1C16A

Crystal structure analysis of the gamma/delta t cell ligand t22
Total Genus 49
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
49
sequence length
260
structure length
260
Chain Sequence
GSHSLRYFYTAVSRPGLGEPWFIIVGYVDDMQVLRFSSKEETPRMAPWLEQEEADNWEQQTRIVTIQGQLSERNLMTLVHFYNKSMDDSHTLQWLQGCDVEPDRHLCLWYNQLAYDSEDLPTLNENPSSCTVGNSTVPHISQDLKSHCSDLLQKYLEKGKERLLRSDPPKAHVTRHPRPEGDVTLRCWALGFYPADITLTWQLNGEELTQDMELVETRPAGDGTFQKWAAVVVPLGKEQSYTCHVYHEGLPEPLILRWGG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system
molecule keywords MHC-LIKE PROTEIN T22
publication title Crystal structure of a gammadelta T cell receptor ligand T22: a truncated MHC-like fold.
pubmed doi rcsb
total genus 49
structure length 260
sequence length 260
chains with identical sequence C, E, G
ec nomenclature
pdb deposition date 1999-07-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00129 MHC_I Class I Histocompatibility antigen, domains alpha 1 and 2
A PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1c16A02
3.30.500.10 Alpha Beta 2-Layer Sandwich Murine Class I Major Histocompatibility Complex, H2-DB; Chain A, domain 1 MHC class I-like antigen recognition-like 1c16A01
2R69L 5IEKA 1E6JL 4N68A 4PJGE 3P9LB 2ENYA 1PKQA 2Y5TB 4I5BA 1UA6L 1KJ2B 1IAIM 1JPGA 5HHQA 3FOLB 4OFKA 3P77A 2EEDA 3FB8A 2FBOJ 3KR3L 5I8CB 1RUAH 3O41B 5F1KC 5GHWH 3MUY1 1KJMA 5ESVB 5E0QA 3RVVD 3NAAL 4MA3B 4UB0H 5AD0B 2AQ1A 3H42L 3FHQA 2VXQL 4GS7C 1QNZH 2DTML 2GUOA 2Q7YA 4QKXB 2HFFB 1M7IB 1D5BA 1U8JB 4Y4FB 5IV2B 3VMNA 1NMAH 2BSTA 5GZOD 2IGFH 4Z7QF 1SYVB 1T0MB 2HH0H 2WBWB 2Y07H 5C0AE 2HT2D 4PBVC 2HMIC 4ZXBA 1NMCC 1AGBA 2CDEB 1SEBB 4YGVB 2E6JA 4F7CA 3MRIA 4LKCA 5H94B 5H2BA 4ZMAT 3O2WL 1QSED 1U8MB 3EOAB 2MSPA 3RAJH 4NZUL 4NKMA 4CRPA 3U2SA 5CIPB 2H8PB 2FEEL 1RJYB 1WZLA 4X9IA 5JA9A 2EH7H 4IHOA 2R4RH 4GOSA 5D72L 3F6LA 1Q38A 3QHFL 1CS6A 4HV8A 3QIUB 5EOTA 4FFZH 4HMCA 1DBAH 1VESA 4F8QA 1S8DA 1GC1H 3WCYA 3G6DL 2E9BA 1I9IH 1G7LA 5ALBL 3KPRA 2PO6C 4XC1L 1SVCP 4RFEB 3BYTA 1UGNA 1MQ8A 1MFDL 5F6HI 1BFSA 3QPXH 4CVXB 1ZS8A 3ZSTA 3OKNA 3CNKA 4NZTL 4I18B 3D2UA 4JANA 1LVEA 3WKNA 2DKMA 2IPUG 2XIDA 4NUGL 4XAWH 4JO4L 4P4RB 1IGMH 4JY4A 5LBSL 3DHMA 2P5EB 2DLFH 1ZWIB 4LVNB 1WQVT 3LRSB 4Y19B 3UC0H 1BJMA 1IM9A 3LKRA 4HC1H 4GG6A 1N4XL 2BHYA 2YR3A 2DBJA 4UI2A 4CJ1A 5KG9A 4B41A 4S1QL 2EDXA 4YBLB 3QEUA 1XF5B 1ZVSA 4FG6D 4N0CA 1KCLA 1I3GL 5SX5K 5CWSB 1P4LA 1YMME 1GOHA 4XPBL 4FQQA 1FE8H 4JPWH 1S5IH 4AM0A 4R4NC 4ELKB 3PF2A 4HUKB 1N2RB 1P1ZA 2IADA 2NCMA 4Q0XH 4XHJD 5JW3L 3I9GH 5FHBL 4P46C 4XVJL 2P5WB 1CFNA 4PJXF 3O4LE 2Q8BL 3TZVC 4KKNA 3L3GA 4NT6A 1JPTL 3AMLA 3EO1B 2GJ6A 2D7TL 3MBEB 5DA4A 1I4FB 1OAZL 3TN0C 3CXHJ 1A6WH 4H5SB 1LO2H 1I85C 2PR4L 1I9RL 3K2UH 5DQDH 3TV3H 2YD9A 3RVXD 3X13A 5F72S 4JFOA 5T3ZD 4K7FA 1KN4L 2X1QA 4PJBF 4G6JH 1YYML 1UWXH 3LN5A 4S1SH 2LFGA 2FX7L 1HHIA 2H32B 1ZMYA 3TPUE 4WWKB 5GJTH 3LQMA 1F6LL 4F9PC 2B39A 3PHSA 5HGDA 2DQDH 5JORA 1LD9A 5I1EH 3D39E 1I1YA 2Z31B 3MV7A 5F7EL 2AABH 3SE9L 3GKWL 4G6AC 5KANG 1X6LA 3C5JB 4KJPC 1IC7L 2O5XL 2H26A 5B39G 3DSFL 2NY4D 1J0IA 1A6AA 1R5IA 3FFDB 4FZ8H 3RUGF 3SE4A 5GGVH 2YC1A 2FIKB 2AJYH 4KKCC 2K7PA 4OLZL 5ID1B 1KGCE 2J7LA 3MRQB 1OF2B 3PWNA 4WU5A 3QI9B 5EZLB 2ZCKH 2GSIB 3LMJL 5C08E 3S34H 2E9JA 5EBWB 1G7HB 3PDDA 4ZUSB 4JFPB 1EEZB 5F6IC 3PNWA 4AYFA 1FFNB 1IM3B 4HQQH 4KHTH 1RZKH 4APQD 4NO2B 5GGSB 2AW2A 1H5BB 4LLWA 1UWEH 1FJ1A 2PXYB 2DWDB 4F8TA 4V2BA 4MA1B 4JN2A 1MI5D 4MYWB 3TH4T 3WIFB 1V3MA 4R6UA 4XNQA 1J86A 1DANU 1EZVY 3PGCA 1FG2B 4QOKD 3PXHA 4XNMA 3GZKA 3KYOA 4P0DA 3U36A 3ARPA 5C3LD 2O5ZL 2LTQB 3BP5A 1HOCB 1G9MC 3QEQD 1HWHB 3M8OL 4XP1L 1JCKA 1P4IL 5EORH 5FA4B 2FYYA 5FYJH 3MNVB 4DZ8A 3WFEL 2F54B 4QTHA 4TUKH 1MJUH 1B4JH 3TBTA 2ZJSH 4NM8L 3BPOC 2RCSH 4XNXH 4YPGA 1DN0B 5DJAB 3UTZB 1JZ4A 3MLSL 1WWCA 2VLRB 3RVTD 3DBXA 1NDMB 4PB9H 3BPNC 4K8RD 4MDIA 5BVJA 1BOYA 1ZHBB 3BZEA 1MRDH 1DQML 4PD4J 2Y36H 1MLBA 4X9BA 5CGYC 4P2OB 4B53A 2XNAB 4R90H 5B8CC 3HC4H 5MP6L 2HRLA 3VWKD 2GTZB 1NCUA 2EDLA 4P2QE 1KXVC 4XBPB 3GSVB 3DX8B 1JMZA 2FSEA 2CKBH 1L9MA 4NO0D 1ZHNB 2CK0L 1DBBH 4HCRA 5I1LB 5J9PB 5FM5O 1OW0A 2Z8RA 1GZPA 1HINL 1U8NB 1LO5B 1Y6NR 1IGYB 2HYMA 1RUML 5E9DD 1FGVL 2ED7A 2AJXH 2CIIA 3X14B 1QSEA 2ZKHL 3VG0L 4G9FE 5GIRA 2XV6B 4CMHB 3NBNA 3V4PH 1JGDA 4GAFB 3QCTL 5D8JL 4Y5YA 3W5NA 4MNQB 3MRPB 4HX1A 5FA3A 4DTGH 4JQXC 3HI1B 1RZFH 1NAMB 4Y4HA 5EO0A 5TDNB 2WBJA 5D7IE 1AD0B 2Y23A 2OK0H 1G6RL 4M1GL 1YJDL 2A9NH 3BP4B 3QUYB 4P5TC 3OSKA 2V2WA 4GKZB 3CPLA 5ILTL 1MY5A 3BGAA 3U46B 2ZSWB 5C7XH 4G8EB 2CKNA 3BRFA 3OBAA 4JJHA 1CFSB 4JO3L 3GI9H 4P9HH 4GMTH 1FLRH 5TE6L 3QDJE 4D94A 5F3BA 3SJVA 1RIHH 2CGRL 3Q3GB 1OPGH 1ZA3A 4EN3A 3B9KC 4JDVA 2R0KH 1VSCA 1ZLSL 2Z9TA 3FJTA 3MRMB 3MROB 5CSGA 3ILQC 5KTEL 2VN4A 1FN4B 1BVKA 5IB5A 4RFOL 4C56E 2MFNA 3VH8G 4G9DA 3VXOA 5J6GA 1FNGB 3VRJA 2VXUH 1BEYL 4Y1AE 3L7FA 4ZFOB 4G59A 1TCRB 1F2QA 1CQYA 4RGND 4KWUA 4L8DA 1BGXH 4NJ9H 4XMKL 1NGYA 4PJDA 1YQVL 4LCYA 1WBZA 3HI5H 3LDBB 2PW2A 4NOFA 5EU4B 5C9KA 1Q8MA 3BKJL 1AR1C 3KPNA 3E2HA 4UUJA 4KI5E 2B0SH 2I9TA 3UYRL 5SX4I 4P9MH 4KRPB 3TA3B 4YUEL 4QRTB 3MCLL 2G9HA 1VFBB 3D3VB 1FV1A 5CZXC 1I1CA 3LQAH 1BHGA 5DK0B 3RWHB 3UDWA 3O8XB 4OZGA 4B50A 3CFBA 3V6OC 3KLHD 1IEHA 1HHKB 5GRJL 4X4YA 2EICA 2JE8A 4PJEA 3IDGA 3PWLA 4NQDE 3MRDB 1T7WA 4WEUD 4OM1H 4PJIF 3TYFA 2AJVH 3VFNB 5GRZA 1J9CT 1NLDL 5DRZA 3GBMH 2KUTA 4ZO7A 1FDLL 1HYSC 1EXUA 1XF2A 1A1MA 1ZT1B 4F58L 3V8OA 2I5YL 3HMWH 2HWZH 1ZSDB 2G75B 3L3OB 1EFXB 4NFBA 4YHNA 3PP3K 3TYGL 3BZFA 4ACPA 4YE4H 5EO9A 5CBEB 2GTWB 3GRWL 4YEFA 4H0HB 5FGBA 3WNOA 3KPOA 3UX9B 3EYSH 3HZVB 2K9UA 2YUXA 3BPCA 5IM7B 3ZE0E 1TVBA 5DD6B 3D69A 3I6KA 2NY5H 4G8IA 4HPOH 3UO1H 5MEQB 3JV4A 4M7LL 2Q76A 4QTIH 1ITBB 4P23A 3T2OA 3QULB 1I8IA 3DWTA 4N0RA 4BSVB 3NZHL 3WE6A 1U8LA 4HXBH 1GYAA 3JWDH 1F58H 4IRSC 4HIHA 4DKFL 4HKZB 2HTLD 3GSUB 4LCIH 4POZD 3V4UH 3SDAC 2RBLA 5CJBA 1JF1B 1DE4B 1HHHB 1Z0MA 3HUJA 2OL3A 2B1HH 4YWGH 3OKLB 5BQ7B 5I1KL 5JHDA 1MI5A 2XXMB 1P4BL 1LEIA 5CSBA 5F9JB 4QOKA 1YECL 2A77H 1MQKL 3N1MC 4X4XA 1A02N 2ZZUT 1NUDA 2Y7QB 1YEDB 3QEQA 2XXCB 2IH1B 3SBWC 2W0LA 3FO9A 4WI4A 4XAKD 3NN8B 5F1OB 2VDNH 1T1XB 5IT2H 3T1FA 2HVKB 3C60B 2IG2H 4J3XA 2NR6C 4YBQC 1A4JA 2OI9A 4YHLH 1D6VL 4Z7VE 3VI3F 5F6HJ 1TCMA 3UTSE 2F8OA 4YDKL 4JR9H 1BJ1H 1NMBL 2H2SD 4ZQKB 2LQRA 1FGNH 2XA8H 2ATKB 3JBG7 4O2EB 3ZL4L 5K9QG 4XPFL 3OKOB 4HJJH 4HMEA 2D3VA 4M61A 4RAVB 2VIRB 4X6CA 1ZT7B 5GGUB 3DROA 1TDQA 4JM2F 2YPLB 2E7BA 3D9AL 3QWOA 3T2NL 4ZFFA 1UXWB 4NO0A 4JN1L 3JUYA 4MB4A 3QFJD 4LQFH 1ADQH 1HDMA 1T20B 3CX5J 4FTVB 3VI4E 5E9DA 3K8KA 4ZUTB 1FP5A 3VFPA 4G7YH 3KNBB 1QQDA 4UU9B 4AL8L 5J0BA 1DQDH 3DRTA 5I1AB 2EH8L 4MQTB 1CR9H 3NTCH 3DX7A 2BVYA 1UM4L 1IQDA 3PGFH 4E0RB 5AZ2H 1I1FA 4V1DA 4FP8H 1DVFC 3MFFA 4GRWH 1PBYA 1K8IB 5KSBF 4H25B 4ZXBC 3T0XA 3W39A 2VZSA 2DQHH 4LCCA 3F58H 3DLQR 4M5YL 4OLVH 3SY0A 4J1UA 4AG4L 1R24B 5GGTH 4GT7A 1IGIL 4FN0A 1YQ2A 2PTUA 5EH1A 4LFHG 3F12B 4XBEL 4CUCA 4TOYL 4J2XA 4MNHA 3CSBA 5D2LF 5M7QA 4TVSa 1CDYA 1R5WB 1T1YB 4YGAB 2J8UB 1G6VK 3QXWA 3GM8A 4WEMB 3S36X 1R3HA 4Y4FD 2MQ3A 2H9GA 3QBTB 1EBAA 3TJHD 3ZTNH 5D6CA 1H15A 1PG7X 3SO5A 5ISZE 2ERJC 3TIEB 4W70A 1T3FB 5DDHB 5DUML 5AAMA 4PRDB 4NQCB 4DN4L 5I8OL 1ACYH 4PY7B 3MJ9H 4LRNL 4RAUA 1TIUA 4K71B 2JB6B 3R4DA 3D39B 4Z0BH 3BN9D 5IMMB 4K23L 4MLIA 4IBLT 4G8GB 3HZMA 3C5ZB 4OQTL 2ICWA 3DRQB 2NX5E 3QZWB 4F37K 1HHJB 1U8PB 3IB4A 1NGWA 2AP2A 2A6IA 5HHXL 4M62H 3C2SA 3NCEB 1VA9A 2A74B 4KPHL 3UJTH 5DEFB 5C0IA 2X4PB 3LEXB 4DKEL 3GSNA 2BZDA 1MHCA 4WV1B 2ITDB 1WAAF 3TO4B 1EHNA 2DQJL 1MF2H 5I8EB 4XCNA 3CD4A 4P3WA 1PY4A 2YZ8A 3BP7A 4N0CC 4J3UA 4OCSL 4F9LA 4I9WD 1K2DA 3H9SB 1BM3H 3HMXH 5JO5B 4IIQC 3WNKA 3UZQA 4X5LA 1AQKH 1RUPL 4WENB 3WLBA 3IFNH 1RIUH 1IGTA 3SDXE 4LGPB 5BO1L 2CKBB 4RMVA 2P5ED 1W0VB 3O2DL 4MMZC 2DBLL 1FO0B 1LO0L 4NQXA 1FNSL 3HI6H 2D4DA 4Y19D 1HSBB 1AJ7L 1OAQH 3MA9L 3EO0A 4GKSB 4PRBB 2MPAH 1GHFL 2EYRA 5IKCB 2UUDK 1NJ9A 1U8OA 5FO8B 3BAEL 2XKSA 2Z8VC 3EFFA 3L1OH 4LSQH 3DUUB 4DVBB 4J8RB 5D70L 1A9EA 2VXVH 4L9LB 2GITB 4W68A 5E2UL 5HTSA 3C5SB 3BO8A 2R0LH 5FYLD 3SCMB 3ILPA 1OSPH 2YZ1A 1RK1B 2Q86A 2P5WD 5EULV 4Z7OE 4KY1L 4L3EB 1A4KB 5IQ9B 1T4KA 1YUHA 3MC0A 3P4OB 3VXNA 1ZT4A 3MBED 4ONGH 1AIFA 1NAKL 3EDFA 3QDGD 2YD6A 4PJAF 4RWYL 1DQLH 4AIZB 4OAWA 5F89A 3SE4C 4JVUA 4RDQG 3AREB 3U1SH 1F00I 1T1WB 4IRZH 3MR9A 5FM8A 5A3IC 2CDFB 1Z3GH 1M7DB 3IGAA 4N8PA 2Y4SA 2HKFH 5E8EA 4UTAH 1DLHB 3GHEH 5FKAB 4ZPVA 4QNPE 3CVIH 4JFHE 4EDXA 1A6UL 4K3DL 4WWKD 5HI5C 5DSCB 5DA0B 2ZPKH 4N90E 1IL1B 2G5RA 4P59L 4NQVA 4DCQA 3VFOB 3MLWH 2X09A 3WEXB 2Z31D 4P2RA 1F3RB 1EGJH 3RKDD 1B90A 2C4XA 5IMOA 3GJEB 4Z7UE 3B9DA 3E6HA 3QQ9C 5L9DH 4Y2OA 4XPAL 4GUPA 4NQSA 2Z35B 5DS8B 4ZSOA 1HKLH 1GIGL 5I18H 3GSOB 4ONHB 1LGVA 1HIMH 1NCBH 3ZKND 3FTGA 3QNXB 4JB9H 1JFQH 3QCVL 3QI9D 4XVUC 3QEHA 4DGYH 1MCSA 3NZ8A 4XVSH 2YXMA 4NHUB 3SQOH 1LEGB 3RBSA 1VKXA 1CK0L 3O6ML 1UZ6E 1ZLVK 4KK5C 3TPKA 1SY6L 2H2PD 3VXUE 1W0YT 2NXYC 3THMH 3EIFA 3LKPB 1INQB 3R1GH 4LHJB 2PXYD 1PZ5B 3LPFA 3OAZK 3F7QA 4KUCF 3UTTB 3C09B 1HZHL 4HBQA 2H45A 1U92A 3P9LA 2Y5TA 4XWOD 4KI1A 5E2WL 1KJ2A 1OW0C 1SYSA 2HRPL 2BERA 2F54D 5C0CA 4TUOA 3JWOL 5I8CA 3NACH 3O41A 5DMKA 1HNGA 3SGDH 5T3ZL 3ULSB 1LE5B 1GAFL 1IAMA 3BFOA 3ARSA 4MAUL 5ESVA 5LGHH 3ULVL 1AD9A 1YPZA 3FO1B 4F7EA 4MA3A 4U4BA 3AAZB 3KJ6H 3LS5L 2VAAA 1T7ZA 1J8HE 4XT1C 4Y4HC 3IAPA 3TNMA 2VXSL 2WBJC 5EOCL 5TF1L 2AI0H 1M7IA 2HFFA 5DHXB 5DJYB 4ZTPH 4PRPE 5JMRA 1RULL 3C2AL 4XNUL 43CAA 3VXMB 4Y4FA 5D71H 2AJSH 5ICYB 5JUEL 4HKJB 1SYVA 3GDBA 4ZOEA 3TJHA 4AEHL 1Y6KR 4NWTH 4PJ5E 1V7NH 1KFAH 3O6KL 1RZIB 1C7TA 1JNNH 2CDEA 4R97B 2UZXB 1SEBA 1I1AA 2VDKH 4NPYA 1OL0A 2CO6B 4XP6L 5HYSB 1MVFA 2OQJB 32C2B 4G7VL 4EN3C 1KT2B 2XN9E 4MNQD 4Z0XB 1RJYA 2DQUH 1PZUB 5KZCB 5HDQH 5ERWA 1VGKB 5L8JB 4WNQB 4P3DB 3GJFH 3P4NB 4Z7NF 4QEGA 1KCSH 1LO4H 2VDRH 1BFOA 4OZIB 1PDKA 3BN3B 4PUBL 5CD5D 1XCTB 5K9OB 5DJ0A 4JPKH 1JNJA 4X6DA 1FVDB 1MCCA 5I15H 1EAPB 4LLDB 2Y06L 1CE1H 4UDTB 3C9NB 4CVXA 4XVTL 4QRRE 4RQQA 3DURB 5JOFA 4LPCA 3NA4A 4KJQD 5ADOH 3H3BC 3RPKA 5EBMB 1ONQA 3KS0H 4LCWA 5F9OL 1FAIH 1CU4H 3E2HC 1OB1B 3AVEA 1YEGL 4FMKA 3QO0B 4KKBC 2ORBH 3RDTB 3W9DB 1U8HB 2I27N 3AC0A 2EDKA 5I76B 3LRSA 4Y19A 4NQUA 1H3XA 1OY3B 4H88L 2UWEE 2QQQA 4HS6B 3UDWC 1T1ZB 2HA1A 2O5YL 3TJEL 5TDPA 3GEWB 5F70A 1OP3K 1XF5A 4OT1H 3EHBC 5CWSA 5I71C 2N7AA 1KIQA 4GRWB 4ELKA 1RZ7H 4OI7A 2WP3O 1AQDB 3I6LE 1N2RA 3EYUL 5DMYA 4NQEB 3WFCL 5JLZB 1G6RA 3RL2B 2P5WA 2BVOB 3P9MB 4X8XA 4K3EL 1KIUA 4X99A 4WW2B 5L6YH 1A7PH 4G3YL 4R7DA 1S9YB 4KRPD 4AEIL 4HDIB 2CIKA 3TA3D 3G5XA 4BM7A 5FO9A 2FJFB 1CZ8H 3MBEA 1ORQB 3PQYE 4A6YB 3QDGA 3RWEB 2GFBB 2RGSA 3D3VD 4H5SA 3QQ3B 3GHBH 1NCDL 1HCVA 4MXQD 3ULUE 3O8XD 4F15B 3W9EA 3MRHA 5FFLA 2CPCA 4NCC2 3KYNA 4L3CA 4P23C 1S9WB 2V5SA 3CXDH 1NBVL 5I1GL 2DM3A 5GGRA 2H32A 5DVLA 2DQTH 5I8KH 4WWKA 2J6EA 3EFDL 3CDGA 3BH8A 1IGCH 4NZRH 3PIQB 3RU8H 5D1QB 3OR7B 3DYMA 5CKAA 4RNRB 1JYVA 2Z31A 3ARTA 3GO1H 1EFXD 3BDBA 4PRIB 4X9FA 3DGGB 4NM4L 1DP0A 4CKVX 4I0PB 4LF3B 3QAZB 1AP2A 3BHBA 2HG5B 35C8H 5HHVH 3IRPX 2BHUA 4XGZB 3ZTJH 2VDPL 3VFTB 1FYTE 1AI1L 2FIKA 3Q6GL 4G8FA 2YBRB 3V0VB 3QRGL 4DUXA 3MRQA 1OF2A 5DR5L 2VH5L 4NSKA 4ELMB 4Y4KB 3QJHB 4WDIA 5EBWA 2V17H 1G7HA 3BDYL 4K9EL 1EEZA 3RVTC 2QADC 2MCPL 2ADIB 1FFNA 3DJ9A 5KSAC 1IM3A 3DECA 5JTWA 4QY8A 1Z9OA 4NO2A 5GGSA 4GMSH 4JLRA 1H5BA 4Z5RA 1ZXQA 3CFJB 5ISZB 3EJYC 4YDJA 3LN4B 3LEVL 3UYOD 3HE7B 5J1AB 2XZZA 3JTSA 5MENB 3HFMH 3D48R 2ADFL 1BREA 1FG2A 1OSZA 5FGCB 3HNTH 2QQKL 5AWNH 3T0EB 4LSRL 1HOCA 1TQBC 4OD3H 4ZYKB 3FAXA 2N56A 4IJ3B 2NY6C 5D9SB 4U1GC 5FA4A 3OPZL 4IMLB 1S7WB 4QRQA 5FM4A 3W11D 1B9ZA 4LEXL 1QP1A 2WQRA 5BOPA 1EMTL 1BBJA 4JPVH 4D9RE 4NNYA 4JJ5B 1LQSR 4QYOB 2YHGA 1D9KB 3C60D 3UTZA 4ZNEE 4S0SD 2C1PB 4DWHA 1NDMA 1WV7T 2VKXA 5ITFB 1OT2A 2HP4A 3OJDB 4QXGL 4WEBL 3CFCH 4HIXH 1F6FB 3KVQA 1KEGL 1JPST 4JZJB 2YPLD 3X3GH 3HPJA 4AENB 4Y7MA 4TNVK 3MOAH 4LCCC 2VSCA 3O3EA 3GSVA 3DX8A 2JCCA 3LPGA 4HH9A 5DJZB 4CNIA 1FZJA 1JYXA 2W0PA 2K7QA 4FTVD 4TVPE 1LO5A 2J88L 4YX2L 5CEXB 1VFUA 3BKYH 3FQWA 5T3XH 4O2FA 2AV1B 1DQJB 1KELL 4NGHH 3WDHA 3PG2A 1INEH 4JG0H 4M8QA 1IJ9A 4Z77B 3HI1A 3PDGA 3MLVH 4QXUH 1VEOA 1NLBL 4R26L 4U6XB 5EIIB 1AD0A 4J3OC 5HVFB 4P3CL 3BPLB 4GKZA 3OZ9H 3U46A 2E6QA 5DJ6B 2DIBA 4PRAB 4G8EA 5IHBA 5MI0C 3TBWB 3W0WB 4KVNL 4UIMB 4P5MB 2WV3A 2X4OB 2EKSB 5FYKH 5C07E 2AJ3A 2BSSA 3RA7H 3LPWA 2CRMA 1CGVA 3LSOA 4M6AA 2NW3A 1KIPB 1A1OB 4OGYH 4IDLA 1H3PH 3PDOB 1DBMH 2EO9A 2QSCH 3KLAB 2P7TA 4HG4J 1FSKB 4HF5H 3MRMA 2R2BA 2VLMD 5IB4A 5JR1L 3V52L 1ROWA 4BKLB 1GZQB 3O9WC 4P48A 2FB4L 3V7AG 4K7PL 3GFUA 4F9LC 3P0VL 1TITA 4NQCD 1MFBH 5GISL 1J0KA 5I0ZA 4PJDF 2H3NB 1BOGA 3BOVA 1A14L 1CF8H 1TCRA 3EJJX 4PJXB 4G6KL 4OZHA 4CVWA 3D39D 3B2UD 1XGPB 4G8GD 3C5ZD 3B83A 3HG1B 4EUPG 2ZCLL 4WUKL 3SGJA 4S10A 4Q2ZB 5FYJD 2BOBB 5ALCL 2B2XL 2CO7B 3RIFK 1J1OH 4GSDL 1F4HA 3ZTJG 4HIIB 2WWMD 1RPQA 5F9WB 4IDJH 5JOPD 4OZGF 4F3FB 3NABH 4AH2A 3D3VA 1NCCH 4PJBB 3U9PH 4FXGA 3I6GB 1CDHA 1L7TL 3MNZA 4MXQA 1JPFB 4Y5VB 3O8XA 4PJEF 5C71A 2UY7A 4CN4A 1A3LL 4L4TE 5EO1A 1HHKA 2I24N 3H9SD 1FFQA 4UIKH 4Q9QH 3V5HB 3W2DH 1F11B 4X6FB 4X4MA 4DOHB 5BW7A 2YMXH 4RAHA 3VFNA 3DYPA 4PG9A 4JHAL 3BE1L 5J56B 1QUNA 2A9ML 1TLKA 4YXKH 1ZT1A 4PJGA 3QA3B 2WLZA 3L3HB 2DN7A 1NC2B 5FCUH 4WU7A 2HVJA 3QNYB 3R06B 4JKPH 3RFZC 1F2XK 3DXAB 4ALAH 5CBEA 2GTWA 3L5XL 5DHYB 4KC3B 4NYLA 3UEZA 3SOBH 2OJZH 4EXPX 5IB3B 2E7MA 4AMKL 3OKKA 4JKLA 5DVNA 3GJFB 5EPMB 1FH5L 5MEQA 3WJLC 2QR0A 4M93B 1ND0B 5K9QI 4JHWL 3SCMD 3GMLA 2GK0B 3BUTA 1LP9E 2XY1A 4LAJH 1NSNL 3EUUA 4HUNB 5D5MB 4Z18A 3U4BH 2EIBA 3FAWA 3H0TB 4L3ED 4KVCL 4FXKA 2Q3AA 2DMCA 4GAGL 2EDNA 3LZFH 1T7VA 4H1LH 2EEBA 4LVHC 3GSUA 5AYQA 1ORSB 5IOPB 2UYLB 1HHHA 5F7MC 1QSFB 5BQ7A 3OKLA 1QFWL 4MQ7B 5HJ3B 1IKNA 1IEBA 3VXPB 3ARED 3WNPA 3RZCB 2GSGB 2H41A 4JVWA 1KTLA 4MCYA 1HH9B 1VFAA 3IRZA 2CJUH 3QIWB 4LSSH 1LEKA 5H35B 2IH1A 2WINA 4RFNC 5D96C 2C7UB 1BZ9A 2F53E 3KPQB 3QHTC 4DQOL 4HAFA 3FN0L 1ZLUK 3T0DA 4FQLH 3RX7A 1F8TL 3EYFA 1IKFL 2D31B 3LH2L 2HVKA 2W60B 3C60A 3OGCB 3GMOB 4QRUB 3TVMB 2QKIB 4OI8A 5C0RH 1JNLH 1KCVH 3WO3B 4X6CF 2ATKA 5FF6B 4L8CB 4M1CC 1LK2A 1N0XL 3MUJA 2BHZA 5C86A 3C08H 1PEZA 3P73A 2EKJA 4LSDA 1ZT7A 2EDOA 3T4YA 3V0WL 1C12B 1DBKL 2VR4A 1R6VA 3IJSB 3GMPA 4MD4A 5D2NE 1UXWA 1YNLL 4MNGE 3OGOE 1YNKH 2A38A 1LO3L 4S0TD 4IM8A 1CXFA 1MHHB 1RZ8B 4GS7B 5SWSB 1DSFH 3CUPA 1Q1JL 1MRCH 3HS0B 3OKEA 4Y8DC 3ARUA 5HPOA 4ODHL 3KNBA 3HAEG 1A47A 1U0QA 1AXSB 4WTWA 2PYFB 3KXFB 5LGJB 1FBIH 1NGZB 2QHLA 5E03A 1VPOL 1F3JA 5KVEL 4DK6A 3SKOB 3ZYIA 4YHOH 2F5BH 1NMCB 1Q9OB 2P8MB 3BIAX 3G5ZB 3O4OC 5C0ND 3UTTD 4F57H 3TJHC 1NUNB 4HWBH 2QL1A 1R0AL 1K8IA 1OGAB 1WFOA 1YMMA 5L7XL 4H25A 1TNNA 1I1AC 1MJ8L 1PG7W 1F4WL 2NY7H 5JXEA 3FO0H 1D6EB 3O4LA 1WSST 4JGUA 3BN9C 2DQIL 3ZT7A 2P44B 4L8BA 3FQTA 4XP4L 2WZPD 3F12A 1DDHA 4QHKJ 3CH8A 4OFIA 1P5UA 5M95B 5JPNA 1JTPA 4M7LT 3UROR 3AS2A 3UAJC 5INCB 3AU1B 2NW2B 4MQXC 3TO2A 5HGBB 3U0PB 3BWAA 3L3DB 2I07B 3VXMD 4DKAA 5C9JA 1TNMA 1T0PB 4S1RH 4HJ0D 2E27L 2M26A 5E8OB 2GQHA 1RUQL 3MOQA 5SX5H 4F7TA 1KC5H 2JIXB 3QJFB 2XQBH 4PRDA 3EZJB 3IDJB 3NPSC 3H3PL 5E4IA 1IGJB 4LDOB 2DTSA 2FO4B 3IDIA 5IMMA 2F5AH 3D39A 1NEZG 4ZS7H 3ZDYE 4G8GA 3C5ZA 1F45A 3DRQA 4JZNA 1HCFX 1X4ZA 1QBBA 5HBBA 1CG9B 5IVXB 5IWLA 3N1GC 1CXIA 1R3JB 1U8PA 2EZ0D 4DJMA 3VXRE 4M1DH 4MD0B 3LEYH 5HHNB 4IEFB 3NCFB 4Z7WE 1D3CA 4AZ8A 1ZK9A 4NBXB 5DEFA 3O2VL 1DL7H 2X4PA 3LEXA 2CDGB 5D7SL 4WV1A 4AEEA 1FVCB 1QRNE 4HGWB 1CFVL 4TSBH 3UMTA 3J8F7 2YPKB 4OLUL 4YBLC 5C08A 2X1XR 3ARWA 3P30L 4YQXH 4MXVF 4P46B 5EU7C 5KN5A 3H9SA 1BQSA 3HZKB 3GSWB 5JO5A 1S3KH 3TZVB 5KS9F 4JREC 3KLSA 4H1LG 1CL7L 1XGRB 3UPCA 1YNTB 4HUWB 2R2CA 5BXFB 4WWID 4JPIB 1MCJA 1CT8B 5K9JH 2AK1H 2JK5B 3RDTD 2CLZB 4KGLA 1FO0A 4KTEH 2ITCB 4K3HA 1KB9J 1HSBA 4NO3A 1MCLA 1IAOA 2DWEA 5EOQL 3NIDE 5TFSH 3B8YA 4GKSA 1OAKH 3DTXA 1JWSB 5IKCA 3DV4B 3VU2A 5C3TA 1QO3A 2V7HB 5E2JA 4XZUA 2FNBA 1YN6A 4J8RA 4QRPE 3QCUH 3T4AB 3FT4B 4B0MM 4L9LA 1MFCH 3VW3L 1WWWX 3UBXI 2C3WA 3MLZH 4EZMA 1ZLWK 4HUUB 3SCMA 2X2YA 3UTSD 4HIEB 4NQED 4CBPA 1RK1A 1RHHB 1R3IL 1IAIL 6FABH 4OTXH 1OTUD 1ZHLA 3KYMB 3MMEB 3RKDC 4RRPA 3C6LD 2DQCL 4LCUA 4UT7L 2EDWA 4P2QA 1T03L 4XH2B 1UEMA 3S36H 4G6FD 2Z93B 4AIZA 1IZKA 2VQ1B 2X9XA 2YKLH 4MMXC 3RWJA 3AREA 1T1WA 1CD8A 5BV7L 1PG7H 2CDFA 1DZBA 5F6IB 1Q94A 2BNRB 3U9UB 4G9FA 2R56L 5E6ZA 1X5GA 4JEGB 5IEHA 2OTWB 1TZIB 4BZ2L 1K9TA 1DLHA 3MOBH 1JHLH 5FKAA 1HILB 2F19L 4LK4A 4TTGA 4NP4H 2H2PC 1A8JH 3MLTB 3QR2A 3O0RL 1XGYL 3MRKB 3A67H 5D1QD 25C8L 1KBGL 3WEXA 2NY0C 1CFQB 3VD4A 4PRID 2Z91B 5DD5L 4ZTOL 2JELH 2JJWA 1JL8A 4I0PD 1A64A 4EIZC 4LLQB 2Z35A 5EU5A 3RPIB 3BPOB 3JV5A 3REWB 2IANE 1BLNB 1CXKA 4ONHA 5JNYA 2AXGB 3ULUL 5ACZB 5FUOH 3JTCA 1MH5A 1OTSD 3QDJA 2C3XA 3BPNB 3PV6B 4BSWA 3SPVA 3EJZD 4M6OL 3LRGA 2YS4A 4HPYL 4Y4KD 3CK0H 5L88L 5BMFL 3RNQA 1INDL 4ZFOL 2OP4L 4NRYA 2XG5A 4KDWA 4NKQB 4FNLH 3RY6A 5B8CB 4NKDB 2XZQL 4M48L 3MNWB 2FGWH 1INQA 2EC8A 5ISZD 3WUWG 3HE7D 3QUZA 5MEND 1R3KB 1XF3B 5DTFA 5DJDA 1RUAL 3CSYA 3T0ED 5D7JC 5GHWL 3T3PF 3FL7A 4UB0L 4JZOA 1FIEA 5T5FH 4KXZI 1YPZF 5D2LB 1D9KD 5LG1A 1LE5A 3KPPA 3I50H 3FO1A 1Q0XH 1A3RH 2HN7B 3T2QA 4MJ2A 5A40E 1NMAL 4I2XB 5A2JH 2IGFL 4P5TB 4QF1A 3MV01 5K93A 1UKQA 3VFWB 2HH0L 2Y07L 3RJDA 1YYLL 5DJYA 1CCZA 5C09E 5HHMB 3F7VB 4LKXB 3LS4H 3NIGF 2YPVH 1FFRA 2A83B 4U0RC 4L5FH 4NQDA 4U1KB 3U7YL 1RZIA 2XTJC 3RAJL 4OCYH 3GSQB 3ABZA 5BRZB 1BX2B 3LD8C 3E3QE 3TT3H 4I0CC 4KTDH 3BVNB 4WFED 1D5IH 3N1QC 4JFDB 1FZOB 5HYSA 2OQJA 3B9KB 1HI6B 4OUUB 4KJYB 5K59F 1DBAL 4Z8FL 4Z0XA 1U91A 1VACB 1GC1L 2HTKD 1FAKT 3GKZA 1I9IL 4XP5H 4WNQA 2AQ3A 4P3DA 1MRFH 4ZS6D 2X1WL 3AXLA 5FV1L 4BUHA 4OZIA 3DX6A 4X6DF 3QPXL 3TP4A 4EIGB 4O5LL 1E4WH 1J1PH 1YEJH 4KV5F 2P48B 5IFJB 1WEJH 1NGXB 1JZ2A 3NCCB 1JRHH 1C5DB 5L8KB 2X70A 4NC1C 4XAWL 5IK3B 3W0WD 1IGML 3C9NA 2DLFL 3DURA 4MA7H 4TVPL 4KHXH 3LDBC 4QXWA 3SGJC 4MWFA 3GSXA 3UC0L 3IFLH 1HWGB 2X4NB 4TNVF 4HC1L 1JI2A 1QLFB 2GJZB 5FIEA 3PP3H 1YY8B 3H9HA 3RDTA 1MWAA 3W9DA 1U8HA 2BRRH 1FZKB 1AGDB 3MLRH 2OSLA 2EDRA 5DRWA 5E99H 2AKRB 4YZFF 2DQEH 5CEZE 4HS6A 4MXQC 4P57A 4RMUA 4JPWL 1S5IL 3GB7A 4JFHD 4PJ9A 4Q0XL 2HT4C 3I9GL 5EG6C 4HT1H 3BJ91 2R29H 3SE3A 3ZKMD 4HCRH 5BW7C 1I8KB 4G80A 1F4YL 4JRYB 1PGRB 3FN3A 1AQDA 5IW6B 3UTSA 1NQBA 4I0KA 4NQEA 4N1CA 3SDCB 4LSTH 3RX8A 1LO2L 3MZTA 4PGZA 5DQDL 2R23B 3SKMB 2L4OA 1J11A 3FQRB 4LASH 2BNQE 4H26B 3TV3L 3H9ZA 1S9YA 3C6LA 4XMLH 2FJFA 3N06B 4QHUA 4HIJB 4A6YA 3DIFB 5IMLA 3TFKD 3RWEA 4HUVA 2GFBA 4G6JL 4JRXE 5CMAB 2OTPA 1J0ZA 4S1SL 5CP3A 2DL2A 4U6VH 1K85A 1S9VB 2OTUB 3VRLE 1J5OH 1U6AH 1AKJB 1NUFA 3VXUD 1TJGH 1FFPB 1QZ1A 5TJWK 4IRSB 1WIUA 5I1EL 4ZG1A 3E6FB 1DJSA 3SDAB 3BD5A 1MUJA 2NY2C 2P42B 3L5HA 1OM3H 3Q5YA 4E5XB 4NHCH 3PIQA 2VXTH 5D7KD 5D1QA 1QSVA 4FZ8L 1NC2D 4RNRA 4XHQA 5GGVL 4ZUVB 3CX2A 1CD1B 3OXSB 2R8SH 4PRIA 1FNAA 3DXAD 2MHAB 1JHTB 4XC3H 3CFDB 1CTNA 2L0DA 4I0PA 1XGTA 4LF3A 5GGSY 2ZCKL 4XGZA 4FABL 3S34L 4WHTB 2IMNA 3BQUC 5IMKA 4HQQL 2YBRA 3RIFF 4KHTL 4QHNB 1RZKL 4X5WB 12E8H 2VLJB 3ZMRA 4Y4KA 3QJHA 1UWEL 5CP7B 5DRNB 3F6IA 4BYHA 1QEWA 4TRPH 1Q9WA 2V5TA 4FZEH 4I5BB 2J8HA 3H8NA 4JGJA 1NFIA 5FOJA 2NYYC 4PJ5D 1UVQA 3CFJA 5ISZA 3P0GB 4FFWC 1N5AA 3L9RB 3P77B 1OQOA 3LN4A 3HE7A 5EORL 3FB8B 2VZVA 3RUGE 1DCLA 1ZGLB 5I16A 3ZHLA 2EDBA 3RZCD 3OX8B 1MJUL 1B4JL 3CZJA 4TUKL 1T7YA 4DVRH 2RCSL 4N8VB 4XNXL 2EYSA 2XT1B 4DGVH 4Z6AT 4GBXC 5D9SA 4PB9L 2NX5A 3LRHA 1S7WA 2GUOB 4HW6A 4ZOBA 1MRDL 3UYPA 4G42A 2Y36L 3BGMA 1BJ1J 1D5BB 4JFYA 1D9KA 3TVMD 4FOMA 1KYOK 1S9XB 2BSTB 5DD1H 4R90L 5ITFA 1WFUA 1DVFB 3HC4L 3OJDA 2VDLL 3STZB 5KOMC 1XR8B 2BXZA 2X4TB 2WWKO 4ZXBB 1AGBB 4A2LA 1DBBL 4FFVC 1CDBA 3MRIB 2NNAA 4EEEA 5H2BB 4XXCC 3JXAA 4JZJA 1JZ6A 4OIIH 2AJXL 4AENA 5EBGA 4Q9RH 4LBEA 4NKMB 3U2SB 5DJZA 5HHOE 1GPOH 2AXHA 2DI8A 4MCZA 5JXEC 3SDXA 3V4PL 3S5LB 4QXTB 3MA7B 1EJOH 3GMMB 3H7LA 1YEEH 4DTGL 1NDGB 2ZUWA 1RZFL 5EOTB 1IAKA 2AV1A 4QHLB 2OK0L 3F7RA 2A9NL 1JMXA 3TCLB 1WISA 1TZHB 2ERJB 5F21B 1SM3H 5C7XL 2HMID 1ZS8B 3QO1A 4DW2H 3OKNB 4U6XA 5EIIA 5HGAB 4D9QD 4WFFE 2D9QB 2YRZA 2OL3H 1OGAD 2IBGA 2VDQH 3GI9L 4P9HL 4GMTL 2P49B 1FLRL 4PRHB 2J4WH 1D5ZB 1G1YA 1MOEA 3TBWA 1RIHL 4UIMA 1G7JB 1OPGL 4P5MA 3VRIB 2X4OA 3FB5A 3IJHA 1CGSH 4PLKC 4Y0GA 4RZCB 2R0KL 1IM9B 3LKRB 5IWLC 4DN3H 1MIEH 4GG6B 3AY4A 2P4AB 4P99A 1JZ5A 2JJSA 5KG9B 2X9YA 1EO7A 3NGBC 5F3HB 2IFFH 3MLUH 1N59B 3QXDA 2G60H 3QEUB 1WK0A 3JWOC 4K8RH 2VXUL 3V7AE 4E41B 2W9EH 4YPJA 4AM0B 2UUDH 3BISA 1GZQA 5EUKB 2VRAA 1U36A 1P1ZB 2IADB 1BGXL 4IIQB 4NJ9L 1OP9A 3K46A 5DVOA 1KCUH 3WD5H 3O6FC 1CFNB 1FIGH 4U1SB 1YC8A 2JIXD 4U1NB 2CSPA 3HI5L 4K94C 4OZHF 2YA1A 2FECI 1EEQA 1RVFH 3KWWB 3UBXB 1TFHA 3S96A 2GJ6B 1F4AA 2B0SL 3L3JA 5LWYH 2NQCA 3PUCA 2QSVA 4P9ML 1PSKH 1XGPA 2ESVB 5F7NC 1II4E 4Z7UA 4N0FB 4YR6A 3ARDC 4YHMH 1X5YA 4Q2ZA 2AV7B 4NWUL 3LQAL 3X13B 5J8OA 4JFOB 4FQ1L 4JFFE 4LU5H 1WCBA 1QHPA 5TPWH 3INUH 4ONFH 3DETC 1CGWA 3LN5B 3TFKA 4F3FA 3WHE1 2WANA 4R4ND 5BS0E 5JIIA 3GMQA 1V3LA 2EDHA 3I6GA 4OM1L 2AJVL 1DEEA 1JPFA 4Y5VA 5K9KB 4XNYH 4P46D 4UT6H 3KDMA 3GBML 3TF7A 4L8SC 5JORB 1I1YB 4YK4C 3V5HA 3MV7B 3VXUA 3N50A 3TZVD 4DUVA 2BFVH 3K4DA 4L4VE 1F11A 3HMWL 4GQ9H 1E27B 3V8CA 1QYGL 3UTPE 4PJGF 5DFTA 2H26B 4HZAA 3QWQB 4FQ2H 4YE4L 1E6OH 1FQ9C 1A6AB 3T65A 2YC1B 3B9EA 3S4SB 2FEEI 3U4EB 3EYSL 5D1XC 3MLPA 3B2VH 1G0YR 1RZJH 3PWNB 2NY5L 1EBPA 4HPOL 2ICCA 4YC2C 4QTIL 5EUOE 3QDMB 2PYEE 5JW5A 5IBTL 1E4XH 5I66B 5J1SC 4IOFD 1F6AB 3ET9F 5IB3A 3X11B 4PJIE 3VFGH 4HXBL 4ODVH 1F58L 1MCBA 1ND0A 4MD5A 5HDLA 1ZLVH 4LCIL 3V4UL 3IF1B 1BP3B 4JN2B 4G6AD 2X1PA 5D5MA 3D18B 4YWGL 1A7NH 4H8WL 1ZOXA 4KJPD 4XNMB 4D8PA 3DVIA 3KYOB 4PRPA 5CINH 5C09B 2ZUXA 4JFXA 2A77L 3FRUB 3OAZH 1ORSA 5BJTB 4KKCD 5JW4Q 2FYYB 4PJ5A 5FYKD 5FECA 2UYLA 3I75A 5EWIH 4DZ8B 1GH7A 3FMGH 5E08H 4QTHB 5INDB 7CGTA 3VFVA 2VDNL 4JFQA 4KKAC 3RZWA 3GSNH 2GEEA 3DBXB 4YDIL 5IT2L 2BNRD 3LIZH 1TQCC 2IG2L 4GAYB 5IG7B 1H9VA 2PTTA 4YHLL 2NXYB 1MLBB 4S1DC 5C6WH 2XN9A 1NCAH 2GJJA 2C7UA 3KPQA 1VADB 4JR9L 4K55A 1KULA 3TESA 2AJUH 1FGNL 3EGSB 3MRJA 3RY6C 2W60A 5HGGS 3OGCA 3GMOA 4QRUA 4HJJL 1RJCA 3QUZC 4DFHA 4EI6A 5FKPA 1OTTC 3C09C 2EC9T 4LQFL 1ADQL 4C83B 1YMHB 2CIIB 2XA3A 1EV2E 4LPXA 4M7JL 2VE6B 4G7YL 1C12A 1EPFA 3IJSA 1JGDB 2BK8A 3EOTL 4HX1B 5FA3B 2D0GA 1DQDL 4NZUH 3LVEA 3HTLX 4KI5C 1CR9L 3NTCL 1MHHA 1RZ8A 1CICC 4MHHG 4TUJA 4Y4HB 5EO0B 2WBJB 4HLZG 3HS0A 2CRIA 5AZ2L 5D72H 3MBXH 1IARB 2V2WB 5HPMB 4CMMB 4FP8L 2OR7A 2PYFA 5E8PB 4OGAD 2UWEA 1OAYH 4QGYA 2IEPA 1Y18A 4RGOH 3G6DH 4OIBA 2DQHL 2X4QB 4KQ3H 3F58L 4N0YH 3BI9X 4XC1H 4OLVL 4HJ0C 4K9EC 4XMPL 4JKKA 5GGTL 3UJIH 1OGAA 4U6TA 5TGBA 1LDSA 1KV3A 1A6ZA 4F2MA 4R97C 3SJVB 1RY7B 3U0WL 1ZA3B 4EN3B 1N5YH 2BVTA 2OZ4A 3DHJA 1OARH 4NC2B 3O3AA 4M9PA 4RMRA 2J8UF 4OCXH 1BVKB 1GGTA 3BP6B 1BD2B 4P5TD 2VDMH 3ZTNL 1GXEA 4G9DB 3VXOB 1EHLH 2I26N 5INCA 2H6PB 2XKUA 2Y5EA 2NW2A 1IQWH 4S11A 5HGBA 5DUPL 3U0PA 3CLFH 5KSBE 3L3DA 5AZEH 4C54A 5DGRA 5EC1A 3F7YB 3MJ9L 1NGYB 1J05A 1NCWH 1I3GH 1KACB 1OP3H 2F58H 1EFQA 5E8OA 1NEUA 2PW2B 5C8JA 2L7UA 4LPVA 2D7OA 3CGTA 4PGBB 3QJFA 5BRZD 4L29A 3E2HB 3IDJA 2I9TB 4I3RH 4JFDD 2RHEA 1QR1A 1JPSH 2Q8AH 3B9KD 3H7BB 4M62L 4LOUC 4O58H 3UJTL 5DFVC 3ILQD 4U1JA 1X4XA 1FV1B 3ZHDA 1MHEA 3MXVH 1CG9A 1YC7A 2Q87A 1BWMA 1IT9H 1IRAY 4F7PA 1R3JA 1MF2L 4Z76B 3FQNA 5B38G 4X4YB 1FYTA 3C8KA 2KDGA 4PJEB 1WZMA 1TENA 4GLRI 2QTEA 4OFYD 1BM3L 1XGQA 3HMXL 4PJ9C 5FV2A 3NCJH 3TYFB 5I71B 1FVCA 3RRQA 4HGWA 5CJQH 2P45B 4PLNC 1AQKL 2YPKA 1OHQA 3IFNL 2MJWA 3KS0J 1RIUL 3SE3C 1EXUB 1TPXC 4P46A 1XF2B 5F7UA 1A1MB 1KJ2H 1AR1D 3QH3A 3MO1A 4D9LH 3MQIA 5CFHA 1BVZA 5E1AA 5EO9B 3VXSE 4YXHL 3UJJH 4QGTA 1XGRA 3GKWH 3KPOB 3QEGL 1CT8A 5CZXD 3K2MC 4R96B 1I85A 3S98A 3C6LC 3MV8E 3BPCB 2O5XH 4PJ7E 5EDXA 1NFDE 3D69B 4LSQL 1L0YA 4M5ZH 3JV4B 2Q76B 3K74B 1ERNA 4P23B 4PJCE 3WSQL 3KYAA 1JWSA 1KENH 2R0LL 3DV4A 5MHSE 3Q1SH 1OSPL 2V7HA 3WE6B 4OD2B 1X5KA 2R4SH 1U8LB 1HYSD 3T4AA 2X4UB 3FT4A 4ZNEA 4HIHB 4F9PA 4HHAA 1WITA 2IPUK 3CVHB 4JRYD 3V0AC 3HUJB 4HUUA 1QVOA 1SBSH 4HIEA 4NUJB 4ONGL 3SDCD 5JHDB 1HXMA 3HR5B 5D1QC 1LEIB 4QOKB 4X4XB 1PAMA 3U1SL 2FX8H 2V5YA 3IXTB 4IRZL 4UQ2B 3DUHA 2YK1H 5A2IH 1Z3GL 3NCBB 4I0PC 4XH2A 1UADC 3WXWH 2EDTA 2HKFL 4ORGA 2Z93A 4NKIL 3TCXA 4UTAL 2VQ1A 2YD4A 3GHEL 5I0DA 5CSZA 3T1FB 1KB5L 2FH8A 3T09A 5CEZL 1A4JB 2QADB 1AKJD 4TTDC 2BNRA 2ZPKL 4HLJA 5KSAB 3S88H 1NGQH 3EBAA 4IRSD 1TZIA 3MLWL 4Y4KC 4HZLB 3SKJH 1HILA 1EGJL 3B3IA 4WFGD 4XXDB 5K33A 3MJ8A 1T5WA 5DMIH 4M3JA 5L9DL 2ILLA 3IS0X 3IAQA 4KKLC 2FWOB 3DROB 4YHPB 3PABB 2ZG2A 4HS8H 3D25B 1CFQA 4ZFFB 5I1IH 3I85A 1HKLL 5I18L 1TQBB 2Z91A 1DQQA 3Q0HA 1HIML 2NY6B 4U1GB 2CK0H 4JB9L 4ZOAA 5ABDE 1JFQL 1XIWD 2VERN 4DGYL 4XVSL 4LLQA 3SQOL 2IQAA 1RUMH 2B4CC 3RPIA 1QQDB 1FGVH 4XTRC 3REWA 3HC3H 2NR6D 5ACZA 3L6FA 4YBQD 3VG0H 4MJIE 3DX7B 2AK4E 3A6CH 2VLJD 1IQDB 3R1GL 2OMNA 1I1FB 1A6PA 4V1DB 3CH1A 2R2EB 3MFFB 2R39A 1UH3A 1BIIB 3V79C 5FYLH 1M4KA 4NKDA 1G6RH 5DQJB 4M1GH 5E6YA 1AGEA 1KJVB 1S7XA 1UKSA 4LCCB 2X42A 3VXTA 1R3KA 1EO8H 1XF4A 2FGZA 3TBSA 1X5ZA 2R9HC 4XCCH 3NACL 5IW3A 4EQ2A 3MPCA 4LHUB 1RFDL 4GG8A 4MNHB 2XRAH 1CGYA 3KJ6L 1CVSC 2VZUA 3J7HA 4OGZA 1XCQB 3IFPA 5T1DH 3CAFA 1R3HB 4JQXA 3QNZA 2AI0L 2Y9RT 4ZTPL 2H9GB 5D6CB 2HN7A 2H32H 1DVFD 2D9CA 3WHE0 5D71L 2HTKC 3CSPA 4I2XA 2AJSL 4LVOC 2J6EH 3EYQD 1QRND 2Y72A 1YN7A 4NWTL 1V7NL 1PKQE 2FLBT 1KFAL 4RISL 3BZ4A 3PWPE 4ZS6C 3O6LL 1JNNL 4RIRA 5DGQA 4NN7C 4RAUB 5MI0B 3DO7A 3BGFC 2AXFB 5CJ8A 2VDKL 1FL3B 4LKXA 4ZUWB 4ZFGH 2A83A 4L4VB 1P84J 2VKWA 4U6HB 3V2AR 2EXYC 3SGEH 3HNVH 4UQ3A 3U48A 5BRZA 2DQUL 2A6IB 1Q9LB 4GXVH 3BIKA 4JFDA 2XKNB 1FZOA 5C0IB 3AY4C 4YLQT 4OUUA 1HI6A 4KJYA 1KCSL 3GSNB 1LO4L 1PLGH 2VDRL 2JJSC 4LRIC 5H8DA 4JFEB 3N9GL 1KTDA 4RX4D 2VL4A 5SWZE 3O9WB 5T5NG 1RIVH 3BP7B 4OZIF 1EEUA 1SEQH 1FC2D 5B3NA 5I15L 2JB5L 5DEGB 4W81A 4QRPD 5IESH 5D7LB 3ARYA 1CE1L 5GRJH 1GSMA 1V3JA 4WTZG 5GS2H 3WLBB 1DEDA 5ADOL 5IFJA 1IGTB 3ZDZE 5DUBA 4PRHD 1LP9A 5GRVL 1C5DA 1CU4L 3R8QA 1CWVA 5IK3A 1NLDH 2FDBP 4NQXB 4OD1H 1GGCH 2ORBL 4F33B 5DHVA 2W1NA 1IM9D 3EO0B 2LU7A 4GW1B 1WUNT 2P43B 3S35L 1BIHA 1HN1A 3MRRB 3AGVA 1NJ9B 1U8OB 4Z7NE 2GJZA 3BH9B 3EFFB 3VG9C 2Q3ZA 4Q9CA 1U3YA 3Q5TA 3KPRE 4N0UB 4KJWC 4E41D 4JFZH 4JG1H 2AKRA 2YUZA 5DLML 2BXYA 3ILPB 4O4YH 4Y5VC 1UEYA 2VTFA 2Q86B 2ADJB 2F53A 2Z92A 1E0OB 4RMQA 2I9LB 3WFDH 4WHDA 1O0VA 4QHMA 5FUCC 1T4KB 4X9GA 4EBQH 4FMFA 5ICZA 5EU6B 1YUHB 4MJ5A 3VXNB 3CDCA 2GJ6D 4BK5A 5L6YL 1A7PL 3PP4H 1I8KA 4BFBD 2ESVD 1H3GA 1S7TA 4PPTA 1CZ8L 2HJKB 1IEAA 3ZDXF 5JQHC 4Y88A 3SDCA 1T2QH 3P0YH 5EZOH 5F89B 5T1LA 3GHBL 3MR9B 4PGDB 2R23A 3RI5K 3SKMA 4AK1A 5IBUB 5EFIA 4BELD 2V6HA 4H26A 3IGAB 4ONOA 1CD9B 1WWAX 2DKUA 2R2HB 2J12B 1CLCA 4V2CB 1AY1H 5D2NA 3CXDL 5T33H 4MNGA 3VXQB 3KPSB 4EDXB 2EYTB 2DQTL 5I8KL 4O02H 1S9VA 2GKIA 2OTUA 3WIIH 5IUSA 1IGCL 4NZRL 1ZLUH 1SBBA 3MV7D 5HYEA 2R1YA 3S3SA 4P2RB 3RU8L 1G1CA 4LVHB 3E6FA 4BH7B 3GO1L 1QG3A 3X3FH 3ZHKA 3ARRA 4GUPB 3PHQA 4NQSB 1KG0A 2QQLH 3NOIA 1EK3A 4ZSOB 35C8L 5JXAH 5HHVL 3DX9A 3NMEA 3RGVA 2LAAA 1U41A 5A3ID 5F9DC 2A0LC 1PFCA 1I7ZB 1T5XA 1X5JA 3QEHB 1CFTA 1PVHA 3QDMD 4GKNB 3SE8H 1EH9A 4RFNB 5D96B 1XIWA 3MRGB 4FHBD 1I7TB 1J0JA 5J57B 4WHTA 2V17L 1EEYA 3IFOA 5HI5D 2ENSA 3B43A 3IU3A 3ZO0A 4ELMF 1T66C 3F8UB 4OSUH 4GMSL 5DWUH 1T6VN 1EDQA 5KAQF 5J11B 3WFHB 5CP7A 3EKCA 2HT3C 5DRNA 1AGCB 2X5PA 3QQ9D 2D7QA 2BY2A 3HFML 3VFUB 2BRQA 3KYKH 5C09D 1U92B 3L3KB 5JHLH 2FX9H 4JHZA 4PTUB 1DN2A 1SYSB 2FECL 5AWNL 3VGFA 5CUSH 4OD3L 4ORZC 3L9RA 5CZVH 5C0CB 2VSDA 4TUOB 1IE5A 3SN6N 1K5NA 4JRWA 1O7SA 4OKVA 4XVUD 1ZGLA 2RB8A 5DMKB 4M5YH 5DJCA 3OX8A 1XGUB 4JPVL 1AD9B 1YPZB 4N8VA 1BJ8A 4F7EB 3O81A 1IGIH 2XFXB 4KK5D 2VAAB 3SDDA 2NXYD 6CGTA 3TNMB 4FQJL 3CFCL 2W0FB 2DQGH 1BECA 3ELAT 4HIXL 4QT5B 43CAB 1CVRA 4JDZA 2Y6SD 3O4OB 1S9XA 4Z7WA 5A2KH 5IJKA 5FOBA 1DVFA 1Q9KB 2VN7A 1X5XA 3QIBC 1XR8A 3STZA 3X3GL 1WWBX 5KBNC 2X4TA 1QRNA 3MOAL 3HPLA 4LPYA 1I1AB 4NPYB 1C1EH 4LP4A 5DK2A 4DN4H 5I8OH 1W72A 4LRNH 3SDXF 3S9DB 2HLAA 1RK0A 4HKBA 2EE6A 5T3XL 4K23H 4R8WH 1SVZA 4NGHL 2DAVA 2X4SA 5FK9B 5ERWB 1INEL 3S5LA 1F5WA 2VABB 5I1CL 4QXTA 4Y4HD 2XWBA 3MA7A 3GMMA 3OF6D 2WBJD 2AAVA 3MLVL 1NDGA 1BFOB 3I02A 3G6JB 1M71B 4QHLA 5DJ0B 2AS5M 4LAQH 4RX4A 3TCLA 4PJCB 4X6DB 3ULUC 4OGXH 3WIHA 1TZHA 3CLEH 1BF2A 2ZOKA 1AGFB 2DQJH 3OZ9L 1E4JA 4RQQB 5JOFB 4QRPA 1SJXA 5HGAA 3NPSB 5GS0C 4OQ1A 1OD7A 1ONQB 4LCWB 2B7DT 5FYKL 5DJ2A 3RA7L 3KJ4C 3SJVD 1T83A 1QSEE 3NFNA 1RUPH 4PRHA 4EN3D 1FCCA 4CU8A 1D5ZA 4OGYL 5BO1H 1H3PL 3MRFA 1DBML 1JK8A 1G7JA 4GW5B 1BF8A 5FGSA 3VRIA 2QSCL 2DLEA 4RZCA 3AS3A 1FNSH 3FB7B 4HF5L 4NO5B 2VR5A 1BD2D 4BH8A 3VDBA 3OTTA 3MA9H 5TDPB 4JRXD 4BQCA 1FNFA 3MGTB 1DLFH 1BFTA 5F3HA 3OKYA 4YBHA 1N59A 1TVDA 2A6KB 4FQCL 1KNOB 5E6IC 1MFBL 2XWTA 3BAEH 2LV4A 1A7OH 4E41A 3ARQA 4PIRF 1ACZA 3TC9A 1KIQB 1RV6X 3HLAA 1UWGH 5I1DB 5EUKA 4IIQA 2Z4QB 1G6RB 4JREB 4U1SA 5C6TH 4PJFE 5KSVB 4U1NA 4X99B 1ZLWH 2HLFC 4R7DB 4M43H 4GFTB 5FYJU 4L3AA 5TE7H 3KWWA 4Z7UF 4KKBD 3UBXA 3FONA 2CIKB 3G5XB 1J1OL 5F9AC 5FO9B 2WUCH 3B6SA 4X83A 3QDGB 1NBZA 2ESVA 3JVGA 4XP9L 4N0FA 4ZPTB 3HR6A 1TETH 1YA5A 4IDJL 4G6MH 1AHWA 1F4XH 3NABL 4RWYH 1NCCL 3W9EB 1KLUA 3MRHB 2VISA 2AV7A 4GRLA 4LP5A 3G5VA 3U9PL 3ARFC 3KYNB 4L3CB 5BZDA 3TT1H 1G7QA 4UIKL 3QRFM 4LLVB 4KK6D 3W2DL 3EHBD 5GGRB 2Q20A 2W0KA 4IOFC 1UZ6F 5AYUL 1SQ2N 4PJDE 3CDGB 3BH8B 2YMXL 2YD5A 4O9HH 5K9KA 1GC1C 1KJ3H 1EA9C 1VEPA 4OBRA 1MAKA 1C8PA 2C26A 2PTVA 1M05A 4YXKL 4DKDC 1UCBH 5FCUL 1E27A 2XOTA 4JKPL 1AP2B 3BHBB 1LQVA 2VZ1A 4ALAL 4CW1A 2N7BA 3OB8A 1N8ZA 4G8FB 3S4SA 3U4EA 4KK8C 3SOBL 2OJZL 1K4DA 1MCEA 3OB0K 3K8MA 4P23D 5T3ZE 4NSKB 3ULVE 4WDIB 3QDMA 2EIEA 1JUFA 4PB0H 5I66A 3V5KB 1F6AA 3MJ7A 3U4BL 3X11A 1UB5A 1ZANH 4M7ZC 4QY8B 1LDPH 2WK2A 4JLRB 3HZYA 5D5MF 4JY5H 3LZFL 4Z5RB 4LDLB 4EDWH 1WT5A 3CZFA 4YDJB 2NY0B 5JHDD 3JTSB 3IF1A 3P2TA 4KH2A 1DANT 3D18A 2APVA 1OSZB 2VWEE 4X8JA 1LE9A 4Y5XC 5C09A 2A6JA 3TH2T 1M6OB 1KIRA 1ZEAH 3FRUA 2AERT 2IALA 5BJTA 2CJUL 3EYOA 9CGTA 5HHOD 4MHHI 4QRQB 3VJ6B 1BBJB 5INDA 4NNYB 3MREB 4WI6A 4X7DC 2C4FU 4YFLI 2XWJB 1I9JL 4ZAKA 4FQLL 1S9KC 2C3HA 2QADD 4W6WB 3ES6B 5KSAD 3IDXH 5IQ7H 4XPHH 5CLTA 4GAYA 5IG7A 2NY1C 5DEZA 1QACA 2WY3A 1JNLL 1VADA 3EJYD 1C08A 4K94H 1KCVL 4BZYA 4LARH 3EGSA 5T1MB 5EB9A 3C08L 5EOCH 3EDKA 4BZ1L 3HPJB 4OGAC 4R2GB 1MI5E 4RBPK 2A73A 3O3EB 4HH9B 4R4BB 2JCCB 5D7JB 4CNIB 3OKDA 1FZJB 4MS8C 2NY6D 4TULH 1FO0H 4UOW1 3DYOA 2X44D 3LHPL 1D5MA 1YNKL 2GY5A 3DV6B 4C83A 1YMHA 1OWRM 3FQWB 5D1ZD 1J0YA 1DSFL 4O2FB 1MRCL 2QSQA 1UM6H 2VE6A 1U58B 5F1NA 4M8QB 5EC2B 4AJ0A 3GI8H 3R0NA 3EO9H 3X12A 1FBIL 4V1DD 5BCAA 3OF6A 2UWEF 4YHOL 2F5BL 1RJLB 5HPMA 3GIVA 4CMMA 5HY9A 5E8PA 1KB5A 3PWVA 4YDLC 4YJZL 4U0RB 1RZKC 1KPVB 4CAGA 5F7FA 2XTJB 2X4QA 5J1TC 2ZCHH 2NY7L 5CCKH 3BKML 3FO0L 3LD8B 5DT1H 2AJ3B 2BSSB 2DS4A 4LHUD 1BQHB 4CVUA 1KCRH 1X5HA 1JGUH 5DMGC 5M94B 3TBVA 2NW3B 3LSOB 1V7MH 1CE6A 3MACH 2ZUYA 2C1OB 3C6SA 4I3GA 1PQZB 4PGCB 3VGBA 1QTYT 2P7TB 3MFGB 2R2BB 2BNQA 2X41A 3CDYA 5IB4B 3BP6A 1MAMH 1BD2A 5F44A 4S1RL 3QG7H 3ALPA 2R0WH 4JRXA 3U82B 1GGIH 5CJXC 2H6PA 3FOMB 2FD6H 1BOGB 1MY7A 1KC5L 2XQBL 2ICWI 3V95A 5TQ0H 1QSZA 4OZHB 4MB3A 4Q6YA 3VA6A 1OCWL 3F7YA 3I2CH 1DBJL 2A1WH 1IBGH 1AE6H 2MQCA 4L4VD 1SJHB 2WP3T 1X9QA 2IQ9H 3M1BA 5E94B 4ZS7L 3FHAA 4PGBA 4LPTA 1JIBA 1S7VB 5IFAH 4HMDA 5KW9H 4WGWB 3ME0A 5DZNA 4M1DL 5IVXF 5ID0B 3H7BA 3LEYL 5E2VL 4FQIL 3KAAA 4JFED 4AH2B 5IHLB 2CLRB 1DL7L 4FXGB 1G0DA 3ROOB 3O9WD 3MNZB 2PYED 3DARA 4Z76A 4KZEH 3MXWH 5IB1A 5EO1B 1N7MH 3TNNA 1P2CA 4PJHE 4YQXL 1WICA 2DKSA 4WVRA 5D7LD 1IGFH 4NBZB 2APFA 4I4WB 1JWUA 5E8NA 2IC2A 3GNMH 3LKNB 4RGNE 1SJEA 4PG9B 4XWGH 4PV9A 3FT3A 2WAHA 4U1IA 4PJGB 2AK1L 2SEBB 4WU7B 3E8UH 2HVJB 4KTEL 4XPTH 3SDCC 5ITBH 3QZWG 1RD6A 1OAXH 5AG8A 2QLVB 5TFSL 1PKOA 2FBJH 4NM4H 1OAKL 1V8HA 4NYLB 3RUGA 5IHZA 4R96A 4X0KA 3OKKB 4NCDA 4AT6A 5EZJA 5D2NC 4HBCH 2QR0B 3QCUL 2C9AA 3HRZB 1MFCL 2EO1A 3GMLB 2RAMA 1UXSA 1MFEH 4Q97A 3QRGH 3MLZL 4MXVE 4TSCH 1XEDA 2HJLB 1OP5K 2NY2B 5CJOL 4FXKB 6FABL 4OD2A 5EU6D 4K9EH 1LWRA 1T89A 4HGKC 2LABA 4ETYA 5KS9E 2X4UA 2OJEB 5B3JF 1U93A 1OT1A 3CVHA 1TZGL 4JY6A 1BVLA 2RIKA 1YY9D 5DYOB 2IAMD 5C0AB 4NUJA 4LLYA 1QPXA 3PWJB 3S36L 1WZ1L 3VGEA 1ETZA 1IEBB 3LEVH 3HR5A 3RGVC 2BNUB 4WCYH 1KTLB 5BZWB 5B4MC 2YKLL 4MCYB 1VFAB 3IXTA 1PG7L 4PGEA 4UQ2A 1LEKB 2XZCH 3BQUB 1MCRA 2QQKH 2CH8A 2WINB 3K81A 4LSRH 5HHOA 1XIWC 1BZ9B 5SX4H 3KPSD 1I1RA 3DVNA 3MOBL 1JHLL 5GJSH 3EYFB 4Q6IA 3VFSA 2WUBH 3QDAA 2F8VA 4NP4L 1ES0A 3RVWC 1HKFA 1MJ7H 1B4RA 3CC5B 1QLEH 4P2RD 5KSAA 3A67L 2CXGA 3D0VA 4HZLA 2W9LA 5HYQA 4XXDA 2APXA 4PREB 1LK2B 1C7SA 2JELL 3P73B 1UCTA 5KJRH 2FWOA 4YHPA 5GRUH 3PABA 3T4YB 3D25A 3G6AB 3HN3A 2VLLB 3ECBA 2JJUA 3EOYG 1XR9B 5CILL 3GMPB 4MD4B 1NANI 4GBXB 5FUOL 3H3KA 4M7KH 4U1HA 1MWAH 3LKSB 4JO1H 4Q7DA 3CUPB 4N5ED 2PUQT 3CK0L 3OKEB 4YO0A 4YX2H 5D1ZA 3OG4B 3T3MF 3IU4H 3SDDC 4HXAH 1XAUA 3RI5F 3AM8C 4FNLL 1KELH 1F3JB 2AGJH 4GJTB 2FGWL 1U8QB 4BQ8A 1ZTXH 2NY5C 3M07A 1XZ0B 4GXUN 5IJKC 4M1CD 4OCWH 1C5BH 4PV8B 2R2EA 4R26H 4ODSH 1BIIA 1BQUA 5HGHA 3EYQC 1YMMB 4X5XA 5DQJA 1YEFL 4S2SB 4P3CH 2NZ9C 1KJVA 5C0CD 3IDUA 4UTBL 7FABL 1UG9A 4PJFB 3VDCA 4PS4H 3O4LB 5T5FL 4L8BB 3FQTB 4EUPA 3HKFA 3QFJE 4A6YH 1MVUB 2VITA 4H8WC 4KVNH 2CLVA 1DDHB 4LHUA 3I50L 1FL5A 1HXYB 4RCAA 2DI9A 5CP3H 5JPNB 3ZE1E 1Q0XL 1A3RL 4J6RL 3ARXA 1CDUA 5C2UB 1T2JA 1XCQA 3TO2B 3RWIA 4OF5A 3BWAB 5C9JB 2VDOH 2UVFA 4FXLA 3BRGC 1K3IA 1X5LA 3LS4L 2YPVL 2APTA 4L5FL 3QUMA 5BS0A 4FQHA 4F7TB 1PJ9A 3TPUB 1I1AD 1JHKH 5FEBA 3FQXB 1G7MB 3BSZH 3IDIB 2AXFA 4M00A 5GISH 1FL3A 3T3PE 4DUWA 3TT3L 4KROC 4KTDL 4ZUWA 1D5IL 1QFWI 1T04B 1T83C 4MJ4A 4HS3A 4L4VA 4JZNB 2CMRH 3CMOH 4U6HA 3VMOA 4U7MA 2EIZB 5DC4B 4RWHA 3UAJD 4NJAL 1Q9LA 1NL0H 1YEKH 4MQXD 1KCKA 3NGBB 4XP5L 2XKNA 2ZUSA 4DK3A 1MRFL 3RL1B 4JFEA 4W4NA 1E4WL 1YEJL 5HDBF 5AG9A 3O9WA 5C08B 5EUOA 4JQVC 2PYEA 1JF5A 1JV5B 2AEQH 1DUZB 4ENEC 5KN5B 1JRHL 3O6FB 2MWCA 5DEGA 1A7BA 1F13A 3K4ZA 5D7LA 3BDXA 1LP9F 2BJMH 4MA7L 3WS3A 4LCWD 4KHXL 2YXFA 4XCFH 1J1XL 3IFLL 3ARDB 2QJDA 4FFYL 4OV5A 4LIQH 5JIPA 2BMKB 3C8HA 2V7NA 4JHAH 2B4CH 2C3GA 5HYSG 1GL4B 3BE1H 4U49A 3JVGC 3ARGA 4NO3B 4F33A 1IAOB 2DWEB 1AHWC 3TBYB 4GW1A 3PHOB 5E99L 3DTXB 4GRLC 4GW4A 2DQEL 1NH6A 3MRRA 1QO3B 3WNNA 4XZUB 3BKCL 2E8YA 1M7XA 2ZUQC 3AB0C 3BH9A 4X98A 5F7DA 1YN6B 5F7KC 1JFMA 4N0UA 4TPRH 4WY7H 3RNKA 4KV5E 4TQEL 5L2KE 4L8SB 1M1SA 2R29L 4PGJA 4YK4B 5EIQA 4HCRL 5ESAA 4D0CA 2ADJA 4JHWH 1UB6A 1Z0NA 2I9LA 4IS6A 1J87A 4LSTL 1Z9LA 4QO1A 1ZHLB 5EU6A 3P9WB 2KQMA 2VZOA 3D87B 1A6VH 4LCUB 2IFGA 1NC4D 2P5EE 4YHIB 1TMCA 4LASL 4P2QB 4EKXA 1GOGA 3NCYP 5CGTA 4XMLL 5D1XB 2IAMA 2HJKA 4UOW0 1WFTA 4Y19E 2DMBA 3RWJB 4YC2B 4PGDA 4ERSH 1Q94B 3B9VA 4G9FB 3JV0A 3QPQC 2R2HA 5IEHB 1J5OL 1U6AL 1TJGL 5I9QC 1B3JA 1W8OA 3VXQA 3WJLA 3KPSA 3HAEA 3WLWC 2EYTA 3U0TB 3FN0H 5D7IB 1OM3L 2G5BB 1IKFH 4JQIH 1WT5C 2P5WE 4NHCL 3MV11 3DI2B 2VXTL 1QBLH 5HSFA 2HFEB 5JQ6L 3RWGB 4BA8A 4M03A 4BH7A 1JTOA 4POYA 5C0FA 2R8SL 3FQUA 4XC3L 1ED3B 5EU5B 3IKKA 1EERB 5JNYB 1MH5B 4HKXB 1G9EA 3QDJB 3ARVA 4BSWB 1TQCB 3L5WB 3SPVB 4DGIL 1I7ZA 3T04D 4EI5A 2FH6A 4UILH 5DD0H 3E3QC 4ZAKC 4GKNA 1I7RA 2EDYA 3NH7H 3MRGA 3RQ3A 12E8L 5ACMA 3RNQB 1I7TA 4N5EA 1G9NL 1H3VA 5I2IA 3LKOB 1W8NA 4NRYB 5FUCE 1LNUB 1NBQA 1Q1JH 4MXWH 4TRPL 4MDJA 5DD3H 4FZEL 4YH6A 1AC0A 1FZMA 2ICWJ 2NY0D 4I3SH 4C56B 3MRBA 3QUZB 2XICA 4IRJD 5GS2D 2Y25A 3WFHA 5DTFB 5T1KD 4PLJC 5SWQA 2Y6SC 5DJDB 1AGCA 4Y1AB 3VFUA 5J3HC 3CSYB 4OF3A 1CL7I 5KSBA 1JGLH 3L3KA 2CUHA 1OLLA 1D7FA 4PTUA 2CK2A 4H20H 4JZOB 1CD0A 3BMVA 4DGVL 5JDSB 5TE4H 5EBLA 1R5VA 1T7XA 4WO4A 3KPPB 3WN5C 1XGUA 4LLMA 1CICB 4Y16C 4OLXH 1CLZH 2XFXA 5DD1L 2JKXA 1ZHKB 5C0GB 4QF1B 3BZDA 1F42A 2HJFB 1WZKA 5SWZD 4MA8H 4Z7WF 2W0FA 2FR4A 2NXZC 4FQXA 3SKNB 4QT5A 5DC9B 4QCIA 1A9BA 4R2GD 3KHQA 2IPKB 2F8XC 4NQDB 1IAII 3IETB 1Q9KA 5D7JD 1JZ3A 4OIIL 3E0GA 2FO1A 4Q9RL 4LGRB 4N9OB 5HI3C 1WCQA 1UH2A 1GPOL 2J1KA 3MUZ1 3GBNH 4L9DA 1HK6A 3BWUC 3LQZB 4XBGA 1EJOL 2F54E 3H3PH 1YEEL 5E2TH 4KRNA 2VLRE 3VXSA 1U91B 2W92A 5FK9A 5GS1C 4GXUM 2VABA 2E7LE 2C3VA 3V4VH 3W81A 1T80A 2GHWB 1SM3L 3MV8A 4PJ7A 3AXLB 3DX6B 1NFDA 4I13B 4DW2L 3G6JA 1M71A 2YEZA 5JZ7D 4BFGA 3ETBF 2OL3L 3FCTA 4PJCA 1I8LA 2VDQL 5D7SH 2X70B 1AGFA 4IOIB 4J12A 2XTJD 5A2FA 1U2HA 2J4WL 5TH2A 2R0ZH 1DR9A 3P30H 5I19H 2APWA 5IFHH 4PRNA 4WJ5A 2OXGA 1CGSL 4MWFB 3GSXB 3KPLA 4KTYA 2YA0A 3WO4C 3WBDA 4WUUE 3VWJA 1MIEL 3H9HB 2Z8SA 2DJ4A 1MWAB 2WQ8A 4MNQE 3KHOA 4GW5A 4GG6F 1MCOH 2IFFL 2OSLB 3MLUL 5DRWB 5EA0H 1LK3H 2G60L 3T0BA 4ZDHB 4K8RL 4AQ1B 3FB7A 4NO5A 4P57B 2E6PA 1UM5H 3GB7B 1GGUA 4PJ9B 3MGTA 1T0NA 2J5LC 4C4KO 3WD5L 1KCUL 3QT2A 4NZDA 4UV7L 5DFWH 1FIGL 2A6KA 1KNOA 2WIIB 1P9MC 1U8KB 5HYIA 4TN9A 1TPXB 3QXAB 5KANI 4KK6C 2ZUUA 4OLEA 1UH4A 2DRUA 1PYWB 2DM2A 1RVFL 4G80B 4Z7VB 5FHAH 5I1DA 3BT2H 3UTSB 5LWYL 1OVZA 4ZO8A 3K0WA 4D3CH 2W07A 1PSKL 2Z4QA 4P2YA 5KSVA 4YHML 1BFVH 2DD8L 5I74C 1L4IA 5ACLA 4OZFB 4ODWB 3C6LB 3AUVA 2E7CA 3T1WA 4NDMA 1NC4A 4QHUB 2QBWA 4P4KD 5TPWL 5IMLB 4HUVB 1RQ5A 4G6FB 3K1DA 4R3SB 4UT7H 4ONFL 4ZPTA 5JDJA 1T03H 1N6QL 4ODUA 4QHKI 4ZOCA 4M4RA 3O3UN 5TQ2H 3WDJA 2HT4D 4XNYL 5DC0A 4UT6L 4LLVA 1IC4H 1QR4A 4MJIA 2BFVL 1MUJB 1UQSA 2AK4A 1Z6JT 1T89C 2E7HA 4KZDH 1T21A 4R0LC 4XRCB 3ZYZA 2WLYA 3WUWA 4FQ2L 1E6OL 1UYWL 1XGYH 4OFPA 25C8H 2HKHH 4HFUH 4LQ1A 3F5WA 4P49A 2D03H 2OZ4H 4J3VA 3FZUC 3BD3A 5ESQA 1XGTB 1RZJL 3S3PA 3RVUC 2XQYG 3NFSL 4ODTH 5IMKB 1E4XL 1KTKE 4JM4H 4Q6IC 3VFGL 3FKUS 5LQBH 4OJFH 1MHPH 1X7QA 2NY2D 4HWUA 4HPYH 4KK9C 3JZ7A 3V5KA 1QEWB 1Q9WB 4HUMB 1A7NL 1BAFL 5CINL 2LE9A 5A1AA 1NFIB 4PJ8B 5GS0H 2OYPA 1UVQB 3OJMB 1N5AB 3TIDA 2XZQH 5C0AD 3CFEA 4M48H 1S78C 4IRJA 1VFOA 5FYKU 3V5DB 5EWIL 5T1KA 3PWPA 2B1AH 2NTSP 5I16B 3FMGL 5E08L 2YN5A 1X44A 2F9BT 1RAMA 5ANME 2EYSB 4OF8A 1M6OA 3BQUD 3GSNL 3G08A 1N6VA 4CL7A 3QWRD 3LIZL 2NX5B 2CRYA 1TXKA 4WIQA 3VJ6A 2ZOLA 4G42B 4YFEA 5D1ZC 3BGMB 3AS0A 3IT8D 4JFYB 1NCAL 3S37X 3MREA 2XWJA 1RURL 1JZ8A 3IYLW 2EE9A 5KVDH 2AJUL 1HQ4A 3GRWA 3SGKA 3QG6A 3ES6A 1IC5H 4PTTA 1RUKH 4HFWA 8FABB 4ZUUB 1MELA 3MJGX 2NYYD 2EDDA 5SWZA 4FFWD 1IILE 3FRPG 2NNAB 4YHKH 1X5IA 2A6DA 5T1MA 4Z78B 4PP2A 1QFUH 4OIAA 1YYLH 3DMMC 1MNUL 5IR1B 4LBEB 5EIVA 3GSRB 4HAGA 4R4BA 5D7JA 4MCZB 4HWZA 4NIKB 2X6MA 4GBXD 3SDXB 3QXVA 2D7PA 3U7YH 4JDTH 1S7UB 2F74B 4UV4H 3DV6A 5DJXA 1L7IH 5I73C 3PWUA 1IAKB 5CAYB 4PLOB 2FJHA 2Q1EA 1U58A 3MBXL 4WGVB 3RKPA 5EC2A 3PL6C 4LVOB 1KEMH 5IGXH 1OAYL 4Z8FH 4WI8A 4RGOL 3QO1B 1S7QB 1A2YA 1QBML 4FFVD 2EXWD 4LLAA 4KQ3L 4N0YL 1RJLA 2YSSA 4M8VA 4NN7B 1YMMD 3BGFB 5L2KB 1TTUA 5HYFA 5TF0A 3UJIL 3HRPA 1U3HA 4O5LH 1PX4A 2YPLE 2DYPD 3SHSA 1KPVA 5JXED 3WFBH 3O4LD 3HCVB 1N5YL 4LSUL 3FB5B 3IJHB 2I60L 2AXJA 3QSKB 4FTVE 1OARL 3MUGA 1BQHA 4NNXB 4TVPH 4OCXL 2XZAH 2D4FA 2C1OA 2VDML 3IXAB 4OZ4B 5GZNC 3WL9A 1PQZA 3QXDB 4PGCA 1EHLL 5IW1B 1IQWL 2YD2A 3MZGB 5KVFH 3CLFL 5AZEL 1NCWL 3QXTA 2F58L 3VRLF 4CU6A 4JHBA 2Z8WC 1B6DA 2R1XA 3FOMA 4AIOA 3S96B 1G9MH 3L3JB 4I3RL 4QRSB 1JPSL 4LNRB 1JGEB 2Q8AL 4PLKD 4XPGL 1SJHA 4Z7UB 1PY9A 4YR6B 5E00B 4O58L 5TDOB 5IB2B 2OM5A 1F4YH 5E94A 3X17A 4EOWH 3MXVL 1Q0YH 2X7LB 4M6MH 3ARGC 1IT9L 1S7VA 1WCBB 3VG9B 3CXHK 2J8UE 3L3IA 2MKLC 3WV0A 5ID0A 4P4KA 1A7RH 1KGCD 2DL9A 4OFVA 2CLRA 4NN6C 3B8SA 2VLME 3GMQB 3ULVD 4MX7A 3ROOA 1JWMA 2V2XB 5C08D 3NCJL 1DEEB 3MRNA 5CJQL 3O6FD 3KDMB 2FL5B 3VXUB 1OAUH 2EDQA 4NQCE 1AXTH 2FATH 1KJ2L 1UJ3B 4I4WA 3RY5A 4NFCA 2PN5A 5JIHA 5LJYH 4D9LL 2D0HA 3LKNA 5E5RB 3UJJL 3ARDD 1LILA 4G8GE 3T65B 1GJIA 4JO2L 3IDMB 5GS3A 2YRPA 1KF9B 4Q9BA 2SEBA 5IIEB 1YY9C 3SKUD 5FYJE 2IAMC 4R9HA 4PP1D 4Y2DC 4M5ZL 4Y89A 3DETD 5JA8B 5JW5B 1D5XB 1K4CA 4U1LA 5JOPE 1KENL 4OQTA 4F37F 3K8LA 3Q1SL 4OUOA 3B9AA 1A6TA 1TVHA 4FABH 2VMFA 3U7WH 2R4SL 5JOEA 4MD5B 3HRZA 2ATPA 3H9SE 4DZBB 1J8HB 3AMKA 2B8OT 4NNPH 2QQNL 1SBSL 2HJLA 4D8PB 4PRPB 4OF6A 1FNEA 3HUJF 1B2WH 4JFXB 5AUMB 2OJEA 4P2QD 2PNDA 2FX8L 4PJ5B 2ARJA 5FECB 3I75B 5D1XD 5DYOA 2YK1L 1T6WA 5C0AA 4ZNCD 3PWJA 4JM2C 3WXWL 3HB3C 4W4OA 3VFVB 2BNUA 3KLDA 4JFQB 5I1HH 5BZWA 2D7NA 2O93L 4PFEA 4G9FD 3BQUA 3VD9A 4EI5C 1A7QL 2B5IC 3O2DA 2PTTB 3QWRA 4MAYC 2XN9B 3S88L 1NGQL 4N5EC 4DAGL 1H8OA 3G04B 4POUB 1WJ3A 3SKJL 4JVPA 3MRJB 3RBGA 3VCLB 3GK8H 5DMIL 2VL5A 4CDGC 4PD4K 3CC5A 3QUXB 2VB5A 4L3EE 5J11C 4HS8L 4R7NA 4K3JH 5B22A 5I1IL 4EI6B 5FKPB 2X1OA 2VDLH 4CU7A 5MERB 2WWKT 4ODXB 4PREA 1DUYB 3HHRB 1O7VA 2DI7A 3BEVA 2Q6WB 5DHVH 4PBXA 4QRRB 1UZ8B 1B0RA 3ESVF 1KPUB 3G6AA 4KKAD 4XCYB 2VLLA 1XR9A 3QDJD 3MRCB 3HC3L 4WO4C 2B20A 3AS1A 4GBXA 4WUUB 5DK3A 1K6QH 3LKSA 1F3DH 4S1DD 4TUJB 3A6CL 2FLRT 1U8IA 2BX5A 4ZD3H 3Q5OA 1AH1A 1EHXA 2E9IA 5BV7B 2UWEB 5FYLL 4C56D 2H1PH 1Y18B 3QUZD 4FQXC 1U8QA 3QIBB 1XZ0A 5A16A 2E3VA 4Y1AD 1OTTD 1UT9A 1MIMH 4PV8A 1EO8L 5HI4D 3RJQB 3L7EB 3IAGC 1GGBL 1MREL 4XXCA 5TGBB 4XCCL 1A6ZB 4F2MB 1JP5A 2YWZA 4S2SA 4J4PD 4LNVA 4BJLA 3B5GA 2VAJA 5D6DA 4R4FH 15C8H 2DYPA 2XRAL 4PJFA 3O3AB 4KI5D 3ZYJA 5T1DL 1CICD 3UTQA 4PG2C 1MVUA 4I77H 4NHUE 3NA9H 3PQYB 3SEPA 1HXYA 4O2CB 5MEOA 2J6EL 1QA9A 3WMSA 5EC1B 5HHPB 1J05B 3RWDA 1IFHL 2P8PA 1I8LC 1MEXH 1OGTA 4ISVB 1I3VA 4NQDD 4X80H 3UTTE 5C8JB 4ZFGL 4NQTA 1SY6A 3L95A 3QHZH 5IF0A 3TPUA 3KJ4B 4L29B 4NRXA 2BCKB 2DIAA 3HNVL 1E4KA 3FQXA 2QEJA 4G5ZH 8CGTA 1G7MA 3MYZA 1QR1B 3ZE2F 4MVBC 1A5FH 1G7PA 1REIA 4GXVL 3QQNA 1T04A 4Z95H 5B39B 4MZ3A 4U3HA 3VWJC 4U1JB 4N8CH 1AO7E 1MHEB 1PLGL 1VFMA 3EW3B 4F7PB 4M6NL 4HWEH 2EIZA 3OR6A 3FQNB 4I48B 1FYTB 3C8KB 1RIVL 3N85H 5E8DL 4NWUH 1SEQL 4OF0A 4FQ1H 4XX1G 5E6IB 5EUOF 2MNUA 3RL1A 1XGQB 5IESL 3B5HA 3VXME 1EJ6A 1L0XA 1JV5A 1CBVL 5C2BH 1DUZA 3O6FA 4FFEX 3QH3B 5J89A 2W9DH 3MO1B 4QWWC 1FORH 4OD1L 1YJDC 1GGCL 5C0DB 3FO2B 1N3NA 5E1AB 4LOUD 2VQTA