4PJAA

Structure of human mr1-5-op-ru in complex with human mait b-b10 tcr
Total Genus 72
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
72
sequence length
270
structure length
264
Chain Sequence
MRTHSLRYFRLGVSDPIHGVPEFISVGYVDSHPITTYDSVTRQKEPRAPWMAENLAPDHWERYTQLLRGWQQMFKVELKRLQRHYNHSGSHTYQRMIGCELLEDGSTTGFLQYAYDGQDFLIFNKDTLSWLAVDNVAHTIKQAWEANQHELLYQKNWLEEECIAWLKRFLEYGKDTLQRTEPPLVRVNRKETFPGVTALFCKAHGFYPPEIYMTWMKNGEEIVQEIDYGDILPSGDGTYQAWASIELLYSCHVEHSGVHMVLQV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Major histocompatibility complex class I-related gene protei
publication title A molecular basis underpinning the T cell receptor heterogeneity of mucosal-associated invariant T cells.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
total genus 72
structure length 264
sequence length 270
chains with identical sequence C
ec nomenclature
pdb deposition date 2014-05-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00129 MHC_I Class I Histocompatibility antigen, domains alpha 1 and 2
A PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4pjaA02
3.30.500.10 Alpha Beta 2-Layer Sandwich Murine Class I Major Histocompatibility Complex, H2-DB; Chain A, domain 1 MHC class I-like antigen recognition-like 4pjaA01
1LE9B 5DTFA 4WRLA 3VRIA 5A16B 2FJFA 5C0AB 5D72H 5J06A 5HHVL 1ZLUH 3IJHB 4L9LB 4XNUL 1A7OH 4JJ5B 1QRKA 5D7LB 3JBG7 1RQ5A 2CIKB 1UXSA 2BRRH 3ARFC 1OW0A 2NXYB 2VJXA 3AS0A 4OCWL 1JWSB 3QNYB 3H7BA 1AY1H 3MFGB 3PDGA 5BOZG 5IVXF 4LDLB 1WBZB 3KPQA 2E6PA 4RWYL 1FFPA 2AJZB 2XN9B 3QA3A 4PRHE 5FOJA 4JN1L 4N0UE 2NX5B 3VFGL 3BIKA 4L8CA 3RWIB 3R1GH 43CAA 2BVUA 1J9CT 3E3QC 1FBIL 1RZGB 4TSBL 4NN6B 1MWAL 4FQIH 3VGFA 5DC9B 4HXBL 2FIKA 1TETL 4X98B 4MD5A 2KZ1B 2YEZA 5E94A 3S88H 2NY0B 1T80A 1NGQH 4YBHA 3UC0L 4EI5D 1ZS8A 1U92B 4FFWD 4UIKL 5I18L 4OGAC 4MLSA 4M9PA 5AZEL 1TZGL 4JG1H 4U7SA 4XPFH 3E6FB 3MA7B 4YZFF 3MJ9L 3VXSA 3O4LE 1TTUA 4UQ2B 3U4BL 3QUXA 5ISZA 3WIIH 1J1PH 2VDQH 4X6CB 3UJJL 2X2YA 2PXYB 3OJMB 3PWPA 5E2JA 1I1YB 1RJCA 1ONQB 1EERB 1U8KA 3JTTB 4DW2H 1U91B 3TFKC 2X4PA 1TJHL 4PG9B 1FGNH 3LAFA 1HOCA 1N64H 3N1PC 1QBML 4MA7L 1UC6A 2DI8A 5DEGA 5EPMB 1JTOA 3PV7A 5HGAA 2K7PA 1R5WA 3F7YB 1BFVH 4XPTL 5I1AB 4OM1L 3L6FA 1ODAA 2VLRB 2W38A 3ARUA 5EBWA 5BMFL 5I9QB 1RZ8B 1UH3A 5J57B 3EOAA 1T2QH 2DQGH 2G9HB 3OAZH 3TNMA 4MCYA 3K2UL 2PYED 3GKWH 4Z9KB 3U9UB 5CZXC 1OT2A 5BRZD 1FFOA 1FG2B 2Q87A 3KLHD 4PJDE 3QT2A 5I8KL 4CUCA 3MRFA 4CVXA 4NZTL 3CFJA 4WUUD 4D9LH 3P40A 4MJ5B 5IHLB 4LCWA 3ZKMC 5GGTA 5KSBA 1EA9C 2IMMA 3BIBX 5HI4D 1IC7L 5SWZD 1E0OB 3PXHA 3RU8H 1BOGA 5I15H 4NZJA 5CAYB 1FGVL 1JZ3A 2DQJL 3QEQE 1KBGL 3KLDA 5I30L 3BPCB 4XNMB 5E4IA 3T4YA 2DWEB 3S4SG 4CU7A 5KAQF 1AD0B 2OL3A 5KVEL 2DQHH 5DD3H 3EOBB 3QIBB 4JM2F 3HMXH 1V7NL 2JJTC 2VR9A 4AMKH 3UTPE 1U3ZA 3IF1A 3UPRA 1WV7T 4YDIL 2YKLL 1A4JA 5DT1L 1T1ZB 3RPIA 2E7BA 4ZSOA 2LABA 4ZUVB 5E5UB 3UXFA 2FDBP 1CDJA 5C3TA 4M4PA 5MEPA 2VUOA 2XT1B 1CDHA 2P45B 2DIJA 4QRRA 2V9QA 3HE6D 3VXNA 4ZD3H 3HS0A 1YECL 3TV3L 5E5MB 2D7OA 1GOHA 2KKQA 3MNZA 4ZAKD 3RWFA 1D6VH 1SYSA 1D3CA 4XPAH 4EQ3A 5LWYL 5K9OB 3GUTB 1PZ5A 5FKPB 3NZHL 5KOVC 2VXVH 3WL9A 2EDXA 2FJHB 2XICA 5C08A 2DI9A 5GISH 4LSVH 2ORBL 3RGHA 1N4XL 1U8NB 4RZCA 4PGEA 5D70H 3X3FH 2A74A 3KLAA 4TSCL 1CDUA 4JHAL 5C0BA 3WHXA 4XAWH 5HDQL 2A6JB 1AHWC 3PHQB 4ZFGH 1JV5B 3OGOE 5C0NC 3HUJA 1DCLA 1DBJH 1UM6H 1EXUB 4GO6B 1I3UA 3QCUH 1M71A 4NSKB 5TE6H 4WTZG 5IP4A 1YPZB 3I75B 3HAEA 1S7UA 3FMGL 3NIGE 4JGMA 3DRTB 3FQXB 2AK4D 3CZFA 5DUML 4POYA 4M7JH 2FR4B 1JMZA 2MPAH 1I3VA 4Q9BA 1MH5B 4ODXB 2J12B 3KPRD 1HWHB 1QFUH 5T1DH 4U49A 1B4RA 4HPYH 1ITBB 3C60D 4G6FB 4NPYB 3EOTL 1GJIA 1BD2B 1VFBA 3PJSB 4GQ9L 4HMCA 5BXFB 3LRSA 5FGBC 2WIMA 3ARDD 1AGFB 5I1JL 3FRUA 3O2DH 2EDJA 1LO5A 2D9CA 3N1FC 1ZA3A 4HS8L 5KTEH 3FO2A 3P2TA 4PJBF 4YBQC 1A6ZB 3ULVC 3BH9A 4L8DB 4J3VA 2NPLX 9CGTA 2HFGH 1I3RB 4MNGA 3N1QC 2VLJA 3U4AA 3G6JF 5IBTH 5GS1B 2Y5EA 4XI5D 4JKKA 3T2NH 1BQLL 3VFOB 2JF1A 4KK6C 2ZUYA 4Y2DD 1EH9A 5IVZA 1NMBL 1MCFA 3SN6N 5DLML 2ERJB 3L3JB 4G8FA 1IQWL 2X4QB 1LQVA 4YHPA 3MXWL 1NCAL 1PLGL 5F88B 1U93B 5FK9A 5FDWB 1Y6KR 1L0YA 3LVEA 1PKQE 1FFNB 1A14L 4P57A 1OGAB 1NFDA 3O8XC 4NO5B 3MGOB 1T0MA 3M45A 2VDNL 2IPTH 2X4UB 4GMTL 4LVOC 3MR9B 4JN1H 4ZS6D 1FSKB 3VFGH 3O4OC 1YQ2A 3GGWA 4AIZB 2AGJL 5K9QG 4LOUC 4FOMA 5IK3A 2VZOA 1KJVA 5IMOB 4O5LL 1XGQA 3EJYC 4H8WL 4KKCD 4XCYB 5ENWB 4B50A 2FYYB 4HXBH 3TESA 3BZEB 2K9UA 1TETH 4R4NC 4ZXBA 2BSSA 1X5KA 3KYMB 3P73B 4NO2A 1P4LB 2VB5A 4BFBD 4DVBB 3UC0H 1IMHC 4WHTB 2CRIA 3D85B 3GMLA 1FAIL 3MRGA 4YJZL 2H6PB 3QZWB 5AZEH 1TZGH 4GJTB 3VGAC 3OKMB 5K33A 3CXHK 3MJ9H 3FRPA 4NHCL 1OP5K 4RFOL 5F9OH 1FYTD 3QP3A 1NC4B 3OR7A 3O0RH 1SJVA 1JHLL 5F6IC 3MRHA 4IIQC 1ORQA 3RWHB 3VFMA 3UJJH 3SDDD 4HJJL 3SDXE 5HYJB 1VFMA 2DQDL 1F4HA 4KC3B 5FO7A 4PJGB 1TJHH 1LDSA 5D93C 4KI5C 2ZCLH 2R1XA 5TDPA 4WEMB 1QBMH 4RFEB 3RY6A 4CN6A 4HX1A 2IAMB 1IC4L 5D2NB 1KELH 3MRMA 1HINH 4ENED 5BS0A 5L6YL 4P5TB 4DFHA 3M1BB 3L5XL 2Q6WB 3VFTB 4WHDA 1LNUA 1XAUA 2ZUVA 3IGAB 4HS6B 2DKUA 4MVBC 4BJLA 5GRWA 1U8MA 1E6JH 1HHJB 1KLGA 4JO3L 5HI5D 3MODL 4JFFB 3SGKA 1HZHL 2X9YA 4YAQB 2ADIA 4OUUB 3RWEA 4BSWB 5BMFH 3MOQA 3RNKA 4Y89A 2WINA 4HIJA 4P4KA 4X7DC 3RP1A 5I1GL 1IGYB 5GJSH 1CFSA 2GJ6B 1H0DB 4P2YA 4L3EB 5DJ0A 2NTFB 1XR9B 3K2UH 1XR8A 4HJ0D 4RGOL 3ZE1E 2NY4C 5I8KH 1KXQE 3WDHA 1HNGA 3VFVA 4OCSL 3QQ3A 5I0ZA 2XYCA 4NZTH 3L9RB 5ADPH 4NOFA 1MI5E 3KYOB 3MLTA 5JPNA 4P3CL 4QF1B 5GSVA 2HRPL 4PLKD 1YUHB 3G5VA 3VWKC 3H9HB 3G6AA 4OSUL 4F7CB 1IC7H 4KAQL 1K5NA 4JQXC 2A6KB 3CPLA 5TE4H 3U4EA 1RULL 4NC1C 4LPWA 1DVFA 4XMPH 3MUY1 3VG0H 2DQJH 1P4BL 1JPGB 1IE5A 3C5ZC 1S5IH 5FYJE 5I30H 1KUMA 1EUUA 1TMCB 2YPVL 1D7FA 5IEHA 4OFYA 5TF0A 5IWLC 2CKBA 4LFHG 2J88L 2X4NA 3BDYL 2ZSVB 1HCVA 3QULB 3VXPA 3CMOH 3RA7L 5BVJB 4QHKI 2VZ1A 1NAKL 5AAMA 3KR3L 4X4YA 1MSPA 2ZOKA 4LCCA 1Q9WA 2GUOB 1AKJA 3NPSC 4HZAA 1FC2D 4JPKL 3JWDH 2YKLH 3LB6C 4WTXA 5DT1H 4WO4D 4LLMB 1HILB 4ODSL 3FB7A 25C8L 4HGWB 1RUKH 3WEXA 2GI7A 2G2RA 4EIGB 2WANA 4FQ2L 3RL1B 2VABB 4UOJA 1IEAB 1P7HL 4OLYL 2DIAA 3GSQB 4R0LA 1YECH 4NNXA 3TV3H 2M26A 4XNYL 4PD4J 1FVEB 4HS3B 4QT5A 4UB0L 3U46B 1B2WL 1MCJA 3ZE0E 2VXUH 1CD1B 5J9PB 1AR1C 1E28B 5KSVB 5L8KB 1WAAA 3OXRB 3S96B 1FNHA 2WBJB 4N8VG 1DDHA 4ETQA 2PO6A 1U8LB 1LO3L 2HVJB 2J6EH 5HHOD 2Z4QB 2JJUA 2QSVA 1N4XH 4LRIC 4BFGA 1FL6A 1OP3H 4PJHE 3DX6B 4KKLD 1FV1A 1D6EA 1CL7L 3U2SA 1YN6A 1LO2L 4JHAH 1XF5B 2HH0H 3HNTH 3N9GL 1WBXA 5K9QI 3ERYA 2OK0L 3OJVC 1QFHA 3VH8B 5KS9F 5D1QA 5FUCE 3NCMA 4UNVA 4AENB 3SJVE 1NBVH 5IVNA 3MUZ1 3HCVA 1U8HA 2NNAA 1WUNT 5DUMH 2HWZL 3AAZA 3HC0B 4JQIL 3QNXA 3PWJB 5GRJL 1JPFA 3SCMD 1UEMA 1XIWA 4IRJD 3TIDB 5FCSH 5GS0D 3SKMA 1S8DA 3V6FB 1JF5A 3QFJB 2VAJA 3EOTH 2A73B 2ADJA 4LASL 3CSBA 3FOLA 3G9AB 3PHOA 4JDVB 2MQ0A 3HC4H 3MRCB 3VWJD 1NGYA 4CNIA 5I1JH 4HG4K 1T1YB 3OX8A 1K8IB 1MCIA 3MV7B 4N1CA 3MRLB 2SEBB 4L4TA 5IJVB 2NLJB 1Q0XL 1MLBA 2GYSA 2HT4D 3FOMA 4C56B 3G04A 4DN4L 4NQCA 4OZIA 3WLBB 2EDTA 3DXAB 1X7QB 3QIWA 5IW3A 4C55A 4PYHA 2C3WA 3LKRB 2HFTA 3QWRA 4F7MA 1T7YA 3WUWG 1OP9A 5EU7E 5DLMH 4Z7WB 4KK9C 3SQOL 4OLVL 1IQWH 5IT2H 2JIXB 3MXWH 4Z5RB 2Z8RA 4YFDB 1N2RB 1MFCH 4ZPTA 1R3IH 1YEFL 4HFWB 3QEGH 1T20B 3BP7B 1F3JB 1QFPA 4RX4D 2FX7H 4PJFA 4QOKE 3OKLA 5A2FA 5B4MD 2CRMA 4LEXH 2CLRB 1AO7B 2VDNH 3LPFA 4Y5YC 1YY8A 5EU5B 2DLFH 5EOQL 2QSCL 2C4FU 5F9JB 2AGJH 3FB8B 4OD2A 5LXGH 4Z7UE 5HY9A 3S9DB 1BWMA 5CP3H 4PTTB 1T0NA 1P5VA 1PG7L 4KDTC 5DZNA 4E41B 4Y4KA 1BF8A 4PV8A 3WSQL 2IH3B 2C1OA 2WQRA 4YPGA 4HHAB 1GGIL 1FAIH 4FHBD 2MHAB 4QHLB 3EBAA 4NZDA 5IROC 2PR4L 1NH6A 3CCHA 1XGTA 4FN0A 5CIPH 4R96B 4PJ7A 1CE6A 5ESVB 2WMPA 1NDGB 1NUDA 5FGSA 3LHPH 1MLCB 1X4XA 4JFOB 2HT3C 1C08B 4MAYC 4NFBA 1KCSH 1ZT4A 3EYUH 1RUML 4FS0A 3RKPA 1JVKA 2GK2A 5KW9L 4E0RA 1NBYB 2DQDH 4P4RB 4H1LA 4X4MA 1EX0A 2GT9A 2YPLE 4B7IA 3PL6A 4HDIB 5T1LA 3TVMD 3VRLE 3I02A 4X7TB 3UZEA 4OF8A 4DAGL 3VJ6A 1P7QB 1IAIH 3T2QA 4CBPA 4IMKC 2HG5B 2VZUA 3MLVL 5HVGB 2YWYA 3P0YL 1F00I 4R7DB 4JRYA 4Q74A 3GNMH 4KJQC 4JO3H 2YUXA 3QUKA 1HZHH 5DI8B 3QSKB 3RZCB 5F7WC 3CFCL 3NFSL 1Q1JH 4YHLL 5L2KA 5DK3A 5F7UA 4U1NA 5E70A 5J13B 1ND0B 5DHVH 4TVPD 5BW7C 4XWOC 1S9WB 4X0KA 1IGMH 4OCSH 5CIPB 4Q9QL 2Z91A 3REVB 4IOFD 1BZ7A 2EDOA 2H26B 1GGCL 3KJ4C 4BFIB 1OTUC 1TZIB 1HSBB 2EDHA 4WIQA 1YYMH 4KAQH 4ZG1A 4ONHB 1AHWB 2JLLA 3KPNA 3WUZA 2R0WL 1WWCA 4JZJA 1MHEA 5ALBL 2CLVB 1P4BH 5GRVK 1EO8L 2BVPB 5DD0L 5CILL 3HR5B 1N59A 3IDMA 5B3NA 2EE3A 3B9KA 1JGUH 4DVRL 2EEAA 5GIRB 3BDYH 5T33H 1OSZB 2BMKA 5DURB 3GBML 3ESVF 3RWJA 2Y4SA 3RA7H 1HI6A 3EO0A 5JOPE 1M6OA 3VXUA 2VLKB 4FQHB 3BPLB 5B8CB 1NAKH 3OV6A 2BOBB 1ZHLB 3K8KA 3LKNA 3KR3H 1H5BA 3OKEA 5HGHB 4OLWL 3V6ZA 2I25N 3FFCA 3LKPA 5JA9A 5EO9A 5IVXB 3GJFK 5EU6B 1AE6H 2NY6D 3WJJC 3C09C 1A7PL 3QI9D 4M8QA 1A1MB 2ITCA 4PGDA 5DHVB 2C4FT 4ODSH 4OF5A 4NHUA 2E7LE 5TGBB 1VPOL 2V7NA 4MNQB 4I18B 3ARGA 1KTRL 4DGYL 1MNUL 5CJXC 3DV4A 4UT9H 4UB0H 4WY7L 5CSZA 2DYPA 1B2WH 5CZXD 4MQTB 1EFXB 5DSCA 3HI6H 1RUAH 4FQJL 1YEIH 3FN0L 3D25A 1KTDB 4X4XB 3TO2A 2Q7YA 1HEZA 4WFGD 5E8NB 3ZKMD 3MRBB 2X6MA 1G7IB 2QHRL 4APQC 5EU4B 3QDMA 1B3JA 3SPVB 1OGTA 4C54A 2NQCA 3UTSE 2IALB 2EZ0C 4JAMB 3QDJA 3RWDB 4BSJA 3LRHA 1QHPA 2DJ4A 5D1ZC 5FM5M 4EDXB 4GKSA 6FABH 5EO0A 5TF1L 4M62H 3N9GH 3HA0A 4JO2L 1JTPA 1BFSA 4AY0A 3PGCA 2JE8A 3DROA 3H9YA 4K9EL 1P4IL 5HD8C 1GYAA 4NT6B 4O9HL 3TBWA 4MXQD 3CVIL 4IRSD 4NKOA 2ED8A 3CK0H 4MQ7B 1JGDB 4PRBB 4HZLA 1MF2H 5ETUB 3T0EC 5J12C 4MCZA 4FQQB 4OBSA 4PB0H 5GRJH 2O5ZL 4YXHL 1U8JB 4JR9H 4RISL 5DQJA 2ITDB 1DN2A 1S78C 5ID0A 2CSPA 1I1AC 3Q2CA 3Q3GB 4YBLB 1A3RL 5EU3B 3PP4L 4OCYH 1QLRB 1TVDA 3NCBB 3PL6C 3G5YA 1BPVA 3EFDL 3FTGB 4G8GB 4K3GA 3DUSB 4YXLL 5K9KA 2QQLL 2WBKA 1U8QB 5C0EA 3AB0C 5D9SA 2A38A 3KPPA 3BW9B 4LLUA 2DQEH 5C3LD 2EIBA 3LKSA 1ZMYA 3BO8A 1XF1A 3ME0A 5D96B 3BUTA 1RMFH 2YSSA 1Q0YH 4PRHA 5JHDD 4TSAL 1NGZB 1S7VA 2IG2L 4GRMA 3RJDA 5AAWA 1KSRA 3MRIA 4MJIB 5F89B 5DVKA 4JEGB 3GMOB 1T1WA 4JM2B 3SQOH 4JHWL 4OLVH 1KG0B 5E7FA 5FA4A 5C0ND 1CD0A 5ANME 4ZFOL 1YEFH 3C08L 4W4NA 5KJRL 1I8LA 2AV7B 3TNNB 1MAJA 3BEWA 3R0MA 3RPKA 4M3JA 3U7WH 3L3OA 1ES0B 1T89C 5CINL 1JRHL 3PP3H 4LLAA 4GAFB 5JW4M 1VERA 4WGWB 4J3XA 3VXSD 3PG2A 4GXUN 2DQTL 3GM0A 2OQJA 2QSCH 5EUOE 5I76B 4RQQB 1HH6A 3ULUC 5ISZD 3K1DA 1CDBA 3PWPD 5D7SL 5HBBA 4JRXA 4LVNC 1D5XA 2XQYG 3WD5H 4XC3L 2BFVL 5TDOA 3RTQB 2WV3A 4LLWB 5FO8B 3N50A 1PG7H 2F54A 5FOBA 3NFNA 4EI6A 4DOHE 2LAAA 4ALAL 3WSQH 3BOVA 3BGMA 4GG6E 3BPNC 2DJSA 3D0LB 3BZ4B 4P46C 5D71L 4GAYA 4O4YL 3QDGE 3CVHL 3RGVC 5IQ9A 2V2WB 1HYRC 3TN0C 1WCBB 1N5YL 4PB9L 4B53A 1MFDL 4Y4FC 2BNUB 1N0XL 1FJ1B 1FNGB 4H5SB 2Q8AH 1G7QA 4KV5F 3BVNA 4G59A 3WMSA 5C0FB 4WU7B 3SGEH 3U0TA 4KK6D 3RBGA 1KJMA 3PF2A 3VU2A 1J12A 3MACL 2X1QA 4XVTL 4YHIA 4PJDA 3NFPA 5GSRB 3JTCA 4EUPG 2EEBA 2RB8A 2RCSH 3EJZC 4DAGH 3FB6B 2FD6L 3C8KB 4HK0A 1JFQH 5C07E 1NKRA 1ZVSA 2JCCE 3MLVH 3DOSA 1QFWM 3R06B 1R5IA 4NN7B 4RRPA 4PBVC 2EKJA 4TTDC 2VDPL 2BRQA 5IKCA 4ZUUA 3NFSH 3UTZB 5JHLL 3HE7C 4PRNA 3ZTNH 1GPOL 1LHZA 4WUUB 5F7EL 1BVKB 3ET9F 4LOUD 5CJOH 5EFIA 1FPTL 5SWZB 1F11A 5E4EC 4XXDA 3EJYD 3THML 5F9WB 2K3TA 3GZKA 2J8UE 4YHOL 4Q9QH 4RSVA 3EO9L 2Y6SC 3FQNA 3O11B 4UQ3B 5DJ8A 4PJBB 4JKWA 5M95B 4P5MB 4UIMA 5IB5A 2B4CL 5I2IA 1GC1C 2XWBA 3VXRD 4PJCA 2P8PA 1I7UA 4PTUA 2R0WH 1H3VA 4FXGB 5DEFA 5ALBH 2VKWA 4OGXH 3G6JB 4N5UA 3D39B 2R2HB 3I50L 4KPHH 4DVRH 2CXKA 1VEOA 5E6IA 4G7VH 5JXEA 1KPVA 3KPMA 3GBMH 3UAJC 3MRPB 1KNOB 2E7CA 5SWSA 3LRGA 1G9NL 1FVDB 1I1CA 2QKIA 4KI5D 1JWMA 5ID1B 2Z9TA 4ZFFA 4BQ9A 2FATL 4U1KA 4LSQL 5C08D 1FIEA 3HE6B 1MHCB 4Z7OE 4HK3J 4P59H 5D7IE 4ELKA 1PY9A 4MVBD 4OV5A 2AK1L 3WFBH 2D0FA 1WTGT 3GEWB 4FQCH 4P2QE 1SY6H 5GS0L 4ZFZB 3K1KC 4HIIB 3WNOA 4P2OC 2VAAB 3GB7A 4JHZA 4NFCA 1N8ZA 1HHIA 3FT2A 3X12B 1WISA 4MDJA 4LKCB 3DV6A 4UDUB 1OF2A 2IMNA 1RVFL 3QZWG 2X4TA 1P69B 3KYNB 5I73C 1FZJB 3MNVA 4MMXC 4IDJL 4KUCD 5HYFA 4Y5XA 5I8EA 2J8HA 5ITFB 2R0ZL 1GZPA 3DETC 3PABA 3BKJH 4JVWA 2QHRH 3BWAA 1CDIA 1YMME 2HLAA 1AGCB 3VWKD 4FZEL 2CLZB 4GH7B 4R3SA 1EDQA 4M7KH 5D7KD 4RGNE 1WICA 4JE4B 3HPLA 3HRZB 5I66B 4XP6L 1NCBL 3D6GA 1DTUA 5D6CB 2H9GB 4O58L 1YA5A 3C5ZD 4IOSD 1O5DT 4K94L 4LDEB 5C0AE 1TFHA 5KVFH 5TF1H 1QTYT 5KSBF 1K9TA 3BGFB 1FZOA 4LIQE 3G5XA 4POZD 5D7LE 3WXWH 4K9EH 5CFHA 2YRPA 3E8UL 3QUZA 1BVLA 1CT8A 3FN9A 5DYOA 1P4IH 3WNKA 2CO7B 5GRXG 2FIRT 2FWOB 2F53E 1QQDA 4N9GB 3GRWA 1C5BL 5T1MA 1KT2A 1QLEL 4UU9B 3EYFB 4QRQB 3O81A 2OZ4A 2CDGB 4N1HB 1NAMA 2XN9E 2R56L 5TPWL 2VLJD 2NX5E 3BKCH 4R4BA 2NY5L 3ARDB 1BBDH 5EO1B 4ONGL 1J8HA 3SEPA 4LPVA 1A3RH 5I17A 4CJ0A 3PP4H 4J7RA 3QPXL 1S9YA 3A6BL 3EFDH 4XX1G 3S37L 3KS0J 4PJXE 4YXLH 2GTZA 2YC1A 2QADC 4TPRH 4X80L 3RHWK 4EUPA 2VDLL 3IETB 1AR1D 5IHZB 1VACA 5D1XB 1YJDL 3QJFA 1JK8B 3GIZL 1EJ6A 4HULB 1JZ2A 4LLYB 3BYTA 3B6SB 3LEYL 4PLJD 4LSSL 1MRCL 4KJPC 4K2UH 3NZ8B 4YEEA 5F7DA 5GJTL 1TQBC 3OB0H 4LGRB 3VFNB 4X6CE 1UXWA 2H2SC 1UACL 4TYUA 2W59A 1DQDH 1G7HB 5GGRB 5J1TC 2YMXL 5KSUA 1T22B 1WITA 3IDJB 3LQMA 4JHWH 4LKXB 3D2UA 5GZND 4ZXBD 1HN1A 4PJIE 5KJRH 3C08H 2VZ3A 1B0GB 4NZRL 3NA4A 3NMEA 2GK0A 8CGTA 4KDVA 2G5BA 3F58L 3RKDC 4N8PA 4Y5VC 1JRHH 3K2MC 3FFDB 4HBCH 4NCDA 2VLRE 4TN9A 2BVQA 2DQTH 4OCRL 3HUJF 1RAMA 4JY6A 1ZLUK 3EYOB 1A1NA 3VGEA 4CL7A 5L88L 2D0HA 3ZYJA 3VDAA 4TVPL 4KUCF 3TM6A 3D5OF 1ADQA 2WW8A 2QEJA 3SDXA 2XZQL 2FL5A 1QZ1A 3T4AA 1KOAA 2EIZA 4PPTA 4WW1A 1DBML 1AI1L 2XA3A 3S35X 3CFKB 5D71H 1FYTB 4YE4L 4O4YH 1Y18B 2Z31C 1A7NL 5H2BA 5BS0D 4RMVA 3T1FB 2NY2C 3BT2L 5DK2B 1N5YH 3QG7H 3VCLA 3GSOB 4M6NL 3BQUB 4AM0B 4OCMC 3JWNC 1UZ6F 5I1KL 2WLYA 1SBBA 4C57C 3EFFA 1KCUH 4NNPL 2XTJE 4P4KD 1I7ZB 4L5FH 4LLQA 1MOEA 3DVNA 2D2OA 3VH8G 4ZFOB 1GVIA 2R23B 2VN7A 1R3JB 2XZCH 1S7WB 3QQ9C 4ORGB 1T5XB 3L3GA 3SBWC 1KN4L 1OB1A 4LBEA 3OAYH 5J1AB 5CBEB 2FB4L 1I3GH 2MNUA 4NQDD 5KS9B 3INUL 3V5HA 4X83A 4GBXC 4Z77A 4P9ML 5EBMA 4XWGL 3UJTH 4WW2A 2VZSA 3HLAB 2B1HH 5KG9B 1DVFD 3NIDF 4G8EB 2VDPH 4UV4H 1JNHA 1OAQH 4JJHA 1DQMH 4YK4C 4FQLL 4QHKJ 4RMTA 3ZT5A 3PXJA 4XBPA 5EN2A 1DLHB 1JPSL 4ZOCA 1F2XK 1QBAA 4OFYD 5F7EH 4Z78A 5FYKD 2XFXA 4MDIA 5AWNL 2WWMC 3C6LC 3X14B 2WBWB 4QKXB 5F3BB 3GSNL 1FPTH 1NFDF 5EC2A 2IANA 3MJ8A 3LH2L 3W9DB 3RVVC 1QG3A 3UBXB 3TIEB 3TBTA 3DNKA 2BSRA 3GMRA 1RJYA 5DHXB 4TOYL 5D1ZB 4PRAB 5EB9A 1AKJD 3IDIB 1JNJA 4JG0L 3LQZB 1QUNA 3OAZK 2EXWC 1BP3B 1MWAA 1RZFL 2BC4B 4LLVB 4PJ9C 4Y4HA 4PGJA 1FIGH 4POUB 2EDRA 3U36A 3IFNL 1MHHA 4JFXB 3FQUB 3I50H 3NCJL 4GG8B 2EH7H 1HDMA 3WKMH 2HT3D 4MAYD 3OKOB 4XCEA 2AVGA 5INCA 2PCPA 1AQDA 4ODVL 5JOFB 3GFUA 4WO4B 2Y5TA 4S10A 3OXSA 5BQ7B 3IAPA 5T3ZD 1ZANL 2XQYK 3EO1B 3IB4A 5F9AC 3B3IA 2FATH 2XA8L 1XCQB 1KGCE 4Z7NF 1A1OA 2PO6D 1P84J 3HG1D 1K4CB 4BQ6A 5I75B 5JQ6H 4PGBA 2X9XA 5GS0H 5HPMA 7FABL 1TQCB 4QRTB 3LV3A 5ESQB 2ARJA 4PJHA 4JY5L 2P24A 5IF0B 4QXTB 1MFAH 1BREA 2XWJA 3S97C 2PUQT 4NUGH 3UCRA 3MCKB 4Q6IA 5HHOB 1A6WL 1KEML 2AABL 1RVFH 12E8L 2EKSB 5EZIH 4L4VB 2Z8VC 5CGTA 3MLYH 1BAFL 5BZWA 1ZGLM 4GXVH 1YNKH 4W4OC 3FHQA 1ZXQA 4NO0A 4R2GC 5MEOA 1OTUD 2IADA 4WWKC 1EAPB 1HHHA 3RDTA 3QG6B 1DUYA 5DQ9A 1XF4B 4H26A 3LN4A 3MLUL 3AM8C 1NCBH 4K3DL 2HFEB 3O9WA 1YEJH 5T1KD 4LAJH 4K94H 1CG9B 3B2UC 3EHBC 2ESVB 3ROLB 4JKPL 1GRWA 1CFNA 2B0SH 3TJEL 3DUHA 2M2DA 2W0FA 3SCMB 4LMQI 2E5EA 3UTTD 4LLDA 3RVXC 5HJ3A 4BA8A 1L0QA 4LVEA 4YNYB 2GSIA 1C5BH 1R24A 2XACC 3T65B 2YPKB 4NO3A 1OGAE 1KB5L 2H3NA 4L4TD 1EK3A 4G43A 1QPXA 3R4DA 1RIUL 1LK2B 4ELMA 2BK8A 4DJMA 1DANU 2ZOLB 3ARQA 5JW3L 5TPWH 1J05A 1DJSA 3MMEA 2XG5A 5F1NA 4ONGH 5MI0C 4P46B 1FLRL 3S8WA 2XKUA 3QIWD 4P23A 5F8RC 1TZHA 4NQEB 3QWRD 3QUYC 1A9BA 3TGXA 1A3LH 3LN5B 4LAQH 5TQ2L 3QPXH 1WZKA 3SDCC 4J6RL 1OTSD 2VL5B 3SGJA 1AJ7L 1XGRA 3MUGA 3S37H 4S0SD 3SKOB 3C8DA 5T5FH 1JWUA 2VDLH 5IMMA 4G80A 4DEPB 1PGRB 3TBYB 1S9VB 2AI0L 3GIZH 5FDYA 4APQD 3GSXB 3QHFL 4QOKA 4QXGH 1V3LA 5JO5B 2ATKA 4XZUA 4ZODA 2APWA 3REWA 4A6YL 4HPOL 5A1AA 4F9LA 4ZDHB 2Q3AA 3S35L 2WK2A 3T3ME 4YC2B 1KC5L 3SO3B 5IG7B 1SEBA 1CN4A 1INEH 4Z7UA 4LSPL 1UACH 1WAAF 3WO4B 5I1LB 4L8SB 3Q6FA 4OIIL 5HYJE 1V7MH 4XMKL 2YMXH 4HC1H 3QXDA 2FZ3B 2AJXH 4PJGE 3NACH 1P1ZA 3MV8E 1NEZG 4Y4KD 5SX5K 5L8LB 2YOCA 4LQ1A 3RZWA 5GGTL 2V2TB 3DX7A 3IFPB 5D2NE 1NMCC 1F6AA 2BOCB 4CAGA 2AV1B 5C0IA 4TUJA 1YNTB 4W68A 3MLPA 1EEYB 3F58H 4FXKB 2FECL 2G60L 2I5YL 1NDMB 4M43L 2Q7NA 4PFEA 1CIUA 2L7JA 3P4OA 1IAOB 3QIUA 4OCRH 3WNNA 3MCLL 2EDQA 2A83B 3C5SA 4PUBH 5CZVL 4JVUA 2NW2B 3UX9B 4ZYKA 5L88H 3ILPA 4IOIB 4OD3H 4TVPH 2OL3L 2AXGA 2VR4A 5SV3A 1UCBH 4EVNA 1I7RB 1WZ1H 4OLEA 2WUBH 3KWWA 3O6LL 1F8TH 3PL6D 5T1LD 2CK0L 1KFAH 3CFBB 1L0XA 4NN5B 3LIZL 1VFUA 8FABB 3DO7A 4YE4H 1QVOB 4HUUA 1BX2A 3CU1A 3Q1SH 4QHNA 1CDGA 3BT2H 3VXMB 4JRYD 2X4OA 1OHQA 3CDCA 3WFHA 3A6OA 1DSFL 5DJZB 2B5IB 5IM7A 1Q72H 4KRPC 2DD8H 1I9IH 2BNRB 4UV7L 3Q5YA 4LCIH 5BV7H 5L2KD 5L9DL 3TVMB 5B22A 2I27N 3ZKSD 1ULVA 1KIPA 5TE7H 1X5AA 5E9DD 2AEWA 3MRDA 1ACYL 3TCLA 5I1EL 2IPKB 4U6YB 2F5BL 1HSAA 2RQ8A 1PYWB 4ETYA 4P3WA 2W1NA 2CR6A 4CADB 3BAEH 4YXKL 2B2XH 2QQKH 4HT1H 1BWWA 4OZIF 4WCYH 3QQ4A 5F7YC 1URLA 4P9MH 3O6FB 4HV8B 1E6OL 4XMLL 3CUPB 5FO9A 4I3GA 5MEQB 4OIBA 3P30H 1NJ9B 1P9MC 3TBVA 1HKFA 4GKNA 4R9HA 1D9KA 4X6DE 5L0QC 2XZZA 3WIFB 4GRLC 5LBSH 3PIQB 3ULUD 3BP4B 5AWNH 3DYOA 3OR6B 2LU7A 4FQXA 4PJFF 2JKXA 1KB9K 3VXUD 4NP4L 4MWFA 3LH2H 1FP5A 1RZJH 4LVHC 2P5EB 4J3UA 1CR9L 2P8MB 3V0WL 4OF6A 3FFCD 1I7TB 3QJHB 4OCXL 5BV7B 3RGVD 5CJBA 4Q97A 3AU1B 1UJ3B 2OTWA 4DK3A 2E27L 4PY7A 5JDSB 1RZFH 2BY3A 4JFYA 1T3FA 3W2DL 4XCNA 3PQYB 3ECBA 3NCJH 2E7LA 3VE0B 2IQ9H 5I1DB 5F72S 2VDOL 4HCRA 3BPOB 3DECA 2DYPD 1A6VL 5C6WH 2NY6B 4PJ7F 1BJ8A 2C7UA 2JB6A 3QI9B 3TJHC 3W11C 2V5TA 1ZANH 2MQ3A 4HJGA 1X5IA 1TJIL 3H2WA 1ZT1A 3F7VA 3CDFA 1DBBL 4FTVB 5DJAB 2AJYH 4MS8C 1EEZA 2R69L 1U95A 3E3QE 2ENSA 3WN5A 4I0PB 3ZKNC 5JDJA 3R8BB 4ODUA 2X41A 1OQOA 2F5AH 2HT2D 3QDJD 2IQAA 2D31A 5DXWA 2CPCA 2HVKB 4JY5H 3RWGA 1M7IB 3PGDB 1GGYA 4ZUSA 4F57H 3DX8B 3ABZA 1QYGL 3L7EA 2FGWL 3GJEB 3M17B 3QHZL 3O2VL 1W0VA 3STZA 3SKNB 4CKVX 2NY7L 1J18A 3F12A 4J3SA 4U1IA 5A2KH 5C9JA 2CDFA 2GAZB 2Y6SD 3C2AL 4Z0XB 3O2WL 4AQ1B 2YA2A 4R4FL 3MV7E 5IW1A 1SMAA 1J0YA 1OVZA 4XVUC 2YD8A 1AGBA 3WJLC 3R0NA 4J8RB 5KZCB 5IVOA 1P2CB 4X9GA 5BO1H 2ZKHL 3MLUH 2YRLA 2DDQH 3C6SA 5TFSL 4K3DH 1AGDA 1FORL 3OBAA 3DXAE 4IRSB 1Z3GL 3IKCB 5KSAC 1NKOA 1UJTA 2FH8A 1RK0A 5F6HI 5J3HC 5EIIA 5E2UL 4HXAH 4NUJA 4X9HA 3TJEH 4WHYH 4Z8FH 5EIQA 1Z5LA 1GIGH 2Y07L 3UDWA 4YDJB 3V5DA 4PP2A 5DZLA 3VRIB 3F65A 2K1MA 1U3HA 3AREA 1IGTB 3D69A 4MA8L 4W6YB 3FT4A 4PRHD 4HUVA 4ZO7A 3DMMA 2NMSA 1NGPL 1JHTA 4KY1H 2EDFA 2O5YL 2B1AL 1BMGA 4HUKB 1W72L 3K74B 4YFLF 1KCLA 4WTWA 1G7PA 3BP5A 2BCKA 3KPQB 1BQHA 4J6RH 1FFPB 3QA3B 1UWGH 5IFHL 3OG4B 4L8CB 5H94A 2H41A 1LO4H 1NC2B 1ZLSL 1HKLL 4K8RC 5A3ID 1T03H 1L9MA 1FNFA 2ZUQC 2BDNH 1RUPL 3O4LD 4MD5B 2YEZB 2XY1A 4KUZH 5ACLA 5EUOA 1KC5H 5DD5L 2WIIA 1ZS8B 5J11B 2BVTA 1DQJA 3V7AE 4EOWL 4WEUD 2FX8L 5I1IH 3KHOA 2DL2A 4XMKH 5DQDL 5J6GB 2NYYC 3AY4A 3GI9H 4OZFA 3S3JA 5GGTH 3VXSB 1X9QA 4X9BA 4GG6A 3SE3A 3SDAC 1F6FB 3QUXB 3QDGA 1EMTH 1OTTD 1WBYA 4WUKH 3T0VA 1OP5H 1R3KA 3FHAA 3PWPB 3GSUA 1CL7I 2G60H 2I5YH 4ZUTA 5HI3D 1U8KB 4M43H 5F7FA 5DRNA 1HIML 1YY9D 2Q76A 3UO1L 1CWVA 2X4PB 3V4UL 1NL0H 3MCLH 4RFNB 1ZSDB 5CZVH 2CKBL 5E8DL 5FYKL 5FGRA 3LD8B 5HGAB 5IQ7L 4DGIL 2OL3H 2IH1A 5JUEH 3OJDA 3QEUB 2XIDA 4D0BA 3L6FB 2APXA 4M5YH 1CK0H 1L9NA 1SBSH 5EBWB 4JFEE 3JZ7A 3GMMA 5I8OH 1XCTA 1LE5A 2FX9L 1H3UA 4YDLB 2AEPL 3EOAB 4GQPH 2JCCA 3ZE2E 2P48B 4X7EC 5HHMB 3UZVB 4TQEH 5DFVC 5B39A 1T83A 1DSFH 1FFOB 3FONB 4XP4L 4J2XA 2Q3ZA 3VRJB 3QEQD 1AIFA 4UV7H 1T1XB 3MRFB 5L9DH 2NY3C 4CVXB 4YLQT 4ZUWA 3CFJB 5CMAA 4EI5A 4KJPD 1RZKC 5EZJB 4LCWB 1NFKA 1OLZA 3B8SA 5IW6A 3GMNA 5KSBB 1VKXA 1ACYH 4I13B 4U0RB 5I1EH 2A9ML 1BOGB 3NCFB 5T3ZL 1BFOA 5HVHC 3GIVA 1JYVA 3FB5A 4JFQB 2W9LA 4G6KL 4YXKH 3UTPD 2QTEA 4FA8A 3VFSB 2W60A 1NCNA 5IVXE 1E6OH 1A6UL 4XMLH 1PZUB 3FAWA 2GCYA 4NC2B 1F42A 3B4NA 2OL3B 4M93B 2HJLA 2VE6A 4X7SL 3FO0L 3FO1A 3K8MA 3U0WH 3IF1B 4YHML 1K6QH 1MJ8H 4PJ8A 3QEHA 5JXED 3UPRB 3ULVE 3MJ7A 2VITA 2OI9A 1A4JB 2WZPD 3RPIB 4ZSOB 1WF5A 3HAEH 3VXOA 1CR9H 5I1HH 5FIEA 2VQ1A 5MEPB 3V0WH 1LWRA 1MREL 1HNFA 2Z31D 1BOYA 4QRRB 3CNKA 4NFDA 4LEOA 1DQTA 5MERA 3MLRH 3VXNB 5BRZA 3HS0B 4EXPX 1CE1L 1G6RL 2E27H 2H8PA 2EC8A 5F3HA 2OMBA 4KJWD 5AZ2L 4YZFE 3DMMC 5CSBA 3W2DH 1CLOL 3MNZB 3RWFB 4F7PA 3RHWF 1SYSB 1H9VA 1MJJA 5IJKC 4YX2H 1CGUA 1FCGA 3QQNA 3H9SB 4WFHE 3WL9B 2I60H 3IFLL 3QQ9D 4N90E 1T6VN 3S7GA 3EZJB 3JWOL 3ORJA 1JUFA 4Q0XL 5DJCA 4RZCB 1KEGH 1AGEB 1DBBH 2A74B 3KLAB 4GBXD 4YFEA 4U1GB 1UM5L 3WHXB 5C0BB 4X6FB 4M7LH 4YDVA 4UOW0 4Z7VE 3SDCB 4J1UA 4KROD 3SQBA 3HUJB 4PJDF 1VEPA 4CMHC 4KK5C 1CXIA 2PKDA 3MRKB 3VI3F 3DRQA 1HXYA 3HAEB 5HYSG 4HSQA 4BKLA 4HH9A 4JO1H 1LP9E 1ZHBA 1QYGH 2DLHA 2EE2A 2WWMD 2Z35A 1RJZA 3CZFB 4K07A 4JVPA 1FLTX 3IJHA 3TA3A 3O2VH 4G8GE 5D7JC 1JFMA 1WQVT 4HGKC 4N8CL 2YWZA 3C2AH 4M1DL 2F53A 3WKNA 3CIQA 2DL9A 3O6KL 3KS0H 5A2IH 3MLZL 1VGEL 1QEWA 2C3HA 1RZ7H 4RIRB 1IL1A 2A1WH 4MHHG 3RI5F 3MNWB 4ZAKA 2EXWD 4FABL 4OFDA 3EYSL 2ZKHH 1FZKA 2NX5A 5LAXA 4PJ9D 5TFSH 2GITA 3PHSA 3FRUB 4LNVA 3OZ9H 1LO5B 4DQOL 1ZA3B 3FO2B 1Z3GH 3CSPA 4Y16C 2WQ8A 1DFBL 4MJIE 4NDMB 3BH9B 4PJCF 3AFLA 2HTKD 4X98A 2Y07H 4MNGB 4RMWA 4PJXA 1GSMA 5DA0B 3I6LE 4LGSB 2ICEA 3WV0A 3MBEC 4FP8H 1T83C 5FYLE 5ERWA 4K71C 1CLZH 3E6FA 4MA8H 3DGCR 4GLRI 5M7QA 2CGRL 3WDIA 4G8FB 3HNSL 5F1IA 4YHPB 3T0XA 5CEZH 1NGPH 5IGXH 4PP8C 5FK9B 2B1AH 4R8WL 2DTML 4JREB 3OPZL 3UBXG 1RU9H 3OJ2C 3SOBH 4DWHA 4O2EA 3ZLQC 4AH2A 4P57B 1UVQA 1NFDB 4DKEH 3LMJL 4OZHE 5FF6A 3QUMA 4NC1E 5EG6C 4NOBA 4F15C 1S7RA 3KPRA 3D2UD 3KPTA 4FQ1L 3CXDL 4PJIA 1HKLH 1KJVB 4JQVC 3IU4H 1G9ML 5EOTA 1XGQB 2X70A 3IAGC 4MNHA 2VO5A 4KU1A 4UTBL 5E2WL 4I77L 4I0CC 4ZXBB 2BSSB 4NO2B 4PJ8C 4LL9A 1YEGL 3BIAX 4MAUL 1WFOA 4OLXH 5E2TL 3GMLB 3MRGB 4EOWH 1QSFE 3NIGF 3OKNA 3EHBD 1KLUB 3CGTA 2ZCKL 4WU5A 5J0BA 1CI5A 3MRHB 3VFMB 1ORQB 1TCMA 2OXGA 1CD8A 4HUNB 4EZMA 1MFBL 3L5JA 3MRQA 1HIMH 1Y0LA 3UO1H 1ZVYA 2QV2A 2Y7QB 4LSRH 1FNSL 5K9JL 2R1XB 4XHJD 5TDPB 1ACZA 2CKBH 5E8DH 3ULUL 4HX1B 4XNMA 3B5HA 4QTIL 1OQXA 3MRMB 5FYKU 1CICA 5IQ7H 1OAXL 1Z6JT 4S1QL 1UKSA 4BUHA 1C7TA 2FBOJ 1L7TH 4GW4A 1A7RL 3WNPA 4ZOAA 4OI7A 1KLGB 3IJSA 3DTXB 2ADIB 3RWEB 3MBXL 1CU4L 1MI5D 3MLWL 2G5RA 2WINB 4HIJB 5GRUH 4P4KB 3RNKB 3P9MA 4PJBE 1CFSB 2AEIT 5I0DA 3E2HA 1V5JA 4TULH 2X89A 5DJ0B 4F2MA 3QAZB 1OWRM 5DMKA 5ICYB 2H2PC 3WDJA 3IDGA 3QQ3B 3D39E 4JY4A 2JK5A 5FYJD 2KUTA 3MLTB 4X7CC 5JPNB 3SKJH 5GSVB 3G5VB 1IAMA 2C3VA 5C2BL 4L9LC 3CX5K 4D8PA 4JB9H 1K5NB 3CPLB 32C2B 5T3ZH 3U4EB 1J1XL 5DDHB 4G6JH 1DVFB 2NXYC 4L4JA 5LGKA 2YRZA 4TULL 4XCFL 4MYWB 2Q8BH 3JUZA 3IDNA 1U6AH 3NH7L 1Q9OB 1ZLWK 5GZOC 2UWEA 1GGTA 5K9OA 5E8EA 3C5JA 3SDDA 5IEHB 1TPXC 4N0YL 5FUOL 2CKBB 3NABL 2X4NB 3OSKA 3I6GA 5SWQA 3VXPB 4GOSA 3ARBA 4HKXA 3DVFA 1IZKA 2DLTA 1B0RA 2R4RL 1OAYH 1IRAY 5HHPA 1PX3A 4OFIA 4X4YB 4X5LA 2ZOKB 2ZSWA 4YHMH 4LCCB 1Q9WB 4FRWA 1AKJB 4NN6C 2YK1L 4M7ZC 1SJEA 4HUXA 1E4XL 1NCCL 3CSYA 2AKRA 2UZIL 1JRHI 2NY0C 2EO1A 1YEEL 5L7XH 3DWTA 1T4KA 3KYKL 3MQIA 2G2RB 2F19L 3BSZL 3I75A 1EEUA 1IGCL 4PS4L 1YMHB 2OLDA 3DRTA 3MV9E 4NYLB 4R0LB 4NNXB 3SY0A 2EE6A 3SDXF 1KB9J 4QT5B 5E00A 5AZ2H 4NQDE 1VB9A 3PDDA 5E8OA 2YN3A 4D3CL 4HAFA 1X6NA 2X7LB 5GGSA 1W8OA 2PXYC 1C5CL 1CFQA 3CVHA 4NWTL 4ZMAT 1DDHB 4ETQB 2PO6B 4U6HB 1I8KA 2BY2A 2QQNH 1I85A 1QSEB 3P9LA 3UBXI 3JWOH 2V5SA 5DUPL 3TP4A 2OCFD 3IAQA 4Q0XH 3D18B 1FL6B 3SJVD 3WHE1 1K2DA 3WS3A 1FV1B 3T08A 3U2SB 4NO0D 3KJ6H 4MD4A 3RDTD 4P49A 4YUEH 1WBXB 2P42B 3LSOA 2X5PA 4X6EA 5I9QC 5ESAA 4JANB 5CGMA 3OAUL 5D1QB 4KGJA 4FNLL 4MJ4A 2EH8H 4QXUL 3R8QA 4PP1D 5ICXA 3HCVB 5BZDA 4M1CC 1U8HB 1QRNE 1EO5A 3AAZB 4WW2F 4PG2A 4KK8C 4K7PL 3QNXB 1BM3L 3MXVH 2JELH 1JPFB 3LY6A 4K3EH 4ZTPH 5HPOA 1XIWB 3V4VL 4QHUA 2R9HD 4RGMB 2P1YA 4M1DH 1JYNA 2D7PA 4KTDL 2NW3B 4PRIE 1NFIA 3SKMB 4JCLA 5JW5B 1IKNA 1S8DB 1VGEH 1VGKB 2ADJB 4WV1A 3VFPB 3QWOA 3FOLB 3PHOB 5DRWA 4KHXL 1UWEH 1NGYB 3W9EA 1EHLL 2KH2B 4FFZH 5JOEA 2K7QA 2PTTB 3QO1A 5FXCH 1RIVL 4H25A 4RA3A 4LSUL 4CNIB 3OX8B 4P23D 4P9HH 2BX5A 5GRZA 3ZO0A 5HYEA 2HMIC 3O2DA 5I19L 3S36H 3AROA 1S7SA 4L4TB 3QIBC 2EECA 1MLBB 4G9FE 3FOMB 3BKMH 3CDGA 3TJHD 3UTQA 1S7QA 3G04B 4NQCB 4OZIB 4KKAD 3QIWB 2GJZA 2APBA 4F7MB 1PSKL 4QOKD 3F6LA 4ESKA 1MVUA 2UZYB 2DMCA 1LILA 3CJJA 3ZE0F 4YIQA 3KVQA 4ZPTB 5J89A 5IV2A 3OPZH 2BSTA 2CIIA 4FG6C 4HIHB 4H1LH 1II4E 4WDIA 4PJFB 1BQSA 3BE1H 4MLIA 4RMUA 5FHAL 3LMJH 5E99H 4MXWH 2MWCA 4IRJA 3MV8A 5BVPL 4XCCL 4M5ZL 4RFEA 5D2NA 4OD2B 3S5LA 4PJHF 1C16A 3T3PE 5HY9B 1T0NB 3VWJA 1AQKH 4HS6A 1G9MH 3ZDYF 1HHJA 4LU5L 3BD4A 3QIUD 4OUUA 4ZO6A 5LQBH 4UTBH 5DO2C 4Y4KB 4PV8B 2C1OB 1KXTB 4YPGB 2DF3A 4WJ5A 1UEYA 4MAUH 1EGJH 5CEYA 4Q9RH 1XR9A 4NWUL 1U3JA 3EW3B 3CCHB 3BD3A 4PJ7B 3RVUD 4F58L 5J3HD 2YPLD 4UBDC 3GHEL 2ZCKH 4Z6AT 3GMQB 3I3BA 3L9RA 4NKDB 1YDPA 4D94A 4XB7A 5JR1L 5JW4R 1IT9H 4AL8L 1ZT4B 2NR6D 3LQAH 1ZAGA 4F7CA 4E0RB 1FL3A 4H1LB 3CFEA 4DUVA 2DQIL 2GT9B 1BBJA 4HK3N 5K9JH 5T1LB 1M05A 2Q86A 3I02B 1WT5C 4M4RA 3VJ6B 1OAXH 4OCNC 3TT3L 3K81A 1X5JA 2ZSVA 2W0KA 5HHNA 2DI7A 5BVJA 4G3YL 3WS6C 4ELMF 15C8L 1CU4H 3ARZA 5I16A 4JZOA 5L2KB 3OF6A 5GGVL 4LHUA 4LPUA 4U1NB 1WSST 2GUOA 5C0DA 3WLWC 3VW3L 3G6DH 4K8RD 1RUQL 3J8F7 1YEKL 3BISA 3IU3A 4X0KB 5GS1C 1U3YA 5BJTA 1D9KD 2VDRH 2Z91B 4X6DA 4OAWA 4NJ9L 1NCUA 3ZKQD 1NGXA 3RL1A 2DLIA 5EA0H 5C0RH 5C2BH 5GQBA 4P5KA 3T0EE 4JFPA 2ERJC 4FQXD 4ZQKA 1J1XH 3B43A 3KPNB 5JOPD 1MHEB 5C6TH 1F58L 1X3DA 1INDH 3KPLA 5JIIA 3IDMB 1N59B 3N1GC 3DLQR 1FYHB 3B9KB 3DYMA 3SDAD 3SE9H 1R5VA 4N0YH 3NABH 4Z7UF 4I48A 2BMKB 4HD9A 3RWJB 2HVJA 3U7YL 1HI6B 1NSNH 5GXBB 3EO0B 1M6OB 3VXUB 3L3DA 3ARFA 3BJ91 3OKEB 5JNYA 1H5BB 1N0LA 4X6BB 3DX6A 3NOIA 5FAAA 1MCDA 1J8KA 2YK1H 5EO9B 3ZSSA 3MLSL 5F7NC 5TH2A 3V2AR 1NCCH 2VR5A 4PGDB 1YEEH 1TJGL 4L4VE 3STLB 2C4XA 3GRWL 3TWCH 1R0AL 4NHUB 4XPGL 4NM4H 1LEIA 1IGCH 2OR9L 2V7NB 4QTHB 2OZ4L 4Y16B 3E3QA 3ARGB 1NAML 3W81A 4WHYG 2BVOA 2H1PL 3DV4B 5CSZB 2DYPB 5DFVD 5L2JA 3UTSD 5DSCB 4NKMA 2V5YA 3TO2B 2NY3D 3VRLF 2Q7YB 1HEZB 4NWTH 5C8JB 4YWGH 4PD4K 1BIIA 2R2EA 2ESVE 3HFML 3QDMB 2D7NA 3MRCA 1EIBA 5MHSE 4DCQA 1F45A 3HMWL 4YQXL 4NRXB 5DUPH 2IAMC 5EORH 5D2NC 2NY1C 2F74B 5E6YA 4ZTOH 3QDJB 4P5TC 4UTAL 3QO0A 1INQA 2DRUA 4GKSB 2YA1A 5C7XH 5IJVA 1DQQB 3TFKA 5F6HJ 5DMIH 3PGCB 3W0WB 3QCTL 2OM5A 3DROB 3OAUH 1CXFA 1MCBA 2IPUG 5CKAA 1VESA 3TBWB 4QXUH 3DXAA 4JM4L 5JZ7C 4NQEE 1G1YA 5HGBA 2XXCB 4HZLB 3T09A 1C8PA 1XGYL 3O3AA 2ZCHH 5CUSH 2R8SL 4MCZB 4J4PC 2HN7A 1CLCA 4K7PH 4LSDA 4V1DE 1LQSR 2OS7A 4WFEE 4Y1AB 4KTDH 5DQJB 1YYLL 4MGXA 1JZ7A 1VADA 5ID0B 2HJFA 2DMKA 3ARED 1VFAA 4KHXH 3GSNA 4JFDE 3G5YB 1XGUB 3G5ZA 4G7YL 4WENB 2YA0A 5E7BA 2R4SL 3DMMD 5TDNA 1G6VK 2AERT 7CGTA 5F9JA 3QNZA 5K9KB 4LSUH 1WIOA 5C0EB 5KVGH 5D9SB 3X11A 1KIQA 3CZJA 4U1SA 5I19H 4LLUB 4NC0B 5JA8B 1Q9LB 3LKSB 3HZKA 4RDQF 2YSSB 2QHLA 5E03A 1JYXA 1GGBL 2IH3A 2J5LC 1A0QL 4JDZA 4Z76A 1S7VB 3TZVB 4UI2A 4LRNL 1G0DA 4P0DA 4HHAA 4GRMB 2BNQB 2VZTA 1UH2A 3MRIB 4KKBD 2C26A 2WLZA 5D2LA 4WI4A 1T1WB 2AAVA 1X5ZA 4M03A 3ZYOA 5FA4B 2JJTA 5DEZA 1MIML 3BEVA 5IB2A 3WXVH 4XBEL 3L3OB 5FHAH 1PY4A 2AJSL 5KOMC 4GRWF 4HDIA 4XCCH 2OQJB 1MCRA 1E27A 4CW1A 1UA6L 3QDGD 1HH6B 2WBJC 3IS0X 3D1MC 5IB3A 2BP3A 4JRXB 3VXME 3H3BC 1YN7A 4EN3C 4R7DA 3L3HA 1MUJA 4M3KB 5TDOB 1RK1B 5CP3A 4LU5H 2F54B 3RL2A 4EI6B 1LDPL 5FYJL 2BNRE 4YGVA 2FRGP 4B41A 4GAYB 3FQRA 4KTYA 4OT1L 1TPXB 5JIPA 1J0KA 2P49B 4CVZA 3JWDC 3CX2A 1L6XA 5JHDA 3GHEH 1G7QB 3MA9L 5CIPA 3I2CH 4JFEA 3HHRB 3BVNB 5EWIH 4ODHL 5JR1H 5C07D 4XP5L 4JGUA 3U0TB 1TZIA 2PN5A 3MBED 3U7AA 4M7ZB 2OX5A 4LNRA 1LEKA 1JGVL 1AHWA 1KJMB 3V6OE 2VKXA 3HAEG 1NBZA 4YHIB 3SKUD 4PJDB 3NFPB 3V8CA 2C1PA 1EAJA 1XF2A 2CLVA 3BX7C 4DKFL 1QBBA 1XGPA 5F96H 1JNNH 1VDGA 4BFEA 4HK0B 1ZVSB 1CQYA 1KB5A 4ZS7H 1DBAH 5C0GA 1MCLA 1R5IB 2P5WE 4R97B 2P5EE 3G08A 4FQHA 2YXFA 4ZUUB 1UM4H 3CFIC 4LP4A 5GGVH 1KTLA 3LPGA 1MFNA 5EFIB 3VW3H 1U2HA 1RUQH 3P0VH 5CWSA 1S9XA 1F11B 1YEKH 2PW1A 5DHVA 4XXDB 5FGBA 3AS3A 4KZDL 3PQYE 3V4PH 2RGSA 4MQXC 3O45A 5DJ8B 3RIAK 4MD0A 4PJ8D 4UIMB 5IB5B 5I2IB 2XWBB 4PJCB 3EZ8A 5DF0A 1CFVL 1CLYH 4A6YA 5DEFB 4QYOA 3BRDA 4O2FB 1NANI 5GHWL 5EUOF 4LARL 5T3XH 1AC6A 4FFYL 4FTVE 4X99A 1SHMA 5DMJB 4XVSH 4TUKH 3CX5J 5E6IB 1KPVB 3KPMB 2YUZA 2VSDA 5SWSB 2GTWA 1MRFH 1IGFH 3BDXA 4P2QD 3DVIA 2IALA 4JAMA 1NLBL 3GHBL 4NQUA 5IB4B 2QKIB 2VLME 3RWDA 3ZYZA 3ZDZF 1I1RA 4CN1A 4GG6F 4BQ8A 4BH8A 2X09A 4NCC1 4URTB 3HZVA 1YEDA 3O8XA 3ZMRA 1DL7L 1RFDL 2FECI 4QNPE 4ELKB 2FCBA 5H37G 3GRWH 2P8LA 4HKJB 4XPGH 1OAUH 2OR9H 3GB7B 4TNVK 1JGDA 3TT1L 1HHIB 1YMMD 2DQUL 2OZ4H 1KN2H 1NAMH 3EYVA 3FT2B 2H1PH 3T04D 3WHE0 1BJMA 4Z7VA 4RGND 4MDJB 3DV6B 3A6CH 1OF2B 5E2VH 2X4TB 2ZPKH 1U8JA 3TH3T 4DUXA 1MFEL 4Y5XB 3X3GH 4JLRA 3VXRA 1GZPB 5C0AD 4D2NA 2C5DC 3FRPG 5LGHH 3BWAB 2HLAB 2JCCF 2J4WL 4ZOBA 1LP9A 3IRZA 1D5IL 3TA3D 4R3SB 3BN9C 5D7LD 4YQXH 3CH1A 1SEQL 2Y25A 3TYGH 1X5LA 2NXYD 4EUPH 2LU4A 1MCOL 4HEPG 2F53D 3KPOA 4UT6L 2AXHA 4S1SH 4JPWL 4IIQA 4AEHH 4D0DA 3HPJA 4MA1B 3RZCC 5F1KC 1F4WH 1FZOB 1EZVX 5JORA 2XN9D 2NZ9D 3G5XB 4H8WC 4XP1H 1RHFA 2NX5D 3QUZB 1CT8B 3CDYA 5DYOB 4DTGL 5J13C 2QJDA 4JM4H 4L8BA 5T1MB 4MSWA 2F58L 1J1OL 4MJIA 1XGYH 1UB5A 2H32A 4MVBA 4M48L 1AR2A 1NAMB 4OM0L 1KG0A 4HWBL 2W92A 4PGCA 2NY0D 4R4BB 1QPPA 1TCRA 5IESL 3U0PA 2ZWLT 1J8HB 2UY6A 4HWEL 3QBTB 5CD5D 2L4OA 3MPCA 3DARA 5EOCL 5AYUL 4OV6F 3VG9B 3TPUB 1IM3A 1T04A 1DLFL 4X5XA 1S9YB 5D5ME 4S1DC 1I75A 2LQRA 2R4SH 1CGSL 5I76A 2GTZB 2YC1B 4KVNL 2VC2H 4RQQA 3MOAL 1ADQH 1CBVL 1ZA6A 2OP4L 2JJSC 2PXYD 4EUPB 4HLJA 2W07A 3VWKA 5IMLA 5EULV 1VACB 3QJFB 4QRPB 4JQXA 5FO8A 4OZHA 3BPLC 5B8CC 4YHZH 2KQNA 1JN6A 3BZ4A 1A0QH 1KACB 2P4AB 3C5ZA 4HQQL 4Z18A 1UXWB 5IWLA 3OHXA 1WCBA 4JFZH 2DLGA 5DR5H 2GY5A 2LVCA 4U1LA 2NXZB 2VLRD 3AUVA 5DHYA 5KSUB 1MHPL 2YUVA 2AXFA 3MX0A 5JMRA 4OLUL 4DKDC 3D2UB 4F3FA 4BSVA 5C0FA 3BRFA 2XRAL 4I18C 4F7TB 5HYQA 5GS2D 5SX5H 2GK0B 4XBEH 1FZMA 2VXTH 3QCVL 4M1CD 2O93L 1QSFA 5FUZH 2N1KA 4EIZC 4HKBA 4KK8D 5E24E 2BVQB 4GAGL 4JY6B 3FB6A 4WWID 5DRXA 3C8KA 4LQFL 4HMDA 2AJUL 5HHVH 1MIEL 1UKQA 4K8RL 3HN3A 5HHME 4XNUH 3SDXB 5DWUL 2O61A 4NKIL 1Z9SA 2FL5B 3WFDL 2GW5A 4OCWH 2EIZB 1LDPH 4L29A 3RUGA 2XTJD 2EDWA 5FYJU 4LCWE 1EBPA 2DQCL 4KTEL 3MYZA 5H2BB 3VD9A 1CICD 1BVKA 1XT5A 4OT1H 3IFOA 5DZOA 5SV4A 2HMID 4JPVL 3VCLB 2Y9RT 4RWYH 3T77A 1ZGLA 2IPUK 4S0UC 4CMMA 3EFFB 4LRIA 4UQ3A 1J86A 4LLQB 2COQA 4I2XA 3DVNB 1FBIH 4TSBH 2X89D 3PWUA 1MWAH 3L3GB 5JIHA 5AD0B 2CUIA 1OB1B 4LBEB 4BYHA 2BY0A 4J23A 4DKFH 1G9EA 1MAML 4HCRL 4PJXF 4F8QA 2DN7A 4UIKH 3V0VA 5I18H 4YBLC 4Z77B 2EXYC 4PJEA 1RPQA 4FG6D 4WW2B 3MRPA 3IDXL 4ZSOE 4CVUA 3U4BH 4X9FA 4N5EC 4PREA 4OD1L 3CC5A 1GOGA 4V3DB 3VA2C 3UEZA 4HUWA 4XBPB 5EN2B 4Z78B 2Y1VA 4QRRE 2XFXB 1W72A 5HVWA 1QO3B 4OQTA 4XGZA 5D96C 3ARBD 1ZT7B 1AP2A 5J6HA 2IANB 3EKCA 3MJ8B 4MA7H 4KZDH 4ZFZA 3TBTB 2BSRB 2NY1B 1RJYB 3GMRB 5DO2D 3S3SA 1RZKL 4PJIF 1A6PA 3K4DA 1OAKL 3NVQA 4X8JA 4XPTH 4XAKE 3H9SE 1JPTL 4OM1H 4XP9L 5CS7A 4JM2C 2PTUA 4EBQL 1CFVH 1MWAB 1N6QL 4P2RB 4UBDD 4Y4HB 3QXWA 5C2UB 2Z8SA 5DJXA 3U36B 2VERN 5GHWH 1MHHB 4XXCC 5ITFA 4FFYH 4S0TD 1KGCD 1HDMB 4XCEB 1NQBA 5C0BE 3MV9A 2PCPB 2CLZA 5I74B 1BZQK 3P11L 1D5MA 4NQDA 4QO1A 3I9GL 2Y5TB 3HUJE 3OXSB 4KQ3L 1NLBH 2VXQL 2OR8A 3LS4L 2F8OA 4PLOB 1AXIB 3B3IB 4TNWF 3RTQC 1A1OB 4UMGA 1FGVH 2QR0A 1KBGH 3QB7C 4Y5YA 4FFVD 1BEYL 2MCG1 2FWOA 5HPMB 3LV3B 5EH1A 1SY6A 4PJHB 2R1YA 2P24B 3IXTB 3QFDA 3TT1H 5ABDE 2DQUH 1S7XA 4CU8A 2Z93B 5KVEH 1UZ6E 2XWJB 2W9DL 1S3KL 3EYFA 1A6TA 1LO0L 3QPQD 4KDTA 3RWCA 1V7NH 4G6AC 1UYWL 2RFXA 4Q6IB 3IDYB 1V8HA 3DI3B 3TF7C 1LEGB 2J5LB 1CZ8L 4PJ5E 2VDML 4YDIH 3HR6A 5BZWB 3C9NB 5IROA 2I9LA 4BZ1L 1QRNA 5DMGC 4NO0B 5MEOB 2IADB 1D5IH 3B9EA 2D03L 1HHHB 1DUYB 4NRYA 2O5XL 4LCYA 4H26B 4YDKL 1O7SA 3LN4B 2VISA 5D8JL 4PJAA 1E4WL 3O3BA 4H1LG 1KENL 2PTVA 4MAYA 3O9WB 4PRIA 2DICA 3IETA 4HIXL 3K46A 1OGAD 3QRGL 4NN7C 2YBRA 2BXZA 3FN3A 1CD9B 3NIDE 4Z0BL 5EBLB 2MCPL 1YNLL 1CFNB 2W0FB 5DJ2A 5I6XB 4M7LT 5LWYH 4LLDB 5HJ3B 4DTGH 3NZHH 1X5XA 3VFNA 1U9KA 2GSIB 2UWEF 4IMKA 3HG1A 4NO3B 3SE4C 3RAJL 3V7MA 1J1OH 4EN3B 4ODTL 4G43B 1QNZL 2ORBH 5F9WC 1LVEA 4ELMB 4OM0H 4TRPL 4XH2A 4G9FA 4BK4A 1J05B 3MMEB 4LF3A 4TSCH 5JPMA 2ZUWA 5HDQH 3S34L 4P3DA 1CTOA 1A9BB 1D5BA 5BW7A 1DLFH 2GQHA 1UB6A 5DA4A 4AT6B 2FEDC 1XGRB 3B9AA 3MUGB 2CRZA 3EYOA 4KVNH 3MOAH 3FMGH 1FO0A 4G80B 2BY1A 5DD6A 5HYJD 4XNXL 5C86A 4QOKB 2ATKB 4XZUB 4O51A 1G6RA 5FCUL 1KIRA 3MV8D 1OLLA 4DZ8A 1J10A 2IAMD 5T1KA 3VD4A 1SEBB 3LKQA 5CEZE 1N5AA 4P5TD 3HE6C 1I9JL 2A6DA 4GQ9H 3V5KA 4ISVA 5FB8A 1MCEA 3Q6FB 4KGLA 2VQUA 3QXDB 1MHPH 3UTTA 3DX9A 1P1ZB 2Z0BA 3EDJA 1HXMA 2YHGA 4HS8H 5DVOA 3DX7B 2G75A 1F6AB 5C0IB 4TUJB 3QCVH 4D0CA 3WJJA 1UT9A 1UG9A 43C9B 3VMOA 4AQOA 3HNVL 3QIUB 3EGSB 3MTRA 4WVRA 1OARL 1BQLH 3C5SB 4EJ1C 4ZYKB 3KDMA 2FLBT 4F80A 3EYQD 1NMBH 2VQTA 3MROA 2AXGB 4EVNB 3HLAA 5CJXA 3ZHDA 3ZKXB 1NCAH 1PLGH 3MLXL 3KWWB 3H0TA 4CGTA 5B38A 3S3PA 1UKTA 2RHEA 3DO7B 2AQ2A 4HUUB 1A14H 3G9VA 2OJEA 4UDTA 4QHNB 1LK3L 3BGFC 1U8IA 2MKLC 4APQA 4Q6YA 4GMTH 5I1CL 1LMKA 2X4OB 1WC7A 2HAZA 3WFHB 5IM7B 5DRZA 2XWTA 1VFOA 3CSGA 3OF6D 4LHUD 3LPWA 5D1ZA 4D9RE 4KZEL 5ILTL 1U58A 4IS6B 4O5LH 3SDYL 4H8WH 1KIPB 4M1GL 3LQZA 1BJ1J 3TCLB 1IFHL 1NEUA 4GW5A 2BC4A 1XEDA 3ARDC 3NA9L 4E9LA 3U79A 1S5HA 3MUHL 4JPIA 4ODWA 3FQUA 3JVGC 4GG8A 4L3CA 1A9EA 1M7DA 3E1F1 2VWEC 3QQ4B 2BHUA 4CJ1A 2ZP0T 3W5MA 3PWNA 3T0EA 5LCVL 3FZUD 1XMWA 5FO9B 5JOFA 4I5BB 3IDXH 4NHCH 4RFOH 4H20L 1FNEA 4OD1H 1JHLH 3TBVB 4GKNB 1D9KB 5E56A 1ZHNA 2AP2A 3I84A 4HJJH 5D1XC 1XCQA 4Y2DC 4GRWH 1I1AA 4HIEB 3RX8A 3I85A 4FQXB 1KCGC 1KJ2L 3ARFD 4F9PC 4K9EC 1Z9OA 1IC4H 2X05A 4QRTA 5L6YH 2YD1A 5IBLC 2UY7A 1OAKH 3L5XH 5INDA 1AD9B 5E08L 3UJIL 1DBKL 4LIQL 5DUBB 1MELA 3MODH 1GAFL 3IJYA 2LTQB 2OTWB 3U30B 4PY7B 1QSEE 4JFYB 1T3FB 2YR3A 4XCNB 5I1GH 4YHKL 3ECBB 2ED9A 4GSDL 3LDBB 1U8OB 2XQBL 3PNWA 2FO4B 5E9DA 4RGOH 1BF2A 4KQ4L 4KKCC 1EAPA 1TVBA 2CMRL 5K59F 3WFCL 5J8OA 3D3VE 3I9GH 3P4MA 2APFA 1A7QL 3GBNL 3MRRA 4P3CH 2HRPH 4HJGB 3LS4H 1ZVHA 2HFEA 4S1RL 1ZT1B 3F7VB 2HYMA 4OSUH 1EEZB 4OGAD 1U95B 1PD6A 2Y23A 1CG9A 1RULH 1T89A 2ESVA 3DO3A 2Y36L 3WN5B 3HI5L 3D9AL 3L3IA 4GRWB 5FM5O 1BEYH 2YD9A 3H3PL 2YD7A 4ODUB 2FHCA 4GKOA 3NBNA 2D31B 2YPVH 5C0JA 3JV6A 3P4LA 2ZUUA 2J88H 1B90A 3BQUC 3MV7D 1P84K 4ZUSB 2A0LC 5D72L 2FO1A 3TFKD 3GMPA 3L7EB 3TBSA 1LO0H 3KPSE 1W0VB 3STZB 4U1MA 2E7HA 4GFTB 4U1IB 3BH8A 5C9JB 4P46A 3M8OL 1CZ8H 1NEZB 2VDMH 3DXAD 4YFLI 5DJYA 4MQXD 3RGVA 4AIXA 3AXLB 4JPKH 3TN0A 3VXTA 3DGGA 5IW1B 3QUML 4BZ1H 4KJYA 1AGBB 4Y4FA 5LVEA 5HI5C 1A2YA 1V3JA 1T7VA 25C8H 2JIXD 2O5XH 1UENA 4V1DA 1E4KA 1F3RB 3FQTA 4FQ2H 5ACZA 1MAKA 4NNYA 2DLEA 4NQCE 4OLYH 4X6DF 3KNBA 5MENE 3R1GL 4XNYH 4HJ0C 4U6TA 1S9VA 3GSXA 5DD1L 1D5ZA 2MCPH 1F4XL 1ZWIA 4FQIL 4JFDA 4NUJB 1A4KA 1Z5LB 3S88L 2HLFC 4PLKC 4RRPG 4PP2B 1NGQL 3V5DB 3EDDA 5KVDL 3GSVA 4S11A 3TO4B 1MCWW 5I1LA 3RAJH 1LO3H 4ODTH 1U3HB 1QNZH 4OZFH 4JG1L 2ED7A 3AREB 1B0WA 5DK0A 3FT4B 4HUVB 3HE7A 1CL7H 2BOCA 1IGIL 1LO2H 4KXZI 4PR5A 1J1PL 2VDQL 4PRPE 3S34H 1EEYA 1T5WA 4Y19B 5FKAA 1ED3A 2OK0H 4MQSB 5IUSA 4MXVF 1G7PB 4QRSA 5FECB 3BP5B 2BCKB 4LSTL 2MOVA 1BQHB 1E4XI 3OGCA 1FGNL 5CKGA 3U6RA 3VA6A 5DS8A 5H94B 3VFWA 4R6UA 4HF5L 2HWZH 4OZGE 1J11A 3DURA 4JQIH 4WO4C 1BFVL 2E9BA 2FLRT 1MCWM 4ZO8A 4GXUM 1ZHKB 1RZIA 2ZG3A 3O3UN 2X1XR 5C09E 5EUOB 1Z9LA 3RIAF 4LASH 1T2QL 2WIIB 2EEDA 5AG8A 5I75C 5E1AA 2BVYA 4L1DA 1DQJB 5D6DC 4XNZB 1I4FA 3GKWL 1GXEA 1JGEA 1MCHA 1TQCC 4WNQA 1AXTL 4OZFB 1FQ9C 1MCPL 1C12A 4D9LL 4GG6B 3GSRB 4DN3L 1FRGL 2JTDA 3QDGB 1WBYB 5HDBE 1MJUL 3CD4A 1R3KB 1Q0XH 3GSUB 4ZUTB 3RU8L 5CLTA 5I15L 1X5GA 2Q76B 4N0UA 4DN4H 1O0VA 4JFED 4P2OA 4KKLC 1TVHB 1JI1A 4OKVA 1P7KA 5BOPA 3K3QA 4KHTL 3ALXA 4HV8A 1CYGA 2IH1B 3K0WA 2VIRA 3OJDB 4UUJA 5HTSA 5C92A 1U8PB 4D0BB 1RI8A 5GGRY 4S1DD 3GMMB 4TNVF 4Y8DC 3DUUB 1XCTB 1LE5B 5HHQA 1ZE3C 4U4BA 4AMKL 1U0QA 3MRNA 5J1SC 1LK3H 1ZV5A 3BP4A 2NCMA 2JCCB 5DURD 5B39B 5IMKB 4BM7A 5LJYH 3SCMC 2P5WA 3O4LA 5EOQH 1RURL 3MO1A 2P5EA 1E4JA 1MCNA 2FNBA 1AIFB 5GS0C 2EDYA 5CMAB 1U36A 4EI5B 3UP1A 4IHOB 2DAVA 3QJHA 3O3DB 3GMNB 1VKXB 1QBLL 2DWDB 4H88L 3FT3A 1IFHH 4RMRA 1BFOB 1HCFX 4EEEA 1CGTA 1KJ3L 1K85A 3PQYA 4PIRF 2XG4A 3GIVB 4RNRA 1GGIH 4UINL 1MQKL 2PR4H 5I1DA 4M8VA 4YBQD 2HJKA 2VXVL 2W60B 3ULVD 1P53A 1ZLWH 3B9VA 1A21A 1E4KC 5AEAA 2GCYB 1UH4A 1EFXD 1G7MA 5D2LF 5E0QA 1AXSA 2HJLB 2VE6B 2J8OA 4DEPC 3FO1B 4E5XA 5D70L 1RUMH 5KW9H 4WI5A 4K94C 4BQBA 5E6ZA 3QEHB 1WK0A 4BH7A 3MJ7B 4I3RL 2VITB 2OI9B 4YC2C 3I3DA 2YS4A 3DI2B 3SO3C 3BKYL 1F97A 2EE9A 1DBJL 1OWWA 1UM6L 1RJLB 3ARTA 3QCUL 5TE6L 3VXOB 4PBXA 2VQ1B 4R90L 3WO4C 4L8SC 5E08H 5CEXA 3P0YH 4WFHD 2PYEB 3O8XD 4LEOB 5CHNA 1HQRB 3DX8A 3QDME 5BRZB 4N90D 2H8PB 3CFCH 5F3HB 2AJ3A 3QEQA 4YHLH 3PWLA 3T0AA 2W91A 4GMSL 2EYRA 3CFDA 4F7PB 1A6AB 3ZSTA 4Z0XA 4MX7B 1MJJB 4MB3A 2WM0A 4V2CB 5I71B 3W0WE 1P6AB 4R4ND 2FJGA 1A7QH 1JUFB 2BJML 1HQ4A 5DJCB 1GGCH 3O2DL 1X44A 5KTEL 1IEBA 3IKCA 1X6LA 2CUHA 4Y5VA 2WUCL 3HI5H 4Q2ZB 4YDVB 5DMYA 1K3IA 4G8GD 1EO8H 4NN5C 5DD0H 5CILH 4RGNB 4Y1AE 2RR3A 3T8XA 3PV6A 1FL5B 4GS7B 4N5ED 5IBTL 3UPCA 3JTSA 3WE6A 3T2NL 3QXAA 3DRQB 4JKMA 1HXYB 4GLRH 4BKLB 3F62A 5GS3A 2B5IC 4HH9B 1ZHBB 1IGTA 2Z35B 1RJZB 1ETZA 3TA3B 5HYIA 4XRCA 3TVMC 5C0CE 2PF6A 3SO5A 4OLWH 2GFBA 3M8OH 3X13A 2F53B 2Z31A 1JF1A 4XB8A 4NM8L 2EYTA 3QUMH 4OKDA 3T2PA 1R3LA 4MJID 1A7PH 1QEWB 3JSSA 1IL1B 4JM2D 3QXVA 2IPTL 4ZAKB 2UZXB 1FZKB 1VPOH 5LAXB 2GITB 3I6LD 3O6FC 1RIHL 1NC2A 2BNQE 4DGYH 1I8MA 1MNUH 5FYLD 4NQVA 3V6OC 4WY7H 4G9DA 2E8ZA 5DD1H 3SBWA 3TC9A 1F4XH 3ULVF 1XF3A 3KXFE 2NY4D 4FQJH 5D5MA 4LPYA 3FN0H 3F7RA 4G8IA 4IOFC 4PJXB 5GS2H 3ALPA 1GH7A 1JHKL 5IIEA 2ICEB 2QSQA 4GBXA 3RRQA 5KVDH 3RTQD 5ERWB 5J6GA 5TQ0L 2XKNB 4HAGA 2VRAA 5F1IB 5F9OL 5SX4H 5BV7C 3O0RL 1WFNA 1IGIH 2ARJQ 2YD6A 4JRXE 4KFZC 3UPAA 1UJ3C 4JO2H 4BZYA 2AK4B 4O2EB 3C6LA 4AH2B 1UVQB 3EDKA 5FF6B 1L4IA 3B8YA 2I9TA 3ROOA 3QUMB 4LSTH 2F54E 1ROWA 1S7RB 3KPRB 4G6AD 1KTKE 3ILQC 1ZSDA 2ZCLL 4O9HH 3CVIH 4WHCA 1IGJA 3LCYA 1IAIM 2UVFA 4PJIB 3Q5TA 3C60B 4YHNB 3BPOC 1KELL 3QR2A 1HINL 3ALWA 4HF5H 3FJTA 2NY6C 1QSFD 4YR6B 3QEUA 3LB6D 4PDCE 1Q9KA 3QI9C 5EOTB 2O5ZH 5DMGD 1DE4A 1E6JL 1I8IA 2X70B 4Z7VF 4MNHB 1PQZA 1TNNA 4PJ9A 4YXHH 1QD0A 4RISH 3Q5OA 1H3GA 5GJSL 1IILE 4QWWC 5CBAA 3IXAA 4I0PC 5HHMA 3OKNB 4EXKA 2ARWA 1EHXA 1LP9F 3FONA 3VRJA 1N3NA 2QQLH 4WU5B 1AXTH 1RZJC 1T1XA 2ATPA 3VI3E 1MCPH 5ADPL 1PKQA 2Z92A 1H3XA 5EZJA 4DN3H 1FRGH 1ORSB 4Y2DB 1MJUH 5IEKB 2X4RA 3MRQB 1Y0LB 2UUDH 1EO7A 5TE4L 4TSAH 2B7DT 4XMPL 1ZOXA 3VG0L 3FQWA 2A6IA 2IG2H 4KI5F 5CP7B 5GRYA 4JFQA 2XTJB 3K7UA 1S5IL 3ISWA 3VFSA 2HKFL 4OGZA 4PV9A 1CICB 1MVFA 4KHTH 4ONFL 4YO0B 1AFVL 4OUOA 2VLLA 1DUZA 3CMOL 4GW4B 4OZ4A 1J5OL 1CS6A 3CLEL 1HWGB 3IJSB 5IFAL 3D39D 1TNMA 2FEDD 1I9EA 2HFFB 4IRSC 4MXQC 3BUYA 3P9MB 5IBUB 5CINH 3E2HB 4W4OA 4PJCE 4F2MB 4WWKA 3JWDL 1Y6MR 5DMKB 1CTNA 1RURH 2ZUSA 4BK5A 3IDGB 1OD9A 1YEHL 1Q94A 3AM8A 4JY4B 1RUKL 2JK5B 5D7SH 1PDKA 4XC3H 2BFVH 4PRDA 1ZLVH 3VGDA 2C3VB 4MA3A 1QBLH 4D8PB 3OKKB 4H88H 5SWSE 5F44A 5HYSB 1MCQA 1XZ0A 4N9OB 5FA3A 3RI5K 4ALAH 4OZHF 1OW0C 1KJ3H 3A0OA 2VXUL 3CVHH 4IRZL 3L7FA 3C8HA 3IDNB 1HHGA 4UINH 2UWEB 1MQKH 4PB9H 5E8EB 1MFDH 3C5JB 3SDDB 1DEEB 5B3JE 3H9SA 1N0XH 1BGXL 3I6GB 5SWQB 2J6EL 3ARBB 4HKXB 1YZZA 2VMFA 4RAUA 2MKWA 1KYOK 5DJDA 3BP6A 1B0RB 1B6DA 5HHPB 1AGEA 1WIPA 1YC8A 2ZSWB 4NIKB 4IBLT 1A22B 2C3XA 3MV9D 1MY7A 3QUYA 3MACH 4X6FA 4XVTH 1SJEB 2HH0L 4HUXB 3HNTL 4I3RH 4KK9D 1VEMA 3CSYB 2AKRB 3SDCA 3TYFA 3BKYH 1Z0NA 1MI5A 2FD6H 3MGTA 3MRKA 1T4KB 2FSEB 5J11C 4R90H 1NBVL 2X1WL 4IDLA 1QLFA 5T3XE 1QFWL 4AYFA 3SY0B 1TIUA 3N06B 5H35A 5E00B 3QXTA 1DN0B 5E8OB 5JHLH 2UYLA 1GPOH 4GMSH 3QUXC 3TH2T 5AG9A 3RUGF 5F7MC 2DKSA 5GGSB 3U83A 5A2LH 1CFQB 3CVHB 1MRDL 4JFHE 4V3EB 3L3KB 4LCUB 4RIRA 3THMH 1I8KB 3HC4L 4DZBA 4YHOH 4DUWA 4RFNC 3MNWA 3TCXA 3EO9H 1BHGA 3P9LB 2R2BA 2BJMH 3LD8C 2B4CH 4PJ5A 1BVZA 1UZ8A 1FCCA 1K2DB 5L8JB 3WS3B 4M6AA 1QRND 4NDMA 3GO1L 4NBXB 4MD4B 1OOAA 2WUCH 3PWVA 4U6XA 1R3HA 3LSOB 4X6EB 3IRPX 5ESAB 5H8DA 4YDLC 3B5TA 4MJ6A 1J8HE 4PRID 4YPJA 1PG7W 5ICXB 1QR1B 5D1XD 5BZDB 3SE8L 3TPUE 1G9NH 4PJEF 2VOTA 5IT2L 4EKXA 1YPZE 3DJ9A 4QHUB 1MFCL 1R3IL 3T1WA 3QEGL 4LSQH 4YEFA 1NFIB 5IBLD 4NM8H 2A2QT 4U0RC 1XH3B 2FX7L 3HZYA 4QRPE 2AK1H 4WV1B 3QWOB 4KJQD 1I1FA 2W65A 5DRWB 4LEXL 4TUOB 4G9FD 3W9EB 2XI9A 3CH8A 2DLFL 3NIFF 2ADFL 4JN2A 3QO1B 4H25B 1RIHH 4M02A 4Y7MA 1A3QA 4EQ2A 1BD2E 5LXGL 2VXSL 3DYPA 4NQSA 4M93C 4XWOD 1S7SB 4HUMB 1CFTA 1SM3L 3S4SA 1IM9A 4IDJH 3SJVA 3CDGB 2R0ZH 3UTQB 1MCCA 1S7QB 1JHKH 3BHBA 4FZEH 3ULSB 5F7HA 2GJZB 2JJVA 1F3DJ 2DBLL 5TQ0H 3MRJB 4XP6H 1KLUA 1FC1A 1MVUB 5C71A 3SGDI 1P9MA 2CDEA 5EZOL 3LHPL 4O58H 1NUGA 4KRMB 1T7XA 4YIQB 1EJOL 2YZ1A 3TEUA 2BXYA 4GRLA 5IV2B 1KCSL 2ID5A 2BSTB 3ARSA 3L1OL 2CIIB 3EYUL 3BQUD 4WDIB 4A2MA 3TLRA 2A0LD 1UQSA 2Y7QA 3E8UH 4IRJB 1NUFA 3MV8B 2ICWA 2EDBA 4IJ3B 3Q48A 4RDQG 4H0IA 3PUCA 2ICWI 1K8DA 4PY8I 3ZHKA 4U3CA 3S5LB 1QLEH 1IAIL 3V8OA 1C16B 4LK4A 3VWJB 2D4FA 3GNML 2R56H 3BZDA 5ADOL 2NY5H 3DTXA 1PG7X 3P77B 2YD2A 1DZBA 1Q1JL 3NAAL 5MP6L 2Y72A 4U1GC 3LEXA 4WJ5B 1A5FL 5CEYB 3A6BH 2P7TA 2DTSA 5ICYA 1IKFL 1IGML 3TJHA 1C1EL 5F93C 4X80H 3I6KB 3SHSA 1BJ1H 1S7TA 5JLZA 4PJAF 4D9QE 3F5WB 4HEME 2HLFD 1YJDH 1YDPB 1CGVA 2F15A 4GW1A 5HXMA 3ULVL 3O3EA 3JV4B 4MS8A 4WTZA 3LEYH 1YYML 4LSSH 1MRCH 32C2A 1FL3B 5DDHA 3CFEB 2EZ0D 1BBJB 5GJTH 4GKZA 5EZLB 1M05B 2Q86B 1Q9OA 5D1ZD 2BHZA 1JGUL 2HKFH 3WYRA 3DIFA 2ZG2A 4ONFH 1AFVH 4QGTA 5T33L 2D0GA 3OKDA 4POZC 5HHNB 1TDQA 2IANE 3QRFM 1J5OH 3CLEH 3GSWA 5IFAH 2ZZUT 4HWBA 5HD8D 4NZRH 3DVGA 5I16B 4JZOB 1HHKA 1PEZA 4LHUB 5CD3A 2ZNWA 3L5WA 5C0DB 5IB1B 1CXEA 3T0ED 4O02L 4JFFE 4U1JA 5HDLA 1AE6L 3WJLA 3NGBB 5HHXL 3WO3B 3IU3B 4P2RE 5BJTB 5EIVA