3B3IA

Citrullination-dependent differential presentation of a self-peptide by hla-b27 subtypes
Total Genus 79
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
79
sequence length
276
structure length
276
Chain Sequence
GSHSMRYFHTSVSRPGRGEPRFITVGYVDDTLFVRFDSDAASPREEPRAPWIEQEGPEYWDRETQICKAKAQTDREDLRTLLRYYNQSEAGSHTLQNMYGCDVGPDGRLLRGYHQHAYDGKDYIALNEDLSSWTAADTAAQITQRKWEAARVAEQLRAYLEGECVEWLRRYLENGKETLQRADPPKTHVTHHPISDHEATLRCWALGFYPAEITLTWQRDGEDQTQDTELVETRPAGDRTFQKWAAVVVPSGEEQRYTCHVQHEGLPKPLTLRWEP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system
molecule keywords HLA class I histocompatibility antigen, B-27 alpha chain
publication title Citrullination-dependent differential presentation of a self-peptide by HLA-B27 subtypes.
pubmed doi rcsb
source organism Homo sapiens
total genus 79
structure length 276
sequence length 276
ec nomenclature
pdb deposition date 2007-10-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00129 MHC_I Class I Histocompatibility antigen, domains alpha 1 and 2
A PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3b3iA02
3.30.500.10 Alpha Beta 2-Layer Sandwich Murine Class I Major Histocompatibility Complex, H2-DB; Chain A, domain 1 MHC class I-like antigen recognition-like 3b3iA01
5DHXB 3NGBB 3GSQB 4XAWH 3HUJA 3VFVB 1MHEB 1LILA 1X5XA 4HWEH 2IPKB 2Z4QA 5IJKC 1N64L 5E8PA 3MUJA 1ZHLB 4IHOA 1XGTB 2J6EL 5DRWB 2OSLA 1T7XA 3DBXB 3MREB 4LK4A 4LSRL 4WUUD 5FHAL 1LE9B 4Q9RH 3O45A 5D96B 4NKDB 4FQ1L 5ISZE 1Q38A 1BLNB 4MNQB 4U1NB 3KR3H 3TO2B 3EFFB 1QR1B 1WCQA 3IVKB 1QO3A 1YEGL 4AK1A 5DJZA 5F7DA 5CWSA 2Z8SA 4Y5YC 2XPGA 4X5LA 5D71H 5T1DL 4WUKH 4TOYH 4P3WA 1KT2A 4OCRH 3FFDB 3O41B 3A6BH 1O0VA 3QG7H 1FRGH 4KMTL 7CGTA 1HEZB 2X7LB 3P9MA 4JPVH 5EU5A 4Q2ZB 4Z7UB 2VLJD 3SKNB 2KDGA 5HYSB 1GCFA 4YR6B 3BEWB 2VXTH 4KK8D 4X6DE 4PIRF 5GGVL 2WSKA 4K2UL 3HZMB 4I0PA 2R2HB 2GJ6B 4K7FB 2A9NH 1XMWA 1YEFH 1A7PL 2BVPB 4ZFFB 4YPJA 3UC0H 5FGRA 4CNIA 2X1PA 2GFBA 1JPTL 2LAAA 1U8PB 3DECA 2GUOA 4IJ3C 4LHUG 4NQXA 2HJFA 4ALAH 3KXFB 3DMMC 4DW2H 5GS2D 3RWHA 3TBVB 2XNAB 1NBQA 4TSAH 4ACPA 3CZFB 3H9HA 1QEWA 2R0WH 5JUEL 3VFWA 4X7SL 2X89A 1YN7A 3SCMB 4NJAL 4NOBA 4K55A 1FYTD 3LEXA 2BVOB 2Y07H 2E7MA 3AU1B 4JEGB 1A1MA 1EHAA 4V2BA 5JQ6H 1D5MB 4LOUD 1FFNB 2R0LH 5EOTA 1XF5B 3CSYB 4PG9A 2Z91B 1T83A 2Y6SC 3VFNB 1UH2A 4MVBC 3G6JE 3HC0B 1FVCB 3HE6A 1QLEH 2CO6B 5E95B 3TYGL 3H2WA 4W4OC 3ESUF 5DK2A 2A74B 3CMGA 4PV9B 3GSRA 5KS9A 3F62A 3DXAA 1UYWH 3MJ7B 1G7IB 3EOAB 3CUPA 2VDRL 5IT2H 4FABL 3MC0A 3QCUL 4HIEB 1CICA 5D2NC 1INQA 1CE1L 4JM4L 2IH1A 2QQKL 2V17L 4LLYA 4BFIA 1GH7A 2DJ4A 2WANA 2IPUK 1MJUH 1XR8B 2MOVA 5IHLB 4ZODA 5AAMA 2FGWH 3STZA 3SO3C 1S9VB 4M1GH 1A1NA 4PJEB 4JRXA 3PDGA 4NHCH 2ICWB 4QHUB 1TZHA 4MJ2A 4PYGA 2Q76A 2C4FT 2R2BB 3DURA 4TRPH 1ZHNB 2W59A 3PXJA 1ADQH 3HG1E 4M6MH 4F57L 3NFNA 3FKUS 3QWOB 5T3ZE 4LQFL 5F1OB 3O6FB 4JKPH 1CL7L 3BH9A 1Z0NA 2A6JB 1P2CA 2X44D 4UT9L 2DI7A 5JDSA 3HAEB 5I8KL 4PJ9D 4L1HA 5C0FB 1RK1A 2YKLL 2D9QB 4ODWA 4PJAA 1KELL 4LP5A 1UKTA 1C08A 1P4LB 5ERWB 3T65A 1U8OB 3CZJA 4OFVA 1YYML 3DETC 3RIFF 5L8KB 1ZA3A 3QUYD 4QTHA 5KSVA 2VDMH 4CVUA 5I6XB 4E5XA 5E9DE 3W9DB 1ZHKA 1FZOB 3G9VA 4TVSa 1RIVL 5MEPB 4PRAA 3RJDA 3HCVB 2NY6D 5B4MC 1YYLL 2DMKA 3IJHA 1WBZA 2ICWI 4YHML 2FO4B 1CLOH 3UTOA 1I8KB 5D7JD 4GG6A 3UTTD 5GGSA 5CHNA 3O4LB 3FJTA 5CIPH 5GGTH 5KSBF 1FHGA 3WKMH 1FZMB 3DVGB 2M8XA 43C9A 2P42B 3MYZA 2VRAA 4OCMC 1IAIL 1G7JB 5F6HJ 4RGNB 1QACA 4MXQD 1DQMH 1IQWH 4LNRB 2GEEA 4IOFC 1KTLB 1HHKA 2H2PD 2Q20A 2VL4A 4N0YL 4PJCE 5EIVA 5TDNB 1BHGA 2BVYA 3H9SD 1SHMA 5CEZH 1A14H 5F6HI 4D8PA 3K8LA 1D5IL 1JN6B 4PJBE 1X5ZA 3B9EA 1S7SB 1UWEH 3VRIA 2HWZL 4XVTL 1U3HC 4HCRA 2IAMD 3L3DA 1H3PL 4NIKB 3QQNA 4CJ0A 4PRPA 1URLA 3RZCC 2CD0A 2H9GA 5DC0A 3P0YH 4KZDL 1HH9B 4MWFB 3EOBA 4HUUB 1H0DA 2XQYK 4R97B 1MCPH 4X4XB 5C09D 1VFOA 4H1LH 1DTUA 4QXGH 4WI2A 3LKSB 5DLML 2AVGA 2HP4A 4JVWA 4YHIB 3L3IA 1E28B 5I71C 5K9QI 3TO4C 3VD3A 1HHIA 5HXMA 4H20H 4U6YA 5F7KC 3VGBA 1XEDA 3WLWC 3UYPA 5I15L 1A6TB 1IBGL 5HSFA 1XCQA 1KFAL 3BVNA 4EUPG 4GMSH 4XNYL 2PYFB 5ICZB 4ZO6A 1GXEA 2ADFL 2JE8A 3BPNB 5FB8A 4GRLD 1UG9A 1DVFD 3G6DL 5IESH 4GBXB 2WUBH 3RTQA 2EYTA 2AXGA 4JVUA 4QGTA 1U42A 4GS7B 4WHTA 1B4JL 4AEEA 1NGYB 4M4RA 3VXPA 2DWDA 4S1RH 3NIGF 1AO7D 5DRZB 5I1CL 4MLSA 1GGBL 2ITDB 1KYOK 4G6JH 2AJ3B 3GMQB 5DQDL 4ODUA 1JHTB 4NRYA 3QUKB 4JAMA 1Q0XH 3IDGB 2HT3C 3IRPX 1F13A 2J5LC 1TJIH 2Y06H 1U91A 2BNRA 1HZHL 3ETBF 5T33H 3VFMA 5E6IB 4Z7OE 1MCCA 15C8L 3EOTH 3U7YL 1DSFL 1KCRH 4RFOL 4ODTH 2W60B 2JCCF 5D7LB 5CILL 4N1HB 3MV7A 2HRPL 4LLQB 4UINH 1KOAA 5DMYA 3HFML 4RWYL 5C2UB 4HWBA 2J88L 4O2FA 1NMCB 1SYSB 4AIZA 4PJDB 1W0WA 1XH3B 4NO3A 4URTB 2HN7B 5MERA 4F7PA 1OGAD 1YC8A 4UUJB 3ZE1E 1VFBA 4OZGF 3EYQC 2XXCB 3HNVH 3IFOB 4HKZB 4N5UA 4NO5B 3PJSB 2YPKB 2PR4L 4LVHC 1PLGL 2V7NB 3LMJL 1U8QA 1EK3A 5CINL 2NTFA 3EGSA 4O58H 4Y4FC 4DZ8B 2MKWA 4WY7L 1NGXB 3VD4A 4ETQB 1IEBA 2HFFB 3MRQA 3TBYB 5BS0E 3K0WA 3BP4B 5D1QA 3BUYA 5C0CB 1QG3A 5CSGA 2BOCA 3TYFB 4ENED 3GSOB 4W70A 3MJ9H 4ZFGH 4NN6C 3MNZA 3FCTA 5KN5B 4LNVA 2CGRL 1S7XB 1JF1A 4XAKE 4YBQD 1UA6H 2CR6A 4XBGA 4HLZG 2YK1H 4PTUA 2GY5A 4JY5H 1MIMH 3BQUB 3JV5A 2Z31B 1L0XA 4M3JA 1L0YA 4ZXBC 2BXYA 4O51A 1CI5A 2VOTA 5DJ0B 3TCXA 3O2DL 1AGCB 4UV7L 2BVQB 5JW5A 4FQHB 5M7QA 4OGAD 2XKSA 4TQEL 3QH3A 3V0AC 1E6JL 3EZ8A 3SGKA 5FYLL 4XP9L 1ZT4B 2FL5B 4F7MB 1FO0B 4TVPL 4JR9L 4ELMB 3VXTA 2YD8A 5J7CC 4PJIA 2VWEC 1KGCE 3SPVA 3O6LH 3QDMA 2Y72A 4DVRH 1H3GA 4LIQH 5JNYB 5IEHA 3NZHL 3LEVL 3AXLB 3V6OE 1FFQA 3MPCA 3AMLA 2KQNA 4J7RA 3SKJH 2YC1A 1AIFB 3KPNB 3I6KA 3NAAL 4GKSA 4OV5B 4V3DB 1EFQA 1TMCA 1I1FB 2GJZA 2GTWB 4XRCB 5GRJH 5B22A 4H0GA 5ANME 4L3EE 3TBSA 5F7WC 2YBRA 4HG4J 1KTDB 3OB0H 4N5EA 4L8CA 4HS6A 5AZEL 2B4CC 5F89B 3ARGA 2VXQL 4NC2B 4KK5D 4XHQA 1FFRA 2VDOL 3IDXL 3VE0B 3UBXA 4S10A 5HVHB 4LAQL 5C71A 1NKRA 4UNUA 2A73A 1E4XL 3MRHA 4LRIC 4WUUA 1JHLH 4L9LC 3AS1A 1EFXD 3QXWA 3BPCA 5ITBL 3NIFF 1A6UL 3FO2B 3RWFB 1QRND 3D25A 4U7MA 2NXZB 3SDXA 2F54B 3B2VL 5C9JA 5L8LB 1CDBA 3BOVA 1NLDL 1IVLA 5HHME 4G7YL 2J6EH 5FHAH 1CIUA 1J0ZA 1FAKT 3BAEL 4KPHL 4M3KB 4OSUH 5CZXC 4AL8L 5A40E 4NCDA 1NKOA 5EN2A 3D3VE 2QR0A 4MX7A 3NOIA 1DR9A 1Q94B 1FL6A 1YEGH 3U4BH 2X40A 4LKXB 1QSFA 1X44A 2W91A 1CXLA 1OHQA 3ZT7A 2NQCA 2BCKA 5JORA 1Q8MA 2QHRL 1JZ4A 5T1DH 2E7LE 1AFVL 5DHVB 4BH8A 1MNUL 4PUBH 5I75B 3QIWD 4NC0B 4KMTH 4M48L 3WXWL 1WBYB 4O5LL 5GGSY 5DURB 4NKIL 3JV6A 5ALCL 3K3QA 5I1DA 5C08E 3MNWA 5GS0D 2JIXB 2HKFL 5EUOF 1I4FA 4XNXL 1IAKA 2CDFA 3VGAC 2YUWA 3BKML 4Z7WA 4MS8C 1UKSA 5AD0B 3MRLA 3DV6B 4P48A 4GW4A 5CJ5A 2VL5A 4PJGE 4NQSB 2LV4A 4QHMB 3REVB 2FO1A 3NCCB 1FYTA 1JPTH 3CFEB 4JRYD 1V8HA 1Q72L 3NBNA 5D93C 1A8JH 4PJXF 5ICXB 4NQDB 5B39B 1X5KA 3FQUB 5FDYA 2AK1L 3QAZB 3WCYA 4M7ZC 2H8PB 4PJ5D 1ITCA 2P8PB 3ZKMC 4N1EA 5LAXA 3O6MH 1F58L 3R06A 1QVOA 4HKBA 2XTJB 4RBPK 2CJUL 2DM3A 3NCYS 1U95A 3MRFB 2RHEA 3V7AE 2WBJC 5HBBA 4NHUA 2X05A 1DP0A 4L3CA 4EVNA 4PG2A 4RSVA 1VFAA 5CJOH 3U83A 3QUML 3MOQA 1I1YB 2OP4L 2HVJA 4CDHA 4XNUL 3OX8A 5TH2B 3BGFC 1U9KA 4EI6A 1EAPA 4Z78B 3W9EB 4HZLA 4S11A 3ZE2E 1OB1B 3TYGH 4QRPB 4YDVB 5JPMA 1MLBB 3K2MC 4Z9KB 4PRBB 4JVPA 4ZO9A 5ETUB 1JWUA 5D5ME 4F2MA 1DBJL 2VDRH 2FZ3A 4MDIA 3AAZA 2CDEA 2IBZX 5LG1A 4GW5A 3VXSB 4ELKA 5GRWA 3ES6A 4Y4HC 1CE1H 4NKMA 2QQKH 4CJ1A 3J7HA 4G8FB 3MFFB 5EO0B 5EBWA 2LVCA 1NSNH 2O5XL 1Y18A 4G9FD 4RNRA 3CDYA 1S7QA 3RNQA 3I3BA 3KYNB 5C07E 3V6BR 2YN5A 2P7TB 4LCIL 2PXYB 4N9OB 5HGHB 3K81A 4PJ9A 1CDGA 2OI9C 2GYSA 2DLFL 2F5BL 4LEOB 1VADA 4G43B 5EFIA 4V1DE 2FBJL 4X9HA 4F57H 1FV1B 1FGVL 2XACC 3DPBA 4X6DF 4LQFH 3V52L 3QUYA 3L5JA 1QSEE 1YEDA 4HWZA 3SGJA 5A2KH 4KROC 5TE4L 5H2BB 3GZKA 4UV4L 1TZGH 4QOKD 2A83B 2YKLH 4LKCA 1MFEL 3UTQB 1AGDA 4U1LA 2VDQL 4Z5RB 1SM3L 4ZFOL 1YYMH 5DVNA 3WSQH 3UTTA 3ZYJA 1M71A 3HG1A 3FRPG 4CADA 5DEFA 5FDWB 1R3LB 4NKOA 1AD9A 4JHWH 1HHGB 3HMXA 3WHE1 3FB5A 3MLSL 1OY3B 4OCSL 4MXQA 4YHMH 1P6AB 4G80B 4I3RH 2FJHB 1IAIM 4HJJL 3LRGA 2FLBT 2X70B 3ZKNC 4PYHA 3MBEC 2CDGB 1UXSB 3H9SA 4D9RE 3SE4A 3QO1B 4ZD3H 3C9NB 3VGGA 1NDMB 4HJGB 3PP3H 3GMMA 4NDMA 5F96L 1FCGA 4AT6A 1QLRB 1NDGA 3KPSD 2D03L 3PQYB 3EYOA 1YECH 3CSBA 1XGQB 3K1DA 4KJPC 3RDTB 3MLPA 3N1MC 2DM4A 2IAMA 3VXRE 4OCLC 3WO4B 1CXHA 5C92A 3PIQA 3PGCB 5CSZB 5DURD 4LASL 4N0YH 1S9WB 2OR9L 3NPZB 4OUUB 3G6JF 4XI5C 1RZ8A 4JN2B 1IGTB 4PJ8C 1D5IH 3W0WE 1QFWL 2CLZB 2HTKD 2YZ1A 1NGPH 4HSQA 5C09A 4XVTH 1YEJL 5D6DC 4XGZA 3MRBA 1H3PH 4G7VH 1QZ1A 4XVUD 1PZ5B 1BOGB 5CLTA 5EU6D 4FFZH 3WIHA 1GC1L 5D8JL 4MD0B 1K8DA 3HI1B 4ZQKB 4PJCA 5DMKA 4GXVL 1FVEB 5I1JH 3F6LA 1UT9A 5I19L 5GRYA 4Y19B 2BMKA 2OJZL 1X7QB 5F8RC 4YNYA 1CBVL 1U3YA 2EO1A 4XCNA 8CGTA 5FYLE 3RQ3A 4GRLA 4R4BB 5DLMH 1LP9B 5FKPB 4TVPE 5E8OA 1MJ7H 4FQJL 3INUL 3E0GA 4OAWB 3FB6A 4S0SD 4R8WL 1IGML 4PRNB 1IGFH 2AXFB 4ORGB 4W4NA 2DYPD 1DQLL 1G7QB 1T5WB 1MFDL 2ADFH 2FIKB 4EDWL 3CMOL 4XPFL 5MHSD 4BSJA 1NUNB 1A7RL 5IFAL 1AGFB 1LO0L 2HLFC 4FFVD 3OZ9L 1CDCA 3D0LA 5KOVC 1BFVH 2I9TA 3VWJD 2X4RB 5TQ0H 3VI3E 4KC3B 5FYJD 3M45A 5HGBB 4P2RD 1U58A 1GGBH 1BJ1J 3QCVL 4L8BA 3VXMD 3MJ6A 4GW1A 5DQDH 1P84J 2I60L 2CRZA 4FQXC 4YHLL 5HJ3B 2FX7L 4APQB 5FXCH 2Q3AA 4MNGB 4G9DA 4JKKA 5J1SC 2OK0L 4JREC 1RMFH 5CD3A 1Y6MR 2YSSA 3QNXB 4IMLB 4U1GB 15C8H 4KI5D 3QI9D 3U7YH 1DSFH 1DLFH 1EGJH 3HE7B 4G3YL 4NQEE 4LLWA 1CFNB 3IKCA 5C7XH 4RFNC 4MB3A 1JHKH 1KJVB 4RWYH 3RL2A 5I74C 4H5SB 4WTZA 3RWGA 2N56A 3EDJA 3BRGC 4UIMA 3M07A 3RVWC 2VERN 2GW5A 4XTRC 2FSEA 1IC7H 3GJFA 1HCFX 3MRRA 4YC2C 3U46A 4PJBF 1AR1D 5BQ7A 5IB1A 2PR4H 4MAYB 2VDLH 3VGFA 1NCAL 4WWKB 4GAYB 4EN3C 2B0SL 1BZ9A 4KUCD 3OQ3B 4WY7H 3ZKXC 2X4SB 2XQYG 1FORL 3SE9L 4OLXL 4YDIH 3BN9D 3BISA 3O4OC 2Y9RT 3MV8B 1G7PB 1Q9WA 3BFOA 3LN4B 1IM3B 5HD8C 3UBXG 2ORBL 3ROLB 2C1OB 3ISWA 1YNKL 1T83C 3SJVD 5EPMA 5BJTA 3K80A 3ULUL 3HE6C 4U1KB 1VSCA 3LZFL 3ZTJH 2D31A 5I1LA 3D6GA 3L95A 4CU6A 1FLTX 4PRID 3V6FB 2CLVA 3L6FB 4PRDA 3WLBB 2BY2A 3QNYB 1J18A 2M1KA 3H0TA 2P8MB 3L3KA 3OTTA 4UV7H 4OGYL 3SBWA 3PQYD 4LSDA 2NY1B 1FNSL 4HGWB 2FD6L 4KKBC 3C5JB 1JGVH 5DJ2B 4O00A 5C0JA 1E6JH 2YD2A 3V7MA 4ZUTA 3SGDH 1VGKB 4ISVB 5FYLH 1NCWL 3I6LD 1MCBA 4OZ4B 4TVPH 4JR9H 3TVMC 3I9GL 5SX5K 5IKCA 6CGTA 3BN3B 3D9AL 3CDGA 3H7BA 1D9KA 2FWOA 2A77L 4B53A 3G08B 1KCUL 3B9KC 2IMMA 3RAJL 1N8ZB 3BIKA 4K7PL 3T1FA 4L8SA 2R1YA 5K9JL 4X6FB 3CFDA 1EA9C 4PBWD 1NFDB 1P9MA 3ILPA 2D7TL 4LRNH 1U8JB 3CC5A 4QGYA 4L9DA 3OKMA 3DX8B 4U1SA 1MOEA 4K3DH 4Z7OF 2YD3A 1LDPH 1IE5A 1ZVSB 2OXHA 4N0CA 3ARZA 3BJ91 2H32H 4TNVF 1QBMH 5BZWA 1P1ZB 4LCCB 1XGPA 3WFHA 5L7XL 1R3JA 1ZLVK 3QRGL 4TYUA 5F7MC 4OGXH 1MCQA 2VXQH 1KIRB 3LSOB 4U3HA 3KYKL 1N5YL 2VDOH 1JPFA 4KDTA 4HKXA 5DVLA 1NC2D 4U0QB 1I85A 4BZ2L 4JQXC 3BKYL 3RWIA 5C0AD 7FABL 1ES0B 2WBKA 4LARL 3EJYC 1QHOA 4QXWA 3LRSB 4YHZH 3NFPB 4RCAA 3JVGA 4RA3A 2EE6A 1EEUA 4OFKA 4Z76B 4P3DB 3IF1A 2RQ8A 4N8VB 3LQAH 1EEZB 3T0XA 1W72H 1XCTB 3KWWA 3CX5K 4FXLA 3UTSD 4HUMB 2YPVL 1G7HB 1RZKL 4HH9A 4J3WA 4RAUB 3GMRB 4KPHH 5HHOB 5BVJB 4AL8H 3DNKA 4JFXB 1FN4B 3AREC 4FQPA 4X9GA 3QIWA 2H26A 3SKMB 4P4KA 4DKFL 1F4YL 3FQXA 5J0BA 3PWPE 3ARQA 5HHVL 3OXRB 1T89C 1VB9A 2PTTA 3MRIB 2N7BA 4XBEH 1UQSA 2HT2C 4TUKL 1DUZB 4M7KH 3GSUB 3BW9A 4XCYB 4BZ1H 3ZO0A 3C5ZC 3RVVD 1YMMD 4AEHH 1RAMA 1S7RB 1CLZH 3GI9H 4F15B 3NABL 4BUGA 3SDAC 4D0BB 1KJ2A 3O8XC 3TN0D 1DQJB 4NKIH 1BEYL 4KJWC 4NQCD 2P5WB 2FCBA 1UWXH 4MDJB 3N0PB 5ALCH 4JRYA 1GHFL 1ZXQA 1WUNT 5IB2B 5GGUA 5D1XD 1Q9OB 2CLRA 4U7SA 2HKFH 5IB5A 3ZL4L 3NPSC 3STLB 2XT1B 3BKMH 4P2CG 4XNQA 4G8EA 1F02I 3BZFA 4PJ5A 3FZUD 3N9GH 4PBVC 1R6VA 4TULH 5FGCB 3KYMA 6FABL 3HPJB 1RJYB 3QDJE 3MUGB 2HMIC 4YHNA 3HZVB 4KVNH 4AM0B 1NMAL 5DD0L 1T04B 4Z7NF 2AS5M 2KBGA 1OAZH 3OR7B 3EAKA 3VG0L 2X6MA 4AMKH 5E0QA 5EUKB 5HYQA 3RI5F 2W92A 1JV5A 4I5BA 1CFVH 3UEZA 3O6KL 5BRZE 1ZT7A 3ARDD 4WTWA 1F58H 2QBWA 1SY6H 5J1AB 2CJUH 2Z35A 1TQBC 3P4OA 1P6FA 1OAXH 4LPCA 3GB7A 4LPVA 1ZVHA 4GRWE 3F7RA 3O11A 3C6LC 1A9EB 5DJYB 1HNGA 1MWAB 3Q6GH 3EO0A 4LSVH 3V5HB 3VG9B 1XGYL 4PLKD 4PP2B 3QUMH 3U9UB 2XFXA 4LCWB 5KAQG 2X1OA 3EO9L 3LQAC 4K71C 1JJUA 2OP4H 4OLEA 3W5NA 1AXSB 2JB5H 3VXOB 1R0AL 1BAFL 2GQHA 3LKRB 3VRJB 4HUKB 4MD4B 4WW2A 5IK3A 4BKLB 4IDLA 1J7VR 5C1MB 3DSFH 4Y5VC 3QIUC 4LLDB 1JK8B 2PKDA 5IFJA 2NZ9D 2D9CA 4U1IA 3QFJB 3TT3H 1WFTA 4FFEX 1SJHA 4YGAB 5A3ID 4MD5A 3WIFA 3QXDB 4B7LA 3OKOB 3S35L 1LMKA 2FX9L 2R29L 3GIVB 4X99A 4QEGA 3BIAX 3O9WC 1A6VL 5GS1B 3Q6FA 4YZFE 3MGTA 2Y36L 5DUMH 4HC1L 1TCRB 4P99A 1TNNA 5HTSA 4JB9H 1MRFL 5JW4N 1OLZA 5DEGB 1KCVH 1PGRB 4U6VH 3DHJA 4JM2D 1K8IB 5F88A 2WUCL 2Q7YA 2LU7A 1WZMA 4UILL 1YMHB 3TPUA 3U0PB 1N6QL 1FGVH 1F2XK 2VZ3A 1WWBX 4Y16D 2Q1EA 5EC1A 2E27L 4X4YB 1P5UA 1UCTA 3MGOB 4PJFB 2CXKA 1NPUA 1BF8A 4KGJA 4HIXH 3FQNA 1BZ7B 3IGAA 1CXFA 4PJGF 1MFEH 5I1IH 1UM6L 3NH7L 5C6TL 2VDQH 4OZFB 2NY4B 4PGCB 1SM3H 4UU9B 3KLAA 2XZAL 5BO1L 4V1DA 4XHJD 4MNQE 1J11A 3WD5H 5SWZD 1NBZA 1MHHA 3X3GL 4JKLA 3T0DA 4ZUSA 2ICEA 2I07B 3S5LA 4A6YL 3KPSA 5BXFB 3X13A 32C2B 4OCSH 3MLSH 4OI9A 4XMKL 4G42A 5FO7A 1PEWA 2QQLL 4YXKH 1JL8A 1S9XB 3K2UL 2ZUWA 3TA3C 4DFHA 1U92A 5I8OH 2D2OA 4AENB 1MI5D 3QO0A 3EJZD 4D94A 5F96H 2HFEA 3DGGA 4Z7UE 2EDWA 5FF6A 4Y5YB 1M4KA 4FMFA 4ZO7A 2ZOKA 4WJ5A 5DO2D 1WQVT 2CSPA 2AV1B 2EC9T 4Y4KB 2BP3A 4WV1A 2NY7L 2AK4B 4GXUN 4YK4C 3AFLA 4YFLI 3PWJA 2DQEL 2IMNA 3ZE2F 1NUFA 3ULUE 3QQ4A 4RZCB 4XPBL 3QJFA 1QFWH 2J1KA 4DGYL 3U6RA 3OWEA 4GRWH 1NCCL 2Z8RA 1YEJH 1MCWW 5D5MF 2GITA 2OTWB 3O2WH 3OMZA 5C70A 2DI9A 3VH8A 4Q9CA 3C60D 1FO0L 1IAOA 4WTZG 3JV0A 3KXFE 3ARFA 5GGVY 3KPMA 1KACB 5J57B 3VWKA 2EIZB 3DROA 2CPCA 4GUPB 4H25B 1ZA6B 3IDYC 3W0WA 2DYPA 1ZVYA 4OZHE 4K23H 1HWHB 1OGTA 2NY5H 1FZJB 4IJ3B 1D6EB 4KAQL 2HVKB 4L29A 2ZJSL 3S96A 4XVJL 4FQJH 3INUH 5IQ9A 1DE4B 4KV5E 3LH2L 4ZTPL 4R8WH 3VWJA 1F11A 3GNML 2PW1B 1IGMH 4RMRA 3O2DA 1F3JA 4WTXA 4OFYD 3LKQA 1MFDH 4BQ6A 2H6PB 3MLTA 3VXMA 5FO8B 4FNLH 4HMCA 5EORL 1HINL 1OPGL 4JPIB 1A7RH 5IFAH 5EOCH 1LO0H 2NY2B 1MJJA 4NZJA 3L3GA 2QV2A 5BZDB 4OD2A 4KK8C 4KTYA 1AGBB 4C56B 3F7QA 2X4NA 1SJEA 1YDPB 2NX5D 2DQTL 3FQRA 5HYIA 8FABA 3QFJD 3UDWA 1QA9B 3QI9A 1OT1A 3L3OA 3QR2A 3BH8B 3IAGC 4EI5D 5EO1B 3VFUB 1R3IH 1C5DA 4KGLA 5JHDB 2G2RB 3E3QE 1EZVY 2DMBA 4M9PA 3QIBD 4XZUB 2FX7H 3OXSA 5E8EB 5KVDL 3SDDB 5JR1H 2EO9A 2W9EL 2EH8H 2IADB 1FP5A 2KZ1B 5CZKA 4E42A 5D2NB 1DBKH 4PJEE 1HQRB 3BO8A 1A6ZB 2BDNL 1GZQA 4HK0B 4GAJL 4DKEL 2JB6B 5C0IA 3D18A 2VZ1A 1OAQL 3BP5B 5JIPA 3KPPA 3N85H 1TQCC 1KIQA 3FT2A 1SMAA 3DYPA 3J8F7 1KIUA 2MWCA 3QDAA 4LVOC 4P2OC 4NQEA 4Q0XL 3SJVA 3T3PE 1IGYA 1J88A 4IOIB 1NCAH 2IFFH 5L2JB 1U36A 3IDMB 5DR5L 3MROB 1FORH 3SE9H 2ZUSA 1WT5A 4OBRA 3O3AB 1KBGH 5EULV 5CP7B 4P5KB 2NY5C 2O61B 5DTFA 2NLJA 5EH1A 4X6EA 1T1YB 5GRXG 5HDQL 1LDSA 1YNKH 4BH7A 1XGRB 4CN6A 4NRXA 4DN4L 4HIHA 3ULUH 3LS4L 1ONQB 3LZFH 1F90H 1A2YA 4R0LA 3VMOA 5IW6A 2ZCKL 3O4LE 3UYOD 5IR1A 5EUOB 5KJRL 1JGEA 4Z6AT 2OL3H 2GI7A 1DANU 4QF1A 5DJ8B 1EJOL 4RGNE 4RA0C 3UZEA 1G9NH 4LBEA 4LHQB 1FG2A 4PTTB 3K8MA 5CEXA 5ID1A 4I8DA 4OGYH 3QHFL 4S1DD 1ED3A 1FNSH 2OCFD 1FNGB 4YHPA 4PJXB 1ZWIA 1JZ7A 2UVEA 5H35A 1HK6A 2EDOA 2R2EB 4HUVB 1QQDA 4GOSA 4OBSA 4UQ2A 3VI3F 1A6WL 3EBAA 3GMLB 1BVKA 3PWLB 1FFOB 4OM0H 4MJID 1NEZB 2HKHL 4KKLC 4HPOL 1U6AH 4JPWL 4PJ9C 4E41B 3PHOA 3QXUA 2RJMA 4L4TB 1KCUH 2HRLA 5FCUH 3VFOA 3JWNC 3RAJH 3NGBC 4BSVA 4K7PH 4P2QD 2VQ1B 3OBAA 5HI5D 1K4DB 2VDKH 5K9JH 1BD2B 3QUYC 4JZJC 1FYHB 1U3HB 1L6ZA 1S5HB 4GMTH 3DX9A 4M1DL 3RU8H 5LJYH 5DVKA 3RZCB 2B7DT 2XWBA 5EU3A 5D96C 4XPHH 1OCWH 2NY6C 3RIAK 1ORSB 5I0DA 1U93A 4XH2A 5C0AA 1OAYL 1FL5A 4MQ7A 2BOBB 1YNLL 3VFGH 5JDJA 5D7JC 5TPWH 1UJ3C 4OIIH 1KN2L 5B38B 5FUOH 4KI1A 1VA9A 3UYRH 1LK2B 2N4IA 2Y25A 3CDCA 4DEPC 4JFEB 5C0DB 4TUOA 1F3DH 3WJJA 1TENA 1S78D 1N5YH 1EO7A 5I71B 1I8LC 3GI8L 3LRHA 3TO4B 4BM7A 2WQ8A 3IFLL 4JQIL 3QEHA 3UTSA 4HUWA 3UJTL 3KS0H 1T4KB 5GIRB 3W5MA 7FABH 4M7LT 1QNZL 2B1AH 2PYEB 5FGSA 3TF7C 1FPTL 3SE4C 2FYYA 3GSXB 4JKMA 2DTML 2DL2A 5JHLL 3QZWB 4YXLH 2WP3O 2AI0L 4X80H 1N26A 3H3KA 3C6SB 1IKFL 4PRHB 2VXSH 3WIIH 1IKNC 4HQQL 1NMBL 2ADJB 2Z92A 4YUEL 2EE3A 3FO1B 1RZKH 5FKAB 4U1HA 4S0TD 1QR4A 1N2RA 4X6DB 5DRXA 2JK5B 5D2LA 4OCYH 4CVZB 3QEQD 1J1PH 3DSNA 4PJ7A 1KJ3H 1I3VA 3MV9A 4EOWL 1G9NC 5IVXA 4DKFH 4Z77B 5D7LE 2ADIB 1VACA 3L3HB 2V7HB 5J1TC 4WFHE 4NQCA 5INCB 4BQ9A 4DWHA 1JZ2A 1T20A 1U8IB 3AS3A 4XNMA 4TUKH 2F53D 3G5ZB 3WKNA 4I4WA 4K3EH 5D1XA 4KQ4H 3UJJL 4PJDE 2WBWB 4ODSL 1HH6A 5EBMA 4GO6B 2D4DA 5F1KC 1RVFH 4JFZH 1NBYA 4JY6B 5EZOL 4L5FH 2V2TA 1NFIA 3FO0H 3D2UD 3PWPA 4GRLC 1BEYH 1DVFC 4QYOB 2QSQA 4KVCL 2P46B 1GHFH 1IC4L 5BV7B 5KVMC 1BFOA 3OJVC 1MAKA 1RUPL 2V5TA 5GRVL 2R23B 5GISH 5C0CE 3QHZL 2IAND 2EXWD 2MQCA 5B8CA 4LVHB 5C0EA 3ARDA 3T1WA 4KJYB 4UOJA 5ESVA 3SGEH 6FABH 4Y4FB 4JFQB 1QLFB 4DAGL 2BNQB 2ADGB 3G5VA 5IVZB 1I7UA 1NMAH 1D3CA 4O2EA 3P9LB 4ZSOA 1AXIB 4IRZL 4LPXA 4Y8AA 4JJ5B 1BX2A 3E6HB 2EDTA 4I3GA 4DZBA 2VITA 3GUTB 1A21A 1R5VA 3QFDA 3PWNA 3KDMB 1QBLL 1A9BB 3P4NB 5TGBB 2VZOA 2G60H 2V2WB 5TE7H 3ZZ1A 3QDJA 1IL1A 3TEUA 2VLMD 5L6YL 5I8EA 4HEME 1XR9B 2Q86B 3LV3A 4FXKB 2OMNA 1T0PB 2WV3A 4ZXBB 4IS6A 4ELME 1R5IB 1BAFH 3TV3H 1RZKC 1B0GA 3ARBA 4U4BA 2DIAA 4CMHC 4WVRA 1RHHB 3K8KA 3WHXB 4C83B 2J8UB 4HWUA 4X5WA 4ZYKA 1O7VA 3V95A 3KJ6L 1R5WA 3FQWA 5DGRA 1N59A 2A6KB 4CW1B 5IEKA 2IPTH 2W0FB 3ECBB 1A7QL 4WDIA 1GL4B 3GGWB 3NZ8A 4NT6B 3S35H 4ENEC 3NFSL 2FX9H 4WO4D 1ACYH 1FC2D 4LLMB 5E24E 4HXBH 4L1DA 4LHUB 4RISH 2BY3A 4XXDB 1A6VH 3CK0H 2AJSH 3SO5A 4YBQC 1N7MH 1J9CT 2Y36H 4TSBH 4JDTL 5IUSA 4Y16A 5FOJA 1T7ZA 2P24A 3MJ8A 3VMPA 2ZPKL 1CF8L 1YJDH 3VH8G 4HZAA 2XZQL 5DQ9B 4F7CB 2HG5B 2D7OA 1J0JA 1RULL 1T3FA 2NR6C 5GSVA 4OTXL 3V5KA 2I9LA 1EJ6A 4OGAC 5FHBL 2ZOLA 3QA3A 3BZ4A 2F15A 2XWTA 3WEXB 3PNWA 5ABDE 1CD0A 4G5ZH 5JXED 3K7UA 5I16B 4QRRD 5SWZA 5MEND 5GHWH 4ZUVB 1A4KB 2AEQH 3BEVB 4JANA 2F54E 1JP5A 2JJTA 3JV4B 3VGHA 5FV2A 4NNPL 3U7WH 1UM6H 3NH7H 5C6TH 3SBWC 1OWRM 4JY4B 1MCJA 1MJ8L 2Z9TA 2F58L 4AJ0A 4IRSD 4L9LB 3DRTB 4GLRI 5T3XL 1NC4B 2NPLX 3X12B 1KJMA 4AH2A 4RAVA 5GS0H 4K8RD 4EDXA 2D0GA 3SQOL 4ZAKA 4M7JL 2YUVA 3X3GH 4WNQB 5AWNL 1BOYA 3GSQA 2NZIA 3PP4L 4OZIB 4XMKH 3CSPA 2R9HC 1U8KB 4R97C 5I30L 5KTEH 2QQLH 1GAFH 2VXUL 1G7MB 1DBMH 5EOQL 5KSAD 3LOWA 5D9SA 4GRWF 2QADD 3DBXA 2QQQA 3MRGB 4L8SC 3C09C 3DVNA 3EIFA 4R9HA 5DK0A 5DJDB 4YDLB 3CFIC 4PGEB 4NKDA 1I1AB 1P9MC 1VFUA 1RZGA 4GRMB 4KQ3L 4U1NA 3TO2A 1QR1A 3L5XL 2ZKHH 3IVKA 3QUXD 4NBZB 5FECB 3IRZA 4KK5C 1UCBH 5CGYC 4OFDA 3QYCA 3C60A 4JFDB 4Q6IB 4C54A 2DQEH 3T0ED 4OLZH 3KHQA 5CD5D 5HPMB 2PCPA 4MSWB 3FFDA 4D3CH 1KLGA 4XPBH 3DO3A 4GS7C 2DDQL 4DGYH 4HH8A 1HEZA 3BP6B 1S7UB 3DTXA 1K9TA 4Q2ZA 1AKJB 1I85C 3IFNL 5I8CA 3VGAB 5DD3L 4NQDE 4ZNCD 4LSPL 3RA7L 5D1ZD 3V8OA 3TBWB 2ENSA 3HZMA 4K7FA 2R2HA 2GJ6A 4A2LA 4D0DA 4YZFF 2C3VB 4OM1L 2BVPA 4JHAL 1L9MA 1YJDC 4RQQB 1OP3H 4OFYA 1RUQL 2EDNA 2XTJE 4GQ9L 3MLZL 3RKPA 1ZEAH 2P1YA 3RKDD 2ZJSH 5I1GH 1IFHL 1MCLA 1R24B 1U8PA 1NGWB 4XVJH 2O5ZH 3DRQB 1WITA 1ZLSH 4JJHA 5JMRA 1P7KB 1FJ1B 5J11B 4PJHA 3UTPE 2R0ZL 2PO6D 2VSDA 3QIWC 3S34H 2XNAA 1Z9LA 2NX5A 3LS5L 5KVGL 1UFUA 4X0KB 5DWUL 1ND0A 3CLFL 4MQXC 1MH5B 1WCBB 3F12B 3BXNA 4IDJL 4PGBB 1EO8H 4LCYA 3K46A 4EI5A 1F97A 4QRPE 1MQKH 4IIQB 5DRNB 2VQTA 5GS0C 1EHLL 1D5MA 1MPAL 4YX2L 5CZVH 1OAUL 4YWGL 1FFNA 4U33A 5A2IH 2BSTB 2DQTH 3BGFB 4OD1L 4J4PD 5DF0A 3VXSE 1XF5A 4J6RH 5FYKD 3CSYA 1KG0B 3BE1H 3BHBB 4PY7B 5IBTH 3IS0X 1J8HD 3FT3B 2X1QA 2EDJA 1FVCA 1UVQB 4NFBA 4P57A 3HZYA 4GG8B 3X11B 4EKXA 1FQ9C 3LN9A 5KVDH 5L2KD 2A74A 2ZSWA 1UM5H 4OCXL 5IMLB 1DQQA 3MJ7A 3MLYH 1G7IA 4KHXH 4Y4HB 3BUTA 4UT6L 1E0OB 1Q9LB 3OKEB 4QY8A 3MMEB 3BQUC 5DA4A 3CH8A 4Z7UF 4GAJH 5HVGB 1SYVA 1KPVA 5HYJD 1YPZB 4FZ8H 3WFBL 1XZ0A 4FTVD 3R4DA 4H88H 1PD6A 4HS3A 4ORZC 4M5ZL 5DJXB 3D85B 1PBYA 2ZG1A 4JFPB 5T5NG 3PWUB 5DS8A 3RBGA 4EUPB 1JYNA 3L7EA 4HLJA 4QXUH 3ULUF 1ZS8A 2K1MA 1KB5L 2QLVB 4GSDL 1R3KB 3T4AB 4Q0XH 4QHUA 2G9HB 3WO3B 4X4MA 2JJSA 1DCLA 4YAQA 1HSBA 3QWOA 3S3SA 2YD5A 3O6FA 4Y2DB 3GBML 2LVEA 1MVUB 2A6JA 4O9HL 4PY8I 3HAEA 5T1KB 4OZHF 5C8JB 2G5RA 4WW2C 4P59H 5E2VH 5FOBA 2ATKA 3LS4H 1OTSD 5ERWA 3KYOA 1UZ8A 5KJRH 4XNZC 1WZLA 3GK8L 2FX8H 4KRMB 4KV5F 2Y7QA 3PGDA 3HRZB 1PYWB 4MA8L 1CYGA 2UWEB 3P4LA 3PQYE 2VAJA 3T77B 5MEPA 5CBEA 2CIKA 4F9PA 4MJIA 1T0MB 2EEAA 3FL7A 1WAAE 2JJVA 2RIKA 4HXAL 5JW3L 3QHFH 4Y7MA 3MBEB 2JELL 3QPQD 2FO4A 3TH2T 3WUWA 4Y5XA 3S4SA 3F7YB 2AJUL 4P2QA 1K5NA 3KVQA 3O4LA 4TNWK 1TJGH 4I0KA 1GZPB 2VR5A 5ALBH 1FC1A 4L8DB 2P5ED 2B1HH 4NJ9L 4I0CC 2E7BA 1PQZB 2HKHH 3F5WB 4LSSH 4HG4K 4HPOH 1MWAL 1G7JA 2X4QB 4C57C 4JPWH 3GMOB 4YDJB 1JF5A 4P23B 4XMLL 5IM7A 5IB4A 3RX5A 3MRKA 4PJ8B 4RX4A 3TJEL 3UMTA 5TE6H 1JN6A 4Y19E 4PB0L 3V5DA 1S7SA 5MI0B 1LP9E 3KNBB 1YQVL 1QPXA 3GBNH 2FBOJ 4PJEF 1XFPA 1SJVA 3P9WB 1E4KA 1ZGLB 3C87A 1EBPA 1H5BB 1HH9A 3LDBB 5E1HB 1K2DB 2YWZA 1U8NB 3H42L 3F65A 4WFGE 5C2BH 4JO4H 1I3GH 4W6XB 4WI3A 2A6IA 4HUUA 4GQPH 3HUJB 5LGHH 1KCSL 3W2DL 4DGIL 4X4XA 4PP8C 5E8PB 2GAZA 4IHOB 3IFLH 4JQIH 4UB0H 4NP4L 3UJTH 4YHIA 2OSLB 1IT9L 4NN5C 3T3PF 3O45B 3D87B 1CXKA 2RFXA 1TLKA 1A6TA 1BGXH 1FPTH 3GKWH 2DIJA 1HXYB 2A6DB 2DTMH 4XC3H 3OJDB 1NUDA 1X5HA 4U2ZA 4NNYA 2HTKC 1MELA 5DJZB 3EDKA 1IKFH 2BSRA 3MLUL 1O5DT 1CG9A 1HI6A 2XPGB 4HQQH 4K9EH 2GSIA 4GBXA 2ZG2A 2HJKB 1AQKL 1KT2B 4KKCD 5ESAA 4AEIH 2F53A 4N68A 1JCKA 4MNGE 5JLZB 1ETZA 2P8LB 3P9MB 2EECA 4EOWH 2ITDA 3HMWL 3MRJB 1JF6A 3GMQA 1X5FA 4M6NH 3E2HA 3T4YA 1ZV5A 3D2UA 3OKDB 4HC1A 1ZE3C 3AGVA 3IDGA 3CD4A 4I0PB 3DI3B 4JREB 3WDHA 4OD3L 1LO5A 4LL9A 1WZKA 5BCAA 5T3XE 4CNIB 2P47B 4NC1C 2IANA 2GFBB 4RFNB 2GUOB 4NQXB 5J12C 2HJFB 5I74B 4KVCH 4WCYL 3RWHB 3MRDB 3TWCL 3VWJC 1BQSA 1RUPH 4LHJB 3MV8E 3VFWB 1YN7B 1FDLL 2HN7A 2UZXB 3QHZH 3PUCA 5EIIB 3FFCD 4UUJA 3LEXB 3MRNA 1PJ9A 1EHXA 4XCCL 4OLUH 3DUSA 3IFOA 1A1MB 4YO0B 4HKZA 4EN3B 2X4OB 1L7IH 2YPKA 3PJSA 3WN5C 4DAGH 4G8GD 2XV6B 3K4ZA 4RGOL 4A6YA 5CS7A 3O4OB 5ESQA 4JHZA 4V2CB 5EOTB 1FL3A 1LO2H 2YEZA 1RZ7L 4ETQA 2HFFA 3TBYA 4NM8L 4PG9B 1CT8A 2YMXL 4LDEB 2BSED 5C0CA 3M1BA 4IRJD 3GSOA 3HE6B 4KI5C 5DD1L 1KXQE 3QI9C 3R8QA 1X3DA 1QBLH 4UBDC 4PB9H 5C0BD 2PXYC 4Z0BL 5DK2B 2MSPA 3LEYH 1S7XA 1OF2B 5KS9B 5L6YH 3I3DA 2FHBA 1N0XL 5ADOL 2HJLB 3MZTA 1FNFA 5J4MA 2Z31A 5I2IB 1CICB 2VLKB 2E8ZA 1S9KC 4MQSB 1F4XH 4K9EC 5FM5O 3OAYH 4K3GA 3QCTH 5E56A 3BMVA 1AR1C 1A7OL 4LLYB 2C3XA 5C6WH 5I1KL 3VXUD 2BVQA 3UO1H 2EYSA 2AGJL 5DVOA 3ZDXE 4QCIB 1IC5L 2UV3A 3KJ6H 1NFDE 2DKUA 2IH3B 2CK0L 2FL5A 3BN9C 4JRXB 1FO0A 1A7QH 1Q9KA 1QKZH 1TZHB 5SWSB 2Q76B 4XAWL 3QDGD 1XIWD 4HWEL 1GGIH 3NFNB 5JNYA 4XWGH 2YRLA 4MB4A 3BH9B 4I9WD 5LWYH 3V0WL 4Q9RL 3WNMA 5JDSB 5JW4R 4PJDF 4D2NA 2OXGA 5JXEA 4PS4L 1RK1B 3KPNA 4CVXA 2D7NA 3EFDH 4QRRA 2IGFH 3KR3L 4ODWB 4XBPB 5AZ2L 4OQTL 1LD9A 1I1FA 3RVUD 3ARVA 3T65B 2EDQA 3PE9A 1RULH 1ZA3B 4OTXH 4QTHB 3U79A 2YA1A 4WHYG 3VFRA 1W0VB 2CK2A 5FHBH 3TC9A 3MR9A 1KTDA 4M4PA 5D71L 1W8NA 4WUKL 2Q8AH 5H8DA 4OCRL 3CX5J 3A6BL 1IC1A 1IARB 2DB8A 5F89A 1FRGL 1Y6KR 5E00A 3FN9A 3IJHB 1WBZB 1GYAA 1RD6A 3HB3D 3PL6D 5LGJA 4JPVL 2V5SA 4NNPH 3VE0A 1RFDH 2R56H 1RQ5A 5CHNB 4UAOC 4R90H 2C4XA 1T2JA 2VXTL 2YZ8A 3ARUA 5HHOE 2F19L 3CVIH 4MCYB 5KSAA 4Z7VA 43C9B 1AI1L 4J3XA 4M7JH 1YEFL 1FSKC 4TSCL 1JPGB 5AWNH 3UC0L 2CUHA 3MLXH 1HHKB 1LK3H 2F54A 5CKAA 1KXVC 5I30H 4D8PB 1OTUD 1CZ8L 1CGSH 3CVHA 3ALPA 1J10A 5F1IB 1JYWA 5EOQH 5F6IB 1G6RH 4ALAL 5FUCE 4I0PD 4ZNEE 2Y5TA 3VRIB 3IU4H 4XC1H 4TSAL 3L5XH 4PRPB 1KTKE 1QFOA 2R0WL 1E6OH 4ELMF 2P5WE 1ZHBB 2H9GB 3RL1A 4CMMA 5GRVK 1ZANL 4I18A 3C5ZB 2DQUH 4HBCH 3SDYL 1Z6JT 1JGLH 5D1ZA 3EOBB 4WFFE 3IU3A 5DHVA 1DUYA 3L7FA 4RIRB 3DVIA 2F5AH 2FDBP 5FGCE 2UY7A 3SE8H 4MGXA 4L4VD 1WBYA 3MRCA 4M9OA 3L3IB 1H3VA 5K33A 3BWUC 35C8H 1HHIB 1A1OB 4G8IA 3IFNH 4U6YB 1JYVA 3E8UH 3NPSB 4NPYA 5DD3H 1YEHH 3RY6A 4XB8A 2DD8H 5JOPE 4Z8FL 1XCQB 5CP3H 1QLEL 5F1NA 2JIXA 3MNVB 1A6AA 1TJHH 2QKIA 4N0FA 4OM1H 4HV8A 5AD0A 4JHAH 2PO6A 1UYWL 5CGTA 4OJFH 2H32B 4GQ9H 3RTQB 2ED8A 3MLZH 2EYTB 4NQSA 5E4EC 2AXGB 5IT2L 5ACMA 3L5HA 4WHTB 3REVA 4U1GC 3V4UL 1YUHB 4HHAA 3F6IA 1CGVA 4HWNA 3VXPB 2DWDB 3HE7C 5ICXA 4P46D 4NQDA 1YNTA 1LQSR 1P84K 2DJUA 2P4AB 3FQUA 3ULVL 3LHPH 3RUGA 4POZD 3S3JA 4LCWE 4ODUB 1TNMA 2P8PA 3DXAD 4NRYB 4X8JB 4JAMB 3LS5H 1TQBB 5DWUH 1OP5H 4J4PA 3GRWL 2LU3A 1KLUA 4M1GL 3LPWA 3TN0C 3RGVD 3C6LB 1U91B 2YPLD 5IQ7L 1C8PA 4WGVB 3QFJE 1ADQL 4Y8DC 4M6ML 5L2KA 1MPAH 1NCDH 1W72B 5GZND 4X6CA 4JKPL 4OD1H 3FZUC 4YHKH 3MV7B 4TN9A 5DMIH 3CSGA 3PDDA 3OKKA 3WUWG 3LQZA 3QIUB 1RUKH 5L9DL 4Z78A 3S4SG 1WTGT 1X5IA 3W11C 5HYJA 5CJBA 4K07A 4FTVA 4GH7B 1HYRC 4NO3B 1MLBA 4NSKA 5MERB 5TQ2L 5FAAA 4F7PB 3STBA 4F9LA 4M61B 5F9WC 4CAGA 1VFBB 4OCXH 2VDML 4B7IA 4PRBA 3MCLH 3WXVH 5ETUA 1SQ2N 3CFCH 1NL0H 1U8QB 3VXSA 2NTFB 2X10A 2XN9D 3KPQB 2WWKO 1T5XA 3WFBH 1IEBB 1CLOL 2NY0B 3MRQB 1A5FL 3MFFA 2A9ML 2DM7A 5D1QB 2K7PA 4X8XA 2NY1C 3FHAA 5D7IB 4PJFE 1PKQA 5GGTL 2NTSP 4PLKC 3TFKA 3ME0A 1S8DB 2VR4A 3MNZB 4M03A 5HGHA 4PLJD 4CL7A 2GT9A 1FIGH 4R3SA 1DQML 2R1XA 1IQWL 4NO0D 4XBGB 4GKNB 2PW2A 3T3ME 5DUPH 4HD9A 1C1EH 3KPRB 5CEZL 1A14L 2NZ9C 2OZ4A 4ZOAA 5EWIH 4OF8A 5A3IC 5GRUL 1BQLL 3S8WA 5KSUB 2VR9A 5JW5B 1UWEL 1RPQA 1CVRA 3P73A 4QLRA 2OTUA 5IBLD 3QH3B 1G0YR 2MHAB 5FO9A 3GK8H 5DD6A 3VXTB 2X1XR 2P5EA 3L5WA 3GJEB 4LCCC 4PJIB 3VMNA 3SPVB 2LTQC 4XP6L 3QDMB 1MCPL 3W82A 5HY9A 4QXGL 5IEHB 5JW3H 2AK4E 3RX7A 4G80A 4JM2C 4KY1H 2WK2A 1EEYB 1T7VA 1F6AB 4Y1AD 4H20L 4N90E 3QO1A 1J5OH 4XCEB 3I6KB 4GKSB 4Y16C 1NDMA 4S1SH 2ZUXA 4WHYH 2Q6WB 4GMSL 4NJ9H 3JWDH 1IM9B 4M8QA 3HC4H 2UYLB 4DUXA 3SKOB 1MWAH 1XGQA 1K6QL 2M26A 3IDJA 4YK4B 3ZHLA 1T1XB 3HI6H 4WHCA 2WUBL 4HAFA 1DQTA 4L8CB 4HS6B 4JN2A 3O3BB 2AQ3A 4XHJC 4S1RL 3Q1SH 2VLRD 4G6JL 3OR6A 4YIQA 3UBXB 4WEBH 5E1AB 4PV8B 1DBBL 1N3NA 2HFGL 1Q0XL 1VENA 2A73B 2MCG1 4S2SA 5CMAA 1BOGA 1HOCB 1I9RL 3MRHB 4D9QE 4J1UA 4WUUB 1TJIL 2G5BA 3IDYB 3EJJX 3H42H 4RRPG 3Q2CA 4ZQKA 3BPCB 5ACZB 3U0WH 1IJ9A 1FVEA 5T33L 1EVUA 4R26H 4Y19A 1FG9C 1KCSH 2ZUTA 3SDXB 1T21B 3EJZC 2YRPA 1GGUA 4MMXC 3U4AA 2HYMA 2R8SH 1QSVA 1LP9A 3RWEA 4I2XB 5B3NA 4OAWA 4C56E 2BNRD 3KJ4C 1X5JA 5EN2B 1PY9A 4PRNA 2QR0B 4ORGA 4MX7B 3DYOA 2VLJB 1T5WA 3UBXI 2B4CL 3HNVL 3I75B 1Q1JH 3BP7A 5JHDE 1BREA 3ZYOA 2E8YA 3KHOA 4BH8B 3C60C 4OUOA 1BMGA 1I1RA 2X4RA 1CTNA 2K7QA 5D2NE 4RDQG 4OZFH 4CUCA 5E99H 2BJML 1U3JA 3JV6B 3VXNA 5SX4I 3MNWB 4ZFGL 4RGMC 5ACLA 1IAKB 1WAAF 2WM0A 4EEEA 3MRLB 1SMOA 3HRPA 3RIFK 2YK1L 4GW4B 4WFEE 2VL5B 4FS0A 4JY5L 4LAJH 3JWDC 1MIML 3QNXA 1CS6A 1FYTB 1RZIA 4KTEH 1MRCH 3RVTD 3UXFA 3VRLE 1UB5A 1S5IH 1V7MH 4G8GA 3TWCH 4H5SA 1LEKA 1EHNA 2LAGB 1TQCB 4FQIL 4DKAA 5LAXB 3R06B 4HKBB 1AP2A 1BJMA 2X5PA 1U95B 3JSSA 4XCCH 3UTZA 4IRJA 5KZCD 4PP1D 5C0RH 1LP9F 3O6LL 4EI5C 4NHUB 2V5YA 3WFDL 5EUOE 5IROA 4WWKA 4HKJA 4EVNB 5GGRA 4RGOH 4LIQL 1VFAB 1P53A 5T5NF 4NUGL 3QIBC 1RZ7H 3EYFA 9CGTA 5GS1C 3IDNB 3SKJL 1KNOB 1L9NA 4EI6B 1IM3A 1EAPB 1YY8A 4JZNA 4HZLB 3LKNA 4JFFD 4OQ1A 1FBIH 5JPMB 4E9LA 5GRJL 3CJJA 4PJXE 3VXUA 2E9WA 3CXHJ 4MXWH 3VD9A 2G75A 4K7PX 4U1KA 4DJMA 1JWUB 4F2MB 2FZ3B 1CGUA 4MDIB 3AAZB 1OWWA 4IMKA 4GW5B 4M00A 1NAMA 2LE9A 3ES6B 3QNYA 5JIIA 2EEDA 4NKMB 4E41E 3BWAB 4HGKC 3RWCA 4L4TE 4HIIB 3C8DA 1A7OH 1WIOA 5I1KH 3QDGA 3DETD 4GKOA 1MLCB 2CKBH 1FZKA 1XIWA 5EBWB 4NRZB 4RNRB 2O5YL 5IOPA 1BD2E 3RNQB 2KKQA 2H3NA 2GSGA 4S0UC 4I1NB 4N5ED 3HNSH 4WU7A 5M94B 1HE7A 3ARGD 4PJ9B 5I1HH 3ULVE 3CFKA 4KU1A 5I1EH 4P49A 2P44B 5EFIB 1OOAA 3O2VH 3ARYA 2GK2A 5EOCJ 3QUYB 1N8ZA 3G9AB 4JZJB 4HWZB 1G0DA 4F7EA 2XA3A 4X6FA 4OSUL 2OJEB 4XP1L 3V0WH 3GMNB 3CAFA 4JFEE 4M1CD 1M1SA 5HHNA 1X5AA 3HR5A 4BZYA 2BRRH 1KEMH 4PS4H 3MO1B 4DGVH 2NY6B 2XICA 3B9VA 4JFHD 1U8JA 4IOFD 5AZ2H 1T6WA 3WS6C 3PL6A 1AGDB 3DX8A 4OQTH 4WI8A 2X4PA 3EDFA 3U4BL 5I73B 2XKUA 4MXVE 4HMDA 5D7JB 4S1DC 1UJ3B 4KMQA 3UTTB 1FNEB 4FQLH 2YS4A 5FGBA 2PYEE 1M71B 2VH5L 5E6YA 2ZZUT 4DEPB 4YDKH 4Y4KC 3ZTNL 3QISA 5JOFB 5DEFB 5FCSH 3VJ6A 4PUBL 4NKOB 4U05A 2J3SA 2ED9A 4PRHE 1KB9J 3FB5B 4MJ6A 4F9PC 1OW0A 4X98B 1QSFD 5BOZG 3DUUA 3CNKA 3H9SB 4R4ND 1TITA 2F19H 3GMMB 4R4FH 5HI5C 4JO1H 1AI1H 3ULSA 4AT6B 1NDGB 3EYOB 1ZLUK 5HI3C 4TSCH 1PG7H 2DS4A 2IAMB 4Z76A 5ISZD 3LPGA 3PIQB 4P3DA 4N8VA 1EEZA 1ZTXH 1GGTA 2OL3B 3WLWD 1RZ8B 4M43H 1G7HA 1CZ8H 4MNHA 4AG4H 4A2MA 3SKUD 4DVBA 2VIRA 1JMXA 3AY4A 5BVJA 4JFXA 2C4FU 5C09B 3ESVF 3GSNH 3MRBB 3SKMA 4XPTH 5DUBB 5H37G 5CEZE 4L4VA 4OZHB 1S78C 3O6ML 1K8DB 1ZANH 2P48B 4QT5A 3SDYH 1E4KC 3GSUA 2R4SL 2AERT 1A7NH 1KB5A 25C8L 2BMKB 2OR8A 2NY2C 3WL9B 3ZDXF 3T0BA 4YNYB 2DWEA 5CJOL 4B5EA 4GRLB 1NFDF 1DVFB 3JTTA 2HT3D 4F58L 3FTGA 5E8OB 1F4WH 1VERA 2BNQE 4ODXB 1DQJA 3CU7A 3T2NL 2MFNA 2P5WA 4Z8FH 1T66D 5JO5B 4EZMA 2H1PL 1CLCA 2FB4L 1AO7B 4P46A 1MY5A 3IFPB 5TDOB 4QRSA 5D6CA 3RBSA 1P4BH 5KSBA 4HF5H 3OGCB 3HTLX 1AXTH 3VA2C 3UZQA 1QOKA 3SDDC 1AD0B 5HGAA 3GM0A 4EQ2A 3RGVA 3D0LB 3V4UH 2I9TB 1UXWA 2YPLA 3MUZ1 3TGXA 4FMKA 3HZVA 4FP8L 1U58B 3ULVH 1I8MA 4NZUL 4L8BB 3EYQD 3GO1L 1NSNL 4X7DC 4GW1B 3WDJA 3FT4A 5LGKA 2V2XA 1G84A 1MHCA 1SBBA 3S35X 3GRWH 4QRQA 3RHWF 3E2HC 3GSVA 4YE4L 2FEDD 2CIIA 1HHHA 5IQ7H 2IFGA 1UWGL 2J8UE 3T2QA 2YA0A 2JKXA 3BGAA 3ZKSD 2BVEA 1A9EA 5DJYA 4PFEA 5ECJE 5CD3B 2HAZA 2YSSB 1G1CA 1OGAB 3UPAA 2VWEE 2GCYA 1F4HA 1RIUL 4LLWB 1J0KA 2EXWC 5J6HA 3TESA 3IKCB 4CMHB 4P9HH 1AXSA 1F3DJ 3H7LA 2IBZY 1TZGL 1I9IL 3RL2B 3VRJA 5L9DH 4BKLA 2XN9A 2ARWA 1WGOA 3RWGB 5D72L 4P0DA 4UIMB 2ZUQC 5TQ2H 2FATL 2FSEB 3WSQL 2AJYH 3GJFB 1UEMA 3U46B 2ICWJ 1T7YA 3LCYA 2V9TA 5BQ7B 3QXDA 5D70L 1EPFA 4JHWL 1EXUB 3ARPA 1HHJA 1Z3GL 4FHBD 3GIVA 2E7CA 2VYRE 2VABB 4CKVX 5A16A 4NO0A 4I3RL 2NW3A 2ESVA 1A5FH 2CUMA 2A9MH 2AXHA 1SVCP 1Q9WB 4ZD3L 3HG1D 1FVDB 5T3ZD 3P3YA 4HUXB 3S37H 5EPMB 1JZ6A 5BJTB 1YECL 4NWUH 1FNAA 3DIFA 5E7FA 1K8IA 2D31B 5I1LB 4MMZC 2Z8VC 2ZCHL 1VFMA 4KMLB 1HIMH 4PRDB 3ROOB 1SEQH 3ELAT 4X4YA 3DO7B 1TTUA 3H0TB 3MGOA 3L3KB 5GRUH 1MCEA 5BV7H 1NGPL 1BQLH 2MJWA 5E9DD 4OZIE 2JCCA 1F2QA 4G7VL 4WO4C 1WFUA 1KCGC 5C0JB 3ULVC 1MIEH 2D7MA 4FFZL 4UU9A 4Y1AA 2BSSA 1IGJA 2NXYD 3M17B 5HYEA 4MA3B 1MAJA 1OARH 2VDNL 5I1JL 2ZWLT 3LAFA 5GGRY 2XXMB 5IVNA 4XP6H 4OZGA 3H7BB 2FWOB 2EKSA 5J89A 3BIKB 3T1FB 4JFDE 4L8SB 2AABL 3X14A 3C09B 1F3RB 5F97E 1MJ7L 1S9XA 5C3TA 3B9DA 4O2CA 2J2ZA 3N1FC 3CC5B 3QHTC 1IGFL 2OTPA 3OKMB 3SGEI 4U1SB 4LIQE 1PSKL 1C16A 5JXEC 4P9HC 2VLRA 2XOTA 4QHLA 1UACH 4BK5A 5DYOA 1ZGLP 2XI9A 1K6QH 3BKJH 4YQXH 3FN0L 3MACH 4Y2OA 5FYJU 1MEXH 5CZXD 3WFHB 2AK4A 1MF2L 4GJTB 1R3JB 1MUJA 4IRSC 5CEYA 2XQBH 1BFVL 3W39A 1EFXB 5TQ0L 3TIEB 5L88L 3D39A 3IDIB 1QRNB 4FQCH 4J3SA 1CLYH 1C5BL 1G6VK 1DBBH 4RMWA 3IAPA 2HFGH 4F8QA 4MZ2A 4V3EB 3QUZD 5E8NA 1I9RH 3RP1A 1U8HA 1S9YB 5K9OA 2EIZA 2QADC 4H25A 3IF1B 1SBSL 2VZSA 3EKCA 1RMFL 4GLRH 3KWWB 4PJFF 1FZJA 2EDRA 3QUXC 1D6EA 1DLFL 1EGJL 3D48R 3QJHA 1TIUA 3IJSA 1QFUL 5C7XL 5H37H 3DMMA 4MS8D 4LPWA 4X9FA 4YFLF 3RY5A 1JHKL 3BDBA 3QIWB 4HFWB 1GOFA 3T0EC 2H26B 1QRKA 3T3MF 5CD5C 1FH5L 3FQXB 2RR3A 5BV7C 5CFHA 2CQVA 2OLDA 2PTTB 1M05B 3B3IA 4DN3L 5K9KA 3T09A 3VCLA 5FO8A 1UQSB 2B4CH 1IC7L 1CK0H 3EUUA 1QYGL 2XKNB 3FONB 2VDLL 1TZIA 2WP3T 4PREA 3V6ZB 4J2XA 3ARSA 5D1ZC 3F8UB 4C56A 2B2XL 1KJ2B 1QP1A 3RX8A 4EIZC 4YDIL 3B5HA 1D6VH 2BJMH 5HHQB 4KK9D 4OI7A 2DKSA 4HS8H 3OJ2C 4JRYB 2WBJD 1RZFL 3BH8A 1YPZE 2CLRB 5IB5B 1BIIA 1MCDA 2R4RL 3EYSH 4Z18A 4UI2A 3L9RA 3U4EB 5JHDA 4G8EB 4UNTA 3IDUA 3BZFB 4PJ5B 2APFA 1LNUA 1AC0A 1FE8L 3MA9L 1M7XA 4G59A 5KBNC 2PO6C 1JWMA 2L7JA 2R2CA 3ZE0F 5E2JA 4HMEA 4HK0A 3FB8B 3MOBH 3NCYP 4W6YB 4D0CB 3EW3B 1AHWA 3PV6A 4NZTH 1JGVL 5HYQB 4I5BB 1JV5B 4FQIH 1W8OA 1ZT7B 2XA8H 3F7VA 5BS0D 4ZUUA 1MCOL 2Z35B 4K94H 3P4OB 2XRAL 3AS0A 2B5IC 3NTCL 3MRMA 4JFFA 4J3UA 3O11B 4CN4A 4G6AC 1YY9C 3WFDH 3EO0B 5AYUH 1Z9OA 4WW1A 4NKQB 3UAJD 4NUGH 2XFXB 5L2JA 4XAKD 1CD1A 3MROA 3MFGB 2UWEE 1PX3A 3O3AA 3I02B 5CP7A 4WW2B 4LRNL 4LMQI 3FN3A 2QEJA 1K3ZA 4K3DL 2Z93A 1B0RA 4XNZB 5E5MB 1F5WA 1D9KD 1LDPL 5IFJB 1ONQA 4Z7NE 3GKZA 4U2YA 4G9FB 5EUOA 1SJHB 1P5VA 1QBML 3WIFB 4C59B 4KROD 2WIMA 5DJ6A 1A4JA 4MAUL 2EDYA 3U0TA 1JUFA 2BZDA 4OGXL 3B4NA 4X99B 3VW3L 2HTLC 1A0QH 4YXHH 1T1WA 1KGCD 1IAII 4N0CD 3H9YA 4PJXA 2O5YH 1V5JA 2ENYA 4M6OL 4YGVB 2R2EA 4YFEA 4HUVA 2YUZA 3O3UN 4YHZL 4QOKB 3IKKA 3ILQD 5FV1L 3VD7A 4PGJA 1DEEA 3LQAL 4M5YL 4P5MB 5KW9H 1W72L 5DFTA 1UKQA 3TPUB 1OQOA 4P5TD 2C5DC 2AKRA 5EC1B 1OTSC 1FAIL 2P43B 3VDBA 1S7TA 4R7DA 2N7AA 3CCHA 4L3ED 3THML 1BD2A 3B8SA 2R0KL 4XP1H 1EAJA 2AQ2A 1U8MA 3FQNB 3HUJE 4KJPD 3P30L 1S5HA 1OSPL 3AB0B 1JTOA 3CFJA 3FQTB 4YDLC 3WE6A 3TJHD 5FEBA 1T2XA 1I1AC 3MX0A 4XI5D 4MCZA 3ZKQD 1ORSA 4XBEL 3QPQC 3MQIA 3B8YA 2VH5H 4M7KL 3VRLF 2AJVL 2VMFA 1MHHB 3ZTNH 1J0IA 5FA3A 4BZ1L 3CPLA 2ICEB 1JNJA 3U36A 3QQ9D 3KPSB 4AEHL 4Q6IC 4K94C 1LEIA 3CLEL 1CLZL 5IMMA 3GI9L 4JFEA 5C0DA 4P4KD 4JDZB 4G42B 5ISZA 1ADQA 3MYJA 3TO4A 4NN5B 5FO7B 1TETL 4XX1G 3S98A 4EUPH 1C12A 1T4KA 1U92B 4ZS7L 5TF1L 1WF5A 5HHMD 2HFEB 3GSXA 4DTGH 2BNUA 3QZWA 4LU5H 5IJVA 1BVLB 3N9GL 3SDCD 3D3VD 4WV1B 5J8OA 4TULL 1T22A 5EU6B 3PWJB 3B5GA 1RJLA 5DMJB 1MY7A 5FKAA 3ZYIA 5F7YC 1ITBB 3QJFB 4KVNL 4PGDA 1JFQL 1PX4A 2EXYD 4X6DA 2JK5A 3C8KA 3U6RB 5F70A 4CVZA 1OAZL 1YZZA 1YEIL 1HILA 2FHCA 4IOSD 4AMKL 5J11C 4Z77A 3VH8B 1CFVL 4F33A 5IMKB 1U41A 1OP9A 2ADIA 1IAOB 5CIPA 2RAMA 1NCTA 1SY6L 3ARFB 5INCA 3KPMB 4M6AA 5GGTA 1OAXL 3DROB 3N1QC 3TM6A 1V05A 2R4SH 4POYA 5ID0A 1PY4A 4I48B 25C8H 3FAWA 2DYPB 5C08D 3Q6GL 4LSVL 2GHWB 4IIQC 4JLRA 1OGTB 3S36L 5J12B 3JUYA 5I1AB 4L29B 4F58H 3S96B 4ZDHB 4FQXD 2FR4A 4KRPB 5IQ9B 1EDQA 1MCSA 3DX7A 3EDEA 2MPAH 2JB5L 3T2NH 3ULVF 2EDLA 5DC9B 3VWJB 1F11B 1H15A 4KKNA 4XCFL 1F3JB 2H1PH 4I77H 1ZLWH 2YD6A 3DSFL 2FB4H 5ENWB 5I66A 4P2RB 1RURH 4NUJA 3CH1B 1TDQA 3LKQB 2MQ3A 4PGZA 3VXMB 1VEPA 2R23A 3TT3L 3ZYZA 5F93C 4KKAD 4HK3J 3PABA 3WN5B 4R6UA 4AIOA 4KJYA 1KEGL 1MJJB 5FM4A 4OD2B 1CFSA 4Y4FA 2KH2B 2BNQA 4O02L 5EBLA 3OB0K 5KS9E 4ZG1A 2X4NB 4MXVF 3G6JA 1SJEB 4FP8H 1U3ZA 4H1LA 4NZUH 5K93A 3GO1H 2F74A 5DUML 3SOBL 2VLKE 3V8CA 3V9FA 3QI9B 4U1JA 5E2TH 1L7TH 5HDOA 3L3OB 5IBUG 4HLZH 4JB9L 3GUTA 4YE4H 1C5DB 1IAMA 1KCVL 3KDMA 1MQ8A 1UWGH 4U6VL 1A9BA 3GHEH 4YHYC 2C1PB 4TNVK 4NNXA 2V5MA 4JN1H 2BX5A 4FXKA 4JRXE 5HD8D 1RIUH 2YD4A 3T8XA 4JPKH 1GZQB 1CGWA 2GTZB 5SWSE 4HIXL 5D7KE 5GRZA 1R5IA 1DJSA 4Y2DC 1I9IH 5I18H 4NGHL 3ZLQC 5EG6C 5C0IB 3MRPB 5I1IL 3AC0A 3D18B 5D72H 1RHHA 4WI7A 1H8NA 2V5RA 2FATH 2IEPA 1CE6A 3FT2B 3H9ZA 3WD5L 5F7UA 5D70H 3SJVB 3GGWA 5C07D 1RK0B 1WWWX 4MZ3A 4IRJC 5ITFB 3KPTA 1KSRA 1Z3GH 3OKLB 1AQDA 4XXDA 1JGDA 5IROC 1Y0LA 3B83A 4YXKL 4PRIB 5ICYB 5DJCB 4R2GD 2BC4A 4V1DD 3TVMD 5I8OL 4X6EB 3DX6A 2VAAB 2OYPA 4UTAL 4FZEH 3O3DA 1QSED 4BH7B 5E9DA 4NRXB 1KIPB 3B9KD 4F7CA 4R0LB 4Z7QF 3RJQB 3OAZH 5IR1B 5CCKH 1A6PA 2K3TA 3WJLC 4F37K 1JGEB 2ZCHH 4QF1B 4P23C 5KVFH 4POUB 3QWQB 3RZWA 3WEXA 4YBLB 4LBEB 3D0VA 1FG2B 5CEXB 1Z5LA 3G04A 4PD4J 1E4XI 3WS3A 1Z9MA 2C7UA 4XP4H 3G5XB 4ZUVA 1ED3B 3LQMA 4UAOB 2VUYA 4YHPB 1OTTD 3SY0A 3ARXA 3O2WL 4LLVA 4EJ1C 2BY0A 4LRIA 3EYUH 2UZIH 4X9BA 3NCJH 1XIWC 5MI0C 2VLLA 1QQDB 4KFZC 4UQ2B 2IPUG 1FSKB 2EH7H 5DHYA 3MJ9A 1BVKB 2VDNH 4D9RD 1H5BC 4XXCA 4PRPE 1JNHA 3LDBC 1V7NL 4Y88A 5DC4B 3FB7A 3PHOB 4JG0L 3BKCH 4K23L 4PJBA 3VFOB 4AIXA 2NY5L 4Z0XA 1V3KA 5IWLA 3HA0A 2AABH 3EJYD 3VXRD 3TBTB 5H94A 5INDB 1A47A 3BGMA 3ARFD 2J8UF 5M95B 3TZVD 5F9AC 3VWKD 5DJDA 4UOW1 3LB6D 2XWBB 5DXWA 1PSKH 5DSCB 5EU3B 3W0WD 3RI5K 1NC2B 5DQJB 4GRMA 1Y6NR 1U93B 3HB3C 4FNLL 4Q6YA 5C0AB 5T1MB 5JW4Q 3FN0H 3QUZA 2V6HA 1IRAY 4KRPD 5EOCL 3ARED 1MF2H 5CJQL 2ATPA 2PUQT 4PLNC 5HPMA 4MSWA 2AV7A 5KANG 2MCPL 5L88H 4TUOB 2J8HA 1PFCA 1E27A 3D69A 5EO9A 3ZDZE 2M2DA 3QEHB 1C5BH 3UTSB 4HUWB 3U48A 3RVXC 1AKJA 1P7QD 4QRTB 1T1ZA 5FYLD 2Q8BL 2FYYB 4MS8A 4TVPD 1R3IL 2WIIB 4U1MA 4XMPH 4X9IA 3SDAD 1IEAA 3TBWA 3O8XD 2C3VA 5JR1L 4I0PC 1SBSH 5E4EB 4U6XA 2EH8L 4KJWD 2IWGA 4OIAA 1DBKL 2Z92B 2BNRE 1A3RL 5HVWA 4N0UB 3AS2A 1QFUH 4U1HB 5D2LB 3VFSB 3MGAA 3OF6A 1YMMB 1P7KA 1FJ1A 1IQDA 2APVA 3F58H 4FN0A 4PJ7B 3MV9B 5IVXB 1FH5H 2PNDA 3N06B 4X5XA 1DFBL 3MV7E 3TN0B 1VPOH 1NUGA 4UTBH 4DN3H 5JA8B 5AUMA 4X0KA 3VDAA 4NQCB 3N85L 5IHUH 2DQFA 2HMID 5EC2B 1WCBA 3F12A 4PGBA 3TCLB 3H3PH 2WBJA 4OZIF 5D1XB 1QYGH 3DUHA 4FG6C 1WWAX 4J23A 3HMXL 4JRWA 4DK3A 1HH6B 2AJXL 5EBMB 1S7WB 1DN2A 2IFFL 1NBYB 4OT1H 3LIZH 2DLIA 2B2XH 2V2TB 3NA4A 5JXAH 1V3JA 1D5ZB 2DQHL 4MA1C 4OF0A 2BSTA 2BHZA 4I3SL 1KBGL 3A0OA 1KG0A 1ORQA 2J6EA 3BHBA 1G6RB 1RZFH 3OG6B 4NQED 5IGXH 2R4RH 5F9WB 2I5YL 2APBA 3PP3K 1UVQA 1F90L 1W0YT 1DN0B 3FMGL 4GG8A 5EZLB 2DQCH 5D7IE 4P46C 5B8CB 5HDLA 2DJSA 5C0EB 2OL3L 3MA9H 1FE8H 3O3EB 5IMLA 3ARDB 3RFZC 1ZSDB 2SEBA 2ITCA 1J1XH 4Y4HA 4DCQA 5BS0A 3HPLB 4HPYH 3V0VB 3MMEA 3EZJB 1G9NL 3G5VB 3RGVC 1CICC 1I7UB 4HCRH 1BQUA 4KUZH 4ZSOB 1CGXA 3KPRE 1K3IA 1BX2B 5DJXA 4JFPA 5FM8A 1M7IA 2C9AA 3WIHL 2VITB 5L0QC 2ZUUA 4NWTL 3QFDB 1S7VA 1MCOH 5IG7A 3PWNB 2XRAH 3BIBX 2OI9A 4OM0L 1X4XA 2QSTA 3O9WD 3NTCH 1R3KA 4HJ0D 1U6AL 3MODL 5T1LA 5GSRA 4QXTA 3I2CL 1IL1B 5C0NC 3TH3T 2EDBA 3Q3GA 5FCUL 1ZT1B 2VDKL 4PJIE 3QDME 3WMSA 1MVUA 4GMTL 3RU8L 4TUJB 1WSST 5T1KA 5C8JA 2LABA 1JRHH 2GY7B 3QT2A 1OCWL 4XPHL 43CAA 4ZYKB 4BJLA 1R5WB 3FQWB 1D5BB 1P4IH 3VFGL 1Z2KA 5IEKB 5TPWL 2LTQB 4OIIL 4MAUH 5FUOL 1MAML 3HRZA 3V6OA 1PYWA 2XWJA 4NBXB 3UYRL 3ZMRA 4ZPTB 1DQDH 3T77A 1VKXA 4JM2B 3VW3H 1YA5A 4F7TB 1B88A 5TJWK 1VEMA 3QNZB 4FFYH 4P5TA 4Y16B 4WENB 4X6BA 3F7YA 4J3TA 2P24B 3MJ8B 4M6OH 2B1AL 4L3EA 5ANMA 3EYVA 4NCC1 4G6FD 3RNKB 3QXVA 1JI1A 2JTDA 2VKXA 1H3UA 4YXLL 2DLGA 3F5WA 4X80L 2X4QA 3TJHA 1MFBH 5GSVB 3X3FH 2VXSL 3WIIL 4M5YH 3V5KB 2DM2A 3PHQA 1WBXB 1WICA 3TA3D 2V9QA 4WUUE 1HYSD 2ZOLB 3QA3B 2VZUA 3BZ4B 3FRUA 1YPZF 3PNWB 1FAIH 4WI6A 3THMH 5SWZB 2R0KH 3HI5H 4HWBH 4OCYL 3VFTA 3SDXE 3P30H 1J1PL 5D6DA 1OSPH 5F6IC 1KJ3L 4MHHG 3QPXL 4I2XE 3PWVA 3OKNB 3U9PL 1KJMB 2A1WL 4AH2B 2EICA 5EBGA 1ZGLA 4F37F 4RAVB 2AJVH 4ZAKB 4K3EL 4JO2H 4KQ4L 1MI5B 5HHMA 5GJSH 2UZYB 2VLJE 5AG8A 3CLEH 1RVFL 4JFZL 3MV9D 5E5RB 4E0RB 2WINB 4L5FL 3SDCA 3FO0L 3D3VA 1AE6H 1TETH 3KJ4B 5D9SB 5DK0B 1XF4A 4EBQH 3DVNB 4ZS7H 4H1LG 2DAVA 5TF1H 1RZGB 4TPRL 1HXYA 2A6DA 2E7LA 3WHE0 5AEAA 2QTEA 1CR9H 3CXDL 3OJDA 5GISL 3VGEA 2UWEF 4PBXA 3IXTA 1Z0MA 3C60B 2IQ9L 3PWPD 3OAUH 1CGYA 1MFNA 4Z7WE 2NCMA 3RTQC 2HJKA 2PCPB 5E94B 1KLGB 3NIDE 3QULA 1JFQH 5JLZA 2P8LA 3A67H 5C08A 2D7QA 3KPLB 4RMVA 1WK0A 1YEIH 2IALA 3DTXB 1FYTE 5LVEA 1HKFA 2XY1A 3I50H 4AEFA 3MRJA 1IMHC 4MJ5A 4RGMB 5I8CB 5HI4D 4KZEH 4FQXA 3OKDA 4PJGA 3C5SA 1MCKA 2NY3B 3T0WA 4JZOA 4D0DB 4BQ8A 2G60L 1AY1L 1NBVL 3HLAB 5DJAB 5TE7L 5IFHL 3T04D 5EZJA 3S36H 2O26U 4HX1A 3ZSSA 1H8OA 4DQOL 4HT1H 4LLUA 3WFEL 4NHUE 3TV3L 5B21A 4XCFH 1TVBA 4PJHB 2EZ0C 3MRDA 3ALXA 3QDJD 5LKNA 2NX5B 1SEBA 1BBDH 1ND0B 3LKPA 3PF2A 3BXNB 5EIIA 3HUJF 4LCYB 5MP6H 2IPTL 4EI5B 5BRZD 1JZ5A 1I7ZA 1KEGH 4YO0A 4EN3A 2X4OA 1ACYL 3DWTA 4HXBL 4UOW0 3ARBD 4O02H 1T2QL 3QIBB 4RISL 1M7DA 3MUHL 1ODAA 1X5YA 3CK0L 4FQQA 2AJSL 2EC9U 1N7ML 2R69H 1EMTH 5CGMA 4TSBL 2CRYA 5IHBA 2QSVA 3SOBH 3U2SA 2NY0C 4P2OD 5I17A 5DDHB 5D1QC 4RFEB 3T2OA 1IILE 1YJDL 5D5MA 5JIHA 3S6CA 4FRWA 4ZPVB 3RVTC 4H26B 4P57B 3HZYB 3K1KC 5DMGC 3A6CL 5K59E 4QRUB 4OLVH 4NO2A 2ZSWB 1OF2A 2D3VA 1I8IA 1DQQB 5SX4H 4LSQH 2HJLA 4QY8B 1TFHA 4G5ZL 5I2IA 2VLKA 4GT7A 4R96A 1V3LA 5GHWL 1SYVB 1KPVB 5C07A 2AEQL 3RWJA 1XZ0B 4NGHH 1Z9SA 4HS3B 4ZMAT 1N5AB 3U7WL 4PP1C 1UENA 3PDOA 4ERSL 3DARA 1AHWC 1GGCH 4OKVA 5DS8B 4QCIA 3L7EB 5J9PA 1VGEH 1MFCH 1ZS8B 2IH3A 3TVMA 1N6UA 5GS0L 3SGKC 4LPYA 2FH6A 5DI8A 3X17A 3OHXB 1JZ8A 2PTVA 1KF9B 1QSEA 2I26N 2QSCH 1JNLH 3B9KA 5SWSA 4YAQB 3UTTE 1KJ2L 1HSBB 1PVHA 1LWRA 5KTEL 2MTPA 1GAFL 1D5XB 1DBML 1EGJA 4KKLD 2IQAA 4GKZA 2WWKT 4ZAKD 4DFIA 1IZKA 1WEJH 4BQCA 1PG7X 3NACH 4UTAH 4LCUB 1ERNA 1UWXK 3Q5TA 4MB5A 2ZSVA 5GS2H 4NYLB 4XBPA 5FOBB 2ATKB 2ZKHL 3BD5A 4QHNB 1QFWM 3KYOB 5C0GA 1UCBL 3H9SE 3OPZH 1UZ8B 3S7GA 2AEIT 2NYYD 5F9OL 2Y7QB 3PGDB 1W0VA 3REWB 3P77B 4OLZL 5CBEB 2CIKB 3L3JA 4MJIB 4D3CL 1YQ2A 1G7LA 4N5EC 5EU7C 3VI4E 4MNQD 3ARGC 4JQXA 1UB6B 5CBAA 3WUWB 4Y5XB 3S4SB 4AYFA 4P2QB 1K5NB 1XF2B 3VXRA 4LVNB 4KDWA 1CIDA 2I24N 4MCYA 5KS9F 3TZVA 5C09E 1I9JL 2X4UB 1YN6B 1MRDL 4M1CC 1LE9A 3M8OH 3NN8B 3VFPA 3LD8C 5F3BA 2OM5A 1JPGA 1V7NH 1U8LB 1X6LA 5CJXA 4JG0H 5IM7B 5IB4B 3MRKB 5F7NC 1ZEAL 3KPOA 2ARJB 5I1GL 1FFPB 5TDPA 1NQBA 3AREA 2O5ZL 5F1IA 1ZLSL 4JDVB 2NY3D 4QO1A 3V5DB 2GJ6D 1T89A 3GMPB 1XF3A 2CKBB 5IMOA 3ULUD 2DQDL 3S3PA 3S34L 5FK9A 4ONHA 1ZHBA 3L5IA 4ONGH 1P7QA 4ZOCA 1EO8L 3C5ZA 3QG6A 5J3HD 3IB4A 5IF0B 5CJQH 1MQKL 1AO7E 5IW3A 2O93L 2A6IB 4R4NC 3MCKB 3KXFD 2DRUA 1KPRB 3EO1A 5FYKU 3SDAA 2MCPH 3O8XA 4G6KL 4RIRA 1BQHA 5CZVL 2GAZB 2H41A 1HXMA 2HH0H 3UPRA 5E6ZA 1B6DA 1JVKA 4J6RL 1TVDA 4PJAF 3SCMD 1I7TB 1A1OA 3B2UD 3BE1L 5HGGS 5IBTL 2Q8BH 2GK0A 1NCBL 4UQ3A 3TH4T 2RFXB 3UP1A 5E08H 3VGDA 2VXVL 3QEQB 3MNVA 3QEUA 4XPGL 4NNYB 4LGPB 1B4RA 1UM5L 3FRPA 4JO3L 2BSRB 3NCEB 4RAHA 1JYXA 1WZ1H 1CG9B 3MLYL 1HI6B 2H32A 2GSIB 4KHXL 3QXAB 5E8DH 4JG1H 1A3RH 5ESAB 2F53B 1YUHA 2H2SD 3MOAL 1L0QA 4HW6A 2HT4D 1ETZB 4GG6F 4M93B 4FZ8L 1OGAE 4H88L 5GPRA 4J8RA 3P11H 1DFBH 3FOMA 3E2HB 4LOUC 4X8JA 3T4YB 2GKIA 2VN4A 3D2UB 4P3CL 4QXUL 3N50A 3MXWH 5T3ZH 3HS0B 4EXPX 3PGFH 4KWUA 3C6LA 2JJUA 3BZEA 1IGCL 1X4YA 4MQTB 1NJ9A 3UJIL 3HMXH 4DOHB 5IB3A 2AJXH 1JWSA 1T66C 1LO5B 5EIQA 1TVHB 2IANB 2EC8A 4M8VA 1W72A 2DQHH 4PG2C 3S37X 4OLWH 4FXGB 4I3SH 2AW2A 4M62H 3JTSA 1BIHA 2W65A 1IZJA 4L3AA 3GSWB 4Y5VA 2NW2A 3QIUA 2ZUQB 1JPSH 5A1AA 2I5YH 4P59L 1BWMA 5E2VL 1JFMA 1HDMB 3GSNB 3MLVH 3BSZL 3GFUA 5MEQB 1AGEA 3FMGH 3BX7C 4U6HB 4M61A 4BK4A 2FX8L 4OI8A 3MRNB 3O6FD 4PR5B 3DUSB 4HIJA 4F80A 3TNNA 4Q58C 1E4JA 3O9WA 5E2WH 1L8JA 3TNMA 2FEDC 1CVSC 4A6YB 4CVWA 3KPQA 5ESQB 1FL3B 1NGQL 2YEZB 3CFBB 4CU7A 4EIGB 4XT1C 3HHRB 3IS1X 2C3HA 4RMSA 2OQJA 5IV2B 1CT8B 1TJGL 3WIHH 5D7IA 5ALBL 3M1BB 2DQIH 3CXHK 4NWTH 2B1HL 1PG7W 4X7CC 5IHZA 1S8DA 2CRMA 1WTLA 3VXQB 2J8OA 4XPAL 4LSSL 3ZDZF 3WYRA 3MODH 1KXTB 3I2CH 4UT7L 4W81A 4KDVA 4GKNA 3G5YA 4LFHD 1DL7H