4PJ9A

Structure of human mr1-5-op-ru in complex with human mait traj20 tcr
Total Genus 72
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
72
sequence length
271
structure length
262
Chain Sequence
MRTHSLRYFRLGVSDPIHGVPEFISVGYVDSHPITTYDSVTRQKEPRAPWMAENLAPDHWERYTQLLRGWQQMFKVELKRLQRHYNHSGSHTYQRMIGCELLEDGSTTGFLQYAYDGQDFLIFNKDTLSWLAVDNVAHTIKQAWEANQHELLYQKNWLEEECIAWLKRFLEYGKDTLQRTEPPLVRVNRKGVTALFCKAHGFYPPEIYMTWMKNGEEIVQEIDYGDILPSGDGTYQAWASIELNLYSCHVEHSGVHMVLQVP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Major histocompatibility complex class I-related gene protei
publication title A molecular basis underpinning the T cell receptor heterogeneity of mucosal-associated invariant T cells.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
total genus 72
structure length 262
sequence length 271
ec nomenclature
pdb deposition date 2014-05-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00129 MHC_I Class I Histocompatibility antigen, domains alpha 1 and 2
A PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4pj9A02
3.30.500.10 Alpha Beta 2-Layer Sandwich Murine Class I Major Histocompatibility Complex, H2-DB; Chain A, domain 1 MHC class I-like antigen recognition-like 4pj9A01
2QSTA 2VR5A 2ICCA 1ADQA 4CNIB 1HHHA 3U30B 4OQTL 2GAZB 5I0ZA 1UB5A 4X7CC 2R0KH 5DO2C 3JTCA 3WLBA 3GRWH 2O5YH 2VXVH 5I1GL 4I2XB 1G7HA 4HUKB 2HYMA 4DZBB 1Q9OB 4HH9B 1LEGA 3E3QC 3D69B 5IK3A 1C12B 1KF9B 5JXED 2NW2A 3S4SG 2AXFA 4QTIL 2D7PA 4JO3H 2R1YB 1EZVX 5JUEL 1J0KA 1A6AB 4UT6L 4HGKC 4M1GL 1PBYA 1GGBL 2BRRH 3HPJB 4NWUL 2M2DA 5L88H 3KPQB 1NLBL 1KIRA 2MWCA 1ND0A 2Y1VA 1B4JH 2A0LD 3ZDYF 2G5BA 1TJIH 3H3PL 4HK3N 3GHBH 2FR4A 5JXAL 4R4ND 3MLUL 4P3WA 3IRZA 1M7IB 2VQ1A 4O51B 1HEZB 3MLSL 4KROC 3KPNB 4FHBD 4F7PA 1PG7H 3KPMB 4QRRA 2P8LB 3O3DA 5C0AB 1FGNH 4OJFL 1QFPA 3L6FA 1WAAA 4HWEL 2R15A 1LO0H 2DKUA 1U8MA 3RKDD 2Z8RA 5E56A 1JRHH 2PYEA 4CJ1A 4K3JL 3P2TA 1QR1B 1FRGL 3MNVB 2YN5A 1DQQA 3TN0B 1I7RB 3JV6A 3Q5YA 4U2YA 1QPXA 3ULUC 4XP6H 4KKNA 3NGBB 5F3BA 4ZYKB 2CKNA 2YPLD 4G6MH 3A67H 4KK8C 3TBSB 5HHOB 1NUFA 8FABB 4U1GC 4UAOB 1F3JB 3GJFA 5IT2H 1KEGL 5SX4H 3VMPA 4C57C 2DYPB 4QNPE 3BQUC 1T1XB 1JFQH 3QXAB 5MP6H 5CHNA 1X5KA 1MF2L 4FNLH 4M8QA 4OIBA 2VLLB 1X6NA 4PJBA 3BUYA 4I1NB 1MRDL 4MXVF 1QSFD 3C2AH 1H5BC 1WT5A 4KY1H 1B6DA 1KENH 2JCCF 4G8FA 5C7XL 5EC2B 4G6FB 4HPYL 4HG4K 1RFDH 2FBOJ 3MOQA 4LF3A 4I3GA 1HOCB 2DJSA 1Z6JT 4XPBL 3T4AA 5IW1B 1DDHA 1YYLH 2VWEE 4WFED 3X12A 2YPLE 4MQTB 1ZGLP 3U30C 4P23D 3V5HA 4I0KA 3SGDH 3HPLA 4PRHA 3RVXC 4TN9A 4L29B 5IVZA 1N6VA 4TOYH 3ZKMD 3DMMA 3I6LD 4LMQE 3HMWL 4H1LB 2B39A 1W0YT 4DZ8B 5F9OH 4XTRC 4HUWB 1R3IL 3RRQA 3D25B 5GS2D 1QHPA 3EDDA 1FH5L 2GKIA 1M05A 4GAGH 5GGQH 5I1IL 4ODXB 4XNYL 1QSFE 4PP2B 4K3HA 2PETA 4RQQB 1GZQB 1RURH 1FYTD 3R06B 4P5TD 4B0MM 2COQA 4PTTA 4L8CB 1HHGB 2BERA 3DVNA 2OSLB 5C86A 2Z35A 1KLGA 1AGDA 5EO1A 3B9DA 3C60D 2EH7L 1QUNA 4PV8A 4IRSB 2VDQH 2YPVH 3C6SA 3LPWA 4WFEE 5DI8B 5I1EL 2NZIA 1QO3A 5HVWA 4QHLA 4NQVA 5HJ3A 1KTDB 4AG4H 4YHML 1QYGL 3EO9H 1IAIL 4ZSOA 1BEYH 3OKDA 3RL2B 4F7CB 3I6LE 5DMJB 3ZMRA 3O8XD 1JGEA 5K9OA 2F8VA 5HYFA 2XN9B 3GMLB 3QHTC 4PS4H 2Q87A 3TN0C 2VH5H 4A2LA 2B4CH 4MJ6A 3O0RH 2Q8AH 4RWYH 5EOTA 4GXVH 4Q0XL 5B3JF 1NBVL 3UPRB 1FYTE 4GRWH 3HE7C 4PJEA 4DTGH 8CGTA 5KAQF 3FN3A 4LLMB 1MCNA 3RWGA 1OY3B 4NKQB 2R2HA 4UAOC 2IALA 1SEQL 2EDLA 3MRJB 3T04D 2A9MH 2A6KA 2Z4QA 3UEZA 3TFKC 4F2MB 5L9DH 1LILA 4LLWB 2DWDA 4WWKB 4FG6C 3CPLA 1KFAH 4LCUA 4PJIB 1TJHH 5BMFH 4HIIA 4ODWB 5D7IF 5IM7B 3SDXB 1E4WH 4ZFOL 5FB8B 6CGTA 4HHAA 3TJHA 3THML 2BP3A 4XBGA 3TP4A 5A2FA 5TDOB 1B4RA 4L4VB 3EFDH 2DJUA 3HS0B 5SWSB 5SWZA 1DBMH 4ZD3H 3D87B 3BDBA 3UTSB 3BDXA 2Q7YA 3REWB 3QHZL 5GSVA 4D9LH 4IRJB 4M3KB 3K1DA 3OGCA 1AKJB 4N0CD 3LZFH 4PY8J 4LIQL 1BIHA 1QSZA 5I1HH 5M7QA 3WN5A 1FL3A 4FA8A 2QV2A 1D5BB 3BWAA 2GYSA 3R1GL 2FR4B 5D93B 4GH7B 1TPXB 5DUPH 2EE2A 3RAJH 2AV1A 3R8BB 4XBPB 5JR1H 2ZUUA 4YO0A 4HWZB 5EU6B 1I3GL 1S78D 5K33A 1WLHA 5CP3H 3GUTB 1T0NB 1S7UA 2YOCA 4F37K 3G5YB 4UDUB 2YR3A 5DFVC 1KN4H 5KOMC 3VFWA 2HFGL 5F6IB 1OAUH 3V4VL 3BFOA 1F58L 4J3WA 3G6AA 4OQTH 3JV6B 4JKKA 1UH3A 2XY1A 4HKXA 5EH1A 1J0ZA 3JV0A 3ARDA 2GT9A 2PXYA 1KJ2A 4P99A 4WI4A 1XCQA 5I1GH 2R69L 2KZWA 3FONB 4AENA 3MZTA 4GBXD 4MXWL 2I24N 4WY7L 3SDAD 1JZ7A 1RJZA 1FVDB 1K2DB 4JRYA 4G5ZL 2C1OA 4LCCB 4BQ9A 2AABH 1PSKL 1RZJH 4RZCA 4WW2F 2X41A 5DUBA 5E2VL 5IMOB 2W9LA 5MEOA 4QTIH 5KSAA 4KVNH 4Q9QH 5T5NG 4LCWB 2CK2A 4UT6H 5D7KD 1QLFA 4M1GH 1VFBB 3WO4B 5EIQA 2GCYB 4A6YL 4KK9D 3RIFF 1QZ1A 4WU5B 1NLBH 2VXTL 5FKPA 3BKCH 5IG7B 4HV8B 4OB5L 3CSYA 2PKDA 1CL7H 5JXAH 4PJ5D 3MLUH 3SDCC 1XEDA 3QNYA 1E28B 4HWNA 1NCCL 1OQXA 5LG1A 5GGVL 3VGDA 5TQ0H 4U1HA 3QQ3B 2QR0A 2DQIH 5AUMA 3O3EA 3ULUF 3LV3A 4GO6B 3EO1B 1G6VK 3OKMA 2MSPA 1H3PH 4QRSB 3NCMA 3SY0B 3HPLB 5DHYA 5D6DC 3ZDYE 3QULA 1FRGH 3RFZC 4YBQC 4H25A 4XNQA 4EDXA 3CU1A 1OPGH 3FCTA 1KT2B 2GI7A 3MO1A 3G08A 4MXQD 3VXNA 4R4FH 5D7KE 3ARPA 2D03H 3TA3A 1WCQA 3N06B 4HUMB 2LU4A 1M05B 3TCXA 1JGUL 3I02B 4IRJC 3T4YB 3L3KB 3GSNA 3T0DA 2EC9U 1KEGH 3MFGB 2V7HA 4PJ5E 3PG2A 1T0MB 3BKJL 3D18A 5LCVL 1JHTA 1MF2H 3FAWA 4UT7L 5FHBH 2NYYD 4ORGB 2FJFA 1MRDH 5DJXA 3C6SB 5E2JA 1OLZA 5D2NA 5C7XH 2Z92B 1J1XH 4NNYB 3QEQB 4HPYH 3BZFB 3IXTB 3UBXG 4JM2A 1Z0MA 3U46B 4ZSOB 3P73A 3QI9A 4XNXL 4ETQB 2AEQL 2ATPB 2ZOKB 4XPBH 5F6IC 3PP4L 5I0DA 5H35B 4UIKL 5CGTA 4WO4A 1NCWL 3ECBA 4U1NB 3C6LC 1KTRL 1A4KB 5GRUH 4CVUA 2UZIH 3QUXD 4MXVE 1UVQB 4F80A 2JCCE 2X6MA 5TE7L 1DQDL 4HUUA 2G9HA 2FYYB 1AIFA 4J7RA 1P7KA 1MCFA 2HVKA 1B0RA 3ESVF 4I18B 3SE4A 1FH5H 2IBBA 1JWSB 2MCPH 4X98A 5I1IH 4NQCA 3OR6A 5HHPB 3TBVA 3RJDA 3SCMB 3CDYA 3DX7B 3SE9L 1JPTH 1CE1L 4HEME 5JQ6H 3WO4C 3QUMB 4LCUB 1YNLH 1WC7A 1VA9A 1HILA 3VFTB 4X6EA 4XB7A 2VLJB 1A1OA 4QF1A 4LLDA 1FYHB 3W5NA 5KJRL 1NCAL 2NY6C 5I1EH 1T89C 2YD8A 1YDPA 43CAA 2VABB 4NQDB 2JKXA 1SJVA 4YHMH 4GG6F 2APWA 1DUYA 3QFJD 1Q1JL 5D1ZD 2F19L 2Y36L 4O02H 1KB9K 2G2RB 5IR1B 2HJKA 2WP3O 1UT9A 4Q9CA 5GSVB 5KVFH 5FGSA 4XMKL 2J3SA 4FABL 1H9VA 5I8OL 2CDEB 5GGSY 2XWJB 4XPTL 3EKCA 3MROA 5E2UL 4Q0XH 4P3DA 4MNQD 3WXWH 1NBVH 1YJDL 4XMPL 4CMHB 2DQUL 1WSST 4W6YB 5ALBH 1I1FB 4H20L 3GI9L 4EVNB 3VDAA 5T1KA 3S88L 1NC4A 4RMWA 3WFBH 3MLTB 3VWKB 4UU9B 3NPSC 5E00A 1OM3L 3C5ZA 1FGVL 1RJYB 1JNLL 2QQLL 4QOKA 4OZFH 1XF3B 3WIHL 4ZUWB 2VDML 2Y06L 2ARWA 3ULVC 3RUGB 4HFUH 4QO1A 1MCKA 3LVEA 3OAZK 3QFJE 5B3JE 1MCWM 2IAMC 4NC1C 1YC8A 1ES0A 2CLZA 4OFVA 5J3HC 1IJ9A 4CVXA 5HTSA 5HI3C 5I8EA 3PGCA 3RWFB 3OX8B 2ZUSA 1XCQB 2R1XB 1GGIL 4PYHA 3U6RA 4HS8H 4ZTOH 4NPYB 1A5FL 4MNQE 5ETUB 4MJ4A 5EBLA 4HSQA 3LKQB 4FQQB 2C1OB 1N59B 2QADD 1F00I 1U8IA 4ZPTA 5KN5B 3RZCB 3HB3C 5D7IE 4H88L 1EEYB 4W6XB 2NY5C 4LIQH 1S9XB 1QNZH 2QHLA 4N0UA 2HWZL 3R1GH 2XFXA 5IQ7L 2UZYB 4Y4FB 3CNKA 1Q38A 4NOFA 3SCMC 3QNYB 3TT1L 3IFLL 2IGFL 4RWHA 4U1HB 1NKOA 5HHNA 1T22A 2GW5A 2YUXA 1RUPL 2YBRA 5ESQB 3TIEA 1N64L 3MRKB 5TE6L 4Y16A 1C16A 3V4VH 1UZ8A 3QCTH 2AI0L 4KK6C 2QQQA 4RAVA 5D70L 5L0QB 3MRIA 3HMXA 3MLVL 5HHXL 4H25B 4EDXB 5I1DA 2VAAA 2DL9A 3FCTB 1WGOA 4H5SA 3D85A 3MO1B 1S5HA 1OL0A 4KROD 4AMKL 2R69H 3TA3B 1VENA 4WFHD 4PGCA 5ERWB 2HFTA 5F1OB 3NAAH 2ED9A 1I9IL 4U4BA 4JO2H 3E3QE 1MPAH 4CMHC 4LLQB 1EJ6A 5E2WL 1JNNL 4EUPB 3OJMB 4HUNB 4QXUH 5HDQH 3ULUD 1IBGH 4PJIF 4N8PA 3SDXF 1J8HA 4MQ7B 4KK8D 1X44A 5CIPH 5AD0A 1Q9WB 1L7IH 3EYFA 2OR9H 1H8NA 4ZG1A 1U8NB 5GGVH 5E8DL 4PRDA 4M1DL 3BQUD 1UB6B 1AY1L 1F4HA 4Y4HA 4CN1A 1QTYT 3PWPB 3GSOA 4L9LA 2MCG1 2DQCH 4UQ2A 2JELL 2PCPA 2VN4A 1K4CA 3AC0A 4X5WB 5EULV 5F7YC 5LGJA 5EUKB 4XAWH 3JTSB 1DQMH 1SJEA 5FYKH 2FSEA 3DURB 3X3FL 1QFHA 2A77L 1VEMA 3INUH 4R90L 1B0RB 4WTZA 5IJKC 3RZCC 3UX9B 3ULUE 2FDBP 1JGUH 3LKSA 2GJJA 1N0XL 3L5XH 3C8KB 1D7FA 2GJ6B 5BQ7B 1S7SA 3V0VA 3RVXD 4QT5B 5E4IA 4XNZB 1SBBA 4S1QH 4OZIB 1N3NB 2NY2D 43C9A 5ITFA 1MLCB 4UT7H 4I48B 1S5IH 3AB0B 4NRYA 4TUOA 1YEJL 5INCA 4Y4FC 4LLDB 5T3XD 3X11A 3KAAA 3T3MF 4FN0A 2P5WA 4Y5XC 5DK2A 3V6OA 2A6IA 43CAB 4P4KA 2G75B 2YD2A 3MNWA 4N8VA 2FJHA 2GSIA 3ABZA 4J3TA 4BFEA 3QCUH 3QXDA 4MA7L 3VXRE 1B90A 1U91B 3GMQA 3WNNA 4JB9L 2X4QA 2BHYA 3L3IB 2WUBL 1FL6B 4JANB 5L0QC 1IAKA 2VZUA 2E3VA 1J18A 5GIRA 4R97B 1A7NH 5JHLL 4IMLA 4TULL 2Z93B 2XKNA 5DMIL 4X6DB 3MUHL 1N7MH 1HINH 3LQAH 4LRIC 5A16A 1WWBX 3QIWB 5IF0B 1OTUC 3KS0J 5C0AD 3CVHL 5DSCB 1QKZH 2CXGA 4NNXA 5T1KB 3TZVA 2J5LB 5FV1L 3K81A 4I2XE 2QHRH 3LH2L 4CVWA 5ID1B 5GZOC 1YMHA 5JDSA 1P4BL 4XZUB 5T3XE 5HGHB 2G60L 1QRNB 2X4UA 4WI9A 4QOKB 3KLSA 4J12A 3TN0D 1BM3H 1I9RL 3MRGB 4M02A 2X1QA 5IMKB 2AK1H 1FNGB 1WUNT 5IBTH 4H0IA 4GQ9H 4YEFA 3TPUA 1T2QL 5HHOD 5KJRH 2VIRA 3TNMB 5I73B 5D72H 2B8OT 3OL2A 2DYPD 5CEXA 3TFKD 3OKKA 4BFBD 5B3NA 1Q1JH 4OGYL 2Y36H 3WHE1 4JFPB 2MQCA 2R2CA 1ZV5A 4RDQG 1N26A 1RUKH 5FCSH 5IEHA 3MLWL 3NTCL 3LKRA 5C0AE 4FABH 1MIML 2X4OA 5F44A 2BSTB 3DUUB 1T1ZB 5F7UA 3H9YA 1G6RA 4XPTH 5ID0B 4G6FD 4P46B 3I6GB 5D7SL 2E7LE 4ONHB 2WINB 3C2SA 2BOCA 5E2UH 1YJDH 2J6EA 2DQUH 4GG6E 4N0UB 1WWCA 4H20H 2V2WA 4C4KT 5GZNC 3IDYC 3S88H 5E99L 4TPRL 4K9EH 5C6WH 2CKBH 3MV9A 1FNEA 1NL0H 5HHOE 3QCVL 1KPRA 1FGVH 3FT4A 2QQLH 2QQNL 1IVLA 3MA9L 3OJDA 3H9SA 4FQJL 5F7NC 5FUZL 1U95A 2CJUL 1RZ8B 3WIHH 5JPNA 2VDMH 4JY4A 4Z5RA 3AB0C 1O0VA 2UVFA 3O41B 1H0DA 3FQNB 4RMUA 2XZCL 1NCNA 4LVHB 2OL3B 1KIPA 1QQDB 3T3PF 5SX5H 4H5SB 3V52H 5EDXA 1U8JA 2BNRA 1GGIH 4HXBL 1MNUL 2MHAA 5BOZG 1A5FH 2H9GA 5DFVD 2W59A 1KIUA 1PY9A 4IRSD 3NN8A 3GJEA 5GS1A 1E6JL 1TLKA 3T0EA 1S7TA 3QIWC 4R8WL 5IGXH 4U6YB 2BMKB 2DQDL 3B9EA 3QIUB 1NAMA 1FHGA 2C4FT 2J5LC 1D5ZB 5GJTL 3AS2A 1D6EB 2OJZL 2HWZH 5I66A 1GPOL 3LQZA 1LP9B 4QXGH 1KCVL 2XN9D 3A6OA 1BZ9B 2IGFH 1VFAA 4JGJA 5DEZA 4YHLL 5HBBA 4JLRA 1LEKA 1A7OL 4UQ2B 1NGWA 5JW5B 1G9NH 3MUJA 4EN3A 3MMEB 4XVUC 5GRJH 5D70H 3U0PB 4AL8H 3MJ6A 5LAXB 1P7QB 3D0LA 3QWQB 2NR6C 4YIQB 1UJTA 4WWKD 1IGIL 2HKHL 1CG9B 5C3LD 3FOMB 1DQLL 1R5VB 4Z6AT 2OTPA 1LE5B 3KYAA 3ZSTA 3VFVA 1N2RA 2Z31A 4PB9L 4M43L 4D9RD 4FFWD 3VCLA 1EDQA 4P46C 5C0CA 3H3KA 4ODSH 3Q3GA 3KYOA 3DV4B 1MEXL 5GGSA 2EIZA 2XN9E 3TO4A 3GRWA 3CC5A 4L4VD 2IPKA 1JNNH 3WUWB 5SWSD 4I5BB 3U7AA 4NRYB 1MCSA 3UTSD 3F7VA 5D7LE 4XHQA 3C87A 1QOKA 2PN5A 4DGYH 5MEPA 1CGTA 4NJAL 3VFGL 4LEXL 4IRJD 5DJAA 1AKJD 4OV5A 5C0GA 2GK2A 3QPQC 2QJDA 4XP9H 5F7EL 4CADB 2A9NH 4V2CB 2QKIB 5T33H 4JVUA 1ONQA 4PJIE 3FQUA 1QLRA 4XP4H 1MFDH 5F9DC 5K9JL 3CSPA 3SDXE 4D9RE 1YEEL 4POUB 1RZIA 3TYFA 3ZYZA 3RWDB 1EK3A 1OT2A 3MRDA 4XVSH 4N5EC 1YEIH 1INQB 2A77H 2BNUB 1EGJL 4L4VE 5JO5A 1URLA 2VDKL 3QQNA 5SWSE 3UJIL 5AZ2L 1P53A 5A2KH 1IKNC 1DVFA 3IS0X 3IKKA 5FECB 3UTSE 2VXUH 4HX1B 3KLDA 1PQZA 3DO3A 3SGKC 3DPBA 1BX2A 3QIUC 1J5OH 4AEHH 5JW3H 3BP6B 4J8RB 4XXCA 1YEJH 1HI6B 1J0IA 1GC1L 4Z8FL 4PJGA 5F21B 3C09C 4ZUSA 4BH8B 4YXKH 3MSPA 3F6LA 3PNWB 4LSQL 4OFDA 4DEPB 3HNSL 2MNUA 3S35L 2HVJA 5E08L 4F58L 1C5BL 4LCWD 3MV7A 5JIIA 4F7MA 4U0RB 4YHIA 2GITA 4K2UL 3PWVB 3IDIA 3O9WB 3MLXL 5JNYB 2PTTB 3PV6A 4Y7MA 1NEUA 1TCRA 5HPOA 3T3ME 2BOCB 3MCKB 2X9WA 1JTPA 5CINH 5DDHA 2H8PB 2R29H 1J1PL 1NFIA 3BH9B 3MUGA 1PDKA 2UUDH 3U79A 1FNEB 1L0QA 3IF1A 1I1YA 1P4BH 2JJSA 2HT3D 3PV7A 4JM2F 3FT4B 2B20A 3SKOB 3H9SB 1CIUA 3TF7C 1I9RH 3BXNB 4FQXB 4V3EB 2P48B 3CFBB 3PWLB 2MQ0A 2FNBA 4LCWE 3UCRA 5HYIA 4F7TA 1H0DB 1FAIL 1PLGH 3QDGA 2WUCL 3GK8L 2N7AA 1FFQA 5ACLA 5ICZB 4HUVB 2D7OA 3DV6B 4YE4L 2ZUQB 3BT2L 1U8JB 5TF1H 3FT3B 3EYSL 4ZDHA 1KELL 3JWOH 4PLNC 4HWBH 3MJ9A 4XVTH 4ODHL 4UQ3B 3VA6A 3MLWH 4E5XB 1TCMA 3WDIA 3RVWD 4M48H 5IHZA 4HLZG 4K71B 4J3SA 4PREA 5H94A 3GI8L 2XPGB 4JKPH 1PZUB 3QEQD 5J3HD 4G9FB 4U7SA 4PJFB 3AU1B 3HUJB 5HI3D 3SQOH 1IGYA 1AJ7L 2W60A 3CFIC 4OZIF 2PNDA 4G6JH 2EIDA 2W91A 4ZFFA 5I66B 5DEFB 4WW1B 4LVNB 4WNQB 1OGAB 4X6CA 3VJ6A 3D3VA 2YUVA 1PX3A 5C8JA 5D6CB 2GFBB 5JQHC 1VFAB 3QCVH 4K7FA 3MJ7A 3GSQB 2QQNH 3EHBC 3RWCB 4HS3A 4FQJH 3BEWB 5DTFA 5FOBA 1UKSA 3FFDB 4NZJA 3A6CL 4GKOA 1WFOA 2XZCH 3U36B 3S4SA 3BGAA 5GGVY 5F72S 4D8PA 2HFFB 4DEPC 5DR5H 3ZHLA 4NC1E 2R0LL 3SCMD 1UKQA 3CLEL 5DZNA 1G9ML 4LOUD 3QEQE 5DWUH 3W9DB 1YPZA 4PR5A 5DJ6A 2A73B 1CICB 4ZSOE 3O9WC 4R0LA 1ZA3A 2VLJD 4G9DA 1IZKA 4EI5B 4LEOA 5FDWB 1RIUH 4NFBA 4KK6D 1EH9A 1E6JH 2C3GA 3V0WL 4NQDD 2IPKB 2F74B 3T3PE 4Y8DC 1OW0C 1NGZA 2DQDH 3JTTA 4F9LA 3QO1A 1OAZL 2VZSA 5GJTH 2FX7L 2H2PD 2K7QA 2AEPH 4O2EA 1TMCB 4HZAA 4KRMB 5A3IC 5A1AA 3CFEB 3OJ2C 5DRZA 3NIGF 4JO4H 1CF8L 4FQXC 4OBRA 1UXWB 1PG7X 3KJ4B 3EJJX 2W07A 4F37F 1AXSA 1MHEA 3BO8B 3QEHB 4M5ZH 1QLRB 3GIZH 4KTDH 3VWKD 1UGNA 4YX2H 2VLJE 5TH2A 3TYFB 4Z7OF 2XTJB 3MREA 5DQ9A 1HXYA 3FB6A 3LD8B 4PG2A 4LLYB 5J11B 1IGIH 2HKHH 1FIEA 1DQLH 4LSPL 3RGVA 4NQDE 5JO5B 2C3VB 2QQKL 5C0FB 4K71C 4M43H 4KQ3L 1IC7L 2OYPA 4OQTA 1ITBB 4ISVA 1MEXH 4XC3L 5HDLA 5B39G 1AGCA 3IJYB 5ISZA 2ZPKL 3T77B 5CWSA 4HKBA 1Q9LA 3KYNB 2AKRA 4OCYL 5CSBA 2J7LA 4UOW1 4JREB 5TGBB 1ZVYA 5HYEA 4NKOA 4BSVA 4MA8H 3WS6C 3LKOB 2F54A 4NKMA 3RZCD 2PW2A 2XKUA 3VFGH 3BDYL 1R3HB 2P47B 32C2B 2Q3AA 1U58B 4L8SC 4QGTA 4L3EA 4K8RD 1KPVB 3RDTC 3LRHA 4IM8A 1MIEL 2R39A 1X5FA 4HC1H 5GSRA 3FB8A 1RZGB 4MAYB 4M61A 4L9DA 2NY1C 1A7PH 4Y4FD 1NBYB 2IG2H 5CBAA 3ME0A 1I3VA 1U3ZA 2C4XA 5F7KC 2PO6C 4H8WC 5EIIB 4JZOA 5GXBB 4J4PD 5BXFA 1B88A 3VI4F 2A2QT 1CICC 4KKCC 1EGJH 4J23A 3S36X 2Q6WB 3FT2A 3WDHA 5H8DA 3SPVA 2VDKH 5AZ2H 1PY4A 1LP9F 2ORBL 5KAQG 5AYUL 3P11L 3RHWK 4DKFH 1MFBL 3WJLC 3IDGB 5BZWB 1JGDA 2YUZA 1JWUA 3UO1H 4JG0H 5E5MA 1BFTA 3KG5A 4ZO6A 2AEWA 4F7TB 3TA3D 3DBXA 4X8JA 1OTUD 1V3KA 2DQEH 4U1LB 4BQ8A 2EKSA 1BQHG 1CZ8L 4QLRA 3L3HA 5GZOD 1ZGLA 3OXRA 3MJ8B 5GGTH 1CGXA 3S35H 3KJ4C 4YH6A 3ZL4H 1C5BH 1KCSL 1R24B 1TVDA 4KJWC 3DX6B 3FQWB 5LGHH 3N0PB 3MLXH 4BQCA 2CH8A 3ULUL 3LEVH 2XTJC 1T1WB 3IFNL 4JM2D 1GSMA 4JDZA 4GW1A 3TESA 1U8LA 1YN6B 4LGRB 2WAHA 5EBMA 4IDJL 4JY6B 5JHDA 1Q9KB 3PWPD 4OKVA 2X4TB 3D3VB 5EU4B 2BOBA 4M7ZB 4YZFF 3AREB 3MRBA 4YEEA 1DQTA 2R1WA 4K7FB 4KHXL 2WW8A 2IH3A 2YD4A 2YS4A 4ERSL 4HKJA 4GRWB 3T0AA 4RMQA 4XBEH 3MRLA 4J3VA 3U7WH 4JREC 4HF5H 4RSVA 5KANG 5H2BA 3PWUA 2WZPD 4Z7NE 5GZND 1LO2H 3ALWA 1CD1B 2BVOA 2GJ6D 5LBSH 3BT2H 2XG4A 2WLZA 5GGRY 4PJHB 4PP8C 3GGWB 3SDYL 1EFXA 3EYSH 5DJ6B 3UZQA 4LFHD 1KELH 2UV3A 3H7BA 4P59H 3V2AR 3F7YA 2YKLH 4HFWB 4MAYC 4PLOB 5FFLA 3MYJB 1MJUH 1ZHKB 1NFDA 3QSKB 4OLWL 1JPFA 2HLAA 4OCWL 1QBAA 4QHMB 1YEDB 2VYRE 4F9PA 1JF1A 4ZODA 5T3XL 3O3AA 1LNUA 3QB7C 5CEYA 3N1GC 3TPKA 4OQ1A 3OHXA 3JTTB 4S1RL 3QIBB 4XCYA 4DQOH 4MSWB 4JCLA 1WWAX 4RMSA 5FGBC 4PJDA 5IQ9B 5M94B 4TRPL 1RJCA 4JFOB 5L2JA 3ZE2F 4BFGA 4J1UA 1N5AB 5I71B 2GJ6E 5E8OB 1G7IB 5TQ2L 1JWMA 2I25N 3PWJB 4GMSL 4NO0A 3DUSA 3RVUC 5T1KD 4OZIE 1NC4D 1OT1A 3OPZL 1W72B 1KV3A 3O2VL 4XI5C 4GAJH 3QR2A 5EPMB 1VGEH 2ICEB 5EBWB 3S96B 1BFOB 2AV7A 2D9QB 3FB6B 3MREB 1QRND 4QTHB 1BLNB 4QOKD 5DD5L 1GHFH 1UQSB 4ONFL 4LCIL 2GK0A 3ILPB 2P43B 3MXWL 4M5YL 4BYHA 4R9HA 2AXJA 1DQJA 2FD6L 1U8PA 3IDJA 1CD9B 4ZFOA 3RPIA 1OB1A 5DLMH 3VFNA 5SV3A 4XCNB 4ISVB 5I16A 4NUJA 3WS3B 2EE3A 4KI5F 2QTEA 3P9LA 3DYPA 3V6ZA 2IH1A 1OAZH 3PIQB 1WK0A 1C08A 1EUUA 1A14L 3DSNA 4M7ZC 4NKOB 3AREC 4JQIL 1MUJA 2GQHA 2PW2B 3S7GA 1EEZA 2EDBA 4P46D 2ADFH 5T1LB 2J1KA 5DHVB 5CKAA 1BBDL 3CFKB 3VFUA 4U6XB 1QRNE 3W9EA 2JIXB 3K7UA 4JGUA 4QOKE 2D4FA 2AW2A 5FM8A 4LLUA 1MLBA 3JV4B 5FAAA 5DGQA 5AG9A 4GRLB 4KKAC 2P5EA 1SJHB 3A6BH 1JZ4A 4PJFF 3NFNA 3VWJA 4FXGB 4YGVB 3NIGE 1DUZB 1D9KC 2QQKH 5CMAB 4RFEB 5DURB 4KZDL 1PYWA 3RTQA 2P44B 1IC7H 4PLKC 3N85L 5M95B 1VHPA 2IANB 3UBXA 4NQUA 3QUKB 1JGDB 3DI2B 3Q5OA 1JWUB 2ZPKH 3HR5A 1TTGA 2CGRH 3QIBC 1P4IH 4Z7OE 4O9HL 4Z77B 4E41B 4N5ED 4X8JB 4OCYH 2PW1A 4OFYD 5E9DB 3TBWB 2XZQH 3IJSB 5ADOH 1V7NH 2MPAL 4NQXA 4N0UE 4LPXA 1F6AA 1IGTB 5HI5C 1JHKL 2WQ8A 3BDYH 3MOBH 4APQB 2XY2A 1UACL 2XQYK 4GG8A 5B8CB 2YRPA 3FN0L 4A6YA 2H32H 1GVIA 2AEIT 4WEUD 3WIIL 3QIUD 1MIEH 2VXSL 5CILL 1G7QA 1NLDL 5CIPA 3IYLW 1IEBA 4LARL 1AGEB 3PL6A 4WHCA 3QNXB 1OLLA 4W4OA 3UZVB 3O6KL 1V7ML 3HLAA 1FFNA 4XP1L 1MH5B 1YUHB 4DAGH 4PLJC 1RZKC 3MNZA 5JHDB 2BCKA 2EYSB 3ARWA 1WT5C 4WEBL 5EORH 1RZFH 4PFEA 3GEWB 5E2TL 1CXIA 1HNFA 3MRBB 5TE4H 4C56A 5MERA 5AYUH 1I8MB 3MRFA 1OWRM 3ARYA 1P7QD 4X5XA 2ESVA 3VRIA 4XH2A 5HHQA 4OF7A 4F33B 1A6UH 1CR9H 3NZ8B 1A7RH 5CAYB 1G84A 2N1KA 4JRXA 1JFMA 3QZWB 1FZJB 3DMMC 2ZCKL 1LP9E 1UWXH 3UJTL 3N1QC 1L4IA 1SM3L 3MRNA 2VL4A 3DROA 1HSAA 3MV8A 1C5DB 4UNVA 1KCSH 4HGWB 5FO9A 4IHOA 3F7YB 4NO2B 4GRLC 2HLAB 4H1LG 1JYVA 3ULUH 3CXDL 3HZYB 1KLUA 1JF1B 3IFNH 2AJ3B 4Y4KA 3KNBB 5CEYB 3OHXB 4XGZB 2YZ8A 4EI6B 3RWIA 1CLOL 5J9PA 5CZXD 3L3DB 5FEBA 4KKLC 1QBBA 4W70A 4X9IA 4OCSL 3OF6D 1QLEL 4PJGF 1DN0B 3VXPB 4NM8L 3TVMC 1C1EH 4QXTB 4JM4L 1DZBA 5HGAA 4JPWL 3UP1A 4D3CL 1AE6H 1TZIA 3T8XB 3MLYL 3NIFE 4NN6B 1ZLUH 2V2XB 4I13B 4NO0B 5I75C 3KDMA 5BV7B 5DQJA 1N0LA 2D31B 5ICXA 1I3RB 1ZVSA 1HQRB 4YHYB 4XP5L 5TPWL 4APQC 1AHWA 1H8OA 4OZFB 5B8CC 1VFMA 1JUFA 3IDMA 4YZFE 4BQ6A 1N6UA 3SDYH 3X13A 4MNGB 4AH2B 1A7BA 1Q0XL 3BPOB 1U8PB 5DC4B 1IM3A 3WHXA 2CK0H 2H41A 1QPPA 4JFFA 4Y89A 3SJVA 2FEEI 1UEYA 4OLWH 5I18H 5I16B 4CL7A 3GIVA 3JBG7 1YY8B 5KVEH 3QPXL 4OM1L 5C0JB 1IEHA 3FHQA 2X42A 2DBJA 1T4KA 4HT1L 1RUML 1NAKH 4O5LL 4K55A 2UUDK 1R0AH 1WEJH 5EZOH 2B5IC 3TJHC 2XA3A 1I8IA 3K8MA 1WZ1L 1OGTA 3EO0B 1AQDB 4PJCA 1EJOL 2WBJC 4FTVB 5F3HB 4HEPG 4I4WA 5TQ2H 5IB1B 4E0RB 4GMSH 5EO0B 1FZKA 3H42H 1U8OB 1LD9B 3MGAA 4RISH 5FO8A 4DOHB 3B5HA 2AJZA 5ITBL 3MBEB 3R8QA 4UZGA 3O2VH 3PJSB 2ZUWA 1AGBB 3LEYL 2BFVL 5GRYA 2RFXA 2ZCHH 3DHMA 1KEML 4IIQA 3H9SD 1WWWX 4ONFH 4KI5D 4LCIH 3WIHA 2OK0H 3GKWL 3MXWH 4PRNA 3OAUL 4FQXD 3WN5C 5B4MC 2FD6H 1T6VN 1L9MA 4X6CF 3QQ9C 5JOFA 4IOIB 4ZS6C 5FYJD 4O4YL 1FN4B 4UINL 2BK8A 2J8OA 2ZUYA 4M8VA 1RUQH 3EOYG 1TDQA 1YQVL 3NIDF 4GRWF 2BNRD 3BOVA 5J1TC 5BCAA 2R4RL 1AFVH 2PW1B 3UAJC 1A14H 2ED8A 4JQIH 2IBGA 2Z91B 4XCEA 5IOPA 3ROLB 4PJ7A 4WUUB 3CAFA 2HRPL 3E8UL 4HBCH 4NN6C 2IFFL 3ARDC 4G9FD 4LCYA 1NCBL 4PJHF 5CP7B 1BBDH 4BA8A 4IOFC 1K8IB 1HWGB 5BV7C 1Q94A 3H9SE 3RNQB 1YY9C 3BZDA 4KI5E 5F71A 3ZT6A 3S98A 3OKEA 1JV5A 1S9VA 4LSTL 4A2MA 4K7PL 5CIPB 1OGAD 1DBJL 5T1MA 5MEQB 1AI1L 4ZUVB 5E4EC 4K94L 2DQTL 1A6TA 3GSUB 3QWRA 5FYJE 5KSAC 3CDGB 4MS8D 1FFNB 3WFEL 5BJTA 1F4XL 2YPKB 3BPOC 5GGRA 3S6CA 1J12A 2BX5A 1XFPA 2E9IA 1WTLA 4LSSL 1OCWH 2BNRE 3SDDA 3IVKA 5IW3A 4Y19A 5TF0A 2WP3T 5L6YH 4WFGD 2VDPL 2AQ3A 1KOAA 4R7NA 4OLEA 2WBKA 3N85H 3MRFB 1ZT4A 3RA7H 4TSCH 5F9JB 3VRIB 4G9FE 4P0DA 3DO7B 1XMWA 5C2UB 4PJFE 4MD5A 3CK0H 4KMTL 1CICD 4KKCD 2FEDD 2ICWB 2Z31D 3LY6A 3VXMA 3QUML 1HH6A 5DEGA 2GTWA 3MBXH 4EI5D 3ARGB 4UIMB 2EIBA 4D0BA 1JHKH 1OGAE 1YYML 4BK5A 2W38A 4FXLA 2R8SH 5ALCH 3DROB 1G0XA 4OLXL 3NABL 1HQ4B 2X4RB 3IDNA 2DQFB 3MBEC 3QG6A 4D2NA 2VXSH 5IWLA 2IPTH 4GUPA 4I3RH 3ZHKA 3BEVA 5D5MA 3KPOA 1P4LA 3B4NA 4Y4KB 1GOGA 4WFGE 3KGRA 3UYRH 1V7MH 1F2QA 4HW6A 2BSRA 1CD8A 2R2BB 1QFWI 4Q58C 5DVLA 4TQEL 1JK8B 4YK4B 2Y07L 3RBGA 3V4PL 4KJWD 3X14A 1NDGB 3WL9A 3BZEA 5E2TH 4FQ1L 1H3TA 3D0VB 3QUZB 4PTUB 3U9UB 3MR9B 2ZG1A 5HGAB 1MCIA 3U83A 2HAZA 2W9EL 4PV9B 5KVGH 2XTJD 3O4OC 5DJ2B 2ZSWB 3RWEB 1U3YA 3WFHA 3REVA 4X4YA 3L1OL 3WJJA 3WEXB 4LLAA 4GJTB 1OSPH 4X83A 4KJPD 3V7MA 1EA9C 1JUFB 3IT8D 2KH2B 1SM3H 5T3ZD 1T80A 3WSQL 2CR6A 3L3JB 3H9HA 3OR7A 4PY7A 2PYFA 3LHPL 3FRPG 4PRBB 4JFFB 3VFPB 1YMMB 1KLFA 1VPOH 5A40E 3CVIH 2DQJH 2EEDA 4G8GA 4YHPB 4DK3A 2V6HA 3EUUA 4NC2B 1BFSA 4Y5VA 3O11B 5MHSD 2XTJE 4JDVB 3L7FA 4I9WD 1CLOH 1YNKH 4EDWH 3MA7A 4OCSH 4MA3A 1QLEH 3LN5A 1PEWA 4K8RL 4MAYD 1AD9B 4CRPA 5IMLB 1F6FB 4JM4H 2IQAA 4PJXB 5J6HB 1S7RA 2X4NB 3DYMA 1F11A 2FIKB 4XHJD 3RY6C 3MRRA 4RMTA 3P0YH 1UWEH 2X4SB 3B5GA 1JP5A 1XIWB 1JHLL 3ARGC 1KCUL 2CKBB 3K2MC 1BP3B 3HNTL 4LVOB 3GO1L 4G42A 3DXAB 3QHFL 3TO2A 2EDWA 4R4BA 3U1SL 4Q9RH 3KWWA 1U3HB 4UBDD 1XGRA 1TZHA 5J7CC 1FLRL 3MV7E 5MHSE 4I9WE 1NGYA 1S9KC 3RVUD 2YPLA 1OAKL 1HCFX 5D1XA 1IKFH 3VW3H 4GRMA 5EFIA 3QPXH 4JGMA 4XI5D 2VZTA 3BZ4A 3GSNL 4N8CL 4PUBL 4X6FA 2N4IA 5INDA 1R5WA 5EO9A 3ES6B 5HPMA 3QT2A 3WD5L 4YK4C 4X7EC 4HT1H 1MHHB 3OAYK 4HWBA 2ZSVB 5DZOA 4M7LT 1G7MB 3QUZC 1WZ1H 5I17A 3TYGL 4JQXC 3TWCH 5EIVA 3IXAA 3QDJB 2MMXA 4KUCF 4BSJA 2CRIA 5F8RC 2HFEA 4R26L 4OUUA 5E1AA 4WDIA 4NBXB 2I07A 2W0PA 3MFFB 1EXUA 3BPCB 1WITA 3K4DA 5E0QA 3WYRA 3ILQC 5C9JA 1ULVA 1A9BB 4WGVB 1AP2B 1NFDF 3D3VD 4MHHI 3RWHB 5BOPA 3ARED 5I2IA 1OTTC 3MCLL 2BFVH 4NZRH 1CFVL 2DTSA 4P23A 4PRPB 5E8EB 2CSPA 4M62H 3OAUH 2EO9A 4FZEL 4JHBA 4CGTA 4XPAL 1FLTX 1CFQB 1I7UA 3HZMA 1I7TA 5GGUB 4PJDF 4U1KB 3I84A 3MOAH 5AEAA 3BGMA 1BFVH 5EWIH 3RWJB 2NY0B 4LQFL 4HCRL 1A6WL 1YQVH 4AQ1B 3MLPA 3GMRB 2R23A 1R6VA 4MD5B 1FYTA 4MX7A 4X7FC 4Y16C 1F3DH 5DS8A 3IU4H 4YUEL 5ICYB 3CX5K 1NCDL 4U0QB 1HH6B 3CMOH 3FB7B 2NXYC 4KTYA 1RMFH 3C60A 4X6CE 4XNMA 3D3VE 3ULVH 3MXVH 3E8UH 3ARFA 3DETD 5GRXG 3W39B 3O45B 1RK1A 1U92A 2W0FA 1P5UA 3BIKA 3LSOA 1LO5B 2YEZB 3QIBD 2KBGA 3NIDE 4MZ3A 1XIWC 4GRWE 3P4MA 4GUPB 3KR3L 2J2ZA 3HI5L 3IAQA 4LVOC 5I74B 3U9PL 2XZZA 3PDGA 2MOVA 3H3BC 3O8XA 1I4FA 4XCFL 4LNVA 3WFEH 1F4XH 3IFOB 1U3HC 5I19L 2PF6A 3G5XA 2A6JB 4NRZA 4MNHA 4BFIB 2Y4SA 4HK0B 4MDJB 1GAFH 4PJHE 4MCZB 5IESL 1ZHLB 3X14B 1D5XA 5F6HI 4KWUA 5DMYA 2YC1B 3BZEB 4EUPG 2NY5H 1WISA 2I9LB 3H6JA 4PGDB 1BVKB 1FNLA 4OT1L 4QRQB 2SEBA 1L0XA 4Y4HC 1MHCA 4X4YB 3REVB 1WV7T 1F02I 2JB6A 1FV1B 4KMTH 3BYYA 4YDVA 5D7JB 5EU5A 3VXUB 2AJYL 1KYOK 2R9HC 5DJCB 3K46A 3F8UB 3QUMH 4UTAH 5TDNB 2BJML 5ENWB 3VGFA 3V9FA 1CLYL 2XQBL 2FX9H 2FBJL 1YYMH 4Z7UB 3QJFA 5FKAB 4UT9L 2X7LA 2BSSA 2CQVA 3QRGH 4WHTA 4OLXH 7FABH 1DBBL 4UNUA 1YZZA 3OR7B 4P2OC 3BI9X 1X4ZA 1AR1D 4EBQL 2FH6A 5KSBB 4Y0GA 4XRCA 2D2OA 2X09A 1HZHL 2EDEA 4MD4A 4P2RB 3VXTB 2C1PB 3IGAA 5DUMH 1K85A 3AMKA 2NY3B 5JIKA 5T1LD 4Y5VB 1IC1A 2V5TA 5IB2A 3L7FB 4L3ED 2JIXD 4GKNA 3MA7B 2K7PA 4N0CA 2Y07H 5JW4Q 3GMOA 5IB4A 3LN5B 5FK9A 2BSED 1KIQB 4FQ1H 3V6OC 3DVFA 2NY0C 4XVJL 3JWDC 4P4KC 1WBYB 3E2HA 1A4JB 1MQ8A 2B1HH 3RJQB 1PX4A 3RHWF 4R7DA 5I1JL 1HHJA 1LE9A 2HG5B 1O7VA 1EGJA 1H15B 3L1OH 3BAEL 3VFSB 1ED3A 5HGGS 3M1BA 3S34L 5DURD 4Q74A 2F53B 3EOBA 4QRTA 4G42B 2IAND 2F5BL 3QEUB 2AXGA 1QD0A 5I76B 2BHZA 2OL3L 3HMXL 4X7TB 4JFXA 3V5KB 4ALAH 1BOYA 2BVPB 3TZVC 1JBJA 4E41D 4PRAB 4DKEH 4L3EE 5E9DD 3HG1B 4U6TA 5D1XB 3SDAA 1QBLL 1RIVL 3FJTA 5EFIB 1FNHA 4RNRA 1KTLA 4APQD 3GSRA 3MCG1 5EO9B 4JFZL 4BM7A 4PP1D 5HPMB 2FJGB 1HYSC 4FQLH 2NNAA 5EOQL 3QBTB 2V5YA 1SQ2N 3IXAB 1F4YL 5KOVC 2OR7A 3DX8A 2FO4B 1ZLVH 4XB8A 4PJ5A 2ZJSH 5K9KA 3FTGA 1RPQA 2IANE 4OSUH 4U49A 2R0WL 5FA4B 1EXUB 1XZ0A 5EA0L 3CFJA 2ADGB 3DTXA 4QWWC 5JHDD 1CI5A 4M9PA 4YBLB 1ZTXL 1A02N 5JDJA 3HZVB 3M8OH 4LLVB 1CDGA 1UWXK 3HNTH 3PHOA 4U1IA 4E41E 5I2IB 4POYA 5E9DE 2CRMA 5CUSH 3U0TA 1A3LH 2YXFA 2KDGA 3HC0B 3U1SH 3LN4B 1SYSA 2HT4D 4HUXB 4UUJB 1I7UB 1I7TB 4NT6A 2O5XL 2KKQA 2HLFD 2FGWL 4OLZH 3OKNA 4MXQA 2P8MB 3NFPB 4KUCD 2NY3C 4N8CH 2DQGL 2H3NB 4O2FB 4OF3A 3FO2A 4YDJA 2VLRA 3VFOB 1L7TL 4MVBA 3QFDB 4UV7H 1GIGH 1KBGL 3U4AA 4GS7B 4MYWB 2CIKB 5JHDE 4EUPH 3T2NH 3TYGH 3MRMA 4ZS6D 1J10A 4WI5A 1ZLUK 2YA0A 2M26A 4V1DA 1OOAA 2O61B 2VR9A 2W0FB 1SHMA 4R26H 2R56L 4DJMA 1ZT1B 4YR6B 2O5ZL 3LB6C 1YECL 1TENA 4ZO7A 4RMVA 5AG8A 1TETH 4M7KH 3RBSA 1IGCH 2VDOL 3UJJH 12E8H 4JKLA 1I85A 5B39A 3UYOD 4QYOA 3QUXA 1A6VH 4N0RA 4LPWA 5EU3A 4C83B 5J12B 4NO0D 2QSCL 3QDAA 4ZAKC 1SVZA 4J3UA 2X9YA 1RJLB 1YY9D 1LMKA 3IU3B 2EO1A 4Z78A 5JPMA 4Z0BL 2CLVA 4JR9L 1NFDE 4PJXF 1MHPL 4LQFH 2R0ZH 2JK5B 5HDBF 1MHCB 2ZUXA 1FDLL 4M4PA 4NHCL 1JMXA 4HKZB 1TVBB 2EDXA 2FX8L 1KXQE 4GW5B 1NCDH 4OV6F 3T65A 3ZT7A 1LK3L 1INEH 2D7TH 1KC5H 4QCIB 5HVGB 3RY4A 3EYVA 2NTFA 5JZ7C 2V7NB 4WHTB 3CX2A 1A2YB 5DK0B 4LNRB 2BXYA 2ATKA 4EOWL 4YBLC 3QISA 3QFJA 5D1ZA 3KR3H 3HI5H 4XRCB 1S7QA 3MPCA 3ZTNH 1HKLH 3BN9D 3S3PA 2LE9A 4L3CB 4N68A 1E4XI 1N8ZB 1SBSL 1DLHA 3QH3A 4N0YL 4FTVD 1U8QA 4OFPA 2DKSA 5F1SA 3FO1B 1M4KA 5I19H 1OAYH 3JVGA 1KJ3L 1VDGA 1EMTH 1EO7A 4MNGE 5IB4B 3UTQA 3O2WL 5FK9B 3WIFB 1T21A 1W0VA 3WUWG 4NQSA 1BQHA 2AS5M 2VITA 2YRLA 4OT1H 4U3CA 2R4SL 5I1LB 3SO3B 1DEEA 3CFCL 4ZFZB 1A3RL 3CX5J 1ED3B 4FQHB 3EGSB 4GS7C 4EZMA 5F7DA 4OCXL 4HIHA 2EH8L 2BJMH 1KJMB 4S0TD 3MRHA 1PEZA 4JFYA 4L8DB 4PIRF 3S37L 2VE6A 4XWGL 4F57L 5FYJL 5IW6A 3HI1A 3B9AA 3S35X 1DBBH 3FQXA 3C5SA 2Q86A 4FTVE 2VDRH 3P77B 5KVMC 5T5FH 3EOTH 5CSZA 1OWWA 4F15B 3OZ9L 4KUZH 5F89B 5JLZA 4KHTH 4ZOCA 5HGDB 1SEBA 5LWYL 4DOHE 4YDKH 3GBMH 5AZEL 1X5HA 1TZGL 2UYLB 5DYOA 1MCJA 5J12C 3KYMA 1CBVH 1E27B 3SGJA 1XAUA 4NHUB 3PWNA 4KTEL 1UEMA 1Y0LA 5F96L 5AWNL 3R0MA 4OI9A 1RZ7L 2DQHL 3NZHH 4NSKA 2RCSL 1EO8L 3TT3L 2QLVB 5FO7B 1FFOA 5TDPB 3MRPA 1X5YA 4OF6A 4ODBD 4MQXC 3E3QA 3KPPA 2XG5A 4RIRA 3DTXB 1S3KH 4PG9B 3F12A 3BAEH 1KYOJ 5BVJB 4PYGA 1IT9L 5DD1L 5IHBA 4FQCL 5DMKB 1MVUA 3BP4A 3U0TB 3PDOA 2DF3A 2VKWA 3PQYB 4UOJA 4ZOEA 5FYKD 1P1ZA 2J4WL 1T66C 3NACH 4CVZA 2DLFL 5EC1B 4EXKA 3LIZL 5C9KA 4L5FL 3ARGD 5IB5B 1X5GA 1IARB 1K5NA 4U7MA 3K3QA 1DEDA 2VMFA 4UILH 4YDJB 2VLRB 3NOIA 1S7VB 2B1AH 2XTLA 5ILTL 2R0KL 5EOQH 4MD0B 2O5YL 2P42B 5IV2A 5HSFA 1F4YH 3VE0A 4MB5A 4V1DB 1CDUA 4JZJB 4YPGA 1YN7B 4Y4KD 3GSWA 4Z7UF 4X7SL 3CCHA 4L4TB 5EA0H 4EIGB 5FYKE 4LQ1A 4YXLH 1S9WB 3OXSA 2C3HA 3BQUA 1LO4L 4OZHA 2BRRL 1ZTXH 5L88L 3SE3C 5FYKU 1JGVL 3OG4B 3QUZD 4Y5YB 1B4JL 3ESUF 3EOAA 4EJ1C 4JN2B 1TJIL 3GHBL 5IEKA 1BOGA 2I9TA 4MJ5A 1CDYA 2GTZA 4G6KL 1T83A 4LHUB 4K7PY 4Q9BA 3HCVB 1PG7L 1CU4H 3VD4A 1FGNL 4YWGL 3V8OA 1CFTA 1W2KT 4NJ9H 1FNAA 4JZNA 4UDTB 1JRHL 2DQGH 1OTTD 4CNIA 2GAZA 4P57A 2L7JA 2HT2C 1L7TH 1R3KB 1KBGH 4XP6L 2AK4B 1JYXA 4JFFD 4HLJA 1YMMD 2DIJA 3QAZB 4I2XA 5IHUH 4MHHG 4G6ML 3A67L 4P9HC 2A74A 4DZBA 1Q9OA 4HH9A 2X44D 3D69A 1C12A 1AXIB 3HNVL 3NCYS 2Q3ZA 4BH7B 5IT2L 4WV1B 4B5EA 1J86A 2ATKB 4RAUB 4R0LC 1LDPL 2R1YA 5MP6L 1UWGH 3IJHA 4FNLL 1A6AA 1S7QB 1OQOA 4Y1AB 3HPJA 4YHOH 5FHAH 5DHXB 2LVEA 1F45A 3OBAA 3C2AL 4KY1L 1KENL 4Z7VA 4BZ2L 2APFA 1QFWH 1M7IA 5DRXB 1HEZA 2OBGA 3KPNA 1CTOA 2BVQB 2AQ2A 3UPCA 4NQSB 3KPMA 3OKYA 2P8LA 2BY1A 5C0AA 2I27N 2Q8BH 4DGVH 4JR9H 4JFFE 1YYLL 2VUOA 3MLRL 3QWOB 5D1QB 1MHPH 4HIJA 1YMME 5LJYH 2E7LA 1JZ2A 4LKXB 1QR1A 1T7ZA 3ARBB 3MNVA 4TOYL 1U3HD 3LN9A 3TN0A 1I7RA 3BVNB 5FCUH 1ZS8B 2FX8H 1LK3H 3BSZH 5IUSA 1ROWA 2C9AA 4LSVL 4ZYKA 2YN3A 3TBSA 3OMZA 4KDVA 2DMCA 4Z95H 5HHOA 4ORZC 3TM6A 1PFCA 5GGQL 4CMMA 1F3JA 4PJXE 3NH7L 3VGAB 4HIEB 2DYPA 5HDBE 3TFKA 3Q1SH 1T1XA 2R2EB 3QXAA 1E0OB 1V3JA 5IKCA 4Y5YC 2JJVA 5DJYB 2LAGB 4JJHA 1GGUA 3B2VH 2EZ0C 2VDQL 2YPVL 1MFCH 4N0YH 4H26B 4MB3A 3KYMB 1H3VA 2DI9A 2H32B 5EC2A 4AZ8A 3BP7B 3BIBX 4AG4L 3EO9L 5GHWH 3O2WH 1BEYL 1HOCA 4NSKB 1UYWH 1Q8MA 2NPLX 3GBNH 2CIIB 5F7LB 5IW1A 3QNZA 3VD3A 3QWRD 4BK4A 1ZSDB 2Z9TA 3FZUC 1FIGL 1CLZH 2R4SH 4PS4L 4PRPD 4RIRB 2VH5L 2B4CL 3O0RL 4L29A 2QL1A 1LDSA 5DVNA 3MJGX 4C54A 3F12B 2Q8AL 4GXVL 1Y6MR 3DLQR 4XWOD 1WIOA 3EYQC 3QAZC 4H1LA 4H0GA 4DTGL 4DZ8A 1UZ6F 4XPFH 1T7WA 4HUWA 4UV4H 1QVOB 3D25A 5FM5O 2ICWI 1IC5H 2JJTA 2NY0D 3S37H 4K23H 5FYJH 4WV1C 5L9DL 4ODXA 4PP2A 4RQQA 1GZQA 3G6DL 3RIAK 5DRNA 3R06A 4L8CA 1HHGA 3L5WB 4PGEB 1ZT7B 2ZWLT 4S2SB 3OZ9H 1TJHL 3V95A 1CDCA 5LWYH 1XGQB 5AZEH 1E4WL 1IE5A 4IRSA 1M7DB 5L8JB 1IC4H 1EAPA 3BHBB 2NX5B 4YHNB 4KTEH 5F96H 4M6MH 4PRPE 3EFDL 1KTDA 3OB8A 3WKMH 1RZ7H 3CH1B 4NUGH 1ODAA 5CZKA 4RGMB 2RCSH 1DBML 3RL2A 4F7CA 2E9JA 5J1AB 5TJWK 4FFZL 3M07A 3L5JA 4U33A 4YPGB 3TT3H 3GSWB 4JFDB 3ZDZF 2B7DT 3FOLB 1IZJA 5IVXB 2XN9A 2E6JA 3GMLA 3AY4A 2V5RA 3MUY1 4P4RB 1HYSD 1IT9H 4OZHB 1R5IB 5DD1H 4FQCH 3UPRA 1DBKL 4LLMA 2VQUA 3GNMH 4QHNA 4MDIB 1Q72H 1BOGB 1H5BB 1W72L 3MRJA 4E42B 3RAJL 4F2MA 5BRZB 2J4WH 4LLWA 3EDJA 3UTPE 2VJXA 3DRTB 2YD6A 4WWKA 2DLFH 3CXHK 4GAYB 5D7JD 3VXUD 4H8WH 4FXKA 4IDLA 4HWUA 4PJIA 4KDWA 3B2UC 2AXHA 4ODWA 2AJSH 5IM7A 2YD3A 3SDXA 4G7YH 5FB8A 3U7YL 3MYZA 4P57B 5D6DA 5ILTH 5TDOA 1NC2B 4S10A 4L4VA 5C08B 4LSDA 3HS0A 4N9GB 5SWSA 3IDXH 3EJYD 2A74B 1DANU 3UTSA 4P2RD 3QXWA 3REWA 2DTML 1LHZA 2AABL 1RZJL 4X7SH 5F1IB 3VA2C 4G8GD 1C8PA 5DD3H 2NY3D 4IRJA 4PRIB 4JKMA 1AKJA 2VZVA 2CRYA 4KVNL 2XACC 4Q9QL 1D3CA 3IJHB 5ACZB 4PGZA 2B2XL 3IB4A 1LO4H 1B0GA 2A1WL 1JGVH 1YQ2A 4OZGA 3VXUE 3BKCL 4Z7VB 1D5BA 2PTUA 1CL7L 2RGSA 4XPHL 4YGAB 3FQRB 5DJ0B 4Z7UE 4XBPA 4G6KH 4NN5C 5TQ0L 3WFCL 4AIZB 3TH3T 4HWZA 5EU6A 2DQIL 2ILLA 5C71A 1T0NA 3GUTA 3G5YA 4UDUA 4YWGH 2F53D 1P2CB 2VN7A 1CIDA 1RQ5A 5KSBE 4HIJB 4M00A 1H3PL 1Z0NA 4MB4A 4D9QD 2HTKC 1U6AL 3Q6GL 3VD7A 4P2RE 1MFNA 4G8GE 1INDH 3S3JA 1FG9C 5I15L 1OPGL 1UJ3B 2CUHA 5T3ZH 4RGMC 2DLEA 4QEGA 1AO7A 2J12B 3T09A 3HE7B 4R4FL 1ZLVK 3FONA 3HG1D 5EG6C 2D03L 4LPVA 5D1XD 3W11C 3EAKA 2XXCB 4NGHH 1FVDA 1K2DA 4CMMB 1CDBA 4LCCA 3HNVH 1C7SA 4NO3B 5FUCE 5IMOA 3TLRA 5D9SB 1FP5A 1LDPH 3T08A 2X1PA 3BKYL 4LCWA 5IKCB 4OLYL 4PJAA 1VFBA 3AM8C 2GCYA 1Y18B 4WU5A 5FHBL 5HI4C 5IG7A 4HV8A 2F53E 3PXHA 5JZ7D 1J1XL 1NUNB 2NLJB 4J6RH 4BZ2H 3EYOB 4D9QE 1E28A 4KZEH 1P84J 2Y72A 3GZKA 1T89A 4FFYH 3QQ3A 1ZWIA 2ZZUT 1XGUB 5B38B 4J3OC 3QNZB 5EN2B 3EO1A 3UTOA 3W2DL 1XF5A 3MLRH 5GRWA 3FFCB 4P48A 3TBYB 5GRUL 4QRSA 2UZIL 3HG1E 3SY0A 2E8ZA 1NCTA 4KH2A 5I1AB 3P40A 4M7LH 2EXWC 2IWGA 3BMWA 1KT2A 1NMAL 3DRQB 3T2OA 4F7EB 5J0BA 1OAXH 1P9MC 2ADIB 4LSVH 3H7LA 4P2CG 5E6IB 4KJQC 4KRPB 3B83A 3VWJC 1BJ1H 2MCPL 4NIKB 3I02A 3T4YA 3L3KA 4BKLB 4NDMB 3NH7H 4GKZA 5MENB 5DRNB 1JPTL 5JQ6L 1YNTA 3RVVC 1T0MA 1RVFL 2E7BA 1YNLL 4LP4A 1WF5A 4ORGA 3ARFD 2IAMA 5F9AC 1EAPB 2F8OA 2Z92A 3EFFB 2WWKT 1LEIB 4NNYA 1FJ1B 3QEQA 1G7PB 3BZFA 3IXTA 3B5TA 1P7HL 3U46A 2I5YL 5CLTA 5C1MB 3ZKND 4O02L 5ADPL 3ZKQD 4ETQA 2ATPA 2ZOKA 4HJGB 5H35A 3U4EB 5KVFL 1FIGH 3VD5A 4ONGH 4U1NA 1A4KA 2EEAA 2JF1A 1UM4H 5DXWA 1UVQA 3GB7B 4RBPH 1UJ3C 3VXQB 5E94B 2FYYA 3FRPA 5DJDB 3WXWL 4KMQA 2X4PB 4DUVA 1ZLSH 2ERJB 5ALBL 3U0WL 1QFUL 4QHNB 3WFBL 4I18A 4DN3H 4D0DB 4MCYB 1JWSA 5BW7C 4KJYB 2DL2A 3KPSB 5HHPA 3SCMA 3G6DH 3DX7A 4MQXD 3SDCB 1N5YL 2CD0A 2DOCA 3WE6B 3WDJA 1ZHNB 4FXKB 3QUMA 4BQBA 5T1DH 4HFUL 3VXSB 1B0WA 4MJIA 1U8KB 1I1AB 3VFTA 1JIBA 2VLJA 2F9BT 3G04B 1E6OL 1UZ6E 4OZ4B 2D0FA 3ZTJG 1VGKB 2CO7B 2VABA 4LAJH 1LVEA 5E8PB 5IIEB 4NQDA 3U82B 2QSQA 1IM9B 4HS8L 4ZTOL 1LK2B 3EJZC 2G2RA 4FFZH 5IR1A 1XH3A 1F3DJ 2C3XA 3TIDB 4IJ3C 2OJEA 2CDEA 2XWJA 3M17B 3QZWG 3VDBA 3QUYB 3JZ7A 3IAPA 1B0GB 3V4UH 4CJ0A 4N1EA 5E6IC 1BBJB 4KRPC 4OZGB 3D39B 1VKXB 1DBKH 1QNZL 1I1FA 5GISH 2YD9A 4EVNA 1BVZA 4Y2DC 4CN6A 1IL1B 3QG7H 1W72H 1NSNH 2WBWB 3MLTA 1LWRA 4UU9A 3VH8B 3VWKA 1R3LB 3ZDZE 1BGXH 1NBQA 3SOBH 1RJYA 15C8H 1XF3A 4MJ2A 4ZUWA 4S1DC 4KXZI 4FFVC 3RUGA 3V5DB 7CGTA 3G5ZB 1RZKH 2HMIC 3F62A 3QCTL 5I9QB 3U7YH 4U1JB 1FZMB 3C6LB 4TVPD 5D96B 3RX7A 1WICA 3RWFA 3OX8A 2R1XA 3PUCA 1G0YR 1AO7B 1HDMB 1GXEA 3TBTB 4NPYA 5DFWH 5ETUA 2EDOA 3QEGH 4F3FB 4ELKB 3LKQA 4FQQA 3SKJH 1N59A 2DTMH 5FDYA 5KN5A 5IJKA 3RZCA 3NAAL 4KU1A 1QEWB 4JO2L 1EEYA 5IP4A 4OZFG 1MPAL 3QO0B 2B2XH 4OGXL 1G1YA 2ERJC 4PJAB 5DHVH 4QXUL 5HDQL 1S9XA 1IBGL 1WQVT 2A1WH 2IEPA 2VUYA 4OI8A 1MCOH 4OGZA 5E8NB 1E4XH 4XPHH 1L7IL 4Y4FA 2OR9L 1K3ZA 5DJZB 2NY6B 1UH4A 3WFCH 4TVPE 3CXHJ 3QJHA 4J4PA 4U31A 1ZWIB 4HK3J 5CJ5A 4OM0H 2H26B 4CAGA 1I1AC 5ESQA 3TJEH 1K3IA 3CUPB 1XF5B 1OTSD 3MRKA 4OD2B 1BIIB 2DQCL 2A83B 2NW3B 1U6AH 3Q6GH 3L5IA 5IVXF 3PQYD 3QYCA 4IS6B 4M6OH 3MGTB 5FM4A 4XAWL 2X1WL 1KACB 2XZAH 1DQML 5I15H 5FYKL 1T1YB 4PJ9B 4OCNC 4OZHF 2D7NA 4NHUE 4G8IB 3INUL 4LRIA 5C0BB 5CEZD 3TCLA 1J05B 4IIQC 5ERWA 4GMTL 2X1OA 3V79C 3L5XL 3FB5A 1I8LA 1D5IH 1FZOB 3NPSB 4GKZB 2W0KA 3QUYC 1ZK9A 4JFEB 3B9KB 2VLRD 3N1FC 1FVCA 1YNTB 4MVBD 4TSAH 3BKYH 3BIAX 4LLQA 4S1QL 1WCBB 4OLYH 4K7PX 4EUPA 3MACH 1S5IL 1MJ7L 3P0VL 3DX9A 2ZOLB 3L3OB 4V1DD 2VISB 5CJQH 4MQ7A 2IAMB 2EE9A 1BD2B 1Q9WA 3E0GA 5DRWB 4L4TD 4U6HB 1U8NA 3PQYE 1FFPB 3QCUL 4TUJB 5FF6B 2YWZA 1UB6A 3HFMH 2X9XA 5DF0A 3W2DH 3PWPA 5I9QC 1VADA 3ZYOA 1D5MB 3SGEI 5CEZE 5D96C 1A7NL 4X5WA 4CKVX 3ZTJH 5CD3B 1MRFL 1V3LA 2WWMD 5EUKA 4X7DC 4G6AC 3JTSA 4LHUD 1N7ML 1HINL 4LKCB 3LQAL 3DURA 2VLRE 1NMAH 2Q76B 4JFQB 2YA1A 1OHQA 1QKZL 4HCRA 4NRXB 5HVHC 4Z7VF 2QHRL 3C8KA 4JDTH 4POZC 4V1DE 2YK1L 2GJ6A 5BQ7A 1T7XA 3SDDC 1BM3L 3Q48A 4QT5A 1FE8H 2EDFA 1K8DB 4L4TE 1RVFH 4KK5C 2AK4D 5A2LH 4OZIA 4M1CD 1N3NA 2AK1L 4MJIB 1A64A 1MLCA 2BNQB 5IBTL 4I48A 4I77L 4GQ9L 2FHBA 3KPRB 5EOCL 4HG4J 3HZKB 5D72L 3ZLQC 5KZCB 3P9MA 2G75A 1XGYH 1JZ5A 3CVHB 1XR9B 3L3GA 2I5YH 4IMKC 5I6XC 2XNAB 4FRWA 5ADPH 4Y1AD 1CGUA 1GZPB 1RUKL 1XH3B 1U91A 3PGFH 2DJ4A 2EECA 5HY9B 3L3IA 2YD5A 1FL6A 4JANA 2OJEB 1UENA 3F7RA 2Z93A 4PJ9C 4X6DA 2AJXH 2E6PA 3L95B 4Q2ZA 3QIWA 1HIML 5IF0A 5L2KB 3U0WH 5DSCA 5BV7H 1QFUH 2AK4E 5KSUB 5D1QD 4DVRL 2VERN 4K9EL 5ID1A 2CKBL 1NL0L 1ETZB 3B9KC 4XZUA 5HGHA 4HBQA 3WNMA 2IQ9H 1QRNA 3ARBD 1N5YH 3UC0H 4QHUB 3MRGA 4GKSB 4M6NH 4QRUB 5IMKA 1MREH 5ESAB 4KGLA 2FRGP 1FNGA 4ZNCD 1AH1A 4ZPVB 3Q6FB 4Y1AE 1E6OH 2RB8A 4I0PB 1ACYL 2X2YA 3TNMA 1MCBA 2ITCB 5DMGD 4WI7A 3P30H 3V52L 2OI9B 1T2JA 3VFRB 3RIFK 4AK1A 4JFPA 1A0QH 1T20B 1H3GA 3K4ZA 2BSTA 4MWFB 3DUUA 1T1ZA 4AY0A 1E4KA 5ID0A 4OCLC 4P46A 3I6GA 4ONHA 2WINA 1NKRA 4Z18A 5A2JH 3B9VA 5IGXL 5DO2D 4HAFA 1GCFA 5JXEC 2C3WA 4QXGL 1VCAA 4JY5L 3STLB 1AGFB 4N9OB 5IROC 1W8OA 4Y5XB 3QJHB 1O5DT 4P5TB 4FQ2H 3EBAA 1RZ8A 1ZANL 4NZTH 3NCCB 5KS9B 2A0LC 4C4KO 1B9ZA 2HKFH 5GRVK 1TTFA 3HC3H 1CQKA 1XF4B 1G9NL 3O41A 4R4NC 4O2CB 1FO0B 1I7ZB 3FQNA 3M45A 5GRJL 4HPOL 4AL8L 3DVGB 2OL3A 1QQDA 1F42A 1A7QH 5LQBL 3E6FB 2NQCA 1GGCL 3I50H 3KLAA 3LOWA 1SYVB 4N5EA 3TCLB 3L7EB 4OFYA 3FN9A 4YHZH 1DFBL 3FB5B 5DGRA 4OFIA 1IKNA 4ODSL 2HTKD 2V5MA 1FVCB 2NX5D 4B7LA 4PBXA 2VWEC 2RJMA 4MA1B 4OGXH 2E27H 3SGKA 4U6YA 2BMKA 2Y7QB 3DX9B 3QIUA 1D5ZA 5IFJB 1D6EA 4JFDD 4ODTH 3KXFB 1LP9A 3AS0A 4UOW0 4WI6A 4X4XB 3VRJB 4DGYL 3MGOB 1MJ8H 1M7XA 4CBPA 1BZ9A 3IFPA 3WKNA 4XP9L 4OUOA 3ZKXC 2A9NL 2CDGB 1S7XB 1VADB 5T33L 4I0PC 3HE6B 4N90D 4WFHE 5JW5A 4YQXL 4XP4L 3S8WA 3MMEA 1MFDL 5GJSH 3U0PA 2EDQA 2FATL 5BRZD 5LAXA 1P7QA 2OI9C 4YIQA 4XVSL 4KV5F 3LEXB 1YEIL 2NX5E 1CG9A 3FOMA 4OZGF 1R5VA 5F1KC 1PKQB 1LE5A 1TNMA 1U93B 4GMTH 3IDYB 3ETBF 2VSCA 2DLGA 2VXUL 3VFMB 4JFDE 1K6QL 4KAQL 5DT1H 3DV4A 5IVXE 2IPUK 3SHSA 2V9TA 3WUZA 1RK0B 1NC2D 3N1MC 1J5OL 2XQYG 5C08D 3LS5H 3WUWA 4AEHL 2DM4A 2EXWD 2IFGA 5JW3L 4I5BA 2EC8A 1MJ7H 3P0VH 1UXSB 2ED7A 4OZHE 35C8H 4XTRD 1Z9MA 3FO9A 1MFEL 4LPCA 1ZHBA 3P9MB 3LPFA 4YXKL 4N90E 3N1PC 4GW4B 4P5TC 4X8XA 4PRID 3ULSB 3L3GB 3G5VB 4G80B 1JPGB 5FGRA 5BRZE 3HAEB 1CXKA 4CADA 3C60C 2BZDA 4KFZC 2QKIA 4RGOL 4IOSD 2BRQA 4P9ML 3OF6A 3DGCR 4JPVL 2RBLA 1ITCA 1MRFH 5SWQB 3RWDA 2UZXB 5CINL 1BWMA 2R29L 4Q2ZB 4PJAF 3T1FB 1DBAL 1INQA 2BNUA 1CLCA 3QA3A 1KB5B 1JN6B 3DIFB 3ARVA 4GQPH 2A6DA 5FECA 2A38A 3MZGB 3TH4T 3WCYA 2YK1H 4HX1A 4MA1C 4RFNB 1H3WM 2IMNA 4PRIE 1OF2B 3L9RB 2YMXL 5CBEA 3BP6A 1NGPH 3HE7D 4JN1L 4I77H 4HXAL 4J8RA 3CZFB 1PLGL 1HI6A 2ZP0T 5EOCH 4JQVC 1KPUA 5BS0A 3EDEA 4BH8A 4DFIA 4Z7VE 1HH9B 3PNWA 2EYRB 2XXMB 5TF1L 3LKPB 1A3QA 3JWOL 2FHCA 4X99B 2JB5H 2VLKB 3O6FB 4FG6D 4AM0B 4HWBL 4XVTL 4DWHA 3X3GL 1HN1A 3HE6C 1JNHB 4L8BB 1X5JA 4M48L 3PWVA 3MLZH 2VL5B 3O9WA 5JNYA 5HGBB 4HJJH 2DDQH 2PTTA 4JKPL 1TVHA 3CDCA 4Q6IB 2DM2A 4ZTPH 5C0DB 3MCKA 3SQOL 5HYSG 2H8PA 3W0WB 4G6JL 2RIKA 2VAJA 1HIMH 3BH9A 3ULVF 1B3JA 2BC4B 2GEEA 3EJZD 4DVRH 4NZUH 3FFCD 2FO1A 5J4MA 2JCCB 3V8CA 3FKUS 3QQ4B 5ESVA 3VXOB 4AEIH 4N0CC 3ARZA 1HHIB 2YXMA 3SKOA 3E6HB 1IAII 3BXNA 3RIAF 1MRCH 4FQXA 1OAQH 1TNNA 4X9HA 3CFBA 1FBIH 4WU7A 3PWLA 2H1PH 5I8CA 4KRLB 3BKMH 3WFZA 4JKWA 4KRPD 4P2QB 3PGDB 1ACYH 3BPLC 4U1MA 4I8DA 4HUVA 5ICZA 5DR5L 2OTWB 3DV6A 5J56B 4KPHL 5MEND 3HRPA 1KB9J 5DWUL 3FT3A 2X40A 2XWBB 3KLAB 3RU8L 3ZDXF 4WTWA 1OP9A 2YZ1A 4S1DD 4UQ3A 5E6ZA 4E5XA 4FFVD 1F8TH 3B6SB 1EPFA 2LTQC 4RBPK 1RIUL 3B8YA 1TTUA 2HMID 2XPGA 5CZVH 3FFCE 3UROR 3PABB 4G9FA 2DMKA 2ICES 3GMMA 1EHAA 1GC1C 4HAGA 1XR8A 3AU1A 1ORSB 3HUJA 1KCKA 4PJFA 2CDFB 1BHGA 3DECA 4GBXC 3SDAC 4DVBB 1DE4A 4JO1H 2AEPL 3CLFH 4F8TA 5DEFA 4WW1A 5IBLC 3AXLB 1OGAA 3LKNA 4WNQA 5IB3B 1KG0B 2EEBA 4JY5H 1A1MB 1S9YB 3NBNA 3C09B 5D6CA 2GFBA 4RFNC 1EVTC 4MS8A 1MY7A 3IFPB 1NJ9B 4GSDL 4JO4L 3WS6A 3GSQA 3RWCA 1G1CA 1Z5LB 3BEWA 4HDIB 2FZ3B 1ZANH 5MENE 3GSXB 3T0XA 1OP5H 3FFDA 4L8SA 3U2SA 4OLVL 4M5ZL 1ZXQA 3O3BA 1NDMB 3GIZL 3O4LB 3U36A 4KTDL 4PJ8B 1IGFH 4HPOH 4UNTA 4YX2L 3KPSD 2HFFA 1J87A 3JWDH 3SDCD 1NBZB 4NWTH 5LQBH 2ARJB 4O00A 3O6FC 4DGIH 2Z8SA 3W9DA 2DB8A 1GGCH 2A73A 1CICA 3VXSD 1DTUA 1EHLH 1EBAA 1I1AD 3GMPB 1DFBH 3G6JB 4EI5A 1UC6A 1I9EA 4Q6IC 4YBHA 5FDWA 5F7WC 1AR2A 3O81A 2BVTA 4MXQC 4YBQD 3WJLA 3HRZB 2F74A 1IM9D 1ZEAH 2VC2L 3QDMB 3RUGF 3KJ6L 3FO9B 5D7IB 3I3EA 5FXCH 1TMCA 1J8KA 5F1NB 4MA8L 4PGBA 1ZHBB 4P5MA 3GJFK 4YAQA 3CFEA 3S5LB 3UBXI 3WNLA 1P6FA 3KPSE 4Z0XB 3QUYD 1UXWA 1HSBB 1Z9SA 4TNVK 1F90L 1T3FB 3KYKH 4JVWA 2N56A 5EUOA 4UTBH 3D39D 1DLFH 1KXTB 4JPIB 4HC1L 3BO8A 3QEHA 4G8EA 4Z76B 3BD4A 1A7PL 4YQXH 3VXSE 4AT6B 2IG2L 2DN7A 4Z7WB 3I9GH 2FATH 5EU6D 4LLYA 4FOMA 3O3UN 1T5XB 3QA3B 4S0SD 1I85C 2C3VA 3MRCB 5C0FA 1FNFA 3CD4A 2YRZA 1LO3H 2A6DB 2EKJA 3IETB 4U1SB 5FUOH 1K6QH 3C6LD 5E95B 4KAQH 4ZOBA 1IMHC 4DKFL 1MWAB 1G6RH 2GUOB 4ZMAT 5C92A 1QA9B 4TVPL 3IJYA 3UO1L 4JG0L 3T77A 3RX8A 5CBEB 2J6EH 5KS9F 1AO7D 5HYJB 3KYNA 5JIPA 4KV5E 1G9MC 3ZE0F 2ID5A 5TGBA 1KPUB 2DQEL 1MFEH 4OZGE 5BS0B 5ANMB 3LKOA 1LGVA 3Q2CA 1M71B 5GGTL 1R3HA 2V17L 3TNNB 32C2A 4POZD 6FABL 3ZL4L 1RAMA 1U58A 5FOJA 5EU6E 1KPVA 4N1HB 5LGHL 4RGOH 1WBZB 4ZFGL 1SY6L 4P9MH 1UCBH 3QXUA 4PJ8C 1RZGA 4JPVH 4L1DA 4MAYA 4AYFA 1U2HA 1TVHB 3LEVL 1NBYA 4KQ4L 4WW2B 3AS1A 3D9AL 4NBZB 1JTOA 1KTKE 2NY6D 4ZXBB 1UFUA 3GSVB 5EIIA 3JSSA 4PB0H 1DBAH 1SVCP 4Z7NF 3K0WA 4PBWD 2Q6WA 4D0CB 4EKXA 1AO7E 4U6VH 5IFAL 3S37X 3JVGC 1MQKH 5ESVB 3I6KB 5DK3A 1K9TA 3IDGA 5DC9B 5BZWA 4CN4A 1N6QL 1H3UA 4XBEL 2ZNWA 2YMXH 4WU7B 5KVDH 2DICA 3U7WL 4NKDB 5I8CB 4HF5L 3FMGH 4KXZH 4JN1H 3IKCA 4HXAH 4PJAE 3D2UB 1DSFH 4OLUL 5F88B 1LO2L 1X4YA 4U1MB 4U1LA 5CEZL 5F6HJ 1QR4A 2W0LA 5LBSL 3DUHA 4BUGA 1F6LL 2DWEB 3MJ8A 4JFED 3B9KD 3NCBB 3C9NB 1R24A 2WANA 4P59L 3DX6A 3FQWA 3X3GH 2YKLL 3GBLA 3ULVD 1MJUL 2IAMD 1U0QA 3WNOA 5C0EB 1BD2D 3I3BA 2ITDB 4DN4H 5C3TA 1T1WA 3GMMB 1XR8B 1XCTB 4FQPA 3LMJL 4XXDB 3LDBB 1L9NA 4YDLB 1NEZB 2AP2A 3VXRB 1YN6A 4DQOL 3CIQA 1CFSB 1DE4B 1CFBA 1RHHB 3W81A 3DNKA 4JY6A 1Q9KA 2QADC 3LKNB 2X4TA 2P7TB 2XA8L 5EU4A 3KPLB 5C07B 3SBWC 3AREA 1YEGH 3JV5A 4NBYB 3HB3D 3UTTB 3MC0A 3R0NA 4JFEE 2NY2B 4K3EH 4L8SB 1AD0B 1EHXA 2FWOB 1DJSA 3U2SB 1WIPA 2N7BA 3RDTB 3O3BB 5FYLD 1TQBC 3ULVE 1FPTH 1CD1A 4GAJL 3ZE1F 2NY1B 1VGEL 3T0WA 4KPHH 4X6DF 3VRLF 1GHFL 1BD2E 4PJHA 2PO6B 3GGWA 3AAZB 4OBSA 1UA6L 4NFDA 2XT1B 1MSPA 3I2CH 3RU8H 3OKOB 4MJID 1T5WB 2BNQD 4HFWA 4DCQB 4OIIH 3MYJA 1D9KA 2QBWA 3KPRD 4WW2C 1ZHKA 4OF8A 5DLML 4M03A 4QHMA 1YEDA 1UM6L 4ZXBC 5KZCD 4RA0C 1X7QB 4WVRA 2I60H 1BJ1J 2IMMA 3QIBA 1NMBL 4MSWA 1A9EB 2ZUTA 1F4WL 3P4NB 5I30H 4AJ0A 4PGBB 4HQQH 4P5MB 5E5UB 5IQ9A 4LDLB 3O2DL 4YNYB 3ZDXE 4YAQB 1I8KA 5FYLE 4GLRI 4JFOA 1CT8B 4GSDH 2HA1A 1N5AA 1YEFL 2ADFL 4NO5B 1RIHH 4GG6B 1JJUA 4LAQH 2D0HA 2Y5TB 2JLLA 5E8OA 1G7IA 4S1SH 5EUOB 3PWJA 5DA0B 5L2KD 4OLVH 4G8EB 2V9RA 1MJJB 3EYUH 3BJ91 1P69B 4MJIE 1W72A 4FP8H 2BNQE 3SGEH 2D3VA 5EPMA 3A6BL 5EBWA 2ICEA 3KPRE 3S96A 1BFOA 4QTHA 5CP3A 1BLNA 1UQSA 3DGGB 1ZOXA 3I75B 3HTLX 3ILPA 1BPVA 3OKLB 5EZIH 2BXZA 4I0PD 2H6PB 1T83C 4H0HB 4XCNA 2ADJB 25C8H 3LDBC 5EZLB 4YDLC 3WS3A 3CFDA 1U3JA 5IBUB 2CGRL 1M1SA 1P4IL 1MAKA 4ZNEA 1TIUA 2DD8H 2VC2H 4RX4D 3KJ6H 2DM7A 3PIQA 4LHUG 4M7JL 4PGJA 3NCFB 4OF0A 2V2TA 1VACB 2XZQL 5ADOL 4GOSA 1V7NL 5IJVA 2WSKA 5L2KE 1MCWW 1MCCA 4CW1A 3MOBL 1Z9OA 2IADB 1MAML 4BJLA 5T1LA 2NY2C 5DHVA 5I1CH 2OTUB 3RX5A 3CFKA 4U6XA 3HI6H 1G7LA 2JIXA 1F90H 5HYQB 3PF2A 3S36H 2DS4A 1MI5A 4R3SB 3JV4A 1BECA 4GRLA 3RUGE 3P3YA 1XGTB 5CSGA 3ARXA 1SJHA 1S8DB 3SQBA 1PW3A 4WCYL 4LVEA 5D2LB 4K3DH 4FXGA 4BSWB 4YGVA 4DAGL 5I1KH 4NQEB 1DUZA 4C55A 1WFUA 3Q0HA 4FS0A 5CMAA 3MJ9H 5EORL 4KGJA 4RFEA 1BVLB 1RZFL 1XT5A 4S11A 5TE4L 4WRLA 1CFNB 4EXPX 4QGYA 2YSSA 1KJVB 2IANA 3SE8H 1EEUA 3TVMA 3QUKA 1V3MA 3PP3K 4TVPH 1B2WH 3BE1H 4YFLI 1NMCB 2OP4L 1U36A 5C0IB 4Z77A 3IKCB 4E41A 4DUWA 4OD1L 1JCKA 1A6UL 5E9DA 1CR9L 2E7LC 4X6BB 3KHQA 1A7RL 4U3XA 3TBWA 4NCDA 3IJSA 5DJ8B 1JYNA 1MCEA 4NYLB 1IGTA 5ABDE 2DIAA 2V17H 3V6FB 4APQA 3NCEB 4TTGA 6FABH 3RVTC 3NGBC 5B8CA 5J6GA 4ZUTB 5LXGH 5D7LB 4P3CH 4GFTB 4ZFGH 4P5KB 1SY6H 5KS9E 3KXFD 3G6JF 4G7VL 4LPTA 3NIFF 4KQ4H 1AGEA 3D9AH 3F58L 3B8SA 3ZE0E 3QNXA 4P9HH 1MH5A 1YUHA 3BW9B 2HJFB 2EYSA 3OAYH 5IFAH 4ODVH 3HE6D 2ZCLH 2ZKHL 4C58B 1C1EL 5C2BH 1HHHB 1I8MA 1UB5B 4XMLL 5E5RB 2WBJA 1AE6L 2OMNA 1N6QH 2VZ3A 2PTVA 4MLIA 3WLBB 4WEMB 5KBNC 3F7PC 1G7HB 4KVCH 2B0SH 4UB0L 4F33A 1LEGB 1S7WA 4OLUH 5IK3B 3NZ8A 2NW2B 4Z7WF 2DRUA 5CEZH 4N1CA 2UY7A 3QZWA 2AXFB 3KXFE 3VMNA 1FZJA 2P4AB 4L4JA 5CJXC 1C5DA 4HGWA 1KIRB 2JJTC 4NO2A 1ND0B 2CK0L 1D9KB 2G5BB 5B21A 5I18L 3PWPE 3HZYA 2W65A 5KVEL 2AJ3A 3KNBA 3DVIA 2VQ1B 3LMJH 4LU5L 4F7PB 5FV2A 1NAKL 4QRRB 3O3DB 4XGZA 1R0AL 1WZKA 1WEJL 4EI6A 5EZOL 3L6FB 3L3DA 4IBLT 3GFUA 4IRSC 1U8MB 2XA8H 1DN0A 3VXPA 1I8KB 1Z9LA 1PKQE 2PYEB 1CYGA 1Y6NR 4QXTA 1DQQB 1TQCB 2KUTA 3T8XA 1NMCC 5J57B 2V2XA 4LMQI 5F7HA 5F3BB 4NQTA 5DVKA 3H42L 3QIWD 5C09A 4RISL 1QFWM 2D31A 1I3RA 4AEFA 1HQRA 3AY4C 5IBLD 2EXYC 3GJFB 1KCLA 2ZCHL 4OZFA 5JUEH 1NANI 2OK0L 4MNGA 4AH2A 5CHNB 1UA6H 4M8QB 4AQOA 4UI2A 4NWUH 1GGBH 3J7HA 4PJBB 3BUYB 4G8FB 3H3PH 1UM6H 1FAKT 1RUQL 4XVUD 3CFDB 1YY8A 4LF3B 4WWKC 2L4OA 3ZE1E 3MLSH 5C0JA 2NR6D 4X6DE 3VRLE 1AFVL 1NMBH 2VLKD 3O6FD 1ACZA 3T4AB 2EICA 4BZYA 4OJFH 4FFWC 5LGKA 2V2TB 1DDHB 1F4WH 4HWEH 5IJVB 3X12B 3O2DH 2EC9T 3V5HB 2D0GA 3EO0A 1AQDA 4PRHB 4CW1B 1IEAA 4K3JH 5IVZB 3V0AC 4HBCL 4FTVA 1D6VL 1YEFH 3DMMB 5F3HA 5KG9A 3K1KC 1JF6A 1G7LB 3AMLA 5IB1A 3W0WD 3VGBA 4E0RA 5EO0A 1U8OA 1MI5B 1LD9A 3U4BL 5K59F 3MBEA 1GH7A 3VU2A 2AAVA 3PJSA 1AGBA 3OV6A 1WBXA 3HUJF 1RD6A 4PTTB 4B53A 3DVNB 2HTLC 3FO0L 2Z35B 1KLGB 3QPQD 1AGDB 1CDJA 5EO1B 1OCWL 1NFKA 4PV8B 5D93C 5L6YL 2VLKE 4IOIA 1TPXC 4DUXA 4P2QD 1FN4A 2YSSB 1C5CL 3TVMB 1QO3B 1CTNA 5FA3A 3RA7L 4QHLB 5C0NC 4NQVB 4TSCL 5HJ3B 4X4ME 3OKDB 2MKWA 1C7TA 4R2GB 5I75B 3CK0L</