3B3IA

Citrullination-dependent differential presentation of a self-peptide by hla-b27 subtypes
Total Genus 79
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
79
sequence length
276
structure length
276
Chain Sequence
GSHSMRYFHTSVSRPGRGEPRFITVGYVDDTLFVRFDSDAASPREEPRAPWIEQEGPEYWDRETQICKAKAQTDREDLRTLLRYYNQSEAGSHTLQNMYGCDVGPDGRLLRGYHQHAYDGKDYIALNEDLSSWTAADTAAQITQRKWEAARVAEQLRAYLEGECVEWLRRYLENGKETLQRADPPKTHVTHHPISDHEATLRCWALGFYPAEITLTWQRDGEDQTQDTELVETRPAGDRTFQKWAAVVVPSGEEQRYTCHVQHEGLPKPLTLRWEP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Citrullination-dependent differential presentation of a self-peptide by HLA-B27 subtypes.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
molecule keywords HLA class I histocompatibility antigen, B-27 alpha chain
total genus 79
structure length 276
sequence length 276
ec nomenclature
pdb deposition date 2007-10-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00129 MHC_I Class I Histocompatibility antigen, domains alpha 1 and 2
A PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3b3iA02
3.30.500.10 Alpha Beta 2-Layer Sandwich Murine Class I Major Histocompatibility Complex, H2-DB; Chain A, domain 1 MHC class I-like antigen recognition-like 3b3iA01
1JGLH 1OLLA 1IAMA 1S7QB 4L1HA 8FABB 3VE0A 3QPQC 5CP3H 4NOFA 2JELL 2KH2B 5TQ0L 4M7LT 5T1KB 4OZ4A 3KG5A 5D1ZA 5IVXF 5LG1A 2B1HH 3MRGB 4KI1A 3QB7C 5DD5H 3S36X 1BFVL 1OQOA 1QBLL 2F53A 3N9GL 4WWKD 3FTGA 1BEYH 4NFCA 1EO5A 1AD0A 4KK6C 3VXQB 1U2HA 1PSKL 1MJUH 1FZOB 3CU1A 1W0VB 3MRIA 4NRXB 4Z6AT 3SKNA 3UDWA 2MQCA 4HUXB 2PXYB 3UTOA 5BZDB 5A1AA 2QQQA 4LEOA 1ZLSL 2O5XL 2PR4L 1R5IA 1CIUA 2AKRA 3MRKA 3UTZB 3ECBB 5EFIA 4K3HA 1PG7X 4UB0L 1KYOJ 5GZNC 1RD6A 3P9LB 4KV5E 4KJYB 3VFVB 3MLVH 1G6RB 1FYHB 3CGTA 3X17A 1OAYL 5BV7H 1HKLL 5TGBA 4FQXB 5FK9B 3NZHH 5DHXB 1IFHL 1QFHA 1T66D 4X7SH 2NZ9C 3CVIL 1BJMA 2VLRD 2J8UA 2IGFL 3BO8A 3OKEA 4RGND 5GSRB 4KTDL 5EZJA 1YECL 1QR1A 3ZKND 1GAFH 2RFXB 4D9LL 3QFDB 2OTUB 1S3KH 4Z5RA 4R0LB 2VLKD 4RDQG 1EA9C 4RMWA 5I8OH 1AC0A 1R5IB 2I9LA 5I0ZA 2R2HB 1P2CB 3PWLA 4JDVB 1YMHB 4K8RH 3BRGC 1A14L 4ODHH 1A6TB 5J11C 5C0BD 5DMKB 1R3KB 5JO5B 5DUPL 3W2DL 2AV7B 1KIPB 3MLRH 4J4PC 4FZEL 2Q7YB 4BQ9A 2EO9A 1P4BH 1V8HA 4G6JL 4ELMA 5H94B 4PRIE 1FNLA 4P46A 5DO2D 1PKOA 2OLDA 2EIBA 5GGUA 1T03H 4LLVB 4OCLC 3MCLL 4NKDA 2IADB 2C5DC 5CILL 2WZPD 1I8IB 3FFCE 4J3VA 4ZOEA 3MV01 4KXZH 4C4KT 5I8CB 4GLRI 3CNKA 3BHBA 5K9QI 1XGYH 3RQ3A 4MXVE 3UZEA 3MV7B 4ZUSB 2ZNWA 4L4TA 1WZLA 4MA3A 1LO5B 5GS0L 5DD3H 1ZGLB 4P9HH 1C8PA 1XIWC 4WEBL 4JO2H 2HFFB 4YDIH 3QCTL 1T0PB 2J8HA 4X6EB 3C9NA 1NKRA 5DRXB 1YUHA 3TH2T 5DR5L 4GAJH 2X05A 3RAJH 1EMTH 3DHMA 5BS0D 4L3EE 5EZIH 3V8OA 1CN4A 43CAB 4TULL 1FFNB 2FEEL 2WBJC 1LEGB 5FB8B 1MHEA 3CUPB 1P84J 4C83B 1G9NC 2GW5A 5IROC 1XGTB 4U6HB 3IFPB 1UCTA 5I1AA 3VXOB 2X2YA 3GSVA 3HAEA 4LSTH 3SGJC 1HYSC 2PYED 3NFNB 4MJ4A 3BD5A 2W0FB 3T0ED 4ESKA 2NY0D 5JW4Q 3E6HB 4L4TD 2PETA 4LPWA 1ZHNA 1LE5B 1A6WL 4U6TA 1UWEL 4XX1E 3OPZH 1MI5E 1MFDH 5L2JB 2F58H 2V2TB 4WI5A 1S5IL 5AWNL 1EVTC 3UC0H 2RHEA 4XPAH 4FXGB 5F96L 3SKMB 5HYEA 3RTQB 4F80A 3O9WA 1MCJA 3VWKD 4MXVF 5CMAA 4ZTOL 1LQVA 3VFSA 1JHLL 1T0MA 2BVOA 1UM4L 3CFCL 4ZAKA 2UWEA 2W0KA 3VXNB 1UZ6F 4MNQD 1NUFA 3QIWB 4BZYA 1JN6B 3R8QA 4PJEB 4FTVB 4NCDA 2YD6A 3MLXH 5C0FA 4OIAA 5C09A 4JZOA 2IG2L 2WBJD 3QR2A 4TNVF 4LHJB 1NFIA 5KS9A 1RK0B 2H3NA 4GXVL 5DQDH 1GYAA 1J0HA 4KWUA 2MJWA 3MCKB 4LQFH 4Z7WF 2AXJA 5F9JB 3ZKSD 5DJDA 4M43L 1K4CB 1T7YA 3B4NA 1F6AB 4PJ5D 4U0QB 5BCAA 4BYHA 2CR6A 3NCJL 1P1ZB 3IJHB 1WIOA 3PDDA 3U1SL 4JPWL 2YC1A 4G7VH 3S5LA 3DMMC 5DQ9B 3UAJC 3MJ8A 2X6MA 1SVZA 5BVPL 2DQDL 4PYGA 3T0VA 5SWZD 3FO9A 1RIUL 2I5YH 2DQEH 2C4XA 2C4FU 2YD2A 1NGQH 1RZ8B 3ABZA 1VESA 2XKNB 3F6IA 4FG6D 5ICYB 4XAWL 1IQWH 3LQAC 3WJLA 3IDMB 3PWPA 1EO8L 4LSRH 4M5YH 3EO1B 1X4YA 1B90A 3Q1SH 3NMEA 1N3NB 4QTHA 4MA7L 1MHPH 4U7KA 4JM2C 3QIUA 4UDTA 4PJ8D 2R0LH 2QADC 5DRNB 3EYSL 3OKNB 3X11A 4L29A 4TPRH 2BMKB 1DQLH 4I13B 5HHQA 4HGWB 4G7YH 3ZHLA 4HX1A 1NUNB 2V5SA 3F12B 4ONHA 2W1NA 1T1ZA 5D1ZC 3RGVA 1MRFH 4NKOA 2DWEB 3UX9B 1ZSDA 1DLHA 3FOMB 3VWJC 1MCOH 3IFOB 3SDYH 4AIXA 4P23C 1YC8A 1CGSL 3DNKA 4QRUA 1EERB 1JFQH 1G7HA 3VXRA 3BDYH 2QKIA 1NCBL 1N6UA 4BZ1L 2EDDA 4LP5A 4LCUB 5E4IA 4MX7B 5FYLD 5ESAA 4LHUA 6CGTA 5D7SH 4LLVA 1A0QH 5CP7B 2VDLL 3QG6B 4FS0A 4K71C 4AJ0A 3TM6A 4OGZA 5JXAL 5T3XH 4J6RH 4KKCC 4PJFA 4JRXE 5DSCB 4DAGL 5C0AD 1RULL 4LCCB 1VEMA 1FL6A 5FF6A 1BVZA 5MEPB 4JRXB 5I1DA 5EULV 1G9MC 1RZFH 4X83A 1QSZA 1U58B 3BGMA 4PLJD 2R2HA 3QUYB 3MYJA 4HUVB 3KPPB 4HS6B 2MTPA 2F5BH 4FQ2L 4BK5A 3K0WA 4NQVA 1JGVL 3U0WL 5IB4A 4ODVL 1PKQB 3DVNA 4UTBL 3LVEA 2NX5D 4LHUG 3GSRB 2ERJB 3DI3B 4ZG1A 5BJTB 2OZ4H 5DHYA 4JFDB 4NHUA 3D1MC 4M03A 3OKKB 1R24B 4K71B 4CMHC 5JW4R 2YSSB 5LWYL 3BP4B 1HILB 1KELL 3IDYC 3U0TA 3E8UL 4IRJB 3VXUB 1EAPB 1V7NL 4JR9L 4ELME 5BV7C 5L6YH 1JWSA 3KWWA 1G7IA 5GS1C 5EU6A 5C0DB 1R6VA 2DQHH 1U3YA 3GMLB 4Z7UE 4NQCA 1BREA 2R2EB 4Y4FA 5HD8D 5KZCD 5JUEL 3HPLA 4Z9KB 1NLDL 3K8KA 2HKHL 4JFDD 4K7PH 2D2OA 5IVXA 1DUZB 3SQOL 2XZQL 3RWGA 3CLFH 1VKXB 2EYSB 4N8CL 3ZDXF 1JPTH 1SEBB 1QRNA 2EDBA 2B7DT 2VLKA 4JRYD 3KPOB 3L3GA 4JY5L 1QFWH 4NZUH 4KDWA 5M95B 3UTTB 2VSCA 2GJZA 3RBSA 1E0OB 4N1CA 1KT2B 2GJ6B 3QO1A 4YDKL 4BELD 1ZTXH 2VLRA 3OAUL 2CMRH 1OGTA 3BPNB 4ZS6D 2ADGB 3QNXA 3H0TA 3V6FA 4OLZH 4ETYA 2QHRL 5HGDA 5H8DA 1HH6A 3CVHH 1JF1B 4HV8B 5D8JH 4Y4KB 3MGAA 4XPHH 1DQJA 4PJCB 3AM8A 4QYOA 3RUGF 1H15B 2D0GA 2H32B 2ICWJ 3MRHB 5D7IE 2NY1B 2BSED 1EO7A 1E4KC 3DO7B 1IKNA 1ZANH 4U1LB 1QG3A 1JMXA 3FMGH 2FRGP 2E7LE 3H9SE 4V2CB 4XBGB 1GGIL 2MPAH 5D7IB 1MRDL 3KNBA 2HYMA 4GKSB 5D96C 2H1PL 5DVNA 4Q97A 2XY2A 2VXSL 1P4LB 4PUBL 2VITA 4Y0GA 1UACH 3U46B 1N5YH 2VXUH 2OK0L 4LASH 4JN1H 1CXEA 1QSVA 2BXYA 3U4EB 4UOW0 3D69B 3N85L 3A0OA 4H0IA 3NFPA 2NY2D 2O5YL 4XNXL 4EI5D 4ETQA 4HDIA 1FNEB 1MFEH 4ZQKB 3TF7A 3MRIB 1BFTA 4NRXA 3C09B 3NACL 3JUYA 1QZ1A 5B8CA 1FFOA 5EB9A 2V9TA 5SWZE 5C07A 1C7TA 2HJFB 3GSUB 3LN9A 3O8XA 4NM4H 1YEIH 4TSBH 5JHDB 4F3FB 3O0RH 1A6UL 3T04D 2BOCA 4JGJA 4LLDB 5F3HB 4MD5B 3LEVL 3T08A 5I71C 4DZ8B 1F58L 5F1NA 5I76B 2P8MA 1MI5B 4F9LC 5J3HC 1RFDL 4OTXL 1NEUA 2BY1A 2ZG2A 4S2SB 2ED7A 4LHQB 1A3RH 5FA3B 4NQEA 5HGHB 1JBJA 4NO3A 3W9DB 4NHCL 1CE1H 4L8CA 3M17B 2QSTA 4NBXB 1U0QA 1H8OA 4PP1C 4PBWD 5DUML 4IJ3C 3CU7A 2CKBH 3EZ8A 3AROA 3NPSC 1T5XA 4PJIB 5E9DE 2VC2L 2VRAA 5DT1H 3I50H 4X6DB 4KRPC 2WBJB 2IADA 4P5TB 2DAVA 2X4QA 3IYLW 4ZO6A 1TMCA 4YZFE 4KKBC 1JGEA 1WSST 4HUUA 1E28A 2A77L 1NCCH 2D03L 3PWNB 5L9DH 5ITFB 4BFBD 5DJXA 4HS3A 4OFPA 1CF8H 3TA3D 1T0NB 4QHNA 4R8WL 3AXLA 2OQJA 4LIQL 1AGDA 3FO2A 1Z3GL 4L3CA 4LFHG 2FX9H 2WV3A 5FDYA 4O58H 4TOYL 1NC2B 1AE6H 2H6PA 4PP2A 3DX7B 3KDMA 3S37X 4CMMB 1YY9D 3UMTA 1NKOA 1X5AA 3OGCA 2MMXA 2VQUA 5E8OB 3EJZC 4NGHH 4OLUH 2CIIB 3VFPB 2X4QB 5A2JH 4WTZA 4OFYA 2ESVE 1A6ZA 1L4IA 3O81A 1A64A 1WZ1H 4N0YL 1CXFA 4XP5L 3L7FB 3KR3L 4PJXE 4TUOA 4AEIH 1NUGA 1AO7D 4L3ED 1Q94A 1KEMH 3GB7A 4MNHA 5MHSD 4YWGL 2NY2C 4KRLB 4YGAB 2X41A 4DWHA 4ZMAT 2OP4L 3DIFA 1RVFL 1AGCA 3HE7C 4XCFL 1T0MB 3BPCB 2EIZB 2EDHA 2KDGA 4MSWA 1OOAA 5E9DB 5B3NA 4WHCA 1GIGL 1DFBL 5AD0A 1JZ3A 3LRGA 3D2UB 1AD0B 5CJ5A 5AZEH 2Y9RT 1NGXB 3JWDL 4JQXA 1FVDA 2VMFA 4IDJH 2DICA 4HWNA 3TIEB 15C8H 3C8KA 4L1DA 4AM0A 5IKCA 4XBPA 1ZA3B 2BY3A 2GAZA 1MUJB 4P5MA 4NUGH 4KJWD 3LD8B 4Y4FB 5IW6B 1B6DA 2YPLB 4QKXB 5J1AA 2ICWB 1A7NL 1Z6JT 4MAYA 4YK4B 3HMXL 2RR3A 1D5BB 4I0KA 4ZSOB 1MPAH 1K4CA 4HBQA 4I2XB 2ITCA 4IRJA 1P7HL 4M61B 2VNCA 2Z0BA 4R3SB 3SO3C 3BH9A 3ES6B 2V2WA 1MAML 2FZ3B 1WIUA 2BVPB 2Q86A 3S88L 4I2XA 4JM2A 3CFEB 2MOVA 1P7KA 2E7BA 3ARWA 3BYYA 3UO1H 3P9MA 4QCIA 2P47B 2AJVH 2HFFA 4PJXB 1HWGB 1JNHA 2R56H 3BD4A 3WE6A 2QQLL 1MJ7H 4R2GC 3VXUE 3SDCA 1SYVB 2IBGA 1OP3H 3C5JA 4Y1AE 1HQ4A 1FGNL 2BNQA 3AVEA 2IJ0C 4HQQL 4G8EB 3RNKA 2C3WA 1PG7H 4QOKB 5HSFA 4OQTA 2BVYA 4ZXBC 3SGDI 1CGVA 4Y1AD 3ZYZA 5HHPA 3HR5A 4W81A 2E7LA 1F3RB 4H88H 2EXYD 3GGWB 4I48B 3V6ZA 5JOPD 3L3GB 3UAJD 2Q76A 1CLYL 1Y18A 3O2WL 4Y1AA 4GRLC 4C57C 2A9NH 1TTFA 3ZT5A 4LK4A 4MNGB 4HSQA 1R3LA 5EC2A 3EDDA 1CS6A 5TF0A 2WM0A 3ZE1F 2EXWC 2ICES 1AR1D 2YD5A 3PHQA 1QNZL 3GJFB 2FJGB 4MQXD 3CAFA 5SWSA 3TZVB 1I7TB 1K3ZA 1IC7H 1JWSB 3QFDA 5AUMB 4NNYA 4G9DA 2BC4B 5CEZL 3DSFL 4P5TA 1FHGA 4F15C 4YUEL 4NQXB 2MCPL 1WEJH 3HC4L 2IALB 2YK1H 4HQQH 3RA7L 1FGNH 3VGHA 1S7WB 5C0CB 1QPXA 5I66A 4X8JA 4XHJC 5DHYB 2HFGL 5D70L 2ZCLL 4TNWF 1Q0XL 3MFGB 2PO6D 3EAKA 1D5ZB 4NQVB 2VZOA 3LPGA 5F89A 3O8XC 4AT6B 4Q2ZA 1OTSD 5HYJE 3SGJA 3MYJB 1KJ3L 4HUVA 4DTGL 1NEZB 2C3XA 2EC8A 5SWSD 1RZ8A 2OX5A 5CP3A 3MO1B 4NO0A 3RDTB 5C08D 4MVBD 2FO4B 1MAMH 3FO9B 1KNOB 3MJ9A 4P23D 1CXKA 3T0DA 4HK0A 2AK4B 4LAQH 4UZGA 4OCMC 4ELMF 2EDXA 4OZGA 1C5BL 3FQTA 1ACYL 3A6OA 1N4XL 2HT3D 5GGSA 3CJJA 4MAYC 3B8SA 3C60B 1F4WL 1DL7H 5K59E 1EFQA 4U1JA 2ATKB 2Z93B 3FKUS 1EEQA 4IHOB 3Q0HA 1VADA 4K23L 1NLBL 5F1KC 3TNMB 4ALAH 4E0RB 1CLOH 1RZJC 2VDOH 3WYRA 4YHOL 1P2CA 3PWLB 4IDJL 5ACZB 4NWTL 1HZHL 2OCFD 1NPUA 5GGQH 1FSKC 5IQ9A 3P4MA 4JRWA 1DLHB 1YEDA 1HDMA 1BZ7A 2GSIB 2OL3A 5LJYH 1JI1A 2JCCB 3VCLB 4Y8AA 2ORBH 4XAKD 3DX9B 4HIIA 3THMH 4EDXB 4XBGA 4PR5A 5HI4D 1IGTB 4PRNA 4HUNB 3JV4B 3B2VL 4WJ5B 4R2GD 4IIQB 5J56B 1JPGB 1KPRA 2ZSVA 4JQXC 4JANB 1CLCA 4Y4HA 1O0VA 3ARVA 4WW2A 3BH8B 1RZIB 2BFVH 1JV5B 5F72S 3L3OB 5HGDB 4AEIL 4YBLC 4L4VE 3F7YB 4I18B 4PGEA 3SGDH 2Q7NA 3NIFE 2Y36H 4TSCL 4DCQB 1IT9L 1ZT4A 1Q9KB 5D1QA 4YEEA 4X6BB 4P57A 1EUTA 3OR6B 2CXKA 3D69A 4OLXL 1F3DJ 2W60A 3WN5C 3VH8G 4OLUL 5L8KB 5TF1L 2ZKHH 4I0PB 3AAZA 1XCQA 1NAKH 5E7BA 1AE6L 4TOYH 1T04B 5KSAB 1IGYB 5E6IB 4P4KC 3WFDL 3MA7A 2A74B 2GCYB 3WJJC 2HFEB 1KSRA 1T7XA 2D31A 5ITBL 1UYWL 5KANI 4FXKB 4JPVL 1ZLWK 4POUB 4UV7H 4D0DB 2G2RA 2XTJD 1AO7E 4POZD 3MLWL 1YN7B 4PJGF 3KWWB 1VEPA 5C9JB 4S1DC 5MEQA 4EXKA 4KDTC 4GRWE 4HMCA 5J6GA 2JJSC 5CEXA 3WIHL 1BIIB 3VD9A 3UJTL 1OAKH 3I50L 2CRZA 2VC2H 2BDNL 3NN8A 4LU5H 4WV1B 5DT1L 1HILA 3FN3A 3ULUL 2YUZA 1RY7B 5CJQH 1I7ZA 5HHOD 1TFHA 1AP2A 2CKBL 5ALCH 1I3UA 4FXGA 3QDMB 4CVXA 5F1NB 5JDJA 1E4WH 3W0WA 1BAFH 1MHHA 1N26A 4YC2C 2B4CC 4KZDL 2MNUA 3O6MH 4P5KB 4HUWB 2BNUA 5GIRB 3FCTA 1U8PB 1A6PA 2VLJA 4UMGA 3WD5H 5MEND 3DGCR 4PG9A 3BI9X 2HVKA 2BSSB 2R1YB 4WUUB 3OF6D 4PJBA 5EOCJ 4ORZC 4DCQA 1UWXH 4JRXA 3UBXA 1DANT 5FGCB 5LBSH 5DMKA 1J1OH 4PRAA 1TITA 2XN9E 4X6BA 1J0ZA 1SYSA 1T21A 2ERJC 2VR5A 5FUZL 4F2MB 4UQ2B 3H9SD 4PG9B 3QQ9C 4PV9A 2EIEA 1A5FL 4P4KD 1A6UH 3LOWA 5DJAA 4L4JA 5GGSY 3WLWD 2X1OA 2NXYD 3IF1A 1RJZB 3H9HA 4XVJH 5D6CA 3QO0A 4ZXBB 2Z8RA 1V7MH 5IMKB 5EZJB 3WSQL 2GHWB 5IM7A 5F3BA 1JZ6A 3D3VA 1YEKH 2V7HA 2PXYD 2Q86B 1G7HB 3U9UA 5HHOB 1MCRA 5LXGL 4S10A 4OM0H 3QIWD 3BPOC 5FHAL 3TO2B 3L3HA 3AMLA 5ID1A 5AYUH 4BSJA 3NAAL 5C0BA 1WBZB 4KI5C 1DANU 1N5YL 2VXSH 3SDCD 1C1EH 3HNVH 3RDTD 3SDDD 1EV2E 5J11B 4JB9H 5CJOL 4OFYD 4J3XA 4JHBA 4FP8L 4L5FL 4O4YH 3O6FC 3FAWA 4P9ML 5FCUH 4EN3B 2LU4A 4YHYB 2OTWB 1N0XL 4LVOC 3IXAB 2XN9D 3FQRA 5I6XB 3NGBC 5L0QC 3ZDYF 4XPFH 4RAHA 5EO9A 5KSVA 3BT2L 4NT6B 2H26A 1E27A 4FG6C 1IEAA 4PY7A 4MA8L 4D9QD 3SCMB 2P45B 4GRWH 4YDKH 2P24A 4JFEA 4N5UA 3G5VA 2HAZA 1G9ML 1UJ3A 4OCXL 4M6MH 3DIFB 4PJ7A 3TBYB 1D5ZA 4ISVB 3QHTC 5C9JA 1HKFA 1BVKB 4Z95H 5FM8A 4U1IB 3UROR 3DVGB 4ODSL 1IGFL 2G5RA 4Z7UA 4MJ6A 3VRLE 3DBXA 4Q6IA 5EOCL 4QHKI 4ODBD 3CXDL 5TE7H 2FL5A 3CX2A 2D31B 4P2OA 1CLZH 1IL1A 4MD4A 1ZLWH 4JFYB 5MP6H 1DLFH 1VENA 1I9EA 1AXSB 5CINH 2ZZUT 1CDUA 2EH7H 3IDMA 3O4LD 2XA8H 4OT1H 3CFIC 5C0CE 1RJZA 3ZTNL 1V7NH 3GHBL 3BIBX 2XZAL 4NRZA 4YHMH 1S5HB 5GJTH 1KTDA 3GBNL 4N0UA 5ICXB 4KKCD 1AGDB 4P48A 1KUMA 4OCSH 4OFIA 3FQWB 3S35X 3TA3B 2Q20A 4TRPL 4PJBB 2ATKA 5I8EA 1TDQA 2VLLA 2YWZA 1U8KA 3PWJA 1J1XH 5DGRA 3QEUA 4OFKA 5LVEA 1AC6A 4IMKA 1M6OA 3TT3L 1H5BC 3C08L 3FT4A 3GGWA 1QO3A 4XXDA 3V6ZB 1UH2A 1PDKA 1KPUB 3FRPG 4XWOC 3WXVL 4HBCL 2FJFA 1KB5L 4X6DA 1OD9A 1PY4A 5FGRA 1OPGH 1T3FB 1NGZA 3DSNA 4FNLH 4MDJA 4TUKL 5ACLA 1JYNA 4JKKA 4Y4FD 5DFVD 4HS8L 2DKSA 1AI1L 3LKQB 1BJ1H 3CDYA 2F54E 5T3ZH 5FV2A 3RDTC 1RUPH 3D48R 3NA4A 1ODAA 4EQ2A 4ORGB 1WQVT 5ID1B 4HKBB 1LHZA 5D7SL 5FYJE 3GMMA 1UVQA 2J4WL 5DI8A 2CUMA 1FC1A 1J7VR 3OKNA 3X11B 3FT2A 3MBED 4QT5B 5H2BA 5KSAC 2F8OA 2JIXB 4J12A 4OD2A 5E99L 4JGUA 1MFNA 5I76A 5HD8C 2V2TA 3LS5L 3QXDB 5EORL 3WXWL 4M48H 5IB4B 2P5WD 2NY7H 1YMME 1MCWM 3O2VL 4BFEA 1RIVH 4G7YL 2XKNA 3ARXA 5IJKA 5DK0B 4AIZB 3IJSB 1I4FA 1U8OB 1HYRC 1U3HC 3TBWB 4G80B 5INCA 3QUML 4UUJA 3X3FL 2EDOA 2ZJSH 1MEXL 1OM3L 1N64H 3SDXE 1N0LA 1QSFB 2XACC 3EO9H 4M1DH 1IGJA 3BZEA 1CDGA 1QRKA 2OJEA 3JV0A 5I1IH 3CH1B 4PJFB 1PKQE 3PUCA 1R3JB 4WVRA 2BNQD 1ZOXA 3WL9A 4QRTB 4R7DA 1QFUL 4NC2B 5J89A 1ZAGA 4I3RL 4JDVA 5C0ND 3OKOB 3X12B 2A2QT 3EJYD 3ULVE 2PYFA 2VE6A 3LKQA 1GOHA 3RFZC 3SOBL 3IDNA 3RHWK 4N0CC 1HDMB 3PXJA 4C56E 3MV9B 3QUXA 4CKVX 4DGIL 2YRLA 1H0DB 1UKSA 5E08H 4RGOH 1ZXQA 4NNPH 3LKRB 4JM4H 3FN9A 1BHGA 2ADGA 4FTVD 3IAPA 3PL6A 4C56B 1MQKH 3UDWC 2VH5H 4QY8A 1DVFC 2VDML 3H3KA 5HI5D 7CGTA 3IDGA 4K94L 1NGWB 4AENA 1V3JA 3MUZ1 4QRTA 4R7DB 5D2NC 1IC4L 3TVMB 1I3GH 3DX7A 4OCWL 4HGKC 3H6JA 5F7UA 4Y19B 3G08A 3B2UD 4XHQA 1LVEA 2AKRB 5DHVB 5ALBL 1TQCB 2W07A 3B6SB 1FE8H 4Y16B 2GJ6E 5BV7B 4XI5D 2JCCE 5F21B 4KZEL 4G8EA 3MRLA 4YHPA 1UCBL 3CFCH 4LSSL 3QJFA 3MCG1 3SKUD 4N0UB 5IVXB 3RZCC 5DD0H 4O51B 1DCLA 2BRRL 5E2VH 1LO3L 5BS0E 3NIGE 4KROD 3UC0L 1DDHB 4X7TB 3BQUC 2H8PA 4K9EC 4ZO7A 5AEAA 4W6WB 3OPZL 4X6CF 3PIQB 4UNUA 5ACMA 3HC0B 5I1IL 4P3WA 1X5IA 2RQ8A 2DLEA 5IESH 3EO9L 1DVFB 4N0RA 3BKJH 4JZNA 3X3FH 4MB3A 1RZJL 3OJDB 4X8JB 1AGCB 4FABH 2AEWA 5H2BB 5F70A 5DMGC 3IB4A 1X6LA 5J8OA 4O02H 4ONOA 4UV4H 2PO6B 4KXZI 1DBAH 1D3CA 2P44B 3K4ZA 2XTLA 3TZVC 2IPUG 5C92A 4G6KL 1M7XA 1RUQL 4TVPE 4L8CB 4NNYB 3DTXA 1O7VA 2P5WA 1ZHKA 4J3TA 2G75A 3HG1D 3KPPA 2X70A 1P7QA 1EEZA 4UAOC 5CZVH 1KTKE 4YR6B 1K8IA 1X5YA 4FFZL 3X14A 1UENA 1FV1B 5JNYB 3DVFA 4LDOB 1ADQL 1S7VB 2NZIA 2JB5L 4RIRA 4K8RC 5HJ3A 4HWBH 3O9WD 4HPYH 4X99A 1NMBL 2OR8A 4K7PX 4YFLI 5DLML 5SX5K 3C60A 2IC2A 2IMMA 4KRNA 2YRZA 1KBGL 4QXUH 4OV5A 3TA3A 3IU4L 1JGUL 4OZGB 1FP5A 2NMSA 3U7YH 2W9DH 4HH8A 3AXLB 3BKYL 4HK0B 3HE7B 2GI7A 3TBWA 4I77H 3DUHA 1OVZA 4P2OC 2J6EH 4U49A 1SMAA 5E03A 4V1DE 1CTOA 1XMWA 3G6DH 4YR6A 2Y06L 2R0KH 3K80A 3JWOL 1ITCA 3DPBA 5C0BB 3LKOA 1L9MA 4U7SA 3QXAA 5ABDE 3QUXC 4GKSA 1NL0H 3CUPA 1RZKC 2J6EA 2DQUL 5JIHA 4KHXH 1QEWA 4QRQA 2D7NA 4NYLA 1U8IB 2KUTA 1KJ2H 4JFYA 1TQCC 1A14H 3HG1B 2HKFL 3C5ZB 1FNSH 2QSQA 1MLCA 4NJAH 5BXFA 5I9QC 3U7WH 5DJCA 1SBSH 1X5FA 4X6EA 1ZKAA 3GHBH 4FFYH 3QUZB 3P9LA 1D6EA 1KACB 4OT1L 2R1WB 1YECH 3D39E 2NPLX 5C0JA 1HH6B 1YPZE 5DJ6A 2IGFH 3O3EA 4JDZB 1AQKH 2VQ1A 3QEHA 2HFTA 4J7RA 3B5TA 3B2UC 4HW6A 3P11L 1HKLH 3L5IA 3MRLB 4YHPB 5EOCH 5F6HJ 5DUBB 4HUMB 4PGDA 4G42B 1FO0B 2APVA 1ROWA 1M6OB 1MRCL 1PJ9A 5E5MB 4XVTL 5C6PB 4Y19A 4MJID 3LZFH 5TFSL 2VDRL 1T20A 4WO4A 1WV7T 1KULA 1F13A 1S7RA 1OCWH 3SPVB 5JOFA 1WT5C 4WDIB 4QT5A 5I15H 5GGTL 3I9GL 1YQVL 2YN3A 2WNGA 5IJKC 1R5VA 3G5XB 4JCLA 4HIEB 4JFQA 1AHWA 1NFIB 5KS9B 1PSKH 3KGRA 5IWLA 2LQRA 1S9YA 1ETZA 4JZOB 4Z5RB 5D2NB 5IHBA 2GK0B 3SDXF 1HE7A 4U1NB 1YEHL 2VITB 3U46A 3IU3B 1DBKH 1RUAH 3QUKB 4X0KA 4XNQA 5L2KB 2HH0L 3OKKA 2HTKC 1BD2A 4FP8H 1U8IA 3KPNA 4PV8B 2AGJL 4XB7A 4JM2D 4A6YL 5BJTA 4P2OB 3ARBB 5H37G 4EI5B 3D39D 1KENL 3AS2A 2UZYB 3PGFL 4KQ4L 3T77B 1BWMA 3QUKA 1T1XB 3QZWB 4OI9A 4X0KB 5IHZA 5IB2B 2Y5TB 1D5BA 3PWJB 3FJTA 3QDMD 4YBHA 4U1IA 4PREB 5AYUL 3AB0C 1QBAA 3O2DA 1PVHA 3GI9L 2EXYC 4JVWA 2QEJA 1F5WA 1TVDA 3RTQC 3QIUC 4PGCB 1AGEA 3FO0H 3L3IA 4AH2B 4F8TA 1M05B 2EEBA 3QHFL 5KSBF 3GJFH 3DETC 3NGBB 3IT8D 3AREB 4YQXH 3BGFB 3KPOA 4GRLB 4D3CL 3NCCB 1XGTA 5E5MA 4KUZH 5ESAB 2JIXD 4XZUB 3QA3B 4R4BA 4HCRA 3T77A 1T83A 3CFBB 5CLWA 4NQCD 4A2LA 3ROLA 4DZBA 2FECI 4HIIB 2C3HA 5LBSL 3ARDC 5KN5A 1WUNT 3MO1A 1RJYB 4ZNEE 3STLB 3SE3A 2AJZB 5MEQB 4NKIL 5DA0B 3QG7L 3P0VH 3R4DA 5D2NA 1HINL 3VXSA 2DIJA 3Q48A 5CGYD 1PEZA 4N0FB 1WLHA 1BAFL 4HX1B 4E5XB 1FIGH 2AQ3A 3JTCA 3FO0L 1NBYA 5ALCL 3MODL 2APFA 2J2ZA 5CJQL 4EQ3A 4XP9H 2NLJA 3ULUH 3WUWG 1JJUA 1V05A 4AQOA 1NDMA 4LQ1A 3IETB 3V0VB 1YC7A 3QA3A 1ZLVH 3F5WB 3RPKA 3WIHH 4MA1C 4G8IA 4Q9RL 4MVBC 4FQQB 1XCQB 5GRJH 3CSPA 3QO0B 4MZ3A 4PRPA 1PD6A 2JJTC 1BQLH 1U92A 3OJ2C 3MLWH 1FNGB 2DKUA 3QUYA 1ZEAL 3HR6A 3PGFH 1C5CL 5F7LB 1EPFA 5C7XL 2ADIA 1DTUA 3T4YB 5AYQA 3WDHA 1OT1A 1UYWH 3FHAA 5ITBH 3ULUD 2GJJA 1WC7B 3DXAB 2R2EA 4OLVL 1D6VH 1FBIL 4HUKB 3LEYH 2H2PC 3EDJA 4C54A 4M7ZB 4KK5C 4H5SB 2Y5TA 3U0PA 5DJDB 4YLQT 3DUUA 5IMOA 4RMVA 2D7OA 2OJZL 1CFVH 3CVHA 4ELKB 3W0WB 1MLCB 4PJHB 3MLUH 4Z0BH 1IAOA 4L4VB 3AC0A 3IDYB 5EU6E 3KPNB 2DQTL 1YQVH 3QFJB 1DQML 5L0QB 1XGRA 1WCBA 3KYOA 2H3NB 3CDGA 4PRHB 4PJHA 5CLTA 4W68A 1TZIB 1P7QB 1VGEH 5C0IB 4YO0B 2BFVL 4F7TA 5IMMB 3OZ9L 2B20A 4O2FB 4MJ6B 3E2HA 1UEMA 1JNLL 2A38A 3PDGA 5FUCC 2YUWA 2V9RA 1JF1A 2P42B 3QIUD 4N90E 5D6DA 3B2VH 1NAMA 3TNMA 2A1WL 3K74B 3GNMH 2AEPH 3UBXB 1I1RA 1QRND 2XZCL 1T89A 4ZOCA 4B7IA 3OXSA 3D5OF 1E4XI 2A6JB 1G0YR 3WN5A 5T5NF 5HDOA 4KAQL 2FLBT 2EDYA 3K8LA 1I9IH 4K3EL 4WIQA 4Q9CA 1W8NA 4JHAH 1U95B 3MBXL 4LVNC 5DJ2A 1KNOA 4NC1C 5BRZE 1FVCA 4ALAL 3GIVB 3S4SG 5K9KA 4KJQC 3WKMH 4G3YL 1JHTB 4WV1C 3RVVD 1UB6A 4JG1H 3HAEG 1JNHB 3MV7D 4GG6A 4IRJD 1BZ9B 4UOW1 1MAJA 1RZIA 1FO0H 3FT3B 3HI5L 5B4MC 2R0KL 2FD6H 3JXAA 2X7LA 5TDPB 3BP6A 1CFNB 4AEHH 4HWEH 1J1PL 2AJYH 1SY6H 2NW2B 3RPIA 4ZTPL 1LEGA 1ZHBA 1KEGH 3C5ZA 1TQBC 4X5LA 3T0EC 4OUUA 4BQBA 3QIUB 2W9DL 1NQBA 1UH3A 1UG9A 4NO0D 3HN3A 4AY0A 4XNQB 1QR4A 4QXUL 4MJIE 1JWUB 5C09B 2OL3B 4OF5A 5DFVC 1CD1A 4L3AA 1KFAL 5KJRH 4JRXD 4POYA 4MS8D 5E2JA 3BQUB 4NSKA 3QNYB 2N4IA 2UV3A 3TZVA 3UZVB 2W59A 5D70H 3QNZB 1JNNH 1ADQH 1ZA3A 2X40A 2DD8H 1GZPB 3ARBC 3IDXH 1KIQB 3TT1L 4M6NL 4O9HL 4OCRL 3MBEC 2AVGA 3MLYL 3Q5TA 4BZ2L 4ENEC 5C70A 3BGAA 5J1SC 2OMBA 5CEZH 3MREA 4IOFD 1T83C 2FWOA 1CFQB 4WO4B 3FCTB 1IC7L 1UQSA 3T2PA 4I4WA 1KC5L 3VFUA 2Y6SC 3RWJB 4N9OB 4Z77B 1ZS8B 3TBTA 1QLRB 3BMVA 1FAIL 2HG5A 3WUZA 5K9JL 1OAZH 4YFEA 4V3DB 4YHZL 3GBMH 1NMAH 2IBBA 2X70B 3VDCA 4WW2F 3C6LB 4NO0B 3IU3A 4S1RL 4AMKH 2CRYA 3WFBL 1W0YT 3RKDD 1JZ2A 1VEOA 4Z78A 3UJIL 5D72L 1E6JL 2CPCA 3C60D 5ECJE 3ARTA 1XR8B 2P49B 2ZWLT 3QIWC 3GSQB 5TH2B 4K2UL 1LP9B 3DUSB 1PG7L 3LDBC 4X4ME 2JIXA 3TBVA 3GHEH 5DS8A 5LAXA 1MFBL 1M7IB 4RAUB 1FYTE 3DBXB 4Q6IB 4NHUB 3ZMRA 1FLTX 3BH9B 2VIRA 3EOAA 5K93A 1DQQB 4QRQB 4GRMA 2Y1VA 5ALBH 3O6LL 4HXBL 1N6QH 1X5GA 1F90L 2YD3A 4GBXC 4Y2DD 2O5ZH 2VDMH 3V4PH 4F7CB 4G80A 5INCB 3Q6GH 3IXTA 2IQ9H 3LIZL 4PBVC 3KS0J 3G5ZA 1NSNH 3TCLB 3BUTA 4HS3B 4KU1A 4D0BA 4RGOL 4Q9QL 2YPLE 2P5EA 3BWAA 1MPAL 1ZE3C 4CJ0A 3V5DA 3N06B 1FDLL 4JQVC 4HJJH 4NNXB 1R5WB 3D85A 5EU5A 1KTRL 5CP7A 3OB0K 1NCDL 1S9WA 4PJIA 4WFGE 2XFXA 1HNFA 5C2UB 3VE0B 5IB3B 15C8L 2AERT 4A6YB 1ZA6B 5GGRY 3RIAF 1A7PL 2FBOJ 1OAUL 3KAAA 1MAKA 3VXSD 4AZ8A 2YKLL 4N1EA 3IDNB 4LEXH 3HI1B 5AZEL 4FFVC 3GJFA 1K85A 4OB5H 1DFBH 3B9DA 4U2YA 1PZ5A 5C8JB 4MAUL 4OD3L 1FRGH 4JY6B 1WFUA 2ZJSL 3JTSB 2WQRA 3ZSTA 5C2BL 5I9QB 4WWID 4N90D 3VG9C 2OP4H 4X80L 1IJ9A 1WWAX 5CMAB 1Y6NR 1J0YA 3LMJL 5I16B 4LLAA 2DTML 4MXQC 1D9KD 4AIOA 4HHAA 3CH1A 4GRLA 4PGJA 2X4SA 4M48L 3KYNB 3H2WA 4MYWB 3U36A 2C9AA 5EOTA 1A2YB 4GAGH 1U8JA 3L5WA 5DJ0A 2BERA 1HHKA 1WZ1L 4QWWC 4YXHL 4CU7A 1T1WA 4LLUA 1INQA 4JPIA 3MJ8B 4U31A 3RKDC 1IEBA 2D9QB 2FO4A 1JYWA 1CU4H 3MX0A 4MDIA 4OZHF 4NN6C 3KPMA 3MRMA 3M8OH 3RI5K 1MQ8A 4WGVB 4K3DL 4RZCB 1T1XA 3QZWA 3KPRE 3PDOA 4JAMB 2FDBP 4LLMA 2BVPA 1KGCD 3T8XB 5EUOA 2A83A 3WXVH 3I02B 1BIIA 4GMSH 2G60L 4NO2B 1JZ7A 2ITCB 4QXGL 5IOPA 3RVXC 5F1SA 3TT3H 5EU6B 3C9NB 5JXEA 3JVGA 3G04A 1VA9A 5D5MF 5FA3A 1N7MH 5KVFL 2BHZA 1BGXL 4CN4A 2XN9A 5IOPB 1K8DA 2FIRT 3WEXA 4V3EB 5I73C 4KI5E 5D5ME 3QIBA 5DRWA 2WY3A 4L8BB 4TUJA 5ILTH 5ADOL 1VFMA 5EO9B 1LEKB 5T5FL 5KSVB 3PDOB 4MD0A 4ZODA 5DJ2B 1NGYB 3MOAH 5E8EB 4YHML 3ZTNH 1GGBH 4Y1AB 4P2QD 5KAQG 1JE6A 1G7PB 2A6KB 4KV5F 4BSVA 2F5AH 4I48A 5MP6L 1TVBA 2AXFB 1KJ2A 2JJTA 1CLZL 2BY2A 4OZHE 4YAQB 3ZSSA 4G5ZH 3QEQE 1KLFA 3C6LD 3T0EA 4Z7OF 3DMMD 4NSKB 4HFWB 4LIQE 2BNRB 3EOBA 2P8PB 3QNZA 4Y4HB 1D6EB 2F54D 3WE6B 4TSBL 4Z95L 5F6IC 4F58H 4IIQA 2JK5B 2YBRA 4UNTA 1I8LA 4G8IB 4M6ML 5GSRA 1MFEL 5IT2L 4OD2B 1BQHA 4DKFL 3VW3L 4JRYB 3T3ME 4CDGC 3ULVC 3BT2H 5DYOB 4MMZC 1IAII 4FFWC 2X9WA 3WUWA 4H1LB 5CWSA 1VFAA 3IF1B 1JMZA 4X5WB 5KVEL 5J6GB 5D7LE 2JJSA 3ME0A 5MENA 1BBDL 2DBLL 3DMMA 3VMOA 4P9MH 4NZJA 3WS3A 3BEVA 1WZMA 2P24B 5IW1A 2GT9A 3K81A 3NPZB 2HRPL 4WTZG 1TIUA 4CVZA 4OJFL 3D0LA 3MJ7B 5CZKA 3D85B 4X7DC 4AM0B 2BOCB 1Q38A 5DVKA 3K7UA 4BH8B 1SBBA 4X99B 2ICWI 3VD5A 4QF1A 2QQNL 1X7QA 3S3SA 3GO1L 3FOLA 4S1QH 4OBRA 4ZQKA 4GG8B 4RMUA 3QIBD 4GW4A 3OAUH 1HHIA 4OKDA 4U1SB 4XMKL 2NY3D 4E42A 5DJ6B 5I30H 4Q0XL 1EEZB 3GMMB 4HFUH 3O3AA 3ARYA 4LVHB 3GMQB 4YBQC 3RVTC 2R0WH 4JLRA 4P23A 4XP6L 1DN0B 1UXSB 5BXFB 1A5FH 5DQJA 2VIRB 1JPGA 4GQPH 4Z0XB 5FUZH 1OAQH 3ARPA 3TA3C 2F19H 3Q3GA 3MV8E 3EOTL 1NEZG 4YIQB 3UZQA 3H3PL 5IM7B 1FZMB 3LSOA 4DKDC 5FECB 1KPUA 3D25B 5J6HB 5CS7A 5E8DL 2JCCF 4JJ5B 1O7SA 4OZIE 3VFPA 4OF0A 2I27N 1MY5A 1FYTB 1GGBL 4G8FB 1HXYB 5GZOD 1WT5A 1E4WL 4R6UA 4C55A 3AS0A 5T5FH 3MRBB 3AGVA 2HLAB 1WCQA 4D0CB 4NKQB 1OP3K 5GGVL 1EJ6A 4JFZH 1J86A 3S96B 5ILTL 4LU5L 4FQJH 2PXYA 1MCLA 3DHJA 4LGPB 3O9WB 4GXUN 5IWLC 1JK8A 1OAKL 3I85A 4WDIA 4XPTH 2NTSP 1NBZB 4UTBH 4P46D 1CFBA 1CFQA 5DJXB 2W0PA 1ORQA 5DJYA 2NY3C 4BSWB 4P4KA 1MHHB 2J8OA 4EVNA 3ULVF 4JPVH 4DQOH 1JF5A 2CDGB 5IF0A 1JNJA 1J0IA 3IETA 1A6AB 3V0VA 4M02A 4UIMB 3HNSH 4TYUA 4U1LA 3IKCA 5KSBB 1PZ5B 2EDNA 4DUVA 1XIWB 5C8JA 4JHZA 1QPPA 5GS1B 2OMNA 3ARGB 4S0SD 5JIIA 4EI6B 4K3DH 2E7HA 5FYLL 4YE4L 5E2UH 2APWA 1YY9C 5JXAH 1EFXA 2ZKHL 3OGOE 4FQ1L 3UTTE 2VKXA 4JG0H 4ZAKB 4YXKH 1IAIH 2FZ3A 1YNTA 3RVUC 1DQDH 5GPRA 2JKXA 3BDYL 1IGIH 2CSPA 4ZFZB 5DJ8B 1XGQB 4KI5D 3TN0B 1R24A 1IEAB 4PY7B 3ULUF 1MCHA 4NQXA 2P8MB 4JAMA 4DZBB 5C08A 1YYMH 5GS2D 3D87B 3K1DA 4H0HB 3RY6C 3DVNB 3A6CH 4UQ3B 3VJ6B 2D7PA 3FB8B 2P5ED 5IEHA 2VL4A 1FFRA 4PJDA 2HJFA 3GSUA 2DM7A 4MNQE 4TPRL 1FVCB 1C5DB 2UUDH 2VISB 3RVWD 3THML 3TF7C 2E8ZA 4UTAH 5SWQB 2R0LL 1PG7W 3SHSA 1AHWC 1U95A 2CRMA 1FNFA 2I60H 4NUJA 1EIBA 4MMXC 4CW1B 1AR2A 1U8PA 1HI6B 3VXME 1TENA 4C83A 2CR3A 4IOFC 2MQ0A 1HZHH 4ZNEA 3RRQA 3NBNA 5E8EA 2AJ3A 4EDXA 4Y4FC 1NLBH 1W72L 4OQTH 4G6FB 3LS4H 1IM9D 2YZ8A 2YD7A 2NY4B 4JPWH 5DD1L 1JYVA 4PJEA 3QXAB 4KGJA 4K55A 4CN6A 1LNUB 1MFAL 4TUOB 5L2KD 4ONHB 3PHQB 3RGVB 1QBML 4M43H 4HFWA 1M7DB 4JDTL 4UIKH 3OKEB 4LQFL 1RURH 2APBA 4URTB 4G6ML 3RTQA 3FB5A 3OJVC 2EZ0D 1NCUA 3T2NL 2NY1D 1PQZB 3V4PL 5DK3A 1VADB 1Q0YL 2EXWD 1QSFD 4JHWL 2KKQA 4U6YA 1Y18B 5EZOL 2A73A 4WY7H 4H5SA 4PJCF 2EO1A 3CZFB 4HXBH 1N6QL 4MX7A 5CKGA 5JHLH 3ILPB 5GRUH 5HI3D 3G5YA 3AU1A 1A7OH 1KIQA 4XX1G 1EEUA 4OCNC 3RA7H 3C8HA 3OKMA 3GHEL 4P59L 1PFCA 3ZE1E 1KCSL 3CDCA 5HPOA 1ZT4B 3GSXB 3X13A 1HHKB 1VCAA 3RDTA 1E28B 3L5HA 1LEIB 5FKAB 3I2CH 2PTVA 4FTVE 3VRLF 4MQ7A 1A7RH 4KY1L 5FA4A 1G7LA 2EE2A 1AXSA 1EBPA 1A6WH 4XP1H 1D5XA 1T5XB 5EUOF 1S7WA 5C0CA 3ZDZF 5DS8B 3S37L 1Q72L 3E3QE 4YHZH 3WHE0 4O5LL 3O6FA 3X3GL 2FECL 1U36A 3ULUE 1X4XA 3W9DA 2NW3B 4XPGL 1YUHB 3ZL4L 5BZWB 1KC5H 3PIQA 1GRWA 5C0AE 1NFDB 2VDKH 3SGEH 1B0RA 3K8MA 2WSKA 3DARA 3T0BA 4PG2A 3B3IA 4OF7A 1H3WM 2X4PB 4F57H 2I9TB 4FFVD 4BZ2H 4O9HH 3N1QC 1HK6A 2DLFL 2AV1A 2VAAA 2F74B 3IVKA 3QCUL 3O11A 4U1HB 3ZO0A 3RAJL 4E41E 1MJ7L 4EXPX 2R8SL 4XBEL 1JF6A 1UQSB 1F3JB 2X42A 4JO2L 1Q1JH 5HI3C 5E2WH 3R1GL 4PYHA 1CDJA 1CQKA 2EEAA 2IQAA 3TFKA 4XNUL 1CDYA 4H1LG 1G9NL 1XGUB 2IH3B 5IVZA 5EU3A 2O61B 5D93B 1FV1A 5IHUL 5JNYA 4KTEH 4HEPG 5DTFA 3RIAK 3TCLA 3GBLA 4HWZB 2R2BA 5BW7C 3L5JA 1HQ4B 1KCLA 4D9RD 1U8LA 2ZOKA 4LDEB 2QSCH 2NY0C 3RL2B 2WUBL 3VFWB 3HMXH 4LP4A 1WBZA 5ITFA 5ID0A 3FL7A 2CKNA 1P4LA 4WFFD 4U3CA 3QIWA 1HYSD 2DWEA 2FLRT 5TDNA 1BOYA 5J13C 4JFEE 2UWEB 3VXNA 4NP4L 1K9TA 5DEZA 3NA9L 3JUZA 3EJZD 2AJSL 5HGBB 1EH9A 5HYSG 2XWTA 2X89A 3AB0B 3SKJH 4DEPB 3MRHA 2H32A 2PCPA 2VO5A 1HSAA 5I8OL 5MHSE 5JR1H 1RUKH 5T3ZD 5JOPE 4NRYB 5FYJH 2P8PA 2Y4SA 4S1DD 4F7PA 4HIEA 2QL1A 3TWCL 4LL9A 3GUTB 5ISZB 4P5MB 5LCVH 2AEPL 4NT6A 5FCSH 1JUFB 2OBGA 5BZDA 3NABH 1R3LB 1WFOA 4LCWD 2ARJQ 5IJVA 1KCVH 2HG5B 2WLZA 5HPMB 1SM3L 3VI3E 2OM5A 3BMWA 3QQNA 2XKUA 5KVDL 4Y89A 3ULSB 1CDCA 4MLIA 4U6XB 3OZ9H 2BHUA 4UB0H 1EXUB 1B3JA 1WZKA 3B83A 4F37K 2HT4C 1FAKT 3Q5YA 4Y2DA 2EIZA 4OIIL 3BP5A 5LGKA 2DQTH 1P4IH 1NANH 3BEVB 4XP4H 4P2QE 4NQUA 4YJZL 4DKAA 4XMPL 1DBBH 2BZDA 2OJZH 2XA3A 5FV1L 3QAZB 4FFEX 3QUZD 2D7TH 1HHJB 4MA3B 2YHGA 3DX6B 4Z7WA 1BFVH 3N9GH 4MCZA 1I1AA 3L95B 1YZZA 1P6FA 4S2SA 2VZ3A 4LKXA 4OQ1A 3TPUE 1U3HA 2FR4A 4RMSA 2NXYB 1A1NB 4PJ8C 4FQXC 4PJAF 2UZIL 4IOIA 2V2WB 4BKLA 1CF8L 3VH8A 4ZFGH 3SN6N 4ZUTB 3QQ9D 4U3HA 3H9HB 3UYRH 2B8OT 3LKOB 1AJ7L 4RISH 2A77H 3D9AH 5DFTA 4NDMB 5ID0B 3L5XL 4WO4D 5DJZB 4FFWD 1YJDH 4MHHI 4QYOB 3AAZB 1YNKH 5TE6L 3GK8H 3FQUB 4ZXBD 1UZ6E 2XYCA 4KHTH 1YMMB 5EWIL 2JJUA 4QOKA 5D4QA 5E6YA 1EUUA 1UA6H 4XP9L 1E4JA 2VERN 2VLRB 2QR0B 1RIHH 5A2KH 5SX4H 1MIML 5J06A 1FZOA 5KW9L 1LO2H 3MLSL 5I19H 4PJXF 1QOKA 1KN2L 1WITA 5DMIH 3U2SA 1KPRB 3ZE2F 4M7JH 2ZP0T 2W65B 4Z7QE 1CGUA 2ZUWA 1A3RL 2J8UB 2GJ6D 5FXCH 3FT2B 3B9KA 4F15B 3ARBA 4OUUB 3HE6D 3DX9A 4RWYH 1CL7H 1F58H 2FX8H 4M61A 1VSCA 5DZOA 4YPJA 1BOGA 1YYLH 3SDAB 2X4PA 3QPQD 3RWIA 1JIBA 3LEVH 1G6RA 1ZHKB 3MR9A 4Z7UB 3O0RL 3OG4B 3FT3A 3W5NA 4MWFB 5D2LF 5A2LH 2XRAL 5D71H 1CGYA 1S9YB 4ONGH 4QRRD 1EAPA 5E6ID 4J23A 3NACH 5C0IA 4TQEL 4HWBA 2NR6C 3BIAX 3DURB 4HK3J 4ZS7L 1HQRB 2CDGA 5IF0B 3GKWH 4GBXD 3L7EA 1OSZA 2BK8A 2EDRA 5I1EH 5M7QA 4LLMB 4JFDA 4YHYC 4NBYB 5GZOC 3FZUD 4X9IA 3ULVD 5D7JB 1INEL 4X98B 4ELKA 3KPMB 3TV3H 2VXUL 2OK0H 1FFQA 1MF2H 3HKFA 1JZ4A 3OWEA 1GZQA 4F7MB 2H1PH 1LP9E 4PJ7F 4MSWB 3MXVL 1CXLA 1UM6L 4IMLA 1KENH 1KIPA 5DQ9A 3EDEA 1RK1A 4YDVA 1FG2A 1LE9A 3OKYA 5JLZB 4UILL 3BN9D 3WBDA 3KYMA 2I9LB 4TVSa 5HHXH 5DJZA 3F7PC 1AY1L 25C8L 3MFFB 4UINH 3MRQB 3FFCB 1G1YA 5D8JL 1SEQL 4JFHD 1AH1A 1TVHB 3D25A 4LSPH 3WJJA 2VABA 2VKWA 5JQ6L 1VDGA 2Y6SD 3QFJD 2ZUUA 3LN4B 4H25A 4L4VD 2CDEB 4MXWL 2B0SH 4DVRL 4R4ND 2C3VA 3GMOB 5D5MA 1LK3L 4NZUL 1QYGH 2DDQH 1N59B 3NIFF 3IFOA 2X1XR 4XVTH 5IQ9B 3DROA 2Y07H 1JPTL 2KZWA 1DQJB 2R0ZL 5SV3A 4F33B 1R0AL 3BKCH 1KJMA 1X5JA 3RL1A 2AJUH 2OQJB 2R2BB 3DXAA 1JRHH 1A7QH 2Z8SA 1I1FB 3MRNA 5F93C 3REVA 4XMLL 3RWCB 1E27B 3ARZA 5DRNA 4WUUA 3MV8A 5JUEH 1FH5H 1IC5L 3BDXA 5I75B 3VMPA 1KYOK 3EW3B 4HF5L 2XPGA 3L6FA 2O26U 4ODTH 3VFRA 4FQHB 4OZHA 4X6CB 3F58L 4AEEA 4FFYL 4PJ9A 4EN3A 2AABH 1LWRA 1T7WA 3ZHKA 1FN4B 1DBJH 1XF1A 3E8UH 4RSVA 1J8HB 4UUJB 1U3JA 3I3EA 2EDTA 5EBWB 1B4RA 3OAYH 1NCWH 5LWYH 4RNRA 1KCUL 1CWVA 2XG5A 3V6BR 2WIIA 4MQSB 1B4JH 5T5NG 2OZ4L 3U4BH 3NFPB 4LPVA 1HHGA 1E6OL 4WFHD 1SY6A 5I8KH 4WGWB 4G59A 3FB6A 3TJHD 3DTXB 5C9KA 1CDBA 5E9DD 3MV8D 4U1MB 1SJVA 1DN2A 3FRUA 3WUWB 1D5IL 3MR9B 1RZFL 1EJOH 2BRQA 4C58B 3RU8H 4XWOD 5JTWA 1UWGH 2NY3B 1YN6B 3VFGH 2QADB 3UTPE 5F3HA 3TCXA 4LBEA 3IU4H 5D6CB 1KOAA 3DO7A 2GTWA 1QFPA 2DQCH 3E2HC 5JORB 5IMKA 4HS6A 3NCBB 4J6RL 2C1PB 2HT2D 4X7TA 2BNRA 3P4MB 5HVHB 1YMMD 3DECA 2IBZX 1KCGC 3PABB 2JB5H 1AGEB 4ODUA 2EIDA 2X4TB 3UPCA 5DTFB 1J05B 4QHLA 1MCIA 5MEPA 3TBTB 1OTUC 5E00A 4IMKC 3IJHA 4U1JB 3G08B 2VOTA 3O41A 3JVGC 32C2A 1MCCA 2C3GA 5FOBB 4YHLH 1U3ZA 2VLKB 2BNUB 4F9PC 1II4E 3FQTB 4H20L 4M6OH 4UV4L 1T4KA 4RQQB 3QEQD 4S1SL 1AP2B 1E4KA 2C1OA 3C2SA 4IOIB 2DLIA 3QDMA 3WIIL 3VDAA 3MRNB 3IFLL 2Q8BH 5L8JB 1XF3B 3QDJE 4N9GA 5IESL 4KKBD 3MV9A 3QUXB 4P2RB 3SQBA 4M5YL 1PX3A 1VPOL 3JTTB 1RZ7H 5D5MB 5J0BA 2NY0B 3QQ3B 4PRBA 2CD0A 1LO3H 4M1GL 3U30B 1MCEA 3HFML 4JCMA 1HCVA 2A83B 4CJ1A 5D96B 3LN4A 1EHLH 1V5JA 1KT2A 3QO1B 5IEKB 4BM7A 3MV9E 3SCMC 5I1HH 1S9WB 4G7VL 3TYFA 5I1JH 1G7JB 5DC0A 3OV6A 2X4UB 2DI9A 1HEZB 3ZDYE 3EJYC 3ULSA 1TTGA 1IC4H 2VLMD 4JO3L 4Y16D 4K94H 5I1LB 1S9VA 1F42A 3CMGA 1U58A 3J7HA 4Y19D 3S97C 3SKNB 1MNUH 2YPLD 3FONB 4ZYKA 3HFMH 3VFGL 4LKCA 4M4RA 5ESQA 1J8HA 5EOTB 4UAOB 1BWWA 3GUTA 1UEYA 4FXLA 4ZSOE 3W0WE 4DGIH 4I18A 4PGEB 1GPOH 1D5IH 2FB4H 1I3VA 1P84K 2HRLA 2F8XC 3SOBH 3BX7C 4JFDE 5E9DA 2GITA 1OSPL 3QXDA 4JKWA 5K9OA 3MNZA 3I75A 2Q8BL 4LHUB 5I66B 4RAVB 3WIIH 2BSRA 1OSZB 2R4RL 4ZFZA 5IMLB 5FKPB 4Q74A 3CFJA 3FQXB 1NCWL 2WQ8A 4XXCA 4F33A 4R97B 1QQDA 1LNUA 1UKQA 2G75B 1QKZH 3JTTA 4WI3A 3EOYG 2NY4C 3F58H 4IS6B 1UWEH 2L7JA 5DO2C 3BZFA 1TZIA 3BRDA 4N5ED 1XCTB 2BCKB 1P9MA 3VXRD 5C0RL 1I8MB 5F88B 3QUMH 4IHOA 5IGXH 2X1PA 3DRTB 5C1MB 5FHBH 3EFFA 1IM3A 4V1DA 3QULA 2IH3A 1J10A 3QQ4A 3BWUC 1QRNE 3EGSA 1R0AH 3MRQA 3V5DB 1XFPA 5H94A 1FPTH 2H6PB 4LSUH 3BXNB 4PV9B 2Y07L 2P46B 3NCYP 1S78C 4Y2OA 2O93L 3ROOB 1WICA 3KPLB 4TULH 1MFCH 1RK1B 4YDVB 4ZYKB 1J05A 1EJOL 4IRSC 1PLGH 1UM5H 1EMTL 4HUXA 4NCC2 3QEQA 5FYKD 4HAGA 3QJFB 5JQ6H 1FFPA 1T5WA 2ATPA 4U6HA 1W0VA 3K3QA 5I6XC 3LHPH 2QHLA 5D9SA 4I3SH 2OL3H 3N50A 4WFED 2CGRH 4P9HL 3U4AA 1OY3B 1AI1H 2WW8A 3RUGE 3WDJA 5KVMC 2FHFA 5AZ2H 5T1LB 3U4BL 3BIKA 5I17B 2J5LC 1RJLB 3RWHB 5T3XE 3MGTA 2ZSWA 2BOBB 1OPGL 1U2CA 5F7YC 1HXMB 4GOSA 3U9PL 4ZFFB 3DYMA 1IKFL 1HQRA 2VDPH 5C0BE 5TGBB 3BW9B 4WUUE 5DURB 1DBJL 2HVJB 1PEWA 3PL6C 2IPTH 4DN4L 4UU9B 1UXSA 4KQ3L 1F11B 2X5PA 3WLBB 4WU5B 5GGRA 5IBTH 4K9EH 3W2DH 4TRPH 5FO7A 4FXKA 1FG9C 4JQIL 1MHCA 5EUOB 1A6AA 1JRHL 1S7XB 4HC1A 2HFEA 4ZD3L 5GSVB 4PD4J 3RWDA 1QLRA 3ILPA 1ACZA 4TQEH 5DZNA 1ZLVK 1QLEL 4U6XA 1URLA 4ONGL 1MELA 2DDQL 1QYGL 1LK3H 1QRNB 3TVMD 4PDCE 4IRSD 4R4FH 5CINL 1ZLUH 5L7XL 4PY8I 1C16B 1MWAL 1NBVH 2YMXL 1DLFL 4JKLA 3DLQR 5HHPB 2CUIA 3RZCA 5EO0A 4NO5B 2VXTH 3WFEH 1U8JB 3L5WB 3OAZK 1QSED 7FABH 5JHDE 5I1CH 3BEWB 5BV7L 1SEQH 1OAYH 4UT6H 4GO6B 4UINL 3DMMB 2YXMA 4PJ9D 5CD3A 1J9CT 2BJMH 1B6UA 1IAKA 1NDGB 3GSNH 3CX5J 2HJLB 3C6SB 4JFXB 2O5XH 4OCXH 3KYKL 4WI4A 1WGOA 3V4UL 4JM2B 2BCKA 4Z0XA 4AL8L 3L95A 2V7NB 4QOKD 1BLNB 4I0CC 1F97A 4XPFL 5ANMB 4KHTL 5F9WC 1PX4A 1ZWIB 3TV3L 4ZXBA 3STZA 1CCZA 4JFFD 3QRGL 2ZUTA 2LFGA 2W0LA 4HV8A 3D18A 2YPLA 5J1AB 3RHWF 3GM8A 3MOBH 2WWMC 5DD5L 4XC1H 2GQHA 4MAYB 4E41A 4QHUA 2NY6D 2JELH 3FO2B 1G7QA 4MXQD 2RIKA 3GKWL 4ZFGL 3H3BC 4RNRB 3TIEA 3T3PF 4N8VA 2XXCB 3I3BA 3MNZB 3GSVB 3BVNB 5D71L 1GSMA 4XNYH 3K2UL 1FORH 3OL2A 5CUSL 2CLZB 4X6CA 4TVPD 5AG8A 4GAFB 3VFNB 4NZRH 4KVNL 3O8XB 1TETL 4P5TD 3LDBB 5SWZB 1CL7L 2FX8L 5B22A 4LCUA 5A3ID 3UCRA 5I1GH 4RCAA 1F2XK 3KPQB 4WUKL 1YEKL 3QIBB 4OCYH 5DRWB 4F7PB 2AI0H 3DV6B 1IZKA 3WSQH 1K2DA 4N0FA 2Z35A 3MBEA 3PHSA 5HHME 5C6WH 1MIMH 3NH7H 4HLJA 2J88H 5KVDH 3Q2CA 1HSAB 3A6BH 1RJCA 2VR9A 3TYFB 2R1XA 4OZGE 5C6TH 1OQXA 1WCBB 1OB1A 5EA0H 1UA6L 4HXAH 5CBEA 4PJ8A 4HMEA 5F3BB 5E7FA 4QRRE 3SO3B 5LCVL 2AEQH 3EDKA 2ID5A 1JHKH 3LKPB 3HC0A 5EOQL 5B3JF 4PB0L 2Y5EA 5CD3B 3PQYB 5C07B 5IB5A 4PS4H 3FFCD 1FVEB 4OSUL 3PV6A 2HJKB 4PRDB 4WFFE 3V52L 4U6VH 4KJPD 3F7QA 5JA8B 4MNGA 4JFPB 2KBGA 4GJTB 2HVKB 3SCMA 5FO9A 2NY5C 2EH8H 4PLOB 4D94A 4HJGB 3L3OA 5L8LB 3P77B 1I8KB 3UTTA 1NFDE 4NRZB 5IR1B 4OGXH 4G8FA 4KVCH 3VWJD 5KVGL 3C6LC 3IXAA 4XMPH 5E1HB 5IB2A 1NGYA 5F9JA 2WUBH 1YEFH 3ARDA 4UV7L 4E9LA 3L3KA 1RHHB 4PGZA 3RWGB 2XOTA 3QYCA 3IVKB 1GGCH 2QJDA 4KK9D 4GH7B 1A1NA 5FFLA 4B50A 1TJGL 2OXGA 3LKRA 4HKJB 1BD2B 2ZCHH 5IHUH 3WFDH 5CEXB 1P5UA 4WTXA 3LB6C 4TSAH 5KG9A 1G9NH 5JXEC 3MROB 4CGTA 1A6VL 1AXIB 1FL5B 2P1YA 1KCVL 4FRWA 4JREB 1TPXC 1MVFA 3QNXB 3I02A 4WI2A 1AHWB 2J8UF 5IB3A 4OKVA 4I5BB 4ZPVA 1F2QA 4QEGA 2ED9A 3QCUH 3S36H 3SDAD 3VXMA 1OAXH 2I26N 4CADA 3D3VB 5T1MA 2VDNL 1ORSA 3LRHA 4RZCA 1T20B 1S8DA 1L7TL 2RCSL 2ITDA 2B1AH 3QXTA 4P3CH 4HZLB 5GZND 3ZTJH 3BOVA 1DDHA 3F62A 4XNMB 3B9KC 4YHNA 1IE5A 2JE8A 3UTPD 3IKKA 5K9KB 4P57B 4ZNCD 4BQ6A 4BJLA 3NA9H 1WJ3A 4NQCE 4NP4H 3QWOA 1JGDB 4DW2H 1PYWA 2ORBL 2AJXL 3I6GA 1U6AH 2XQYK 2DWDB 5IV2A 3MRCA 1TPXB 4WCYH 4OGAD 2GTZA 4KTYA 4EUPH 3S3PA 2AW2A 2QSCL 1I8LC 1A7RL 4KY1H 4U6YB 2X4UA 2WINB 3MCKA 1KB5A 2NZ9D 4YHOH 4QTIH 3REVB 5HYIA 3TN0A 4APQC 2XWTB 2VDOL 3C8DA 4K23H 3NTCH 1QA9A 1IEHA 3JZ7A 1M7DA 1ES0B 3LQMA 3QFJE 1XF4B 3R1GH 5E2WL 3P0YH 3QXVA 4P3DA 1WAAE 3HZMB 5EZOH 4K7FB 4JHWH 4OZIF 2DLFH 3LPFA 3SY0B 4OLYL 4UIMA 4M3JA 2DTSA 4G6MH 4LGRB 4V2BA 3H9SA 1RU9L 2WWKT 4HKXA 1B0GB 4PJDF 3O6KL 2BXZA 3FN0H 3D3VE 1OW0C 3RP1A 1SEBA 5LQBH 1MFAH 5ADPH 1CBVH 1I8KA 1G6RH 2AV7A 3UPRB 2HFGH 3X3GH 1NANI 1N8ZA 4RFNB 5HGAB 1Q72H 3VXMD 3LS4L 2CK2A 2FIKA 3HPLB 5CHNA 3C5JB 5KOMC 5DFWH 3GMLA 1Z9OA 3IJYA 1U92B 2YA2A 4GAYA 3F7YA 3OHXA 3SKOB 5HDQH 1F11A 4Y19E 4L4TE 3K1KC 2A0LC 1JWUA 1P69B 3BKML 1MHEB 2NW3A 5HYJA 4P59H 3HE6A 5IEKA 1A7OL 1I1YA 4G43B 1X44A 5GRUL 1P5VA 5BRZD 5K59F 3MACL 1H8NA 3MLZL 1Y6KR 4XVUD 3LKSB 1CBVL 4ORGA 5ADPL 4X5XA 3LH2L 1Z9MA 3QDJA 4JRYE 1G7LB 3EYUL 3GMPB 3FN0L 2FATL 3P3YA 1L0XA 1HH9B 5C09E 1RU9H 1NGZB 1YYML 1S9XA 3MZTA 5CBAA 1NBQA 1XF2B 3BGMB 1UT9A 3T1FB 1FL6B 2ARJB 4PB9L 4WI7A 1K5NA 4XRCB 1IGIL 1S7UB 1U93A 3BP7B 4C59B 3OBAA 4X4MA 2O61A 4OGAC 4KK8D 2EE6A 3CCHB 5DJYB 4I9WD 3FQRB 1FJ1B 4KI5F 2E9JA 3GI8H 3P0YL 4QRPB 2WMPA 4ZFOA 4LNVA 3QWRA 1A6VH 3O45A 5KTEH 4PP1D 5D2LE 5ENWA 4UNVA 2BSTB 3FQWA 4TSAL 2V9QA 3JV4A 1ND0A 4Q6IC 1FLRH 2V17L 3HUJB 3PG2A 3HNSL 1K8IB 1RK0A 4RX4D 4FQIH 2WUCL 1NC4D 3TGXA 4S0TD 3RL1B 4QWWD 2DM4A 4IS6A 4WCYL 3DXAD 1A7NH 3D18B 4DOHB 4KUCF 5ELIA 1A7BA 3FOMA 2PYFB 1U6AL 4ZPTB 5IK3B 4OBSA 4DW2L 1QHPA 4UTAL 2DQIH 1CR9L 4XI5C 4Y5YC 4XPTL 1ZA6A 3C5ZC 3O6FB 5FK9A 2CDEA 2LV4A 1EGJA 3EBAA 4YNYA 1NCAH 4G43A 3VWKB 4BQ8A 1U9KA 3QPXL 5GGVH 5IBUG 2AJ3B 2P8LB 5EIQA 3KXFA 4UDTB 3ARQA 4KMLB 3A6CL 4OSUH 4Z7VB 4PJDE 4X6DE 1YPZF 5ICYA 4CMMA 3UTSB 1G0XA 2MHAB 2CDFB 1QLFA 4XB8A 2PW2B 4TTDC 1F00I 1OAXL 2DWDA 5EU6D 2ARWA 3V0WL 3KLDA 5IKCB 1WWBX 2FIKB 2AEQL 2VWEE 4NWUH 2LU3A 1RVFH 4F7CA 2CUHA 4MCYA 1MJ8L 2F53E 5ESVB 3MRJA 4NKMB 3V6OE 5D93C 2Q6WA 2LABA 5E2UL 5GS2H 5I0DA 1KEML 4PPTA 2BP3A 4WEUD 3VG0H 3IDUA 4XCCL 4P9HC 1IBGH 4JFFA 3TO4C 5CCKH 2HLFC 2R0WL 3MRJB 1OP5K 5T1MB 1TJGH 3OXSB 4HFUL 4DQOL 1Q9LB 4Q0XH 3VXMB 4HEME 5HI5C 2EC9T 1A1MA 4WUKH 1X5ZA 4G9FA 2E6JA 5I1GL 3KPRB 2EKSB 2BC4A 3PWVA 2QQNH 4PG2C 2ZUYA 4GUPB 4EOWL 1TETH 2C7UA 2VXQL 4KVNH 3VXPB 1CGTA 5CJBA 3LCYA 3L7FA 3N1PC 5CUSH 5HDLA 2FX9L 3K2UH 3MXWH 4JFZL 3TPKA 1CE6B 4EZMA 4R8WH 4U6VL 3SO5A 1IAOB 3ULVL 2DMKA 2PUQT 3OMZA 5E8OA 2C1OB 5F7HA 4PJEF 4LLDA 1I3RA 1DBML 1BBJA 1C08B 3VU2A 2Q87A 5I73B 4RA3A 4ZOBA 4PB0H 4KJYA 3ARBD 5E8DH 1U8KB 4LARH 5IROA 4MDIB 3F7VB 1F45A 1E4XH 3PQYE 4PTUA 1XF5B 4OD1L 4XCYA 1OAQL 1WAAF 1ZT1B 2E6QA 5C6TL 1YDPB 2IAMB 3TBSB 5DUMH 2X4NB 3W9EB 5HHVH 2AK4D 2Z4QA 2PO6C 3FB8A 5FGBA 3PQYA 1A21A 1W2KT 2VDQH 5AAWA 1OTTC 2BJML 5JDSA 2DIBA 5ETUB 4NN5C 4XMKH 1NCTA 1KXQE 3HC3L 2LTQB 1RFDH 3NN8B 4S1QL 5B38A 3GO1H 2FJHA 3JTSA 1XR9A 2JCCA 3VCLA 1AFVL 1MCSA 1NBVL 2YMXH 3TIDB 3GZKA 1U8HB 2ADFH 4Z7WB 1MI5D 1UFUA 1YEIL 3QDGE 1LO0H 2ESVD 3FAXA 4XNYL 2ICWA 3MLTB 4KPHH 4YBQD 3RVTD 1QLEH 3V6FB 1GOFA 4HKZA 5EBMB 4ZUSA 3V7MA 1SMOA 1I9RH 3PJSA 5INDA 3UYPA 4E0RA 5F1IA 3MRDA 5ICZA 1KCKA 4ZD3H 4JVPA 4PRPD 1OL0A 1RHHA 5GGUB 3MJGX 1BBDH 3N85H 4JZJC 1LGVA 2FH6A 4IRZL 5HYJB 4XC1L 3MOBL 2MWCA 2CIIA 5IBTL 3QRGH 2H2SC 3GFUA 1QD0A 5GGSB 3FTGB 3O4OC 2LU7A 5BRZA 4G8GA 1FNAA 2VXVL 2UY7A 4BK4A 4PUBH 2R69H 4BFIB 4XCEA 1D9KC 4L3CB 1MRDH 4GMSL 3L3JB 5LGHH 4LPUA 3W82A 2HT4D 3ERYA 4QNPE 2K7QA 3GSNL 4NQCB 4HT1L 1MIEH 2CK0H 3KYNA 1HXYA 3PWUA 1WIPA 5GHWH 4YGVB 5IBLD 3NFSH 4GKOA 1XH3A 4JPKL 2OL3L 4I3SL 4LFHD 5I1CL 7FABL 4MGXA 4G5ZL 2VXTL 3HZKA 3WFEL 3J8F7 1CU4L 3KYOB 3UP1A 4L8SB 3FB5B 5A3IC 1GCFA 43C9A 2CMRL 4L9LC 2FL5B 2DLHA 2XV6B 2KQNA 4PLKD 3DUSA 5E6ZA 4R4FL 2R1XB 4D8PB 2F15A 4R96A 5DWUH 3PP4H 3QAZC 4QRPD 4FQXD 3HI1A 2NR6D 1EAJA 3E3QA 5F7FA 2V6HA 3MOAL 2GK2A 4N8CH 4PJCE 5DEGB 4P0DA 5BOPA 1JTOA 2XZQH 3QH3B 4H26A 5HGHA 2XWJB 3FB7B 3HI6L 3LMJH 5IFJB 1G0DA 5IMLA 4F7EA 4X80H 3U6RA 5FF6B 2VZ1A 1CIDA 4JQIH 4K9EL 4UT9L 1KJ2B 4Y5YA 5C2BH 1BGXH 3HNTH 4Z77A 2DQHL 4PJGB 1MVUB 5HVHC 5DK2B 4KQ3H 2ESVA 3HPJA 3T2OA 1MCDA 5CSZB 4O2CB 4MJIB 1KG0A 3BWAB 2F54A 1H3UA 2AEIT 5IV2B 2G60H 1QVOA 4RGMC 4RDQF 5SWQA 3VA6A 1IKFH 2VDPL 1KELH 2GUOB 4KH2A 5L88L 4KMTL 1DR9A 2QQKL 5JZ7D 2X09A 4ZUVB 1K6QL 3T65A 4OV6F 4UDUB 2DS4A 3QDAA 2YA0A 3LEXB 5F97E 5IEHB 4NRYA 2CGRL 1F4HA 3CDFA 2PW1A 3LHPL 5DD6B 3LQAH 4B41A 4FQ2H 1VFAB 5BZWA 1GPOL 2ZUVA 4NO2A 1AO7B 3H9ZA 3IAQA 4XGZA 3ES6A 4RFOL 1MFCL 4X4ZA 5DI8B 5B38B 3U7AA 1Z9SA 4LCIH 5J4MA 1AGFB 1CVSC 3ROLB 1M71A 4HIXH 3HE6C 1HSBA 3BAEH 2Z31C 1JFMA 3PWPD 4MB4A 2YBRB 4L8DB 1FPTL 3VGDA 1C7SA 4U1MA 2B39A 1QSEA 1LK2B 4JO3H 4YH6A 5JXED 4JN2A 5JMRA 3QDHA 4GAYB 5FHBL 3CFDB 3O6LH 1KGCE 1QFOA 4U7MA 5IGXL 3MA9H 3TYGH 4YBLB 3K46A 2XKSA 5I74B 3GSOA 1U8QB 1OGTB 1Q9KA 4MAUH 4G9FE 1T4KB 3FT4B 4XXDB 5DSCA 1N8ZB 4OB5L 1YMMA 4D9RE 3SDDB 4K2UH 1Z9LA 4PJIE 3CZFA 2GSGA 4JFOA 4RFEB 2R15A 5HHMA 4PJ9B 4LEXL 1A4JA 4HG4K 4JO1L 2VLLB 3F65A 4OLWH 4LVOB 2M26A 1YEGL 1VGKB 2UWEF 3WFBH 1O5DT 3WNKA 3FQNA 1PQZA 3CMOL 1FZKB 2R4RH 2BNQB 4I8DA 3RWCA 3K4AA 1UZ8A 3OX8A 4NQSB 4PV8A 3PGDB 2FCBA 5CZXC 1S9XB 4YXLH 1FSKB 1OSPH 5CGTA 3Q1SL 2NXZC 2FB4L 4PJXA 4H20H 1ZK9A 3RGVC 1EO8H 4LSRL 3D39B 3PXHA 2VE6B 1IC1A 4XVSL 4YHLL 1D9KA 5SV4A 2FSEB 5HY9B 3CDGB 2DQEL 1BFOA 2EYRA 2IQ9L 2A0LD 3LIZH 3Q6GL 1YN6A 3BW9A 1MNUL 1QA9B 1H3TA 2LTQC 3VFSB 1T80A 5CD5D 4CN1A 3IDXL 5EZLA 4ZS6C 2PXYC 2HT2C 4X6FA 3QHZH 3I3DA 3U1SH 4FA8A 1LDSA 3CVHB 3BSZL 1F90H 4M5ZL 1MCPL 3TPUA 3NCJH 3P40A 1KFAH 2GYSA 5J9PA 4EBQH 4OAWA 4XPBL 3OR7A 1K2DB 3JBG7 1IGJB 3QRFM 3G5VB 4M62H 1OGAB 1MFBH 5EIIB 4LF3B 4WFEE 3MLPA 3S34L 2DF3A 3HS0B 4HC1H 1CT8B 1MWAB 3GSWA 4M1GH 3MRFB 1T66C 5LKNA 3SBWA 1LDPL 3VXOA 1SY6L 4RBPH 1OGAA 2IG2H 3VD3A 5C0JB 1VACA 1RZ7L 4HJ0D 1VPOH 3MLXL 3VFNA 2F53B 5DDHB 1S9KC 5TDOB 4DKEL 3MYZA 3DOSA 4TVPH 3O3BB 2QBWA 4M9OA 2EYTB 2XPGB 1ORSB 2RB8A 2WWKO 4H8WC 4Z7NF 3D0LB 3T4AA 5I8KL 43CAA 1A3LH 4K94C 4ZO9A 4KFZC 2QKIB 3H42H 3TBVB 4DK6A 1LD9B 3AUVA 3EYFB 1H0DA 4Y5VC 1KB9K 5DRXA 2NX5B 3LRSB 1CICA 1AKJD 4LCWA 5TDNB 4JHAL 1UGNA 1MFDL 4PJ7E 3RNQA 2AABL 3D39A 2NY2B 4Z78B 2GFBB 3LAFA 5GQBA 3DVIA 2NX5A 4P4RB 4ZUWA 1A6ZB 5E56A 5EC2B 2XZCH 3RVVC 3G6JA 1HN1A 4Y5XA 4G6AC 4IJ3B 1KTLA 4KJPC 4L9LB 5DRZA 3PQYD 2YUXA 3IDIA 2R0ZH 3GIZL 3O45B 3CPLA 1I9JH 5CKAA 5E5RB 1J5OL 3UXFA 3VGAC 2G5BB 1WWCA 3MREB 4PRID 5C0AA 3MRCB 3RX8A 1UWGL 5DVLA 3ZDZE 4LKCB 2B0SL 1T0NA 3CSYB 4DVRH 3VXRB 1U91A 2AJYL 3GSOB 5EZIL 1C16A 3PABA 8CGTA 4I18C 2AXGA 2FD6L 2WBWB 3S5LB 4PJDB 4U3XA 1PAMA 1MCBA 3E1F1 3QCTH 1CFVL 1H3GA 5IB5B 3I6LD 1TZGL 2PN5A 25C8H 1E6OH 4G3YH 2PO6A 1FL3B 2FGZA 5BOZG 1FBIH 4S0UC 2P5EE 5FGCE 2HMID 2E9WA 4FMFA 5D7LA 3BZ4B 3EHBD 2ZCKL 3KPTA 3MBXH 5MEOA 4QTHB 1T7VA 1XR8A 1NCNA 4U1NA 3VI4E 2JB6A 2R23B 1CFTB 1I85C 1FL5A 1IQDA 2BNRE 2FX7H 2R39A 2AQ1A 5FKAA 5MERB 1FH5L 1IC5H 3Q5OA 1INEH 3FFDB 4PJ7B 4Q6YA 1KPVB 1U8MA 1GC1L 1A7QL 5IFAH 1I8IA 2DYPB 4ZDHB 4XBPB 4ODHL 2AAVA 1K4DA 3C5ZD 1DSFH 5CHNB 3KLSA 3CXHK 3U30C 4MD5A 1KV3A 1TLKA 4XZUA 4QF1B 4RMRA 5DHVA 1XIWD 4JFFB 4MZ2A 5SX5H 4M3KB 3VG9B 4ODXB 2E27L 2EYSA 4WU7A 3WFZA 2DJUA 4LLQB 5SWSE 4IDLA 3P0GB 1SJXA 4AH2A 3IDGB 1CZ8L 2DRUA 5EH1A 3REWB 3GRWL 4DEPC 1BD2E 4P2RE 3DV4A 5DVMA 4RWYL 2P48B 2W0FA 3NZHL 3MRBA 3P4LA 4LSPL 3CK0L 1G7QB 2IAMD 2OS7A 5C0GB 4OLEA 2VUOA 3MRRA 3VFOA 4E41B 1AY1H 1HNGA 3RZCD 3BXNA 2D0FA 2MHAA 3CPLB 1DJSA 1OTSC 2ZUSA 3WS6A 3QUZA 5KS9E 1KN2H 3QZWG 4WJ5A 4P2QB 5KW9H 3S9DB 2Y25A 1J8KA 3MGOB 1HSBB 2PR4H 5C09D 4JRYA 1AXTL 3NIDE 4OZIA 3W5MA 3MXVH 4JY6A 1IILE 1ZEAH 5E8NB 5I1KH 3CLEL 4N5EC 1Z5LA 1MF2L 4GKNB 4V1DD 4R7NB 3OGCB 3ARUA 4PJCA 3ZYIA 5TQ2L 2W91A 5JMOC 2VN7A 1YNKL 5TE6H 2R9HC 3EYQD 1BQSA 3ZT6A 1L6ZA 3TFKC 4L4TB 1J87A 2EDEA 1L9NA 3CH8A 3SBWC 4NQEE 3T0EB 4ZS7H 1JGDA 3O4LE 4PRAB 2CKBA 2CXGA 3TESA 2UZIH 3GMRA 1U8OA 3QUMA 5EBWA 4A6YH 5DMGD 2N56A 5BW7A 3O4OB 3R8BB 5B3JE 4NNXA 1RUAL 1HINH 1C12A 1T2QH 2WK2A 5A16B 5B38G 3P0VL 1JGEB 3WFHA 4G42A 3VXSE 2F53D 4WWKA 3QCVL 2DI7A 2VLJE 5D7JA 3BJ91 4D0BB 3CK0H 4RIRB 3OTTA 5FM5O 3MC0A 3MJ7A 3HZYA 3BPCA 3S7GA 1QUNA 2AP2A 2W9EL 1P9MC 4PJ5B 3GRWH 3QI9B 3HCVB 5I15L 1S7XA 2D0HA 4OIIH 1I1AC 1VFUA 3KHQA 3W81A 2EEDA 5J9PB 4R90L 2OI9C 1LO2L 4LDLB 2CO7B 2VDRH 4NO3B 5BS0A 1MRCH 3AMKA 5JPNA 4EI6A 4X9GA 5I18H 3V79C 3OSKA 4KROB 1SM3H 5KSBA 1M7IA 2X4RB 4RAUA 2YSSA 5I8CA 2FJHB 5IQ7L 2EDFA 5EWIH 3EKCA 4JGMA 1IGCH 3RWHA 5EN2A 3GK8L 5FM4A 4YDJB 3TFKD 4RWHA 3ZYJA 3S3JA 1X5HA 3D9AL 4Y5VA 2EDWA 1AD9A 5DJAB 3UYRL 3NCYS 3QDGA 3I6KA 4IOSD 4FQCL 3UTZA 1AIFB 5JIKA 1MCWW 1X4ZA 4NJAL 1LE9B 2HKFH 1QACA 1BPVA 3DV4B 5F7MC 1A3QA 3MMEA 1DBKL 2IH1A 3O4LB 2AJSH 1FGVH 4EDWL 3SGKA 1U8NA 2B4CH 3GJFK 2D7TL 5JW3H 4K8RD 1A4JB 1DBBL 3WDIA 4DN3H 1XAUA 1H8SA 3JWOH 4CVXB 1BBJB 1ZVHA 1NGWA 4G8GE 1G7MA 3G6DL 2W92A 4NQDE 4GSDH 4O00A 3RNKB 4WW1A 2DN7A 3NIGF 1OARH 1OCWL 2DQFB 5D1XD 1UJ3C 4LOUD 4YK4C 3BKYH 3U7YL 3LZFL 5TFSH 4PJ5E 4HCRH 2MFNA 3BN9C 4FTVA 4Y4HD 1I9JL 1J18A 1YEDB 3TH3T 3GIZH 5BS0B 4P23B 3MJ6A 5MENE 1JZ5A 3NABL 3N1MC 2XQBL 5HDBE 3ARFB 1A1OB 2HVJA 1Q9OA 2Z31D 3HHRB 2BVOB 4P2CG 3WMSA 3LQZB 1M4KA 4PJ5A 3C2AH 4GLRH 1CDIA 3MJ9L 2OXHA 2ADJB 1KB5B 4PLKC 1FL3A 4PY8J 2X7LB 5FYJL 3KVQA 5TDPA 1ONQB 4GS7B 1CYGA 3FRUB 2OI9B 5JHDA 5L2JA 4F57L 3BPLC 1SBSL 3U7WL 3VXTA 5DMYA 3SDDA 2CLRB 4LLYA 1A9BA 1BQHG 1C12B 5KZCB 3ZL4H 1M05A 4UT7L 35C8H 1QSFA 1Z2KA 5E4EB 1INQB 4JPIB 1KJ2L 2NY6C 5HVFB 1MCNA 3C8KB 5D1QB 2DM3A 4OZGF 5GRVK 1OGAE 1A3LL 5FM5M 2DQUH 4QXTB 3NZ8B 1FVDB 4O5LH 3HUJF 4PTUB 5F9OH 1CD8A 2DQJH 4EJ1C 4CU8A 4TVPL 5D7KD 4AT6A 4MJIA 3M1BA 2Q1EA 3HZVB 4X4YA 3HRPA 2CDFA 2Y06H 4RFNC 3AREC 4UQ3A 3VJ6A 4J8RB 1SJEB 4NJ9H 5IW3A 2J6EL 2JLLA 3MNWB 4QY8B 3EOAB 4P5TC 5HBBA 3VFTA 2BRRH 1ZT7A 1UC6A 4KTEL 3S34H 4Z7QF 3EJJX 2ICCA 5GRZA 1JGUH 4RGMB 5F88A 4LSSH 1KBGH 2EYRB 4KZEH 2APXA 4IRSA 5JHLL 3B9EA 5IG7A 2CO6B 4EBQL 5DLMH 5CJXA 2NX5E 2ZG1A 4XBEH 4Z7VF 2E7MA 4GW1B 1MCPH 1QQDB 5GJSL 3TJEL 4OCWH 1CICB 3QHZL 4WY7L 4MNQB 2KPNA 4QHMB 3OKLA 3GSNB 3H7BA 3LN5A 4FFZH 1A1MB 2FJFB 3HAEH 4RAVA 3V2AR 3ARDD