1C16A

Crystal structure analysis of the gamma/delta t cell ligand t22
Total Genus 49
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
49
sequence length
260
structure length
260
Chain Sequence
GSHSLRYFYTAVSRPGLGEPWFIIVGYVDDMQVLRFSSKEETPRMAPWLEQEEADNWEQQTRIVTIQGQLSERNLMTLVHFYNKSMDDSHTLQWLQGCDVEPDRHLCLWYNQLAYDSEDLPTLNENPSSCTVGNSTVPHISQDLKSHCSDLLQKYLEKGKERLLRSDPPKAHVTRHPRPEGDVTLRCWALGFYPADITLTWQLNGEELTQDMELVETRPAGDGTFQKWAAVVVPLGKEQSYTCHVYHEGLPEPLILRWGG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords MHC-LIKE PROTEIN T22
publication title Crystal structure of a gammadelta T cell receptor ligand T22: a truncated MHC-like fold.
pubmed doi rcsb
molecule tags Immune system
total genus 49
structure length 260
sequence length 260
chains with identical sequence C, E, G
ec nomenclature
pdb deposition date 1999-07-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00129 MHC_I Class I Histocompatibility antigen, domains alpha 1 and 2
A PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1c16A02
3.30.500.10 Alpha Beta 2-Layer Sandwich Murine Class I Major Histocompatibility Complex, H2-DB; Chain A, domain 1 MHC class I-like antigen recognition-like 1c16A01
2V7NB 5F9JA 4JFPB 3INUH 4ERSH 3CDGB 3FONA 4X7TB 3P30L 3M1BA 5BQ7A 2NY5C 5JHDB 1YYMH 2GAZA 4NRYA 4AT6B 5CJ8A 1HNFA 3Q6FA 4Y4KC 5DHVB 3QRGL 4LSUL 3SPVA 2GT9A 3RU8L 1OP5H 4GQPH 5FO7B 3D0VB 1Y18A 1RUAH 4N0UB 5GRJH 3T0BA 2XWTB 1I7UB 2K3TA 3BP5A 1JZ6A 2F53D 4JM2C 3U82B 4AEHH 3CFIC 1YEEL 5LKNA 2VXUL 5D2LB 3GMOA 3WKNA 1G9EA 5DQJB 4M1CC 5INDB 4F7PA 4MDJA 3MV9E 2XY1A 4J1UB 3VFVB 3MLZL 5L2JA 4XC3H 1I9JL 4KPHL 5CSBA 3IRZA 1IEAB 4X4XB 1CCZA 1NC2B 4OFYD 5FUCE 1WFUA 3U1SL 4RFOL 1U95B 5ADPL 1WFNA 1NUFA 2IQAA 1KB5L 2B7DT 3D39D 4YNYB 4KHXL 4UB0L 5J1TC 2WWMD 1PEZA 2YD1A 3AREB 4HGMA 4LCIL 3CVIH 3HUJF 2D3VA 3IETB 4WTZA 4PRDB 4M7JH 2G60H 3ZHLA 2J8OA 2IBZY 5TE4L 4DCQA 5CSGA 4P57A 3LMJL 2CIKA 3N9GH 2JKXA 5FYJH 4N9GB 3CDCA 1GSMA 4HIHB 2CIIA 4QEGA 5EBWB 2A74B 3W2DL 1LVEA 4GRLA 2GJ6A 1NFIB 4LNVA 1UXWB 4ODUB 1VFAB 4FFYL 1QSEA 3BE1H 3ARDB 1HWHB 1JPFB 2NY5H 5F6HI 5SWQA 5CUSH 3KYMB 1FVCA 3VFOB 3ECBB 1M05B 3QIWD 1LDPH 2CXKA 2DQHL 4ACPA 1HI6A 2BZDA 4OF6A 5I1AA 3SDAD 1UM5L 5DR5L 4G6KL 3GSQA 2NCMA 5L88L 1ACYH 2QSCH 1MH5B 3JSSA 1KN2H 1SJEB 2BNQA 3WO4C 1JGUL 4K7PY 1X44A 3ZKQD 4HEME 4HFWB 5DS8B 3GJFA 1PYWA 4N5EC 5T1LB 1M7IB 5E2VH 3LHPL 4M93C 5K9KB 1VDGA 1JNLL 3MLRL 3NAAL 2A2QT 3OF6A 5I8EA 1DL7H 1KFAH 4MNQE 4I3GA 1ZLWK 5ESAA 1TCRB 2VRAA 4X8JB 2O5XH 2X6MA 2J3SA 3TA3A 1WIOA 1P7KB 1SVCP 1FRGH 4ZTPL 4NO0A 5FM5M 1X5HA 4V1DA 5KZCD 2PXYC 3QDJE 4XBEL 3WLWC 1L7TH 4X8XA 1PKQE 1T1XA 5ALBH 1ZLUK 4D0DA 4J3UA 2ICES 1FGVH 3RJQB 5HI5C 2GY5A 4Q74A 2RQ8A 3EBAA 5DF0A 5C71A 1EHXA 1ZWIA 1ZVSA 3OR7B 2EKSA 4AENB 3SQOH 4BUGA 5D1ZD 2FIKA 1NLBL 4P5MA 5E5UB 2DQCL 1MHPL 3GB7B 1UACL 4Z7VF 2LFGA 4L3AA 5IUSA 5IP4A 1A7PL 1MREH 3E6HA 3SKMB 1ETZB 4JFDE 3U6RB 3OB0H 4OZIB 3V0WH 3KYNA 3WS6C 3GO1L 1MJUH 1IGJB 1XGRA 2GSIA 3QEGH 4RDQG 3DX8A 4K55A 5FYLE 4PLKC 1EK3A 1KLFA 3FFDB 1CIUA 1F8TH 1HSAA 4P48A 4XTRD 1CS6A 3FN3A 2R15A 1AD0A 1J8HD 1JHKH 1U8KA 2A38A 1C5BL 3X13A 1X5YA 4NUGH 4YC2B 1L0YA 1SMAA 4JPWH 5HGBA 5HYQB 4JM2B 4N90D 1RZGA 3CSBA 5T1DL 4PP1C 3WD5L 5EOCH 4P59H 4XP6L 1FLTX 2MKWA 2UZIL 5GGRB 2XI9A 1A8JH 4JFQB 2NY0C 2FATH 3LRSB 3SCMA 1N64H 5D7JD 4YDVA 3S37H 5DJCB 4TQEH 4A6YB 3W9EA 2Z8VC 1OQXA 3J7HA 4FQHB 4P2QB 1UWEH 4PRBB 3QG6A 2FWOB 3ZDYE 3H42L 5E00A 2XKUA 1KXTB 1KC5L 1D7FA 5IVOA 5I76B 5T3XD 3RTQB 3FOMB 1CICB 1YNKH 2XNAB 3ARBC 4EDWL 3OKNB 4FMKA 4U1KA 1RURL 2CGRL 3PGFL 2GTZB 4QWWC 1JUFB 4Y2DC 3P4NB 1OAZH 1QNZH 1IEBB 2Q3ZA 3L3GB 2J8UB 1A6WL 3F12B 3RUGE 4OI8A 4EEEA 4OLZH 4L5FH 1BJ8A 4UTBH 3ZKSD 1XMWA 3L3HA 1RZIB 2HYMA 3EOAB 4MXQD 5EIVA 4PB0L 5IVXB 5D1XD 5HPOA 4FTVB 3EDKA 3UYOD 4X0KB 5TDPA 2WBWB 1XT5A 1ITCA 4DUWA 4Y16C 3VGFA 1I4FA 3BPNC 1WBYB 1RUPL 1QRNB 4X98B 3O0RL 2BC4A 5EO1B 2RHEA 3GI8L 4QGTA 4Q9BA 5E94B 1UB6A 2NR6D 4JFYA 4FZ8L 3BDYL 2FECL 5EU7C 5IQ9A 3DVNA 5EU3B 4NHUE 5FYJE 2HG5A 1TJIH 3LZFL 1P9MA 3QUZD 1U58B 2CDEA 3SQBA 5CWSB 1MVUA 3VW3H 3FB6B 1BFOA 1RZ8A 4TNVK 4Q2ZA 3FO9A 1NGXA 4LDLB 3C60A 4XPBH 2LABA 1I9EA 1B0GB 5JW3L 2HTLC 3IB4A 4LK4A 3IKKA 5IB4B 2VE6B 5KW9H 1BGXL 1MCOL 4M93B 1MFNA 2X05A 3RQ3A 5T3ZH 4R7NB 1FO0H 4JDTL 4K94C 4CADB 3PIQA 4M8VA 3HPLB 7FABL 5JNYA 4XCFL 3TV3L 4O4YH 3OBAA 1VGKA 3L7FA 4XNMB 2CDFB 3ALWA 4HLJA 5SX4H 2EIZA 4WY7H 3W11C 5E9DD 5E1HB 4Z78A 3SEPA 4YX2H 5MI0B 1QVOA 4R9HA 5DHYA 1MQKL 5INCB 4KK6C 4FQXA 2YPLE 4AL8H 4RMUA 4XI5C 3CLEL 5DRXA 1EIBA 4BFIB 5HHPA 1SEBB 2VL5A 1S3KL 4NKDA 1AP2A 2V7HA 1KIRA 4PJEF 4GXVL 3Q2CA 2D7TH 3RVXD 3QWOB 3U46B 3BGFB 3IAGC 5DK2A 4KRPD 5ESQB 4R2GB 3MXWL 2MHAB 5I66A 4MQTB 3GZKA 2AXHA 4QNPF 4QXGL 3O2DA 1U8HB 1VPOH 2NY2C 5I2IA 1J87A 4MJ6B 2C4FT 1T3FB 1LO2H 3Q3GA 3OJ2C 1NCAL 3BQUB 4HIXL 4LLDB 5CEXB 5I16B 1YY8A 5GGSB 2ID5A 5ACZA 2YD2A 1EJOH 3TBWB 1H9VA 4XPTH 1MRDL 4K71C 1GZPA 1ZEAH 1X3DA 2DL2A 4OCMC 3BEVB 4OTXH 4E41B 3ILQD 3M45A 5A3ID 1MIML 4AJ0A 1JI2A 2MQ0A 3VXME 4HC1A 3AROA 2JK5B 1A5FL 2DN7A 4P9HL 2CLZA 2NY0B 4OF8A 2YBRB 1X5GA 5TJWK 1QSFB 1FGNH 1CD1A 2LE9A 1EXUA 3PV7A 1CGXA 3FO2B 1G7HA 1KELL 3EO9H 4K7FA 4L4TE 4K94H 1ZVHA 3B9KA 4LPYA 3ZHDA 1QSZA 3I84A 4D9QD 1FH5L 3HG1E 3WN5C 1U8LB 4GAFB 4DKFL 1CBVL 1GC1L 4GG6B 2DBLL 3B9AA 4HKBA 2NZIA 4OD2A 5DJ6B 3BP6B 4LKCA 4ZTOL 5FYKL 2AI0H 2UUDK 4XVTL 4ZUSB 1N4XH 2HFFB 3RWGA 4DZ8B 3RIAF 4Z95L 1P7QD 2V9RA 2NNAA 4CJ1A 3HI5H 3HRZA 2C7UA 4PP2A 4XNYL 5J56B 1CL7I 4BFGA 2OK0L 5FA4B 1MCWW 3DTXB 43CAB 4TSBL 3UPRA 3K4AA 3IXTB 1UWXH 4XVUC 2DJSA 4K8RL 3O41B 2V17H 2VXVH 4QRSB 3EGSA 2WQ8A 4CVZB 5FV2A 1SBBA 2J4WL 5GHWH 1P4BL 4JE4B 1I7ZA 3BP7A 4Y16B 4XP9L 2DIJA 4ZO6A 1L7IH 4JLRB 3D3VB 2EZ0D 3DMMA 1MFAL 3NA4A 4Y1AA 4PJAE 2VDLL 3O6FB 1IL1A 4DKEL 5IB3B 5DK0A 5HVHB 4PRNB 2EO9A 3VD7A 1MCBA 5BJTA 3WNOA 3UXFA 3MO1A 3OKLB 5GIRB 4HH8A 3LEXB 2UVFA 4ZS7L 2BVQB 2QV2A 1Z0MA 3W9DA 1TETL 4PRHA 3NABH 4XCCL 4F3FB 5E2TL 3N06B 4DFHA 4X80L 1GVIA 1JNHA 2YD8A 3OPZH 4M6NL 5HPMB 4YWGH 3NIGE 4YO0A 3BPLB 5DVOA 4PG9A 3FB5B 2FEDD 1JI1A 5C0JB 5GPRA 4Q58C 5FYJU 1KIPA 3MC0A 4ZFOL 1WCBB 5JOPE 4UDUB 2KQMA 4M9OA 3IDJB 2IMMA 3AAZA 1ZLSH 2IFGA 4U6VH 1SYSB 4MAUH 4G8EB 2FH6A 1T1ZB 2E27H 1Q9KB 3DVIA 1RMFH 3ARTA 1JGEB 2YPVL 5TE7H 5JDSA 4ELMA 2R2HB 3SGDH 2OL3B 3OAUL 3KR3L 2JCCA 4G5ZL 4KXZI 4N0CD 2Y36L 2NXZD 4POZC 4KQ4L 5C07D 3SKUD 2ZUXA 3GSXB 4KDTC 3CZFB 3G6AB 4KI5F 5J89A 4UI2A 4L29B 3IDNA 3GSOB 2YD3A 4XBPA 1J12A 4NKOB 4G9DB 2QSVA 1CDIA 3FRUB 3HC0B 1MCJA 3MREB 2Y7QB 5HHOE 1S7SB 1PG7L 3WDIA 5MENE 2HRPL 1M6OA 3E8UL 1V3KA 2FB4L 3QCVL 1KTDA 4XMKH 2BX5A 2NY7H 1FNEA 3GUTB 4OV5A 2AV7B 5E2WH 5I15H 4JPIB 4J4PD 3WS3B 2PTVA 2YA1A 3NOIA 4MQ7B 2ICEA 3NIFE 1ZE3C 5TPWL 5E6YA 4XMLL 1HILA 1QFWH 4BH7B 1DBBH 2VLKB 3BSZL 1RZFL 3MV9D 4ZUUB 4JQVA 5DJYB 2B8OT 1G1CA 4FG6D 4EXPX 2IANB 1PSKH 4HKXB 4DJMA 4FFEX 2OJZH 4I3SH 4OQTH 1KBGH 4RGMC 1DBJL 4FQQB 2DMBA 2DICA 1WTGT 4NQCD 5FUZL 4JR9H 5AZEH 2ITDA 5D72H 3VMPA 4YHKL 2A6JB 2EE3A 1JRHL 1ZHBA 3KWWA 4PY7A 5EU7E 5F7UA 4OAWA 4EUPA 4ONFH 3K4ZA 4UU9A 1R3JA 3GMQB 4DK3A 3WN5B 3BRFA 5I19L 2ZZUT 3EYUL 4P4KD 3DRTB 1MQ8A 4HS8L 4ZO9A 1FL3B 4OFKA 2C26A 1QLEL 5IF0B 5ENWA 1Q1JL 3HI1B 5IOPB 4QRRB 4L3EA 4DUVA 4R8WH 1T04A 2DL9A 3ULSB 2GSGB 1V7NL 1VHPA 5D7SH 3W81A 3UPAA 1EAPA 1IGYB 2AKRA 3VMNA 4X6DF 2VWEC 4G3YH 1NBZA 2F53A 1CE6A 3ZYJA 4GOSA 2FJGA 3HE6C 1EGJL 4RGNE 4GAGL 1UQSB 32C2A 1AI1L 3DROA 2FCBA 3BPOB 3LKPA 2HJFB 2H9GB 4PLNC 4NWTH 4WWKC 5IFJA 1N2RB 4PJFE 5E6ZA 5JOFB 1G9NL 3NCCB 3CMGA 4M5ZL 4AEIL 3UPCA 5DGRA 3BXNA 4R7DA 2PW1B 3OAZK 5IROA 4AQ1B 3LEYH 2ILLA 4L1DA 2W9LA 4OFYA 1WTLA 1ZGLB 1VADA 3WHE1 5KVEL 5B39G 1YEHH 3CJJA 4FQLL 2V2TB 2EKJA 1JYWA 2NLJA 3D39A 5D96C 4PV9A 5FGRA 1FFNB 2YD5A 2BOCA 3IS1X 3TN0B 1DQJA 4LBEA 4NM8L 4PJBA 3WE6A 4YHIB 2MQ3A 1OAYH 5FDWB 5I17A 4K3DL 2DTML 5E70A 3MOAH 3P3YA 3K46A 1A1OB 1TQBB 5I73B 3NA9L 1UB5B 1BOGB 3STLB 2AJSH 1BFVH 3EJJX 3HCVA 3RWEB 3PL6C 3W0WB 5EOTB 1N3NA 4JO1L 3OKEA 8CGTA 3B5HA 4QRPE 1KN4H 4FQPA 4MNHB 3EDEA 2O61A 2NW2A 3BHBB 3PABA 4KAQH 3L3KB 4I0KA 2FJHA 4IBLT 4MCZB 4YAQB 1NC2D 4MJIE 1D9KB 1ORQA 3QIWA 4PJ8C 25C8H 4G59A 1XFPA 4ONOA 4P9ML 4DW2L 5L8KB 4JFDD 4LLQA 2EDQA 2C3WA 2EYTA 2Y25A 4K9EC 3AVEA 4NRZB 1F6AA 1JTOA 4OUOA 4Y4FC 1YPZB 2A9MH 2FIRT 2NX5E 1GHFH 3MGOB 1R5WB 2Q86B 4WHCA 5GS0D 3QPQD 2JJWA 2VAAA 1Z3GL 3UJJH 1U41A 4H5SB 2YXMA 4N0YH 4AYFA 3HUJE 1EFXB 4HT1H 4ZG1A 5EZOL 1XR9A 5I8KH 4JAMB 3VFMA 1T5WB 4CU6A 3U7AA 4ETYA 2LAGB 1JYNA 1N6UA 1CU4L 1CGWA 3D48R 4FFVC 2B1HL 3O6LH 3HMXL 2VLJE 3U0PB 5CIPA 3QFDA 3O9WA 4ESKA 3AS3A 1AGBB 1KLUB 4FP8H 4G6MH 1YNTA 2XPGB 3MRNA 4QTIL 3TH2T 2CMRL 1EFQA 3JBG7 5JXEC 4ORGB 5C0AB 3KJ4C 3RX5A 4MVBA 3MCLH 3CPLA 4LL9A 3TZVC 4QXWA 4ZFFA 5DJAA 5F1IA 1UM4H 2Q3AA 3MUGB 4JDVA 5I74C 4XP5L 2Y07L 4LSSH 2WBJC 2R1XB 3MGAA 3FHQA 1S78D 5T1LD 5D1ZA 1P4LB 3R8QA 3HPJB 4ZFZB 5C9KA 3ZDZF 3BVNB 1VB9A 4Z8FH 1WBZB 1HDMB 4KU1A 1AQKH 3ULVF 4PD4K 3ZSTA 4QHNB 4AY0A 4HGWB 3C2SA 3BZFB 4I48B 5F9DC 2C4XA 4Z76A 2EDLA 1UH2A 4I0CC 1JF6A 5EUOB 1EAJA 3C5JB 4UOW0 4BZ1H 4RZCA 3B2UD 3QEHA 1CLOL 5CZVL 2A0LC 3DX6A 1B2WH 2UWEF 2F58H 3BWAA 2R69L 3MLXL 2CJUH 3OV6A 5DD1L 3UDWC 4JZOB 3ARFB 3BDXA 4LAQH 4GLRI 3S37X 2IBZX 3VG9C 1Q9WB 4XP4H 5IV2A 1SYVB 4K9EH 1I3RA 3MRCB 1S5IL 2Z35A 3V4VH 1IGTB 1D5MA 3CFJA 4GBXC 3VXPB 3MBED 4WWKB 1IAOB 5IR1B 1OTTD 5F7WC 1T2QH 2OZ4L 3OMZA 4UINL 2D31A 4LPUA 4OI9A 5F72S 4PJHA 4B0MM 2IADA 4D8PB 1YN6B 4XVJL 4MAYC 5IG7A 5C2BH 5GGUA 4Z7VE 1A9EB 3G6JA 1IGFH 1A4JA 4K7PX 4Z9KB 4PJCF 1J9CT 4QYOB 4Q9QL 2DM4A 3GIZL 4IJ3C 2AS5M 2V2XB 4ETQA 3HFML 3ZKNC 3OAYH 1WZ1H 1SBSL 3EO1A 1C1EL 1E4JA 3FQRB 4XBGB 2Z31B 4JM2D 2IFFL 4YFDB 2LVEA 3UEZA 5D8JH 5HHVL 3MJ9A 3VXSE 1F4WL 4WW1A 1LK3L 1D5XB 4M1CD 4MMZC 4M1GL 4CDGC 2IPTL 2Z8WC 4MXQA 1L6XA 3PL6B 1SJHB 4YHYB 2J6EH 5D1XA 3WKML 2AEPL 5D7LB 3MRLB 4FXKB 1IKNC 4WCYL 3TNNA 1ZSDA 5C0EA 5C0CE 2XWBB 4XNZB 4LPXA 1I1CA 2BHUA 2V2WB 3S98A 4CRPA 4N8VB 4PJ8B 1G0XA 3RTQD 1EHNA 5EBLB 3VFRB 4IRSB 3IDMA 4XPGL 1CZ8L 3RL2B 4KI5C 4IOFC 5CP3H 3GMMB 2DLEA 2Y9RT 3DI3B 3GIVB 1UZ6F 1VFBB 4BKLB 4CMHC 1X5FA 4UNVA 4Q6IA 4V2CB 5A2JH 1OD9A 4MCYB 4JVUA 4MXVF 2PKDA 4ODVL 4HV8B 5E8NA 5EU5B 4FQIL 4FFWC 4KJWC 2OSLA 5AZ2H 3BJ91 5GJTL 2EO1A 1CYGA 3MUY1 1F11A 1AHWB 4WHTB 3DURB 3FFCE 1AO7E 3EKCA 3HB3C 2VDNL 2I60H 1F6LL 1T21A 2O26U 3PHOA 2VWEE 1IQWH 2G9HB 3MJ7A 2ZUTA 3VRJB 3KPOA 5E9DA 4WEUD 1C8PA 1ZTXL 1UKQA 1SM3L 2DQJL 5C08E 4Z5RB 4ZXBA 1T0NB 3OHXA 1VSCA 3HG1D 3L3IB 4X7EC 3SDXB 1UC6A 3TZVB 3S5LG 3FQTB 4UAOC 1IAMA 5C0BA 3QXTA 1S7QB 5IW1A 5JHLL 2EXWC 1GOHA 3P9LB 4JHBA 4U3XA 1JK8B 1OF2B 1FIGH 2GQHA 5DFTA 5DUPL 5HBBA 4FZEH 1CI5A 1RIVH 4KZEH 4NZUH 4XC1H 1KULA 4YFLI 1XZ0B 4K23L 3MGTA 4JKWA 4F57H 3DYPA 3F58H 2JB6A 2Q7YB 4OSUH 3FAXA 1A6VH 5JPNA 2PXYD 4GRMB 5CZXC 3REWA 5GQBA 5IMMB 1CQKA 1JGVL 1FLRH 3OKYA 2LTQC 2E7HA 4HHAA 3V4UL 4B50A 1MWAA 4Z7UE 5MEQA 5HI5D 1X9QA 2PO6A 1KCUL 1U2HA 3HI6H 3K2UL 3NZ8B 4JGJA 1HXMB 2QLVB 5EC1A 1BVKB 2Y06L 5KJRH 4PIRF 5F1OB 5IW6A 2OI9B 3F7PC 4MNGE 1KENH 4R2GD 4CN1A 5JLZB 1DQQB 5JR1L 3ZYOA 4PJ9B 1ZVYA 5D2NC 3VWKB 3BYTA 4MAYB 4TUKL 2DQEH 5ABDE 1RHHB 2FGWL 2I5YL 2AEQL 3H9SB 4L9DA 4PJEE 2X4PA 1PEWA 5LQBH 5GGTH 2FO4A 3AY4C 3I50H 4GW4A 4PJ5D 2OS7A 4GKSA 4PLKD 1FZKA 4J6RL 4JZNA 4QNPE 4M7KH 4IJ3B 1FNLA 3NIDE 2XZQL 1D6VL 1T1WB 2DQGH 3G6DH 4I77L 3X3FH 5JOPD 1O7VA 4HEPG 2WINB 3HA0A 4TVPL 3JXAA 5T3ZD 4LCUB 1G7MA 2DLIA 2V5TA 4PP1D 3ARVA 4NC1C 4MS8A 3ZZ1A 4MNQB 1R5VA 1MNUH 4RIRA 3TPUA 3E2HC 4HF5L 4LVOC 4X7CC 5TQ0H 3WJJA 2NY0D 4L9LB 3CC5A 4Y5YA 3ARSA 1A7RL 3RWHB 5B8CC 4F8QA 1OTSC 1P84J 5L7XL 1NGWA 4HUXA 1NL0L 4WW2A 5CGYC 4OIAA 3I3DA 3U0WL 1IC7L 4EXKA 1MCPH 1JZ5A 4NQXA 5EZIH 1HEZA 1LQVA 2BVOA 4I13B 3H3PH 2E5EA 4YHNA 2B4CL 3ARBD 4DVRL 4IIQC 5DHXB 5HHOD 1NMBL 1I7RA 1EZVY 4QWWD 5KSUB 1UA6L 4YIQA 5MP6H 5SV4A 1QOKA 1CT8A 4NJ9L 1FNSL 1Q8MA 2C3VB 2IQ9H 2APTA 3L5WA 1FDLL 3BIAX 1RUQH 4LPTA 3S34H 4AEEA 3U9UB 4Z7QF 3GKZA 1HHKA 4QCIA 3SKJL 5ID1B 4IRZL 5L2KD 2BFVH 1A0QL 1RFDH 3N0PB 1RJLB 2YWZA 3MV7A 1FL5A 2AK4B 5F7DA 1QYGL 5GZOC 3QXVA 4K2UL 2VITA 3TLRA 3RNQB 4OF5A 3K8LA 4Y16D 1OP3H 1YN7A 3UJIL 3S4SG 3T8XA 1DUZB 4TSAL 2AW2A 4KTYA 2O5YH 1UJ3B 1LP9F 4F58L 4P5KB 3QNZA 5E1AA 4KVNL 4QHKJ 3O6FD 1WEJH 4CVXA 4J2XA 2ZKHL 5DGQA 4QXTA 4HUMB 4P3DA 2J88H 5DJXA 5IT2H 5ERWB 4UAOB 1BQHA 2G5BB 3I02B 1CQYA 1HWGB 2P5EE 3RY4A 1NGPH 4YHML 4N0CA 1C5CH 1LHZA 2ZUVA 3HZYB 4XPFL 2HTLD 3HZMB 2YA2A 2AXJA 5DO2C 3THML 3RWJA 1UWGH 1FYTB 4PGDB 3LV3A 2CH8A 3GNMH 1G7QB 3EO0A 3PP4L 5HHMB 3ULVC 1U8JB 4JG0L 3T77A 5I6XB 1DQDH 4Y7MA 4JY4B 1DVFB 2FECI 3D9AL 1ZXQA 1F3DH 3OJVC 4YDKL 1H3GA 3BRGC 3EYFB 1WQVT 4PJXB 4AIZA 1E6JH 5TF1H 1W72A 3W11D 1IGIH 2IGFL 3QNXB 3QISA 1BAFL 2P8MA 5CLTA 1OPGL 5H8DA 2F54E 3QXWA 3ILPB 4ELKB 4KK6D 2LTQB 4PB9H 4P2CG 1G6RB 1S7RB 1FORL 1SY6L 4XI5D 3CVHL 5ANME 4J3OC 1QA9A 3AU1A 1ZA3B 5IFHL 2GUOA 1QLRB 5HGAB 2C1PB 3QULA 5HJ3A 1Q0XH 1KG0B 2BMKA 4P5TC 3VGAB 4NQCA 5HGDA 3BGMA 5CMAB 3CFDB 2E7LC 3KNBB 2YR3A 5D9SB 1UH3A 4IHOA 1HYSC 2X9WA 1W0VB 5DD0L 1YEDB 5T1MB 12E8H 5E8PA 3WLBB 4G9FE 1KPUA 1RJYB 1EEYB 2JB5L 2OX5A 1MAML 2NYYC 4XPHH 1C12B 2NY2D 3DSNA 3MV8B 4JFOA 4HJ0C 4NHCL 4O58L 4JFZL 2OTWA 3MA9H 1K8DB 4P4KA 5DI8A 3LQZB 4OGAC 5E56A 2D7QA 3MFGB 1RIUH 4KRLB 4M03A 3PWPB 2VLKD 2N7AA 1X5JA 1J8KA 1K4DA 4M1DH 4G7VH 2IAND 3DUUB 3WFEL 5JOEA 3VE0A 4HKZA 4QKXB 1MHCB 3CSYB 1BBDL 2FDBP 2Q1EA 4KKAD 3CX2A 2HH0L 3B5TA 1YY9C 5L0QB 3C2AH 5DRZA 1V3JA 1R3KB 4HDIB 3U2SA 4YK4B 5TH2A 2ZOKB 5DZNA 5IB5B 3QO0B 4IMLB 5B8CB 3VI3F 1IZKA 3FB8B 1AE6H 5M94B 1OB1B 3QDME 4D3CH 4JFXB 3RA7H 4NDMB 4WFHD 1A3LH 4MJ2A 2NX5D 2V7NA 5IHUL 4PJIF 4JFPA 3CDGA 3MLVL 4OIIL 4X7TA 2Q20A 5JHDA 4RX4D 4IIQB 4WVRA 4AT6A 1U93B 1IGML 5DHVA 4MGXA 1NCWH 2RBLA 2BSTB 2X89D 4NNPL 4HK3N 5FO7A 4HSQA 4D0CB 3D0VA 3QEQB 3VXRB 3UC0L 4N0UA 4XVUD 4JB9L 2XWTA 2VLJD 1I7UA 4YQXH 3CU7A 5D2LA 1EEUA 5DQJA 2FGZA 5INDA 4IDJH 1ZMYA 1WK0A 1CXLA 3GRWH 4J1UA 5FIEA 3NTCH 4Y8AA 5J06A 1S5HB 3VFVA 4LSVH 1YEKL 5DK3A 4U6TA 2LV4A 3RVUC 1IEAA 4X4XA 1NC2A 1OGAB 3ROOB 3CXDH 2WUBL 1U95A 3NPZB 4ZS6D 2P43B 4AH2B 1H3VA 1MRFL 3LVEA 3V2AR 4XMPL 4YNYA 3CX5K 4Q7DA 3RWIB 5I8CB 2N4IA 3ARXA 4XX1G 5HDQH 4GO6B 5GGVY 3AREA 1F4YH 3TT1L 3IETA 2UVEA 4PRDA 3LKOB 1YEGH 4KY1L 4PP8C 3V4PH 2ERJC 1N6VA 1NEZG 2Y5EA 4X9GA 1MF2L 3KXFE 4ZOCA 4N9GA 4HIHA 4XHQA 1GPOH 2PR4H 3MRDB 4D2NA 5EBWA 2A74A 4WU7B 2YHGA 5AG9A 3UTPD 1NFIA 1F4HA 1JFQL 1UXWA 4ODUA 1VFAA 2VYRE 4H88L 2XA8H 2J5LB 3ARDA 1JPFA 4KUCF 4PBVC 3H3BC 1D9KD 3KYMA 3MSPA 5MHSE 3OL2A 3QXUA 3E0GA 4RISH 3ECBA 1M05A 3VFOA 4POZD 5ALCH 2AABL 4XHJC 3VXUD 4D9RD 1JWMB 2R4SL 4OD3L 3QXAB 1SJEA 3ZE2F 3N1PC 1RULH 3V5KB 2PYEB 4ELMF 5FO9B 1YNLH 2VQTA 5D4QA 3PGDB 3HZKB 3F6IA 3NH7H 1J1PH 2JCCF 2X09A 4U49A 2XYCA 5LGHH 4HFWA 5DS8A 5EU6D 5T1LA 1M7IA 2QEJA 5K9KA 1TFHA 4WTWA 1X6LA 3P77B 2Q76A 1SEQL 4XPAH 3FZUC 1RIHH 5HYSG 3BX7C 3U48A 4I8DA 4PJCB 1TCRA 2FZ3B 1EFXD 4FQCL 4X8JA 4NM4H 2XA3A 3U0TB 3VFGL 3V0VB 4KZDH 3VXQB 4WIQA 1T2XA 1P7KA 1F42A 3VMOA 1TZIB 4MA8H 1KT2B 2EDWA 3QUMB 5SWSE 3ULUC 3O4LB 4R26H 3PP3H 3ZTJH 5GS2H 4ALAL 4GAYB 4DZBB 1Q0YL 5MERB 5C0AD 1YYLH 4AQOA 3D1MC 4HUVB 4R4FL 3UBXI 3D0LB 3K1KC 1VERA 5BMFL 1C16B 3MODH 1SQ2N 3OR7A 5E4IA 4AENA 3U7WH 3NCJH 4EI6B 3OB8A 2ADFL 3GJFH 4R6UA 3GB7A 2ZUYA 5C3TA 1KJ3L 2CKBB 1NUGA 4MD0B 2XTLA 3SKMA 1ETZA 3U6RA 4OZIA 3N85L 3ZDZE 3OJDB 1IGJA 4HUKB 4UILH 1U36A 2YD6A 3FFDA 3BZEB 1AGCB 1B90A 3QDHA 4R4NC 1QG3A 2XQBL 4GW1A 3MLWH 4YEEA 1NKOA 4ODHH 3WIIL 3SDYL 1AO7D 4EBQL 1JPST 4PGCB 4EI5C 4OFVA 1VENA 5HYQA 4JM2A 3TWCL 1V7ML 2DD8H 4I1NB 3HE6D 2O5ZH 2UWEE 4KROC 1QHPA 1MFEH 4PJGE 3IFNL 4QXUL 2WUCH 1NFDB 5MENB 1Z5LB 5GGRA 3SE3A 4WWKD 4JFQA 3LRSA 3L7EB 2VH5H 4NQDE 4OLVL 5DJCA 4A6YA 1D5IH 3T3MF 4FQHA 5C0IB 4PRBA 1T03H 3L3DB 2FWOA 4LF3B 5E08H 3MNZB 2QR0B 4WENB 2FBOJ 4HXAH 4P4RB 1CDUA 4FQ1H 3RTQA 5I76A 3FOMA 1CICA 1QKZH 2QADC 2XNAA 1N8ZB 3OKNA 3RBSA 1X4ZA 2ESVB 4H1LB 1N59B 3BUTA 2GTZA 1JUFA 1QBBA 3C60C 5T3XL 3P4NA 2HWZL 5TGBB 5A43C 3L3GA 1IEBA 1EO7A 2J8UA 3ALPA 4QF1B 3F12A 4M7LH 4DTGH 1BLNB 3SOBH 3TO4B 4LLUB 4KJPC 1RZIA 1NC4B 2ZCHL 4PJBF 3JWDH 3EOAA 4YHOH 3FMGL 3PL6D 2XICA 1FSKC 1KJ2B 3V6BR 1F97A 1TZGL 5FKAB 5IVXA 3OJMB 4FTVA 5T1KB 2ZCLH 4X0KA 5TFSL 3V52L 2ZOLB 3HNTH 4X7FC 4UIKL 2XKSA 5A16B 4TSCH 5IBTH 1WBYA 4AK1A 1QRNA 4X98A 2VIRB 5EO1A 3VFSB 1UT9A 1TNNA 4QGYA 2WIMA 5E94A 4OF3A 4P46C 2MCPH 3KJ6H 1M4KA 5JW4Q 4PJ8D 5EU3A 1U3HB 4WHYH 4IRSD 5I0ZA 3WNMA 1NEUA 4FQXC 4PLJC 5JPMB 1U58A 5CWSA 4TNWF 3ARUA 3FB6A 4JO3L 4Y4FD 2R0WL 4BSWB 4PPTA 4JPKH 1B0GA 2NY6C 2VB5A 3LRGA 3ZTNH 5IB4A 2VE6A 2WWKT 5GGQL 1NLDL 5DUBB 1TJHH 1QUNA 3D25B 4R7NA 3S88H 5AWNH 4CADA 5DLML 1UZ6E 2GW5A 2HMIC 1CXIA 2A1WH 4MXVE 4JPVL 3HPLA 1E4WH 2YUVA 4XNMA 4FFVD 3LEVL 1CGYA 4YBQC 3DV6B 5BO1L 1QTYT 1ND0B 3ZKMC 3WNLA 5H2BB 1NMAH 3GBNL 5JXED 1Q72L 3GKWL 4WTZG 1URLA 4XCNB 5INCA 1NKRA 3CX5J 1NANH 1YMMB 2Y4SA 3GSWB 3TZVD 1FZJB 4PRPD 2HKFL 1JHTB 3GHEL 3QH3B 4QHUA 2ZUQB 4JFFB 4BFIA 1SEBA 2EDBA 2GJ6E 4FQ2L 4NN7B 1KB9K 5BS0B 2GK0A 5DJ8B 1QSEE 5FFLA 3QWOA 3U46A 1BIHA 2XY2A 5EORH 4NSKB 2I07B 5ESQA 4ZD3L 2MHAA 4Z0BL 3ZTJG 4FABL 4W68A 3P4MB 3DETC 4CVUA 3A6BL 3U4BL 3B9KC 1U8HA 1YEIL 3O3DB 2BNQE 4MJ6A 5DVLA 2ATKB 1DQLL 1IC5L 4KKBC 1T3FA 1EX0A 1V3LA 2WP3T 1DCLA 3BQUA 4YLQT 4LLDA 5CEXA 1FV1B 3MFFB 5GGSA 5I16A 1CWVA 2A0LD 1I1AB 4HCRL 4YXHH 3TBWA 4OCSH 5C7XL 5KS9E 3IFOB 3JVGA 1BWMA 5KVDL 4EI5B 3LKQB 3TBSB 2EECA 4CDHA 4DAGH 3VGHA 2NQCA 3RBGA 4FRWA 4LCYB 1PJ9A 3BEVA 2W9DL 2X1QA 4FFZH 4X9IA 4BQBA 1GGIH 3R1GL 4AG4L 4LQ1A 4GBXD 3WXVH 2JK5A 4NZRL 5A2LH 5KBNC 4V1DE 3OKOB 2YBRA 3BN9C 1KCVL 1LP9B 3HZVB 1QSFA 3KDMB 2CDGB 3FO2A 3VFWB 2VLME 5LCVL 4MAYD 3DXAB 3VD9A 1LEKB 3H9SD 3IDXH 3O2DH 5K9QI 1E4KA 1U8LA 1INDL 4GG6A 1R3IH 3DMMC 4G8IB 1UKTA 5DJ6A 5ITFB 2C5DC 3BP6A 4PJHF 5EZJB 4ZUSA 2HFFA 4DZ8A 3EJZC 3C09B 3BH8B 1TMCB 2DQDH 3RPIB 2BVUA 3G6JF 2QQKH 3P30H 2AJZB 3T4YB 4OD1H 5IB1B 2BRRL 4MD5B 5FA4A 3DTXA 43CAA 4NQSB 3VCLB 4AIXA 3IXTA 4RNRB 3O41A 4M48H 3NVQA 4HC1H 4QRSA 4CVZA 3T0WA 3P9WB 1HN1A 3B6SA 4GQ9H 1NJ9B 4H20L 4M6MH 2F8OA 4GAJH 1ZANL 4U6XB 2N1KA 1AFVL 4Y16A 3WMSA 3QQ9C 3TT3L 4JHWH 4YXLL 5F9OH 3F8UB 1S7UB 2VXUH 1U42A 2X4UB 3DO3A 4JLRA 3KLHC 2EDOA 3D3VA 4P46B 2YRPA 5HHQB 1OAXL 1I9RL 1HKLL 3O6FA 3P40A 5H94B 3SE8H 5IB3A 4PRNA 3MLZH 4OJFL 4KI5D 4IOFD 1P4IL 4KPHH 3OKLA 5GIRA 3LEXA 2ENSA 2BVQA 1RU9L 1CGTA 4LIQH 3MBXL 5DQDH 4UT9L 4YH6A 4KTEL 5CINL 4F3FA 1EEZB 5BZDB 4FFWD 5DDHB 4KJWD 1A3QA 3FO1B 5HPMA 3VFNB 2AK4D 3FB5A 4U2YA 1LWRA 3FB7B 1LD9B 4WHYG 5C0JA 3WL9B 3KYOB 1WCBA 1J0KA 4HWNA 4LCIH 4UDUA 3HB3D 3IDJA 5I1JL 2WQRA 1SYSA 4NN6B 2P47B 1X4XA 3RX7A 4G8EA 2VKXA 1T1ZA 5TE4H 3OG4B 1Q9KA 3LN5B 1UENA 4POYA 2IH1B 2HKHH 1JGEA 1EV2E 1YUHB 4JQVC 2FD6H 4GH7B 3W2DH 2WIIB 2R2HA 2JIXD 1MHHB 1RZJC 2OL3A 5B21A 1CFSB 2BDNL 1TTUA 4XNQB 4FQJH 3VXSB 3UYRL 1KCSH 2EXWD 1B4JL 3GSXA 3BKYL 3S35H 5C8JB 1FYTD 2KZWA 3UTQB 3CZFA 1AXIB 1AY1H 3G6AA 4GUPB 3RDTB 2R0LH 4HPYH 1PY9A 5H37H 1HQ4B 1UM5H 5T5FL 1MCDA 4G6KH 4L29A 1FNHA 5D6DC 5L88H 3GSOA 1ITBB 4PJIB 1FNFA 4NKOA 4G9DA 5F70A 4HIJB 3FRUA 3HC0A 1Z9OA 3MREA 2Y7QA 4HKJB 2OYPA 2FBJH 5T33L 4IMKA 4U2ZA 1S7SA 2VDQL 3X12B 3AFLA 8FABB 3GUTA 1EZVX 2AV7A 5CILH 1JNLH 1K3IA 4JPIA 3WS3A 2R9HD 2YD4A 5KANI 1AR2A 3U9PH 5D7IB 5J11B 4AZ8A 4LSRL 4BH7A 2H6PB 1I3GL 2VLKA 1D6EB 4ZUUA 5EA0H 1TITA 1TVHB 3HKFA 5DJYA 5IEHB 4WWID 2IANA 1JVKA 1KB5B 1UZ8A 3SDCC 5I1GL 3WFHB 4HKXA 1AJ7L 3TJHC 4BA8A 4L8DB 4Q0XL 4FQQA 4KGLA 4LNRB 1X5LA 3OKDB 2Z91B 1IRAY 2MCG1 4XXCA 2A6JA 1DSFH 1WICA 1QRKA 4R4BB 3E1F1 1DN0B 2H8PB 5J12C 3FFCB 2DQUL 4QHKI 2X42A 2AQ2A 5CZKA 3GMQA 3WN5A 4WFGD 2IEPA 3FOLB 5C09D 3BKJL 1U6AL 1ZT1B 3NCFB 1FFQA 3DRTA 5IROC 35C8H 2DB8A 1FL3A 5ISZB 3QZWB 4RX4A 5DT1H 5FHBL 3TIDB 2J2ZA 4W6WB 5IF0A 1D5BB 3BH9B 3HI1A 5IOPA 4QRRA 3H7LA 3ULSA 4MD4B 2BNRB 2GSGA 4K3EL 3TYFB 2VC2H 4PFEA 4Q9RH 4JHAH 1OP5K 2CK2A 5HGHB 1RZJH 5C0FB 2WWMC 1KB9J 1IGYA 3MRIB 5DC4B 3BIBX 4M3KB 1IM9B 3L3OB 5DA4A 1BEYH 5I1KL 1DBML 3KYAA 4LLYB 1MSPA 4RFNC 5MHSD 3MZTA 3ETBF 1KEGL 1C5BH 1MCNA 1UQSA 1OTSD 2HJFA 2H9GA 5T1DH 2MPAL 5CGYD 3QQNA 1N2RA 4S2SB 5JOFA 3QR2A 3WD5H 3C9NB 4JCLA 1CK0L 1B6DA 5JUEH 5KN5B 1DUYB 2BERA 5GISL 2PW1A 3VI3E 4WW2F 5HVGB 3WFBH 2BSRB 4Z7UB 1ZGLA 2P5WB 4H0GA 3BKCL 4M3JA 1XF2B 3OZ9H 2BVEA 3GM8A 4WI8A 2R2CA 2V2TA 4HMEA 5B3JE 3H42H 1HK6A 5F3HB 5CBAB 1CVSC 1FFNA 3QEQD 3VXRD 4LHUB 3TN0A 3FQNB 4YHIA 5FDWA 3QIUC 5DMIH 4EDWH 1TZHB 5SWSD 4YDIH 2OMNA 4HBCH 4Y89A 1RURH 5JQ6L 1A1OA 1RJZB 5GZOD 2UV3A 5E99L 1UB5A 1E6OL 1BOGA 4MLSA 4CBPA 3STLA 2XXCB 3O2WL 3RWEA 5DD6B 1NBVL 3W0WA 4CAGA 1R5IB 5EOTA 5I8OL 4LIQE 1DE4B 2VN4A 4OLYL 3EYVB 3LDBC 4Z7OE 4MNHA 3WIHL 3BHBA 3W82A 3L3KA 4OGYL 4KTDH 4MCZA 4YFEA 2W0PA 3O9WC 4YAQA 1OGAD 5B38B 5HDOA 3UAJC 3IAQA 4NYLB 1D9KA 4U1GC 1RUPH 5DD3L 2VXSH 1OAUH 4X9FA 3GI8H 4KHTL 4MVBC 3QHFL 1J05B 1YQVH 1XH3B 4NRZA 4QOKB 5EUKB 4U1IB 1YEJL 1YPZA 4JN2B 4Y1AE 3MGOA 3ULVD 1LQSR 1MEXL 1R5WA 3QFJB 2Q86A 4OCWL 4LSQH 1II4E 5FYLL 1KTKE 3RNKB 4P9HC 4H5SA 4HAGA 2OXHA 1BGXH 3VXOB 1EFXA 4EN3B 4ONGL 4RGOL 1FQ9C 5A2FA 5EULV 1UH4A 1JGDB 4JAMA 1NUDA 1T5WA 4JDTH 4DKDC 4ERSL 3L5XL 1R3HB 5H37G 3U0PA 1YYML 3MXVH 1AGBA 1GC1C 2YRZA 2ITCB 2PCPB 1KLUA 4LU5H 4OUUB 2XPGA 3SDCB 4XTRC 4R0LC 4ORGA 5C0AA 3VD3A 4P5TD 5AD0B 4G6JH 2PYED 1RV6X 1RUAL 1MQKH 3L1OL 1HYSD 3MUGA 3BWUC 4AEHL 4KWUA 5J12B 2R1XA 2VR5A 3T2PA 2A6DB 3SGJA 3ZE2E 1P4LA 4ELME 3HPJA 4ZFZA 5JORB 3RL1B 3BVNA 2QHRH 1WBZA 1S3KH 2IPKB 2JCCE 3MLTB 5LJYH 1HDMA 1YMHB 4OGAD 5EU4B 2QL1A 3W39B 2B5IB 3ISWA 4MXWL 4QHNA 2FX7H 4HGWA 4XC3L 3BZFA 4I48A 1J5OH 3OB0K 5EUOA 4XZUB 4QXGH 3C5JA 5CIPH 2VLLB 1WZMA 3O4LD 4HIXH 1U2CA 4JZOA 4JKKA 1NFKA 3ARFA 1HYRC 2DBJA 3KHOA 1Q9WA 4RFNB 1T0MB 1YY9D 2VZVA 3FN0H 1SYVA 3T1FB 1FE8H 3MRCA 5ETUB 3ARZA 3CVIL 4HK3J 1IAII 1IGTA 4NP4H 4JVPA 2EDKA 4M7JL 5IVZB 3VXPA 2G60L 4M5YL 1I85A 4WWKA 1IAOA 1MIMH 5IR1A 5D5MB 3N9GL 5FYJL 3HNVL 1BZ7B 1A5FH 4P9HH 3KPSB 1YN6A 4D8PA 3MROB 1K8IB 1U3YA 2L7UA 4HAFA 2FSEB 2ZPKH 3TJEH 1VKXB 3OWEA 3DI2B 1A9EA 4NNYB 4JVWA 1A7QH 3BE1L 4LRNH 5HYJD 5ANMB 1JF1B 4QYOA 2NY5L 5CUSL 3I6LD 4DKFH 1UCBL 3TYGH 2P48B 1GC1H 2V2XA 2DBLH 1H3WM 4XB8A 3NFNB 3QAZC 4LARL 3VI4F 4WNQB 1ACYL 2QSCL 1KN2L 5I1DB 3FQRA 4XBGA 3QIUB 1WIPA 2Z31A 2L0DA 4LCCB 1WZKA 4Q6IC 5E2UH 2RJMA 4HFUH 1MI5B 1N0LA 1D5XA 2GCYB 5IKCB 1F4AA 4L3EE 3PL6A 1SJHA 3LOWA 1DL7L 4KV5F 3F5WB 4U3HA 1KFAL 5D7LA 3MRLA 4FXKA 4YXKH 3MRHB 2ZG1A 3RVUD 4MA1C 2D2OA 4M7ZB 1QSED 2XWBA 1P5UA 2F53E 4U05A 5CJOH 1EDQA 1FRGL 3B3IB 2V2WA 4OFIA 1L9MA 4N8VA 3RGVC 4J23A 4PJ8A 1KPRB 2R29H 4ZXBC 3VFRA 5JIPA 1MCHA 4IRSA 3SO3C 1L7TL 1J86A 2ESVD 5ALBL 3RL2A 3GM0A 1EHLL 5CJQH 3GMMA 1FGVL 2VOTA 3GIVA 5F44A 1VFBA 3GJEB 2XZZA 4BKLA 4MCYA 2KDGA 4HV8A 4U6HB 3W5NA 5EU5A 3MJ9H 3SQOL 3OF6D 4QRTB 2HFGH 3KPPB 4O02H 5BVPH 4P2OC 4EQ2A 5DURB 5E2TH 3D39E 5T1KD 1AHWA 4WHTA 3NCEB 4X80H 1B4RA 3E3QA 4C59B 5FV1L 2BVPB 3DURA 1F4XH 4LPWA 1MREL 2APXA 4ONHB 4PJBE 2V6HA 3V0WL 4NO0D 3BN3B 2G9HA 3VRJA 4V1DD 3TNMB 4YZFF 2Z93B 4BJLA 4R0LB 4XHJD 1F8TL 2W07A 2EEDA 1AH1A 1ERNA 4Z5RA 5I9QC 2QJDA 1T0NA 5HY9B 3L3IA 3SDXA 4YHPB 2HT3C 3TZVA 3DHMA 1JHKL 2ORBH 3FQTA 2PO6C 2R23B 2HLFC 4JPWL 1S7QA 2BCKB 2OM5A 2ZUSA 5FK9B 3P9LA 1A9BB 3QHZH 5CGMA 1JK8A 3OAUH 2I26N 1OF2A 2W1NA 3LS4H 4APQB 4P59L 2WLZA 3FZUD 2X4QB 3GSUB 4OLXH 1XZ0A 2FATL 4X5XB 3UTTB 2VLRD 1N64L 2LAAA 3S37L 4TQEL 3GSRB 3EHBD 1UWEL 2Q7YA 1G9NC 3KPRB 1U8NB 5GS1B 3ZSSA 3VJ6B 3AS2A 3ULUD 1PG7H 3H0TB 4GRMA 2HRPH 3N1FC 5IMMA 2ZNXA 1N6QL 1YNKL 5C0RL 1BF2A 2UUDH 1YMMD 2J8HA 4M8QB 4HMCA 4XMLH 1HHHB 4HX1B 1QNZL 1VFOA 3T65B 4MS8C 1HXMA 4OLZL 1BVKA 2LU4A 4UTBL 4N1HB 2EDNA 3BISA 3WJJC 4K7PL 5M7QA 1YJDC 2OI9A 1DBJH 2AJVH 1RQ5A 5JLZA 1T7VA 2D03H 4PJ9A 2Q8BH 3MRJB 3QIBB 2IH3B 3VWKA 4GKZB 4WW2C 4MAYA 4ZFOB 1JRHH 1RHHA 4JJHA 3H9SA 5IBLC 4H8WC 1E0OB 1DTUA 3QUML 3P0GB 1FVEB 1KCRH 1F45A 3O3EB 5FO8B 4XWGL 3H9ZA 4R4ND 4NGHL 4V2BA 5BRZB 3PWUB 4OZIF 3EYUH 5JIKA 1T1WA 4K3GA 3V5HB 3NZHH 3QAZB 4EI5D 2WINA 4LCWB 5GXBB 3VW3L 5I1HH 1MWAH 2P8LB 1KJVB 1Q1JH 2FRGP 4LCUA 4XPBL 4RMRA 4WFEE 4KROD 2ARJB 1A7OH 2XN9B 5DZLA 5KW9L 5KSBB 1V7NH 4OLEA 4MNQA 1UWXK 5T3ZL 2VZSA 4JM2F 1VA9A 5F7HA 1WAAA 2DMCA 4L9LA 4TPRH 2M1KA 1FO0L 5C70A 2CKBL 4AEFA 2BOBB 1DLFH 3B8YA 3IFLH 4GT7A 3X17A 4HIIB 1Z9MA 4MA1B 3RWHA 3B9VA 4O4YL 3UBXB 3DUSB 4LSPH 1XF3B 2G2RB 2ED7A 4G8GB 2QADD 3SO3B 5FM8A 1FNAA 1CGSH 4I18B 5KSUA 4N0CC 5FKPB 5EPMB 4NZJA 2C3VA 3HLAB 2RR3A 3I6GB 1LEIB 2FX8H 1QR4A 3U9UA 4FQLH 5ID1A 4KJPD 1JWSB 4DGIH 3G6JE 4RMVA 3RHWF 2GFBB 4WO4B 2J8UF 4E42B 1PD6A 1RJLA 3U30C 1W0WB 2AK4A 1YJDH 4NOFA 2R56H 5E7BA 1VPOL 4JQIH 1Q9OB 5ITBH 1DUZA 3PDOB 3BD5A 2C4FU 4I3RH 2CR6A 1OSPL 5IVXF 3FQUB 1LO2L 1UJ3A 3S35X 4P46D 3B2VH 4H8WH 4P5KA 6FABH 1GOFA 4JO1H 4LGSB 3EOYG 4F7MB 1IGCH 1OP9A 2M2DA 1GGYA 1EJOL 4BM7A 4XPTL 2DWEB 4FQXD 3DBXB 4PLJD 3FJTA 4OFPA 3VRLF 4UQ2B 5ERWA 2G5BA 3I02A 3OR6B 3HZYA 4PJGB 5DJ2B 3HZMA 4NNXB 3VH8B 5IJVB 1FYTA 5BZWB 4PGDA 4JO2H 4P2RB 3PNWB 1G7QA 4P9MH 4DW2H 3K2MC 1KACB 4ODTH 2NTFB 5J9PB 1VFUA 5HHMA 1U8JA 2D0HA 2HMID 1FGNL 2W60B 4JY4A 1DVFA 3EO9L 4K94L 3QWRD 2VNCA 5DEGB 2XRAL 4YBQD 3EYFA 4M6OH 3OXRB 4N9OB 4PJXA 4K3JH 3QNXA 2ZJSH 3ZKMD 5DA0B 4YHLH 2AI0L 5FCSH 3ILPA 4ELKA 4X6DA 1N4XL 3LCYA 4GMSL 3HI5L 1G6RA 1S7RA 2R2BB 1BVZA 2HA1A 4HBQA 1INEH 3UMTA 5F7EH 4HWEH 1ZA3A 1OLLA 5C0DB 1QLRA 5HGAA 2C1PA 1KG0A 4NN5C 4QTIH 5E9DE 5CMAA 3CFDA 3MZGB 1I9IH 2V17L 2VXVL 4K3HA 2YK1H 5D9SA 5ILTL 1LE9B 2LVCA 1W0VA 3PHQB 5T1MA 1Y18B 4HS6B 5IMKB 3WLBA 3DETD 4EKXA 5J8OA 3EYOB 3H9YA 1FBIH 3B9KD 1RJYA 5GHWL 1ZLVH 5H35B 3E6FB 1EEYA 2R0ZH 3I75B 1C12A 3MV8A 2Y07H 3KPMB 2X4TB 4KKBD 1K8DA 5TF0A 3RP1A 3U36B 1DZBA 5C0BE 1L7IL 3LQZA 4G6AC 2VL4A 1W72H 4HMDA 4Z6AT 1RHFA 1ZA6B 4LPVA 3S6CA 2ZUWA 3PWPA 3OAZH 4U4BA 1RK0B 3DUUA 1CR9H 1MHCA 5CZVH 3CSYA 3PE9A 2R69H 1LEGB 1K5NA 5DD1H 1QP1A 5BXFB 2X1OA 1PFCA 1R3KA 5EIIB 4HDIA 4RFEB 1AKJB 2ZOKA 4JDZB 5IB5A 5FGCE 3V6OE 3QO0A 4IMLA 5I1EH 5B8CA 5ICZB 2OBGA 3FB8A 2VABB 2V9TA 5DUMH 2VXTH 1OB1A 4JFEB 4PGBB 4JFXA 2DS4A 4NDMA 1KCKA 3OKMB 4U6VL 5KVGH 3DMMD 4Y1AD 4MAUL 1SHMA 2E27L 5LAXB 3BO8B 3CFBB 5CGTA 3EJZD 4IIQA 4OFDA 4P3CH 1RMFL 1U93A 3HNSH 5TE7L 5CAYB 4GG6F 4MDIB 2BNRD 2BSTA 5IFAH 3VRIB 4PRHD 3GMLA 4XXDB 3ARRA 5E6IB 4D0CA 4EJ1C 3QEQA 3VXRA 1OY3B 4M4PA 1IM9D 3P2TA 1KLGB 3AREC 2XTJC 5D6CB 1V8HA 4LQFL 4B5EA 4LVNC 3HFMH 1AGDA 5EN2B 1PW3A 3WNNA 4MJ4A 1IILE 5L6YH 2IFFH 3ZT6A 4HPOH 3QQ9D 3ZE1E 5HHVH 3VDCA 4KUCD 3WEXB 3VFUB 4OZHB 2AXGB 3FT3B 1VFMA 1S5HA 1GGBH 4XMKL 2NY7L 4HWUA 1T80A 5E2WL 1FZOB 5KS9B 5D1QC 1EHAA 1CDYA 1OGAA 3ARDC 3ROOA 3WKMH 1QFWL 1OT2A 4JRWA 4AH2A 1MJ8H 2X70B 5DEFB 4NRXB 3ZDXF 5DHVH 1S7WB 3SE9H 1PSKL 2OJZL 4I3SL 1AQDB 3K4DA 4OQTL 1KBGL 4HJJL 4LFHG 4OLUH 5I8CA 3V0AC 4F2MB 4JR9L 5AZEL 5D72L 3WFCH 2A6KB 4YHZH 4S1DC 3LKOA 1J10A 2HT2C 3CD4A 5EDXA 4DGYH 3R8BB 5IIEB 3MRDA 2AP2A 1DBAH 4KVCL 4WU7A 2XKNB 1KXVC 5A2KH 1INQB 1G6VK 3S36H 3MV7E 3CIQA 4HUUB 4R8WL 1CF8H 2CLRB 1DJSA 1JWMA 1PZ5B 1ZK9A 4Y4HB 5KOMC 3QXAA 5D7SL 5CEYB 4H25B 4NN5B 4LOUC 3V5KA 2PYEA 5FO9A 2WM0A 4TYUA 3PGDA 3HZKA 4G3YL 1OGTB 2E7LA 5EBMB 3WUZA 4N8PA 1IAKB 3L5JA 5ICXB 2CRMA 3QFJD 4P23C 1WIUA 2EH8H 4PR5B 4J3VA 3P77A 3LB6D 3ZT5A 5J1AB 4NWTL 1RVFH 4PJCA 5C07E 2FZ3A 4EN3D 1BQHG 1ED3B 3U0TA 3LQAL 3V0VA 2SEBB 1UM6H 3VXQA 1OTUC 3LEYL 4LLMB 5HHNB 4K23H 5HHXH 4L3ED 5KAQF 1TZIA 3O6MH 4GMTL 1BOYA 4FNLH 1KT2A 3QUMA 1YEHL 4AIOA 3O4LA 3SDCD 1S9KC 4GAYA 3TJHD 4DZBA 1UXSB 1KYOK 4UMGA 5MERA 4YC2C 3TH4T 4YDLB 4A2LA 1OAYL 4HUVA 3D0LA 4XAKD 3V4UH 1C16A 3MOAL 3WXWH 4ISVB 4EI6A 1TQCC 3SE3C 1KCUH 5KSAC 2AJSL 4HWBA 3K2UH 1BFVL 5FEBA 4GRWE 1DP0A 2FLBT 2OCFD 1BX2B 2A9NH 1Y6NR 4UOW1 4UV4H 5JIIA 2CKBA 3O8XB 1KN4L 4MD0A 4NQCE 4KAQL 1MCEA 4RSVA 2QBWA 4F7CB 3OJDA 2RCSL 4TUKH 5HYJA 3LPFA 3RTQC 3T3PF 3BZEA 1AGCA 1CICC 3G08B 2I9LB 1MCRA 25C8L 1XF4B 2FEEL 2FJFB 3QDGB 4PGCA 4J6RH 4DOHB 1RUKH 5I30H 2XTJB 2XZQH 5C86A 3DVNB 4LVNB 5CJBA 3SJVB 2EYRB 3PV6B 4FMFA 2NY3B 2VQUA 1NFDA 5MENA 1Z5LA 1P6FA 1WF5A 1DR9A 3HN3A 3UJJL 5LWYH 4PYHA 3L7EA 4N0YL 4XVSL 5I1IH 2YWYA 3FQXB 4HT1L 2EDJA 4Y19B 4TVSa 5I8KL 5C0IA 5D1QB 3L3DA 4LF3A 4MJ5B 1A7RH 3O6LL 3MNZA 3ORJA 2QR0A 5L7XH 3ZLQC 3RIAK 3BKMH 4P4RA 5LGJB 4L1HA 4CMMB 4G6ML 3V6FB 5D71H 4I2XE 1LO3H 1L6ZA 1A2YB 1N8ZA 2ESVA 4H1LA 1QLFB 1RZ7H 1N59A 3T08A 3RWFB 5TGBA 3QIUD 4DVRH 4QF1A 2XACC 3PHSA 1UM4L 1BLNA 1SJVA 5JHDE 4LSSL 3DPBA 1UA6H 4WDIB 4LLUA 3TO4A 1MAKA 1BWWA 1NC4A 5CFHA 3DECA 3RKDC 5CEZH 1KJ2A 1S9XB 5FKAA 4JN1H 4Z8FL 1GCFA 4MHHG 5T1KA 4Q6YA 2ZOLA 1JPTH 1XR8B 5A16A 1QYGH 3O9WD 1IARB 1TIUA 4M62H 3Q0HA 4K2UH 4A6YH 2VIRA 5GGSY 3VFSA 3UAJD 5MI0C 3RY6A 4BZ1L 3VWJC 5IHZB 5GJSH 5D2LE 1A6UH 3C6LB 5B4MC 4DN3H 1U3HA 4WHDA 1B2WL 1BM3H 1J11A 4MVBD 2F58L 2CJUL 5JPMA 4LAQL 4TULL 1U3JA 4BSWA 3RWCB 1XGUB 3CFKB 4XP4L 5MEPB 4MLIA 4K9EL 2LQRA 4HD9A 2XZAH 5DRNB 1WV7T 4P23B 5DUBA 3CFCH 3BGFC 3D25A 1I1FB 4WU5B 1YPZF 3O6KL 1A7NH 4R2GC 3SKOB 3THMH 43C9B 3H7BB 2VMFA 4UT6H 2VLRA 1T2QL 1WBXB 1IM3B 4WFED 3PP4H 3NMEA 3V79C 5C2BL 3TFKC 3BQUC 1WWBX 4C56B 2EDFA 5CHNB 3DV6A 4H26B 1ND0A 1IGFL 1LILA 4PGZA 4X6CF 5H2BA 5FYKD 3JVGC 4L3CB 2NY1B 5EOQH 5ACMA 3BGAA 4XCNA 3JV5A 1KIUA 1RK1B 1YMMA 3GSWA 3ZT7A 4ZNEE 1WZ1L 2FH8A 5ID0B 1FZJA 1W2KT 3ELAT 1JHTA 3QH3A 4JFFA 3T0AA 4YUEH 5BS0A 5DJ8A 5HI4C 3VD5A 1TQCB 5KSAB 1EA9C 4GW5B 4WEBH 5IFHH 4NSKA 1CN4A 2I07A 1BIIB 3RVVC 3P4MA 2J6EL 3UTTD 2ICWJ 5CS7A 1CDGA 3O3DA 1CXKA 3MNVB 1E4KC 2ATKA 2RB8A 3IFPB 5DC0A 1WFTA 4W70A 2JB5H 1FV1A 3MFFA 2CR3A 4R97B 1I1AA 3QUKB 1FP5A 1EPFA 3IFOA 4XCEB 1R0AH 4D0BB 5EUOF 4EI5A 3LKQA 3TBSA 4EQ3A 5BOZG 4LCYA 1H3PH 1X5KA 2FNBA 5IJKC 1GOGA 3CK0H 1OWRM 3NGBB 2X9XA 3RPKA 5GRYA 1E4XL 2JELH 5IK3B 3TCXA 2MNUA 3OKOA 4I0PC 1LP9A 3HZVA 3MUHL 3AC0A 3KDMA 2J7LA 2CDGA 1O5DT 3VFWA 3DXAA 1LEKA 3ZHKA 1MFDL 1YZZA 4PDCE 2YUWA 4B53A 5F3BB 3LKSB 2I60L 1I1RA 1IQWL 1KNOB 2E9JA 1ADQA 4HGKC 1HCFX 4G8IA 1OM3H 5ITFA 3O6FC 5F9AC 5HVHC 5EZJA 3ZO0A 5BRZD 1CLZL 3BESR 3BH8A 2HFTA 1TMCA 3RPIA 1KYOJ 3MLVH 1NCTA 2AJZA 3T4YA 5IB1A 4MD5A 1CFVH 4J7RA 4TRPL 4UQ3B 2FLRT 3CVHB 4JRXB 4NQSA 4OZIE 1W0YT 3VCLA 3X11B 4NNPH 4RNRA 1G7IB 1FIGL 3BJLA 4DGVH 3UROR 3BPLC 2DQFB 1RIVL 4KZEL 2IMNA 2F19H 1HNGA 1NJ9A 2AGJH 4L4VB 4XC1L 4JB9H 2RFXB 2P46B 1ZGLP 4U6XA 1IKFH 4F57L 2OQJB 1JTTA 5TQ2L 1AC0A 3TVMB 2EXYD 1S7UA 2D9QB 3F58L 3FRPA 1OP3K 5HDBF 1QBLH 3UTZB 2X4UA 5E4EB 4OSUL 3IU3B 3BW9B 4P46A 3VWJB 4G8GD 3RGVD 5HHQA 5H94A 4ZXBD 5EWIH 1B6UA 3HAEB 4AMKL 4UIMB 1FLRL 2APFA 5C0BD 1HOCB 5HTSA 3ZL4L 2WAHA 1HQRB 3HI6L 2WUBH 2YXFA 5A1AA 1EEZA 5BZDA 5DDHA 5KJRL 2YPKB 3FO1A 3QCTH 1PX3A 3I9GH 3MA7B 5E8EB 4P2OD 3VFNA 1UG9A 1KENL 3FB7A 1LD9A 4S0UC 2JJTA 1F58L 1ZHLB 4IMKC 5IBUB 3WL9A 3KYOA 3PG2A 3T0EC 3QWRA 2DQEL 3LPWA 5LQBL 5GGTL 3DSFH 5EO0B 3LN5A 4UU9B 4RAHA 2IH1A 4M7KL 2NMSA 4LMQE 4NQEB 5SWZB 1YUHA 2DQGL 3G6DL 3X3FL 2GITB 15C8L 2HT3D 3R06B 5IVXE 1MHHA 3H2WA 5EZLB 1CFSA 4FTVE 2PO6D 1NAML 4PY8J 4XNQA 2YD7A 2HLFD 3VXSA 1JPSH 4U1NB 4KKAC 5C8JA 1QRNE 3SDXF 3UTQA 4G42B 4XXCC 1T4KB 4GUPA 2AABH 2F5BH 3RDTA 4P2RD 1HQ4A 3OTTA 3QUXC 1MNUL 3KPQB 4IS6B 5TQ0L 3K7UA 4PJIA 2DYPB 4HIJA 1NH6A 4HKJA 1TCMA 5HYEA 2H1PH 4PTUB 1KEMH 3X12A 1MCPL 5JMRA 1OT1A 8FABA 5EZIL 1PG7W 3TO2B 4EDXB 4HG4K 4ODXB 5JQHC 3X3GL 3H3PL 3EOTH 4OLWL 1SVZA 5D7IA 4ZPTB 2H6PA 1D6EA 1NGZB 3OG6B 2FHBA 1TVHA 3AS1A 1HHGB 5IEHA 1KB5A 3WFHA 2OL3H 2IQ9L 4MS8D 5I1LB 4L8DA 4LNRA 3OKDA 2H3NB 3ZYIA 2Z91A 4ALAH 3NCYS 2BFVL 4I0PB 1RFDL 3CCHB 3IXAB 1KTRL 4R4BA 4W4OA 1DN0A 2H8PA 4LFHD 3BPOC 3FFCA 5E95B 4HJGB 3RI5K 4BQ8A 3MJGX 1XGPB 4HIEB 4ZUTB 1MCCA 1E28B 5IBLD 3FOLA 4LRIC 3TC9A 1ZT1A 1CIDA 2ARWA 2O5YL 5ISZA 3QZWA 1G7JB 1NCCL 1KF9B 2DMKA 3TIDA 1WEJL 2OJEB 1MCSA 1D5BA 4ZS6C 3BH9A 4Z7WB 5GS3A 4JQXA 4MD4A 2BNRA 3LSOB 5DTFB 2J88L 3TYFA 1I3UA 5JW4N 2CLVB 3O11B 1C5CL 5HGHA 3HTLX 3TN0C 5C0FA 1JL8A 3MRIA 1UWGL 1IM9A 3L3OA 4PJ5E 4OZGE 5J6HB 4LLYA 3STBA 3MV7D 3SDAB 3LRHA 3WIIH 1TQBC 3SDYH 5I73C 3X14B 1WT5A 3MRRB 1MUJB 4Y5VB 2CSPA 1U8PB 1AKJD 5BCAA 1DQDL 3TWCH 1V7MH 1F2XK 2Z8RA 4YPJA 4S2SA 4JFED 1WAAF 4EIGB 3C9NA 4L8BB 3S3SA 4PUBH 5T3ZE 5KN5A 1DUYA 5TF1L 4OLVH 2BSRA 4UT7H 4Z7UA 3GBMH 2P5WA 1D9KC 1XF2A 1NCNA 4PB9L 1HH9B 1KPVB 2ATPB 4TUOB 1ZOXA 1EMTH 5F3HA 2YA0A 5CBAA 2DLFH 3IDYC 4LHUA 2ZG2A 3QYCA 1Q0XL 3UCRA 1IZJA 5KZCB 4GG6E 3TBVB 2FL5B 3MRNB 1TZHA 5F7YC 4UV7H 1RJZA 3LS5H 5SX4I 2F8VA 4S0TD 1C5DB 3S36X 3T0EB 3LPGA 5DD6A 5DJAB 2QKIB 1R5IA 1DE4A 3T09A 3EYVA 4CU7A 4JG1H 3DVFA 2YC1B 5F6IC 1U8IB 5L2KE 4M6AA 3WSQL 3VFPB 1XF5B 5TFSH 5B38A 1RIUL 2YKLL 1K2DB 1WWAX 4NYLA 1A14H 1FPTL 1E27B 1MFCH 1QBAA 4M1DL 4G7VL 4S1RH 1J1OH 2WLYA 1J05A 1JNNH 2AERT 3NFSL 1XH3A 4HQQL 4QOKA 5EUKA 4U1IA 3D3VE 2VKWA 3CLFL 3QUXB 4JN2A 2NXYC 5D6DA 3ZDXE 2AV1B 1B0RB 3C2AL 2HVKB 1J8HB 3QFJA 3SGJC 4JO3H 1AXTH 4JRYB 1JPGB 2ZSWA 2OR8A 3RNKA 1AE6L 1AC6A 5JXAH 5GGQH 2ZCKH 2DQTL 2EH7L 3RA7L 3VXOA 2P49B 4EN3A 1JGDA 5IQ7L 3GSNB 5E8DH 1PDKA 1QO3B 5HXMA 2ZG3A 2BRQA 1BQLH 1R3HA 1YQ2A 2X1PA 5D7JB 4PJXF 2EDHA 4HS3B 3I85A 2ITCA 2PCPA 1T89A 5FM4A 1MLBB 1NCWL 1DANT 4N8CH 1DEEB 4OUUA 4BUHA 3SDCA 3TJHA 2I25N 4N1CA 3ARFC 3PP3K 1L9NA 4OZFB 2BY0A 4RMSA 5HVFB 5AD0A 3VD4A 3LKNB 3RUGF 1EUTA 2W59A 5HSFA 3ARYA 2QHLA 1FHGA 1RSFA 4YQXL 5KVMC 1CXEA 4JJ5B 1AIFB 1I85C 5JORA 3PQYB 3BP4B 3RL1A 4IDJL 2AK1L 4FQ2H 3GJFK 4U1LB 3MLTA 2ADGB 2IPKA 3GRWL 4RAVB 1YMHA 3VDAA 2UY6A 3NTCL 4QHLB 5EU4A 4G6AD 2BY1A 1WVZA 4LSVL 3U7YH 3W39A 5HVWA 5JHDD 3DYOA 1BF8A 5K33A 4XZUA 4F80A 3CXDL 2VLLA 1DQLH 5DD5H 1EJ6A 3MOBL 4S10A 2YRLA 1S7VB 4LVHB 4M43H 1PQZB 2RAMA 1OVZA 4RA0C 2NTSP 2Z31C 1S9WB 5FF6B 4TN9A 3G5XB 1T0MA 5HDQL 4ZSOB 1TVBB 3T1FA 5ETUA 5B22A 2OP4H 3QUZB 1F4YL 2VLKE 4OGZA 2W9DH 5IVZA 4U7MA 4U1MB 1YEGL 4YHYC 1NSNL 3GHBL 3PWNB 5D5MA 1IJ9A 2IANE 4ZPVA 2ZWLT 1BZ7A 1BD2B 2PR4L 2W65B 4O2CB 3KPSA 3MROA 1K8IA 4XNZC 2DQIH 2FSEA 5C6TH 1VKXA 2GJZB 1P2CB 5IESH 1H5BB 2F5AH 4B7LA 4NNYA 4DKAA 1I7TB 5LCVH 2WWKO 2XA8L 5ANMA 4PRIB 1JF1A 4WI3A 3QEUB 4IRSC 4RISL 1INDH 1AGFB 3RFZC 2EC9U 3IDYB 4WUUB 3WUWB 2P4AB 3NFNA 4WNQA 4WFHE 5I1DA 1RULL 3ARED 2XTJD 3QIUA 4O5LH 1CLCA 4LCCA 1J1PL 3UTSB 5FGBA 5LGHL 1MI5A 1QQDB 2BRRH 3BUYB 2GCYA 4XH2B 1WUNT 5IKCA 2OR9L 3MACH 4X6BB 5EB9A 2E8YA 3IDGB 5DC9B 4UBDD 1RIHL 1AHWC 3F5WA 4X6CB 2X4NB 3E3QC 3QO1B 4PLOB 3H8NA 4PJ7B 3MRHA 4G8FB 5F6IB 2VDML 3SGDI 4NM4L 4Y19D 1R6VA 5D1QD 1A6AB 3ARDD 3LD8B 1T0PB 3B3IA 1AFVH 4MA8L 2KZ1B 4HXBH 4XNXL 1DLHB 1KPRA 3JUYA 1TDQA 4R26L 2HN7B 1MCLA 1IFHL 1OAXH 1I9RH 3VA6A 1YYLL 3D87B 2X7LB 2FO1A 1HKLH 3QRFM 1WC7B 2NXYB 3GJEA 3O3UN 4IOIB 2HJLB 3FO0H 5FGCB 4JY6B 4S1DD 3PXHA 3KLDA 2WP3O 3MODL 3U4EB 2HT2D 3N50A 4U6HA 3U7WL 3NCJL 4QRTA 1RU9H 3OXSB 3KPPA 1M71B 1MLCB 4BELD 3KPTA 1QFWI 2DIBA 1VACB 5FUCC 4RWYH 2BVPA 1LO4L 4ONHA 3MRKB 3PWVB 2CRZA 2P8PB 2KQNA 3V8CA 3TNMA 2V5MA 2Z93A 5I1JH 5IGXL 1F90H 1WGOA 4R0LA 5CD5C 3EUUA 4JFHD 5JA9A 3W0WE 5HY9A 5AAMA 3MLWL 4LOUD 4ODSH 1I1YB 4YHPA 3C5ZB 1OL0A 1NMCB 4OCLC 3CGTA 4F7EB 4NCC2 5IWLA 2R23A 1P7QB 2BCKA 3BAEH 3MRPB 3UTPE 4PYGA 1MJJA 5FK9A 1A9BA 2DD8L 2GTWB 3QT2A 2BDNH 2O5ZL 4P23D 2Z4QB 4MX7B 4APQA 1MFEL 2OI9C 3T2QA 3UYRH 4TOYH 5F9WB 2WUCL 5GGVL 4PTTB 3D6GA 2X4QA 1XGQB 3GSUA 3BKYH 3OX8B 3JV4B 4PJ9C 2BK8A 4D9RE 1BZ9B 4X5XA 4KK9C 3VXUE 3VWKC 3UTTA 2JJUA 3MYJB 1AR1C 2VH5L 3ABZA 3PF2A 5T5FH 4GXUM 1FFPB 3GSRA 3MRQB 1F6FB 3R4DA 1D5IL 1OTUD 2XQYG 4U1SB 1I8LA 1YPZE 3JTTB 4OT1H 4C56D 1EO8L 5E08L 3KPRA 1U8NA 4JO4L 3VJ6A 5EU6E 3VG0H 3H0TA 3MLSL 4HXAL 2NW3B 3LKRA 4FQ1L 1QKZL 2ZP0T 1BECA 4ZQKB 4M8QA 1F3JB 4J3SA 1JHLL 4XAWH 1HHHA 4HX1A 1Q94B 4FS0A 1TVDA 1PKOA 3T65A 4M7LL 1FAIH 2B1AL 4DTGL 5CEZD 1TXKA 3K0WA 1OAQL 2X9YA 3KYKH 3SOBL 1LDSA 5KSAD 1AD9B 4L9LC 3JWDL 2EEBA 4DN4H 2VQ1A 3MMEB 5DJ0B 5JMOC 4LGRB 5JO5B 5CJ5A 3MRJA 3QIBA 2GYSA 2IH3A 5C0AE 4P2QD 2ZCLL 3CZJA 3U83A 4GKZA 1RZKC 4ZFOA 2UYLB 4NBXB 5E8OB 3HNTL 4TSCL 5IBTL 1I75A 3MPCA 3O81A 1FVEA 1B3JA 3O3EA 3DWTA 5FO8A 3GI9H 2B2XH 4PGEB 1CICD 2DLTA 2MCPL 3KJ6L 5BRZA 3PWUA 2CK0H 4MQSB 3V5HA 5J7CC 2ENYA 5HDLA 1HIMH 4RCAA 3UO1H 3NPSB 4LCWA 2ZSVB 1HE7A 2FX9L 1UYWL 2P8LA 1KJVA 4JKLA 4JPKL 1L0QA 1HZHH 1BQSA 4CKVX 2DLGA 2ARJA 4U1JB 4PJDB 5JDJA 2XN9A 3ZTNL 5EUOE 5KSBA 2VISB 1TJHL 2NXZB 5C07B 2A83B 4FTVD 4HLZH 3S88L 5AWNL 2BOBA 1IC4H 5D93B 5I1KH 1DBMH 3KPNB 4HIIA 2A1WL 1NFDF 1QRND 1KEGH 1E4WL 2LU7A 3DVGB 3UBXA 3DUSA 1UJ3C 2FEEI 4LDOB 1QFUH 3ARPA 5D7KE 4F37F 1XF3A 2G2RA 5F1KC 4FHBD 4G8GA 4XCYB 3RGVA 3NIFF 2YMXH 1G9MC 1NMAL 1CK0H 1JMXA 2UY7A 5TE6H 2A77L 4I18A 5DFVC 5FKPA 5J13B 2L4OA 2H26B 5EPMA 5SX5K 3HLAA 3GGWB 3M8OH 3BKCH 3I6GA 1LEIA 1EH9A 3MV9B 1WCQA 2ICWI 5JW5B 2PETA 1JWSA 5FCUL 3RKDD 5I1CH 1G1YA 2GFBA 4WO4A 2R0KH 4E42A 4EOWH 4P2OA 5I6XC 4QO1A 5EORL 1W0WA 3OGOE 1DVFC 1BBJB 3SO5A 1J1XH 4XT1C 1Q9OA 5JQ6H 2V5YA 1JZ7A 4IHOB 3A6CH 3PDOA 1JCKA 5E99H 1G7PB 3FQUA 1RZKH 2R9HC 3VWJD 4NWUL 2IG2H 5B4MD 4F7MA 4JY5H 4OCSL 3RWDB 4KKCC 2DWEA 5C6WH 3DBXA 1J0ZA 4UQ2A 2LU3A 1WLHA 1P5VA 2BP3A 4DAGL 2H32B 3OR6A 2XWJB 3LH2H 5D7LE 1NCBL 2AQ3A 3TP4A 4PJGA 5DJ2A 2NY4B 3VGAC 4NNXA 3VH8A 5IJVA 4DWHA 5BZWA 5KTEH 4U0QB 5J3HD 3BRDA 4P2RA 3PNWA 5IMOB 2KUTA 1MCFA 4KHTH 2NTFA 5J9PA 4QT5B 4X6FB 1EGJA 1A6TB 4N8VG 2W60A 1YEJH 1FYHB 2J12B 1B0WA 3P0VL 4PJFF 3IKCB 5ADOH 3GMNB 1WFOA 5DEGA 4OCWH 3TFKD 3BQUD 3FN9A 3IDXL 3O2DL 4WV1B 3OXRA 3U2SB 5F71A 1HKFA 5FYLH 4BK5A 1R3IL 4I2XB 4NO2B 1NGQH 3QQ4B 3ZYZA 4DEPB 3PWLB 3SDDC 3Q5YA 5SWZD 3RZCC 1VGEL 1G9MH 2DQDL 1RUMH 5E03A 1RAMA 1KIQB 2QQKL 3ULUF 2R2BA 2YSSB 3L5XH 3QBTB 4LAJH 4E41D 2JJSA 4OD1L 1MHEB 3E3QE 1JZ3A 2IAMC 5C0DA 2R1YB 3PWJA 4NJAH 2B20A 5HI4D 5DWUH 5L0QC 5F97E 4B7IA 4OCXH 4M48L 4RMTA 1QSFD 1F00I 1LE9A 4YK4C 4HC1L 1LMKA 3RVVD 4C4KO 1JN6B 1H15B 3PHQA 4HS6A 4PD4J 2DYPD 5IMKA 2R1WB 4GQ9L 4LGPB 3EYOA 2DDQH 4M6ML 4GAJL 3L1OH 3E6FA 3I75A 5H35A 3SDXE 4V3DB 5DFWH 3KPMA 4S1QH 2X4TA 4PRPE 4JHWL 5F9OL 3QDJB 3U36A 2NZ9D 1PKQB 5K9JH 3EFDH 4URTB 3H6JA 1ZA6A 3SE8L 5CKGA 4EZMA 4MXWH 4F9LA 1RK0A 1NGYB 2BJML 1Z6JT 4NPYB 1G6RH 2AJYH 3TF7C 5C9JB 4LIQL 4LLVB 3MLYL 3DIFB 5DQDL 1YECL 3RVWC 4HW6A 1LEGA 4I0PD 5BXFA 4JFDB 1GZQB 5EIIA 4RFEA 1AKJA 4JDZA 5ICZA 2VABA 2B0SH 3MLUH 2R4RH 4ZFGH 4JZJB 4JFEA 4PGBA 3D3VD 3OKMA 3ZKXB 4M5YH 4PY8I 1HH6B 3SY0B 1U0QA 2OXGA 3BO8A 3CFBA 4MB3A 5LAXA 3EJYC 3HMXA 3HNVH 1CLYL 2HKHL 4JKPH 4MDIA 2FD6L 4HLZG 4MYWB 2XZCH 1E4XI 3VRIA 3Q48A 4M02A 1ZGLM 4FQJL 1QSVA 4XXDA 2AJUL 5E7FA 3H9SE 2VDPL 5E6IA 1KCSL 3ARGC 4U0RC 3S35L 3JWOC 1UCBH 1KLGA 1AY1L 5D6CA 5FOBB 2R0LL 1T6VN 4HPYL 1A1MB 5EN2A 5DMJB 1N5YL 3Q1SH 3AXLB 4LARH 3S7GA 4S1SH 1CFQB 3MRGB 1YEFH 5KSVB 2FBJL 3WEXA 3VFUA 4OZHA 1ACZA 2AXGA 3FT3A 5LBSL 5MEOB 5CILL 5KS9A 1FZOA 2Q76B 5BOPA 3U9PL 2J5LC 4PBXA 3RUGB 1WAAE 3EAKA 1A1NB 5C0GB 5EA0L 4R90H 2X70A 5DEFA 4XP1H 4NRXA 2Q8AH 1KUMA 4WJ5B 2BNUB 1HHJB 1S7WA 1ROWA 4UZGA 1AQDA 3MCKB 4LEXH 1MJ7L 3VGDA 4MA7H 3UP1A 1TLKA 4F2MA 4F15C 5J6GB 4ZMAT 3NBNA 3O2VH 1LE5B 3RIFK 2A6KA 1DSFL 2E7CA 1EHLH 4KQ3H 2W92A 3GBLA 4YGVB 4KI5E 3T0ED 2CD0A 3MNWB 1G84A 1IAIL 3EFFB 4NHUB 2OZ4A 4X7DC 5IIEA 1MCWM 2VAJA 4ORZC 4G6FB 5FUOH 2XKNA 1JZ2A 3LIZH 3MBEB 1FFRA 1ZT4B 35C8L 3BEWB 1KSRA 4P3WA 3SDDB 5DT1L 3RZCB 1INQA 1ODAA 1EEQA 1DDHB 4CVWA 3WHXB 2AK4E 2X2YA 3IDUA 4HUUA 1ZT7B 2CLRA 3L9RB 2VC2L 1PZ5A 3MR9B 2IAMB 4TNWK 4Y4HA 4JHAL 4Y4KB 4Q9RL 3QJFB 1RZJL 4H25A 5CEYA 4CW1B 1MIEH 3L6FB 3FHAA 2CO6B 1OGTA 5EBMA 3QUXD 1BEYL 4GW1B 1IAKA 3L3JB 3JWOH 2Y23A 5ICXA 3ULVH 3Q6GH 2P1YA 4JRYD 3BT2H 4PR5A 4X7SH 2HLAB 5J1AA 1IQDB 1K6QH 1CL7H 4XWOC 3AB0C 5JUEL 1ED3A 5CCKH 4Z7NF 5IHLB 1FYTE 3R0MA 3IAPA 1MFBH 2SEBA 1CE1H 3RAJH 2YPLB 5C1MB 2A6IB 4LLMA 5HHNA 4QRRD 5ELIA 1BFSA 3WFBL 5HHME 2VXQL 5IW3A 2AQ1A 3OZ9L 4HULB 2UZXB 5D7IF 1UXSA 3W5MA 4PJXE 2DM3A 5CJXA 1N6QH 5DMIL 5C0RH 3IGAB 4KMLB 4YDIL 4HBCL 2P7TB 4OM0H 4OGXH 4X6DE 4ISVA 3A67H 2YZ8A 3IDIB 1PY4A 2W9EL 3DX9B 3PQYD 1TPXC 5CKAA 1D5ZB 3VXNB 4NQTA 5C92A 1BX2A 1BJ1J 1ZHKB 4K7PH 3O8XA 4I4WB 4F9PA 3QNYB 2G5RA 4GKNB 2GK2A 4ODWB 2DAVA 3PJSB 3CH1B 5JIHA 4KTDL 4F7CA 1I8MB 2OLDA 3D69B 3O3BB 1NUNB 5D2NE 3VXMB 3G08A 2I9LA 3QUMH 5BV7L 2VXSL 4XX1E 1OAUL 1U8QB 4O51B 3MV8E 1XF4A 3TN0D 4HZLB 3CU1A 2FJFA 4WFGE 4YFLF 3ARGB 4U0RB 3QDGA 4XWGH 3H3KA 5C09E 4NGHH 4MMXC 3DX7B 1YQVL 5IM7B 1GL4B 4L4TB 3SJVA 4HUNB 3TO4C 2EYRA 3PV6A 2Y1VA 3WV0A 5LXGH 3HG1B 3WO4B 5IVNA 2K7QA 2IC2A 1BVLB 4LSQL 2HJKB 3O3AB 3PWPE 3W0WD 1JP5A 1MPAH 1H0DB 3P0YL 4KK5D 4HWBH 4QY8B 4KXZH 4QRQB 3MQIA 1BD2D 3FQXA 3T2NL 4NC1E 4Y19A 1CDJA 2CKBH 5D1QA 4ZNCD 1X6NA 4P99A 4Y5XC 4MJ5A 4OB5H 3RY6C 1EO5A 3RX8A 3ET9F 2EC9T 3MXVL 4PRID 5GRWA 1OAKH 5LGJA 4CMMA 1U3HC 4LU5L 3V6FA 3CFEB 4NKIH 4Y8DC 3QSKB 2Q6WB 1MH5A 1LO5B 1A2YA 1QPPA 4WUUD 4Z7UF 1QLFA 5DXWA 2YUXA 1BHGA 3DLQR 1CXFA 3QPXL 2PXYB 3RWFA 4F15B 1FCGA 4MB5A 4RGNC 4G6JL 3WFDH 2DWDB 4E5XB 3UTSD 2KH2B 3F65A 1FVDB 4WDIA 2PW2B 2VDKH 3REVB 1TJGH 4LLWB 3P73B 4JHZA 4QHUB 3T0XA 2KBGA 1S9XA 4PJAB 1XGTB 2QHRL 4HH9B 3BI9X 2QQNH 4GFTB 4PS4L 4G7YL 4BZYA 4OIBA 2GK0B 1KGCD 3FCTB 3QEQE 3VXRE 3EHBC 3IF1B 3FT4B 1XR8A 1A3RH 2FX7L 1J5OL 5GSRB 3CUPB 3NIDF 3EYSH 4U1HB 5IHZA 1UEYA 5I18H 3C6LA 2Z0BA 1OSPH 1GIGL 3M07A 3TEUA 4NOBA 1U3ZA 1Y6KR 4PJ5B 4OZGB 4FA8A 4H1LH 4RQQB 2ZUQC 1ZKAA 2NXYD 3RWCA 1XGUA 2QQLH 3MJ8B 1VESA 3CFKA 1NCDH 4M00A 3FN0L 2AJXH 4NN7C 1RJCA 4X4YB 1FE8L 3D2UB 5MEPA 5DRNA 5AYUH 4KMTH 4P23A 1OGAE 1T7XA 1K9TA 3SBWA 5IHBA 4NP4L 3HMWH 1I1FA 3MLPA 4WU5A 3SKOA 43C9A 1FO0B 3AB0B 3H7BA 3HE7C 3B5GA 3Q5OA 5L9DH 1KJ2H 1WBXA 4KH2A 3QI9C 1IM3A 4GKOA 1IE5A 2P24B 3F7VB 3QCUL 4OCRH 1U91B 4YE4H 2ZPKL 4RAUB 3TJEL 4C56A 4O2FB 3UZEA 3OGCB 3ULVE 5CHNA 1I1AC 4H26A 1A7QL 4LRNL 1EBAA 3A0OA 5I75C 5F96H 2XRAH 3VGEA 4L3CA 4WFF