4PJAA

Structure of human mr1-5-op-ru in complex with human mait b-b10 tcr
Total Genus 72
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
72
sequence length
270
structure length
264
Chain Sequence
MRTHSLRYFRLGVSDPIHGVPEFISVGYVDSHPITTYDSVTRQKEPRAPWMAENLAPDHWERYTQLLRGWQQMFKVELKRLQRHYNHSGSHTYQRMIGCELLEDGSTTGFLQYAYDGQDFLIFNKDTLSWLAVDNVAHTIKQAWEANQHELLYQKNWLEEECIAWLKRFLEYGKDTLQRTEPPLVRVNRKETFPGVTALFCKAHGFYPPEIYMTWMKNGEEIVQEIDYGDILPSGDGTYQAWASIELLYSCHVEHSGVHMVLQV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system
molecule keywords Major histocompatibility complex class I-related gene protei
publication title A molecular basis underpinning the T cell receptor heterogeneity of mucosal-associated invariant T cells.
pubmed doi rcsb
source organism Homo sapiens
total genus 72
structure length 264
sequence length 270
chains with identical sequence C
ec nomenclature
pdb deposition date 2014-05-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00129 MHC_I Class I Histocompatibility antigen, domains alpha 1 and 2
A PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4pjaA02
3.30.500.10 Alpha Beta 2-Layer Sandwich Murine Class I Major Histocompatibility Complex, H2-DB; Chain A, domain 1 MHC class I-like antigen recognition-like 4pjaA01
1MIEL 4NP4L 3S37H 2FO1A 2CIIB 1BFVH 3QAZC 5GGSA 4Z0BL 3QDJE 1LDSA 1DQTA 3VFVA 2ARJB 3OKLB 5D96C 5ERWA 5FM8A 4KI5F 4XWOC 5E8DL 3FZUD 3QQ9D 1GOHA 1MF2L 4I3GA 1X5LA 1IRAY 1WBXB 4GOSA 5F3BB 1DTUA 1SYVA 2E9WA 1CK0H 3ARBD 5JUEH 1MWAL 3D3VA 5E94A 1LP9E 3VFVB 5IROC 1MCOH 3BMWA 1NMAH 1MAJA 5ERWB 3KJ4B 1A7PH 3UCRA 1KJ2H 1BIIA 5HGAA 5I19H 1C1EH 4OCXL 4YDIH 2AGJL 4JHWH 4JM4H 2P5WD 1SYVB 1UWEH 3IKKA 1BEYL 3BKJL 5FYJH 3NCMA 4MYWB 1HNGA 3DI2B 5I1DA 2IMMA 2R8SH 2DTML 2UVEA 1YPZE 3D3VB 3ULVC 5E94B 3VGGA 5ADPH 4PJEF 4UAOC 1E6JH 3BH9A 3MLWH 3OAZH 3H2WA 1KCUL 5F89A 4WHYG 5T1LA 1F4XH 2WV3A 2YRZA 3CU7A 1BIIB 2OQJA 3I6GA 4OUOA 5HGAB 4N5EA 4UT7L 4XP6L 4G8IA 4JB9L 2D0HA 2DQDH 3RVXD 1IC5L 2CDGA 3FFCD 1HN1A 3FT2B 3BN9D 3CK0H 3QDGD 5T3ZH 1OHQA 5I1DB 4TUOA 3SE4C 1JMZA 3ZTJH 1VEOA 3IB4A 3BH9B 1OD7A 2VDKL 1U92B 1ZOXA 5F89B 5T1LB 4MB5A 3I6GB 2OQJB 4PRDA 2XZCL 3UTSE 2J7LA 2NY1B 5D93C 4G8IB 2A1WH 2CDGB 4P5MA 4E5XB 3MV8D 1YN7A 2Q1EA 5CJXC 2IH3A 2R4RH 4LMQE 3OAZK 4PS4L 4YHYB 5HYJD 3GSNL 1JNLH 5FV1L 5ADOH 1HH6A 2AQ1A 3VD3A 1XAUA 4NQEA 3KPSE 5HDQL 5CMAA 5FCSH 2VLME 4UILL 5HHMD 2R1YA 3MNVA 4J4PC 3GKWL 4PRDB 4KAQL 4QRRD 4U1MA 5ISZD 4F9LA 3S3SA 1NUFA 4P5MB 3L5XL 2Z8RA 3K1KC 1YN7B 1ZLSH 3P2TA 4XXDA 3CDGB 2IH3B 3UEZA 1I1AD 1HH6B 3QUZC 4NQEB 3HUJE 5EWIL 2YD5A 3UXFA 4LFHG 5BS0A 5HVGB 2R1YB 5DC0A 1OM3L 4U1MB 3HZYA 3HE7A 1CLOH 1DJSA 3CZFA 3MC0A 4AQOA 1PG7H 1IKNC 4OZGE 2P7TA 4WJ5A 4XXDB 4PJHB 3Q0HA 5E4IA 2I5YH 4LCIL 2CLRA 4IRJC 3FO0L 1SHMA 1T2QH 3V6OA 5CKAA 3P9WB 2XG5A 3N1QC 4YC2C 1HXYA 5BS0B 4L3EA 4GLRI 3WHXA 1E6OH 5FUOL 3C60A 1P4IL 3HE7B 3CZFB 5E4EC 1A22B 1CXHA 3H8NA 2EDJA 4XP1L 4S1RH 3LS5L 2HAZA 2P7TB 2ENSA 4HCRL 4WJ5B 4QKXB 4ODVH 3O6LH 4GXVL 3RAJH 4NZRH 5D7JA 1NFDF 1N8ZA 2AABH 3D3VD 2CLRB 4P2OC 2Q8AH 1HXYB 5F9WC 2OL3H 5LCVL 3WHXB 4DUXA 4XMLL 3UMTA 1D5BA 1FDLH 1QLRA 3G6JA 3RY6A 3C60B 3OSKA 4KROC 1C5BL 2JKXA 2BSRA 1LQVA 1ND0B 1EUTA 5D7JB 5DMIL 3M8OH 1N8ZB 5GS0H 3TIDA 1CG9A 1CXKA 3RX5A 3SDYL 3TH2T 4RGOH 2Y9RT 5T1LD 4I3RH 4JM2F 4X0KA 1QLRB 2ZKHH 3G6JB 3OGCA 1RZ7H 1QUNA 4WFED 4KK8D 2BSRB 1SVCP 1EGJH 2X4PA 5I18H 5JLZA 3TIDB 1CG9B 3H9ZA 2YD9A 3NBNA 3OB0H 3BPLC 4Z7VA 4LLDA 3WXVH 1YEGL 1RZJH 4UIMA 4Q6IC 4X0KB 2KKQA 3OGCB 4JDTH 5C0AE 5C7XH 4JJ5A 1U8OA 3WO4C 1HINL 1NKRA 4WW2F 3R8QA 3UJTL 5JIKA 1WWBX 3EBAA 2X4PB 1I3VA 4ZQKA 5MI0C 2OR9H 5FYKU 1JZ4A 4ZFOA 5JLZB 4PJDE 1A4JA 5F7NC 1HYSD 5D1ZB 4Z7VB 3WIIH 2YPKA 4LLDB 2YA1A 1PD6A 4UIMB 1CL7I 3AVEA 1J05A 3SHSA 4JJ5B 1U8OB 4PD4J 3RKPA 1TJHH 4PRHA 4MVBC 1R3IH 5J13B 3GMQA 4S2SB 3OB0K 2QSCL 4ZQKB 1ZANH 4ZFOB 1XGPA 3QUMH 4F33A 4HWEL 4JVWA 3MRBA 4Y4KA 1A4JB 4FZ8L 5ECJE 5BS0D 1DANU 1D9KC 4ZODA 2HVKA 1PFCA 4AL8L 2DB8A 1JYVA 4GAJL 1I9EA 4JFDB 1AFVL 3V5HA 4JO4L 4S0UC 2CXGA 3GMQB 4WNQA 4OZIA 1BBJA 5MEND 4XAKE 5ICZA 5DRZA 2JIXD 2OI9C 2CXKA 2IF7A 2VDOL 4I0PB 3MRBB 4Y4KB 4HWNA 3BQUC 3OXSA 2BK8A 5SWZA 4L3ED 4HC1H 2HVKB 1CGYA 4KJWC 32C2A 1JF5A 1J8HD 3L7EA 1U42A 3C60D 3PGCA 1Q9OA 4LSSL 1SBBA 4DKEH 4LOUC 5I1AA 3V5HB 1CYGA 4OZIB 4WNQB 1BBJB 1P2CA 1JMXA 5ICZB 4HWZA 3QWOA 5D7JD 5DRZB 5AD0A 3SKJH 5KW9L 2V5MA 4OBSA 5DI8B 1MEXH 2NY4C 2ZCHH 2XQYG 2H8PB 3LZFL 3BRDA 5DVNA 3OXSB 4DK6A 5K9QI 5SWZB 2B7DT 3HZKA 4D3CH 2CDEA 3MRCA 2YXFA 32C2B 3A6OA 1IMHC 3L7EB 1Q9OB 5D6DC 4LCWA 4F2MA 1U3HC 3QI9A 1NBQA 3MCLH 2J6EA 3L3JB 4A6YL 4NZUH 3NVQA 2HVJA 3HG1E 1JPGA 3QWOB 4HWZB 5AD0B 1NBZA 4JO2H 1KB5H 3OBAA 3QPXL 4FFWD 2QHRH 1S9KC 1U6AH 1EHNA 5C70A 1UXWA 4JY5L 1NMCB 5AAMA 5C07A 2VDNL 3HZKB 3EOAA 3MRCB 1JFQL 4PP2A 3FTGA 4YXHL 1EHLL 3HE6A 3C09C 4LCWB 3RPIA 4F2MB 5H94A 1L7IH 2JCCF 3QI9B 3V95A 3VXRA 1IKFL 4Y8AA 5IEKB 3E3QC 5DJCA 1LEKB 2HVJB 1JPGB 5FV2A 4NQCA 4ZD3L 1G9NH 2AXGA 2YA0A 5FM5M 4LVOC 4UQ3A 3QP3A 2RFXA 5H8DA 1UXWB 2PTVA 4LQFH 3JTSA 1NCAL 3EOAB 5GS0C 1F3DJ 4PP2B 5B21A 3FTGB 4K3JL 1JP5A 2GIYA 3HE6B 4MGXA 1I9JL 3QXAA 5DJCB 1H3PH 5D5ME 4NQCB 1SJVA 2AXGB 3QH3B 3ULUL 4UQ3B 4PLJC 3ISWA 1A47A 5D2NE 3ARGA 4U1IA 1B4RA 1XGYH 4DN3H 1WWCA 3MJGX 3WJLC 2IAMB 4M7KL 3JTSB 3VMOA 1S5IL 3TBYA 1U41A 4PRHD 1A1MB 1YNKH 3L3DA 3QXAB 4KUZL 1RZJC 1F6AA 2YEZA 4NJAH 3BAEH 3MV7A 1QTYT 4OFVA 5JOPE 3LN4A 1ITCA 4OFIA 3LHPL 2WP3T 4U1IB 3UBXA 2CRZA 4NQXA 2UWEE 3F62A 3VRLE 1EXUA 2OYPA 5KG9A 3HFMH 3A67L 4HQQL 3PGFL 4BQ8A 4JFED 3TBYB 4M48H 3CSGA 4WIQA 4K8RC 5TF1H 2F9BT 1F6AB 2YEZB 3DXAA 3MV7B 4AMKL 5DJZA 3LN4B 3IYLW 1CGVA 2LE9A 3UBXB 1A7NL 4NQXB 2EDEA 1ZLUH 1X4YA 5SWZD 1EXUB 5JW4N 5KG9B 3E6HA 2DMKA 4V1DD 4F37F 1O0VA 5IFAH 2QHLA 4JFFA 2XACC 1K2DA 3DX7A 4AYFA 1EDQA 3DXAB 3JUYA 4KV5E 5DJZB 5JDJA 1OQOA 1GVIA 2NTFA 1KUMA 3RUGF 1JGLH 4RWYL 4PGBA 5GISH 3QIUC 5I66A 1U8JA 3E6HB 1UJ3A 4LCWD 2J5LB 4OIIH 4HZLB 3QI9D 2CSPA 4JFFB 5ILTH 4P4RA 1K2DB 2J1KA 3DX7B 1P4BL 4HGWB 1QFWI 3JV4A 1NL0H 3NTCL 3BZEA 2DI8A 1ZLUK 5DK2A 4N0CC 2NTFB 1Q9LA 5L9DH 2VR9A 3MSPA 3QXWA 4PGBB 4XNYH 1WAAE 1MCBA 5C07D 3U79A 4MZ2A 4PY8J 5I66B 1CGWA 1QO3A 1S7SA 3JXAA 3SGDI 1UJ3B 3LDBC 4ODWA 4KVCL 1EJOH 4QRSA 2OS7A 5E2WH 3JBG7 3VXRD 2JB5H 4P4RB 3QNYA 3RHWK 3JV4B 5JW5A 3BZEB 5DK2B 2IC2A 4PJ5A 2AJXH 1KYOJ 1Q9LB 2DQTH 2W59A 3S4SA 2AEWA 2K9UA 3MV11 1OD9A 4PJXE 3G04A 5JR1H 35C8H 3AXLA 1QO3B 4Z18A 5BXFA 1S7SB 4Z0XA 3PV6A 5AG8A 2EYRA 4ODWB 4KQ4H 3SCMC 3CVIL 4QRSB 1SMAA 5FHBH 2FJHA 2OR8A 3TH4T 4X5XA 4JANA 1NAKL 2V9RA 5JW5B 3T0EE 4F7MA 4PJ5B 2DQHL 2NNAA 4U2YA 3ARGD 5FA4A 4R26L 3G04B 5T3XL 1G9NC 1JWMA 3AXLB 5BXFB 4Z0XB 1A0QL 3X3GL 1JZ7A 4P9MH 1S7WA 1NLDH 3WS3A 2FJHB 4X5XB 1TZIA 4JANB 3TCLA 4R2GD 3EDJA 3CXDL 4RFNC 2APTA 4HPOH 4F7MB 4DQOH 4FFVD 4EDWL 2WUBH 4G6KL 5F1IA 4F9PA 2NNAB 2NXZB 5F70A 5B3JF 4JAMA 1JWMB 5L88H 4DEPC 1TVBA 3C2AL 1AQKL 1V05A 1S7WB 4NRYA 4WU5A 4X9BA 3WS3B 4EI6A 4K55A 2CK0H 1FVDA 1TZIB 4UZGA 3GRWA 3TCLB 4ERSL 3DXAD 1OP3H 4NNPH 1HCVA 3BSZL 3C8DA 3BKCH 4Q58C 5C9KA 1BD2E 5CEZE 3RIAF 1CD0A 5K9QG 3NZ8A 5F1IB 4Y16C 2CRIA 1Z9LA 4JAMB 3EOBB 1TVBB 2D4DA 1J1PH 1T7XA 2G5BA 4NRYB 4J3XA 2EKSA 4WU5B 2ED9A 4EI6B 4PBWD 1FVDB 3IAPA 4Q6YA 5C0RH 4M1GL 5DUBA 5KSBA 4JPKL 1G9MH 2NY0C 3NZ8B 3BDXA 4LCUA 1M6OB 2EDOA 1MFAH 1I1RA 2XY2A 3QZWA 2P8PA 1ZVYA 2XOTA 4OGZA 4PY7A 2G5BB 1OP3K 5F8RC 4PTUA 3ZHKA 2EKSB 4TOYL 1PSKH 4HGMA 1ADQA 5EU3A 4FQ1H 1XIWD 4JY6B 3CFBA 5F1KC 4TULH 3CFCH 3CX2A 5KSAB 5DUBB 5KSBB 5HGDA 1DBML 1PG7W 1WCQA 3DSFL 4LCUB 1AE6H 1SEQH 2ZWLT 5I1KH 4UQ2A 5D7SH 1A3LL 2VQ1B 1MJUH 1FG2A 3QZWB 1INEH 1BBDH 3MLSL 4AG4L 2VN7A 4PY7B 4GMSL 3LN9A 2Z92A 4PTUB 4BSJA 4P59L 5EU3B 4LGPB 1JNNL 1FYTE 2R1WA 3CFBB 1MCQA 3V0WL 1NFIB 1PLGH 2LFGA 1B2WL 5HGDB 4POUB 1V7NH 4WUUE 3KPRA 4Y19D 3RWEA 4PJ8A 4PG9B 4UQ2B 3LS4L 1FG2B 1NFDA 1RFDH 2DYPD 3V7AG 2EE2A 4JPWH 4K2UL 3B9KA 3W5NA 5SV3A 2Z92B 3DWTA 2COQA 1JNHA 5GRJH 3DPBA 4PJ9D 2R1WB 2D9QB 3VW3L 5LAXA 4PRPE 5L7XH 2X42A 3IETA 3IDUA 3BRFA 3KPRB 1HNFA 1U3ZA 1RV6X 2NXZD 3RWEB 4PJ8B 5GGVY 4S1DD 1NFDB 3MOBH 3GUTB 4OCLC 1QLFB 5IVOA 4O9HH 4M93C 1CDIA 3B9KB 2R2BA 3T8XA 4FXGA 5EORL 1JNHB 1HXMA 5K9JH 3TPUE 4JKPH 4P49A 1EEQA 2FGWH 5LAXB 4ZOCA 3SKMB 1AR1D 3WSQH 4DAGL 3IETB 1O7SA 3CVHH 4AEIL 1KTDA 1RJZA 3MYJA 3D9AL 3RA7L 1QKZH 2R2BB 3T8XB 4XCEA 4FXGB 1HXMB 4C56E 1DQJB 3U9UA 1IAII 2Z91A 3VDAA 3L3GA 2C26A 4TPRH 4P3WA 2CIKA 5KVFL 4HFUH 5IB1A 4OGXL 1QZ1A 4O4YH 3WV0A 4R4FH 3ZSSA 2HJLA 1KN2L 1KTDB 4P46A 1RJZB 5TFSL 3MYJB 4LCCA 4KTEL 1EJ6A 1QYGL 4XCEB 4EUPH 3CH1A 1FNSL 1UQSA 3WHE1 1JPTH 3VFGH 3U9UB 1YEIH 4MJ4A 1CDHA 2AQ3A 4NN7B 2Z91B 3L3GB 4K3DL 4OBRA 5F1SA 1OT2A 1OLZA 3I84A 2CIKB 1QSEE 5IB1B 3MLPA 1HK6A 1A7BA 2HG5A 4QGTA 1RVFH 2HJLB 2EO1A 1ZHLA 4P46B 4LSUH 4LCCB 4POZD 4PG2A 1R3HA 4FQIH 4XCYA 4RCAA 3UBXG 5EPMA 3CH1B 2GJ6E 4YIQA 1UQSB 5I0ZA 3MPCA 3W82A 1F2XK 2BCKB 3NABH 5TE7L 2O5YH 3BPNB 2BNRA 3T0XA 2EDFA 2IBZX 1BWMA 5MEPB 1VFUA 2E7HA 4Y4HA 5FK9A 4OM1L 3GMNB 5C1MB 2HG5B 5M7QA 3DBXA 4FXLA 3TNNA 1ZHLB 2NY7L 1T20A 2M26A 1G9MC 1UADC 2X70A 1R3HB 4XCYB 1EA9C 1KV3A 3FQTB 3GFUA 5EPMB 3SDAC 3OKMB 3I85A 4KVNH 4YIQB 3FQRA 1Z3GL 2HWZH 4KMTL 1C8PA 1NBVH 2ED7A 4P5TA 2R56H 4QHNA 4PV9A 2BNRB 5ETUB 3MCG1 8FABA 5KVMC 5FK9B 5CBEA 3DBXB 3FOLA 3ZDZE 5BRZA 2DM3A 2JB6A 1T20B 3RTQC 4EBQH 2AJYH 2X70B 1WVZA 3FQRB 2A38A 3C5JA 4JRXE 2LU7A 4GBXC 3HI6L 4J23A 2MPAL 4P5TB 3BMVA 4QHNB 3U48A 1GOFA 1YYLL 1P6FA 1MCKA 1CS6A 5HSFA 3PE9A 4KRLB 3K81A 4ZYKA 2F54A 1BQUA 5CBEB 4XX1G 3FOLB 3CDCA 5BRZB 2JB6B 1VFAA 2DLEA 1H15B 4YQXH 1H8NA 1AY1H 1LEGA 2VLRE 3T4YA 1J8KA 2YS4A 4YBQC 3C5JB 3IKCA 2V9TA 2W9DH 1FBIH 3LEYL 3H3PH 3K4DA 3OAYH 3GK8L 2I25N 1BM3H 1AH1A 1FZOA 4M7LL 1CU4L 1U8PA 2JCCA 3L1OL 3IDIB 1QG3A 1P84J 3JV6B 5E9DE 2CPCA 4ZYKB 2F54B 1VFAB 2AKRA 3KPQA 1H5BC 3S4SG 2BOCA 3L95A 2R15A 5F1OB 5CP3H 1BJ1H 2R0KH 4WO4C 1LEGB 4UT9H 3C2SA 3ZMRA 3DVIA 3T4YB 4JFXA 2H32A 1NAMA 5KJRH 1RULL 2VH5L 1BOGA 4H88H 4OGAC 4KK9C 2VKWA 3VGAB 1BQHA 1FZOB 1YUHA 3K2MC 4CVXA 3RFZC 2JCCB 1U8PB 1H9VA 1OTTD 2CJUH 1A6TB 5CILH 1NCBL 1UC6A 4M5YH 2XV6B 3QEQE 1TPXC 5E00A 1CFBA 2D0GA 3OQ3B 1BJMA 4ODHL 3G08A 2BOCB 3L95B 2VR5A 4IRZL 4WTXA 3OAYK 3M17A 4L1DA 4X6CE 4JFXB 2H32B 3W0WA 1NAMB 3RWCA 1BOGB 3MJ9L 1GAFH 4LDOB 5I17B 3GMPA 1BQHB 1A6ZA 2AXJA 4CVXB 5EOCJ 4FZEL 4BZ1H 1H3XA 3T0VA 1IGCH 4KKCD 5JXEA 4ZTOL 5E00B 3EOYG 1UB5A 1T0PB 2E3VA 3G08B 3S34L 4J2XA 5E2TH 4YHPA 4B7LA 2I26N 2FSEA 4YWGL 5HYQA 3M17B 4JCLA 1P6AB 3W0WB 3RWCB 2V9QA 4ENEC 1KBGH 1FPTH 1JZ6A 1M7IA 3ARYA 2BNRD 3GMPB 1A6ZB 1J0YA 2X40A 4XXCA 2HKHL 4Y4HD 3K1DA 5LVEA 2PCPA 3SOBH 4NHUE 4YAQA 4RFEA 5I1JL 1DBJL 2WK2A 4ELME 4LLMA 1IGIH 3ZL4L 4YHPB 1BFSA 5HYQB 1U8HA 4NYLA 3FQWB 2ORBL 4JQXA 4N90D 2E6PA 3UZVB 3V6BR 4FQCH 1FYHB 1M7IB 4G9FA 3TH3T 5CJOH 2GKIA 1K5NA 5TE4H 4TQEH 3WNLA 1MIEH 4NP4H 1D5MA 2PCPB 4WI5A 5BRZD 4RFEB 3HZMA 3RZCA 4LLMB 2C3HA 3GM0A 1IQWL 2HH0L 3FKUS 1DEEA 1U8HB 2AK1L 2K7PA 3QZWG 4JREC 3IDGA 4EOWL 4G9FB 4CU8A 5FO7B 1WZ1H 1K5NB 4YHML 3C08L 4R7NA 2FH6A 4YHOH 1D5MB 2F54D 3HZMB 1TJIH 1MWAH 4GG6E 3D1MC 3GI8H 1RAMA 4YEFA 3RZCB 3MXVL 1J7VR 1H8SA 4RZCA 3RUGB 1DEEB 5C2BL 1PAMA 5FYLH 2HFTA 2MTPA 4U1SA 4Z76A 3O45A 1W0VA 3IDGB 1W72H 3GSXA 5C0JA 1RIUL 4GMTL 3IGAA 4G6JL 5DF0A 1BEYH 2AV1A 3BKJH 1ADQL 4Z78A 3ECBA 4R7NB 1KELL 1N2RA 3FO2A 3WKNA 3PF2A 4RZCB 5IVXF 5HJ3A 5GRVL 3TYFA 1MRFL 2RCSL 4U1SB 3TA3A 1XMWA 3WN5A 4Z76B 1W0VB 3GSXB 4UT7H 3WNMA 5C0JB 4XP6H 3IGAB 5D7KE 1IC5H 2AV1B 1RURH 3MRRA 2RGSA 4Z78B 4OIBA 3ECBB 5CCKH 5FO8A 3LQMA 1HYRC 4F8TA 3OPZH 1N2RB 4NKOA 4JFQA 3ARVA 3FO2B 5HJ3B 2VDKH 4HS8H 3TYFB 3JTTA 3WN5B 3TA3B 5I8OL 3QFJA 2NYYC 1VDGA 3SKNA 3KHOA 3MRRB 4M6OH 4JFHE 4G8GD 3ARFA 1EERB 5FO8B 4PS4H 1FL3A 2VABA 4M7JH 4NKOB 3VXMD 2VDLL 4N0UE 5HDQH 5BO1H 4HT1L 3HAEB 4Y1AE 3JTTB 2F8VA 5HTSA 3D2UA 3QFJB 3GKWH 3KR3L 3ULUE 2FD6L 3HB3C 2E27L 3SKNB 2HTLD 4JHAL 3O8XC 3L5XH 4NWTL 3LMJH 3ARFB 2EXWC 2A0LC 4KU1A 1IC7L 2VABB 1GRWA 3CXHK 1QBLH 3VA2C 4I9WE 1GC1L 5EWIH 4XB7A 3VD4A 4R90L 4FQ2L 1UZ6F 3D2UB 4X6DE 1G7PA 4KY1H 1ZHBA 2H3NA 1OM3H 3G5ZA 1M1SA 4RQQA 1EFQA 5DT1L 4CMHC 3BKMH 4M6AA 1FFOA 5MP6L 1DQQB 4L4VE 4Y5XA 4AEEA 3BWAA 1G6RA 3QDMA 3SGKC 4DKAA 1T5XA 4Y5VA 4P2RA 3PABA 3PP3H 4BK4A 1G7PB 4YDKL 1F11A 3AU1A 1ZHBB 2H3NB 3G5ZB 1P4IH 4RQQB 4XP1H 2GCYA 3LS5H 4HCRH 4L8SC 4X5LA 1FFOB 2R2CA 3IF1A 5GGUA 3BWAB 4N0YH 1RJCA 1MLCA 1T5XB 2AJUH 2VXTL 4P2RB 2R2HA 2CD0A 5DWUH 5DD1L 4DVRH 5LCVH 4TYUA 1F11B 3QRFM 3AU1B 1D3CA 4XTRD 2VZVA 1X5KA 1S9VA 2OXGA 1B0GA 1DBBL 4ZS6D 2NCMA 3NPSC 2GCYB 4XGZA 3V6FA 3MCKA 2DLTA 1GZQA 5CSBA 1JL8A 3NZHL 4OF6A 1CDUA 5DMIH 4CN1A 3PP3K 5GGUB 4U3CA 3RDTA 1DUYA 1WF5A 3TFKC 5A3ID 1QSFE 5JOEA 3JUZA 1NGQL 1MLCB 4JKKA 4I48A 1II4E 5HDBF 3TA3D 4V3EB 5FCUL 4R3SA 3LB6D 5IBTL 1SYSA 3OL2A 5DJXA 1B0GB 1JRHL 3WFDL 3TF7A 4XGZB 1S8DA 3MCKB 3BUTA 4PJHE 1GZQB 4JG0L 5JQ6H 3U1SL 4XAWL 4YZFF 2Y36L 1DUYB 4CAGA 3NIDE 3PWJA 4DOHB 5E6IB 4IOFC 5BOZG 5J8OA 1YEGH 4Y4FC 5DMGD 3SBWC 5CBAA 2EIZA 2XTJE 5DJXB 4GRWB 4YLQT 1YN6A 3ZKSD 1S7UA 5IHUH 1IGML 1S8DB 3T3PE 4NGHH 4PP8C 4K7FA 5C0BA 2X4OA 4JZJC 1N0XL 1PDKA 2DM2A 2DD8L 3VFNA 5E8NB 5JIIA 4PLOB 5JW4M 5GRXG 2RIKA 3D2UD 5C0DA 3WBDA 3HR6A 1KACB 5CBAB 2X6MA 2EIZB 3P4OA 1Q0XH 1S7UB 5IT2L 4N5UA 1IGTA 5T3XE 1WSST 3L3OA 4ZOAA 3PNWA 4OLVL 1L0QA 1JTPA 3DTXA 1IGJA 4K7FB 5C0BB 1BQHG 2VZUA 2X4OB 3D39A 4MDJA 5DD6B 4HWEH 3ILPA 3VFNB 1L6ZA 1MJ7H 2K1MA 4RWHA 2RJMA 3K80A 2VDRL 5DHXB 1LD9B 5L6YL 5ITFB 4UNVA 1P4LA 1MQKL 1OAQL 1UWGL 4UIKL 4GAJH 5SWSA 1AD9B 4CRPA 2V5YA 1AFVH 1IGTB 4LSRH 4JO4H 5B4MC 3AY4A 1NAML 3L3OB 2XZAL 3PNWB 1B0RA 1IGJB 2VDOH 1ZGLM 4MDJB 2AEPL 3ILPB 4M3KB 3QDMD 4HG4K 5F7EL 2Y25A 2BXYA 4MB3A 3A6BL 5E7FA 3O6FD 1P4LB 3LAFA 3I50L 5SWSB 2VZSA 1DVFA 2HFGL 1B0RB 2BNQE 2RBLA 3CD4A 3RGVC 5I74B 1ZA6A 1AGFA 4HF5L 1KC5L 2VSDA 1VGEL 4KTDH 3ZYOA 5GGTH 4BQBA 4PGCA 1KCLA 5IQ9A 5KSUB 1DL7L 2AK4A 3K0WA 1A6AA 1DVFB 1LVEA 1X5FA 3SO3B 4A6YH 2VAAA 3SQOL 1FIGL 4XWOD 5GGSY 2JJTC 3N1GC 1QRNA 3V5KA 3QPXH 2DQIL 4WI6A 3RDTD 1ZA6B 1AGFB 2DAVA 4JY5H 4KRPC 5GGQL 2MCPH 4PGCB 4E41A 2VDNH 2WUCH 4JFDE 4TVPL 1HSBA 5IQ9B 2E7BA 4LHUA 4P9HH 4MXQA 3FT3A 1EHLH 3WFBH 2AK4B 1A6AB 4AEHL 1IKFH 1ZVHA 1T1WA 2IFFL 3B2VH 1LNUA 3DRQA 5IQ7L 4ZD3H 1QRNB 3KYNA 1CF8L 2O5XH 3T04D 1E4XI 1RZFH 5DJDA 5HVWA 4FHBD 5IKCA 5JHDE 2ZCLL 1HSBB 2ZCKL 4LHUB 3SDDB 4BFGA 4OZIE 2GI7A 1K4CA 4LVNB 1T1WB 1OL0A 5B39A 1LNUB 1T21A 3DRQB 4P2QA 4G6FD 5C08A 4CUCA 1U93A 3KYNB 1Z9MA 1VFBA 1XEDA 1A14L 2P5EA 1XCTA 5LQBL 5DJDB 1CE1H 4ZAKC 3T0BA 1KJ2A 5IKCB 3EYVA 5EZOH 1S5IH 5EULV 5ALBL 3DX6A 5DYOB 4KUZH 1K4CB 5IJKC 4C59B 5CKGA 1KPVA 3W81A 5B39B 3AM8C 1OLLA 1WLHA 1T21B 1OAZL 4P2QB 5C08B 3ESUF 3D39D 4ETQA 1FRGL 1U93B 4LDLB 3FRUA 1VFBB 3SGEH 2P5EB 1I9IL 4HZAA 1XCTB 5IBLD 3LHPH 3MV9E 3QQ9C 1L8JA 1M7DA 3EYVB 3H3BC 1R3LA 4HQQH 4NBXB 4OCMC 2VOTA 1YQVL 5E8EA 5I71B 1LO4L 4BZ2L 5DJAA 3DX6B 1V8HA 1AC0A 5TPWH 2LVEA 1KPVB 3KPNA 4J4PD 3GDBA 1TTUA 4ETQB 3U4BL 1H3GA 3FRUB 4APQA 4RX4D 4HX1A 5A2LH 1MCNA 4MVBA 4X9FA 1IM9A 3BESR 1AGBA 2F53D 1M7DB 4FTVA 1UKSA 1R3LB 3DROA 1G6VK 3IXTA 2R4SH 3FHAA 1P1ZA 1PYWA 1AGCA 3CMGA 5DJAB 3QUZD 2EDYA 3GGWA 1LO2L 4PGDA 3QYCA 4NQCE 3RIFK 1UM5L 3KPNB 5D6CA 1AJ7L 2ED8A 5I75B 4APQB 1NEZA 3BZDA 1UWXH 5D7LE 4HX1B 4RWYH 2FGZA 1IM9B 1AGBB 4FTVB 4DK3A 3GJEB 5D2LA 3DROB 2Y1VA 3RVXC 3IXTB 4JDZA 1PYWB 1AGCB 2FHFA 3MZTA 3BN9C 3S96A 3DYPA 3GGWB 2ESVD 5GZOD 4PGDB 2LTQB 5D6CB 1KJMA 1W0WA 3NTCH 3WNKA 2IANA 3MLUH 3OKOA 5IM7A 1BFTA 5IFJA 2EE3A 1PX4A 3SDCA 5BMFL 3KAAA 4E41D 4RMTA 2HMIC 3P9LA 4XCCH 4NQUA 1MFEL 1B90A 4P57A 1XFPA 3K8MA 4LHUD 4JDZB 4MXQD 5BV7B 1PKQA 4M9OA 3S96B 1X5JA 2R1XA 1F97A 1FN4B 2J3SA 4JLRB 4M03A 4EDXA 4Z95H 2HJKA 4NJ9L 2NX5A 2I9LA 5JHLL 5EZLA 1KJMB 1W0WB 3ZTNL 2IANB 3EUUA 3OKOB 4RFOL 3FAWA 5TQ0H 5D6DA 4KROD 1CGSL 5IM7B 2GSIA 2J8UA 5IFJB 3SDCB 1D6EA 1U8QA 3P9LB 5IB2B 4P57B 2DQJL 1N5YH 2YR3A 1YNTA 1YY9D 1PKQB 4GKOA 4WFFD 2R1XB 2GW5A 4EDXB 2HJKB 1NAKH 1YEKH 2NX5B 3PWPA 2I9LB 5EZLB 2OR7A 4P9HC 4R9HA 3G5VA 4P2QD 3EYSL 5T33L 5EUOF 1HQRA 3BKYL 4YBHA 2GSIB 2J8UB 3I3EA 1IGFL 1RI8A 4R26H 5EOCL 4LIQE 1D6EB 5T3XH 1U8QB 2I60H 1KLUB 3X3GH 3VJ6A 4JFFE 2E7LE 2PR4L 1YNTB 2GY7B 4U31A 3B3IA 4CVUA 2IBZY 3SE8L 3PWPB 2KZWA 2VDML 4PRAA 3CXDH 3QT2A 3G5VB 5IOPA 1J0KA 3QIBA 4HW6A 4ODUB 1KCGC 1BGXL 1HQRB 3KJ4C 4EDWH 4P99A 4HUUB 1ONQA 1LK2A 5IUSA 4ACPA 3V0AC 3ULUC 4POYA 3D69A 3UTPE 3VJ6B 2NPLX 4MLIA 3B3IB 5T3ZD 3VGHA 4ERSH 4PRAB 5IOPB 3QIBB 4Q9QL 5T1KA 4APQD 3VH8A 3MMEA 3HMWH 5IG7A 1ONQB 1LK2B 1AP2A 1BVLA 3NGBB 4MVBD 4QXGL 1IM9D 4M00A 5GQBA 4FTVD 2MCG1 5HYEA 3HHRB 1J0ZA 4EVNB 4KI5E 3O2VL 3PP4L 1J1OL 4CN4A 1LDPH 1XF5A 3V4PL 1D9KD 3CDYA 3CX5K 5LGHL 3FMGH 5T1KB 3GNMH 5GRYA 3VH8B 2QQNL 3MMEB 5IG7B 1BVLB 4U1GB 3P30L 4LLAA 4N5EC 2NY1C 2Z31A 5F6HI 1Y18A 5J4MA 4LVHB 2CGRL 2YN5A 3CFDA 4LPCA 5TDPA 4TOYH 4WEMB 3FT4A 4YHYC 4QO1A 5DUPL 1HHKA 5KZCB 2DQFA 5I1CH 1XF5B 3PUCA 4KJWD 2IAND 2VLLA 1DBMH 2Q86A 5IHZB 2IGFL 2CKBB 3D0LA 3SDCD 1FVCA 1K8IA 1A3LH 5KVEL 4D94A 4OFDA 2Z31B 4Q9BA 1Y18B 4PJEE 3MLSH 5EIQA 4AG4H 3QDJA 4QF1A 7CGTA 3CFDB 3O2WL 5TDPB 1RHHA 4YBLB 2NY4D 4HBQA 3FT4B 1HHKB 1JNNH 1FFPA 5AEAA 2NX5D 3QIUA 2DQFB 3QA3B 4X98B 2FHBA 3O3AA 4HWBA 1HYSC 1OPGL 5HYSG 2VLLB 3KS0J 4C54A 2Q86B 3D0LB 3P4NA 1FVCB 1K8IB 2V5RA 4YNYA 4K2UH 1T04A 3QDJB 5MHSE 4QF1B 4PYGA 1J0HA 3QUYA 1LP9A 1GGTA 2WBJB 4PJCF 1RHHB 4H20H 2M2DA 4GKSA 4XP4L 1FFPB 4NZTL 1WZMA 2PTUA 4JN2A 3VW3H 1HI6A 3O3AB 2W65A 1YEJL 2V5SA 3P4NB 4NO3A 3WD5L 2Z93A 5LWYH 3QWQB 3HE7C 4YNYB 2IPUG 1T04B 1C5CH 2YD1A 5JDSB 1YPZA 4HGKC 3QUYB 1LP9B 4GSDL 2FX7L 4E0RB 4HIHA 2E8YA 4GKSB 4JN2B 4LHUG 3V6OC 1MJJA 2B2XL 4DFIA 1N6QH 2RQ8A 2W65B 5FEBA 3G6AA 4KZEL 2J6EH 5IW6A 4NO3B 2Z93B 3C60C 4UOW1 3D9AH 1YEDA 3RA7H 1YPZB 2YKLL 4PLJD 4HIHB 5D7JC 5CSZA 2VZ3A 4K7PL 5IF0A 4N1CA 1MJJB 3FOMA 2C1PB 3AFLA 3WFZA 4MLSA 3U0PA 3S9DB 3G6AB 2AAVA 1SQ2N 4QRQA 5IW6B 2VB5A 1KN2H 3RY6C 1MRCH 4OFKA 1YEDB 1JGUH 1QYGH 1JK8A 3KPSA 3ZSTA 1FNSH 4QYOA 5CSZB 1EMTH 1MFBL 4U33A 5IF0B 3FOMB 5HI5C 3KPRE 4K3DH 3U0PB 2DDQL 4EI5B 2B0SH 3BGAA 5HHQA 1NFDE 2F19H 1YECL 4QRQB 4K8RD 3WIHL 1KGCD 2I24N 4IMLA 3HPJA 4BA8A 2XIDA 4M5ZL 1MFDL 3UTQA 3X3FL 2V17H 3KPSB 3HUJA 5INCA 4MDIB 5DLML 1ODAA 1RUAH 1MNUL 3DRTA 3W11D 1IL1A 1QBMH 3LRHA 4ODSL 5D1ZC 3K7UA 3IDXL 5HHQB 4I4WB 3ULVF 4LAQL 3BT2L 4OZGA 2VISB 2Y07L 3ZT6A 4IMLB 4X80L 3QDJD 3HZVA 3MLXL 4P0DA 5J13C 3UTQB 4HXAH 3CDFA 5INCB 1WEJH 4Y89A 5T1DH 3QIUD 5BVJA 4Y5YA 3DRTB 4F58L 1IL1B 5DUML 3VFOA 3ZT5A 3OKKA 1F4WH 1JPSL 3CSYA 3MBEA 3T0DA 1EVTC 3FO1A 1MHPL 5LGJA 1HHGA 3REVA 1NEZG 3BGFB 3HZVB 1JHLL 2IFGA 4N0CD 3QUYD 3OHXA 1TITA 3UZQA 1BZQK 4UTBH 3OR7A 5FOBA 1FH5L 4JRYE 5BVJB 1N64H 2X1QA 4OIAA 3HI6H 3VI4F 3K2UL 4Y5YB 4Y4KC 5BCAA 4XCNA 3TC9A 5T5NF 1ZGLP 3VFOB 1YYLH 5EBWA 3OKKB 3MBEB 3CSYB 3SJVB 3FO1B 1L9MA 5LGJB 1HHGB 5JORA 4LKXA 3RU8H 1UGNA 3OHXB 4XP9H 2YPVL 2CLZA 4LARH 5GSRA 5BQ7A 5ITBH 5KS9F 1T2XA 3L9RA 4B53A 4OV6F 3ROLA 1ZT7A 1WK0A 1AXIB 4XCNB 4RDQF 1N4XL 4M7LH 1CU4H 4YHKH 5EBWB 4OQTL 5D72L 1TQBB 4NBZB 1G0DA 3F7QA 3TBVA 4LKXB 1MIMH 4JZNA 3P77B 2CLZB 5GSRB 5BQ7B 5C0GA 2ICCA 3L9RB 4P23A 3ROLB 1ZT7B 1QOKA 2R0LL 3UTSD 3BIAX 5C0AA 3D5OF 1NMCC 3W39B 3E1F1 4LPUA 4J6RL 3TBVB 1TZGL 3QI9C 2GK2A 1ZXQA 2HKFL 4PJDA 4JZNB 1BFOA 3KPSD 4PBVC 4Z7QF 5DA0B 1EEZA 5IB5A 5LKNA 3RJQB 5C0GB 2VLMD 4PD4K 3QFDA 4P23B 3ESVF 1PKOA 4WDIA 4CGTA 2XWBB 4XVTL 5C0NC 5C0AB 2ZSVA 2VSCA 5DA4A 2Q7NA 1RU9H 4PFEA 4GAGL 4LPXA 2DQCL 4Q0XL 4KZDL 4GQ9H 3S36L 2XKNA 3HE6C 4ZTOH 3ZYZA 1F90L 3MXWH 3S34H 2IPTH 3O6ML 4PJDB 4FQXA 5C09E 4PJFF 1EEZB 5IB5B 4Y16D 3MNWA 4G42A 3CFJA 3QFDB 3AS0A 4WDIB 4MQSB 4RGNB 1YEHH 4LSQH 2IAMC 1U95A 2ZSVB 3C6LA 2BX5A 3ELAT 3WLBA 3I75B 2XKNB 2OXHA 3ZL4H 3U30B 3LIZL 4S0SD 4FQXB 2NY0D 5DJ6A 1VEMA 2ORBH 3VXTB 4G42B 4U4BA 3SGJC 1ZHNA 2PO6B 1XT5A 4NPYA 4XPFH 2JCCE 1GHFH 3H9SA 4WENB 5I1HH 3MLTA 1U95B 3C6LB 1ROWA 2FX8H 3MBED 3WLBB 2MQ0A 3GRWH 1IAIM 1ZV5A 3K4ZA 4G5ZH 4ONGL 2XWTA 5GGRA 5D1QA 4MJIE 2AK1H 1WWAX 5DJ6B 1N7MH 4EOWH 1ZHNB 1D5ZA 3HR5A 4W6XB 4FNLL 1F3DH 1I1FA 4HUWA 2V7HA 3H9SB 3MLTB 4YHMH 5EA0L 2OJEA 1KXTB 2K3TA 1AXTL 3MBXL 3ARQA 3HG1A 3MXVH 4XI5D 3TV3L 2XWTB 5GGRB 1EUUA 2CKBL 5L2KA 5D1QB 3TYGL 2MJWA 3PDGA 1ACYH 5CEYA 2BC4A 2ZP0T 2G9HA 2Q3AA 1D5ZB 1JNJA 1EBPA 3HR5B 2D2OA 1I1FB 1RIUH 3QB7C 4GMTH 2V7HB 1W8OA 3BZ4B 1ADQH 3N0PB 4BSVA 2OJEB 1KELH 2ICEA 4F3FA 3HG1B 4DUVA 1BZ9A 4D9QE 2J5LC 3IJYA 4JFPA 4GRLB 5L2KB 2NY6B 1R3KA 5CEYB 1LGVA 2BC4B 2G9HB 4NO2A 1FORH 4P23D 5IGXH 2B1AL 1CDCA 8CGTA 3V4UL 1TNMA 4ZG1A 2Z8VC 1HKLH 1MCDA 4W70A 4BSVB 3JSSA 4TVPE 4F3FB 1UJ3C 2H1PH 1OAXL 4HWBL 5D5MA 2BHYA 1BZ9B 3IJYB 2OK0L 2GSGA 3Q5OA 4JFZH 5KVGH 5HPOA 4UB0L 3EO0A 4KHTL 4RSVA 3PGDA 1E4KA 1DLHA 5D2NA 1R3KB 5BZDA 2E8ZA 4NO2B 4G9FE 1RD6A 4JGJA 2YK1L 3MLZL 5ID0A 4MQTB 3S3JA 2OMNA 5AZ2L 1WIOA 1FNEA 2XQBH 2Z9TA 1OTUD 5D5MB 3T1WA 3RUGE 3IFNL 4Z7NF 4S10A 2GSGB 1IEBB 4LNVA 4Z7WF 3EO0B 1AIFA 4AM0A 1XF4A 2ADFL 3T4AA 1S7TA 5J7CC 3PGDB 1DLHB 5D2NB 1FE8L 3ARDA 5BZDB 2UWEA 1TJGH 2FD6H 3P0YH 1MREL 2E27H 3C6LD 3MJ8A 5CJ8A 5ID0B 4Y8DC 1Q1JL 4LLVA 5ENWB 1FNEB 1F42A 2IADA 4H1LA 4O2FA 4L9LA 1F13A 3PDOA 3Q5YA 4N8PA 1PGRB 1AIFB 1ZSDA 1XF4B 3T4AB 4AM0B 1S7TB 3V2AR 4R90H 4FQ2H 3U7YL 2R29L 3ARDB 4WCYH 2UWEB 4NN5B 4I5BA 3W9EA 2BY2A 2DJUA 2IQ9L 3RY4A 1JTOA 1DQLH 2NXZC 5DT1H 4WFHE 1JYXA 4LLVB 2VZTA 1YEEL 5F21B 4Z7UF 4I2XE 5MP6H 4H1LB 1J87A 4L9LB 4O2FB 2AJSL 1IAIL 5ISZE 3PDOB 4ZSOE 5JQHC 1I85A 3EHBD 1ZSDB 2ZUWA 1VA9A 3WS6A 5D1QD 1UM6H 3B9DA 2PXYA 3MRFA 1KJVA 4YDKH 2VLKA 1VEPA 4I5BB 1AR1C 1OP9A 3W9EB 2QQLL 4PJBF 4F9PC 3ARXA 5D4QA 2L7JA 2WBKA 3F5WA 4XCFL 5I73B 3HG1D 6FABL 1Y6MR 4FQLL 3PV7A 1EX0A 1PQZB 4NNXB 5M94B 3SN6N 2ZNWA 1KCVL 2VXTH 5KVDL 3WFHA 2QQKL 2PXYB 3MRFB 1KJVB 1WAAA 4UV4L 2VLKB 4NKDB 3A6CL 1L6XA 4MHHG 3B8SA 4OZHF 3RTQD 3UPRA 1DBBH 4OLYL 3SEPA 4ISVA 1FNAA 3NZHH 3F5WB 3EJZC 1KYOK 5ICYA 4D2NA 2BSTA 5B3JE 1S9XB 4UBDD 1INDH 1OT1A 3HC4L 3QR2A 1CBVL 3WFHB 1REIA 2KQNA 5KSAC 5FCUH 3VWKA 5J1TC 2F8XC 5IBTH 3UPRB 1V5JA 2YRLA 1JRHH 2QADB 3WFDH 3VRIA 4JZOB 3NAAL 4ISVB 6CGTA 3C5SA 2X4QA 4POZC 3U1SH 5ICYB 3DOSA 5F6IB 3L3IB 2Y36H 3T0EA 2BSTB 5KANG 3AREA 1QEWB 5B22A 3Q1SL 5D71L 3VWKB 2CR3A 3UAJD 3BHBA 1U8KA 5BJTB 3VRIB 1IGMH 1OSPH 1AGDA 3DVNB 1S7VA 2X4QB 2FIRT 4KDWA 4ZOBA 5D7IF 4PJAF 1HILB 4KK9D 2DD8H 5JOPD 3T0EB 4ZO9A 1S3KL 1A5FH 1DP0A 3AREB 1QBAA 1UB6A 3RVWD 12E8L 3QQ3A 4U6YA 2YD3A 1Q9KA 5DK3A 3MRPA 1U8KB 4PJ8C 2GITA 3UPAA 5IVNA 5IT2H 2IALA 3V4VH 3D0VA 1S7VB 4OLVH 5D70L 2C7UA 4NIKB 5EBMB 3B9KC 2NXYB 4RAHA 4ZUUB 2UY6A 2P48B 1BD2A 5HGGS 5DJ0A 5C3TA 3S88H 5CZXD 2W9LA 5L6YH 4X7SL 1UB6B 2CUHA 3QQ3B 4U6YB 2V2TA 1QA9B 1UWGH 4JN1H 1Q9KB 2DJ4A 3MRPB 2Y6SC 1FHGA 2GITB 3GHEL 4HLZG 5EO0A 2H32H 2IALB 1NAMH 2O5ZH 1VPOL 3D0VB 4Q7DA 2C7UB 4ENED 5IFHL 4XVJH 3SQBA 2OCFD 2AEPH 1LO3L 3TVMA 3FHQA 1BD2B 5DJ0B 1Z2KA 1CIUA 3U46A 2PXYD 2EDTA 3A6BH 4ZFFA 5T5FL 2DL9A 3MLYL 1BMGA 3QHZL 3MODL 3S5LA 2V2TB 4XBGA 2BSSA 1CFVH 1J5OL 3N85L 1JF6A 4QT5A 4LSTH 2HFGH 5E03A 1RUPL 3LPGA 1P7HL 4OKDA 2DM7A 3VWJA 5CUSH 3TVMB 3WJJA 4YDJA 3MUY1 4XHJD 5GRUL 3U0WL 2VUOA 4NN7C 4ZFFB 3H6JA 3EYOA 2B4CH 3S5LB 5A43C 1DL7H 4XBGB 3EKCA 3SKOA 3VFPA 3GHBL 2F5BL 1AKJD 4QT5B 2DQUH 4P46C 4TUKH 5C0BE 4LCCC 3SQOH 4NZJA 4KHXL 4OT1H 5HHVL 1RHFA 3VWJB 2OM5A 4YDJB 3RI5F 2EIEA 1XGRA 4WUUA 3KYAA 3QHFL 3OKEA 5GGQH 3BPNC 4WY7H 5DD3L 3T0WA 4EIGB 3EYOB 3VWKD 3MLRL 1X5YA 4LKCA 1JJUA 2H2SC 4QCIB 3SKOB 3VFPB 4OLXL 4AEHH 2VQUA 2WINA 1TQCB 2IFFH 3MGAA 4EZMA 4PG2C 1LO5A 5IQ7H 3F12A 5ESQA 3DMMA 1LEIA 4PRPA 2XA8H 3T0ED 3ARED 1XGRB 4WUUB 3OKEB 1NGWA 4OFPA 2ILLA 3O4LE 2ZCLH 3V5DA 4LKCB 1JYNA 2PYFA 3D25A 2WINB 4YE4L 4O58L 3K74B 3TPUA 1LO5B 2Q87A 5IIEA 3F12B 5ESQB 1HSAA 5L8LB 5KSVA 3DMMB 4P3DA 4UU9A 3S98A 1LEIB 4PRPB 5IMMA 2BVTA 3THML 5LQBH 4P5TC 2QV2A 4U6XA 1NGWB 4U49A 3V5DB 4RMSA 3S35L 2YWZA 5ALBH 1HHHA 2PYFB 3NIGE 5DEGB 4M62L 4C56A 3TPUB 5IIEB 1CE6A 2NYYD 1DBKL 1HSAB 1FRGH 5KSVB 4P3DB 2Y06L 4LLQB 1I9IH 2DQEL 5I9QB 5IMMB 1BD2D 5EU6E 5ALCH 3F7PC 2HT2D 5CEZD 1PBYA 3RHWF 4C58B 1LE9A 1DLFH 4U6XB 1F4HA 1ORSA 4KK6C 5E5MB 3D18A 4K9EH 4U7KA 4LK4A 3ARTA 3LVEA 5C0FA 1LO4H 1JZ5A 1HHHB 1NCTA 1QRNE 5J56B 2APVA 4C56B 1V3MA 1KCRL 3NCCB 1CE6B 3E0GA 3ZYJA 1B6UA 5ESAA 1UEYA 3HB3D 4TSBL 1LE9B 3O8XD 3DNKA 3EFDL 1ORSB 4ORGA 3D18B 3RWFA 3VGAC 1UA6H 2EXWD 5F3HB 4TVSa 5C0FB 2DBLL 1QFPA 1LK3L 2LU3A 3GZKA 3GSVA 3GSNA 5EU5A 3UJIL 1K4DA 1AJ7H 4HH8A 3O3UN 4OCRL 4CJ1A 3VWJD 3JV0A 4QXWA 5E6YA 3OWEA 1MQ8A 4XPHH 4MNQE 2LABA 4N1EA 4K94L 4DN4L 4H1LG 3REWA 4S1SH 3RWFB 2H2PC 4WHDA 3GMOA 3S7GA 3N9GH 4R0LA 4JR9L 3UPCA 5BW7A 2XRAL 3WEXA 4W68A 4MAUH 1FYTD 3GSNB 3NIFF 2EDRA 2P5EE 5EU5B 1K4DB 2F5AL 2A77L 1IBGH 1KTLA 4WUUD 5BMFH 1IC4L 1XF3A 1MFEH 2FHCA 4W4NA 4EUPG 3QUXA 4H0HB 3AMKA 4R0LB 4TSAH 3WEXB 2C3GA 5JXEC 2B4CC 4QHMA 2X2YA 1QFOA 4JRXA 5E24E 3LEVL 4RFOH 4PRPD 3VXUE 1CGSH 4M6MH 1KTLB 1P9MA 3EO9H 2R0WL 3EDDA 3B6SA 4FG6D 3EYUH 2EC9U 1Q72H 1XF3B 3V9FA 2CK2A 3BEWA 4ODTL 2HTLC 2X10A 3QUXB 3VXNA 4J8RA 1FZKA 1G6RH 2LU4A 4LASL 5GHWL 5L0QB 5HYFA 5JXAL 1D5IH 2VLRA 4P3CH 2WIIA 4QHMB 3QQNA 4OD3H 4JRXB 3DIFA 5FDYA 3CLFH 1KG0A 4ZFZA 3ARPA 4IDJL 5T33H 1P84K 1V7MH 4HFWA 3SPVA 2VXUL 5DD5L 5AUMA 1TMCA 1IGFH 3B5TA 4JQXC 5EOCH 1JBJA 5HHOE 5E9DA 2A74A 3BEWB 3X11A 3R4DA 2AJ3B 4U2ZA 3VXNB 2WP3O 3WFCL 4QNPF 2PR4H 4J8RB 1FZKB 3KXFA 1CICA 2NW2A 3F8UB 5JTWA 1T1ZA 5EIVA 2VLRB 4B7IA 4LSPH 4IOFD 3RZCC 4KXZI 2VDMH 3DIFB 1KG0B 4ZFZB 4DGIH 1J9CT 5C92A 1Q94A 1FFNA 3H0TA 4HFWB 3SPVB 1KENL 3P11H 4X9GA 3VGEA 4WHCA 5AUMB 2KPNA 5DZLA 3CMOH 5E9DB 2A74B 3C6SA 2VL4A 5EC1A 3FJTA 1AR2A 2ENYA 3KXFB 1CICB 2NW2B 3GI9L 2XYCA 1T1ZB 1VB9A 4X6CA 4HIIB 5TE6L 4ALAH 4ZAKA 3RBGA 3GBLA 3TJEH 1A9EA 5KN5A 4GRWH 4JQIH 1Q94B 1FFNB 3H0TB 1DQDL 4JQVA 2EDDA 2UZIL 4QXGH 1MCLA 4DGVL 4OFYD 1QSED 4XTRC 4C4KO 4PB9L 4ZS6C 5ICXA 1PKQE 2AI0L 3EOTL 5EC1B 3QEHA 1AI1L 2X05A 4IDLA 4YPJA 3R1GH 4PRNA 4NCC1 3PP4H 4K9EC 2GJ6D 4X6CB 5F7LB 1J1OH 1GGYA 2R69L 5IBUB 3V4PH 3JWOL 1A9EB 4FABL 5KN5B 1DCLA 4YK4B 3WN5C 3TA3C 2QQNH 5CD5D 4I3SL 2JELL 5B4MD 4QHUA 3OJVC 3O3DA 1OP5H 4X4MA 2XXCB 4NHUA 5DRNA 3VI3E 2XXMB 2CGRH 3QEHB 4ELMA 1QR1A 4P48A 4PRNB 1NSNL 2WIMA 1TLKA 2P45B 5GSVA 2AEIT 3IU3A 5IP4A 1HIML 2N1KA 2NY2B 1I75A 4UDTA 4R96A 3GSWA 5DMGC 2BVOA 5KVEH 1NDGA 1ZTXL 4QHUB 1I9RL 3O3DB 2W91A 4HMEA 5CLTA 5DRWA 4NHUB 5DRNB 4BJLA 5IVXE 1F5WA 1S78C 3QUXD 4OF5A 5J57B 3O4OB 1QR1B 3ARFC 3U9PL 1B88A 3S5LG 5GSVB 3IU3B 3F58H 1OPGH 3ZE0F 1OP5K 1LWRA 4HIXL 4UDTB 4R96B 2DMCA 3GSWB 4R6UA 5JIPA 2DRUA 2BVOB 2EDNA 1DBAL 2FBJL 4Z7UB 4YXKL 3UTTE 4NDMA 3L3KA 5DRWB 4PIRF 1A3RH 1NANH 4KQ3L 4NOFA 5DVOA 4LLYA 1FL6A 4C55A 1UYWH 2VLRD 3AS3A 4MXVF 4NZTH 2P44B 3O0RH 1M05A 4M61A 5I16A 2I07A 1P69B 3SKUD 1NJ9A 2G60L 4OI9A 4LSVL 1JTTA 3WD5H 1T2JA 5AAWA 2DKUA 4NDMB 2P8MA 4AIOA 2APXA 4RISL 2XN9D 4X99A 2BHZA 4MNGE 4LLYB 1CICD 1FL6B 3GIVA 3V7MA 3ULVL 1TETL 2VIRA 3DURA 4HJJL 3KG5A 4TRPL 1U9KA 4BH7A 2BY0A 4M61B 5I16B 5I8KH 1CDGA 1IZKA 1ITBB 4G6AC 3TEUA 5JMOC 1NCCL 1CXEA 1B4JL 2CRMA 5EBLA 3V8OA 4I13B 1NMBL 3RWJA 2G75A 2P8MB 1MPAH 3QEQD 2W0FA 4X99B 3AB0B 5J06A 1UZ6E 4MXWL 1CXLA 1T83A 2YKLH 3GIVB 5F7WC 1NEUA 2VIRB 3DURB 4ZAKD 1RIVH 4BH7B 2VO5A 4HEME 2P47B 4UOJA 4U6VH 4NQDB 4K07A 5EBLB 4PJAA 3RWJB 2G75B 4BQ6A 5JOFB 4I77L 1WFTA 2W0FB 5CJ5A 1MCWW 4J3VA 1KFAH 5HHXL 4N0UA 4I0KA 4Y1AA 3FN0L 3HTLX 3MUJA 3RDTC 5DRXA 2VLJB 3NFNA 1QHPA 2YMXH 5E6IC 3T2QA 1YMME 1W2KT 2FWOA 3HC3H 2IPUK 2FEEL 2X9YA 4AENA 4PJAB 5E5UB 4M5ZH 3TF7C 3PHSA 1MFDH 3BFOA 3EAKA 2BVPA 4N0UB 1KEML 2ZJSL 2BXZA 4OCSL 5DLMH 4HK3N 5A2IH 4Y1AB 3QWRA 4X6DA 1UH2A 1I1CA 5DHVA 3SE9H 1LO0L 5DRXB 3NFNB 3QXUA 2XNAA 3IDXH 4OKVA 2A9NL 3FT2A 3ZE1F 5EOQL 3MA9L 2FWOB 1EVUA 4LAQH 4PUBH 5IESL 3BT2H 4NM4L 2VWEE 3TWCL 2Y07H 1E4WL 5FECA 4AENB 1NFKA 4L4VA 3MLXH 4OF7A 5HVHB 5HDBE 1U92A 2BVPB 4YEEA 1MFCH 2VXSL 1ZHKA 4X6DB 4QOKE 4XPTH 5DHVB 4F58H 2VDQH 4LP5A 4K3EL 2XNAB 4OKVB 4E5XA 4WEBL 1MHPH 1J10A 1OF2A 4YZFE 5FECB 3QHTC 1CD9B 1EBAA 1JHLH 4L4VB 3MNZA 3J7HA 3TO2B 3TT3L 5H35A 2YZ8A 1Q0YH 2W9EH 3IRPX 1FH5H 5HHPA 1OGAE 1BFVL 1ZHKB 2HMID 1GSMA 1PY9A 5IBLC 3UC0H 1FGVH 5IK3A 1KIQA 1G7MA 3CDGA 4JY4A 5C0CA 1OF2B 2MKWA 4K23H 4IRSA 3QISA 4TSCL 3AY4C 1U0QA 3MNZB 1Q9WB 5H35B 3BVNA 1CK0L 1QSFA 3U4AA 5I74C 5HHPB 4XPGH 2D7PA 4JDVA 2RR3A 5BV7H 5ESVA 1N4XH 3UTZA 5D7KD 5IK3B 1KIQB 3HS0A 1G7MB 1GL4B 5D72H 4PJHA 3UZEA 5A2KH 4JY4B 5C0CB 1C1EL 1V3KA 1DVFC 4XBEH 1OCWL 4YDIL 4IRSB 3SGEI 3SO3C 4JHWL 1L0XA 1VHPA 3BVNB 1QSFB 5FYJL 4WI8A 3I6LE 2R8SL 3T3MF 4JDVB 2R0LH 1FIEA 3X17A 5ESVB 1MRDH 1U2HA 4OZ4A 5ADPL 3UTZB 1E6JL 3U2SA 2Y4SA 3HS0B 1I7TA 4K71B 4JFHD 1F4XL 4J6RH 2HP4A 2MKLC 2ZUSA 3PHQA 5GZOC 4G59A 2DQDL 3MRGA 3ZE2F 1KF9B 1X3DA 3QULA 1M4KA 2FB4L 2ZPKH 2YXMA 2W38A 4LEXH 4AJ0A 3CK0L 2DLIA 4Y1AD 3SDXF 4MS8A 2JJUA 3QPQD 3ULUD 4XVTH 4L29A 4OZ4B 5F9OH 2XTJB 5C6TL 3SJVE 3U2SB 1I7TB 1ND0A 1MSPA 1BF8A 1JZ3A 4KZDH 3SDDC 4F7TA 1RSFA 4MXQC 4OB5H 3AC0A 1F90H 1T6WA 2ZNXA 2A1WL 3PHQB 4LVNC 3GMRA 3MRGB 4I9WD 4CL7A 3QULB 5CZVH 1QR4A 2ZOLA 1IAOB 3BH8A 4X4XB 4DW2L 3QWRD 1QLEL 1JNLL 5ADOL 4L29B 3CPLB 3DHJA 5IBUG 3TPKA 2DI9A 3B9VA 3MRQA 1BX2A 4F7TB 1CQKA 2AS5M 1YY9C 3ALXA 4L4VD 3LIZH 1ZEAH 3TJHA 3GMRB 3BDBA 3UX9B 2ZOLB 3BH8B 5JPMA 1ZLSL 5JW4R 2HT4C 4N5ED 1MHHA 2NY1D 4M1DL 5FUZL 5IV2A 5DD0L 3WNPA 4JFOA 1X5HA 4WW1A 2W1NA 3MRQB 5I71C 3HA0A 1BX2B 1GPOL 1A21A 1FZJA 2BNQA 2BY1A 1SJHA 1CLOL 5D1ZA 1D5XA 1PG7L 2J2ZA 3QXTA 5JPMB 2UV3A 1MHHB 3IJSA 3G5YA 5EH1A 4HV8A 1EV2E 5IV2B 1FO0A 4S2SA 5DVLA 5EA0H 4HKXA 2YSSA 4JFOB 3BDYH 4WW1B 2L7UA 3MBXH 3ET9F 1E6OL 1FZJB 2BNQB 4NQED 1SJHB 3TV3H 3T0AA 1D5XB 3TYGH 1QSFD 4K8RH 4PGJA 2GEEA 4ODVL 3MLVH 3O6LL 5I75C 4RGNE 5EN2A 4NZRL 3W2DH 3IJSB 4APQC 3G5YB 2BOBA 2AABL 2ZUQB 4PJIF 4JFDA 4HV8B 2NR6C 2D7QA 2D7TL 1FO0B 3N1MC 5FGRA 2Q8AL 2ZUYA 4LF3A 4HKXB 2YSSB 3JZ7A 2OL3L 3KLDA 2DIBA 4I0PA 1FDLL 1QFUH 2LTQC 4YFLI 3BP4A 4KI1A 5TQ2H 1A6WH 1JPST 5EN2B 3H7LA 2B1AH 3M8OL 4Z5RA 2BOBB 2NY3B 3HE7D 5DR5L 5JHDA 4TNVK 5GS0L 2XTJD 4XNUL 5DZNA 4LF3B 4CW1A 5E8OA 5C0EA 4I3RL 1J11A 4HWBH 5DI8A 5BV7C 1J18A 2ZKHL 3GBNH 2OK0H 3MOAL 1RZ7L 1X4XA 2ZUTA 3I9GH 1DZBA 2H8PA 4KHTH 3BP4B 1GGIH 4WI9A 1EGJL 3H9SE 4MS8D 4Z5RB 5JHDB 1LMKA 2YK1H 4YHZH 5I18L 3NH7L 1RQ5A 3SDCC 3L3JA 3WXVL 4CW1B 5AZ2H 5T3XD 5E8OB 3IU4L 5C0EB 1S9YA 4XWGH 3OF6A 3NA4A 4JDTL 5C7XL 2AP2A 1JZ2A 2FATL 3MV9A 4G80A 3QCVH 2ATPA 1MREH 5TH2A 1A9BA 4XMPH 5ID1A 4CU7A 5IEKA 3WIIL 4P4KB 1LEKA 4FQJL 1S9YB 1Q38A 3RWIB 5JIHA 5L2KE 1UCTA 5C2UB 5HI5D 3TJHD 5LJYH 4GXUN 4JO1H 1R3IL 4G8GE 3MV9B 3U7YH 4G80B 2C1OA 2ATPB 4OSUH 2VZOA 3QCUL 5TH2B 1A9BB 3BP7A 5ID1B 4HMDA 1HZHL 1KPUA 5A40E 4RIRA 1A6VH 2FL5A 2P4AB 3QH3A 2GQHA 3O9WA 2BNQD 3CLEH 1N6VA 5D1ZD 5K93A 2IAMA 4HUNB 1K85A 3TESA 5D7LA 3UDWC 2YPLE 2C1OB 3QIBC 3K3QA 4HLJA 1A1MA 1IAMA 3TN0B 3BP7B 1RZIA 3NGBC 2WSKA 1KPUB 4RIRB 4JE4B 2FL5B 5EUOE 4NM8L 4LRIA 3SGJA 3O9WB 4FQLH 4ONHA 3OKDA 5FGBA 4QTIL 3EYQC 3BJ91 5GJTH 3NFSH 4DKEL 1KCVH 5KVDH 5D7LB 1N3NA 2QQKH 4KGLA 1NCWH 3A6CH 4IM8A 4JFDD 5KOMC 4OLYH 1RZIB 2VXQL 3LEXA 4U1GC 3T65A 4LVHC 5HXMA 3WXWL 4D3CL 1CDJA 1L9NA 4O5LL 4I0PD 4Y4KD 4ONHB 4BM7A 3OKDB 1RK1A 4XMKH 4MJ6A 1HHJA 3B9EA 3HC4H 3BXNA 3MCLL 3IT8D 4TTDD 1N3NB 4ZOEA 4WRLA 4NZUL 2IMNA 1UEMA 4JO2L 5JHDD 1IEHA 5DQDH 1T0NA 5DGQA 4HK0A 3CNKA 1JGEA 3NAAH 3LEXB 4QGYA 3GM8A 3TZVB 1U6AL 3ZDYF 2Z31C 3T65B 1MCPL 2Q3ZA 2W07A 3KYOA 4OGYL 4LHJB 4YBLC 3PQYA 4B41A 1RK1B 4MJ6B 1HHJB 3P0VH 3BXNB 4KRMB 1BPVA 3W11C 2FECI 3Q1SH 3BZFA 1MCCA 4PGZA 1J0IA 3EO1A 4OLEA 1T0NB 4HZLA 1PEWA 3BOVA 4HK0B 3R8BB 2E7LA 1JGEB 1KNOA 4G7VH 4HGWA 3KYOB 1NCDH 2WBJC 2VAJA 3EW3B 3PQYB 4NQTA 4KDTA 1UENA 2XTLA 5DFTA 2VLKE 3MV9D 3EDFA 1A2YA 2QTEA 3V79C 3BZFB 3MR9A 12E8H 3EO1B 3IDNA 2EICA 1KNOB 1XGYL 4DN3L 1A7RH 3O3EA 4M43L 3PL6B 5HI3C 2W0LA 3QUYC 4O02L 3C5ZA 4DFHA 5GPRA 5C0ND 2VC2H 3WUZA 3OZ9L 5FA3B 4KUCD 3T09A 4F7EA 1A2YB 4Z7OF 4X7SH 3MR9B 3GMLA 4NKMA 3HE6D 3IDNB 2WQRA 1T89A 5JW4Q 3UBXI 4U6HA 1VPOH 3O3EB 1CDYA 4NQCD 5IFHH 2AVGA 3FB8A 2C5DC 1LO3H 3C5ZB 4M48L 2IAMD 4WGVB 1MI5A 4F7EB 5D7LD 2E9IA 3J8F7 2W0KA 4MCYA 3MJ9A 4OI8A 1UCBL 4F7CB 4PJCE 2NZIA 3MLYH 3QHZH 3GMLB 4NKMB 5LXGH 1F3JB 1J5OH 4XZUA 3NCYS 1B6DA 4U6HB 4HLZH 1NGPL 5AZEL 1RUPH 1P7QA 3FB8B 4AEFA 1JYWA 2AQ2A 3EJJX 5IFAL 5E8PA 3UO1H 1YDPA 1MI5B 1AO7E 4MCYB 5D9SA 4X9HA 2BVQA 3V52L 3UYRL 4EI5C 4PJEA 1BZ7A 4XZUB 3MV7D 3D87B 2HYMA 4BUGA 1P7QB 5HHVH 25C8L 4OIIL 2H41A 5E8PB 3ES6A 1YDPB 5ILTL 3RKDD 2EDXA 3RVVC 3EOBA 5D9SB 2BVQB 3DUUA 4H25A 3HNVL 4PJEB 2R2EB 1BZ7B 1FC1A 1NC4A 2AEQL 4OLXH 4YDVA 1WFUA 4XNYL 4QHKI 1RUQH 2VITA 4RAVA 5SX4H 1INQA 1U8IA 4UUJA 2N7BA 4RNRA 3WDHA 1EJOL 1M6OA 1KJ3H 5IMOA 3ES6B 4FQQA 1A7QH 4P2CG 3DUUB 4H25B 1TCMA 2DQTL 4JFFD 1NC4B 3DSNA 4Y0GA 4YDVB 4JY6A 4CNIA 4GW4B 2VITB 3BGFC 1UJTA 35C8L 5E7BA 5KSAA 4BZYA 5I76A 1HE7A 4RAVB 1INQB 1U8IB 4UUJB 4RNRB 4KQ4L 2PETA 3LH2H 1FO0L 4PB0L 4WUKL 5FHBL 5IMOB 2VQ1A 5GS1A 4Y5YC 4FQQB 4OLZL 1CR9H 1WIUA 3LKNA 4R8WH 1WCBA 3HNSL 1FFQA 3S35H 2FX9H 3MBEC 4M62H 4RMVA 1IC1A 4XNMB 4CNIB 1OAYH 5IWLA 1NFIA 1WICA 1SJEA 3FAXA 4JG1H 4OLUH 3K46A 2EIBA 1DBKH 3BIBX 3DYMA 1CIDA 5BVPL 5I76B 1MFNA 3C5ZD 3ULVE 3GMMA 2DQEH 1PX3A 4PG9A 1K8DA 4HHAA 5GS1B 2WZPD 3LKNB 3EZ8A 4NSKA 4HKZA 5J12B 1WCBB 3MRKA 4DQOL 4KI5D 2LAAA 1TQBC 4WGWB 3F65A 1KCRH 1SJEB 4XI5C 5CIPA 4PJ5D 3GMMB 1K8DB 4HHAB 2FEDD 3GUTA 1QLFA 3FB5B 4NSKB 3BKCL 4HKZB 1KEGL 5E2UH 2DBLH 3MRKB 5CHNA 4ESKA 5A16A 3W9DB 3VI4E 4ZO6A 1LK3H 1EHXA 2DTSA 3U7WH 1P7QD 3SKMA 4OCRH 5CIPB 3WLWC 1NGYA 2CUMA 1J1PL 1ZS8A 2WWKO 4P23C 4K94H 1JPFA 2AXFA 1P53A 4PBXA 5CHNB 3UYOD 3V8CA 5A16B 5KS9E 1G9ML 2V5TA 4JR9H 4UINL 1DQJA 4JM2A 5E99L 3WHE0 3QXDA 1G7LA 1JHKH 3DVGA 4M7ZB 1NGYB 1JWUA 2A6JA 2A77H 1CFQA 1ZS8B 4FXKA 3KYKL 1PSKL 3TT1H 2Z35A 1JGVH 2ICWJ 4G9DB 4RGNC 4H1LH 1JPFB 2OLDA 4ZUTA 2AXFB 1IT9L 5MHSD 1NC4D 5I30L 4ODXA 4QRPA 1WISA 4ZTPH 4JM2B 1AE6L 1OTUC 1SEQL 1MAKA 5I1KL 3I3BA 1RZKH 5I6XB 3QXDB 3U30C 1G7LB 5IHLB 4JRYA 1INEL 2VXVH 1BBDL 1RIHH 3DVGB 3G6JF 4FQXC 2A6JB 1JWUB 3WUWA 4UI2A 2NZ9D 4WW2A 1CFQB 4FXKB 4YFLF 1SM3L 2FJFA 2Z35B 2BVUA 3QIWA 1DFBH 4ZUTB 3EJZD 4ODTH 1PLGL 3C6LC 2VE6A 4Z7QE 4M8VA 2EH8L 1MCSA 4WI7A 3DX8B 5BZWA 2A9MH 2FYYB 4LASH 5GHWH 1V7NL 4ODXB 4QRPB 5JXAH 3RY5A 1CLZH 3PWNA 2BCKA 2UVFA 3STLA 2X4SA 4JRYB 5KSAD 4XNZB 1Z0MA 4IDJH 3WUWB 4OCYH 1NC2A 4WW2B 1I3GH 5MEPA 5I1LA 3GMNA 5DD5H 1NCUA 1ZE3C 3KDMA 3P9MA 5AYUH 5GRJL 2FJFB 4NO5A 4YX2H 3QIWB 2Y7QA 1SBSH 2VE6B 4PJFE 2QQQA 3FQTA 3OKMA 5BZWB 4KK5D 4GRMA 3ARRA 4Z7VF 1UH4A 1QHOA 3PWNB 3STLB 4LGSB 2KBGA 2X4SB 5ETUA 4PJIB 1FNFA 3EHBC 4PRIE 1UACL 5D1QC 1NC2B 3RRQA 3QO0A 1F8TL 2ADIB 5I1LB 1KENH 2LV4A 2NMSA 1WT5A 3DGCR 3KDMB 3P9MB 4NO5B 5LBSL 1KCSL 5GIRA 4JKPL 1UH3A 2JJSA 5C0IA 1JE6A 1QNZL 2Y7QB 4XPBH 3CGTA 2FBOJ 3WSQL 3FO9A 4GRMB 4LPVA 3W5MA 1CDBA 2YUZA 5TE6H 1QSVA 4OTXL 4ONFL 4PY8I 4GRLC 2NY6C 3KPRD 5J6HB 1YMHB 3QO0B 4YHLL 1DQDH 4PJ8D 2UZIH 5FYJE 3L3HB 5GIRB 4KPHH 5GGVL 1H15A 3ZKMD 5C0IB 3PDDA 3B9KD 4UV7L 1AI1H 1R24A 1DQML 3FO9B 4HFUL 1S7QA 4JCMA 4O4YL 2YD8A 5C09A 5CS7A 4UNTA 4LIQL 4U7MA 3JWOH 1G0YR 4FABH 2Q76A 4UBDC 4HKBA 1GGCH 5FGCB 1VGKB 3F7VA 3IDIA 2Y6SD 3JV6A 3H3KA 1JPTL 3VFGL 3VD5A 3R0MA 2D03L 5HDOA 4XPAH 3WO3B 1T03H 2ZUVA 1R24B 1PZ5A 3TNMA 2IG2H 3JTCA 2OTWA 1S7QB 2B39A 4JM2D 5C09B 2DN7A 4KKNA 5DJ2A 1GZPA 2ATKA 4FRWA 1F58L 4LSUL 1IVLA 1UFUA 3B5HA 2Q76B 4HKBB 4L9DA 5E1AA 3RX8A 4D9LL 3F7VB 1E4KC 5D2NC 3CUPA 3ME0A 4EXPX 3MRJA 1OAUL 4NUGH 1A6TA 4KMLB 1ZTXH 1ZLVH 4EQ2A 4IMKA 3UAJC 3NABL 4QLRA 3KXFE 4RMRA 5FXCH 1XGQA 1PZ5B 4K94C 5CEZH 1IJ9A 4LP4A 3TNMB 2OTWB 3P40A 4MJIA 5DJ2B 1GZPB 5I17A 2ATKB 5I8EA 5A1AA 4K3GA 2HTKD 2HFFA 5E1AB 4HIXH 1JRHI 4GG8A 3CUPB 3ARDC 3MRJB 3RVWC 2APBA 4NN5C 4P46D 2MMXA 2HWZL 2FBJH 4YXKH 1NBVL 1VFOA 3GO1L 2KH2B 2R56L 2HT3C 4YDLB 4KQ3H 5E2VH 1XGQB 3I02A 3VFTA 4L9LC 3TM6A 4MJIB 1OW0A 4KUCF 5I8EB 4EBQL 2AJYL 1ZLVK 2YD7A 2HFFB 1NC2D 5CZXC 4GG8B 2H2SD 2G60H 1RZKC 4LSVH 4ZS7H 1A3QA 3MYZA 3OKYA 4Z7NE 2VL5A 3VG9B 1JN6A 4Z7WE 3I02B 3FQWA 5K33A 1VESA 5I73C 3VFTB 1I3RA 3ARBA 3DJ9A 2EH7H 5DMJB 3JVGA 1I85C 4YQXL 2HLAB 3WS6C 2ID5A 2IBGA 2PXYC 1L4IA 4X4ME 1QBBA 4OF0A 4F57H 2VL5B 3FRPA 1JFMA 1FBIL 3H3PL 2ICWA 1JN6B 1BM3L 1MELA 4MXWH 4X6FA 3R0NA 1R5IA 1I3RB 3ARBB 2FR4A 2FCBA 4HPYH 4P5TD 5IB4A 4YJZL 3RNKB 4XHJC 5FO7A 2R0KL 4UT9L 4Z7UE 4LAJH 5KJRL 1P5UA 4Z0BH 1W0YT 2YBRB 1FSKB 3HPLA 1XGUA 2ICWB 4MX7A 2QADC 4I77H 1ZVSA 4N0RA 3RUGA 2JF1A 1G9EA 4X6FB 5HHXH 1OAKL 3ZDXF 4R7DB 1R5IB 5E8DH 2FR4B 5D8JL 1MF2H 2CJUL 1DSFL 4PJBE 5F6IC 3FN0H 5IB4B 3MV01 4KK6D 4M5YL 4X7FC 1XR9A 1SVZA 4PV8A 4O2EA 3Q48A 5ANMA 3VWKC 4FQHB 4ETYA 2CO7B 4LLWB 3HPLB 1XGUB 4MX7B 4QRTA 5IJVA 1ZVSB 3LKRA 3FFCB 1KEMH 2ZJSH 1XF1A 1MCFA 3MV8A 4H8WL 4YHNA 4OZHE 4OCXH 1LO0H 2AGJH 3T0EC 1XR9B 4PV8B 2BERA 3AREC 5E2TL 4O2EB 2BP3A 5EOQH 2EDKA 3MA9H 2ITDA 5IESH 1CXFA 5DMKA 4NM4H 5ANMB 1YEFL 1FL5A 4HXBL 4XB8A 3JWOC 1KBGL 2DTMH 1C7TA 3H9HA 4CU6A 3VMPA 2A6IA 4I2XA 4QRTB 2VUYA 5IJVB 3PWVB 5ISZA 4ZSOA 3LD8B 3LKRB 1KCUH 3B9AA 2YHGA 4D9RD 3MV8B 4YHNB 4MJID 3SOBL 1U8LA 3KYMB 2EE6A 4JB9H 1I1AA 2H9GA 2H2PD 3DETC 1ZGLA 5E08L 4NQDE 4WEBH 4L3CA 2ITDB 5HHMB 5DMKB 1FL5B 3S8WA 1I7ZA 5M95B 2A83A 1FAIL 3H9HB 2A6IB 3LN5A 4FQCL 4I2XB 5ISZB 5CJOL 3HAEA 4ZSOB 4L5FL 1EEUA 3TT3H 3W0WD 3CFIC 4TQEL 3E8UL 2VLJE 1U8LB 2XZCH 3MREA 5EU7E 1I1AB 2H9GB 2HT2C 2ZUUA 1I3UA 1I1YB 1ZGLB 2HFEA 4MZ3A 4FP8L 4L3CB 1HWHB 5D7IE 4PJAE 1FZMA 2JK5A 5JXED 3GSNH 3T08A 1I7ZB 1OB1A 2A83B 3LN5B 1MOEA 2P46B 5EIIA 4D9QD 4TSCH 1WZ1L 2ZG1A 4UILH 1C5DA 3TO4A 4YHOL 4KAQH 4JO3L 3MREB 5GGSB 1TJIL 3TVMC 3GI8L 1WQVT 5FM5O 2HFEB 1A8JH 2EKJA 5FYLL 1IAKA 1FZMB 2JK5B 1DQQA 4TVPD 1OB1B 1W72L 3WUWG 1OCWH 5EIIB 3Q2CA 2PTTA 4AH2A 3O6KL 1C5DB 2EZ0D 3TO4B 3VWJC 4G9FD 3WJJC 1LE5A 1C7SA 4NKIL 4JRWA 1EEYA 3MO1A 3S97C 2I9TA 4EKXA 1IAKB 4LCIH 4GXUM 3RZCD 2PKDA 3MRLA 3FO0H 1T1XA 2OX5A 1TQCC 2EDBA 2PTTB 4AH2B 4DGYL 1RURL 2FB4H 3ILQC 3NFPA 2C4FU 5CCKL 5F1NA 5FUOH 1ERNA 3GSOA 1LE5B 4L1HA 3OPZL 5LGKA 4TNWK 5C6TH 2Y5TA 1EEYB 2X1WL 3MO1B 4HS3A 4HS8L 4GXVH 2I9TB 1T7VA 2GK0A 3G9VA 3MRLB 1T1XB 2B5IC 2UUDH 3IFOA 3IJHA 4YH6A 4M6OL 4TN9A 3NFPB 4XMLH 4DW2H 3DMMC 1QLEH 2SEBA 2V7NA 3GSOB 5F1NB 2FDBP 5DFVD 1C5BH 2J88L 4TUOB 4CMMA 4M7JL 5BO1L 2Y5TB 3PJSA 4FG6C 4HS3B 4WFHD 5C0CE 1TENA 1X5XA 2N4IA 2GK0B 2YD2A 4G8FA 5KSBF 3IFOB 1BQSA 3SDYH 2YC1A 5E6IA 3IJHB 4Q9RL 1RK0A 4HAGA 2Y72A 5EO1A 3LMJL 2SEBB 2V7NB 4M1DH 1FNLA 5I9QC 5FUZH 4CMMB 1QBLL 3QQ4A 5DD0H 3PJSB 5CMAB 1H3UA 4Q2ZA 1KB9K 2UUDK 4R4NC 2HRPL 3MNVB 3F7YA 4FN0A 3VMNA 4RBPH 1GPOH 4KY1L 4G8FB 5IB3A 5DO2C 5E8NA 2CDFA 2R39A 1G1CA 2YC1B 4IS6A 1RK0B 3FN9A 3BKML 4ONOA 3QFJD 5MENA 4NKQB 5EO1B 1F00I 4NHCL 2FJGA 2JIXA 1HINH 2HLFC 1S78D 3QQ4B 3GEWB 1IE5A 1C08A 5L2JA 3UJTH 4Q2ZB 1EIBA 3ARFD 1VSCA 1KLGA 4LU5L 3F7YB 2JJVA 5DD6A 1J8HA 2VZ1A 4YPGA 4CJ0A 5IB3B 3HZYB 1S9WA 2CDFB 4GQPH 4IS6B 1LD9A 4X9IA 1IARB 4KKBC 5MENB 3TO4D 5ITFA 2C3VA 3HN3A 1HDMA 2FJGB 2JIXB 1Z9OA 2QJDA 3P0GB 4X7DC 3C8KA 1AD9A 3KPPA 5FYKL 2D7TH 5GJSL 2WLZA 1C08B 4N0YL 4RBPK 5L2JB 5F71A 4HDIA 2AJUL 1FLTX 3VXSE 5DWUL 1KLGB 4GS7B 1VADA 4L3EB 2QSCH 4DVRL 5JW3L 2EDHA 3LOWA 5CFHA 1J8HB 4YPGB 1S9WB 4FZ8H 1FNGA 5JO5A 1A7OL 4AL8H 2C3VB 2VJXA 1HDMB 4MCZA 4QWWC 5DR5H 3C8KB 3KPPB 3O4LA 3OKNA 4PPTA 4G7YL 5KOVC 5CD5C 4XNUH 4HDIB 1KT2A 1VADB 1QD0A 3CAFA 1D5BB 4R0LC 1A1OA 4CBPA 5C8JA 3MOAH 1F02I 5BW7C 4G6AD 4P2RD 1FNGB 1OSZA 5JO5B 5GZNC 4M6NL 5KSUA 5JQ6L 4LSSH 4MCZB 1K3ZA 3NH7H 3O4LB 3OKNB 3DYOA 1X9QA 1KT2B 1BAFL 3IU4H 4XC1L 1SY6L 1QPXA 3QUXC 5KW9H 1HKFA 1EO8L 4IJ3B 1A1OB 5L0QC 2XWJA 5C8JB 5FDWA 1NKOA 3LZFH 5IHUL 2EIDA 2FATH 1OSZB 3HLAA 5EU6A 3FRPG 5C6WH 4NGHL 3KLSA 1UXSA 1P9MC 4KJPC 2WWMD 3NIFE 4FQJH 4XHQA 1DR9A 5I2IA 3KJ6L 3CH8A 1BQLL 3SO5A 2XWJB 1AGEA 3Q6GL 1T3FA 5FDWB 1Q0XL 5B8CA 5E6ID 2VQTA 4Y2DA 3HLAB 2L0DA 5EU6B 4AY0A 1QSZA 1JFQH 1UXSB 3SDDA 1FVEA 4YXHH 3QCUH 4R97B 2EC8A 1FC2D 4PJGF 3B2UD 1MJ7L 1HZHH 3H42L 4QHKJ 2YPKB 3NCJL 5I2IB 1J05B 3ZKQD 1CICC 4JFEA 1AGEB 1T3FB 4PRHB 4WHTA 1Z5LA 2DLGA 2J12B 5B8CB 4Y2DB 4LSRL 2GJZA 4MNQA 1NCAH 1BJ8A 4OD1L 4PGEA 1FVEB 4K3JH 5DYOA 1XGPB 1I9JH 4F33B 1NANI 5JA8B 2DWEA 4M3JA 3WIHA 3KWWA 4XVSL 3X12A 3RWHA 5C0BD 4NM8H 4V1DA 3T2NL 3ULUH 4JFEB 1MLBA 3HKFA 4QTIH 4WHTB 1Z5LB 4M1CC 2ZZUT 4GJTB 2DICA 4M7KH 4BUHA 2GJZB 4MNQB 3IVKA 1U36A 4QNPE 2DLHA 4PGEB 1RJYA 4YK4C 4JQVC 1FJ1A 2VXQH 4NRXA 2DWEB 3KWWB 3MJ6A 4KTDL 5GGTL 3RWHB 3X12B 3WXWH 5DHVH 4UT6L 5LG1A 4O5LH 4V1DB 1X4ZA 3PGCB 2CO6B 1MLBB 4WU7A 4AZ8A 3VXUA 5I1AB 3OR6A 1P2CB 3A67H 3IVKB 5HPMA 3PGFH 2NY2C 4LNRA 3HAEG 1RJYB 4YFDB 5SWSD 4XC3L 3O4LD 1DN2A 4HIJA 4P2YA 1KTKE 1FJ1B 4NRXB 4PR5A 1D7FA 1YYML 1MCPH 1KN4L 3RWDA 2R23A 2X4UA 2MCPL 4OGYH 2WUCL 2CDEB 4AMKH 3O4OC 2FH8A 4P9HL 3WFBL 4NUJA 4WU7B 4FFZL 1A7NH 3VXUB 3OR6B 3GJEA 2X44D 3M1BA 3B2VL 5HPMB 5HHOA 3VRJA 1NBZB 4B0MM 4LNRB 3MRNA 1DVFD 3VFRA 4HIJB 1FV1A 2O5XL 2GYSA 4PR5B 1RZFL 4FOMA 4XNQA 3BP5A 3RWDB 2R23B 1CZ8L 1WTGT 2X4UB 5C07B 3B8YA 1U8NA 5HDLA 3K4AA 1DN0A 1NH6A 4RAUA 4NUJB 1YNLL 3RPIB 5H94B 4S1QL 5EU6D 3VXRB 1JCKA 3M1BB 2V2XA 3STBA 1VACA 3V6ZA 3VRJB 5HHOB 3MRNB 2AK4D 2Q7YA 3IDYB 3VFRB 4QY8A 4JLRA 1FN4A 1FV1B 2RFXB 4OQTA 4XNQB 1CE1L 1P4BH 4XRCA 4M43H 3BP5B 1QRND 4AK1A 1U8NB 1DDHA 2BFVL 4O02H 1ES0A 5EZOL 1DN0B 3BP6A 4RAUB 1NCNA 5GS3A 4MMXC 4Y2DD 2B8OT 3OZ9H 4FFYL 3TBWA 5IB2A 2V2XB 3NCEB 1VACB 1RZ8A 4KJYA 4L4TE 3SDDD 3V6ZB 4KVCH 4U1HA 1FP5A 2Q7YB 1EZVX 4QY8B 5B3NA 4HD9A 3OB8A 4R4BA 5I0DA 3ARGB 1CI5A 1BOYA 4XRCB 3ZE0E 3BYYA 1UWXK 5E1HB 4N0FA 1X6NA 3AB0C 1DDHB 1ES0B 3U0TA 3BP6B 3VFUA 3L3DB 4F8QA 4HBCL 1A6UL 4MNQD 3TBWB 3RI5K 5TPWL 4R2GB 1UCBH 1KLUA 1RZ8B 4KJY