4PJ9A

Structure of human mr1-5-op-ru in complex with human mait traj20 tcr
Total Genus 72
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
72
sequence length
271
structure length
262
Chain Sequence
b'MRTHSLRYFRLGVSDPIHGVPEFISVGYVDSHPITTYDSVTRQKEPRAPWMAENLAPDHWERYTQLLRGWQQMFKVELKRLQRHYNHSGSHTYQRMIGCELLEDGSTTGFLQYAYDGQDFLIFNKDTLSWLAVDNVAHTIKQAWEANQHELLYQKNWLEEECIAWLKRFLEYGKDTLQRTEPPLVRVNRKGVTALFCKAHGFYPPEIYMTWMKNGEEIVQEIDYGDILPSGDGTYQAWASIELNLYSCHVEHSGVHMVLQVP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Major histocompatibility complex class I-related gene protei
publication title A molecular basis underpinning the T cell receptor heterogeneity of mucosal-associated invariant T cells.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
total genus 72
structure length 262
sequence length 271
ec nomenclature
pdb deposition date 2014-05-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00129 MHC_I Class I Histocompatibility antigen, domains alpha 1 and 2
A PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4pj9A02
3.30.500.10 Alpha Beta 2-Layer Sandwich Murine Class I Major Histocompatibility Complex, H2-DB; Chain A, domain 1 MHC class I-like antigen recognition-like 4pj9A01
2H2SD 3FN0L 1D9KA 5BOPA 3HMXL 5F96H 2JCCE 3LDBC 3ARRA 5BV7L 3T0EB 4PJ7A 4OAWB 1BX2B 3JBG7 4G7YH 2BFVL 4JRXA 3U4BL 3OV6A 3QEHB 5ADOH 5INDB 1ZLSL 1PYWA 5IEHB 3OXRA 5DLML 4DKEL 5SWQA 3OKMB 3OR6B 1MHEA 4QO1A 5KOVC 5IW1B 2IH3B 1NLBL 4WCYL 5D2LE 5DJAA 4UAOC 3FQUB 4FQQA 1H3UA 1Q0YL 3QUZD 3VCLB 3VFGL 4DGYL 4Y4HA 4HIIA 3F7VA 4MXWL 1YEGH 1MFEH 3RWEB 3B9KB 1YUHB 1DLHB 3NCBB 3SE9H 1HWGB 1FG9C 1YY8A 2ILLA 5I74B 4P5TB 1QBMH 2Z4QA 2FH6A 5GRUL 2F58H 3WXVH 4JB9L 3PDOA 2WANA 1Z5LA 2ZOKB 2X4UB 5DTFA 5GIRB 1KUMA 1RZGA 5GRYA 3MLRH 4KTEL 4APQC 3UJJL 4JQXC 2GAZB 3C8KB 1FIGH 1B0GB 4PJAA 2V7HA 2J8UE 3PWVA 3H2WA 5ISZD 3RWJB 3L6FA 3TIDA 4KZDL 4JFPA 1ORSB 4LCYA 1YMMB 3QDAA 2QQNL 3RJQB 1OCWL 4U6VL 4Y5XB 4EOWL 1IC1A 2A6JB 4GUPB 2GHWB 4TTDC 3L3HA 3TNNB 3ULUE 1HSBB 5EBWB 3I6KB 3FFDA 4G42A 3C6SB 4ZUTB 3CC5A 3G5VB 4YHZH 4OZFB 3DOSA 3ARGB 1BFVH 2OTUA 4MDIA 2HKFL 5TDOA 1SQ2N 2H9GB 4PP8C 3BGFB 4EN3A 1NC4D 1UEYA 2CO7B 3VDBA 5GJSH 3Q3GA 5FDYA 1FVEB 5E99H 1N5YH 2ZOLB 2DN7A 3D3VB 4O4YH 1DN0A 3JTTB 5ITFB 1GOHA 5E70A 1KCVH 3SKJH 1NANH 1X9QA 1A1NB 1Z0NA 2EIZB 1IAOA 3PP4H 3E3QE 5D1ZC 2HKHH 4BZ1L 4OT1H 1LE9A 4P4KD 4FFYL 4L4VD 1WBYB 3IXAB 5F93C 1QRNA 1U58B 2RHEA 4J1UA 4FZ8H 4QXGH 1J11A 1GAFL 1TZIB 2VAJA 4KH2A 4OQ1A 2GSIB 5LQBL 2X05A 3TBSA 4Y1AE 5I0DA 3QBTB 1EXUB 4LSRH 2DM7A 3D6GA 1M4KA 1UENA 4YEFA 2O5YH 4YUEL 5TGBB 4OGYH 3GGWB 1ZWIA 7CGTA 1S9WA 3EUUA 3F7RA 3MV7D 1WAAF 4HEPG 4M7ZC 4N0RA 5F7UA 3TT1L 2QQLL 4X4MA 3TN0A 5HHPA 2Q76B 5FUCC 1FFQA 1A4KB 4Y5VB 1T5XB 1ADQH 1HEZA 3IRZA 4LHQB 3P0YH 1XZ0A 1KJ2H 5DQJB 3QDGE 2QQKH 1PZUB 3RUGA 3SE8L 4JM4H 3WLBB 4RGNE 4FQLH 3TZVA 3U46B 4L8SC 3KXFB 4L4TA 1CDHA 2DQIL 3KPRA 4JRWA 4XNZB 1RY7B 5GXBB 4JFEB 3HNTH 4DN3H 1CLZL 3UJIH 3HKFA 2IH1B 1S9VB 5GZOC 1FYHB 1G6RH 1HHKB 1A6ZB 1T7VA 2AJVH 2LE9A 1IM3B 2B4CL 1FFRA 3TPUA 2NTFB 4LVHB 1NC2A 1A14H 2FH8A 1ZS8A 1XF2A 2XA8H 3CLFL 1A7NH 4U31A 1Q94B 2DBLH 4RZCB 5GGUB 5SX5K 4KDVA 4JKPH 4RMSA 5JHDB 2CUMA 3L5WB 5DURB 5TFSL 2YD4A 5E8OA 4L9LC 1AXSA 3C2AL 1NUDA 4M93C 1FZMB 2R4SH 5D71H 2GTWB 2PYFA 2I26N 2DMCA 2WSKA 4EI6A 3O9WD 3BWAB 4HWZB 3TVMD 2DM4A 1YECH 3QIBA 5CCKH 1OB1B 1ZT4B 2WUBH 1RVFH 1INDH 2APVA 4DFHA 3MRFA 3OF6D 1U3ZA 1DBAL 3KYMA 5D9SA 1W0WA 3TO4C 2IQAB 3QEQB 5ACLA 2J4WL 3FQWB 3L3OB 4JQVA 5KANG 2AJUL 4POZC 4GBXC 2RQ8A 3QRGL 6FABL 2CRIA 1X6LA 4RNRB 4PJEB 2Y07L 1SYSA 4MCYA 5DRXB 1UXWA 1WTGT 5A16B 3F6IA 2XQBL 1A6PA 1UJ3A 3RWGB 3RY6A 3WXWH 2PW2A 4PRHA 1K4CA 4NO2B 1HIML 3MV11 2CQVA 5DHVA 4MA7L 4QXUL 2BVYA 4FQ2L 1AKJB 5F71A 1A6WH 1WAAE 4G6FB 2P48B 2GJ6A 4JY4B 2DKUA 4ODWA 4YIQA 4CN6A 1CD0A 3U36A 2EO9A 1FAIH 1FCCA 2HJFA 5GGTL 3H9YA 5SX4H 4GQ9H 4M03A 5CAYB 4Z7UB 3FMGH 1MWAA 3BE1H 5B39A 3BKYH 3SY0B 5EZOL 3SGKC 3V52L 1U3HB 1T22A 1ZEAL 1S7QA 4WRLA 3D0LA 5SWSA 4WTZG 3WHXB 2R0KH 4NKMB 1OGAA 1NCAH 1FO0B 4OGAD 4EQ2A 2JB6A 1T3FA 2GW5A 1MY5A 4RFOH 5D96B 2ICWI 4NC0B 2YN3A 5CINL 4YBLB 3Q6GH 4OLVL 4R7DB 3WHE0 3DO7A 4M4PA 3WCYA 3JTCA 5I1GL 2JCCB 3DO3A 1MAMH 1LO3L 4U6YA 4I77L 4LEXL 3CVHH 4PJBA 3IFOA 3DI3B 2NX5E 5LGJA 3GBML 2Z0BA 3IDYB 2X4PB 4QRTB 3MNZB 4KQ3H 5C0EB 3CSYA 8FABA 4CBPA 3JWDL 3MYJB 1MLBA 5D93C 1KLFA 4C59B 5MEQA 3LPGA 3JWOC 4MMXC 4PLNC 1HNGA 3RNQB 4NQDD 1KF9B 4N0YH 2OS7A 1D9KC 5FYJE 4EXPX 4M1DL 1JZ3A 2R15A 3LRSB 4Y16C 5CWSB 4HAFA 1CDCA 3AAZB 5F89A 3QEGL 2R8SL 5JOPE 4N90E 4PRPE 1U8LB 5FGSA 4KKBC 3FONB 1HHHA 1T1XA 3LIZH 1EFXB 1YEHL 4F8TA 1IQWL 4PG2A 3WV0A 3KNBB 1RK0A 2Q8AL 2EC9U 1JL8A 3WIHA 4S2SB 3C2SA 2I5YL 3IDUA 3QH3A 4PRBA 4XHJC 5EWIH 4M7KL 2W0FA 5FM8A 1T4KA 4IOFC 4AQOA 3JV5A 3RPKA 4V1DA 4YXHL 2J8UB 4LLYA 4Y4HC 5FA4B 4G9DB 1G7MB 4HS3A 2EKSB 2LV4A 3LKSB 3QCVH 3FAXA 1KIPA 2DQJH 1G7IA 2KUTA 2XWJB 3LOWA 3HRZB 1QSFE 5T33H 4PJIA 4TULL 1RJYA 4KU1A 5D7LE 1SJEB 2AERT 3MV8E 4N9OB 3DSNA 1EZVX 5HHVH 3RHWK 1CL7L 4ZXBD 4AEIH 1QEWA 4QEGA 4X5XB 3V6OE 1GXEA 3TLRA 2FJHB 3QO1B 1SMAA 1IGML 3FTGB 3NGBC 3FQRA 4DK3A 5HY9A 4OCYH 5DI8A 2BSSB 2F53A 3GSRB 5C09E 1DL7H 1SM3H 2VR4A 2V17L 1FE8H 4YDIH 5EH1A 4JFFE 1IGYA 3QIUD 4NZDA 4WTZA 3EYUH 3WNOA 4ZUVA 1BJ1J 4EN3C 5IESL 3U0PA 4M4RA 1QLRB 3CFJA 1VFAA 1T04B 3C09C 4OZHA 5AD0B 3LSOB 1QFWI 5E95B 3QNXB 4LCIH 3O3AB 4OZGA 2OJZL 1RQ5A 1JBJA 3SKMB 1U8NB 1DEEB 4Y1AB 3L3JA 1FFPA 3BX7C 4LLUB 3M8OH 2B39A 2D7NA 4P9HH 3OKDB 4OGZA 4ZNEE 1W2KT 3LQAL 3V6FA 5EO9B 4HD9A 2CKBB 32C2B 5F8RC 1YEJL 3SJVE 5FOBA 3D25B 4OLYL 3T4YB 5EOCH 3HMXA 2ICEA 1LEGB 1RUPH 5KG9B 2DQDH 2P8PA 3CFDA 4F37F 2XT1B 2VZTA 4R8WH 4LLQB 1A7QL 3CCHA 3QDGB 4NC1E 5DA4A 3GO1H 1NCTA 1AFVL 3DBXA 3S36X 3FQXB 4HDIA 3QJFA 1LP9F 4RGNB 1RZJH 3SKNA 3LPFA 3O41B 1GGCL 2WWMC 2XN9A 3GSUB 1S7TA 1EV2E 4G8IB 3QRFM 3BPCB 5D2NE 3ULVF 8CGTA 2RAMA 5JNYB 3TN0C 1B0RB 4GQPH 3UBXI 1BZQK 4OD3L 3KLHD 2V2WB 2C4XA 1MFDH 2A9ML 4OD1L 1ACZA 2OBGA 3TYGH 1HWHB 1M1SA 3HUJA 1WFOA 5L6YH 1UWGH 4TPRL 5MHSE 3HI6L 4HWEL 4FQHA 3KJ6L 2A83B 4MNQE 1T1WB 3S37H 5GS1B 1LO2L 1QKZH 5J3HD 4GXUM 3S8WA 2NY4D 3B2VL 3OZ9L 5E8PA 2PXYD 5F7DB 2VH5L 1FVCB 1OTTC 2P24B 3WS6A 3I6LD 3S97C 1JFQL 1MOEA 4IJ3B 4P4KA 1ED3B 3T8XA 4CADB 3RWDB 3AREB 3BDYL 3ZDZE 5LKNA 2K1MA 4QNPF 1A9EB 3H9HB 1IGTB 4AM0B 3FHQA 1A3QA 2PO6D 5HYJE 4F57H 2CLRA 1N8ZB 1YYML 1GL4B 1JI1A 3MJ6A 1JCKA 1MF2H 2C9AA 1RIHH 3UJTH 5EC1A 3PJSB 5IOPA 1MCNA 4ONHB 3W82A 5IV2B 5AAWA 4BH7B 3EBAA 4O51A 3QQ3B 3QDHA 4JCLA 4DGVH 2HFTA 2ADGA 3H0TA 2DQEH 2QSCH 3PP3H 4RISL 5M7QA 4N8VB 4Y4KB 3OJ2C 4JQVC 4R7NB 5EFIB 5LBSH 4QWWC 5D1QA 3RGVD 5C9KA 5J1AB 1FFNA 4FABL 1UJ3C 2VXSL 2ESVA 3RY6C 2NY6B 3F12B 4D9QE 1ZSDA 1EO5A 5T1DH 1MH5A 4XP5L 3RA7H 3OSKA 5D8JL 2EH7L 4QY8A 3UO1H 2GITB 5GQBA 4J3XA 1FL6B 1LP9E 5DVMA 2DQCH 5I8OH 1CGWA 1YNKH 3E8UH 1UA6H 2NY0B 3T0BA 4NKIH 3L95A 5DJCB 1MQKL 3ULVE 5F1IA 2YKLH 1GIGL 1VEPA 3ABZA 5E5RB 4OZFG 1CICD 3S6CA 4HT1H 4K3JL 1NUGA 2WBWB 2CIIA 1NUNB 4XZUB 4F8QA 1P84J 1C1EH 4NRZA 3ARBB 5DJ6B 4LNVA 2VAAA 4LSQL 3GB7B 4XB8A 5C6TH 5GS0H 1KCUL 5C0ND 2AW2A 3EYVA 3GK8L 4JN1H 1JPGA 4OZ4A 1CS6A 4I18A 1AE6L 1OAQH 1GC1C 4R90L 3OAUL 3F5WB 4NZRH 2WP3T 2G60H 4LFHD 3NVQA 1ONQA 3SKOB 2FEDC 1MREL 3BQUD 5C0DB 4JGMA 2HA1A 5CP3H 2OP4L 4U49A 4K7PX 3S4SB 4QNPE 3T0EA 2OX5A 5C08B 1BX2A 3W2DL 2QADC 2XZZA 1A6VH 2E6JA 4F58L 3ILPB 4ISVB 3FO1B 4PRPB 4AIZA 3K74B 3EOAB 5INDA 4CL7A 3MNWA 4TSCL 2VQUA 4L4VE 4TNWF 25C8L 1CXHA 2KPNA 3O11B 3OKMA 5I16B 3OR6A 3QFJE 5I30L 3EOYG 1IGIH 1CK0H 3GI8H 1QHOA 3BZFB 4NHCL 5J11B 4M7LT 4L5FH 4G7VL 4MMZC 3ZKXC 3SGEI 5I71B 4TVPE 5F1SA 3TBWB 3UTTE 3DVIA 4JPWL 4NFDA 4MNGE 5B8CA 3VCLA 4HS8H 1F97A 1AGEA 2OL3B 3QHFL 2ZZUT 1MFAL 3MODL 5E5UB 3B9KA 1DLHA 4PLJD 1DQML 1JPFA 4HUVB 3DUSA 3ARUA 2CPCA 2X40A 3P0GB 4KVNH 2E7CA 4P5TA 2BVOB 4X99A 1K8IA 1LO4H 3VRIB 2ZOKA 5E5MB 1G9NL 2VXQL 5GIRA 1A47A 1QSFB 1CLOH 5D7LB 1D6EB 1DBKL 5IB5B 1X5YA 3I85A 3O6KH 2Y36H 2GAZA 3C8KA 3MV8B 2NY1D 4H25B 3EDEA 4NNXB 1DQTA 5C2BH 2D7OA 1ORSA 3HI1A 2YD3A 5JTWA 2CR6A 4Q0XH 3F65A 5ETUB 2DWEA 2EEBA 2X4RB 4KC3B 5FCSH 1CN4A 5JPMB 1TCRB 4CN4A 5GGSB 2B1AH 1UXSA 5FHBH 4OF7A 3RVXC 4YHPB 4Y5XA 1RSFA 4ZUSB 2C3HA 1TENA 3CLEH 3TNNA 4YO0B 3HC3H 1DVFB 5T5FL 5C09B 2GEEA 1U2HA 4V3EB 3EYFA 4UT9H 1U0QA 4MD4B 1BVKA 5IGXH 5CFHA 4TRPL 3S36L 5ALCH 2FRGP 2UZIH 3ARGA 4WU5B 4NFBA 1A6TB 4UU9A 5H2BB 5FXCH 5DC9B 1S7WA 3V4VH 1YN7B 4FRWA 4L29B 1FVEA 3EYSH 3FJTA 5DR5L 4KI5E 3MRRA 2IBZY 2PYED 2XPGB 2WV3A 3D3VA 4YHNA 4ZDHB 5TQ2H 4OGXH 3K81A 4QTIH 4BSJA 5LWYL 1S3KH 3UAJC 1FL3B 1NSNL 3D18B 3DX8B 4P2RE 2EIZA 1UM5H 2MPAH 1IEAB 4NNPL 1S7UB 1EIBA 2EXWD 5DUMH 2BOCB 4RFEB 4GFTB 4PP2A 1WBYA 1U91B 4Y4FB 4LRNH 3MXWH 3L5HA 1ACYH 3PWPD 4K3GA 1TZIA 3A67H 1DBBL 5HVHC 2EO1A 2VLKD 4X7SH 4LVOC 3AS2A 2X2YA 1EXUA 5J89A 5IIEA 3BP5A 4LHUD 3EJYC 5JR1L 5I1EL 1WGOA 2FJGB 4FFZH 4LOUD 4M8QB 5TGBA 1MCPL 1WZKA 3GGWA 4XVJH 3WNMA 4Z7VF 2DRUA 5K9OB 5F1NA 5D2NB 4ZMAT 2VDRH 1NCNA 2B2XL 2JIXD 2VLLB 3LEXB 4POUB 5B4MC 2Q76A 3RKPA 1WEJL 3K7UA 2EDEA 2X4QB 1A4KA 2BNQE 1T5XA 1WV7T 4PG9B 4PV9B 4FA8A 5DQJA 5I6XB 1J88A 1U92A 2A2QT 3WLBA 3K0WA 4KHTH 1JRHL 1UACH 3VGHA 3U46A 2DTSA 2LABA 2EDKA 1OOAA 3KXFA 5DEZA 5DGRA 1EERB 4WJ5B 5F7HA 4JFEA 3LQZA 5L9DL 2Q87A 4P2OD 3VG9C 4MXQD 1SYVA 4QLRA 4MNQB 4BM7A 4WDIB 1NGPH 5J0BA 4TSAH 1HHKA 2IALB 1GVIA 4R2GD 1IM3A 1T83A 2NTFA 1DR9A 1PY4A 1GGIH 2F74A 2BC4A 1Q94A 1C5CL 5D7JD 4I3SL 4N0FB 1M6OB 1QZ1A 4HK3J 5JHDA 3SE4A 5HYJB 1K3ZA 4R26H 1FGNH 5F96L 4S0TD 5AUMB 4G43A 3FZUC 2EE3A 4P23B 1UGNA 1T7XA 3WS6C 3EFDH 4NQDE 2UV3A 3O6FD 1VFBB 4I3GA 4PGCA 2VZVA 3UTPD 2GTWA 1TPXB 4G7YL 2FB4H 3BWAA 3FOLB 5TPWH 2NQCA 1G6RB 1SY6H 3T04D 2I07B 1ZT4A 5IW6B 4E5XB 4OJFH 2ZJSH 5J56B 4P49A 4LSDA 1A5FL 2IQAA 1CTNA 3QEQA 3RDTA 1J8HE 5C7XH 3FQWA 3L3OA 3LN9A 1K5NB 4NOBA 3L3KA 5IJVB 1I3GH 2VL5B 3H3BC 1ZT1B 4RNRA 1KB9K 3A6BH 4Z7WF 1F45A 1B4JH 2VB5A 1VACB 2VC2H 1DANT 4UBDD 4DK6A 4YDKH 3EHBD 3R8BB 4B7LA 1LE5A 4HFUL 1YEGL 4BSVA 5C86A 1MFEL 4M9OA 1LP9B 3BH8B 3Q2CA 1AKJA 4X5WB 5EBLA 3SE9L 3K4DA 1VERA 2V5TA 4FQCH 2P8LA 4A6YB 4JY4A 3T2NH 1QBML 5D1QC 3QHZL 2F58L 3WXVL 3VA6A 1WFUA 3DTXB 3MLRL 4HWBH 1MIEH 4NUJA 4PGDA 2VLMD 1FIGL 3MLXL 3VXME 5DRZA 2IPUG 2WLZA 1D5BB 3BHBA 4Z7UA 1LWRA 5ESQA 3DVNB 4J8RB 5EUOE 2PXYA 4I0PB 1U3HA 4YXLH 4JDVA 1AO7A 3DX9B 4X7EC 2NXZC 2DQTH 1MCWW 4ZSOA 4CVWA 4NKMA 1FO0A 1UWEH 1X5AA 3ESUF 3FT4B 4R4ND 5EA0H 1CCZA 2O61B 1NC4B 1F6AB 2R9HC 3KS0J 4NCDA 2ADJB 2FYYA 3MJ8B 4DFIA 4KWUA 4R7DA 1QSEE 4PD4J 2QHLA 2P5EE 1BFVL 1UKTA 4CJ0A 2EDQA 4AMKH 2DLTA 2HYMA 5GJSL 3T4AB 2X4PA 4QRTA 3MNZA 4I18C 3FHAA 5E99L 3MYJA 1JHLH 1N5YL 3GJFB 1II4E 4L4VB 1DDHB 4O4YL 2GJJA 4X4YB 5SWZE 3HB3D 3MRLB 2H32H 3QFJB 3SKJL 3QXTA 3PP4L 5CWSA 2HKHL 1T1ZA 3NPSB 3T0EC 5D2LA 1ITBB 3BEVB 2ZUTA 3UTTB 1U8LA 4MNGB 3FONA 4QXGL 1MFBL 3M17B 1KB5L 1G9ML 1S7XA 1EFXA 3STZB 4ERSL 3QCTH 3MRCA 2P43B 3K8MA 1MAKA 1XAUA 4Z7WE 3KNBA 2AV1A 2O5YL 5L8KB 3I3BA 3QI9D 5DS8A 1W72H 3WLWD 1CFTA 1BJMA 1CG9A 4KUZH 3B2UD 3TFKD 5B8CC 2D7PA 2VABA 3VGGA 1LO0H 2GT9B 4IMKA 4PRIE 3P0YL 4WUUE 3IF1A 5FA4A 1KJ2L 4CRPA 4U1IB 3B9KC 1G7MA 2QQKL 2Q6WB 3H42L 4JM4L 4P5TC 2VLRA 3LKSA 4W70A 1DP0A 1MUJB 2XWJA 1S7SA 4OF5A 2C4FT 3GSNH 3HRZA 5CZVH 1XF1A 2E27H 4DN3L 1QA9A 3K80A 4NUGH 4MAYB 1KSRA 1FZJB 1LQVA 3HE6D 4C4KO 2R2CA 1IZJA 3LPWA 2AJVL 5CGMA 2A0LD 4XMKH 4WFGE 3WN5B 1A14L 4X5XA 2LFGA 1FAKT 4G3YH 1A7NL 4JEGB 4Y5XC 3TNMB 2AXJA 4OCLC 4OV5A 1ETZB 5IG7B 2DBLL 2BSSA 4YHLH 5DO2D 4WFFD 4RA3A 1IE5A 1BWWA 5ANME 1I9IH 4JKPL 2ZUWA 3Q1SL 1J0IA 4OFYA 3O9WB 1G0YR 2Q86B 3TVMB 4PJ8A 3D39D 3JSSA 4R97B 3ARGC 1R3LB 5D71L 3FQTA 4P2RB 3RQ3A 3BGFC 3E3QA 2D2OA 1BEYH 4NO5B 5IBLD 4N8VG 1IAIM 1T04A 5AD0A 3QNXA 4L8CB 3O3AA 1YECL 2R1XB 5FECB 5KAQG 1FPTH 3GIZH 3MJ7B 2BHYA 3SKMA 2QR0A 1E27A 1INDL 1RVFL 3MJ9H 1DEEA 1Q72H 2PW1B 2KBGA 1QYGL 4NT6B 4LLUA 1UJTA 3VFVB 3IKCB 3Q0HA 4G9FE 5BMFH 3OKDA 2K7QA 4HS6B 3IJHB 5EO9A 3GKZA 3IDIA 2X7LA 4GKZA 4HC1A 1H3WM 3WXWL 3T4YA 5L0QB 5EZIH 2E7BA 1LEGA 4X6EA 5KG9A 4OI8A 2BNQB 4GG8B 5T1MA 1WTLA 5F7WC 4JPIB 3QUXD 2VKXA 2ZG2A 3S37X 3QDGA 2Z8RA 2D7QA 3E6FB 1FAIL 4XVTH 3JWNC 2R1WA 3QISA 3SKUD 3BPCA 1NMAH 2E6QA 3FRUB 4HHAB 5JNYA 3RFZC 4GQ9L 1B0RA 4DW2L 4I9WD 4LKXB 1LK2B 4YAQB 2V2WA 1V3KA 1X7QA 3FMGL 3BE1L 5HSFA 2YD2A 3BKYL 1UVQA 5EU7E 5EU4B 4ZUUB 3C5ZB 2R0KL 1IC7H 2WUCL 2X70A 3S4SG 2RIKA 3NFSL 4RFOL 4X98A 1IAKB 1LGVA 1FSKB 3PV6B 4HKJB 1QO3B 1X5GA 2A83A 1T1WA 1WIUA 5GS1A 5CBEB 5DD0H 2XA3A 5F7DA 1MAML 4CDHA 3VI4F 5E6ZA 3ME0A 3CVHL 4JPVL 4NQDB 3VXNB 1QFHA 4B7IA 4X9IA 3RWDA 3AREA 3LB6D 5EO1A 5C0RL 3BDXA 3ARFD 3OTTA 3RGHA 3LKNB 2YUXA 1A9EA 1ND0A 1IGTA 3H9HA 1RUML 5BRZD 1B3JA 4MB4A 3PWPA 4HJJL 4KKCC 2Y6SD 1CGSH 1HQRB 3SE4C 3VWJB 1ORQB 5CGTA 2VLKA 4EI5D 5I73B 1N8ZA 1J8HB 5KVFH 2P45B 4WY7L 1LEIB 1L8JA 3OKEB 2P1YA 3PJSA 2JJUA 3RL1B 3OHXB 1AGCA 5IV2A 1FLRH 3AY4A 1UKSA 2VWEC 4BH7A 4NWTH 1Q1JH 1BM3L 1ITCA 1CE1H 3LIZL 2FNBA 1U93A 3PG2A 2CGRL 2HJKB 3QQ3A 2A77L 5HGGS 1PEZA 3RDTC 4Z18A 4AIXA 1LNUB 4N8VA 4H1LB 4Z7VB 4QHLA 5EFIA 3O45B 3ARTA 5MEOB 4Y89A 1G0DA 4KK5D 2GK2A 5I1JL 4IOIB 5EWIL 5I66A 4X7TB 5T1KA 3F12A 1MEXH 1TVHA 4DTGL 2CD0A 2X1PA 4PJ5E 3VMPA 3IFPA 1AP2A 3VXMB 2GITA 2COQA 3QXDA 5BVPH 3U82B 4KK8D 2HFEB 3DGGA 1T5WB 4XAKD 3DNKA 1WUNT 3QCVL 2YD5A 2GKIA 4YFEA 1VKXA 5T33L 1GZPB 3DVGB 4ENED 4M61B 1UM4L 4XZUA 2IPUK 5DRNB 1KBGH 3ARBA 2PTUA 5HHVL 4AEIL 3LQAC 1QSEB 5FOJA 2P5EB 3NIGF 2V9TA 3RX5A 1U3HC 2NXYC 3O6FA 2NX5A 4HEME 3QIUB 2XQYK 3MZGB 3VWKB 1J0JA 4OCYL 1MRDH 2P42B 2FSEB 2X41A 1FNLA 3FB8A 1DL7L 1SM3L 4WI3A 4EDWH 1I1FB 3F5WA 3VI4E 1FE8L 4YDIL 4YBLC 1OARH 5SWZB 3RAJH 1CLYH 4ZFOL 1BVLA 2IAMD 3CFKB 4HIEB 5C0DA 3SKOA 3EYUL 4AG4L 3LEYL 4PRDB 3S4SA 2RJMA 4G8FB 1INQB 3BO8B 3CX5J 4G6MH 4LCIL 3ZSTA 5IB1B 3JVGA 3FO1A 4PRPA 4O2CB 4YBQD 2W65B 5KSBA 4X80H 1IC4H 2W0PA 3OKOA 3O11A 4O2EB 5CLWA 1F3RB 3M8OL 2VZOA 4Z7WB 2R29L 4QKXB 4P9HL 3QUML 3BZFA 1JYWA 1PD6A 4F3FA 1RZKC 3RX7A 5JIPA 5EUKB 1EUTA 3OJDA 5HDLA 2WINA 3L3IA 5KW9H 2ZSVB 4RAUB 5DZNA 1F4WL 5CMAB 5IT2H 2W60B 5EOCL 1RUPL 4BQ6A 4Y7MA 1NDGB 4YHKH 4PRIB 2VZ3A 2PKDA 4WUUB 1LVEA 4HGKC 2EECA 4R8WL 1LD9A 5JDJA 4HUVA 3UTSD 4S1QH 1IC5H 3BP7B 3NIFF 3EJZC 3QXUA 1GZQA 4ZOEA 4XI5D 1RZJL 4Y2DD 1C5BH 3VRIA 4MHHI 1ZLWH 1S5HA 1QSFA 4N0CD 5CIPB 3VFTA 1D6EA 4KTYA 2A6IA 3MUHL 1Q9KB 4IMKC 4C56D 4NNXA 2DQUH 2IQ9H 4ZPTB 2EH8H 3BGMB 5AYUH 1MFDL 4UMGA 4K7PY 1C12B 3GKWH 3TYGL 2OTWB 4DUXA 1TCRA 2BNRA 2NY4B 5GGSA 3V6OA 2M26A 5L6YL 3CFEB 1UWGL 4WTWA 4YHPA 2BVEA 5HHXH 4DWHA 1ZVYA 4IDJL 2YD6A 3ORJA 5GSVA 2F8XC 3P4LA 3VXPA 5C09A 5ANMB 4B5EA 3NIGE 3ULUC 2ATPA 1CIUA 3F8UB 3S37L 1QKZL 4I2XB 4KKAC 4JFFA 4WU5A 3U7YH 1OSZB 1A7PH 2VXUH 12E8H 2R39A 2Y1VA 5H2BA 2JKXA 3GMQB 3QXAA 1MVUB 1NBYB 2WIIA 4AEEA 1XR8B 5IMLB 5E7BA 4U4BA 2BXZA 3GRWH 1OF2B 3UTPE 1CDYA 3REVA 2XPGA 4ORZC 4QRUB 2OYPA 1WT5A 5F88A 4ZDHA 5CEZH 1HSAA 2MHAA 2DI9A 4V3DB 4PJ8C 3V0VA 5L88H 5GISL 3KLAB 1MRCH 1CGUA 3D18A 1MF2L 3JWOH 1CQKA 4ZNEA 4LBEB 1RIHL 3E3QC 1IEAA 5CJQH 2AK4E 5D7IF 1U91A 1NEUA 4RIRA 4Y4FA 2C3GA 3SJVA 3VE0B 1KEGH 5HDOA 2GCYB 1J5OL 3VFMB 5HGDA 4DGVL 4O2FA 3PL6B 3O4LD 3SDXE 5LBSL 5I1DB 5D7KE 3O3UN 4XPFH 5ACZA 1TZGH 1I1AA 1F3JB 3G6JF 3IKKA 4JFDE 1TJHH 1CDGA 5T1DL 3LEXA 2VLLA 1CICB 5IMKB 3NIFE 3UO1L 4ZS7H 4MDJB 3MPCA 4E9LA 2DQCL 1YNKL 1RD6A 4PG9A 5E7FA 2J1KA 1UA6L 3TO2B 4NKIL 2DLGA 5IB2B 2YKLL 5KJRL 1CFSA 3OMZA 3KHQA 4PJ9D 4JO2H 1JMZA 2ZG1A 4HT1L 5E0QA 1S8DA 1WICA 5D6CB 4ODTL 4WJ5A 1C1EL 5ALBH 1U6AH 1ES0A 3IU4H 4JY5H 4LDOB 2ZKHH 2CIKB 5C6TL 3RBSA 2DDQL 2R2BB 2BK8A 2IALA 3ARVA 1B90A 3RVVC 4FTVE 3VXUA 2OZ4A 3WFHB 2W91A 1JNNH 3TJEL 2G5BA 3BQUB 5AAMA 3MROB 4HUWB 1ADQA 1OAQL 2YOCA 1KJ2A 4KFZC 5HI4D 5FO8B 4NZRL 4N0FA 1MJ8H 1GGTA 1TVDA 1I8LA 1M6OA 2G60L 5GS1C 3CMOL 5HYJA 5AUMA 3ELAT 1G9NC 4P23A 1IFHH 2A6KA 4WHTA 1K9TA 2WBJA 4LPTA 3VGFA 1EHAA 1GGYA 1A6VL 4IJ3C 4WHYH 2NY5C 1QOKA 3AREC 2VXVH 1J87A 3FOLA 4F7EA 1G6RA 2IGFH 1OGTA 4NZUH 2I07A 5IW6A 4FQIH 1DSFH 4E5XA 1HINH 3S96A 1OWWA 4NOFA 4WENB 1CK0L 3ZKMC 4DEPB 4HPOH 5D7IE 4QHNB 5IFAH 4YPGB 4L5FL 4NPYB 3MNVB 4OUUA 3VXSD 1GCFA 1ZT1A 2EYRB 2PF6A 5CLTA 4FQXD 1LHZA 4ZQKB 2VQ1B 1FNAA 2NTSP 3AY4C 3MLUH 4HS8L 5DYOB 5CJOH 2XKNA 5K59E 4PLOB 4XNQB 1RJCA 4PJ5B 4P5KA 3ZT6A 3QA3B 4OFPA 1MCCA 3GSOA 3BH8A 4NGHH 4Y4KC 3U9UA 2NY1B 1WZMA 3NFPB 4XB7A 3T3ME 1LO4L 5C0BA 3BSZL 1J86A 3D85D 5DA0B 1CLOL 4I5BB 2NY6C 3O6KL 3B5GA 3RZCB 2Y36L 5ESAB 1H9VA 3GJEA 5C2BL 1D5BA 5EPMB 2ED9A 5HHMD 2H2PC 1EJ6A 4Q0XL 4D94A 4GSDL 3DVNA 3H3KA 4J8RA 3C5JA 1VADA 4I0PA 1ZOXA 1I8IA 2B1AL 5DFVD 3DX9A 2QTEA 3HC3L 3QWRD 3LS5H 2O61A 1F6AA 4HIHB 3ARBC 4I8DA 2DQFA 2V5RA 2ADJA 5BRZA 4F33B 1KENH 3MJ8A 2UZIL 4PY7B 4AH2B 3P4NB 1G6VK 3EYSL 3B8YA 2VDPH 5AZEH 4H0GA 2MNUA 3GJFA 1DDHA 5TQ2L 4E42B 4QTIL 2VZUA 2ZSWB 3CXHJ 1ZV5A 4X4YA 1S3KL 2HT3C 3SDCD 2NZ9C 3RVWD 2HLFD 3QFJA 4GRWF 2HJLA 3MREA 2O5ZH 1UM5L 2MPAL 5DDHA 4KRMB 5DUML 3T08A 4U1HB 1FDLH 4BSWB 1FGVH 4G6KH 4XVUC 3JVGC 4LRNL 3UTTA 3MXWL 4K8RC 1ACYL 3HZYB 3A67L 3SGJA 2FATL 4P46D 2D9QB 1KCRH 3NZ8B 4X7SL 1VESA 1Z3GH 2FIKA 1RZ7H 1U8KB 5DEFB 4FFZL 3WEXB 2ZCHH 1BQLH 1N3NA 5CSZA 3IVKB 4HZLA 4ZS6D 3VFNA 4QOKE 1RI8A 2VDRL 2ZUQB 1E6JH 2H32B 3IDGB 1JK8A 5E2WH 4OLXH 2GT9A 2VZSA 1N6QH 1JWSA 5KANI 5CZXC 1VFOA 4U1IA 4XAWH 3ZKND 3RWIA 4K3DH 4LQ1A 4I9WE 2FEEI 1WZLA 2YC1A 5EBMB 1UACL 1MUJA 4KRLB 4ODHH 4X4XB 4EEEA 1A0QL 1KTLA 4LKCB 1Q9WB 3W39B 1DCLA 1OSPH 3PQYE 2I60H 4UNUA 1N0XL 1FIEA 4MAYA 1NGPL 3LKQA 1FZJA 4HJGA 2NW2B 2IAMA 4E41E 3FN3A 1IAIH 1S7VB 3PHSA 1BVZA 5E08H 3P11H 3VH8B 3WN5A 3QDJE 1F4YH 3HHRB 3V6OC 5LCVH 4NQSB 1MWAH 1KT2B 3ARXA 2Z91B 5IG7A 4TNVF 5K9QG 1L0QA 3QIWD 5C07D 4P5MB 3B4NA 9CGTA 2Q86A 3MO1A 4R26L 1FGNL 4IRZH 1N5AB 1PKOA 1T2QH 2X89A 1GC1H 1R3LA 1YPZF 2VN7A 3EFDL 3CDYA 2NW3B 4P2RA 3QFDB 2ZP0T 2LQRA 4LGRB 4M9PA 2AK4B 4NO5A 5CD5C 2FB4L 4HXAH 5DJYB 4HSQA 5DJXB 5TPWL 4QRQB 2L7JA 4L8CA 5E6ID 2R1XA 3VD5A 4KKLD 3MJ7A 5GHWH 1G7HB 3UDWC 4OJFL 2ZJSL 5EU3B 1WT5C 3RI5K 5BZWB 1R3HB 4HIJA 5D5MF 5C7XL 2APWA 4UI2A 5CS7A 4NT6A 3VFVA 3WJLA 1I3GL 5FM4A 3MTRA 3CJJA 4HS6A 3A6BL 5INCB 1B4JL 4WV1B 2VC2L 3RIFF 1XCQA 3K1DA 4YDKL 4Y4FC 4JFDB 1CFVH 3MUGB 3O3DB 2ICWJ 1XGQB 2BNQA 5DC0A 4GG8A 3QR2A 4FQCL 4YR6A 4JPIA 4D9RD 1J9CT 4JZJB 3T2NL 1MJJB 4ETQA 3TBYB 4X6DF 3IDJB 1I1AC 1P5UA 3B43A 4RGMC 3F6LA 4HWBL 5D2NC 1MIEL 3FRUA 1KTDA 1BZ7B 3X3GH 1XGRA 2HFFB 1OAKH 4LGPB 2JJTA 3DSFH 1LK2A 5A2JH 1C08A 1U8MA 3PABA 1C5DA 5E03A 1QFPA 2A74B 3ZKSD 4UTAH 3V0AC 4UT6L 1I8MB 3FL7A 3WUWB 4FTVB 5EU4A 4WWKB 3C5ZA 4MQSB 4NRXB 1MJUL 3CFBB 3IS1X 1UWEL 5EA0L 4UOW1 2MKLC 1IAKA 3BD5A 1OPGH 3PV6A 1QO3A 1AD0A 2EEDA 5I75B 3CNKA 2ZUYA 4MYWB 1S78D 5HYSB 1J0HA 1H0DB 4AMKL 3MOBH 3ZMRA 4HLZG 4N8PA 1EHNA 4NBZB 4H26A 4ZAKA 1EBAA 3MCG1 3LKNA 3FOMA 3LN5B 4D8PB 4XC1L 4RGOL 1YPZE 3DXAE 3FFCD 2IAND 5F7YC 4Z7NF 1I8LC 3VWJA 1HQRA 4HUKB 4MJID 1ORQA 3QNYB 1CIDA 1J8HA 2ZUSA 5D7IB 1FNHA 4P23C 1JPSH 3WIFA 3VXRE 4FHBD 5IP4A 1LEIA 2WBJC 3CPLB 4GOSA 3O8XD 2E7MA 1MI5D 3WS3B 3OKEA 4LF3A 4XCEB 5D5ME 3G6AB 5F7NC 4WEMB 4CMHB 5JLZB 1QHPA 4XP6H 2YS4A 3PGCB 1DLFH 2HJKA 4MA1B 3QCTL 5JOFA 2QSVA 3OAZH 2XFXB 3WNKA 5MEOA 3SE3A 1N59A 1W72L 4G8EB 5GZNC 3S34L 4IOIA 4NHUE 3QYCA 4KUZL 4FS0A 4X7TA 4LIQL 3QUYB 5J6HB 1LO0L 3IGAB 3VXMA 2R0WH 5DJ0A 4X6DE 4K94L 3HNSH 3KPSE 2OR9H 1G7PB 5CBAA 5EUOA 3ULVC 1JE6A 1Q9OB 4I0KA 1HQ4B 5T3ZH 1D5IH 3HE6B 3FB5B 2Q3ZA 5GSRB 3GSNL 5CZVL 3DVGA 4JFXB 2X4SB 3FCTA 2E27L 5BS0E 1KYOJ 3DMMB 2F54E 4NUGL 3EZJB 4QT5B 1FHGA 2J88H 4XNYL 3ZYJA 4DUVA 1OTSC 1QSEA 3O3BB 2P5EA 4XBGA 4I0PC 4XCNB 1QBLL 2NYYD 3RX8A 4G3YL 2W1NA 3ARPA 2HFGH 3NBNA 4XNXH 2BSED 4TOYL 4UIKH 2BY0A 3ZYIA 1I9IL 2DQHH 4K7FB 1JHTA 5SWZA 1F6LL 3W0WD 3L3GB 4HIEA 4QRRD 3KYNA 1AIFB 4PRDA 1IILE 2VTFA 4Y0GA 3DV6B 4G8FA 4MGXA 1INQA 4Z7NE 3BO8A 5IB1A 1WZ1H 1WBZB 3U2SB 3DYMA 1FPTL 3GIZL 2NZIA 2W65A 4M5ZH 4Q6YA 2VUYA 3BZEB 3MJ9L 4OLUH 4O2EA 1NBZB 2DQGL 2R4RH 3LCYA 4Z7WA 1I1YB 4GXVH 4G6AC 3QAZC 3QP3A 3NPSC 2BDNH 4MS8A 1T6VN 1ZHKB 1OQXA 1H3VA 4RAUA 2P8MA 4QOKB 4F7TA 4WW2F 5CMAA 5EZIL 2W60A 3MOQA 3SGJC 1IKNA 3VFSB 2NY3B 1KNOA 4WUUA 3WE6B 4G8GD 4EBQH 1K3IA 3DIFB 4OCWL 5DFTA 3BP7A 1U9KA 3MRNA 3QDMD 4J3SA 4XVTL 4XRCA 1Z9MA 5BJTB 4I3RH 2E9BA 1FCGA 1L0XA 2PTTB 4JY6B 4D0BA 3BWUC 5CIPA 4R96B 3QPQD 3PQYB 1I75A 5KZCD 1T21B 1IZKA 3G08B 3NABH 5HYFA 5DZLA 1X5LA 4E41B 1FV1A 1EEZA 1CT8B 2OTWA 3LD8B 4HJ0C 2UWEA 4DKFH 3QDJB 1T03H 3N1QC 3BESR 4JLRB 2EE2A 4LPUA 1IC7L 3MCKB 1CD1A 4M6OH 1SEQH 4GKNA 1E4KA 1P1ZA 5HGHA 1Y18B 4GLRI 1T0PB 1WIOA 4XMPH 5ANMA 5EU6E 3BKCL 5DMGC 3MUZ1 5T1LD 3ARFB 4MAYC 5DD0L 1P2CB 4FOMA 4QRSB 1OSZA 5CZKA 5FHAH 2BY2A 2FLRT 3IT8D 3WN5C 4WFHD 3EYOA 2BOBB 2DD8H 4YLQT 4EI5B 4ZO8A 3GMQA 1MVUA 3RL2B 1A6UH 4YGAB 5JMRA 2B0SH 1XR8A 4NSKB 4KI5C 3ECBA 3KDMB 3NCYP 3OL2A 3P4MB 2EYSB 2DBJA 4ZFGH 1A4JB 2WZPD 4QRUA 3MRDB 3AS3A 1XR9B 3RKDC 1H8SA 2Y4SA 4UV7H 4R97C 3KLAA 5KVFL 3RWFB 3PIQB 3SDYH 1L9MA 3OGOE 1YEDB 2BHUA 2Y06H 4G9FA 2AABH 5F9WB 3MUJA 5F3BB 3O2WH 4L3CB 4YH6A 4AY0A 1Q9LB 2KL6A 3THMH 2Y7QA 1NQBA 4GS7B 3VE0A 4NWTL 1IBGH 1Q1JL 1HDMB 4BJLA 4APQD 1CE1L 2GCYA 2WP3O 4NO0D 1A6AB 2RGSA 3VFMA 4X8JB 3CFCH 1SJVA 2QV2A 4MD0B 1SJHB 4FQ1H 3SCMB 3PL6A 3IAPA 3WJLC 1N4XL 3AVEA 3BMVA 1FZKB 1OW0A 1NFDE 1F3JA 1OAUH 4TTDD 2EE6A 2FGZA 2CSPA 3U7WH 1MEXL 3V7MA 2DI7A 5L0QC 3PP3K 3SDDB 3UPAA 2NY2C 3HG1D 3PWJB 5ID0B 5IB2A 1QG3A 3MRKA 5HHME 2ZUUA 3MCLH 2EZ0C 4LLDB 3GMMB 4JHWH 2G9HB 2I9LB 3GMOB 4U33A 3AC0A 2Z35B 2XRAH 5AG8A 1IKFH 5D6CA 5GGVY 4EZMA 2W9EH 3B83A 4LGSB 1I3UA 1K6QH 2GUOB 5A2LH 1A3LH 2CUIA 2YPVH 2BMKA 4YK4B 2OSLA 5EDXA 4LMQI 1A7BA 5D1ZD 4LCUB 1W0VB 3C5ZC 4LVNC 5FYLH 3QZWB 5JW4M 3ARYA 4HUWA 1MRDL 1T0MA 2ZPKH 5FO9B 5TE7L 3ROOA 4X9BA 3FT3B 1FSKC 1YPZB 4EDWL 1OARL 1OT2A 1CLYL 5I9QB 4GLRH 3TYFB 5GGQH 4PGEA 5C0GA 1NFIB 3FQNB 1N2RB 2AVGA 3VXRB 2GSGA 4RWYH 3VFOB 4OZFH 4ZAKC 1IM9B 4JQIH 1XF5B 3GMRA 5D5MB 3DUHA 1CL7I 1IC4L 5DQDL 3V0WH 1BQSA 1DBJL 3VWJC 2AV7B 5I73C 2HVJA 2AEIT 4NWUH 4R3SB 1JWUA 5E94A 5F9OL 2KQNA 4HUNB 4PJXE 4QHNA 1OP3H 5L8LB 4NPYA 1RU9H 5JOEA 3MNVA 3R0MA 4DZBB 2EYRA 1QBBA 1GGBH 4NHUB 4RWHA 5IT2L 1AXTL 4UQ3B 1PX3A 2G75B 4DCQA 4XNQA 2D31A 4PJ5A 4YHKL 5I1AB 4X6DB 3WFBH 1W0YT 2ICWB 5GZOD 2AJSH 4S1QL 1IC5L 2MKWA 1F90H 3KPSB 4U0RB 3SE3C 4ZFFB 1SY6A 3HZVB 3IFNH 1ZLUH 2IPTH 2G2RA 5HHNB 3F58H 2MCPH 4I5BA 1XGTB 2Z8SA 5BS0B 3RZCA 1D5MB 4UDTB 5CP7B 5ESAA 2F54B 5C6PB 3QPXH 2YPLD 2IQ9L 3ARDB 2EH8L 5TJWK 5AYUL 3UTZA 1FNEB 3FO9B 5I8CB 3HTLX 4S1RH 3MLTA 3IAGC 2WAHA 4AENB 2V7NB 3IFLH 5HHXL 3WO4B 5K9KB 1LEKB 5HBBA 1AY1H 2XZAL 4KROB 2OQJB 4P4RB 4HIHA 3C5SB 4FN0A 4QXTA 1OLLA 3O0RH 3TO4D 1VGEL 4C54A 3U7YL 3VD4A 1A7PL 4POZD 4GBXD 3W9DA 4HWBA 4PY7A 4UDUA 4AH2A 3NCEB 4LRIA 4KXZI 4XTRC 3P4NA 4Z7OF 1NEZB 2HT2D 4XPBL 3VWKC 5F3HB 2OJEA 1EEYA 4M48H 4WHDA 3GRWL 3V5DB 1U41A 5FYKH 1U8IA 5IF0B 4QYOB 1FYTD 4F7PB 5CEZL 4E42A 3PHOB 2ZSWA 1AR2A 5EULV 2MFNA 4LHJB 1I7ZB 4PGZA 1WK0A 4U05A 3JWOL 4HMCA 1OP5H 1FG2B 1Z9LA 1L6ZA 4HH8A 2NNAB 4P99A 4U1HA 4YDJB 1JZ2A 5IK3A 5E9DA 3HZYA 4Z7QF 5GS0C 5IR1B 3UYRH 4WI4A 3NZ8A 1UEMA 4TQEH 4QXWA 4KTDH 2OXHA 2AP2A 1VFMA 3OQ3B 3VXTB 4XPFL 3WEXA 1KCSL 4MS8C 1TZGL 1YEKH 3PWUA 3IVKA 1TJHL 3CU1A 3WUWG 5C3LD 2H32A 2FECL 3UC0H 2QJDA 2LU7A 1IKNC 4PUBL 4QRPE 1YC7A 1M71A 2VDQH 4IHOB 4XMLH 2N56A 3LKOB 4PJDA 3T77B 4U1GB 5EBMA 1MCBA 1G9EA 2OK0H 5HYSG 4JO2L 1PG7H 4X4XA 3TT3L 3F7YA 1ZVSB 2UYLB 3HA0A 2WNGA 3ZYOA 5ALBL 1U6AL 3S3JA 3IU4L 4JY5L 2RBLA 5EU6B 1I85C 4R4BB 4X83A 3BD3A 4JR9H 2ZKHL 2EDNA 3C6LB 1W72A 1D9KD 2DLEA 5LGKA 2NW2A 3VFWB 4JFHE 4Y16D 1S7VA 1X6NA 3ROLB 4HKBB 1HOCA 3B9VA 1PEWA 1TTFA 4JRXD 1E4KC 43C9B 4JFYB 1KT2A 2Z91A 3MRJB 4KKBD 5EC2B 5JO5B 3RP1A 3NCCB 1DBMH 2YWZA 3TCLB 1MJ8L 3KPMB 3HAEB 1UQSB 1RK1B 4LSSH 4ZUWB 1N5AA 4Z7OE 1F2QA 2IANE 3I2CH 1IFHL 2RB8A 3QFDA 3WFZA 4FMKA 2GIYA 2AK4A 2Y5EA 1H8NA 4U3CA 4XCFH 4XHJD 4P2CG 2VXVL 5DJYA 5HYIA 4QRQA 5IVXF 2AJ3B 4IOFD 4NZUL 5GRWA 3WNLA 1AD9B 2ZUXA 1MI5E 1G7HA 4FQIL 4WFEE 4NBYB 5EU3A 1HINL 4Y4HD 4J6RH 5BZWA 3PF2A 3P9WB 2HLAA 4N0UE 3UBXB 1JZ4A 3MBEB 1LDPH 4XGZB 2D4DA 3EO1B 1AC0A 4RDQF 3SDXA 2GTZB 5IFAL 1BIHA 1V3MA 5MI0B 3OR7B 4WW2B 3DX6B 2LU3A 4Z7QE 1NFDB 5INCA 4WV1A 4MZ3A 4OF0A 4JFDA 5CJOL 3OKYA 2XV6B 3MUGA 3O3DA 4OQTH 1RZKH 3MYZA 3KR3H 3CUPB 1XGQA 4F15C 4NGHL 4XNMA 3PL6C 4JZJA 1IEHA 1MJJA 4GW5B 3E2HB 3GMNA 1OW0C 3DRTB 5HHMB 5DVLA 4M7LL 3OJMB 4QCIB 3V8OA 2F5BH 2M2DA 3B5HA 3RWCA 2BSTA 1CICC 3SDAB 1KULA 1M7DB 1A8JH 1A22B 2A74A 1TMCA 5EIIB 3T0WA 5A2KH 5AWNH 3EW3B 4EN3D 3WUWA 4YDVB 4FTVA 5IMMB 4WWKA 1PLGH 1BBDH 4GAFB 3RNKB 1UH2A 3CFBA 4K2UH 1QFOA 4OD2B 4FZEL 4HMEA 3JXAA 1KENL 5KVGH 4JO3H 1UT9A 3IETA 5I17A 5JQ6H 1YJDC 5HYSA 2ITDB 4JO1H 3ULUH 1AHWA 5CD3A 3PNWB 3MRMB 4QRRE 2NY7L 1QRND 3AB0B 2VDPL 5AZEL 4X6CA 1FORL 1CFQB 3LN5A 4BQCA 1HNFA 1DANU 3LZFH 4JQXA 5DGQA 1KLUB 4U1LA 3STLB 2JK5A 1O0VA 3TV3H 2CMRH 2V5SA 2VSDA 4Q97A 3BP4B 1UWXH 4PJXB 3EYQC 5IVXE 1OAZH 5KVDH 3CPLA 3K1KC 1FDLL 4HF5L 4JDTH 1FGVL 4G6KL 2WWMD 3WS3A 1KLGA 1CWVA 5AZ2L 1BBJB 4XCEA 2I25N 3QEUB 3V7AE 2FL5B 5ILTH 3TN0D 1Y0LA 2B7DT 3G6AA 4WUKH 1MQ8A 4JZNA 5HGAA 1Z3GL 3DROB 3HG1A 4V2BA 1RZ7L 1LO5B 4GJTB 4OLZH 3O6MH 3AXLA 4PRNB 4F7CA 2ZCHL 4EJ1C 1HXYA 4G8GE 1PAMA 1E4XI 4L4TD 5JW4R 3KPRD 3DETC 1E6JL 4O9HL 5E2WL 4PV8B 5J6HA 3NOIA 4H0HB 2DJUA 2L4OA 2CKBH 4OLXL 4LPWA 1N6QL 1QACA 5GS2D 3D2UB 4XAWL 1WWCA 4K3DL 4XPHH 4P3WA 5JXAH 1Q9OA 1NC2D 5D1ZA 5IBTL 1HQ4A 1QNZH 1ZTXL 4ODHL 1GSMA 1B88A 1RIUH 3D1MC 2P7TB 2ZNWA 1SBBA 4OBRA 4A2MA 3RZCC 4FP8H 1OSPL 1R24B 4PGBB 3DMMA 2I60L 1WBXA 4QT5A 4LLAA 1P9MA 4MQ7B 1F58H 2MCG1 3O3BA 1HHJB 2Q7NA 3GI9H 2R56H 2XY2A 1IAIL 5E08L 2W92A 3P11L 4XCNA 5LCVL 4LQFH 3IJYB 1MWAL 1JZ7A 1MFCH 1XGPA 3QG6B 5JORB 1T7YA 3LS4H 3WFDH 5E6IB 4IRZL 4JM2A 3C8HA 1T2QL 1ZANL 1GC1L 3L3GA 2ZCLH 1MVFA 1XFPA 4QWWD 1NAMB 3GIVA 4Q9BA 4LRIC 5E8NB 2BSRB 3CH8A 5E00B 3P9MB 4HXAL 3S9DB 1KEMH 4PRHD 4HUUB 3U30C 1T20B 3I02B 5C0CE 2UZXB 4HUXB 3BZEA 2FBJH 3BKJH 4I4WB 3AROA 1R3KA 5HYQB 2GJ6D 5ESVB 1R6VA 1F00I 1YY9D 3HZMB 1O7VA 1T2XA 2AJYL 1R3JB 1ZKAA 1CFVL 2I24N 4QOKA 5F7FA 4Z78B 1JTTA 3HPLB 2C4FU 1B6DA 3VFSA 4GG6F 3K3QA 4I13B 4NRYB 5HHOA 3WE6A 1A2YB 4PFEA 1AGBB 4L9LA 4ZPVB 4N5EC 2F15A 2VDLH 3ZDXF 4IS6A 1NMCC 5HVWA 1A21A 1M7IA 3RTQB 4Y88A 5EZLB 5SWSD 3TWCH 4OCSH 5BJTA 3H9SE 5A3IC 2FZ3B 1EK3A 2JB5H 3LKPB 4JDZB 3S5LB 3GM0A 4JY6A 4M02A 1E4XH 5MERB 3WIHL 3QZWG 4R96A 5CILH 3X3GL 1I3RB 1HH9A 4ZD3H 1KFAL 3PQYA 3DSFL 4WEBL 5AEAA 5IQ7H 3G08A 1OVZA 3U6RB 2FEDD 4KY1H 3MRPB 2Z92B 1CT8A 3IU3A 1RZIB 35C8H 5F7LB 2QADD 4MB3A 2FEEL 4XWOC 2HG5B 5HJ3B 5DJ2B 3P40A 2RCSH 1OPGL 4PY8I 5D70H 2W9DH 3V5HB 2B1HH 4W6WB 1CFBA 3HRPA 3E6HA 2IANB 3BKMH 3OKLA 2ZCKH 5DHYA 2CLVB 2AGJH 1RJZB 3S35H 3RL2A 2IMMA 5E6YA 3MA7B 3KDMA 3P4MA 2HMIC 2EYSA 5L2KD 2ZG3A 4LEOA 3M07A 1MI5B 3MRDA 5CKAA 3JTSB 4YZFF 1XR9A 4N0UB 3DWTA 5FUCE 1JPSL 5FB8B 1YEDA 1KPRB 3TM6A 1FL5B 3SGKA 4QF1A 2W0KA 5FYJH 3RVUC 5ID1A 1SBSH 5IB4B 1HDMA 4D0CB 4PS4H 4V1DD 1A6AA 4JPKH 4XP6L 3AGVA 5IEKA 3OX8B 4X8JA 3QUKB 3L5XH 3C9NB 4MD0A 1BOGA 1QQDA 4JFZH 1SJHA 3SCMA 1KN4H 2IBGA 3GRWA 1JPTH 1FZKA 1NAKH 1M05A 2ENYA 4Y5YB 5D4QA 5FUZL 3RVXD 4NNYB 3U0WH 3Q5OA 4WV1C 1KELH 4GG6E 3W9EB 3MRQB 5IHBA 4WNQB 5C0AD 4HPYH 5JPNB 1V7NH 2R0WL 2DF3A 3ZDXE 1NANI 4RMRA 1T1YA 4CU8A 3D0VB 4JGJA 3PWJA 2Z31B 3SGDH 5C8JB 4JZJC 2OR9L 3WFCH 7FABH 1QLEL 4YE4H 4Y16A 2OL3H 4LLMA 3T0VA 4KK6C 3L5JA 5T3ZL 1D5IL 4HK0B 1CVRA 2BNUB 4OB5L 3GMMA 2G9HA 2I9LA 2Z35A 2F53D 2VISB 4N1HB 4UB0H 2VDNH 3GSQB 1NEZG 4GT7A 2J88L 3BIBX 3UAJD 1MNUH 2EDHA 1I7TB 4GAGH 2O26U 2OMBA 4OCXH 3H7LA 4HKZB 3NAAH 4ZODA 4F9LA 4LLVB 3V6ZB 1VEMA 4DKAA 4LCUA 4WWKC 1BGXH 1W0VA 2LAGB 2HFGL 1S9XB 5H94A 3MV01 4QRRB 4XNXL 4X9FA 3GMLB 2X1WL 4NN7C 2UY6A 5FO9A 2DQHL 1Y6NR 2H45A 3TA3A 1TTUA 3DXAA 4LSVH 5I75C 3OB8A 2IBZX 4YEEA 5KS9F 2P47B 2GFBA 2HTKC 5DJ8B 4GMSH 1NFIA 1G7JA 3TYFA 4KI1A 1AQDA 5D1XA 3EJYD 2J7LA 3QWOA 1AHWC 3VXRA 5IVXB 1I8KB 5J06A 3MFGB 1DQQA 4XCYA 3VFOA 3W5MA 1WZ1L 1ZHBB 4KMLB 4YZFE 1XF5A 1XIWA 5B4MD 1XMWA 5EZJB 3TBVB 4M5ZL 3PGFH 4Y8AA 5E4EB 4ESKA 3AM8A 4IRSA 4WW1A 1FZOB 1NCUA 1OAYH 4NQUA 4PJGA 5FV2A 4R3SA 2FO4A 4GXVL 3H9ZA 3CSPA 5IQ9B 1ZA3B 5MENA 4C57C 2BDNL 2HTLC 4G8GB 4DZBA 2IFFH 5MP6H 2XN9D 1CU4H 1DQJB 3ZE1F 4PJAF 4NHUA 4N9GB 3GSWB 4X4ZA 4UQ3A 4X6FA 2JJWA 3FO2B 1MPAH 1N6UA 1NGXB 2G75A 3G9AB 4CMHC 3LV3B 4DQOH 1TITA 4MA1C 5I1AA 2DWDA 2AJXH 3Q48A 1YYLH 4R4FL 1WJ3A 3KPSA 5FV1L 5KZCB 4ZFFA 5E1AB 5JHLH 1A1MA 2DTMH 4NCC2 4P9ML 4I3RL 1H15A 3LDBB 4LPXA 3ARQA 1YQVH 1XGTA 3QUYC 5BS0A 1I9RL 4UDTA 2APFA 5CP7A 2ITCA 2F54A 3AFLA 2CXGA 3ARDA 3NABL 2V2TA 3FZUD 1B9ZA 3OKKB 3FO9A 3HAEG 1ZLWK 4U2YA 4UQ2B 5ELIA 3REWB 4AEHL 4M6OL 1OAXH 1SEQL 5K9KA 1PQZB 2CRZA 4XMPL 2QKIA 5GGRA 3C5SA 3DMMC 5BW7A 4UAOB 1KJVA 4MD5B 1P9MC 1IQDB 1YC8A 3BPOB 5FHAL 4OM1H 5J1SC 2DD8L 2GJZB 3G5XB 5SX4I 2XY1A 1A6UL 5CJ5A 2B0SL 3H7BB 3JZ7A 5DXWA 4PLKC 5KS9E 3V5DA 4ZFGL 1MLCB 4LLWA 3O3EA 2SEBA 5IF0A 2OZ4H 2WQRA 4J4PC 3MBXH 1J1PH 5C0CB 4LDLB 5T3XL 3HC0A 1I7ZA 4JM2C 3WO3B 4NQCE 1JZ6A 5L7XH 1FNGB 3SDYL 1TQCB 3P77B 1PVHA 4M1GH 2Y06L 5D1QD 2AABL 2DYPB 2H8PB 1FG2A 4K07A 3ZSSA 2R2EB 3O2WL 1F4AA 4YDJA 4NM8L 4PREB 2ESVD 3G04A 3THML 3VJ6B 1IBGL 1PG7X 4YFDB 4NQXB 1BJ1H 4DZ8B 3CFCL 5IR1A 2VE6A 3WD5L 3U4EB 3I9GH 4PJAE 3F62A 5GS3A 3CXDH 5C0JB 2NXZD 1JI2A 1JUFA 1OAUL 4XC3H 5AG9A 3L9RB 2G5RA 3TIEB 3H9SB 3KAAA 3U7WL 2A73B 1DE4A 2R2HB 1JHKH 4MX7B 2R9HD 3RIAK 1I9JL 1TNMA 3ZT5A 1KIRB 3IAQA 2YD8A 5F97E 2NY3C 2PCPB 2HN7A 2IADB 4U1JB 5IHLB 3PXHA 1ULVA 4CKVX 1RIVH 3MGAA 4Q9QL 2OI9B 4KJYB 2HT4C 3MCLL 1BFOB 3Q6FB 1JV5A 4JHWL 3LHPH 5E2VL 3KPOB 3HE7B 4S11A 3RHWF 5T3XD 4A6YH 1IKFL 2UYLA 3ULVH 5IHZB 1KXTB 3RU8H 1K6QL 4R4BA 1A3LL 1P7QA 2YPVL 5E4IA 2VYRE 1R5WB 3C6LA 3EGSB 1ZT7B 3CDFA 3B9EA 3ULSB 2DKSA 4BFIA 2HRPH 4RFNB 1JYXA 3T0ED 1WC7B 3LD8C 3L3DB 4U1MB 3ROLA 4HKBA 5FYLL 4OV6F 3OXSA 3G5YA 43CAB 2ZPKL 3HZKA 4JKKA 4F80A 1L9NA 3VFUB 3MRJA 5EC2A 3NCJL 5JO5A 1VGKA 1MHHB 4Y19E 4DAGH 1MCHA 1QRNE 3HAEA 3KPMA 2D0HA 5JDSB 1NFKA 5GGQL 3VFGH 5HDQL 1KCLA 4DGYH 4MQTB 3IRPX 3V5KB 1EGJH 1IL1B 2VN4A 4RWYL 4LCWE 4LU5H 4JQIL 1BZ9B 4L4JA 5C2UB 2AJ3A 3V0WL 3UYPA 4Y8DC 4P57A 4PDCE 4X4ME 3MBEA 3B9KD 5EOQH 1K2DB 1N0LA 4QHMA 4AT6B 3GJFH 4Q2ZA 4P5TD 4NQEA 2N1KA 1RU9L 4JRYE 2IG2H 5F9WC 3V6BR 4HGWB 1GGBL 1NFDA 2J5LB 4KZDH 2BCKB 4GG6B 3P73A 2YEZA 4GS7C 3EFFA 3VMOA 3NTCH 3CUPA 4TVPH 3WFBL 1UADC 3SCMC 2YK1H 4GW5A 3X12A 3E2HA 4GRLA 3IFNL 3DRTA 4Z8FL 1NCDH 5HI3C 1NMBH 3DURA 2I9TB 4QCIA 4P2QA 2OLDA 3F58L 2C3VB 2HKFH 2EIEA 4KRPB 4NKDB 3SDDC 2HVKA 2FWOA 3HPJB 1P7KB 3QPXL 1IARB 3SDAA 5C0IB 4YQXH 3BYTA 2XIDA 4AZ8A 1IMHC 4XHQA 3ARGD 5F6HI 1R5VB 1YA5A 2XTJE 5JW5A 2WY3A 4S1RL 3TO4B 4YDVA 5C08E 4XPTH 4YC2B 3T0XA 1AY1L 3X11B 3MRIB 5L2KA 2EXYC 3D3VD 3O0RL 3R4DA 5TDNA 5BQ7B 4OZIF 4NP4H 4YK4C 1HI6B 4FXKB 2ITDA 2ADFH 4F9LC 4IDLA 1UZ8B 3TH3T 1P4LB 1N64L 5B21A 1DUZA 5LQBH 4WI5A 3GSVA 3OJVC 3VU2A 1J0YA 4FFVC 2H3NB 4M48L 4KJWC 5FYKL 3TA3C 4LNRB 4KMTH 3J8F7 1KLUA 3TT1H 2QQLH 3STLA 2BP3A 4PRHE 5I9QC 4OTXH 2P5WA 5DMIL 2CUHA 3MV9A 5D1XC 4GRMA 4PJXA 3TH2T 2R23B 2UVEA 4KMQA 2GJ6E 3GHBL 2CDEA 5K9QI 3FB7B 1CD9B 3QEUA 4I48B 1XIWC 3L7EA 2XKUA 5C0AA 3UYRL 4MCZB 2DQIH 3AM8C 4IRSC 4TQEL 1WVZA 1LO5A 2JELH 2H26B 5FAAA 4PJIF 5LJYH 3NH7H 4NDMB 1YEKL 4DKDC 1NGWB 3KXFD 5EU5A 1R0AH 1YN6B 3UC0L 1X5FA 2B4CH 4JFED 5KN5A 1OGAE 4GW4A 3D2UA 1IJ9A 3VXQB 5I1KL 5D93B 4ODXA 2VDQL 3QO0B 3KVQA 5TFSH 4PTUB 2OK0L 1D9KB 1PG7L 4WU7B 2M1KA 4EDXB 4G80A 5K33A 2P7TA 2FHBA 5DD6B 4L8BA 1BECA 4PGBA 4KKCD 3QHTC 4LCCB 4JR9L 4JRXB 5JHDD 5DURD 2QBWA 3ARDC 3EOBB 4MQ7A 1PYWB 1HHJA 3OXRB 4NKQB 5ENWB 1NH6A 3BDBA 1J8KA 4HFWA 4L3EA 4OZGF 3LY6A 4N1EA 3ZHKA 4JGUA 3BH9A 1BLNA 1KXQE 3IJYA 1U8JB 5IMOA 3WO4C 5CEXA 5DT1L 3QG6A 2ENSA 5KS9B 1PBYA 4OZIE 4KROC 4QHUA 5FM5M 5JORA 5DJAB 1TTGA 2P46B 4KDTC 3KPQB 5BW7C 1B0WA 4FQQB 1FO0L 1WITA 3QEQD 3RDTD 2D3VA 4NQCB 3AU1B 3I2CL 1HIMH 4CNIB 4Y4HB 1KTRL 4HIIB 4Z76A 3ETBF 3F7VB 4XH2A 1NAMA 5EN2B 5C9JB 4XCFL 2BSRA 4ZOCA 5KSAA 2MQ3A 4EVNB 3TH4T 3BW9B 4HUUA 3O4OB 3PDOB 4QGYA 1F02I 2XICA 3A6OA 4HUXA 4KGJA 4IMLA 4U1KA 1RZGB 1CE6A 2YHGA 5CKGA 4I4WA 1AKJD 5E8EA 3X13A 5KVMC 1LDPL 1VCAA 4G6FD 5JXEA 4V1DE 4PJAB 2V7HB 1ZGLM 2DMKA 2XNAB 1PX4A 2VR5A 1BD2A 1FFOB 4I1NB 4M6NL 2VLJE 5TF1L 2CR3A 3V52H 5DJDB 4MNHA 4OQTL 1RZKL 3KR3L 5GJTH 4QRPA 4U3HA 4Z95L 3HUJF 4ZPVA 5CINH 1U3HD 2NXYD 3VGAB 4UINH 5C0FA 3GM8A 1AO7D 4HULB 3RTQA 4OLVH 5EZLA 2OTUB 4MDIB 2VIRB 1CGVA 2XOTA 4S1DC 2F5BL 2FZ3A 4H1LH 3LKPA 1BF2A 5TDOB 3MR9B 3WSQH 3HI5H 1LO3H 4JDZA 3L1OH 3CK0L 3S35X 5MERA 4H8WC 3MC0A 3GBMH 3Q3GB 3IYLW 1I3RA 3C09B 2E7LE 4ODSL 2F53E 2X6MA 3JWDH 3ZE0F 3MRPA 2Z92A 1DN0B 1RZIA 4U1GC 1BBDL 4Q58C 1Q0XL 2RR3A 1RHHA 4H0IA 4PP1C 1UG9A 4K2UL 3JV4A 4TUOB 4Y19B 5KVGL 3V5HA 1QRNB 5L2JA 4OZGE 1XF3A 4J1UB 3V7AG 3C6LC 5JQ6L 4BZYA 4JO1L 5HI4C 4RDQG 3ULUL 3B3IA 1YEHH 4KRNA 1IQWH 4M3KB 4LCWB 1RJZA 3KJ4C 2DJSA 1JWMB 3V4PL 3MA7A 2E9JA 2BRRH 2YA2A 2GK0A 3TJHA 3HS0A 1ZWIB 1S9WB 1TJIH 5FK9A 1EFXD 3N1MC 3TV3L 2CMRL 3JTSA 4M7KH 4N0UA 5HHPB 3EJZD 3ALPA 5FB8A 3NIDF 1OAZL 4JRYB 1XZ0B 1FL5A 4K9EC 5ISZE 4WI2A 1FLTX 4JDTL 2DMBA 4OI7A 3N50A 3DYPA 3PWNA 2BVQB 4URTB 3GBNH 5ILTL 2YXFA 3TZVB 2XN9E 4D0CA 3U0TA 3OX8A 3KPRB 3MBEC 5J13B 1J1XH 3C9NA 4OLZL 3O6ML 5C70A 3T2QA 2VLRD 5MI0C 1U95B 4AL8L 4HLZH 3W9EA 1CR9H 3MMEB 3TPUB 3ULUD 3KPPB 1ZS8B 2CKBL 5JPNA 1S7RA 3QJHB 4RBPK 1IGMH 5EB9A 3OAZK 3BI9X 1XF2B 3FN9A 4FQJH 4KKAD 4HC1L 3D0VA 1F3DJ 2YA0A 1YNLL 3VDAA 2Z31A 2XTJB 1WFTA 5C8JA 4AYFA 2V17H 3E2HC 4YBHA 4GRLC 3WJJC 5E8OB 4NBXB 1QNZL 4OAWA 1YNTB 4HK0A 5IBUB 1RIUL 2VISA 5FYJU 3QEHA 4FP8L 5IESH 1HHGB 3QNZB 5H37H 3ZE0E 5IEHA 4OFYD 3SDAC 4KQ4H 4Q7DA 3UXFA 2DIAA 4PJ8D 1F58L 3QIBB 3GI9L 1RMFH 2R56L 5CIPH 2Y5TB 5IW1A 2IH3A 5JW4Q 4LLVA 3KYMB 5D9SB 5TDPB 1S9XA 3GMLA 3LN4B 3IDMB 3FQUA 3SPVB 1SYSB 3LS4L 3MV7E 1UJ3B 5HDBF 1MCEA 2PW2B 4PRHB 4OLYH 2MOVA 2ZCLL 3RWEA 1YUHA 1XGYH 4NJ9H 1E4WH 2YPKB 4LSTH 5DHVB 1I8KA 3KS0H 4KHXH 2XKSA 2NCMA 1BJ8A 1ZHNB 1IGCL 2L0DA 1KB9J 2GJ6B 4K55A 2X4UA 1AFVH 1ZHBA 1KEML 3U36B 4WO4B 2HJFB 3C8DA 1GGCH 4NZJA 4ZG1A 3NIDE 1OY3B 1B0GA 2J8HA 2NY5L 2FBJL 3BKJL 5DMKB 4OM0H 3RWJA 3FO0H 5FDWB 3QDGD 5H8DA 4XP4L 1YMMA 4D3CH 4OD3H 3UROR 1ZA3A 3EIFA 4BZ2H 3X17A 2EDDA 5B39B 2V9QA 2A6JA 5T5NG 1Z6JT 4GUPA 3GSWA 1T22B 3MACL 2WBKA 3FO2A 1HSBA 3LV3A 5EBWA 1KJMB 1OGAB 3I6KA 2JB6B 3C6SA 4ZUTA 3G5VA 2C5DC 5AYQA 4OZFA 2VDLL 3RVVD 3TBTB 1LO2H 2H9GA 2LAAA 5E1AA 3TWCL 2JB5L 3I84A 4U6YB 3NFNB 1E4XL 1H3TA 5CILL 3HLAB 2ZOLA 3O81A 4ZD3L 2APBA 5HVFB 3BDYH 1DUYB 2W9LA 5IQ7L 3JTTA 1MLBB 4FG6C 1KCKA 5ITFA 4Z6AT 4KY1L 1FRGL 3QT2A 4YDLC 2IBBA 1ZA6B 1A1NA 35C8L 4UQ2A 1EFQA 1CXKA 3LEVH 3ARED 1X5ZA 3IXAA 4OLEA 4OZIB 1U58A 4GXUN 5IVZB 1C16B 1PFCA 2PNDA 5D70L 3ZKXB 2W9DL 4N1CA 2B1HL 5TF0A 3AUVA 1HKLH 2GSIA 3LH2H 2Y23A 3ZKMD 1HHHB 1TCMA 2QLVB 1T1XB 2ZCKL 5I8KL 5J9PB 2EDRA 2AGJL 1LQSR 3IXTB 3C60B 3S35L 1RK0B 3CZJA 3CDGB 1YJDH 3H7BA 5HDBE 5F6IB 3FKUS 1MLCA 3HFML 3BRFA 3D69B 4RX4D 1U8OB 4Y5VA 3IB4A 4Q6IB 5HD8C 2NR6C 4Y4KD 1FNGA 2EH7H 4V1DB 5ITBH 3N9GH 2DYPA 2FX8L 4HS3B 3CSGA 5KSAC 5FYJL 4J23A 5T1KD 2NY6D 1MQKH 2VLJB 1SBSL 3AS0A 1X4XA 3VJ6A 1KIPB 1L4IA 4NQXA 4PS4L 1ZLVH 4JPKL 4HBQA 4DZ8A 3L5XL 2IH1A 1RJYB 4XVSH 2H2PD 3U4EA 5KVEH 4K8RL 1KN4L 5JXEC 1S9VA 2UUDH 4IRJB 5C0JA 1JPTL 1A6ZA 2OTPA 5B3NA 5DF0A 4JCMA 1KELL 3L9RA 3TIEA 3H9SA 1KCUH 1F5WA 4EXKA 1DZBA 4RZCA 1EEQA 4MX7A 5GGUA 1MJ7H 1V7NL 3ARBD 3GK8H 1KIRA 3BN9C 2PCPA 5HY9B 2IADA 4U1JA 2F53B 5J12B 3L5WA 3WFCL 7FABL 1FZMA 4YE4L 2OL3L 2F19H 2X1OA 4KJYA 3I3EA 4WI9A 2NX5D 3RTQC 5I1IH 1J1OH 1EO7A 1P5VA 3HE7A 4ZUVB 5EIQA 4HWZA 5JQHC 5ADOL 3U0PB 4UB0L 1OB1A 2HRLA 1BFSA 2HT3D 1MNUL 4OZGB 2NZ9D 1AXIB 3QUZB 4OCXL 1ZT7A 3NAAL 5F9AC 5FYJD 3P3YA 5HVHB 3ULSA 1A1OB 4U1MA 3L3DA 1BGXL 2FX9H 3L3JB 4PB9H 3LVEA 4PJEA 5I30H 4XVUD 5DRXA 5JOPD 5A16A 4N90D 4PRPD 4NHCH 3SQBA 3V6FB 4K8RD 3RWGA 3VFUA 2CLZB 1I3VA 4LL9A 4PPTA 4NO2A 1W8NA 4LSVL 2D03H 1SVCP 3I75B 2B5IC 4JPWH 5IUSA 2Y9RT 1JIBA 4Z7VE 5BV7B 4MVBC 3IJSB 4OF6A 3V5KA 4S1SH 5ISZB 1DQMH 3CCHB 1A7RH 4ALAH 1CDBA 1BZ9A 4HDIB 3QJFB 3TJHC 2XN9B 1LDSA 3OG6B 2VXQH 2XWTB 5CZXD 3MLZH 4ONFH 1C8PA 2YRLA 3SY0A 4JHZA 2IFFL 5MP6L 1CU4L 1S9YB 1A3RH 1QSFD 3WHXA 4N8CH 4Z7UF 4M6MH 4X9HA 5SV4A 1MPAL 3MV8D 4DQOL 1OP3K 2X1XR 3HN3A 4YHZL 1YYLL 1JPST 3VRJB 4CAGA 2JCCA 2BNRD 3S36H 5JHLL 1FN4B 5HHQB 3H8NA 3JV0A 4MXVF 5E8PB 2I9TA 3GHEH 2C3VA 1YQVL 1D5XB 5C0EA 4GAYB 5C09D 2DB8A 4P4KB 3V9FA 5JUEH 3HPJA 1P7KA 3RNQA 4JFFD 3TEUA 1KCVL 2LVCA 2Z31C 2ATKB 4YHOH 1ZLUK 3LRSA 4OT1L 3AAZA 2CLRB 5CD5D 4OQTA 2ID5A 4GW1B 4XBPB 1JNHB 1RURH 2E8ZA 4UNVA 3X11A 1KACB 3MRIA 4I0CC 2Q3AA 4FZ8L 5EC1B 5IOPB 1TIUA 3MV7B 4ODVH 1CXEA 4XXDB 3B5TA 5BQ7A 4L8DB 4FXKA 5D2LF 4LSRL 2N4IA 4O51B 1DFBH 1UZ8A 3OWEA 4NKOB 1P4LA 3H0TB 3MLVH 4OGYL 4S2SA 1BIIB 3B6SB 1MCRA 4Y4FD 3SJVD 5D1QB 2B8OT 1NCCH 2OZ4L 5F72S 1J1PL 4QHKI 5GRVL 1RJLB 1ADQL 2A38A 2ESVB 2J8UA 1J18A 4G9DA 1ZSDB 1MH5B 5L7XL 4KJQC 2WM0A 3RY5A 4HCRH 1BWMA 2EKSA 5I74C 4MJ2A 4FQLL 1I1AD 5E2TH 4PJHF 1QFWM 3X14B 3FB7A 5F1IB 4I48A 2NXZB 5F1OB 1JRHH 1SJEA 3MOAH 3HNTL 3UJIL 1Q38A 2QSQA 5BZDB 5E4EC 1OP5K 3I9GL 3DI2B 3S98A 4NRZB 1G6RL 5L9DH 4U0QB 3CXDL 3MFFB 4XCCH 3UEZA 1Q8MA 4XC3L 1FNFA 5L8JB 3NA9H 2FJHA 3QO1A 2XA8L 3FTGA 4YFLI 2VOTA 1WWWX 1URLA 3QQ9C 5MHSD 2LVEA 1JHKL 1AO7E 3EYVB 3I6LE 4POYA 3GSRA 3TP4A 4ZSOE 1JPGB 4OZ4B 4I18B 4I2XE 4MXVE 2R4SL 1BPVA 4JFQB 3VXUD 4IBLT 1ONQB 2F9BT 4PTUA 3LHPL 1EJOH 1SEBB 4WU7A 1QLRA 3PGDB 4EDXA 4A6YL 1NPUA 2R1YB 3LSOA 4FNLH 5IFHH 3ULVL 5DD6A 5CCKL 3RU8L 4MAUH 4JREB 2WUBL 4LCCA 4PR5B 1U8NA 3HC4H 4AIZB 5HYJD 3EOBA 3K4ZA 3MNWB 4Y1AA 1G1YA 2HRPL 4P23D 5ENWA 2WBJD 1A5FH 2ZNXA 3OB0H 2FHCA 4P3DB 1T7ZA 2CKBA 1ZHLB 1HXMB 1U8JA 4KPHH 3ILQC 2ARJQ 32C2A 5KS9A 2FIRT 2AI0H 3D25A 3P2TA 2MQ0A 4DAGL 3KPQA 4H20H 5HGBB 5B8CB 4NQCA 1K85A 1A6WL 2ARJB 3BPOC 1AGEB 3AU1A 4JG1H 3LMJH 2AXGB 4LLQA 4CNIA 1EGJL 1LMKA 5JW3H 4HFUH 1YEEH 3FQXA 4HLJA 4LU5L 5EN2A 5GZND 1JPFB 2BVUA 4K7PH 5C9JA 3DUSB 3NCFB 3O41A 3CZFB 3GSUA 4EVNA 4G8IA 3BW9A 1FVDB 4D9QD 1AGDB 3QHZH 4X99B 1K8IB 1RUAH 3U9PH 3WHE1 1QUNA 4Y5VC 5EOQL 5ICZB 4UIMB 4PJHE 5ADPH 4Z9KB 3MLXH 4TSBH 1TQCC 2PN5A 4XBEH 2W59A 3ULVD 2XNAA 3BEWB 5C0BD 2IG2L 1FFOA 3HI1B 2DWEB 5B22A 1NCAL 2OCFD 1R5IB 2VLRE 1IGJB 2BJMH 5DJDA 4XNZC 1UXSB 5IBUG 1WQVT 4GKSB 3NTCL 4TVPL 5TE4H 3Q6GL 5JZ7C 1D7FA 1OTSD 3ZHLA 5IW3A 1UC6A 3EYFB 2YK1L 2X4TB 4I0PD 1BVKB 4LAJH 1FVCA 2P24A 1NCDL 1NMBL 4LVHC 2VIRA 1ED3A 2ORBH 4UU9B 4CADA 4KQ3L 2Q7YB 3MR9A 3RWHB 1S7WB 1V5JA 4AIOA 1U8PB 1X5HA 1MIMH 4AM0A 4YQXL 4PJCF 3MRRB 2LTQB 2YN5A 4N0YL 1FC2D 2IMNA 1KG0B 3OAYH 3BIAX 4YHNB 3L7FB 2OI9C 1F4XH 4XPTL 4ODUB 3D9AH 1P7HL 1NGQH 3HE7C 4ONHA 4LSUH 4UOJA 5JIHA 4PP2B 1L6XA 3ES6B 4TUOA 4Y19A 5IFJB 3MA9H 4RX4A 4NP4L 4S0SD 3QFJD 1Z9SA 1MFBH 2ADFL 3EO0B 4DUWA 4Y4KA 1KB5H 1WAAA 1G9MH 4G6AD 4R7NA 1P53A 1NBVH 4RFNC 4ERSH 4LCWA 5IIEB 5ECJE 4BQ8A 3BP5B 3K46A 4TVPD 5J1AA 1JWMA 3UTTD 4YHMH 1CDUA 5B39G 4KMTL 5F1NB 1FL6A 3INUH 4A2LA 5KAQF 4OTXL 3VD7A 5DJCA 4JRYA 4EUPB 2DQJL 2PUQT 4JHAH 4ZXBB 5C6WH 3MLSH 2BVQA 4BFGA 1U92B 2VNCA 4Y2OA 3ARSA 4MQXC 3H42H 2YZ8A 1WSST 1CGXA 1MSPA 3VW3H 5DJ6A 3P9LB 4CW1B 1AQKH 1E4JA 1UWXK 3UCRA 2VDKH 4KVCH 1E6OH 3LQZB 4NZTH 4R9HA 3GB7A 2WK2A 2JELL 1SYVB 2BRQA 4HJ0D 3NH7L 4S10A 4LVEA 1U95A 3QULB 2J5LC 1R0AL 1EDQA 3MMEA 3W11C 3KPPA 5D96C 4PBVC 3QJHA 2F74B 5DMGD 2BC4B 4JE4B 4MAYD 2O5XH 1V7MH 2PYEE 2QEJA 1ZE3C 4UZGA 3Q1SH 4TN9A 3A0OA 1YNTA 5C08A 4G43B 3ALXA 4ODBD 1U8HB 4PJCE 3IDYC 4KI5D 5HTSA 2E7HA 3VD3A 3ILPA 4ISVA 4KRPC 4PGCB 3EOAA 1HHGA 3QNZA 4XNUH 2J2ZA 3RKDD 3K8KA 5I16A 1G84A 2X89D 4PJFF 3MSPA 2Y5TA 1IGFH 3PWPE 4X9GA 4P2RD 3V2AR 4JN2B 3DJ9A 2VLKE 5TDPA 3RDTB 3WNPA 2FECI 3RVTC 5KSBF 1QYGH 4YC2C 4XXCA 3L3KB 3LN4A 3IDMA 3TBWA 2AS5M 3SPVA 3PDGA 5FGBA 2HT2C 2OL3A 2DQDL 1LE5B 4OKVB 2YPKA 3GO1L 1EUUA 4BSVB 5EBLB 2BVOA 4BYHA 1Z9OA 1ZHNA 2P8LB 5J6GB 3AMKA 4D9LH 5E5MA 3FB6B 1JN6B 2E9WA 3ZO0A 4MA3B 5D7LA 4J3WA 4WO4A 1VSCA 5IB5A 4J3OC 5K93A 1JGDB 3MV8A 1TFHA 5GGSY 2VDMH 2NY2D 2BNQD 4H25A 5DMKA 3VRLF 1DQDH 4NUJB 3BZDA 4PGDB 5FDWA 1CBVH 5DRZB 4DW2H 1F8TH 1HYSC 4GRWH 5ETUA 1T80A 1X5KA 2X4RA 3BHBB 2X10A 5JPMA 1Z2KA 5DZOA 2EZ0D 5ESQB 4ZUSA 2PXYB 2NXYB 5C3TA 2EKJA 2O93L 4JDVB 4YO0A 1AO7B 1DVFA 4OIIH 5GJTL 4PY8J 4ZSOB 3VDCA 1KJMA 5E2JA 1I7RB 2WUCH 4OF8A 4MD4A 3NFSH 4HMDA 2DICA 4UINL 1A6TA 2PO6B 2FYYB 3K4AA 5CGYC 3TBTA 1G1CA 3C5ZD 5IHUH 1YN7A 4L29A 3WSQL 3HI5L 3L1OL 3NFNA 4JPVH 1JGLH 4OLWH 3HLAA 4PB0H 3UDWA 4HV8B 4ORGB 1DUYA 2YSSB 5C0RH 4F57L 1FL3A 1RUMH 5DD5H 4HJJH 3DX8A 1ZA6A 3UJTL 1S7UA 2BOCA 2A6DB 1L7TH 4RFEA 4ZAKD 4U7KA 1UCBH 1T1ZB 4WY7H 4OZIA 3HCVB 4PJFE 3RGVB 5IVZA 1C16A 5J4MA 5D2LB 4LCCC 3VWJD 2DQEL 2QSCL 1J8HD 1WIPA 4MA8H 5KSBE 1BM3H 1OTUC 1S7XB 4OCRH 4ZYKB 5J9PA 2CGRH 1BP3B 3MRCB 1VDGA 2ED8A 3IXTA 3KYKH 2A77H 2FJGA 4M8QA 4PBXA 3C60A 4HKXB 3S3PA 3CDGA 1A7OH 2OMNA 1VPOH 2AV1B 1CF8H 1ROWA 3PWLB 2BRRL 5K9OA 5D2NA 5DS8B 1CLCA 3EKCA 1TJIL 3RA7L 5I1JH 1CFTB 3D69A 5H35B 2E3VA 1HHIB 3NA4A 4NIKB 1CG9B 4J3VA 1U8OA 2X4QA 4KJPC 4Q6IA 5I8OL 4DGIH 3E8UL 4PJHB 2VABB 4N5UA 4PV9A 4DTGH 2VLME 3CMGA 3R0NA 3IF1B 4RGNC 3VRLE 3GBNL 1JNJA 4MJ6B 1SVZA 2VLJA 2VLRB 3SOBH 4BFBD 3O4OC 1S7SB 1D6VH 3VXMD 4JZOB 1F4HA 4BA8A 4MNQA 1J1XL 4R6UA 5HVGB 1UM4H 4WDIA 1WWAX 1QA9B 2BY1A 5GS0L 2Z93B 2AKRB 4IRJA 4YGVB 2IJ0C 2YUZA 1TVBB 1CQYA 4JN1L 1CR9L 4OI9A 5GRJH 1X4YA 4MWFB 2BNRE 4O5LH 4Z0XB 3UTOA 1IT9H 3KPLB 3Q5TA 1AR1C 1C7TA 4OV5B 4OSUH 4FQJL 1RUKH 2E7LA 4F9PA 1ZGLP 1QSED 2P5ED 4DVRH 1N26A 5BVJB 1QD0A 2D7MA 3ZDZF 4E0RB 3VGAC 4PJ8B 1UH4A 4XTRD 1VFBA 2RFXB 4NY