA 4K23L 5J57B 1MNUL 4D2NA 4WV1B 25C8L 2B4CC 1NGYA 4XP1H 4JFFE 3KR3L 3VXME 5D7LD 3X17A 1I3VA 3O81A 1RHFA 5JHDD 3S7GA 1EHXA 3QXWA 4IOIA 3B5TA 3MLWH 5ADPH 2Q8BH 3I75B 3JV6A 3LQZA 3T0DA 1N59B 1NCCH 4LNRB 4PV9B 1NFDE 3GMOA 5CEZE 4WWKC 2XZCL 4WO4C 1WK0A 5C0CA 4P57B 4PRHA 3IFLH 4UB0L 2Y1VA 1UCBH 5E2UL 3P77A 4HK0A 4KHXH 3DXAB 1J8HA 3RGVC 3NCJL 4XVSL 4K71B 1IEBA 1U3ZA 1ZVSB 1OB1B 1DUYB 4IMLA 4PP1C 1FNEA 5EBMB 1FFRA 4N0CD 4QRQB 5L8JB 5F7EL 3HMXL 3MNVB 2ZUUA 1N5AB 1FBIH 1P2CA 2MQ3A 2YUVA 2ATPB 3D85A 3LKPB 5KS9B 4RA3A 1T20B 3GSOB 2BJMH 5A1AA 1H15A 1YUHA 1JF1A 3A6BH 5C0BD 4YDJA 4HJJL 4BQBA 3QHZL 4R26L 1D9KD 5HSFA 3QEQA 5CSGA 4UMGA 1DBML 4ONGL 4D9RD 3QWQB 3H3PL 4XWOC 4J2XA 4L4VD 4HKJA 5JDSB 5A2JH 1PGRB 3SDXF 4NPYB 3MJGX 4OZGB 1U8HA 3X3FL 5TFSL 1HINH 4OI9A 4TN9A 1X5AA 3OMZA 4MLIA 3D25A 3VXQB 2A77L 3G5ZA 5B38A 5DD0H 3QG6B 4R97B 2BDNH 3QO1A 2AEWA 4AK1A 4NQXA 1XGPB 2YD9A 2G2RA 3AREC 1AD9A 1CR9H 1OCWH 4FQQB 5C1MB 5IEHB 4MNHB 5ILTH 1I8IA 2CQVA 1PSKL 3G6JF 3AS2A 3G04B 3PIQB 1KV3A 5JQHC 1HHIB 2EDLA 5JPMA 4WO4A 4WU5A 1T2JA 3OB0H 3GB7A 3BUYB 4KJQD 5E8NA 2WP3O 3RGVA 5AYQA 3SKNA 3IDGB 3PGCA 3MREB 4HX1A 3BPLC 3SEPA 1FZJB 2A6KA 4FQIH 5FCSH 4X4ME 2XT1B 2CDFB 4QHMB 3QAZC 3ULUD 1NGXB 5DWUL 5DUMH 1UVQA 2YPKA 3E1F1 3TM6A 1SM3H 4FQ2L 1J0JA 1SJHB 1UWEL 2DJUA 4J3TA 4GRWB 4PB9L 4KKNA 2J1KA 4KI1A 4LSTL 3NPSC 1ZT7B 1QBML 4KPHL 5C0FA 1WC7B 1JTPA 3QDMB 4P2CG 1IAOB 3GSVA 1AY1H 4G9DB 4R4NC 1RUQL 4PREB 2RAMA 2ZOKA 3W39A 1FNAA 1AH1A 3DXAE 5FKAB 4NZUL 3RDTC 4XAWH 3VXRB 5GGTH 4LSPL 1G6VK 3MJ8B 5HI5C 5ESQB 2A6DB 5FDWB 3VMOA 5BO1L 1G7QB 3AREA 3LMJL 5F1KC 4EXPX 1F11A 3BZFB 2IEPA 4H8WC 3VFTA 1B6UA 3HNVL 3FQWA 5MI0B 3B3IB 6FABL 4JPVL 3PWLB 1IGYA 4M1DH 1NH6A 2PYED 3NVQA 3TPUE 4FQ1L 1MQKL 3MC0A 5AEAA 4OZGE 4UV7L 4HHAA 3CFJA 4DN3L 2NNAB 4RX4A 1F02I 3CZJA 4ZTOL 32C2B 5DD1L 1RZFL 3GZKA 4ALAL 1R3LA 1DQDL 3C8KA 5FA3A 3U2SA 4LLWB 3S3JA 1PEZA 3B2VL 1YQ2A 3T2OA 5IB2A 5C09B 4PD4K 2E7LE 3MRIB 3HC3L 1MREL 5KANG 4HKBB 3KGRA 2DYPD 4NC1E 4FABL 4ZPTB 3BWAA 4GXUN 4R96B 4LSRH 1HXYA 35C8H 5HHOD 4X9BA 5EO9A 2BNUB 2AJXH 3OKYA 4L5FL 4Z18A 5CILH 5C9JB 2JJUA 3T04D 3WYRA 2WBJC 2VLRB 1HK6A 5CHNA 5GS0L 3LN4B 5INDA 5T1KB 3D1MC 1XF2B 4HS3A 3FFDA 4FQPA 5KVFH 3IDMB 1OGAA 2YD7A 1ZLVH 1FG2A 3V4UL 2L7UA 4JZJA 1FVCB 4RMSA 2HVJA 1IJ9A 3BMWA 4X5XA 5JUEL 2NZIA 2P5ED 1TZGL 4NKDB 3RDTA 4LRNH 4HEME 4YHZH 1KYOK 4JLRA 3OKMA 4HZLB 3V52H 3T1FB 4X9HA 4GRMA 4RMWA 1MLCA 1INQB 3R0MA 4HBQA 4QTHA 3D0LA 1RK0A 5C6TL 4L8CB 4XMLL 2BX5A 1T22B 3O6FA 4OTXH 4FTVD 4QOKD 3QG7H 3IGAA 4NIKB 3MRKB 1LD9B 4GRWE 4J6RH 4G8EA 3S5LA 1KPVA 5GGUA 1LMKA 43CAA 1IQDB 4Q58C 5D1QB 3QDME 3C9NB 2NR6D 5LBSL 3TCLA 4KMTH 5I6XB 1LNUA 2H3NB 4YHIA 4RMUA 1A1MB 1UM4H 1YYML 1FDLH 2NY7L 3AS3A 4MXVE 4F7PB 1KPRB 4F3FB 3OWEA 4AM0B 1IAIL 3VXRE 1XH3A 1RQ5A 1T4KB 4PS4H 4KI5C 5FECB 1F97A 3F7QA 3FO0L 5HDBF 4CVXA 3SGEH 5FO8A 4BKLB 2VDOH 2VLME 3W81A 2CKBL 4RGNB 3O9WA 4G42A 4NJ9H 2YA0A 4OLZL 5I30H 2SEBB 3VRJA 2XWBB 4N1EA 4OF0A 1MJ7L 1Y6KR 3QCUH 4WJ5A 2BNRA 1E6OH 1JZ5A 2RCSH 2BHYA 2NY5C 5ACMA 4PJHB 2JIXD 2FWOB 4I5BB 4P46B 2PXYB 2JCCA 3GSUA 4RMRA 4WFHE 4I77H 5FO9B 1FIEA 5EOQH 3WKML 3U7WH 2LTQB 5MEOB 1A14L 2HT2C 5DJCB 2H1PL 4V2BA 2YD6A 1Z0NA 2HN7A 5C09E 1LEKA 4YDVB 2O61B 4ODTH 4P4KC 1IM9A 4QRPB 1INDH 3UCRA 2EDKA 4E41D 4M93B 3ZL4L 1CDBA 1G6RB 1XAUA 5DFTA 3D69B 1D3CA 1JHKH 3D5OF 3PHOA 1I1AD 2VLRE 5L2KB 1PZ5B 1HNFA 5L9DH 5EPMA 1EERB 4RRPA 2V9RA 4Y1AD 1IC7L 5CEXA 5E00B 3N9GL 1R5WA 3V0AC 3AU1A 4P2QA 2X7LB 4O2EB 1JVKA 4J3SA 5J6GB 2CO6B 4OB5L 4OZIA 1FNFA 1JPFB 4DJMA 2YUXA 1I3RA 1A9EA 3GRWA 3HFMH 4MWFA 2P49B 5CZKA 5AG9A 4UT6L 2WUBL 3S4SG 5J13B 1S8DA 2PTTB 5ITFA 3ZTNH 5JLZB 2PO6D 3MYJA 1D6VH 2XNAA 4QRTA 4L4TB 4NQED 4ODXA 1LEIB 1HDMB 4HUWA 5KW9H 4U6VL 3QZWG 5DQ9A 4U2ZA 3BZEA 2HVKA 5DRNB 5GSVA 4JPWH 3DI2B 4IOSD 3WNPA 3CXDH 4FS0A 2C5DC 1JYWA 3FB6A 3NAAH 4ACPA 3VFPB 1GZQA 4GG6B 3U83A 4F7CB 3QQNA 4PGCB 2QSCH 3MOQA 4F15B 5I1HL 5CJBA 5C3TA 5ISZD 5GQBA 1OT2A 4JO4L 4DAGH 2HTKC 5F72S 1CF8L 3CU1A 4YXLL 5CEZH 4YDKL 2X70B 4HWBH 5DFVC 2Z91B 4TSAL 1MVUB 4PJ5A 1MCBA 5FCUH 2R9HD 5CJQH 1NAML 2VXUL 1UG9A 5HDLA 4LSVL 4ZUVB 4GKZA 3ARTA 4HC1H 3WFBH 3PUCA 4KAQH 4KY1H 2WANA 5HPMB 3O4LD 3NZ8B 2IQ9L 5DI8A 3RY6C 2EDFA 2VL4A 1ND0A 1KJ2A 3STLB 2XQBH 1GCFA 2H26B 2APWA 4JE4B 2FX9L 1JHLH 5GGQH 5DUBB 1A5FH 4AZ8A 1K8IA 5DZOA 3JV0A 3MFGB 3ZKMC 3CDFA 2W60A 5DQDL 1ITCA 1BLNA 1BQHG 5AUMB 5SWSE 3UTSB 1C1EH 2BXYA 5IBUB 2R1WB 3TH3T 3DWTA 5F3HB 1OAQL 3S3SA 3N85H 3CFBB 2ITCA 1I9JH 2OBGA 3T77B 3VD9A 4GKSB 4TSCL 1NJ9B 2E3VA 4NO0D 5JOPD 4TNWF 2BRRL 2BSRA 1X5KA 3TF7A 4TUKL 5IFHH 3EO9H 2M26A 2YRPA 3VE0A 1TJIH 3R06A 1CLZH 4OZFA 5D5MA 3BRDA 1NCWL 2Y4SA 4LCWA 4C4KO 1YMMA 2EICA 4XVUC 3BJLA 4Z0BH 5FUZH 5A16B 3QP3A 2IH1B 2V2TB 3Q5YA 1ZGLB 3FJTA 3D2UA 4C58B 3I6KA 3B6SA 4HKXA 1S7SB 1NCBH 5FHAH 4PRID 4UTBL 5E8OA 4LVOC 2OZ4A 3RKDD 4MA1B 2V7HA 1KN4H 1DBAH 2HJLA 4PJ8D 2NY2D 3MJ9H 4HCRA 5GZNC 1P5UA 4YBHA 4U1JB 5EIVA 4EI5C 2FHBA 3NCEB 4MB4A 4QNPF 3EFFB 1CT8A 1ZHNB 1W8NA 3CK0L 3WE6A 4NKMB 2XFXA 4UIKH 3ZDZF 4NRZB 5GS1C 4Y5XA 3WFEH 1XF3B 1MFAL 4IRZH 3AVEA 5I9QC 3IFOB 1T2QL 3GMPB 1A3QA 3NCBB 3MQIA 4OD1H 2X4SA 4F7EB 3HC0B 3KLDA 4JZOB 5CP7B 3IFPB 1RUPH 4HJGA 3P11L 2X09A 4YHLH 4OJFH 3SDYH 3VI3F 5C0JB 1KEGL 2ZUTA 2HT4C 1NFDF 1TVHB 1AGEB 1MRCL 1EV2E 4PV8A 3E2HC 1LK3L 2ID5A 4JAMB 3V6ZB 1ZGLP 3BZ4A 3HTLX 3QIBA 3LKNA 1P7QB 4NGHH 1XMWA 1T03H 2CDEB 4PPTA 3UC0L 1A7PL 1NLDL 4FQLH 4UQ2B 5HGDB 1BBJA 2VZVA 5GHWL 3FB8A 3BHBB 2OI9A 3F12B 2ED9A 3WFHB 5FM8A 3DX8A 2XKNB 2FL5B 3UTTD 3BYTA 5HGBA 4ISVB 2QJDA 5F1IA 1KIPB 1ORSB 3FO1A 1CU4H 2GSGB 3GSWB 5IBLC 4FQXD 1T3FB 1EDQA 3STZB 3UTSE 4WY7H 1CG9A 1FH5L 5C0EB 1U8JB 1U8KA 5LGHL 3ULVC 1RPQA 2AI0H 3D9AL 1CE1L 4ORZC 4LLVA 3S3PA 4JANA 1T89C 3G5YB 2DM3A 3R8BB 5A40E 1BZ9A 4G7YH 4F33A 2DLIA 1JBJA 3C87A 4X9GA 3K80A 4N8VA 3PHQA 1EHNA 5DYOA 2ZCLH 1G84A 3MLUL 3N1PC 1TCRA 3J8F7 2BOBB 3NN8A 4OCWH 3BAEL 5E9DB 1SY6H 4OUOA 4Y2DA 4DZBA 3H7BB 1MHEA 3RL2B 3U36B 3X11A 2P5WD 2VTFA 5F88B 2PNDA 1LE9B 4HJ0C 3PL6D 4N0YH 5F9AC 3CVHA 3FL7A 3ZZ1A 2EIZA 1BQLH 5J06A 3ILQD 4POUB 3KS0H 2ATKB 1AD0A 1RIVL 4WWKB 3UPAA 1KIUA 3D18B 5SV4A 2CLRB 1JPSH 3DBXB 3WN5B 1LO2L 3TV3H 3F6IA 1MHHB 5GRUL 3HNSL 4KKAD 1U8LB 2IADA 2C3VA 2CIIA 4JFHD 4N9O