4PJ9A

Structure of human mr1-5-op-ru in complex with human mait traj20 tcr
Total Genus 72
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
72
sequence length
271
structure length
262
Chain Sequence
MRTHSLRYFRLGVSDPIHGVPEFISVGYVDSHPITTYDSVTRQKEPRAPWMAENLAPDHWERYTQLLRGWQQMFKVELKRLQRHYNHSGSHTYQRMIGCELLEDGSTTGFLQYAYDGQDFLIFNKDTLSWLAVDNVAHTIKQAWEANQHELLYQKNWLEEECIAWLKRFLEYGKDTLQRTEPPLVRVNRKGVTALFCKAHGFYPPEIYMTWMKNGEEIVQEIDYGDILPSGDGTYQAWASIELNLYSCHVEHSGVHMVLQVP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system
molecule keywords Major histocompatibility complex class I-related gene protei
publication title A molecular basis underpinning the T cell receptor heterogeneity of mucosal-associated invariant T cells.
pubmed doi rcsb
source organism Homo sapiens
total genus 72
structure length 262
sequence length 271
ec nomenclature
pdb deposition date 2014-05-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00129 MHC_I Class I Histocompatibility antigen, domains alpha 1 and 2
A PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4pj9A02
3.30.500.10 Alpha Beta 2-Layer Sandwich Murine Class I Major Histocompatibility Complex, H2-DB; Chain A, domain 1 MHC class I-like antigen recognition-like 4pj9A01
4JFOB 2I60H 4HPOL 1H3XA 1GGCL 5DUML 1HHIB 1PY4A 3MNZA 2PXYD 5MEQB 1C5DB 3WFBL 2DICA 1U8NA 2VXSH 1G0XA 1GAFL 1KCSH 3HAEH 3HN3A 4BUGA 1S7UA 3GGWB 4U1JA 1RFDL 1PY9A 1EO5A 4RMUA 2COQA 4IHOB 3MFGB 1PZ5A 4XNXL 3ZT6A 2VDKH 2H8PA 1NMCC 3AS1A 3NFPA 43CAA 1SMAA 1F3JA 2GJZA 5DHVB 1LEIA 3BXNA 5SWSA 4HF5H 4AT6B 3BEVA 4HXAH 4NCDA 3RL1A 5BZDA 3RZWA 3MV8A 3ARDB 3RWHA 3TT1L 3RWGB 4YDIL 1L7IH 1FSKC 1CK0L 4OD1H 3L9RB 4OF3A 2P5EB 3PDOA 1GHFH 2Y7QB 1A1NA 3ZTNH 2VAAB 4XVSL 5D2LA 4G8FB 4Y4FD 5ADPH 1D5ZB 1SYSA 4NZDA 3MA7B 1QLRA 3RAJH 1KNOA 4ZMAT 2BRRH 1QP1A 2M1KA 5HD8C 4PLKD 2X1XR 4KKBD 2X4NA 4LCCC 4OZIF 3RUGA 3MRKA 4W6YB 4WHTA 3WXWH 2GFBA 3GUTB 4YXHH 1FPTL 5HXMA 3DX7A 3GBML 5FCUH 4QOKA 4P4RA 3SE4A 3ABZA 3I6LD 2KL6A 5I66B 3D18B 1YZZA 4LRNL 2ATPA 4R4BA 4KROB 2CIKA 2I5YL 3RQ3A 2GJ6B 1VADA 5HJ3A 2YD4A 3C6SA 5DXWA 5JO5A 2EDNA 1YNKH 2YKLH 2C1OB 3RIAK 5L8LB 4HG4J 4RA3A 2R8SL 1BVKA 3TF7A 2ED7A 2YA2A 3GKWL 1YEHL 3LN9A 1GGBH 3QEQD 5IGXL 5JHLL 3TVMC 2R2EB 3LKOB 1N6QH 4YFLF 3MR9A 2DDQL 4BH7B 5C09A 4PGZA 4MAYB 2N7AA 3P30H 2DWEA 3UBXG 5IF0B 6FABL 2NY2C 1NC4B 1EAJA 5DHVH 5EU3B 1R3HA 1S7WA 5D7IF 5HDLA 4YHPB 3TBVB 1YECL 5SX5H 5FOBB 3GIVA 5KTEL 4JM2C 3AMKA 1DE4A 3JXAA 4JJHA 4KHXH 3UAJD 1YYLL 1BJ8A 4KRPB 4FTVE 1BBDL 3SKMB 1XGRA 2EC8A 2EYRA 5DZOA 2X4QA 1F00I 4MDJB 3V4PH 2Q8BL 4LLDB 4RIRA 3IXTA 4HEPG 3X17A 4M3KB 5IROA 3RVVD 2FDBP 3G5YA 2JCCB 3ZLQC 2Y5EA 2YD6A 4DOHE 3MRQB 3TJHC 1EHAA 3VWKD 3LS5H 3ZYJA 5EORL 3Q2CA 5IV2A 1EGJL 2I24N 4M93C 1T7VA 3MRDB 1ORQA 3KPQA 4C57C 2FHBA 5KZCB 5KSAD 3PGCB 4V3DB 5JUEL 1BQHA 3RWEB 1HHHA 3TNNA 1KEGH 2X10A 5E8DL 5K59E 3O2VL 5F7WC 2R0ZH 3G6JA 1KIPB 1BAFL 1K4DB 5DLML 4XC3L 5FF6B 2DJ4A 2EH8H 3CDCA 4JHZA 5SWZB 4CMHB 1GZQA 4HJGA 4WTZG 1MI5A 1ZE3C 1HSAA 2AEIT 1MCIA 1FFQA 4MVBA 2BXZA 5HVHC 5DURD 3FRUA 3MODL 5CWSB 1G7MB 3MV9B 3SE9H 4CVZB 5L9DH 3HRZB 5TQ0H 4I2XB 3FB6B 2Y36H 1A6ZA 5GJTL 1EHLH 4S0TD 3U9PH 1YY9C 4F33A 4E42A 4J3VA 1U2CA 1NBQA 4M6NH 4NQCD 2ZOKA 5D96C 3WEXA 2NY4C 1UM5H 1FYTB 3ISWA 3DX8A 2VLME 4OF6A 4DGVH 1YJDC 1X44A 4QHLA 1CD1B 3O41A 1OARH 3SE8L 5GZOD 3QDMA 1A6WL 5I6XB 2FX9L 1JV5B 2P8LA 3KYMA 1G0DA 3S3PA 2FEEI 3ZE1F 1KLUB 5FHAH 2DLHA 4RRPG 3RWDB 1DN0B 4DWHA 2MCG1 5E03A 1IGTA 5GSRB 1WCQA 4Z5RA 3VFSA 2C3VB 4J23A 4P5TB 3BSZL 2F8XC 1EBAA 3K3QA 4KKCD 2DQUL 4JFED 5GS3A 3WUWG 3D3VA 3QNXB 1O5DT 4G9FA 3TN0B 3BOVA 4O9HH 2W60B 4M1DL 5IHZA 5DJ8B 3DURB 3B2UD 3EYQD 1LK3L 3UTPE 1KUMA 4WTXA 4P2OB 1DLFH 5FUCC 1JE6A 3UYRL 3KPOB 1JMXA 4NO2B 2OR8A 3LKNB 2P1YA 4WGWB 3IDJB 5F8RC 1GL4B 1GOFA 3BP6B 4C58B 3SDAC 4RGOL 3RZCB 5HGAA 1LEGB 1U8PA 2BNUB 2F54B 3E0GA 5I19H 4ZS7L 4P9HH 2DWDA 1RULL 5BJTA 4XPHH 5FGSA 4RDQF 1GGUA 5KS9E 4OV5B 3TV3H 2I26N 4RAUB 3D9AL 4XMPL 1KB5B 3QDJB 3GFUA 1QFUL 4M8VA 1R3JA 1URLA 3GHEH 3G6DH 1F4YH 4CDHA 3F6IA 4ZPTA 4X7TB 4ORGB 1W0VB 1TZIB 2VDOL 4Y2OA 2ZSWA 3FZUD 1JTOA 3O6MH 4PJCB 3S35X 3QEUB 4PTTB 5EOTA 4D9LH 2YRZA 3W0WA 1TVHA 4V2CB 1FL3A 3IDYB 2DTML 1KJVB 4QGYA 4LFHD 4RA0C 1UCTA 5DMGC 5JQHC 3QXAA 2I07A 3H9SA 2WNGA 3EFFB 5F6HI 1KXQE 4G6AD 1NGZB 4WVRA 2C26A 3HG1A 2D2OA 5J6HB 4YQXH 3I02A 5HTSA 3VGFA 4CN1A 4JO2H 3P73A 1B0WA 2HMID 35C8L 2VDRL 1X5LA 4IDJL 1QO3A 2DQIL 3TYGH 3PWLA 3SDCD 5GS1C 3UTOA 3V4UH 1MJUH 4DCQB 3DV6A 4JFXA 3FO9B 3WIFB 2K9UA 3WHE1 4DN4L 1ZLWK 1UB5A 3MV7D 4X8XA 5CFHA 1JZ5A 3IJHA 3ARRA 3ES6B 1KCLA 2NXZC 1EA9C 4UNTA 3S6CA 3NN8B 5D1QA 2BCKB 1HWGB 4C55A 1CFSA 5EFIA 2VSDA 3PWJA 4QTIH 4HMEA 4OQTA 3S97C 3VFGL 2AS5M 3A67H 1VFMA 4PJXE 5HI5C 4AIOA 3BN9C 3DRQA 4WHDA 3V6ZB 5B4MC 3MMEB 4KJPD 2DKSA 1JGUL 4GLRH 1QFWM 4EUPG 3KPLA 1KB5H 4NN6C 5D72L 3EW3B 1QYGH 5T1KA 4LASH 3C60C 3MRHB 4EI5B 4Y2DB 1NEZG 2Y5TA 3BDBA 3V6BR 4Y5VC 4APQB 2Y06L 4RGMC 1PQZA 4XT1C 2DS4A 4RCAA 3VFTB 3HPLB 3VRJA 1CGVA 1BJ1H 4RMSA 4KAQH 5IFJA 3GNMH 3B8SA 1U8MB 4PFEA 4XNZB 1MY5A 5FKAB 4I9WD 4PJDB 1AGCB 1WTLA 4J3SA 1XMWA 2F53D 4U6TA 5B8CA 2F74B 2XQBH 3L5IA 2I60L 3TGXA 4BFBD 3BZFA 5KVEH 5F7DB 2Z93A 4LNVA 1RZGB 1AJ7L 2CLVA 4XAKE 4GMTH 2E6JA 2VXSL 1KCSL 3TIEB 4NC2B 3ZT7A 4G8IA 3FCTA 5IKCB 3IDNB 4Z7OF 4W4OA 4KVNH 2VDKL 1IGYB 1ADQH 3BPOC 4U1IB 2A0LC 2FBOJ 4OZIA 1NANI 3B5TA 4NPYB 1G7HA 1J8HB 3LCYA 4QTHA 5IQ7H 3LKQA 3GSUA 4HF5L 4HXAL 3REVA 4EN3A 4ZFGH 1E27A 2XICA 2Q7YB 3U30C 2FJFB 2IAMC 3QIUD 4I13B 4JZOA 4OD1L 4LCUA 1T04B 3V4VH 2QQNH 1GHFL 1V3KA 4R3SB 4BYHA 3WMSA 1JUFA 1NJ9A 1B0RA 4K7PX 3RAJL 1KJMA 1IGJB 1ERNA 3LB6C 5F1IA 2BRRL 4OBSA 3WO3B 3VXUD 5KVGH 2F5AL 4F3FA 4M4RA 3BP5B 2HRLA 4UOJA 1ZHKA 3WXWL 1HKLH 3N06B 4NKOA 4YXHL 2D0GA 5FCUL 4HUUA 3ARXA 1MVUB 1JPST 4PJXF 1ZA3B 2YUXA 2D31A 4JZJA 4HS8H 1P5UA 1XIWA 4G42A 4YR6A 2ICWI 2V9QA 1FDLH 4QO1A 1YNTA 3SE3A 1CFVL 4L4VE 5E94A 4NSKB 3D1MC 5D7IA 3OXRB 5A3IC 4ZFZA 3NCBB 1YNKL 3PL6A 2YKLL 1TZHB 3DYPA 1HYRC 3F12B 4BSVB 1JHLL 2BFVH 5DJ2B 4G3YH 3VFPA 1IGMH 1GGBL 2AAVA 5C08A 5HHMA 4QRTA 4JFQB 2P8MA 3K4AA 4UT7L 5IK3A 1N6QL 2DRUA 3D0LA 2ADGA 3LEYH 2VR9A 3P30L 5DUPL 1A3LH 4AK1A 1Q9OA 4LCIH 4KGJA 3QWOA 4MQSB 3OJDA 3ZHKA 3NIFF 5IMLA 1AKJA 4I0PD 2RR3A 4LP5A 3T8XA 4R97B 5MEOB 4O2EA 1FG2B 5GZND 5L2KD 1TCRB 2DQGH 1C12A 4KHXL 4LKXA 4LLYA 3MRPB 4GO6B 1RZJC 5E95B 4NKDB 4WFED 5GGRY 3ARUA 5TE6H 3FQTB 3K1KC 2DLFH 4DVBA 1H3UA 4JHBA 3N85H 3V4PL 1NBZA 1VCAA 2NY1C 4RZCA 2ID5A 3GMRB 3WYRA 5D7LB 4Y5XC 4U6HB 4RAVA 5I9QC 1LD9B 3I75A 2GUOA 2X4TA 4U1KB 5GRWA 2CIIA 3LS5L 3F7VA 3FAXA 2FWOB 4P3CH 1N3NA 1BZ9A 3WJLC 1CDBA 5IW6B 1WWAX 4XNMA 1UZ8A 1VACA 2VWEC 4XVTH 3OB0K 3IFPA 1HINH 1U8HB 2HJKA 2Y4SA 2CDEA 3FOMB 1ZLVH 5F7LB 3SY0A 2WAHA 3IF1A 3MRGB 4J3UA 1KEGL 4JFHE 5GS2D 4G7YL 1FCCA 2R0ZL 5E9DD 1CG9B 4RNRA 4M03A 1NCBH 1I85A 2E9IA 3ZDXE 4K71C 2EH8L 1NCTA 1D9KC 4DGYH 3EGSA 2Z35A 2YUWA 4X9GA 4JGJA 4NO3B 2MPAL 3GB7B 1I1AB 4M5ZH 3SE9L 3HMXA 4ZXBB 3KPRB 3KLAB 3CFEA 1LK2B 2Y36L 4HFWB 4X5XA 5BVJA 1EHLL 2G9HB 4JRXB 1H5BB 3U9PL 2DYPA 1OCWH 4M6NL 2B4CH 4HC1H 1FBIH 1UM5L 2AEQH 3B6SA 4F7MA 3RWFA 3ARGA 3TZVD 4DGVL 1IM9A 1CL7H 5ITBH 4ETQB 1OARL 4BQ9A 1XF4B 4NUGH 3BKCH 3LDBC 2W9EH 4F7TB 5I1IH 5E8OB 1QFWH 1UH4A 5B21A 4WNQB 1EEYA 1HIMH 2VNCA 5FHAL 1ITBB 4FTVA 2QHLA 2ESVA 2B5IC 4WRLA 3KAAA 1H9VA 3LPFA 5GS0C 2LAAA 3IKCA 1MPAH 4KQ4H 3OAZK 3MFFA 1JNJA 4O9HL 1RVFL 3PHOA 1CDIA 2R2CA 3BWAA 5B3NA 2ZUQB 2ARJB 1ZAGA 4PRPE 4GBXC 3T0EC 2XWTB 1JPFA 1MY7A 1Y18B 1DLFL 4X7CC 3DI2B 3W39A 2HJFB 3VGBA 3DIFA 2VE6B 2NY3B 2IBZX 5GGSB 4HS6A 5F70A 1FNEB 1N2RB 3BP7B 2VLKB 3KPNA 5I19L 1AQDB 4UIKH 3PWPB 4P9HL 5DS8B 3GKZA 1A8JH 2NW3A 5I16A 4Q97A 5BVPH 2APTA 2Z4QA 3QO0A 2X89A 3TV3L 1XGTA 4WI7A 2GCYA 3GSNL 3L7EB 2V5MA 3GHEL 1F4YL 2Z31D 5EPMB 2FJGB 1N59B 4URTB 4W6WB 3OKNB 1FLTX 1R3IL 2NX5D 2KBGA 3O6ML 4D9LL 3JWOC 3OJVC 5FECA 5D1ZA 1T5WA 2W9DH 4LSRH 1UCBH 3PNWB 3TWCH 4M8QB 5T5NG 3DUHA 3T1WA 3BGMB 1A3RL 5FDWA 1J12A 3KG5A 5AWNH 3CFDA 4QCIA 4N0CD 4WGVB 1MNUH 2AJSH 2W91A 4JFFE 4YQXL 1YN6B 2VABB 4P2RA 5FA3B 3F58H 5INCB 4JO2L 1BWWA 3WFEH 4OZFG 2VLLB 3D6GA 2WIMA 4RSVA 3MREB 4PJHF 5M95B 3TYGL 1CS6A 1AO7B 3DYMA 2E8ZA 1IAIM 2FLRT 5EC1B 5E7BA 3V4UL 1MJUL 5EUKA 2IH1A 4NCC1 1UADC 3HC3H 2DAVA 2HP4A 4DK3A 3NBNA 3KHQA 1C08B 2ARWA 3UTSB 4GRWF 1AGFA 5IFAH 1BD2A 5D7JC 4QTIL 1YC7A 2VLJE 3PGDA 3TC9A 4E0RA 1UWEH 2NY6C 3T2QA 3O6FA 1OSZB 3ARFD 1IEHA 3ARBD 3U36A 1MCWW 2DI7A 4AZ8A 2OR7A 3H2WA 1OAQH 1KB5L 5L0QC 3IETA 3MRNA 1U58A 3ZTJG 1QYGL 3L3DB 4YNYB 4DFIA 3FO2B 4LASL 5MEND 1TMCA 3S36H 1MHHB 4OUUA 2EC9U 4PJEF 3RWCB 4PRNB 3SQOH 1RJYB 4KI1A 4JY4B 5DYOB 1JVKA 4PG9A 2OK0H 1N8ZA 1DSFH 3JWDH 1JZ6A 3H7BA 2A6KB 2Z8WC 5J89A 3WS6C 4KAQL 3MRIA 3BQUA 5EU6E 2YOCA 5DMKB 3GNML 3BIAX 4F37F 2XQBL 1JNHA 4UZGA 4JPKH 4X4XA 5KVEL 1G9MH 4P59L 4OFPA 3MNZB 4GMTL 1WIPA 4KHTH 4KK6D 4HKJA 2BP3A 1U8NB 4OCSH 3LQAC 2IAND 2FATH 3ZSTA 4U1JB 1MEXH 5CEXA 3I6LE 3LKRA 4EIZC 3OJ2C 3ULVH 4D0CB 1JHTA 1HH9A 1PZ5B 2EIZA 1WT5A 3E3QE 4KVNL 4Y4KC 5ALBH 2H8PB 1ADQL 3E2HC 3PHSA 4S1RH 1FVDA 2WUCH 4JFZL 1JJUA 4XWOD 43CAB 3L6FA 1ZLSH 2XA3A 2GJZB 5IQ7L 1LEIB 4BJLA 5E5RB 3BXNB 4ZFGL 2YSSB 5BZDB 5JOPD 5CJQH 3MV8B 3UBXI 4PJXA 3QEQE 4RBPH 3V4VL 2QQNL 3DVGB 4HCRH 4HK0A 4L4TD 1B9ZA 3UZVB 3PDOB 1A1NB 1TIUA 5D2LB 1XCQA 2PKDA 1SYSB 2PO6D 1KNOB 2ZPKH 4GUPB 4QWWD 1IILE 2WP3O 4PIRF 3V7AG 1MCJA 4F9LC 5F7KC 2X4NB 3QUXA 1TZGH 1YEKH 1H3GA 1RJCA 3RUGB 1HKLL 2GFBB 2YC1A 3DX7B 4GG8B 4XAWL 1UXWA 4QOKB 4P4RB 1IL1A 1Q0XH 4LF3A 3UC0H 3T09A 1I3VA 2OLDA 3B8YA 2KQMA 4K8RC 4OLVH 4P5MA 4ODBD 4FQXD 2Q86A 3G08A 4HS8L 4GKSA 2CQVA 1FDLL 2ATPB 4R4BB 4PP1C 1QSFA 2IJ0C 2CIKB 2QQKH 4L1HA 4OF5A 1VADB 4CKVX 3KVQA 1G7IB 3C6SB 3QHFH 5JO5B 1L4IA 1HILA 3RIAF 3ARSA 2BFVL 1Z2KA 1N5AA 4KY1H 5DJZA 1IGML 4K23H 4XPGH 5KN5A 4HH8A 2H1PH 4KI5D 4XX1G 5CP3A 3GJFK 3LEYL 1WBXA 5C09B 2DWEB 1A3LL 4DUVA 4PJ5D 3QIBD 1Z5LA 4Z7NF 4TSCH 4LLWA 2MNUA 1R3HB 1S7WB 3HR6A 1OGTA 5GRYA 1KPUA 1A9BA 1Y6MR 2GK0A 3TFKA 3GIVB 4IBLT 4WUKL 2DQGL 1DE4B 1I7ZA 3DPBA 5ALCH 5TE6L 2DLFL 2JJTC 1QHPA 1XGRB 1QG3A 2EYRB 4NQUA 5KOMC 2YRLA 3N85L 2X4QB 5ACZA 4F2MB 2R1YA 2CRYA 5LKNA 4QKXB 4NQCE 3IXTB 5EO9A 5J57B 5HYSA 4NQVB 3G5YB 4GAGH 2APXA 3TH3T 4FFYH 4GMSH 5GRXG 4HUVA 5IV2B 2ITCB 4S2SB 5B3JE 4XVTL 1CVSC 5DJXB 2X4PA 2V5YA 1HINL 4MJID 2Y72A 1BQHB 3B83A 4X9HA 1HHHB 4OZGF 3TNNB 1KN4H 1FJ1A 4L4VA 4LARH 1NCBL 1RHFA 3MLVH 4OB5H 5JMOC 3L3GA 4X5LA 3EJYD 4Y4FB 4U33A 4HJGB 4NKMB 4X99A 4DGYL 1F97A 5EA0H 4OZHF 1MI5B 4Y4HD 4AEHL 1HSAB 2X1QA 4ZUWB 4XP6L 5FUZL 3EYFA 2D7OA 1IAIH 4M5ZL 3FRUB 3HI1A 5KBNC 3SCMC 4UUJA 4NC0B 3ZKQD 4N1EA 3HFMH 1A6ZB 3MOQA 1PLGH 2C4FU 1OCWL 1HN1A 4E42B 4F33B 2B4CL 3QH3A 2ZOKB 4YC2B 3WEXB 4PJGF 1FBIL 4G9DA 4NO0D 3IXAA 2AEQL 5E0QA 3DI3B 3DX8B 4GXVH 1CL7L 4XNQA 2P8PA 2EDOA 5ITBL 4Z7QF 4QHLB 3VFVA 3O41B 4NUGL 5H8DA 1VHPA 3BKCL 2W9EL 5I1IL 3QDMB 3MUJA 1UJ3C 2P8LB 1QFWL 3KYMB 4MCYA 1R3KB 3VXSE 1P4LA 3LSOB 1HIML 1FNAA 2LU7A 3S5LA 3FN9A 2X1PA 3HAEG 1TJIH 4KUCD 4Z5RB 3VFSB 4PJBE 3D69A 2WANA 3T0BA 4AQOA 2NR6C 4I3RH 1MPAL 4KQ4L 4R2GD 3D3VB 1OQOA 1E4XH 4G9FB 3V6OE 3SGKA 3VMNA 1L0YA 4MB3A 5B39A 1SVCP 2BVYA 2GTWA 5EN2A 3AB0C 5T1LA 2NY0C 2WZPD 1CGYA 4QF1A 4NWUH 4YBQC 3WDIA 1W8OA 1CXHA 1HNFA 4PGBA 1ZVHA 1MCQA 1IGIH 3MYJB 3I84A 3SDXF 3IDMB 5HGAB 4X6CE 5I76A 1U8PB 2DD8L 4UIKL 4HMDA 4G6MH 2DWDB 1NL0H 2V17H 1JNNH 4YBHA 2BY0A 1CDCA 5BJTB 5BVPL 4CJ0A 2J8UE 1CVRA 5DTFA 2UZYB 4C59B 4M7ZB 1NKRA 3MV7E 1NSNL 3UPAA 4ZPTB 4H0HB 1GC1C 3AFLA 4OZ4A 5FYLD 2ZSWB 4PJHA 4Z9KB 3GEWB 3VFUA 4MAUH 2FJHA 5EOTB 4PJ9C 4MJ2A 2W9DL 4LSRL 3W0WB 1TVHB 1FL3B 1UCBL 3TWCL 3U1SH 1J0JA 3WV0A 1A2YA 3DVNA 2HFGL 2DJSA 2E3VA 3GMLA 3OAUH 5C0GA 3TA3C 1MSPA 3MJ8A 5DURB 1FQ9C 2I07B 2AJYH 3H9SB 4M48L 4J4PD 3E6FB 5AWNL 5TF1H 1FE8H 1FHGA 4Y8DC 3HHRB 5KVFH 3HG1B 1MNUL 3AU1A 3EDFA 3JVGA 4JJ5A 3I02B 1YEDA 4FMFA 5A2LH 3F58L 4OT1H 4W68A 5FYKH 1W2KT 3QG6B 4JQXC 3P73B 4QT5A 4HBCH 4PB0L 4JRYD 3LKPB 4NQSB 3FOLA 3PWLB 5DD1H 4HXBH 3PV6A 1KEMH 2VDMH 1A9EB 2EDFA 3U46A 1UYWH 3DV6B 4JFXB 4PJBF 1RAMA 4I9WE 1UB5B 3HC3L 3IFOB 1AHWB 2F53E 5DZNA 4PJEA 4U3CA 3MBED 4GG6F 2PW1A 2R0WH 1U8LA 5D1QB 3T1FA 3GSRA 4M1CD 2UYLA 2ZG3A 3BIKB 1CFSB 5HDOA 1T2QH 3N9GH 4OIAA 3T0WA 5CD3A 4JFEB 1UWEL 5C07D 3BEWA 3DRQB 1EIBA 4U1MA 1WCBA 4IIQC 2FEDD 2G60H 1O0VA 1UC6A 1F02I 3I3EA 1OAQL 1QD0A 2P7TA 1NMAL 3KPLB 4WUUE 3QXDB 2CO7B 4PJ8D 3D25A 5T1KB 4LVOB 1YQVH 1U3HA 4TUOA 2Y5TB 2QR0B 3QXUA 4IOFD 4WWKD 3SQOL 1PQZB 3O45A 2WBJD 2OK0L 2LABA 5I17A 3JWDL 2QL1A 3VRJB 1CR9H 3DETC 1BBJA 1JHKH 5BXFA 1A21A 1OY3B 1YC8A 4JB9H 5IFJB 4NN5B 1AXSA 4UOW1 4WO4A 3QEHA 4N0UA 4AIZA 4U6VH 2LAGB 5B8CB 3ULUD 4JPKL 4JFFA 5CZXC 2Q87A 1G9ML 1CICA 1ZVYA 3BZFB 2Z93B 5DMIH 5F96H 3MACH 2CLVB 4KHTL 1GVIA 1KIRA 2ZUXA 4RMWA 4OCSL 3FQWA 2GJJA 4JDTH 2R4SH 2FATL 5E6IA 1MEXL 2E6PA 4G8IB 3ULVL 4P9MH 3CSYA 3FT4A 1FP5A 1OSPH 1CQKA 2GAZA 2IC2A 3WNLA 4S1RL 2WUCL 3DECA 4OFYA 2NYYD 4TVPL 4S0UC 4OZIB 4MXQC 4KVCH 4U05A 1ZLSL 1S7XA 5I1LA 1G7HB 1NCWH 4QTHB 3GSUB 3MUHL 3HB3C 1FL6A 3C6LA 1DDHA 2VLJA 4OQTH 4XMKH 3REVB 1KLGA 5CJQL 1U8QA 4CBPA 1EMTH 1E27B 2XY1A 1RIVH 2MTPA 4KUZH 4JZOB 1ROWA 4K3GA 4LCUB 3RVTD 4JKMA 3CK0L 2YPLD 1JUFB 1NJ9B 4HBQA 5HYJB 1B0RB 4JM2F 5DJYA 3DOSA 3SDDA 1JWMA 2ZPKL 3OZ9L 5F1IB 4IS6A 4DGIL 2DQCL 3IU4H 2I25N 2IPKA 3G9AB 1ND0A 3SDCB 4F3FB 1TZGL 4N68A 1YEKL 3KLHC 1EEZA 3KLSA 3REWB 5D1XA 1TTFA 1EDQA 5IT2L 3NCYP 4H1LG 5GPRA 4HUUB 1Q0XL 1TITA 3HE6C 4UV7H 3UC0L 5TDOA 3RDTB 2P5WE 3MJGX 5JZ7D 4OLVL 4K94H 5EU6A 4JZJB 3WLWC 1XIWB 3FN3A 4G42B 2JB5H 2QQKL 1YNTB 1ZTXH 4BSWA 3AROA 5D7IB 3QHFL 5BRZD 2QHRL 4DUXA 4ZFZB 2R23A 2HLFD 3ILQC 3PL6B 1YNLH 1EH9A 2XN9D 2HVJA 3T4AA 2ADIA 3UJIH 4KY1L 3VFPB 5F72S 1VFOA 4K23L 4XPGL 5C08B 5JW4Q 2YUZA 1YMMD 3MC0A 5GISH 5HHMB 2H1PL 4MGXA 4QRTB 4CL7A 2P8MB 1CLOH 1OM3H 3T04D 1PZUB 2ADJA 5CEZD 3D0LB 1RUML 3WHE0 1CBVH 3E3QA 3C5ZC 3CFCH 4OD2A 1W0YT 4Z8FH 2H41A 3V0WH 5E9DE 1Q9OB 1K85A 5AAWA 3AAZA 5C0CD 3B9KA 4TSCL 1JP5A 1YEIH 3OJDB 4JQVC 5I18L 5IMLB 4N5UA 2ENYA 1HKFA 3T8XB 1U0QA 4ZFFA 4O2EB 1CXLA 3CFJA 4B5EA 4QHKI 1C12B 4LLYB 1JF1A 5D2NC 4OZGA 3VXTA 1HHJB 3V5HB 3GMQA 2VJXA 1NBZB 4RZCB 4PLNC 5KSBE 2BOBA 2E7BA 5DFVC 3TBWA 1U3JA 1OAYH 5T3XH 4GAGL 2GUOB 2X4TB 2CIIB 5DQ9A 3F7VB 3MRFA 3H6JA 3WKMH 1GGYA 5DGRA 3SKUD 1N3NB 2B7DT 1PG7W 2D7QA 3VWJD 3QIWD 1UZ8B 1VACB 1NAMA 4LSVH 3IFPB 2GSGB 3SY0B 1DVFD 4KGLA 5I1DA 5D7KD 2XG5A 1M7IA 3NCEB 4LVNB 1KN4L 3QIUB 3M17A 15C8H 2AJZA 4LARL 3LKSA 4RNRB 1UENA 4JPWH 3MLVL 4OB5L 4U1GC 4P5KA 2VQUA 3BKMH 4HGMA 1ETZA 3EOYG 5L8KB 5EA0L 5BV7B 4JFDE 3EGSB 2Z35B 2FYYA 3VXUB 1G7LA 5CSBA 1OP5H 3Q5TA 1IAIL 2J4WH 2F19H 2WWKO 4JGUA 1V7MH 1MFCL 3CFEB 1BJ1J 3HFML 5BVJB 1MQKL 1PLGL 2DYPB 2QSQA 3VXPB 1NGYA 4IRSA 4UAOC 3TO2A 3R0NA 3B6SB 3QPXH 1NAKH 4F7MB 3RWFB 1NUFA 2CRZA 2V5TA 3ZDYF 3TF7C 3E6HA 4GXVL 4B7IA 1IM9B 5FGCB 3T3ME 2DIAA 2EXWC 4YPJA 4Z7VE 1UQSA 4K3EH 2UUDK 2ESVB 1J10A 4H8WH 4Q6IA 4MXVE 4RGNB 2JELH 3IKCB 3SDXA 4I3RL 4NQCA 2AP2A 3MFFB 1T5XA 5KVDL 3QFJB 1E4XL 2X4SA 4FQ2H 1A6UH 3PHOB 4Q58C 3BWAB 2NX5E 2SEBA 4P49A 3NVQA 4D94A 4XH2B 1JPFB 4NWUL 4KWUA 5CILH 1FAIH 4DKDC 5L2KB 3W39B 5JDJA 5DZLA 1IGIL 5ITFA 2YPVL 2FZ3B 4RFNB 1N64H 4HS6B 5BV7H 1QFHA 2ZUWA 1CIDA 3KPNB 3RX8A 4OCNC 2AEWA 2VISA 4IOSD 4G6ML 4P2QD 1EVUA 2V17L 4QXWA 1JNNL 3QDAA 2NW3B 3S37H 4GW4A 3DUSA 3QO0B 2GCYB 5AUMA 3QSKB 1X7QA 3AY4A 2NXYB 4FQCH 3CAFA 2VOTA 1IFHH 3K1DA 4WI6A 4N8VG 1T89C 3BRDA 3VXSA 4MAUL 1MCCA 5FECB 5D1ZB 4HDIA 5D71H 4C54A 3U1SL 4JQIH 3C2AH 1XH3B 3BAEH 3OAUL 4JY5H 4PJBA 3DWTA 2IGFL 5ESVA 4GG6A 3U7YH 2YZ8A 5MENE 5FDWB 3GMOA 1N26A 1EAPB 1FE8L 3DBXB 5BW7C 5KVFL 1F6FB 4MNQA 3DO3A 4MB4A 1Y6KR 4P2RB 4XBEH 3MYZA 4OT1L 2BSRA 5FYKL 4IOIA 5T1DL 1DBMH 1MCHA 3MBXH 3WBDA 4U7KA 3THML 3TZVB 5DD1L 4HXBL 3TBYB 4XXCC 5ICZB 1BQUA 1KEML 5DO2C 2VDML 3Q3GA 1VKXB 2ZG1A 1NCAH 1UYWL 2IH1B 1NGPH 1QUNA 2BMKA 2QQQA 3X12A 2R0WL 1GGTA 4NQEA 5IBLD 1CXFA 1T2QL 3BKYH 1BD2B 3N9GL 3QDGD 4JY6B 2B8OT 3PDGA 3PGDB 3QQNA 4Z7WE 5A16A 4E0RB 1JRHH 5JDSA 1MAKA 4LCCA 4YHZH 3O6FB 5DRZA 2IANE 4PLJC 4JRWA 2NTFA 3T08A 2G60L 2R1WB 3MRNB 1Q9WA 3IETB 1U58B 4EDWH 5EH1A 1JF5A 1YQVL 4QEGA 1TMCB 1IARB 3FO1A 2DB8A 1Y6NR 4OM1H 4OUUB 3GBNH 3EZ8A 5J12B 4PRDA 4B7LA 3EOAB 3K46A 1N8ZB 4HZLB 3H7BB 2V2XA 3ERYA 3X3FH 1CR9L 4L4TE 4U1NA 5C0DA 1JHKL 3C8HA 1XF2A 2BDNH 4GJTB 3ULSA 3MRIB 4FQHA 3BQUB 3GMNA 5E1AA 3C09B 4F9PC 3QUYA 3TVMA 4RFEB 1BEYH 4XPTH 5HHVH 3HZKA 3NPSB 2EIDA 1AI1H 1JNHB 2Z9TA 4OGZA 2IQAB 1KTRL 4YE4H 3VW3L 4F80A 4MZ2A 5DMIL 5F96L 1DBBH 3MACL 5CGMA 4MD0A 1AGDA 4HKJB 5IEHA 4JDTL 1CD8A 4QRPD 2R4SL 5D6CA 3KXFE 4TYUA 4ZNCD 5CEXB 3LKRB 1QR1B 4P9ML 4JM2A 3MRRB 1JHTB 1HH9B 1OSPL 1WVZA 5I15H 4KKAC 5ACLA 1H3PH 5KAQF 2X70A 1MFDH 2Y9RT 1FVDB 1YPZE 2QADB 3JV6A 1RHHA 4KVCL 4XP1H 3L6FB 1NCWL 1Z6JT 2EEAA 4DZBA 3VFOA 3RGVD 4U6XB 4OQTL 4XMKL 3QUKB 4OF0A 5C0RH 2BRQA 2KZWA 3HZVB 4G80A 3PDDA 4PJXB 3TJHA 2FX8H 4ZO7A 1DUYA 1XCQB 1EEUA 3EOBA 4WUUA 4AY0A 3BJLA 3CLFH 4LPVA 1LEKA 4PJ5E 5ABDE 3CZFB 4XBPA 3IU4L 1U3ZA 4LHUG 4JZNA 5BZWB 2JJVA 3P4NB 4MXWH 2YC1B 4PY8I 4Z7WF 1UXWB 4HFUH 4CMMA 5EOQH 3I9GL 4UV7L 1AC0A 1HZHH 4K94L 4P5MB 2HAZA 2Q86B 3G08B 4OM0H 4GKSB 5SX4H 2JB5L 3TYFA 5IHBA 4N5ED 1QSFB 1VFAA 1ZTXL 2VRAA 3G6AA 5T5FH 5M94B 3MX0A 5D6DC 4EXKA 1AGBA 1IAKA 1VPOH 2E7LC 1BZQK 2XKUA 2EDWA 3UJIL 1N5AB 3VGAC 5DJZB 4LOUD 5KN5B 5GISL 5DEZA 1CLOL 2IG2H 4MJIE 1XGQA 5TE7H 3NA9H 2APBA 3D0VA 5EZIH 3AS0A 4Z8FL 5FB8B 2XTJC 3V0WL 3ZT5A 2X4OA 3IYLW 1LP9E 1Z5LB 3NFSL 4LLWB 2VZVA 1RY7B 4NRXA 1YEIL 2BVOB 4KKLD 1AE6H 1OGTB 1KPUB 1A9BB 2GK0B 4NJAL 2BOCA 5A2IH 1RQ5A 1CQYA 4ZAKD 1A6TA 2IEPA 1Q8MA 3L5WA 1CDUA 2LQRA 1I7ZB 5B4MD 4JM4H 3LQMA 3H3KA 1PW3A 2HRPH 2R1YB 1ZLUK 4TOYH 1RJLA 1PEWA 5EO9B 3F62A 5HYSB 2X09A 2CLZA 4FFWD 4EN3C 3O3AA 2A9NH 1R6VA 3WKML 4HUVB 3SDAA 5I1CH 1B3JA 1FVEA 3UTZB 3ZE0E 3VCLB 2P5WA 1J1PH 1OPGH 4QHUA 1T7YA 4XGZB 2ICWA 4L4VB 4QRSA 3BKML 4PJ7E 4S1DD 1TNNA 4X99B 4FQIH 4GKZA 5IHUH 1X5IA 5JTWA 4E9LA 4ONHA 4TRPH 5DSCA 3T3PF 5FEBA 3WFHA 4N8CL 2J4WL 3HI1B 4HIXH 5CP3H 4CMHC 3KPSD 1V7ML 2W0FA 1RI8A 4OBRA 4UUJB 4HUXA 4XXDA 5E2VH 5J4MA 3IJYA 3KS0H 4M61B 4DVRH 5J11B 1ZOXA 3IXAB 3QPXL 1NAKL 4P46D 4FQXB 5TDPA 2EECA 3QJFB 4J3XA 5HI3D 4UDTA 4P4KD 4A6YA 4XNQB 2P8PB 5I0DA 3VFVB 3U2SA 1F6AA 3PP3K 1C7SA 4G6JL 4MCYB 4TUJA 1P4LB 2GT9A 4RFOH 1JYNA 4K3EL 1VGEL 3OWEA 1U41A 2H45A 4HIJB 5JW4N 3D69B 5DQDH 3S34H 2JELL 4NM8H 4HKXA 4MWFA 5LGHH 5L6YH 4IRJC 2WW8A 2RCSH 2X5PA 3FHQA 3O8XD 3TIDA 4WEMB 1G84A 5GS1A 1WICA 4FQ2L 4K3HA 3NIGF 3T2PA 1IT9L 4U1LA 4HKZA 1FNHA 5B39B 3T2NH 2GTWB 5EN2B 4YDVB 1TQCB 4QNPE 1DBJH 2QSTA 4E41D 1FAIL 1R5IA 1NFDE 3V95A 1DANU 1MLCB 4PGBB 3VE0A 3QI9B 5TQ2H 3HE7C 1MCRA 1N64L 1T4KB 1MJ7H 3MRLA 3VXRD 5BV7L 4XRCB 4JHWL 2AEPH 5I76B 4JFDA 4K7PY 4FNLH 3U4AA 3C60A 1DBKH 2WINA 1JYXA 2AV7A 3OG4B 4IJ3B 4Y5VA 4JRYE 4LHQB 3NFNA 1OWWA 5ISZA 1MUJA 1I85C 3NTCH 3OKDA 4Y16C 3QPQC 4D2NA 4QHMA 4NNPH 3QB7C 5FUOH 1LO2H 4FQCL 1RUQL 4Y0GA 2FHCA 1IFHL 1CI5A 4LSTH 1TQBC 4G8EB 4OZ4B 1PG7H 3FT2A 4U1HA 5C07E 1AD9A 5IUSA 4PJHB 1K6QL 3VFUB 4H25A 2FJHB 1A4JB 4JKPH 5D71L 2FECI 1S5HA 5IMOB 4BM7A 3F7QA 4JQIL 3C2AL 1A2YB 3BAEL 3DVNB 3EYVA 4JY5L 1DQQB 1CDYA 3GMLB 4PDCE 5ILTH 2VZSA 3MJ8B 3ZE2F 4ZOEA 5GSVA 4J6RH 3U7YL 1KYOK 3ARGC 3K8KA 1JF6A 4MA8H 3ARYA 3SO5A 4GQ9H 2KQNA 4GRWB 3AU1B 3ARDD 1YEDB 2E8YA 4Q9RL 4XBEL 3U83A 1G7QB 1DBML 1ZHBB 1SHMA 2P5ED 4NO0B 4O2FB 2J2ZA 3MBXL 3UMTA 4ALAH 4XCYA 4MCZB 2HT3C 2EE3A 3FOLB 3PV6B 4HWBA 3OKMA 1NCAL 2R29H 4JDVA 2IAMA 3HC0A 1QBLH 3MROA 2ERJC 3WNMA 3RHWK 3ULUE 4PJEB 2H9GA 3MOAH 1P7QD 2PW1B 3PQYE 1U8LB 5HPOA 3PWUA 4WI3A 3T1FB 2UYLB 3MJ7A 25C8L 1FNGB 1J0YA 1LNUA 1YMHA 5GGTA 1JRHL 5CD3B 4R2GB 4YHZL 3CD4A 4POUB 3BEWB 4U1MB 4KROD 5JLZA 2GJ6D 2P7TB 2AI0H 4EDWL 1IKNC 3RKPA 4ZD3H 4WFGD 5HHNA 2ADFH 1U3HB 3DMMC 2HTKD 5I1AB 4OM1L 4TUOB 4MD5A 1XGYH 4N8PA 3GBNL 1FLRH 5JHDB 3O45B 4CJ1A 5I17B 5SX5K 3MXVH 4F58H 2NY5L 1KG0A 4EI5C 3MLYH 4JDZB 3X3FL 4MAYD 5ECJE 3BRGC 1BBJB 2BDNL 2YPLE 1NC4D 5BXFB 1VA9A 2BZDA 2JF1A 1AXSB 4WO4B 1MQ8A 2WLZA 5KJRL 1BEYL 3QEHB 4LCWA 4XPTL 4N0UB 5HHVL 5MENA 2W9LA 4BFGA 1AI1L 4GRWH 3MSPA 4YE4L 1X6LA 2X4UA 1LMKA 1E6JH 4JFFB 5DDHB 1CICB 1DBBL 1ZV5A 4WW2C 4XCEB 1T3FA 1KIRB 5DD0L 1A0QL 1ZT7A 4HW6A 4KRPD 3FQWB 4KJWC 4TNWK 4FZEH 1RK1B 2VXTH 3GJEB 5TFSH 2R9HD 3CSYB 3FT4B 5I15L 4LPWA 1P7KA 4MS8D 1H3PL 5HHQB 1MFDL 3BWUC 1MAMH 4HH9A 4H26A 5FHBH 4XP1L 5BRZE 4G59A 4CN4A 1T22A 1S7XB 2A73A 3CSGA 5I1EH 3QUZC 3O4LE 4Y5XA 5KZCD 1FL6B 3GRWL 2XN9E 3C6LB 1DDHB 4Z7WA 1U8QB 5C0RL 5KSUA 2R2BA 1A6VH 1YMME 2FX8L 4JFPA 4Y1AA 1T0NB 5CEZE 1XR8B 3WJLA 1J0ZA 3CLFL 3TH2T 5DJYB 1BQHG 3SDDB 1JWMB 1LILA 3CDGA 5SWZD 4IS6B 2ICCA 3IFLH 1J0KA 1XF5A 3C87A 5C0CE 3D2UA 2IPKB 3GO1H 1ND0B 1PFCA 2AXFA 3AM8C 4MXWL 5D1XB 3MV9D 2GK2A 3MBEB 4M00A 2IBZY 2AW2A 3FFCA 3GJFA 4HFUL 5EOQL 1KTLA 4L4TA 4L5FH 1HZHL 3NGBC 1AQKL 1ITCA 4OM0L 1ZT1A 1FYTD 2H2SD 5GGVL 4WW1A 4BSWB 3B3IB 4FOMA 5IOPA 5K9KA 1JK8A 1WWWX 3LPGA 5F7EH 1VPOL 1G9NC 2HVJB 3EKCA 2ADIB 1EX0A 1GYAA 4RWHA 4GLRI 3KXFA 3CH1A 2IG2L 3PHQA 4D3CL 4P5TD 1GOGA 2E7MA 4OGYH 4P23C 1MFBH 4YH6A 2JE8A 3HUJF 5D7KE 4E5XA 5TE7L 3P0VH 2IFFL 5EZIL 4OD2B 1EJOL 4X7SH 3U9UA 3AREA 3P9WB 3LD8C 5ETUA 3BHBB 3TN0D 3AAZB 1AE6L 4FG6D 4FHBD 4KRLB 1DQMH 5DEGA 4ZFFB 7CGTA 1F90H 1H0DA 4UINH 2ITDA 4YPGA 4BQCA 2W0PA 4P2OD 3UBXA 1LO3H 2VDPH 3V8CA 4BK5A 2Z8RA 2PYEA 4JM4L 4OZGB 3VXTB 2HRPL 3GMQB 1C16A 3F5WA 4ZUTA 4GBXA 4TOYL 3G5VA 3BUYA 3WNOA 3RZCD 3T0EA 3TBWB 3F7RA 2F54D 3V5KA 3LS4H 5J1AB 4QXGH 4OZHB 2A9NL 2NZ9C 2X41A 5DQ9B 5HGDA 3MRFB 3BH8A 4LSSH 2VTFA 3GSWA 5I75B 1KIQA 3MRMA 5DK0B 1TDQA 4NCC2 4PJAE 4UOW0 5I1DB 2WY3A 4POZC 1OPGL 4U31A 1M7IB 3IKKA 3WNNA 1T2JA 4LPYA 2QSCH 3WN5C 3M17B 2AJZB 4PJGB 4ODTH 3QUXC 3LKSB 3X3GL 4X5WA 3B9VA 2J5LC 4FQIL 5IHUL 5HI4D 1S7RB 2DI8A 1U36A 4NNYA 4TRPL 2FYYB 1G7LB 3MV01 3H7LA 3HC4L 4KV5F 2BSSA 2UV3A 4ZO6A 5IVZA 1PX4A 4AENA 4HLZH 4HIXL 3CC5B 2EXYC 1KGCD 2ZUTA 1LE9B 4BH8A 1MFAH 3STLA 2HG5A 4I77H 4V1DA 1X4YA 4OUOA 4WTZA 4DVRL 1NGYB 5DMJB 3TO2B 4X98A 3SBWC 2Y6SC 1NCUA 3MV11 3F7PC 1BF2A 1M4KA 4DAGH 2GSIA 4F57L 3MUZ1 3M8OH 4P2QE 1C5CH 2XWBB 4BZ2L 2Z0BA 4RFOL 5SV3A 1UQSB 2Z8VC 5GJSH 1R24A 3O9WC 4Q6IB 5DQDL 3S34L 4NM8L 5F44A 2P4AB 3SDXB 3VGGA 4XB8A 2WK2A 1F4XH 4U7SA 2EDHA 1T5XB 3V0AC 2X4SB 3DXAE 4A2MA 3CXDH 1XGPB 4QRRD 4AIXA 4RRPA 5I1GH 1HSBB 2SEBB 2A6DA 3T2NL 3R06A 1DBJL 1RIUH 4PTUA 3HS0A 4NQXA 1ZGLP 3FONB 4Y19A 5CJXC 5HGBB 3WUWA 4LLVA 3WFCH 1GH7A 1JGVH 4I4WA 4KJQC 5CIPA 2CRMA 5L88H 2OL3A 4Z6AT 4APQD 5TQ2L 2R69H 1MJ7L 2W59A 4Z0XA 5JIHA 5ICYA 3C5JA 2AEPL 3ZKNC 2DQTH 2FBJH 5L8JB 1DBKL 2VISB 2XA8H 3TO4C 2FB4H 1S78C 2CDGA 2EDEA 1DFBL 3DUSB 3QZWA 1OTSC 1YEJH 5EULV 4K3JH 1BECA 5DJ0A 2BVPA 3BH9A 3MJ9A 1KTDB 3NTCL 4GRLC 3D85A 5AUMB 3WS6A 2F15A 4NNPL 4OLZH 1X7QB 1G6RB 5FUOL 1LO2L 5GHWL 4CU7A 2V2WA 3QDGE 3OF6A 3NABH 1PG7L 2L7UA 3KJ4B 2DL2A 5J8OA 1KV3A 4G6KH 4JKPL 4FZ8H 4JO4H 4L9LB 4HDIB 4I3SH 5IMMA 5ILTL 3ZYOA 1X9QA 4J6RL 4GG6B 1J8HD 4MA8L 1CF8H 4GQ9L 3VXMA 1Z3GH 4M9OA 4MNQB 4WDIA 1I1YA 4QRUA 2HFEA 4OLWH 1MFNA 3E2HA 4XVUD 3KPPA 1IRAY 1NMCB 3SO3C 4DEPC 4LFHG 4IOIB 1I3RA 1J87A 5H37H 3EHBC 4ALAL 1NLBL 4M6MH 4ZSOA 1UACH 4KFZC 3VFNA 3TPUA 3JBG7 1V7NL 2BC4A 2L0DA 2R29L 5E56A 4OAWA 4G43A 3KPTA 4XHJC 1QBLL 1DQDH 1FSKB 4CW1B 4OQ1A 4CNIB 1FYHB 2BMKB 3MOAL 1Q9KA 1YDPA 3D5OF 4NQEB 1EHXA 1MCNA 2UY6A 5A16B 3R0MA 1I1FA 5JDSB 3RPKA 4LCCB 5EUOE 5T5NF 5DRZB 2VDNH 4KMLB 2NTFB 5EIIB 1S9YA 3MLTA 5EU5A 3RTQD 2AI0L 1Q9WB 4ZD3L 2ADFL 1P9MA 3OSKA 5F93C 1G6RH 1QEWA 4F7EA 4EQ3A 1QRKA 1FLRL 5GQBA 5ANME 5EOCH 2CR6A 2HT2D 3JV5A 3NZHH 4PRDB 5CHNB 3SKNA 3MXVL 2YHGA 5ICXA 4EUPA 2V2XB 3H3BC 3MLYL 2XRAH 5C8JA 7FABH 5C0DB 1ZLWH 3AGVA 1ZGLA 1OP3K 3L1OH 3ULSB 4FQHB 4HJJL 4ZUUA 3GMNB 5E1AB 3TVMB 2CDFB 3VDBA 1JFMA 3HZKB 1E6OH 1AY1H 3QR2A 1E6JL 2R1XA 4ZUVA 3TLRA 4XPBL 3K8MA 2NY2B 4YIQB 2PR4H 5BQ7A 4MD0B 3GMMB 4TSBH 1AGDB 2XZZA 5E8PA 4O02H 3OMZA 5M7QA 5IEHB 3RP1A 1II4E 5A2FA 4FZEL 5A40E 2VXTL 1PKQE 4JM2B 5D7LD 5IQ9A 2NW2A 1Z9OA 2VZTA 3FN0H 3W5NA 2GW5A 1F5WA 1MAML 2X70B 4LAQH 3VXOA 5FHBL 2JJTA 3BZ4A 1S8DB 3BDYH 3JV6B 1RHHB 1Q1JL 3PQYA 3VJ6A 4MA1C 1UB6A 1MCDA 4U3XA 4WJ5B 3RY6C 4DZBB 5I1EL 3VFOB 1CLZH 2P49B 1QLEH 5JIKA 4G80B 4NHUB 1A6VL 5IW1A 1P84K 2R15A 4M93B 3PWNB 2FSEA 4HQQH 2CGRH 1UWXH 4X6DE 4Z95L 4ZOCA 3IFLL 2AK4E 4XBPB 3IDXH 4ZYKA 3EJJX 4JZNB 1QSED 1H15A 5GRJH 3I3BA 1I1AD 2X9WA 4ZXBD 5I1JH 5TGBA 3KPRD 3O0RH 5E6YA 3VXQA 4MQXD 4JRXD 4L5FL 5I71C 1S9XA 2YPLA 1FL5A 4B50A 4OI9A 5HVHB 3TYFB 1INQA 1VFAB 4OFDA 3SCMA 1BFTA 3G6AB 1HXMB 1M05B 2QBWA 1C1EH 1GGIL 4U2YA 4HWZA 4XCNA 4X7EC 4BFEA 4UTAH 1G6VK 2D4FA 4PREA 5D96B 5H35A 4CRPA 2NY4B 4PGDA 3CVIL 3ZKXC 5IVXE 1IZKA 4TSAH 3EO1A 5FYLL 1MWAB 4LNRA 4OGYL 2J6EA 1MFBL 2J8OA 3P0VL 5I1HH 1QHOA 3WJJC 2AXHA 3D0VB 1AP2A 4X7SL 2C3GA 2X4OB 4AH2A 1ZKAA 5FXCH 3VD9A 4NRXB 4NFCA 2FIKB 1CLCA 3O4LA 4LIQH 1DQML 1MRDH 4ODXA 2VXQH 2E5EA 2BOCB 1OTUC 4UINL 1MRFH 1P6FA 4HGWB 1NFKA 1A6TB 8CGTA 2VDPL 4HIEA 1YMMA 3L5WB 5GGRB 5KANG 3V6FA 1KSRA 4YEFA 2NY3D 4H20H 3RBSA 1JGLH 4QRPB 1WF5A 3TPKA 5GRUL 2VLKD 1DCLA 3LS4L 5GIRA 4MNGE 2PXYC 5DC4B 3PWPD 2AV1B 3OAYH 4OGAC 4L8SC 1KPVB 1ZVSA 4LSSL 3GSQA 4ODVH 3VA6A 3EYOA 1AFVH 5CSZA 3SDAB 4C4KO 5CJBA 4PJFE 2ZJSH 4J3TA 2P5WB 4L29A 5EBMA 1UA6H 1FNSH 4QHUB 1GIGH 4HT1H 2QSCL 4HJ0D 4ODTL 2ICWB 2AK1L 5C1MB 1A47A 4Z78A 5E2JA 2ZCKL 2VLRA 4GKZB 1D6VL 1LO4H 4ONHB 1MCFA 5DSCB 1ZT4A 1LWRA 5HY9A 1ONQB 3BFOA 3WFHB 1CFNA 1MWAH 1YJDH 5CZKA 5C0EA 4Y4FC 2XQYG 1XZ0B 4E41E 5J7CC 2YR3A 2W0FB 1MFAL 5J3HD 1EV2E 5DK2A 5FIEA 2MOVA 4HUXB 1K3IA 4I77L 3RIFK 2IF7A 3BE1H 4XXDB 4PLKC 4PJ9A 4KKBC 3IJYB 2VR5A 1I7UA 4MXQD 1T0PB 5BS0D 3TA3A 5TDPB 1DZBA 2BNQA 3G6JF 5FO9A 3FO0H 4DAGL 4UDTB 3OB0H 1AH1A 1F3DJ 2W0KA 3M8OL 3BPNC 3U2SB 2UWEF 1F6AB 1C5CL 1AO7D 5HYIA 2P44B 3NCJH 2GT9B 1IQWH 3EBAA 3WIHA 5GJSL 4JQXA 3N0PB 4L8DA 4NC1E 5E4IA 3B9KC 1F4XL 3U6RB 4HKXB 2DM3A 4MWFB 5F8QC 4NT6A 3UTSD 3UTTA 3TIDB 5GS1B 1VERA 2KDGA 3CPLA 3IT8D 4HKZB 4U1LB 5I1GL 5JXAL 4XC1H 3D39A 1NLDH 2NXZB 4MJ5A 1R5WA 1RIUL 1ZS8B 3HE6D 2AVGA 5BO1H 4PJAA 4X0KA 4GKNB 5F3BA 2C5DC 1R5IB 3WFCL 2CUMA 3CX5J 1JGVL 3M1BB 1CD9B 1M7DA 2G5RA 4IIQA 4L8BA 3MRLB 1W72B 4NN6B 4ZNEA 5J9PA 5ID0B 3OKLA 2DQTL 4R7NA 4QLRA 3UAJC 2XA8L 5DRXA 2WINB 3C8DA 2FB4L 2P5EE 2N7BA 2EICA 5D9SB 4Y5VB 5FA4A 1F4HA 3E8UH 1YEJL 5SWQA 12E8H 3NFNB 4K3JL 5ISZB 3OAZH 3X14A 1G7PA 3EYUH 3OPZH 4BFIA 1MUJB 2ENSA 3OKDB 3RVVC 2DF3A 3VWKC 2KZ1B 4OLZL 4QHMB 1WTGT 4N0YH 3NABL 5HDBF 3QNYA 5DJAA 1JPTH 4BUHA 1CXEA 3FT2B 4U1HB 5KSAC 1AD9B 1SEBA 1PYWA 4H25B 1NGWA 4G6KL 3VU2A 1QBBA 4JO4L 2E7LE 1S5HB 4LPTA 2G5BA 4LGRB 4I3SL 1PVHA 5J0BA 4LSDA 3EYVB 2GJ6E 3QA3A 4RMTA 1G1CA 3NIDF 2GYSA 1FNLA 4MZ3A 5GSVB 3EJZD 1CF8L 5BOPA 4JO3H 3KPSB 5DFVD 5SWSD 1Z3GL 5D5MF 4KQ3H 5EG6C 3DXAA 5LAXA 3MV8D 4OLWL 4XNYH 4HGKC 2XWJB 3BPOB 4JKWA 5F89A 4ODWA 2RQ8A 2E7HA 3WS3A 3P40A 3SGEH 5K33A 3PIQA 1UACL 2RGSA 1J05A 1IGFH 3UZQA 2FL5A 2LTQC 3U30B 2OTWA 2IAMB 3HC0B 1DQDL 3BRFA 3ME0A 1KPRA 4C83A 2DMKA 1Y0LA 3VDAA 1JN6A 2YK1L 5DT1H 2H9GB 1H3TA 3IDUA 3PWUB 5GZOC 5FYKU 1T66D 4QOKD 2RFXB 1AHWC 1L7TH 4LAJH 5F88A 3P77A 1JZ3A 3PG2A 1NC2A 3S96A 5C0AB 1JWUA 4JR9H 5JLZB 4KKCC 4OSUH 2MHAA 3B43A 1NCDH 2JCCE 4GKOA 5HHNB 5DUBA 1G6RL 5KVMC 2BNRE 4MD5B 5EOCL 3NZHL 3QDGA 3B2UC 3EYQC 1KG0B 3VXRB 3FKUS 1NH6A 2AJUH 5C09D 2XRAL 2DMBA 7FABL 3L1OL 4GOSA 2IPUG 4R8WH 4LEXH 4R0LC 4LCWB 2DLTA 5SWZE 1PSKH 1E6OL 1MF2H 3BPLC 1AY1L 4M6AA 3KS0J 4M43L 3RGHA 1KBGH 3C5ZA 3T0VA 2XKNA 2OYPA 1HHGA 1OGAE 2PR4L 4J1UA 1F8TH 1RUKL 4TSBL 4WHYH 1ZT7B 3MV9E 4O02L 1OLLA 1K2DA 1U95A 5CP7A 1KT2A 2CJUL 4I2XE 4JQVA 4M9PA 5CJOH 1A1OA 3SKOB 4U0QB 3BYYA 4HWBH 1CN4A 3NMEA 1WZMA 1PKOA 1IC4L 3T0DA 1I8KA 5JIPA 3FN0L 3O2DA 4N1HB 5D2NA 1FYTE 4LAQL 4NQDA 4HH9B 4TTDC 4KXZI 3V6OC 1ED3A 3BDYL 1FGNL 5E24E 1T22B 1H3VA 1LDPH 2NY1B 3WE6A 4CN6A 5KSVA 2A73B 3FZUC 2DBJA 1CLZL 5GGTH 4AG4H 1FZMA 4Y5XB 4V3EB 4BA8A 4Z7WB 4FABH 3ORJA 4U6YB 5K9OB 4R96B 4KTEH 4ZPVB 5KSUB 5I9QB 3I50H 1Q9LA 1ES0A 4Y1AB 4ENED 4KTYA 4HQQL 1U3YA 4G6AC 2CGRL 1A3QA 3CDGB 1XF5B 1NBVH 3MRJA 2H6PA 3IDXL 1MI5D 2RBLA 1HQRA 1MHCB 1OAKH 1RU9H 5ANMA 4MVBD 1I9IH 3X13A 5LXGL 5GRJL 3FT3B 4NZRH 1QQDA 5I1JL 2BY1A 3O0RL 1P7QB 4K71B 1D9KB 3FFCB 3GJFB 1KTLB 4CDGC 3MGAA 5E2TH 2D3VA 4NNXB 3WDHA 5CUSL 3CMOH 3DHJA 1JTPA 1N7MH 5F9JA 5C0BA 3U0TA 1ZT1B 2D0HA 2A9MH 5I8EA 4WW1B 3ECBA 3HI6H 5K9KB 2F54E 1C1EL 1JK8B 2OJEA 1OQXA 3QDMD 4G7VH 2P46B 4UTAL 2VYRE 3CDYA 3VI3E 5EO1A 4KJPC 4TSAL 3JTCA 4HKBA 3WDJA 2YPKB 5E8NA 3B4NA 2CXGA 3CH1B 3PHQB 1B4RA 2DJUA 4E5XB 3QUYC 3QDJE 5I1HL 1FFRA 1RZJH 2WV3A 3BI9X 5C0IA 3WL9A 3D3VD 4C56B 4N5EA 4G9FD 4HHAA 5ETUB 3G5ZA 2EYSA 5F1KC 2B5IB 4XCFH 3B2VH 1D5IH 4LIQL 5FYKD 1JGDA 1MRDL 2VXQL 3EZJB 4PJCE 2ITDB 1MRFL 4QXTA 2MCPH 4K55A 4YPGB 4FXKB 1RD6A 1JGEA 5TE4H 3QULA 3T65A 1DQLH 4X83A 2PYEB 3K4DA 1KGCE 3FFDA 1FVCA 2OX5A 2OBGA 3WHXA 1C16B 3EDJA 4PD4J 1J5OH 3F5WB 4NM4H 4H20L 1UZ6E 4ZUTB 4GBXB 3T0EB 3G5VB 2AK4A 3STBA 4F8TA 5D7SH 2Q8AH 2BVEA 1H8SA 4AEFA 5CLTA 5ERWA 4ODVL 3IU3A 3BH8B 2YD5A 4MLSA 4DK6A 1WISA 2PF6A 4BQBA 3GJFH 1AFVL 5IBUG 3MRMB 2ZJSL 3BD5A 3TBSA 1UA6L 3N50A 1GIGL 3KYOB 4HT1L 2Y23A 4WV1C 3L3IA 2VQTA 4QHNB 4WFHD 4M7LT 1HEZA 1D3CA 4LPUA 5DRNB 4XP9H 4UBDD 2UWEA 3QIUC 1LO4L 4I48A 4NNYB 3W0WD 2VZUA 3V5DB 1E4JA 4CVUA 1YJDL 1MWAL 2RIKA 4AENB 5EWIH 4BH8B 3STLB 3H9SD 1O7SA 2HG5B 3CFIC 3ROOA 1T89A 4V1DB 2R0KH 4I18A 2AKRA 3HG1D 1U8IA 2VDQL 4S1QH 2ZP0T 4PP2A 2O5YH 4X98B 4JHAH 2NZIA 1R3LA 5GS0H 2DOCA 1S7QA 5E00A 3FO0L 4HWUA 1MRCH 1U8JA 5CKAA 5BW7A 3NCJL 1EFXA 1IQWL 1QRNA 1AIFA 1KB9K 3IS0X 1O7VA 4JAMA 4PJDE 1R24B 2JK5A 1ZGLM 3H9HA 5HHOB 3MTRA 5JW3L 3NA4A 1NDGA 5D1QD 4YX2H 5I2IA 4XXCA 1RZ8A 5FGBC 1HE7A 1ZMYA 4ZS6D 2EE6A 5J56B 3BKJH 3SKJH 1EVTC 4XC1L 3HAEA 3QQ3B 1E28A 3R06B 2CO6B 2IBGA 4PJFA 3SOBH 3HS0B 3TH4T 5BO1L 4NQXB 3W9DB 1Z9MA 5D7JB 4Y19B 5T1KD 3WUWB 1YYMH 4LLVB 5LCVH 4OLEA 2NY6B 5CIPB 2KPNA 3S4SA 5C0JA 1J8HE 2OL3B 4N9GA 3STZB 5EO0A 1NPUA 3DRTB 5K9QG 1UEYA 4I0PC 5K9JL 4Z0XB 5L0QB 5ICYB 3SJVA 3C5JB 5GZNC 5H94A 1TENA 5F6IC 3MLXH 2CDGB 5JNYA 3NACH 3NH7H 1V5JA 3QZWB 3E8UL 4J12A 3VI4E 12E8L 3EYUL 5DJ0B 3NCCB 2BVPB 1NCCH 3JWOH 3OPZL 4CADB 5D5MA 1FZKA 4MX7A 3MUGA 1BFVH 1ZK9A 4PY7B 5K59F 4F9PA 3NOIA 2V2WB 2AERT 4KK8D 5HPMB 3CMGA 1JPTL 2YEZA 1KN2H 4L3EE 2Z91A 3A6BH 3UO1H 3RU8H 4KK9D 5FAAA 5EZOL 2FR4B 2Y07H 3OGOE 1EFQA 1JWSB 3C8KA 5IMMB 4I1NB 4R90H 1J1OH 2NY5C 1BFOB 4JO3L 1I75A 1T7ZA 3VXMB 4KQ3L 5CINH 5BOZG 4Y4KB 5MEQA 1J86A 4WDIB 1I1YB 1C5DA 2HFEB 4XNYL 3E2HB 3KPPB 2ZUYA 3IGAA 5HYJD 1A5FL 4ZSOB 1EO8L 4KK5D 3TPUB 3W11D 4PRIA 2BC4B 4WW2F 5CIPH 4YHMH 3RL2B 4G43B 4PRHB 2OL3H 1F11A 1A64A 4KMTH 1CXKA 1W72L 5T3XD 5C71A 5DT1L 1MCKA 3DX6A 2VUOA 5LGJA 1YDPB 2P48B 3RJQB 1L7TL 3OV6A 4UNUA 3RDTD 1I1FB 3Q6GH 4QRRB 5JXEA 1WFNA 1XIWD 4EVNA 3MA7A 4P57A 3JZ7A 4JR9L 5EU5B 3MJ9H 5D7LE 4OSUL 3PL6D 1NCDL 4EQ2A 3WLBB 5JR1H 1RUPH 3CDFA 1QEWB 4F7EB 5C0NC 5JORB 2ZOLA 3BVNA 2GY7B 1DANT 1TJGH 5C08D 3AS2A 5HHMD 3SKNB 5ICXB 4EUPB 1CFQA 2ICEB 5DVNA 5DC9B 5D6DA 1DLHA 3D18A 2AJUL 1KCRH 2E7LA 1WFOA 5C8JB 2OR9H 4HZAA 3B9EA 3LQAH 4XTRC 4R8WL 3VI4F 4LEXL 3VA2C 5I74C 5KS9F 5I8KH 1PSKL 2ZUSA 4HK3J 1MF2L 1UKSA 3H9ZA 3L3KA 3DJ9A 1P69B 1KBGL 5A43C 2R1XB 1WFUA 4ZUVB 4LKCB 3VGHA 2WWMD 3NAAH 4YUEH 2N56A 3KPRE 4BH7A 4HWBL 1WUNT 4JRXE 3UDWC 5AZEH 3ALWA 3VG0H 5IB3B 3J7HA 4TUKH 2A6IA 2Z31C 2IADA 2JKXA 3VJ6B 1UB6B 3HMWH 1LDPL 1XT5A 3ZKMC 5GGTL 4OJFH 4IDLA 4FABL 4KTEL 3SKMA 5IW1B 1JNLH 2ZSVA 1KACB 3CXHK 3ILPA 1L7IL 2HTLD 4LLDA 1FFNA 3LEXA 1I3GH 4G8GA 1NEUA 5E1HB 3B5GA 3ZTNL 2JIXA 4N0CC 5IHLB 4EZMA 2JCCA 5ADPL 4K8RH 4PGEB 1NBVL 1M1SA 1EERB 2BNRA 1WFTA 3KNBA 4ZYKB 5KANI 4P2CG 1OAKL 1RU9L 4OLYH 1I9IL 4EUPH 4NZRL 2W65A 4XB7A 2BERA 3PGCA 3QQ4A 1NCNA 5TGBB 3RVXD 1R0AH 3RWEA 3VXQB 1AXTH 1I8LC 3HUJB 5E2TL 3CMOL 2DYPD 1N7ML 3HKFA 1FL5B 3QG7H 2GEEA 1K4DA 4YHNB 1KTKE 2A9ML 1INQB 3SCMB 3ARGD 3UTQA 1IM9D 1LGVA 2VLKE 3RTQB 4H1LA 2EEBA 4HWZB 1XF3A 3PWPE 1OGAA 4G7VL 4UU9B 4XCNB 5CBAA 3SPVA 1A1MA 4X9BA 1JZ7A 5H35B 5A2JH 3ARFC 1G7MA 4FTVD 3ARBC 4GAFB 3HRZA 4PGDB 4CVXA 3IJSB 2ESVD 3FB6A 3EO1B 4Y8AA 4LNRB 4RGND 2XG4A 1RZJL 3TESA 3GSNA 1K4CB 1UJ3B 3QFJD 4AH2B 1T0MA 5F3HB 1T83C 1SYVA 5MP6H 4XCFL 3B2VL 1D5IL 1J11A 3DX9B 3O4LB 4ODXB 4X7FC 4GW5A 4IRJA 5I73C 4WCYH 2MCPL 5H2BA 1CU4H 4ODSH 5TE4L 1INDH 4H5SA 1UKTA 1DQLL 3L3JB 2C3VA 3V6FB 4P5TA 4O00A 5H37G 1J5OL 4NM4L 1AD0B 3AB0B 3LY6A 4O4YH 2NY0B 4NO5A 4OLXH 1CTNA 2WM0A 4RX4A 2LU3A 4OGXH 4KK6C 4OKVB 4JCLA 3RBGA 1ZVSB 3WD5H 4PRAA 3RVUD 3EYOB 3HE7A 4PB9H 5CSZB 2X89D 1AO7E 4YXLH 1MIEH 1OD9A 4YHYC 3ULVE 1VFUA 3BMWA 4PBXA 1CZ8H 4L29B 5EBMB 3LKNA 4Q9QH 1XFPA 3IDJA 3T77B 3BP6A 3V8OA 4TVPE 3U7AA 4LLUB 2NXYD 2BVQA 3LEVH 4Z78B 3UTSE 2BNUA 5D8JH 2OXHA 4XP9L 1Z9LA 5DHYA 2VLRB 5CCKH 3BGFC 4Y16A 3FQRA 2PTVA 2PYFA 5D1ZD 5EOCJ 1ZT4B 1UG9A 2ARJQ 4KJWD 4J7RA 2J6EH 5CS7A 1BZ7B 5C0EB 1QSEB 1L0XA 1CFBA 5EWIL 2PO6C 3QDJA 5CD5D 2VKWA 3RIFF 3VG9B 3N1QC 2APWA 5L9DL 2R0KL 4QWWC 5TQ0L 4K3DH 4PJ9B 3FQNA 4KJYA 4S1QL 3UJTH 1I7UB 2O5YL 4P2RD 4ESKA 4JHAL 4NQTA 5GS0L 3TA3B 4G6FB 2BNQB 1MRCL 2YD2A 3UTPD 4GT7A 5ESAA 1RSFA 3LRHA 5J11C 4YDLC 1OW0C 4FQXC 5SX4I 3LAFA 1TFHA 3AREC 5FM5M 4WU7A 2X44D 1OD7A 3EFFA 1NGZA 4EEEA 2V7HA 4YX2L 4ORZC 2E9JA 1MLBB 3UTTB 1BD2D 5L2JA 2ZCLH 1W8NA 1QLFA 3BKJL 3CPLB 3T4YA 3UX9B 1ZANH 3SKJL 3J8F7 3O6FD 5CBEA 4KI5C 3TT3H 3D39B 1EO7A 2MKWA 2XQYK 3O3EA 2OXGA 4MJ5B 5HYQA 1R5WB 3SOBL 3ALXA 4D8PB 1NGXA 2EZ0D 5F3BB 1NDMA 1LHZA 1CDGA 1YYML 4UB0H 5E70A 5LCVL 3QIBC 1K8IA 3T2OA 8FABA 4I3GA 5GRZA 1U93A 4HUMB 3P2TA 1M7DB 4LDOB 4IIQB 2HVKB 3JTSA 1IQDA 4L8BB 5CGYD 1D7FA 3MV8E 1IKNA 3OKLB 3VFMB 4DQOH 4R7NB 1OTTD 5HVWA 5DRXB 3DMMA 1KLFA 3MMEA 2UUDH 1GC1H 3MLXL 5DC0A 3MOBH 3NACL 3BQUD 3NH7L 5D2LE 3SGDI 5FA4B 2HT4D 5SWQB 4XPHL 4X6BB 1NCCL 3JWOL 1G7PB 4BFIB 1R5VA 4WY7H 4EI5A 4Y2DA 2XZAH 1IKFH 4B0MM 5F6HJ 2RJMA 4M62H 1BFVL 2EH7H 4N1CA 2QJDA 1TTGA 3G6DL 5FKPB 2YWZA 3ZDXF 4QOKE 3BT2H 1SBSH 2NY7H 3S98A 3UO1L 1SEBB 2V7NB 1PYWB 2B2XH 3RU8L 3I6KA 1HCFX 2Y07L 5JIIA 4WW2A 2G5BB 1U8MA 5J6GB 1HOCA 3CX5K 4R90L 2F74A 2QADD 2BSTA 4KC3B 5GGVY 3EJYC 4N8VA 5CINL 3CCHB 5DD6A 4PGJA 1HI6A 5LAXB 4Y4HC 3TIEA 5J13C 5F89B 4ODWB 3EDKA 2A74A 2H2PD 5BS0B 3GI9H 3IDNA 1J0HA 3WS3B 2RB8A 2WIIA 3QUZA 5C09E 1IGYA 2CH8A 1J05B 1DEEB 1MH5B 3OGCA 4YHML 2FL5B 2YD3A 2H3NA 5FYJH 2OTWB 1KPRB 4C83B 4DKEH 4KMTL 1JN6B 1YN7A 5DI8B 3TT1H 2FJFA 5IVNA 3MGOA 1T04A 2BSED 4NDMA 1SY6A 3Q6GL 1N0LA 2GQHA 5IJVA 3JV4A 3AM8A 1EEQA 3A67L 4QXUH 3S96B 4F15B 1QSFD 3MJ9L 2MHAB 5KS9A 4J3OC 3NCMA 4YWGH 1S5IH 5JR1L 3HE6B 1X3DA 2NQCA 5DUBB 3T0AA 1FIEA 4OV6F 2YA0A 4XAKD 2OMBA 9CGTA 3AVEA 1TJGL 3VH8G 1ZA6B 1JFQH 4O51B 1MVUA 4L3EA 1FV1A 4GS7C 1CE6B 2EKSA 1KCRL 3QCUH 2OR9L 1CT8A 3LQAL 4D0DA 2JB6A 1GZPA 1AR1D 2I27N 5I8KL 4QYOA 3FMGH 4P23A 3F12A 2Q20A 2C4XA 3TFKD 5DJ2A 1MI5E 3C5ZB 2P45B 2XKNB 1HHGB 2Q6WA 3RNQA 3EAKA 2EIBA 5ID1A 6CGTA 1K2DB 1U95B 4K7FA 5CP7B 4MMZC 2F8VA 1A1OB 5KG9A 2F5BH 1DUZA 1S7UB 5AZEL 6FABH 1KXTB 3PXJA 3VG0L 3LPWA 4C4KT 1I8KB 4TUKL 4B41A 2MQ0A 5C70A 5F9DC 2D03H 5D2NB 3KYAA 3G5XA 4NQDB 1ED3B 1ZWIA 3HMWL 1FG2A 3NFPB 5KSVB 3QDME 4OJFL 1F3JB 3GBLA 3F7YA 3R8QA 2VXUH 3QRGH 5SWSB 4JLRA 3BEVB 5MI0B 3RL1B 3RWHB 3WO4C 1Q9LB 2IPUK 1ES0B 1I3GL 4NZTH 4L4VD 3BIBX 4J4PC 5EBGA 4NN7C 3D3VE 4K8RL 2ICWJ 4G9FE 4U1KA 1QLRB 2H6PB 3MRJB 5KVGL 1HQRB 4OLYL 3WN5A 5IW6A 3OJMB 5FYKE 3X13B 1HWHB 4U1GB 3ZTJH 5IVOA 3MRKB 4PUBH 4WHTB 1AXTL 1RZIA 1I3UA 2B1AH 5E8DH 2DQJH 1X5FA 2YBRA 3MNWA 3QG7L 5C0BB 1P9MC 4LHUA 4MA7H 3U0TB 1RUAH 2JTDA 5I8EB 1NUDA 2E9WA 1IC5H 4M1CC 4XVJH 1NUGA 5JMRA 2A1WH 5HJ3B 2OJEB 5DFWH 3GB7A 4UAOB 1M6OA 3MODH 1JTTA 3SBWA 5EO1B 3QXWA 4OIIH 4G3YL 5DVLA 4HKBB 2FEDC 1HDMA 3KLAA 5E8NB 1BVKB 3CGTA 1JPGA 1Q94A 4PJ8C 1ZSDA 1B4JH 3O2DH 5C0IB 3KR3H 3WL9B 3MR9B 1L6XA 2O5ZH 4IOFC 3ARVA 5T3ZH 3G5ZB 4WFHE 4WWKC 4LCIL 2EYSB 3O9WA 4ETQA 2WBJC 1XF4A 2GIYA 3SE8H 4F7TA 1A6WH 4XCCH 1JGDB 5E8OA 5T1LD 4WCYL 4QXTB 3W0WE 1CU4L 4ODSL 1INDL 1JGEB 3T65B 5E7FA 4YAQA 3FFDB 3QI9D 1FVCB 3H9SE 3IRPX 3WHXB 2DQUH 3ULUC 1SJHA 2X4RA 4O4YL 4OLXL 3HG1E 3HNTH 2IMMA 5CJXA 1TJHH 2C3WA 4P3WA 4RIRB 2VZ3A 5DEFA 3WD5L 2ARJA 4L3AA 5ERWB 3IU3B 4TQEH 4K9EC 4HG4K 2XWTA 4PB9L 4P3CL 1MIEL 4J8RA 3UYRH 1CZ8L 3TBSB 1ORQB 3KPQB 4AQ1B 4WTWA 3TO4A 2NYYC 2R39A 5IWLC 5GGSA 3L3IB 1BGXH 1WC7A 1FNEA 3LEVL 1L9MA 4LVEA 1M7XA 5D8JL 1HEZB 3G6JB 4MHHG 2OMNA 1FAKT 4W81A 3PE9A 5DS8A 4JFEE 4GRLA 5CCKL 2UWEB 1T6VN 2A6JA 1FZJA 1GZQB 4I48B 3RVTC 3U0WH 3QWRA 4ZQKA 4FA8A 5K9QI 1VFBA 3KDMA 1ZLUH 2V2TA 3L7EA 1A7QH 2MMXA 1QFUH 3S35H 1KXVC 1Q72H 2AKRB 3DTXA 1U8IB 1FGVH 3UJTL 1MCLA 1WQVT 4PP2B 1R3LB 4HC1L 1MVFA 4P3DA 1S7QB 1JI2A 1L0QA 1U8JB 4K2UH 5DRWA 1GCFA 2XNAA 4WEBH 5JZ7C 4L8CA 1EFXB 1QRNB 1KF9B 1AIFB 1JZ8A 3TNMA 4JAMB 3H9HB 2C1PA 3ZL4H 4WI2A 2VR4A 1IGTB 3L5JA 3MZTA 2HLFC 1NDGB 2D9QB 5I2IB 3B9DA 1RZKC 3PP4H 2ZCLL 4XI5D 4JREB 1ZANL 35C8H 3MREA 4IDJH 3TT3L 5HBBA 4OF7A 5ACMA 2DQFA 2K1MA 5IHZB 5EC1A 1JI1A 5A2KH 4UB0L 2XI9A 1U3HD 3FQUA 5F21B 4LLMA 2YA1A 3S4SB 1MJ8H 2HWZH 5C0JB 5IBTH 4N9GB 5EO0B 2Y1VA 5JHDD 5ESQA 4M7KH 5HDQH 2BHYA 5C92A 3PP3H 4NJ9H 3SJVB 5H94B 3KGRA 5MEPA 1OSZA 3FRPG 1JGUH 3MOBL 1H8OA 5HYJE 5JNYB 3QP3A 3RVWD 4WO4D 4YNYA 5B3JF 5JA9A 4NZJA 2HLAA 5TDNA 4WY7L 1TPXC 4XP5H 2XZAL 4EIGB 4JFFD 5D5MB 1IKFL 4LHJB 1CICD 1FZKB 4MX7B 3MUGB 2EH7L 4M62L 5DYOA 4JY4A 1R3JB 5LJYH 3VWJC 3QIWC 2AGJH 5E6ID 3BT2L 2YEZB 2NY7L 5F9WC 1DVFC 2B2XL 3P11H 2L7JA 4M3JA 2DQEH 2W38A 3QO1A 4V2BA 4OFYD 3C8KB 4ZODA 5D7IE 3IS1X 1IJ9A 4JVUA 3QHZH 4L9LC 3QXAB 4KMQA 1T03H 3C6LD 1BM3H 1AJ7H 2VLJD 3FQXA 2QEJA 4OGAD 3DGGA 5C08E 2AJSL 5HHME 3MLZH 3OKEA 4UMGA 3GI9L 3IGAB 3C9NA 4M7LH 4D0CA 3WFEL 3RY6A 1P7HL 1IEBA 1OLZA 2CD0A 3SDDD 4M5YH 4PRPA 5IG7A 2FCBA 1SJXA 1QO3B 4PRIB 5JA8B 4XWGH 2WMPA 5FYJL 1F11B 3OX8A 4DKEL 2V9RA 4JCMA 4MA3A 3ZHDA 3DX6B 1P4IH 4K7PH 3ZYZA 2YSSA 3IJHB 5D1XD 4DUWA 4EJ1C 4D9RD 5LGJB 3GM0A 3GM8A 5LQBH 2VERN 2IPTH 5JOFA 5IFAL 3DVGA 5EFIB 3PWJB 2JJSA 5MHSD 5EU6D 4QXUL 5DFTA 1A7BA 4EVNB 4P57B 4GUPA 4YHOH 2C9AA 1GPOH 3VMPA 4YWGL 2F5AH 1KFAH 1S5IL 2IH3A 2I9LA 2P43B 3DV4A 3S36L 2ZOLB 3BVNB 5F71A 1JFQL 4GG8A 2CKBA 3BO8A 1CFQB 4X6CF 4ZUSA 1DSFL 1DLHB 3QCUL 3ZKSD 3S36X 3VGAB 1CFVH 3B9KD 3WKNA 1G7IA 5C7XH 1AXIB 2J8UF 2B39A 1XR9A 3FMGL 1JHLH 3L3KB 1EZVX 3WJJA 3HZMA 1JZ4A 3VXUE 4R4ND 2XTJB 3ZE1E 1NQBA 2JJUA 4UT7H 4FQ1H 3L95A 5AAMA 5FGRA 2CMRH 1OAZH 4K07A 2F5BL 5DUPH 4QY8A 2QKIA 2YN3A 3FCTB 5MERA 2A6IB 1QTYT 2D03L 2IADB 4AMKH 5ALBL 5HHPA 5FGCE 2XTLA 3KYNA 3RJDA 3OTTA 2VXUL 3LKQB 4YDKH 3QRGL 2PXYA 4EN3B 2ZSVB 2WQ8A 2ESVE 3ILPB 2XXCB 2NLJA 4L8SA 4F2MA 2VSCA 4KRNA 1FFNB 2AQ2A 3LEXB 4NZTL 2CXKA 4GAYA 4HCRL 4RGNE 4G8GB 1EBPA 1F4WH 4NQVA 2JIXB 3QFJE 4XNUH 3GIZH 1KJMB 4D0BA 2BNRB 2ITCA 3KNBB 5IM7A 5IESH 4S2SA 4OCMC 4UT6H 5D93C 5DJXA 2W65B 4MSWA 3G04A 2EEDA 1ZHKB 3QQ4B 5F97E 4PUBL 2BVTA 4NKOB 5L2KE 1IMHC 2B1AL 3PUCA 2DQJL 4G7YH 4WFEE 5HGHA 4IRSD 4MA7L 5CAYB 1RUAL 2D31B 4Y4FA 3UTQB 4NKMA 1B88A 1IC5L 4XVJL 4YR6B 5IBLC 2A1WL 5E94B 4H1LB 4OTXH 1XF3B 1GOHA 1OGAB 4OCLC 4ZUWA 5CBAB 3SPVB 1NKOA 1A1MB 3QNZA 4ZFOA 2MPAH 1G7JA 4OIIL 4P0DA 1IM3A 1QFOA 4CVXB 4LVHC 4F7CA 3CX2A 3WXVH 1KENH 1B4JL 5IK3B 3PGFH 3O2DL 3KR3L 3GSNB 4W70A 1TVDA 2ADGB 2O5ZL 3FJTA 4CAGA 1GSMA 1T0MB 5T3ZL 5JPNA 3W5MA 2PCPA 1SYVB 4YGVA 3QWOB 1GXEA 4XCCL 3TM6A 3RA7H 1R3KA 4GW5B 4IRJB 3LSOA 1HYSD 5H2BB 3VXNA 1AKJB 1RPQA 3QHTC 4H5SB 4LKXB 2CUIA 3QEQA 1MCOH 1U92A 4YZFE 5ALCL 3AXLA 3ETBF 4DVBB 1UH3A 3O2WH 4FFVD 4NO5B 4YK4C 3HNTL 1UWGH 1TJHL 1RVFH 2O26U 4P2RE 4LK4A 2FH6A 2XPGA 3RKDD 3CZJA 4RAVB 3I75B 4PRAB 1U91A 4TQEL 2UZXB 4J3WA 4FFYL 4GMSL 3HE7B 4Z7UE 3BGAA 1IE5A 5E2WH 1S9VA 1BZ9B 2DLIA 5DA4A 4XNMB 4UILH 3MYJA 2HJKB 3QZWG 2CDEB 3MLSH 2FO4A 3IF1B 1BGXL 3DYOA 3IDMA 2BVQB 4H1LH 3RGVC 1BD2E 4M1GH 1IAMA 5DHYB 3QJHA 5EB9A 3SGJC 3VXSD 3QUMA 4Y16B 3FQRB 1BJMA 2PYFB 3VWKA 3U0WL 4X4YA 3VMOA 2XOTA 3MCLH 4UQ2A 1PBYA 4NOFA 1KCUH 1WZKA 1TQBB 5C2BH 1A7QL 3GSNH 3DVFA 3S35L 5KSAA 5EIQA 1Q72L 4GAJH 4X5XB 4MNQD 3FQNB 1FGVL 4KJYB 4L4JA 4TTDD 5E4EC 3OHXA 1VSCA 1R3IH 3X11A 4K2UL 3ARGB 5ESAB 4LCYA 4OLUH 4Z7OE 4WEBL 1I1RA 4Q2ZA 1J9CT 3QCVH 1EEYB 4N5EC 4U3HA 4WU7B 4PLOB 3E6FA 4MNHA 1A3RH 4FTVB 2H26A 3ZL4L 3HRPA 1TJIL 4W4NA 2Z92A 2V7HB 3CSPA 4NQED 3PP4L 5L2JB 1SM3H 2VN7A 3QG6A 4H0GA 1QLFB 1QBAA 5HD8D 1JPSH 3OR7A 3T4YB 4LOUC 4DOHB 2ERJB 1ZXQA 5CBEB 3LKPA 1DJSA 4NQSA 3O3EB 4B53A 2DQHH 4Y5YC 5HYQB 5I30H 4MLIA 1E4KA 1A9EA 2WSKA 1FRGH 1NGXB 1QSZA 1NDMB 1LO5A 3IFOA 1AHWA 1K8IB 4YZFF 4PRBA 8FABB 4NWTH 1U93B 1UXSA 1MJ8L 2HWZL 4JGMA 4KKLC 5GRVL 5IBTL 2DIJA 3JTSB 3BIKA 4M7KL 5HDQL 1IQDB 5B38A 1BP3B 3DIFB 3O4OC 5GGQH 3G9VA 5KSBF 4NJ9L 4P48A 3HTLX 4JFEA 4ZAKC 4Z0BH 3BZEA 2B0SH 3DMMB 1J18A 3OXSA 4Z7UF 3ZYIA 2MFNA 1MOEA 1NL0L 3QXDA 3LH2H 4BKLA 3HMXH 3QUYD 3TVMD 5I16B 2Z4QB 4KU1A 4XP5L 4G5ZH 1R5VB 1XGTB 3DUUA 4FFWC 2QR0A 1FC1A 2NY2D 4EXPX 1UM4H 3ZZ1A 3JWNC 2CR3A 4R0LA 2AGJL 2X6MA 3SEPA 4JM2D 3P11L 3I6KB 2DQEL 4I18C 4WW2B 3N1FC 1QSFE 2ICES 1HOCB 1T5WB 2BSTB 3NIFE 1UWXK 3QHZL 1TVBA 4N8VB 4S1DC 4P59H 3WFDH 2AJYL 1T03L 1TETH 1BM3L 2DM4A 5DD6B 1HI6B 5TF1L 3CFDB 4QCIB 1YUHA 3V6OA 3TJHD 3MLZL 2A74B 2NCMA 4M7LL 3T3MF 4LLQA 4HBCL 1BLNA 4WUUD 2WIIB 3QUZB 4MMXC 4I0CC 4M5YL 3V7MA 1U9KA 2PNDA 3OGCB 4XWGL 4JFZH 2H3NB 4Z7VF 3LQZA 3A6OA 2X1WL 1CTOA 4P46C 1A6PA 1MFEH 5EUKB 5HI3C 1P4IL 4MXVF 3U7WH 4P4KC 4K7PL 3ZSSA 1YN7B 4JG0H 2XYCA 5HYEA 5LQBL 4XP4H 2IPTL 5F7UA 4X6CA 3MGOB 1AGFB 4XMLH 4NDMB 5HYJA 3O3UN 1WV7T 5IJVB 3JV4B 2I9TA 1ACZA 2ED9A 5C6TH 4I8DA 4YHOL 1GPOL 3U36B 5KS9B 2J8UA 4TTGA </