1C16A

Crystal structure analysis of the gamma/delta t cell ligand t22
Total Genus 49
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
49
sequence length
260
structure length
260
Chain Sequence
b'GSHSLRYFYTAVSRPGLGEPWFIIVGYVDDMQVLRFSSKEETPRMAPWLEQEEADNWEQQTRIVTIQGQLSERNLMTLVHFYNKSMDDSHTLQWLQGCDVEPDRHLCLWYNQLAYDSEDLPTLNENPSSCTVGNSTVPHISQDLKSHCSDLLQKYLEKGKERLLRSDPPKAHVTRHPRPEGDVTLRCWALGFYPADITLTWQLNGEELTQDMELVETRPAGDGTFQKWAAVVVPLGKEQSYTCHVYHEGLPEPLILRWGG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords MHC-LIKE PROTEIN T22
publication title Crystal structure of a gammadelta T cell receptor ligand T22: a truncated MHC-like fold.
pubmed doi rcsb
molecule tags Immune system
total genus 49
structure length 260
sequence length 260
chains with identical sequence C, E, G
ec nomenclature
pdb deposition date 1999-07-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00129 MHC_I Class I Histocompatibility antigen, domains alpha 1 and 2
A PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1c16A02
3.30.500.10 Alpha Beta 2-Layer Sandwich Murine Class I Major Histocompatibility Complex, H2-DB; Chain A, domain 1 MHC class I-like antigen recognition-like 1c16A01
5KVFL 3T2OA 3JTTB 2PYEB 3D5OF 3T2QA 3E8UL 3KWWA 1N7ML 2AKRB 2JCCE 12E8L 4NO3A 5DJ0B 1KIRB 5IHUH 2B39A 1HCFX 5DC4B 3RAJH 5D1XA 3O3AA 4IOIA 2W0LA 2EDEA 1U92A 4CVUA 1RV6X 3PWPA 4RGNE 3OJDB 2AEQL 1DQLL 2EE9A 4P2RE 3WSQH 3VFUB 4NGHL 1TITA 2CXGA 4JQIL 2PW2A 1AD0A 1JGEB 3BWUC 4B50A 5D72H 1UC6A 5FOBA 3BIBX 4P2OA 1R3JA 1YYLL 4DGVH 2ICWA 2AXGA 1DANU 2DQHL 1IJ9A 2NYYC 1W8OA 1B9ZA 2NQCA 5GGRY 4AL8H 3X3FL 3U2SB 4QKXB 1CLZL 3G5YB 4H1LH 2WW8A 1ZWIA 4QTIH 1JF1A 4U6XB 1I1RA 1UJ3B 2B0SH 3MGTB 3UEZA 5TQ0L 2NY7L 1HIMH 1EGJH 4XBGA 1OAQH 5HYJE 1BREA 1FORL 2GSIA 4GMSL 1CLYL 4HS8L 5D1QA 5GRWA 2CDEA 2X4RA 4EVNA 4XCEB 2D3VA 3DECA 3FT4B 4RNRB 1EUUA 1LILA 4XXCC 2PNDA 3PIQA 2FATL 3MREB 3EAKA 2CIIA 1UWGL 4HJGA 3TBSB 2IFFH 1T0NB 1YN6A 5DLML 1NBYB 2VDRH 5E70A 4W70A 2XOTA 1OQOA 3W5MA 2YPLD 2PETA 1FL6A 3WO3B 5JPNB 5KTEH 1NFDF 5IFAL 1J8HE 1FHGA 4IRSB 1JWUA 2EDWA 3FO2A 2R69H 2YXFA 4PY8I 5DT1L 5JPMB 1IZJA 2QQLH 1S9VB 3GB7A 1GC1C 3VU2A 4XMLH 2BSED 2CDGB 3K4ZA 3RY6A 5AZ2L 5IB3A 4BQ8A 4H1LG 1OGAA 5J6HB 1ZVHA 3P0GB 5MHSD 5F7DA 32C2A 3KPSE 2ADGA 1G84A 4PJEF 1E4WH 4XPHL 4P2QB 1MHHA 1CTOA 2AK4E 3ULSA 4X9FA 4M1GL 5B38A 5DRWB 3ZDXF 5GGTL 2HKFL 1JPSH 1IAOA 3S35L 2VAAB 5I19H 1AE6L 4PFEA 4F33B 2B1HL 4FQJH 4KKAD 1U2HA 4XZUB 2VXQH 2VN7A 5FCSH 4KPHH 1FNEB 4C56D 1JN6B 4Y19A 2X4UA 2FD6H 1GXEA 4OI8A 1UWEL 2X42A 3SDCA 3E2HA 1T1YB 1LEIA 3LIZL 2R23A 2EDBA 1UYWL 2YSSB 3K0WA 3PP4L 4QRSA 5B21A 3VD5A 1MF2H 2WMPA 4G42A 4XNUL 4RZCA 2ARJQ 2YPKA 4D3CH 4PGBB 3DRQB 3LEVL 3QDHA 3MJ7B 3QJHA 5BV7C 4KQ4L 4TPRL 2OK0L 2FH8A 5CJOL 1UZ6F 3T0DA 1FCCA 3WNLA 5I8OL 4PGCB 4J3VA 1TZIB 1J0JA 3MNZA 2HRLA 5BRZA 3P4OB 2IGFL 4D2NA 1KXTB 1DQDH 4G9DB 1CD9B 5DRNA 5H2BB 2XZCL 3P0YH 5J12B 2A6JA 3KYOA 3FOMA 4Q0XL 3IDNA 3NAAL 1K4CA 1U6AH 4Y5VB 3S37H 3CFCL 1A0QL 4NZTL 4NP4H 2E8YA 4MA3A 1PYWB 3SJVE 3NIDE 1VFAB 2XN9E 3HE7B 1INDH 4GH7B 4WU7B 2Y23A 3MLPA 4YX2H 4P2CG 5C0RL 3LQAC 3KYNA 1WIPA 1NSNL 1I9EA 2DBJA 4GKZA 1UB6B 1RPQA 2VXSL 4NQDD 3DHMA 3HI1A 4IMLB 4XPTL 4BSWB 1J86A 2OBGA 1FFNB 4OQTH 5I66B 1WBXA 5K9JH 1G9NH 4GRWB 4RIRB 2DAVA 2NXZB 3VFGL 1S7XA 2V7HB 5CSZA 2ATKB 1RZIA 2ED9A 3KPTA 4PGDB 1R3HA 1OW0A 4X6BB 4CRPA 1JGVH 4G8GA 3ULUF 1LNUA 4Z18A 3WS6C 1UCBH 4OSUH 3BHBA 3ZE0E 2ARJA 3U4BH 1PY4A 3D2UB 4N8VG 2BRRL 2ZOKB 1AGBB 3KYMA 1A7RL 1A9BB 4OV6F 5E9DD 1EDQA 4W4OC 5CP7B 5KSVA 3FHAA 5JQHC 3S36H 3CVHA 1F3JB 1VCAA 1VADB 4H8WL 4FZEH 7CGTA 5ANME 5I1IH 5JHDA 5MEND 4PLJC 1DTUA 4RSVA 2APVA 2Q76B 4Y16B 4PGZA 3GRWL 1YEGL 3FQXA 4N8CH 3QZWG 3MRRB 3V0VA 1JUFB 1T5XA 4U6YB 3H7BB 1YNLL 3K2MC 1JGUH 1G9MC 3P73B 2ZPKH 1KJ2A 1YMMD 1ODAA 3IU4H 4ZPTB 3VA6A 5BZWA 4I9WD 3MRHA 5ENWA 1CFNB 5IWLA 1W0WB 1T1ZA 2GTZA 5FYLL 4PLKD 4WHTB 3RTQC 2ZNWA 5C6PB 1A6ZB 3CU1A 5J0BA 5ALCH 3SKJL 1D5IH 1A21A 1JF5A 1NBQA 1J0YA 3Q6GH 3GSVA 1T5WA 4TYUA 1L0QA 2R4SL 3ARGC 1WWCA 4Y4KA 3IFNL 2YMXH 2Y07L 4NQXB 5JHLH 4RQQB 2LU7A 5B39G 4NO5A 2HT2D 5SV3A 3VFOB 1MI5A 3F12A 2A2QT 1EXUA 3S88H 3DURB 1NKOA 2NY4D 5KSAB 5DD1H 1T6VN 1M7XA 5T3ZD 5K93A 4YHKL 4EJ1C 3O6FC 3EJZC 3OXRB 1YEJH 2IMNA 3W0WA 4A6YH 3FQRB 4LBEB 3U6RB 2N4IA 1ADQL 3DSFL 1JPGA 1I7UA 1H3VA 5B3NA 1JGLH 2DKMA 5HYEA 4HMDA 5EZJA 3FRUA 2BERA 3PWJB 2AJYH 3MLXL 5IVXA 5D7IA 4OLUL 3MJ9L 3Q1SH 5EOQH 4ELKA 4OF0A 1MPAH 3IFLL 1H8OA 5L8LB 3K1DA 1N4XH 2IJ0C 4GBXC 1XT5A 3RHWF 4N5EA 4ZUVB 4NNPH 2BVQA 2XA3A 1RK0A 4HKZB 4WI5A 1F3RB 2VXVL 4WFGD 3HNVL 4XI5D 4P4KD 1CQYA 1MCPH 2A6KA 3L3DA 1K5NA 3SQBA 3W11D 4KK8C 4Y4FB 3U0TA 5K9OA 2HJKB 2XKNB 4F3FB 1F3DJ 2V2TB 2EYRB 3B2UC 3FOLB 3O4OB 5H35A 4P9ML 1N8ZB 4J1UB 1X4YA 7FABH 1CE6A 4NDMB 5TDNA 2E8ZA 2YPVL 3N1GC 3QUXD 5E1HB 5I30H 4M6NH 5EIVA 4EIGB 4ZSOA 5KW9L 1HHGB 3A6CH 3UDWA 5SWSD 1FG2A 4FZ8L 4FXKB 3BP6A 2CIKB 3MRDA 3ULUD 3P0VH 2XZAH 4APQA 3B2VL 3M17B 4KUZH 2F5BH 1CICC 4XXDB 3HB3D 3ABZA 2YA2A 4NWTH 3P40A 3KPNA 4MNQB 1A3QA 5DJCB 2YUWA 3DYOA 1EHLH 4K7PH 2IMMA 3FHQA 3GSNB 4GG6E 4HLJA 3BGMA 3O2WH 4DKEL 3AB0C 3ZLQC 1PQZA 2EZ0D 2DTML 3RL1A 2ZJSL 1CK0L 4TULH 1FPTL 5GJTL 4MAYD 4MB4A 1N0XH 1EEZA 3HNSL 1RFDL 1MFEL 5CGYD 4BZ2H 3L3GB 1L9MA 4OCLC 1WZKA 2Y06L 2BMKB 2QADC 2VISB 3GIZL 1EMTH 1AP2A 1HINL 1NCWL 2AV7B 1VFBA 3LRSB 3QCUL 4ZODA 3WV0A 1PKQA 5ESVB 4HH9A 5CJ8A 5D5MB 3ROLA 1ONQA 4K7PY 2Z8WC 1BJMA 5T1LA 4ZTOH 5FK9B 3DMMA 3VWJA 3L5JA 1YEDB 2DIBA 4R4FH 3KPRA 4ETQA 1SJVA 3O6ML 4WTZG 4O58H 3U7YH 3IFPB 2K9UA 5D1XC 2ICWJ 1Q9OB 1D7FA 4NNXB 3VI4E 2BHYA 1ZT4A 2HFGH 4OZGE 3KYKH 5KSUA 5CBAB 3CFBA 1WGOA 1S78D 2R2EA 3MV8B 3N1MC 3ULVF 3SQOH 4UDTB 3BH8A 4IRJA 1ACZA 4OV5B 3BZ4A 4PJ5A 3TYGL 3HLAB 4LHUA 43C9A 1QVOB 3RDTA 4MD5B 2W9DL 4X6DB 2Y9RT 2QHRL 1H0DB 3HZMA 3HI6L 4CVXA 1DBKH 4M7JH 1BQUA 1U8LA 2L0DA 3QNZA 4MJ5B 4DKFL 2D0HA 4XCFH 1UM5H 4WI3A 2IQAA 3CDYA 1RZ8B 5HYSA 2Z91A 3DIFB 3BDBA 5EUOE 3QBTB 4OZIF 1GGBL 1VFUA 4JG0H 2XZZA 2GCYA 1I7TB 1ZANL 2HP4A 4HJJL 1AJ7L 1UKTA 2RAMA 2H8PB 1VESA 4C59B 3T3MF 1I3RB 4M6OH 1A6AA 3SDDC 5CEXA 3D85A 1FV1B 3JWNC 4G8EB 1AH1A 2X4OA 3S98A 4LLWA 4HX1B 3WIIH 3P30H 1KT2A 1EEYB 3BEVB 3ALXA 5IHZB 4F57H 3O2DA 1F4XL 1ES0B 2VLJB 2X9XA 2C3HA 5IVZA 5I71B 2Z31B 4F7PA 1FZOA 5CLWA 4HWEL 4K2UH 3N50A 1CBVH 5D7LB 12E8H 4OLVL 1BM3L 3O3EB 1EBPA 1HI6A 4Y1AA 1AGEA 4J3SA 3RY6C 3DVGB 4ZPVA 2NXYC 5DURB 1NKRA 2UWEA 4K94C 3GI9L 2BVUA 2GUOB 4YBQD 5IB1A 2C26A 3FQNB 3QUKB 4H25B 1EVTC 5DQJA 2DJUA 4JFPA 3UJTL 3C5ZD 2E7LA 2HT4C 4QRRE 4V1DB 2YC1A 5F7HA 1FZKB 3PP3H 4HIJB 2Q86A 4AH2B 5HGBB 2B8OT 2K7PA 2VL4A 3PJSB 2W65B 5ACZB 4PRID 5ISZA 4AT6A 4EI5B 3HE6B 3C9NB 4ELMA 4PRNA 1OT2A 2XTJE 1DBAL 1INQA 1A22B 3G08B 1R5VB 1ITBB 1L7TH 4LSVL 2DQDL 4NKDA 4KDVA 3K80A 4GMSH 4HS8H 4WU5B 3SEPA 3P9LA 5DUPL 5T3ZH 4DN3L 4TSCL 3SDCC 3E2HC 2VE6A 5JXEC 4PJGE 2GHWB 4EOWL 3TA3D 5FEBA 4JRYB 5IF0B 5EOCJ 4A2MA 5GGQH 1BZ9A 3PWNA 4M03A 3STZB 3LN5A 1UWGH 2EKSB 1P84J 2E3VA 5DLMH 1AQDA 5D2NA 4LOUC 3T0BA 5FECB 1KPRA 4WUUD 3AMKA 3QCTH 4PD4J 1ZT1B 4R90L 3MBEA 4QF1B 5E08H 2DI9A 3FB6A 1EIBA 2BVOA 2W91A 1T21B 3U0WL 3B9KD 3LQZB 1V7NH 5D1ZB 4Y2OA 2BDNL 3I02A 3DXAD 3VXQA 1FIEA 3ULVD 1QRKA 1J1PH 1M7IA 3TF7A 4YNYA 2E5EA 5AZ2H 3REVB 1AGDA 1LO0L 3QXTA 5I16A 5GS1C 1E4KA 3DTXB 3UZVB 3T0ED 4NQED 4XPHH 1U8MA 1AO7D 3IKKA 3EOAA 3NFSH 5FA3A 3PV6B 4XWOD 4UT7H 1B4JH 5C0AB 2COQA 2JJSC 2NX5B 2BOBB 3QFJA 1U8PA 3DGGA 4XTRC 4MVBD 3S35H 3ULUH 5E2UL 4ONGL 3D18B 3LD8C 3U7AA 1IC7L 3OG4B 5LGJB 4NQSA 1MHEA 2ESVB 5DA4A 3GSUB 4HS3A 5KSBE 4XGZB 1HCVA 3QH3B 4O2EB 1QHPA 2C9AA 2R9HC 4YPGA 1RURH 4OFVA 4RAUA 5AZEL 3WFEL 1A6TA 3C8KA 4YLQT 1RUKH 1N64L 3OQ3B 3LIZH 3MLWL 3P9WB 5DZNA 3SDAB 3Q3GA 4XH2A 3TWCH 4X4XB 5JUEL 2NNAA 4HPOH 4YHOL 3WFHB 5CD3A 1YMHB 2OJZL 2RBLA 1NCAL 3PABB 4L9LB 3S4SG 1G9NC 4HQQL 3ZKND 3EIFA 3UJIH 4CU7A 2DYPA 2CKNA 4HWBA 2PYED 3G5VA 1X5JA 1QO3B 5GZOC 1ZHLA 2CRMA 2GJ6A 4L3EA 3DUSB 2OK0H 1MJ8L 3BEWB 4OFYD 1K6QH 5F72S 4RMWA 3GBNL 3VG9B 1KB5H 4I3SL 4X98A 4JN1H 2FIKB 1LGVA 2IGFH 3BMVA 2PF6A 3NCCB 4EUPH 3LS5H 3QRGH 4TNVK 4KXZH 2ZCKH 5ACLA 4TOYL 4F15B 1O7SA 2J2ZA 2AQ1A 3HI5L 35C8L 3STLA 4LVOB 1PFCA 5D93C 3GJEA 2OI9A 1QKZH 5E8OA 1A0QH 5IWLC 5GRUL 4YDJB 2G75A 5DRZB 3RRQA 1TJGH 2BSSB 2R0LH 1NEUA 3S5LA 4N5UA 4MZ3A 1IGIL 3ZSSA 2IPKB 1QSVA 2NR6D 2ADJA 1RHHB 4E0RB 2HVJA 2E7BA 1CLOL 4PJCE 5CP3A 1YNTB 4NHUB 2FGWL 4NN7C 4QHUB 1G7LA 3TPKA 5ELIA 1IC4H 1D5ZA 2EE3A 4JHBA 2A83A 4GRWF 2G60L 5HDLA 5KOVC 1KULA 4OJFL 3GK8H 3O8XA 1NC2B 1KTLA 3BUTA 3QDMB 4Q9RH 5CHNA 2AJXH 5F3HA 1T0MA 3X11B 1DEEA 4GKOA 1LWRA 3NCBB 1RUAL 4K3DH 5FDWB 4V3DB 2YWYA 3MV11 5CD5C 4R8WH 4IRSD 2H2PC 4M43H 2H32H 3WIHL 2R0WL 2ED7A 1K8DA 2VIRB 4OBSA 5IW1A 3D3VB 3T3PE 4HKBA 3RZCA 4I4WA 5IR1A 3SE3A 3G6JA 4OLEA 5GQBA 1G0DA 5JIIA 1IGYA 3GRWH 1SY6A 1PSKH 3HPLA 3R1GL 4M7LL 4L8DA 5GPRA 5ICZA 3P11L 3JTSA 1U2CA 1MLBB 3RKPA 3DPBA 4JFOA 4N5EC 3BP7A 2J8HA 3IETA 1BOGA 4P2QD 3TO2A 3RIFF 4PJ7E 2MCPL 2FR4B 5C2BH 3QDGA 4CL7A 5T1MA 4FS0A 3FCTB 2GKIA 3IS0X 4AEIL 1HEZB 5E56A 5FB8A 3W0WE 2CXKA 1YEKL 2CLRA 4JO3H 1WEJH 1HXMB 3RVUC 4HULB 2AJUH 1SEQH 1FH5H 4RBPK 3QNXB 3CD4A 4NCC1 4ZDHB 5D7SH 4LLDA 5EIQA 1L7IH 5B3JF 2UUDK 3HG1D 3UO1H 5GSRB 1TJHH 2XTLA 4LLMB 5F1NB 3UDWC 5EB9A 3ILQC 3QA3A 3V79C 1K4DA 4Y2DB 2EH8L 5IVXE 4MXQA 3GSNL 3B8YA 4APQC 2QV2A 5CZVL 5HGGS 5BZDA 2B7DT 1OARL 1I8MA 4X5XA 2IG2H 4NSKA 3CFJB 1CL7L 1FLRL 4KZDL 4F7TB 1OCWL 3DYPA 3QAZB 2RFXB 5MEOB 1MAKA 1FRGL 5IEKA 4U1GB 1QFOA 4LSRL 2BC4A 1QEWA 5T1DH 4LASL 3JUZA 2IH3A 1XAUA 1U58B 5IB2B 3QO1A 5GIRB 1T2JA 5D6DA 1Q0XH 3HC4L 1QSEE 4KFZC 4LNRA 4ZSOE 1EERB 4UDUB 3WL9B 4UMGA 4UBDC 4LSSL 4UV4H 5MEQA 3ULVH 4OLUH 3VFSB 4PB9L 4XHJD 2VDNH 5HHPB 2UVFA 3C87A 4M7ZB 3VWJC 1SYVB 3DMMC 4GFTB 5I8CA 3BWAA 5TDOA 5TGBB 4M9OA 4X7TA 4WEMB 2JB6B 3HE7D 3ZDZE 4LSUL 5DR5H 5KN5B 4U0RB 3CDFA 3LOWA 5ITBL 2JF1A 4MJ2A 5HI4C 3UC0H 3F58H 4IRJC 2CLVA 3WE6A 5HHVL 4ODXB 4XP6L 3RDTC 3UYRH 1E28A 1F2XK 5I1AA 2MPAH 2NTFB 2NMSA 1A6UL 2J4WL 1FL5B 4QEGA 2NXZD 1KG0B 3BI9X 1T03L 2FBJH 1AXTL 4GS7C 5KW9H 3TT1L 4D8PA 1GGTA 4FZ8H 5INCA 1U8JB 5EN2B 4YWGL 1UXSB 1CT8B 1OLLA 2HMIC 3B2VH 4X4ZA 3RY5A 3BD5A 3HUJA 3RX8A 3X17A 3KLHC 5LCVH 1RK1B 3TT3H 4G6KH 3D2UD 1ZK9A 1FYTB 4GMTH 4XNMA 4L4VB 3T09A 3V6FA 5D6CA 3D69A 5KVDL 2R0ZH 5AAMA 5DQ9A 1V7MH 2UZIH 1MFAL 4NQCE 5HHMA 1U8IA 3KJ4B 1JVKA 3LKPA 1JTTA 1BEYL 1CLCA 1CD1A 4K9EH 3X12B 4LRIC 2C7UB 2ZSWA 2DTMH 5I8KH 4OTXL 3QXDB 4NO2A 4PTUB 1QSFB 4Y5YA 3BPNB 3HNSH 1VACA 3QUZA 4OAWB 2FO4A 1MFEH 1KV3A 5F6HI 1V3JA 5IBUG 5LWYL 3GIZH 1XR8B 1OTUD 4J3OC 2VR5A 5D5MF 5I1KH 5ALBL 5EU3B 1FVCB 2LQRA 3H3KA 4XPBL 1R5WA 2EEAA 4Z8FH 1NMCC 4PJFA 2ZUQB 3D39A 4JM2A 1IGJB 5IW6B 5L2KA 3GBML 4ZUUB 1VGEH 5EUKA 4DVBA 5DSCA 5HHOA 2BHZA 4KMTH 4X5WA 1FGNL 3WFCL 3R0NA 5EBLA 2AV1B 1DANT 3MGAA 4KKCD 1D5XB 1A1MB 3SY0B 3L95B 2AJ3B 3LH2L 3JWDC 2NW3A 3RUGA 4WO4C 1J1XH 1CFTA 2E7LC 2XRAL 2W9DH 4UT9L 2QHRH 4X6DF 3TVMC 1S9XB 2X09A 1NMAL 4PP2B 1T6WA 3IU3A 1AR1C 1TCMA 5EO9A 1JWMA 1B0WA 1QBML 4YHLH 1QLRB 2YD7A 3LRHA 5DD5L 4YGVB 1DVFC 3VDAA 4MDJA 1MY7A 4ONFL 4R4BB 5HVFB 3HC0B 3VGHA 4LIQL 1N3NB 3FO0H 5E94A 5KSAD 3TCLB 3CH1A 3E6HA 4FQXB 1Z5LA 2D4DA 4Z7NE 4M93B 1XF2B 4PJBB 1OF2A 1KCGC 4JKLA 5D4QA 3ARPA 3FQTB 5DJ2B 2E27L 3V6ZB 3OKLB 3O4LA 3VJ6A 5DJXA 3RBGA 4GRLB 4OF3A 3F7YB 1C1EL 4MYWB 3W9EB 4PJEE 3LY6A 1ZLUK 4AY0A 5DO2D 3B6SA 2E7LE 2HA1A 1P4LB 4R3SB 2FCBA 3I2CH 4JFDA 3CX5J 5EOTB 5E95B 3VGEA 3FO9B 4U49A 4KJQC 4S1DD 4FABH 4Y5XB 1YN7B 4I9WE 1X4XA 4JFEB 3MBEC 1U95A 1IL1B 3VCLB 3FONB 1G7HB 3CIQA 3EDKA 3ARDB 4FXGB 4PY7B 4HWEH 4H88L 5FHBL 4G7VL 3MRBA 4EI6A 5EU6B 1OTSD 2VABB 4CW1A 2EICA 4Y4FD 2G9HA 5EPMA 4G9FA 2Y36H 3FO1A 1TMCB 4HCRA 2XZQH 2BNQA 1WFTA 5EZOL 5CWSB 4Y4HA 3GMRA 4IBLT 4S0UC 4JDVB 2YD6A 1BIIB 2NTSP 4KDTA 3WNNA 4OUUB 1S9WB 4OCRL 3LV3A 2AXHA 5FCUL 1MRDL 2Q1EA 4R4NC 4PJIA 5E2TL 3QIWA 3BGAA 2WP3O 2QR0A 5T3ZE 1XR9B 4GXVL 2GEEA 4TUJA 4AM0B 5CLTA 1MJJA 4GLRI 4HZAA 1O0VA 1UZ6E 1DBAH 1CFSB 1U8NB 4MNQD 1MJ7H 1AKJA 3S3PA 2D7NA 3ARSA 1L9NA 1WLHA 2YK1L 1MH5A 1QA9B 2RJMA 4N0CA 4PJHE 1CU4L 4MWFB 4I48A 3WUZA 4IRZH 3BJLA 2ZCHL 5F9JB 1MEXH 4P3CH 4DN3H 3OF6D 3BRDA 1IGTA 4QRPB 3ZHKA 4C58B 4M1CD 4PJAA 2Z35B 3P4MB 2F53A 1DBBH 3LEYH 4PRDB 3AC0A 5J13C 1FSKC 5HPMA 1KF9B 2ID5A 1MFNA 1E6JH 3OKYA 4WW2C 3RGVB 1QLFB 2APTA 3IAGC 1A3RL 1NCBL 4MMXC 1DUZB 4DGYL 4HG4K 1YA5A 1IARB 3QFJE 4X8XA 5I75C 5L0QB 3VRLF 4PGEB 5BVJA 3V4UL 1GZPA 4ZFOB 2X89A 5EBMA 4PG9B 1URLA 2L4OA 3OL2A 1WZMA 4J12A 3DUUA 5C07D 2OL3A 2OXHA 4ZS6D 4JPVH 3OKMA 2EDKA 1FYHB 3KAAA 3RJDA 5CIPH 1J5OL 2PTTA 2YZ8A 1WAAF 4OCWH 3V2AR 1B90A 4GKNB 5E8PA 3ULUE 3UTZA 1OAXL 1XIWA 3C08L 2AXFB 1GHFH 2HFEB 3S9DB 1MCIA 2VQ1B 4HFUH 1TETH 2OI9C 4H0GA 5DTFB 4CN1A 2LAAA 4Q9QH 2BCKA 1IMHC 2UV3A 1A9EA 1FO0B 1J0KA 1HH6A 3B5TA 5A16B 4GRWH 2PR4H 3D0LA 2EC8A 4WGVB 4Y89A 3MRFB 4PRPA 2YBRB 1BZ7A 1S78C 1WIOA 1TQBB 1TPXB 1VFMA 3MLUH 2JB5H 2X7LB 3BD3A 3EOBB 2CK0L 1UH3A 4X7CC 5IQ9A 3GSXB 2PKDA 3QIUC 2V7NB 5DJYA 3QQ4B 4UOW1 3TBVB 1T1WB 2E6PA 2ZKHH 3O8XC 2VWEC 5AZEH 1CXFA 3BQUB 4XVSH 1N64H 2JE8A 3KYAA 1NAMH 1ZVSB 4FNLL 3ZMRA 4PRHB 1CR9L 3O41A 4QOKA 2OQJB 1KCKA 3DGCR 1UM6H 2VLJD 4HQQH 2HFTA 3C2AL 4XB8A 2Z31D 3TPUB 3MXWH 2LVEA 3QI9B 3GSWB 3BPOC 4M4RA 1ZLSL 3PGCB 5T5FL 5JO5B 4NKMB 1P1ZB 4PJ9B 5D7LD 2IEPA 4QRTA 3RKDC 3VH8G 4Y8AA 2JIXD 4Z77A 3MC0A 1P7KA 5DURD 4NRZB 4M48H 1MRFH 3VE0A 2MOVA 4MQXD 4YPJA 5J89A 4NRYA 4RGNB 2VWEE 4F2MB 4P2RB 4PV9B 5IROA 2IC2A 1OOAA 3GGWB 3OSKA 4JQVC 1BBJB 4O9HH 3ORJA 4IOFD 2BP3A 1RUPL 3HI5H 5EWIL 3ARZA 4IIQA 4V1DD 1LEGA 3VRIB 3VRJA 1NCCH 3RWFA 3VXMA 2W0FA 5IT2H 2EYSB 1FBIL 5I74B 3VW3L 4EI5D 2GSGB 4WEBH 2J8UB 3HE6D 1A6PA 3NA4A 5JLZA 1DLHB 1O5DT 1FL3A 3AXLA 4HUXA 4JM4L 2ADIB 5HGHA 3QUMA 1G1CA 1I7RB 5E5UB 1CLOH 2X5PA 1JFQL 5HYJB 2AEWA 2Q6WA 3CCHB 4MXQC 5C2UB 1F58L 5E8DH 4XC3L 1X5ZA 4LSQH 5C0DA 4B53A 3QZWA 3OXSB 4OJFH 4JRYD 4CVZA 3C5SB 3QXAB 4JN2B 3P9MB 4NUGH 1EFQA 2J88L 5EFIB 3SE8H 1Z9OA 5F93C 4HV8B 5IV2B 5IOPB 4I18A 1RUAH 2D7MA 2B1AL 1QBLL 4OQTA 4KRPC 3TV3L 4DZBB 1BJ1J 4X80L 3MUGB 5IUSA 1DUYB 1H3PL 6FABH 2G5RA 3W81A 1AGFB 3WIHH 1J8HB 5D6DC 4BELD 4NFCA 2JJVA 5D1ZD 5CKAA 4KJPC 1E4JA 2A74A 2AERT 1C5DB 1BX2B 1S7TA 3VXNA 2XNAB 5AYQA 3R1GH 5DJZB 5D70L 2DOCA 4U1KB 4LCIL 3P11H 4CUCA 3TNNA 3LSOB 3NCMA 1FDLL 1S7UA 4GRMB 2PO6D 5B39A 3KPSB 3ARFB 3DV6B 4RWYH 5FKPB 4ALAL 1RJLA 4P59L 1LK2A 3CH8A 4U6HA 4HF5H 5C0AD 1E27A 3FN3A 1A3LL 4S1QL 1YEKH 2NX5D 2D03L 2OTWA 3VD9A 1MFCH 3DWTA 4UV7H 2R2CA 4BUHA 1ZTXL 1WCBA 2QQNH 1MELA 1GAFH 4LCWA 2V5TA 4PGJA 4XRCA 3GSNH 3BJ91 4DVRH 4ZUWB 5JW3H 4KZEH 3IRZA 4YDLC 5IBTL 1OARH 3SDAD 1NDMB 3ETBF 4X4ME 5DK0A 5IMMA 1Q9WB 1KJ3H 2OTUA 1FN4B 4BH7B 5GISL 5ID0A 1PY9A 5BQ7B 4ZAKA 2WUBL 4LSRH 4BZ1L 3NTCL 1OB1B 5IW3A 3R8BB 3RQ3A 3UTTA 4RA3A 4GW4B 4X6CA 5DJAB 4XNQA 3VXOA 3QUZC 1U93A 2ORBL 3X3GL 1AQKH 3ZTNH 5H37H 1I85A 1CTNA 2OR7A 4P5KA 4BQ6A 2DRUA 3L9RA 2HTKD 1XEDA 3KPMA 3AS0A 1AO7E 1SVCP 3U4EA 4NOFA 5FO9A 5TQ2H 4HWZB 2ENYA 4L29B 3GJFK 1KNOA 3GHEL 1MCQA 4UT6H 5HY9B 1A4KB 3BN3B 3VFNB 2YPLA 4OZIE 3WDHA 4JM2C 3L6FA 4G7YL 3T1FB 5E6IA 4O02L 1WWAX 4KKLD 4LSUH 4KJWC 4FQHB 3PE9A 3MYJA 3SJVB 4POZD 1NFIA 1QRNE 3H9ZA 1P4BL 1LO5A 4X0KA 3BH9B 4C54A 5BV7B 1LE9A 4F7CA 2MKLC 5C0FA 4U2YA 1A7OL 4R0LC 4HUWA 3EYQD 1U8QA 3IVKA 2EYTA 4JY4A 3QCVH 1A2YA 3CXDL 1IGFL 4Q2ZA 2WBJC 1Q72H 3QDMD 4R96B 3WFBL 1QPXA 3IDGB 2B4CL 3QHFH 1PDKA 4KHTH 3I6KA 2PYEE 4HUMB 3QULA 3FQWB 5F21B 4U1SA 4PJFE 1NDGB 5D7JD 2W92A 1EJ6A 3D25B 4JAMB 4D9RD 1B88A 4FFZL 5HHOE 1REIA 4K07A 4GXUM 1A5FL 2XWJB 4ODTH 1UG9A 1Z3GL 4R2GC 1KFAL 1PG7L 3MA7A 4I0CC 4PBWD 4C56A 3LKOA 5GHWH 4AMKH 4NPYB 4RAVB 1BOYA 3ILPA 2FYYA 5FDYA 1JGDB 5ANMB 3OX8B 2QTEA 4LEXH 5DFWH 3RGHA 5KZCB 4QXGH 2EECA 3HS0B 3FB5B 3GJFB 4MLSA 3OGCB 3QEGL 3DROA 5IGXH 5ETUA 5C09A 1QZ1A 4HIHA 2GY7B 4K8RD 3WEXA 2A9ML 4ZFFB 5J1AB 4QT5B 3CK0H 1NGWB 2XFXA 3DETD 3EFFB 1RU9H 4M1DL 1MWAH 1FFOB 3DX7B 5L2JA 1ED3A 3QFDA 4RDQG 3O4LE 1SJHB 4LP5A 1A8JH 4EXPX 4GAYA 4DK3A 6CGTA 1PG7W 3QIBB 4KDTC 4LDOB 1U3HA 4IM8A 2XRAH 3ECBA 5DUMH 2I9TA 4LGPB 5FF6B 4Y2DD 4ENED 3VI3E 3QIWC 4LLQB 3RA7L 4NHCL 2UYLB 3WD5H 3TIDB 3NZ8A 1NGYB 2F5AL 3U7WH 1TZGL 4YAQB 2FJHB 4ONFH 4YHYB 1D6EA 1INEL 4NZUH 5FAAA 2DI8A 5CCKH 2JJWA 4F9LA 1YY8A 4GOSA 5DGQA 2FJFB 1AI1H 3MV01 4HGWA 3ZO0A 1JYVA 5IQ7L 4PJBF 4UILH 1LQSR 4U1LB 4U1JA 2B5IC 4U6VL 3PDOB 1MCJA 4KQ3H 4NM4L 4WWKC 5FYJE 5CEYB 2E27H 4R6UA 4HS6B 3RNQA 2OP4H 3BSZL 2XV6B 5EA0H 3RTQB 2OR9L 3BIKA 1KBGH 3IJYA 5CJQH 3TCXA 4IJ3C 1FE8L 2GITB 4NN5C 1LD9A 2HLFC 3U9PH 3ARGB 2F19H 2MHAB 1Y18B 5E03A 4OD2B 5HDBF 4BFIB 2A1WH 5FA4B 1RZFH 5L88H 3OGOE 2FJGB 5E9DA 4N1EA 3R06A 3BFOA 5EC2A 1FG9C 3HZVA 2WINA 2EIEA 4Z7QE 3HRZA 2ITDA 3N0PB 4Z76A 4Z95H 3ROOB 1FO0L 4M8QB 2V2XA 3HG1E 1NH6A 1QP1A 3O6FB 4X99A 5MENA 3RU8H 1KJVA 3C2SA 3IJHA 3L5HA 4HKXB 4OLYL 3T4AA 5C9KA 1IT9L 5E00B 1BFOA 3TIEB 3KPPA 1IC1A 1FZJA 4MSWA 1OD9A 2WQ8A 5DMIH 1BGXH 4YXHH 4QNPE 4ZFZB 1HHHA 1MY5A 4XBEL 1IAKB 5D9SA 4OT1L 1V5JA 4GXVH 3QDJA 2H3NA 5JW5A 1KCRL 3GO1H 4JPIA 3MA9H 2CLZA 1PBYA 1FYTD 2MQ3A 3VXRD 4F7EB 4L4VD 4GBXB 3GSQB 1NLDL 3EO1A 4X9GA 1AFVH 5DDHB 5HGAA 1NCUA 2IAND 2O5XL 1UXWA 5I76B 1NPUA 1XGPB 5EO1A 1W2KT 4GG6B 3EO0B 3THMH 3U9UB 1QSFD 3SKMA 4XWGL 4I2XA 3AU1B 2ITCA 3OR7B 2X40A 3BDYH 3K2UH 1VGKA 3BT2L 4GO6B 1TZHA 5MEPB 5F1KC 4XNYH 4NJAL 1FVEB 1JP5A 2FZ3B 4ONHB 3TBWA 2OX5A 1EPFA 4ZO9A 2QLVB 2W07A 3MNWB 4P57A 2FHBA 1ZOXA 4BH8B 2K3TA 4ZD3L 3TBYB 2X4SA 1CICB 1LDSA 1HHKB 4KDWA 1KSRA 5E5MA 1ERNA 2QKIB 1Q94B 2P46B 5E2WH 2DL2A 3RNKB 3QSKB 3BP5B 5C0EA 4E41D 4OZGB 3NACH 3NMEA 4K7FA 2V9QA 5T1KB 1J5OH 1MAJA 3FT3A 3AS3A 1TJIH 4YEFA 3EYUH 3ZKSD 3AB0B 3IKCA 4IIQC 4YDVB 1RUML 3N9GL 5EC1A 3EFDH 5I8EA 4HT1L 5IKCB 4TUKH 3HC3L 5FGSA 4ZYKB 4F80A 3CFEB 3TGXA 3E3QA 3S4SA 3V8CA 1JNNL 2QADB 4M8VA 1NBVH 3C60B 5C0JB 5D8JH 5HHNA 5LQBL 4LSPH 2EDHA 4ZFGH 1DJSA 1H3GA 1W72H 2D2OA 3OKEB 2CR6A 4FQXD 3GKWH 5C08A 3KWWB 4ODHH 5HGDB 2FL5A 1MIMH 4KKCC 3JVGC 1WFUA 5FGCB 43CAA 1UWXH 3G5ZA 4MB5A 5CZXC 3UAJD 2QJDA 1DSFL 3QHZL 4OUOA 1ORSA 3BW9A 5TE4H 2YKLL 2BJML 3O3AB 4GW1B 2I60L 2C3VA 1P53A 3PWPB 4TTDC 4GRLD 2JK5B 4HPYL 4O51B 3KLDA 1CXKA 1S9KC 4Z7VA 4FQIL 3SGJA 3BKYL 4OZHA 5SWSA 3MUJA 5GGTA 2E7CA 2NZ9C 4MLIA 1CR9H 1R3JB 3LMJH 4I18C 1Z9LA 2AXGB 5DI8A 1RVFL 5GGRB 4KK5C 4JFED 1CGSH 3ZDYF 2X1XR 1LO3L 2APXA 2WAHA 1ZWIB 4D0BA 3OPZL 4M6AA 4LVHC 4LPUA 5EU6D 5K9QI 4WRLA 3VFPA 1NGPH 3MRIB 1FNSL 4K8RH 25C8L 4WHYH 3WLWD 3EHBC 4LARL 4G80A 1UJTA 2C4XA 15C8H 2HVKB 4V2BA 3VMPA 2BNRA 3IGAA 4PG2A 3SDDB 1PD6A 3CFKA 2EKJA 3FMGL 3RVVC 4PR5B 4QXTA 5GS0D 4MX7A 3PIQB 1ROWA 4ZTPL 2Y25A 3L1OL 2CIIB 5EWIH 4HJGB 4L8BA 4QRRB 5FO8A 4LPVA 1YN6B 4OD1H 1XH3A 3GMNA 4U7KA 4WI8A 1KGCD 4TSAH 3VXSA 2VUOA 4NQUA 4C83A 1SBSH 1BVZA 2J8UF 3FO2B 5B4MC 1YEFL 1IGCL 5TF0A 1NGZA 3WNKA 4WW1A 1MCCA 4FFYL 1JI1A 4UQ3A 4ODSL 1I8LA 3SE9L 1SJEA 2NW2A 5EORL 3TO4C 4QRPD 2X4TA 3IDMA 4DAGL 4G6JL 5IB3B 4KY1H 1P84K 2GY5A 2NXYB 4EN3A 1IKFH 4F9PA 2HTLD 4N0YH 1CFQA 2YUVA 3QXVA 1I8KB 1QFWL 3MLSH 1MCWM 1JIBA 3DV4A 3QDAA 4PD4K 1MHHB 3K3QA 4OLZH 4ZAKC 5TE6L 4KHXL 3WXVH 3RGVD 4AEHH 4WENB 1MRCL 2D7PA 1HZHL 1QBLH 2ICES 2DQGH 5L6YH 5F7NC 3EKCA 5HVGB 2R0KH 1RZJC 2AJSH 3JV4B 3MUHL 2DQCL 4K3HA 4HFWA 3WJLC 4KVNH 3ARVA 1UA6L 3LN4A 2VQTA 4PS4H 4V3EB 1I85C 5J1SC 1S8DA 2D0GA 3KR3L 4Y8DC 5J11C 1I1AC 4RBPH 4MJIA 2RB8A 2X4UB 1AIFB 3MRGA 5E2VH 4MD0B 3U83A 1K8IB 4E5XA 2UUDH 3MO1A 4WV1C 3SDCB 3E2HB 1OSZA 5AYUL 4WI9A 5D2LA 1KELL 2OZ4L 2R23B 3EYVA 2ZP0T 5AEAA 3LEXA 2FGZA 3PGFL 1WTLA 2CDFA 5E6IC 4ALAH 1LK3H 1MQKL 4HK0A 5IBLD 4S11A 4RZCB 4QXWA 2WM0A 1G7PA 1JWSA 3I9GH 3JWOH 3MODL 1CVRA 4MJ6A 3WJJA 2VDML 5HDQL 3AVEA 5BCAA 5J3HC 2BSRB 3QJHB 4GAGL 3EYOA 4CJ0A 1OLZA 2CD0A 1I1YA 1JNLH 1M6OA 1HHIA 4G43A 2DWDB 2GFBA 2XPGA 1I7ZB 4ODWA 3C6SA 4CADA 1T7VA 4BM7A 2IBZX 3MNZB 4UIMA 4CN4A 5BRZB 2H9GA 5C0GA 3C5ZA 3FFCA 4GQPH 1ZMYA 2GAZA 3BQUD 1S7RA 2YD3A 3GSOA 4M3KB 1KTDA 4DUVA 5AD0A 3LQAL 4PRHD 5GS1B 3OWEA 1N0LA 4L4TA 4MD4A 2IALA 3EJYD 5EZIL 3QI9D 3I6GA 4TVPE 1YUHA 4H5SA 5DC0A 1MREH 1W0VB 1C5CL 3IDYC 5C07E 4PJ9D 5F6HJ 2FSEB 1HOCA 3KYNB 5K59E 1CL7I 5SV4A 1S3KH 5A3ID 4Z0BH 4HC1H 3LD8B 3VG0L 1YEEH 3HFMH 1WBXB 2PW1A 4RFOH 3TA3A 5TDPA 1OSPL 2FX7H 4RGND 5JDJA 4P2RD 1DBMH 2QSCH 1OD7A 2GIYA 1RZIB 4LGSB 1R3HB 2EXYD 3TJHD 3PDDA 5F1IA 4KKBD 3S3JA 2YD1A 4UU9A 5SX5K 4EDXA 2ARJB 4WUUA 1ADQA 3TH4T 5JR1H 1L0XA 4TUOB 4O02H 3L7FB 3V4VH 4AZ8A 4AENB 3JV0A 4E9LA 3B9KA 4LCYB 3NIDF 1DN0A 4HUNB 1TVHA 5KSVB 5GRVK 3LCYA 3V4PL 3BPCB 4MCYA 2ZCLL 3MJ9A 1G7MA 3CVHB 3P4NA 1U3HC 4GSDH 4KGLA 3NOIA 1G9ML 4OGAC 1AC6A 1JHLH 4RX4A 4PJCB 5JORA 4LLVA 1KPUA 5GGVL 3OKOA 4ZQKA 3V0VB 3C09C 3ME0A 4PJXA 1T5XB 5ID1B 5BJTA 4XMPH 4Q6IA 5F89B 5IG7A 4F9LC 2N1KA 3QO0A 4JO4H 3UBXB 1VHPA 2HN7A 4XBPA 3G6AA 2JJUA 1G7QA 1KJ2B 3KLSA 4HDIB 3UCRA 1BQLL 3ZE0F 5D93B 5BS0A 2CUIA 2NYYD 5ENWB 1MLCB 1J8HD 2EDDA 3TH2T 1C8PA 1FCGA 1A14H 2VZ3A 2FIRT 5FKAA 3DX8B 1KFAH 3LRGA 1PG7H 1UB5B 3WLBB 4LFHD 4LQFH 1F6FB 1ZT7B 4WIQA 1Q8MA 2Q7YA 3GMLB 4FP8H 1JHKL 4LPTA 4V1DE 1QFPA 2ADFH 1YQVL 4JZNA 4GKSB 3KPSD 5E8NA 3TLRA 1MI5B 3F12B 1J05B 4IDJL 4RGMC 4D0DB 3JTTA 3U1SL 4PJ7B 5GS0H 2DLIA 4M1DH 2AKRA 2DQJH 2E7HA 5DJ0A 2AQ2A 3C6LA 1UENA 3W0WB 1WZ1H 2CMRH 4L8SA 4GG8A 2FEDC 3FKUS 2Q8AL 3B9EA 3C8DA 4N68A 3U82B 5L8KB 2VUYA 4OCNC 1X5LA 1JPGB 4YC2C 2BY3A 1EX0A 1I7UB 2ICEB 1H8SA 1X9QA 3FRUB 1B0GB 1JGEA 3T2NL 3WYRA 3PL6C 4UZGA 4WFHE 1JPFA 3V0WH 1YC7A 2L7UA 4F7MB 5A1AA 5IVXB 4A6YB 1NCNA 1ZLUH 1JPTH 1INEH 3QQ3A 4C55A 4LLAA 4DEPC 3U2SA 3S6CA 4XVTH 1T2QL 2X9WA 2X4QB 3VMOA 4U6XA 1UJ3A 1RK0B 2OS7A 3MGTA 5IQ7H 1NFKA 3LKQA 4QCIA 5ITFA 5IESL 1LE5A 5K9OB 4G5ZH 3SDYH 3BSZH 1WAAE 1OAZL 1GPOL 4XCEA 3FT4A 4RNRA 3UPAA 4P4RB 2IAMC 1KIUA 4ORZC 1QSEB 4KC3B 4ERSL 4ZSOB 4G3YL 5KS9E 4NBYB 4AQOA 4WFFE 1G6RB 1OM3H 4YHIA 3MRDB 1NBYA 4YHML 4NT6B 3QDJE 4TSBL 4APQB 5J8OA 4LEOB 3BVNA 2WUCL 2XQYG 4U7MA 1J88A 3MLVL 2NX5E 3QEHB 5ADOL 1AY1H 2HG5B 5MERB 2NY5H 2ZG1A 4J3UA 1HH9A 1BQSA 4IRSA 2Z93A 3KPNB 1ZA6A 5JXAH 5JPMA 2C4FU 3SJVD 2AW2A 3UJJL 4GAJH 4MXVF 5JIKA 3HMXH 4BFEA 3M8OH 4JJ5A 1S9VA 2V5RA 3H9SA 3BGMB 2CDGA 1RIHL 1YJDL 5E24E 4L3CA 2VLKE 1X5IA 1PQZB 5HD8C 1WJ3A 1E0OB 4FFWC 1XCTB 4F37K 1KIQA 1S7SB 3HRPA 3MJ8A 2ERJC 3E3QC 1BVLA 1MHPH 2Z8VC 1KCSH 1AP2B 1VFBB 4X7EC 5F7EH 3RVWC 1Y0LB 3X14A 1PKQB 4HH9B 2BY1A 4NNYA 3ROLB 1T22B 1ONQB 4YUEL 3UTPE 5DRWA 1KCRH 2DLFH 5T1LB 2CRIA 3VWJB 3DMMB 4OZ4A 4ETQB 1NLDH 2VAAA 1J11A 2DKUA 2Q3AA 2BSTA 2O5XH 3ET9F 1UVQA 1ZT4B 4FQ1L 5KSUB 5FO7B 4NQCB 3RAJL 3CFBB 3NH7H 1KCVH 4GXUN 1XZ0B 3NABL 4L3AA 4GG6F 3SGJC 4IRJB 3BX7C 3WSQL 3RDTB 2XXMB 5KZCD 4I13B 3ZKMD 4CVXB 3ELAT 5J9PA 5JOPD 5D72L 3MRCA 4AIZA 2EH7L 3QNZB 2DLHA 5ILTH 4DGVL 4WHCA 1EFXA 4GS7B 1S5IH 4S10A 3I75B 2IQAB 4HBCH 3OZ9H 5GGSA 4LAJH 4AL8L 5HYSB 4PGBA 2Z91B 3DRQA 1J1OH 4QTIL 1IVLA 1S5HA 4I0KA 2B0SL 4YDIH 5EU5B 2GCYB 2P5WA 2CKBH 1T89A 1HIML 1BMGA 1EGJL 5F3BB 1OAQL 4OI9A 3CU7A 1XGRB 5M94B 1A6AB 3VI4F 3D85B 1LP9A 4OZGF 3P4OA 4WI7A 4FRWA 2Y6SC 2JELH 1F5WA 1RUQL 4OZHE 1B0RA 3DARA 5DD6A 3CMOH 4LLWB 2VH5L 4G9DA 3NPZB 4PLJD 3V52H 4NQVB 1JZ8A 4JO1H 5TF1L 5FM5M 2IFFL 2CSPA 4JY5H 4OIBA 3T4YA 3MBXH 2YR3A 4D9RE 1VFAA 3HE7A 4F7PB 5LQBH 1IM9A 1CWVA 1FZOB 1QR4A 3RI5F 2FH6A 3QQNA 5KTEL 4R26H 3EJJX 5KVEH 1VDGA 2R69L 3KGRA 1NGXB 3VH8A 1NMCB 3WFZA 2QQLL 2LE9A 5EU4A 1AGEB 1I8LC 1QBAA 4BSWA 1CGYA 4XMLL 1FFNA 2BNRE 4TNWK 4ZPVB 5HYIA 5I66A 4EN3C 1DE4B 4F9PC 2UWEB 4YHPB 3BPLC 2V7HA 3P77A 1VENA 2F74A 4FQIH 4WGWB 5CILH 2ATKA 1R3LB 4FN0A 4JFPB 4X6BA 2XKUA 4WO4B 3DO3A 4J3TA 3UMTA 4FTVA 3SKOA 2K7QA 3ARGD 2YC1B 3TVMB 1EHXA 4DW2L 2A73A 2EO9A 5TH2B 3D2UA 3VXSE 3CUPA 2ZOKA 1HKLL 2PYFA 3H9HA 1DVFB 1AGBA 2OJEA 5C9JB 1A9BA 4PB0H 4PRNB 1JPSL 5I19L 3LDBC 3CSPA 2VLRA 1F3JA 5K9KA 4FQJL 4JG1H 3O6FD 3EJZD 2B2XH 2VXQL 3P9LB 1RI8A 1VEOA 5IFJB 3FFDA 3PXHA 4KPHL 2YZ1A 4Y16A 3TJEL 2FD6L 2E7MA 1NBZA 1JUFA 1X5GA 4HKJB 4ZTPH 5GRXG 4U6YA 2WWMC 2F54A 1BZ9B 3PWNB 3DOSA 4H8WC 3MOQA 4OLWH 2AABH 5DK3A 5E4IA 1MF2L 3P73A 1F6AA 4JHWH 2VAJA 2JTDA 5BOZG 4Z7WA 4OM0H 1GC1H 4ZPTA 1FNLA 1RZKH 3GHBH 4D3CL 3I3EA 1KN4L 4JRXA 5J57B 1CFNA 4QXUH 3MBEB 4GBXD 2BVOB 4YDKH 3EYSL 2NY3C 4HGMA 1A6ZA 2FX9H 5TJWK 4BJLA 1LO4L 1C08A 3VXQB 4PJHB 4AIXA 4ODSH 4KK8D 1M7IB 4JPKH 1FAKT 3B2UD 4ONOA 3V7AE 2VZVA 5D2LE 2AJZB 5I16B 1DQDL 4KRMB 4NCC2 1NAKH 3IB4A 3MFGB 3P0YL 4ZS7H 4UTAH 2CH8A 1ZA3B 1QFWH 1GGYA 2WSKA 3VFOA 1XGQB 5FIEA 5TE6H 3DURA 1U6AL 1WICA 2Y5TB 2EDLA 3S37L 4NP4L 4LVNC 3NCFB 1INDL 1KTRL 2QQKH 3QFJB 1U8PB 4YXKH 1EJOL 1KCUH 2BX5A 2P8MB 1CICD 3CPLB 2ARWA 5CZKA 4NQSB 4QRQB 1MHEB 1G9EA 4R97C 1F00I 3MRPB 4YPGB 3FFCE 5K9JL 5T1KD 1G9NL 1X5KA 3S97C 2ZUWA 4OLXH 3PWJA 5HI5C 3C8KB 3N1QC 5AYUH 2R2HB 5BV7H 1KELH 3S37X 1JGVL 3WIHA 3Q3GB 3PGFH 2DF3A 4XH2B 1UCBL 4BSVB 4HLZG 1GIGH 2NNAB 4OSUL 3QXUA 4Q74A 3RL2B 5CD3B 3VXRE 4ZUVA 2QADD 4MA7H 2LTQC 5J13B 3MODH 2DIJA 1FSKB 2DYPB 4UOJA 2IANE 4WW2B 3G5VB 1ZHLB 2VLLA 4AJ0A 3D0VB 2GJ6B 1RD6A 5AWNH 4N0FA 2H6PA 3SBWC 5FFLA 2BOCB 5I75B 3S36L 2XKNA 3S3SA 4F3FA 4L5FH 5C71A 1PZUB 2EYRA 5FV1L 5CJ5A 1DLFH 3PHSA 1QSFE 1N8ZA 3MLYH 4FZEL 1S7VB 5D1XD 3DHJA 4ETYA 5I1IL 4MAYB 3KDMB 5EG6C 1NEZB 3PWPD 4NDMA 2DDQH 5IJVB 1LQVA 5H94A 2HWZL 4N8CL 1HHGA 2CO6B 3MLZH 4FXKA 2CGRH 2CIKA 4JVWA 4RISH 4TRPH 3F7PC 5IB5B 3INUH 4RMQA 3STLB 5F88B 1JGUL 3WCYA 4LMQI 3GUTA 2ZPKL 2OI9B 5E6ZA 5E8OB 3IU4L 2EDRA 5EZIH 3DJ9A 3GJFH 3UAJC 3AREC 3CC5A 4BZYA 5DJCA 1IEBA 3ZE2E 4EUPB 4YXLL 4E41E 3GSNA 3MROA 4WHDA 1WV7T 3IFOB 5ALCL 1D5IL 3OF6A 4XP5L 1NLBH 3IDJA 3Q6GL 5EBGA 1C12B 5D1QD 4XP9L 3MRJA 2EXWD 3HR5B 1OSPH 3QIUB 5GRZA 3L3GA 4KGJA 4PJXE 3SO3C 1QD0A 2J6EH 2BMKA 2VISA 5KBNC 2YMXL 3LRSA 1YPZA 2ZSVB 5ESVA 4DGIL 5CHNB 4QRRD 1X5FA 2C5DC 2Q8BH 5F3HB 3S88L 1T0MB 1DEEB 1KN2H 5FK9A 1RIUH 1YEDA 4PJBE 3C6LC 3AUVA 5E5RB 3OHXA 2W0KA 4L8SC 2GW5A 3IFPA 2X4NA 3T1WA 1Q9OA 1YEJL 1BLNA 1UKSA 4A6YL 1DQML 1K8DB 3BPOB 4XCNB 5IW1B 2ZCLH 3MV8A 5JZ7C 4UDTA 5IR1B 3SPVB 1SM3L 2XY2A 1G9MH 1R5IA 1T2XA 3AAZA 3HLAA 4MA8H 1JGLL 2MQCA 1IGYB 4PJCF 1H0DA 2NXYD 3SCMC 5ICZB 2AVGA 2AJYL 4M6MH 3VD7A 3Q1SL 4JFOB 3BP7B 2N56A 1MPAL 3H3BC 1RZ8A 1N4XL 2HT4D 4P9HH 5IMKA 4NNPL 2I07A 1BQLH 4OQ1A 1P6FA 2NY6C 5FB8B 4LCCB 1MCPL 4PJ8A 1G6RL 2CLRB 5T33H 3C5JA 2VYRE 1I3RA 5F70A 2DLTA 3MJGX 3A67L 5LGHH 4MNHB 1MCNA 5GZNC 4G8EA 7FABL 1FGVH 1JHKH 3MV7E 4HX1A 1JYWA 3QA3B 4Y19D 1K4DB 4YFLF 5I30L 4M6NL 3A6CL 4IDLA 3BEVA 3SDCD 5JXED 5IHZA 3MLTB 3P0VL 1I8MB 1A1NA 1PEWA 2VLJA 4NSKB 4KUZL 2VERN 1KOAA 2F5BL 4IDJH 1R3KB 1KB9J 1RZ7H 4PJ7F 4NWTL 3O0RL 1YEHH 5D7LA 4LOUD 2BC4B 1QEWB 5CUSH 5D71H 1EHLL 3MJ6A 2IH3B 4K7PL 3A6OA 3QEQA 2Q8AH 3DVGA 3QO1B 1P9MA 1QNZL 3O2WL 4PRBA 4L8CB 5IK3B 4TULL 3O2VL 3CFIC 1N0XL 5BRZD 3BYYA 2D7TL 4C4KT 4BZ2L 2C1OA 3F8UB 3KS0J 3AM8C 2P8PA 5SWZA 5CSBA 4X4YB 3W9DB 4MQSB 1EMTL 5GRJL 4HIJA 5B22A 5IVXF 1EAJA 4AH2A 5HGBA 5ACZA 1F97A 3NIFF 5I8CB 3BWAB 4EI5A 4ZTOL 4X7TB 4HH8A 4O58L 3U7YL 2Z9TA 4J23A 3F7RA 1N5AB 1BP3B 3BZFA 1H8NA 2HFGL 3KYKL 2CLVB 5CINH 3WE6B 1OGTB 4ZO8A 4XTRD 1F3DH 4CU8A 4YH6A 3SQOL 3DX9B 4ESKA 4LLYB 5DYOB 1F4YH 5I1AB 3BGFC 1JV5B 4J4PC 3NIGE 4JRYA 5IF0A 2OSLA 3DYMA 2R9HD 3PWVA 1DBKL 4M7JL 4D8PB 2EKSA 5INCB 3F6IA 3S96A 1AO7B 1E6OH 4G8GD 4JY6A 4XCFL 1NL0H 3LPWA 1ZT1A 5C0BA 5A2FA 4XNMB 4QF1A 3V6FB 3EOYG 5D6CB 4IHOB 1CI5A 3D69B 3MXVH 4JG0L 4XMKH 2FBOJ 4M5YH 3LQZA 4AEFA 4IS6A 5GZOD 3LKPB 1QRNB 4M6OL 2EEDA 4HIIA 1CD1B 5FUOH 2VC2L 2A38A 1UACH 4DWHA 4QYOA 3P3YA 4J3XA 1VACB 3QUZB 3MFFB 4EKXA 2FO4B 3MV9E 4M5ZH 5I17B 3WIIL 2VXTH 1X6NA 3P30L 4YHNB 1UADC 1N6UA 2N7BA 3ZDYE 4HIXH 4U6TA 5IM7B 4BQCA 2WIIB 4F57L 5I9QC 4YUEH 3GSRA 5C0CA 1R5WB 2BOBA 3JWDL 5HDOA 4PJFB 4K2UL 3RJQB 5I15H 4JM2B 2AEPH 3D18A 1CBVL 3J7HA 3OAZK 5LGJA 3CFDA 3EUUA 4JFFA 3RWEA 1JK8B 1XF4A 2ESVA 3FJTA 4FQ1H 2AI0H 4JANA 1LP9E 3JV6B 5DSCB 5HHOB 2Z8RA 5I0ZA 1HHJA 4X5WB 5DEGB 4XGZA 4O2EA 2M26A 4RMRA 2AQ3A 4ZOCA 3NABH 3M1BA 5HYFA 4RFEB 3U0PA 1RAMA 1RQ5A 3UPRB 3IDXH 2NW3B 4GT7A 5M95B 1X5XA 4CMMB 3IU3B 1NJ9A 3AFLA 5EO9B 2EH7H 4X4XA 3ZTJH 4R0LB 5IJKC 1YMHA 4DJMA 1TENA 4FQCH 3D1MC 1MI5D 2WBJB 2J8UE 4OF6A 1D9KA 4HJ0C 1SHMA 5E94B 1QO3A 1ND0B 5F9OH 3E6HB 4O2CB 1IC5H 2VITA 3DUSA 3KXFE 3OB0H 3V6BR 2IADA 3KPQB 5A2LH 1JTPA 3L3HA 1WC7A 4JB9H 3W0WD 1L7TL 1BF8A 2VDLH 3TN0C 4U0QB 5CD5D 4Y16C 4KTDH 1ZSDA 2H2PD 1W8NA 2FIKA 5EO0B 3O4LB 5T3ZL 3VJ6B 1I1FB 5DJXB 3T65A 3VDBA 1RUQH 2VH5H 1L6ZA 2P5EA 5JOFA 4FTVE 5GGQL 5TF1H 3S34H 1FJ1B 1MCFA 5DJDB 1U95B 4YDJA 4N5ED 4K94H 3QCTL 2BSSA 4P5TA 5I1HL 4RGOH 4U1IB 3RWIB 5E08L 3MRBB 3UZEA 1KPVB 1V7NL 4CW1B 2IPKA 4Z7NF 4MHHI 2I9LB 1MSPA 1RHHA 2G9HB 5EPMB 4G9FB 3TFKA 4RWHA 3FO1B 1J1PL 1YNTA 4NHUA 2YRLA 1RZKC 4QHUA 3RVUD 1IE5A 2UWEF 5INDB 1P2CB 3KPLB 1NC2A 4P48A 1QSED 2LABA 1YECH 3E6FA 2NY0C 1BBDH 3VGAC 3Q5OA 3ILQD 5DVMA 3LV3B 4HAFA 4DW2H 1MUJA 3QEUA 4APQD 5A2KH 3X11A 3PHOA 3NFSL 3QIWB 3B5GA 4JRXE 3ISWA 4NFDA 1HKLH 4UT7L 1B4JL 4LAQH 4X9BA 1U3JA 3ULUL 2VIRA 1AKJB 3D3VA 4LPYA 3T8XB 4J8RA 3BE1H 1WBZA 3TNMA 3HG1B 3RY4A 1LDPH 2B5IB 2ZUVA 1RURL 4WWKB 4JDZB 1T66C 1IGTB 3TJEH 4WUKH 5F9DC 5I2IA 1RUKL 5EOCH 1HDMB 1MLBA 2X1PA 4M4PA 3TWCL 1IRAY 4IJ3B 5BO1H 4HPOL 4NN5B 1U3YA 4UBDD 5DMYA 3B43A 1UH4A 4MQ7A 3S35X 3UJIL 5C6TH 5BVPH 1KN4H 5T1LD 3NCJH 3VWJD 3DMMD 1T20A 3U4AA 5BVJB 3VFWA 1GZPB 1HXMA 2E6QA 2LU4A 5EBMB 3EYSH 1GGCH 4EEEA 1OAUH 3MLRH 2ZUSA 1K6QL 1LO4H 3DUUB 4NQCD 5GSRA 1KB5L 4PJHF 4JN1L 2H2SC 3I50H 4IRJD 5HI4D 4X7SH 4Y2DA 3LS5L 3QRGL 3RDTD 2ZCKL 4FQ2L 5E8PB 4MS8A 1V05A 4BQBA 1G6VK 1RJYB 1P7QA 2ZOLA 2XG4A 5HTSA 2FWOA 2X2YA 3CFJA 2BCKB 3VGDA 3OJVC 3SGDH 3KPOA 1A9EB 1HH6B 3MMEB 5A2JH 5SWQB 3D0LB 1QKZL 5MEOA 4I1NB 2HMID 1UKQA 5CIPB 1TJGL 3UZQA 4M62L 3KLHD 4JVUA 5DWUL 1EJOH 2N7AA 2R0LL 1QFWI 3S7GA 1OHQA 1DR9A 2EE6A 2D7QA 5KJRH 3AGVA 2P47B 3QWOA 3TZVA 3I3BA 5IQ9B 3D85D 3ZKMC 5CEZH 1IC4L 3DX6B 5DQDL 3VWKA 4O2FB 1VA9A 4UDUA 2QL1A 3RPIB 4P49A 1DQQA 3T0XA 3GK8L 5EZLB 1XGTB 3VFSA 1OPGH 2ENSA 3CVHH 4Q9RL 1JMZA 5HHPA 1M4KA 1XF3B 2AJXL 1SYVA 3O41B 2YD4A 1GH7A 5TE7H 5TGBA 4K3DL 1Q9LB 4JZOA 4R8WL 4WW2F 1H15B 2FX8L 5JW4Q 1IAIH 4K3EH 4M43L 4QRTB 1NAMB 4MNGA 1KJ2H 4Z77B 4EQ3A 2NTFA 3OKKB 1P7KB 1FL5A 3EYFA 1CGXA 3VE0B 1KG0A 4WTWA 5JOPE 1PSKL 2HWZH 4JFHE 1T3FA 1WIUA 1U8JA 2KKQA 1UXSA 4WO4D 5IB4A 2L7JA 5KANG 4IIQB 3TVMD 3VRJB 3RWFB 1AR1D 2W0FB 1EUTA 4HD9A 5C2BL 4K23L 4Q6YA 4PJ8C 4L4VA 1IGMH 1PJ9A 2YUZA 4CNIB 1DVFD 5ISZD 2G5BB 2F58L 5C8JB 5AUMA 3LQMA 5JLZB 5SX5H 3GZKA 4JO3L 4NKIH 4YXLH 5A43C 1WEJL 3AXLB 4F58H 4HUXB 2AJUL 1SEQL 1FH5L 3VXUA 5J56B 4I5BB 4P9HC 5HGHB 3QUMB 5D7SL 2C7UA 2DQUH 2KZWA 1L7IL 3QXDA 4XP5H 4PTUA 2VDPH 3O9WC 3UO1L 1TJHL 4XP9H 4OAWA 1GRWA 5KAQF 2ZZUT 1YNKH 1YYMH 4PV8A 1KACB 4WY7H 2Q7NA 1MCHA 3BDXA 3WN5C 1HXYB 5I71C 4H20L 4LF3A 4DGIH 2XWTB 1U42A 4MJ4A 3UBXG 5CJXC 2IG2L 4UTBH 2P49B 1UFUA 5EU3A 1FVCA 1D6VH 4I18B 4KJQD 1CCZA 5IW6A 3HZKA 4ZUUA 2P8LB 5GRJH 3KNBB 3MBED 3U46A 1R24A 2D9QB 4LVEA 5T1DL 2HT3C 1DQMH 2ICCA 4X7DC 1JZ5A 2VZSA 3M45A 1SM3H 2AV1A 4LVHB 3R4DA 2VSDA 1Q0XL 2A74B 2DQTH 1A1MA 2AJ3A 2EDFA 3VXNB 2EDOA 2NLJA 4N9GB 2X1QA 3F7VA 2GTWA 1KLGA 1M71B 1DP0A 4HW6A 4UV4L 1QLRA 3ULVL 1S7UB 3MSPA 3SDXE 5CBEB 5F7FA 1I8IB 2VDNL 3RWJA 2XT1B 8CGTA 4JZJC 3DRTA 2XA8H 2DBLH 3NFPA 1RJLB 1LK2B 4R4ND 3V5HB 4MXVE 4MAUH 4U6HB 4QTHA 1SYSA 5DR5L 1SEBA 1G6RH 4POYA 3QFJD 1BF2A 3UC0L 3F58L 3A67H 3MCG1 5DJ2A 4LL9A 4AG4H 2IWGA 3GEWB 1GOGA 1MCBA 3UYRL 2FDBP 4LKXB 3F7YA 2MPAL 3ARTA 1MJUH 1WCBB 5C0NC 1XGYH 4IOSD 1I9JH 3NA9H 3D9AH 2HJLB 3FZUC 2FBJL 4OFDA 4XRCB 1X44A 1MFBH 3TO4B 3F7QA 3FO9A 2I5YH 1RULH 3BUYA 4Y5XA 1YN7A 1U91A 5AG8A 5IMMB 3X13B 3VCLA 5LCVL 3TT3L 2WNGA 3PQYE 4G6KL 3ARDA 4PY7A 4ODUB 3AS1A 4GMTL 4OFIA 3G5XA 2DYPD 4ZAKB 2IPTH 3O0RH 1K85A 5EU6A 2R0ZL 3B9DA 1J18A 2VABA 1V7ML 2UZIL 3OAUL 2GJ6D 1S7WA 1SJXA 4QHLB 1QNZH 4K9EL 1TMCA 2VXUH 4XNQB 3WXWH 5CWSA 2J7LA 4YBHA 5I8KL 3O2VH 4U7SA 1BIIA 4P5KB 2D7TH 3L9RB 4U1MB 5DZOA 2NZIA 4OUUA 3U4EB 5J11B 1I1AB 1G0YR 5FO9B 1N5YH 3HN3A 2AK1H 3FQUA 4PRAB 1QLEH 2IPUG 4QWWC 4WV1B 1KNOB 5I1KL 2C1PA 5E99L 3VD3A 3LKNB 4AM0A 4M7KH 3L6FB 4G6FB 4RMUA 5E6IB 4Z8FL 4K3GA 3O45A 2X4PB 1G7IB 2JKXA 1VGEL 1QA9A 2FLRT 1NFIB 4MGXA 1LO5B 5C07B 2YA1A 4MWFA 4X0KB 4KK9C 3LS4H 4JRWA 4KMTL 1QUNA 5F9JA 1LE9B 4F7CB 3BXNA 4DTGH 1UH2A 3QP3A 1J1XL 1G0XA 3QIUD 4P2OC 4D9QE 1U8QB 1P5UA 5ABDE 1I3GH 5DHVB 3QNYB 1JZ2A 4LGRB 4Q2ZB 3O8XD 4YHLL 1TLKA 3F6LA 5C86A 1D9KC 4HEME 3DVIA 3I6KB 1DUZA 4CVWA 3QULB 3WHE0 4S2SB 4U1SB 4WVRA 3H2WA 4FMKA 3SGEI 2W9EH 3FO0L 3TYFB 4QY8B 1FVDA 5FGCE 5F6IC 1FAIH 4NKOB 3CZFA 5D1QC 3O2DH 1QYGH 3IDYB 2EXWC 4P23A 3PWPE 5E4EC 3T0WA 3UTSA 4PBXA 3MA7B 5JOEA 2VC2H 5CMAA 3RKDD 3LKOB 3EZ8A 4G8IA 3QUYA 1K2DB 1CGVA 3MACH 3I2CL 5DTFA 4XC1H 3DROB 1FO0A 1WK0A 5C09B 4FABL 4P5TC 1RJCA 3BO8A 5HYSG 2VN4A 3WEXB 2YBRA 2ZWLT 3CSYB 2J8OA 3JWDH 4I8DA 3RWHA 4DN4L 2XFXB 4HHAA 4PJFF 4JM2F 1JJUA 3TFKC 1T04B 5L2JB 1ED3B 3EOBA 3QFDB 2JIXB 3GSXA 2Y36L 3BISA 3DUHA 2V7NA 3QQ4A 5TPWH 3TBVA 2XZQL 5IMLA 1YY9C 1KLUB 1A1OA 3BQUA 1U3HB 2I9TB 1DDHB 3HAEA 3VFRB 1TCRB 4MXQD 2OQJA 1MWAB 4KTEH 3NZ8B 1I4FB 4UI2A 1IM3B 1RIVH 2R29H 3TPUA 3L5XL 4LK4A 3CLFH 1G7JA 4KVCH 1YY8B 3CSGA 4PJ9A 5JNYA 1OWWA 3LPGA 4HGWB 1MJ7L 3DI3B 2JCCA 4KRPD 4DKAA 4HXAH 4IRZL 3RNQB 1MEXL 5GSVB 4NRXB 4P3CL 4XCCH 4NYLA 4PBVC 1OGAE 4KJPD 4OF8A 1WWBX 4P2RA 4PV9A 3IJYB 2HH0L 2Z92A 1BBJA 1DBBL 3TJHA 3GMMA 3LEYL 4JR9H 4TN9A 1LD9B 3EOTL 4WCYH 1JL8A 5T3XE 1IQWH 3VI3F 3BP4B 4KRLB 1E6JL 1CZ8L 3CNKA 3OJMB 2YXMA 2UZXB 2AAVA 1AXIB 2GSGA 4GQ9H 5I1HH 2P24A 4IMKA 1DLHA 5EC2B 4RGMB 4JDTH 1OWRM 2WINB 3LB6C 3HRZB 1MNUH 3WHXA 2V2XB 1J0ZA 4JPVL 3N1FC 5HYJA 1ZGLB 4Y19E 1O7VA 3CCHA 3IJHB 3BN9C 4BSJA 4NO0A 5MP6H 2R2BA 4MS8C 4LHQB 4O5LH 3T4AB 3MZGB 4U1NA 4OCWL 4C57C 5DMJB 1EAPA 5ECJE 4YC2B 3KPPB 3QXAA 3U30C 1GHFL 2PO6B 1LMKA 4JN2A 4MSWB 4HFUL 4Q9QL 1TETL 5EFIA 3PL6B 1HHHB 5KS9B 4HV8A 3F5WB 4OKDA 2PR4L 1GOHA 5D9SB 3ZT5A 3QDJB 4UAOB 3MUGA 1DUYA 2CLZB 2O26U 4ZMAT 1V3KA 4DEPB 1AGFA 2EIDA 1J8HA 3B3IB 5HGAB 3TZVC 4YQXH 2GK0B 3MLUL 1UXWB 1NUGA 2JB5L 4Z7QF 1SVZA 5JDSA 1I9RH 1QRND 3VWKC 5EO1B 5BRZE 2VSCA 1C5DA 1BX2A 3OJ2C 3V6OA 2XNAA 4HWBH 5FGBA 3IXAA 2ZKHL 5KOMC 1OW0C 2YOCA 1NGQH 5DJZA 1BQHA 2VLKB 4U1KA 3QUZD 2XICA 4JO2H 3ARQA 4XVSL 3ARBA 5DEFA 5LBSH 4FQQB 4GRMA 1VGKB 1NAML 2IBGA 2IAMB 3ARFA 1VPOH 1I1CA 3DV6A 1NCDH 1RY7B 2RQ8A 5FKPA 3OTTA 3HR6A 4NCDA 1UM6L 4QNPF 5GGUA 2AK4A 3MXWL 1TVDA 3EDJA 3RWCB 4NJ9H 3D39D 4JM2D 1CXLA 1U9KA 5E5MB 4X9HA 1VB9A 4KJWD 5HHOD 4Q9CA 2J12B 1C5BH 1GVIA 5F8RC 4K7FB 4M48L 1MRFL 3MRQA 3OAYH 3FT3B 4WWID 1EBAA 4FQ2H 2V5MA 1T4KB 4G8GE 4O9HL 5EC1B 4QGTA 1D5BB 2CUMA 4OF5A 1Q9WA 1NCCL 2ERJB 2X70B 3NFNA 5IT2L 2VZUA 5CEZE 1H3WM 2WBJD 5BQ7A 2UVEA 4XVJL 1KCLA 2OTPA 3OV6A 4WEBL 2MWCA 4M62H 4GW5B 1OB1A 5DWUH 5C08B 5EIIA 3O6KH 4KAQH 5EULV 4GW4A 5C70A 4XVUC 4MNGE 5DJAA 1U3ZA 43CAB 4O4YH 3BKJH 3GMQA 5JHDE 3BW9B 4RMSA 5JMOC 1NEZG 3O4LD 4Y4KC 5DQDH 4FG6C 4HZLA 4R2GD 5E8DL 4UINH 4EBQL 4LSQL 4Z7VB 4OZHB 1JE6A 4KK6C 1W72B 2HFFB 1XF5B 4L29A 1X7QA 4NUGL 5HY9A 1WITA 3SE8L 1H3XA 2ZUQC 4OZFA 1KENH 4S0TD 1MIEH 5DI8B 1EEQA 3MZTA 5D7JB 3UXFA 1SY6H 2NY1C 3NZHH 3PHQB 3OKNB 3SJVA 2AJVH 2FX8H 2XN9A 2DJSA 3R0MA 6FABL 4EUPG 3KLAA 4FXLA 3BH9A 4DUWA 3VFPB 1SMOA 1CD8A 2OZ4A 1FZMA 4G9FD 1HILA 1C7SA 5FYJD 5KAQG 2BNRB 3EZJB 4YBLB 2JLLA 3VDCA 3UBXI 5DVKA 4QXTB 2EC9T 4MX7B 1PLGH 4N0UA 3JSSA 3O11A 1P7HL 3IDGA 1MI5E 4XCYA 4CGTA 1IEAA 4RWYL 3FQWA 4UB0H 4CN6A 5FO8B 1XH3B 3GMNB 2J3SA 3QIWD 4K23H 5ICXA 1NDGA 3NBNA 4JAMA 4OD3L 3VXSB 2F58H 4HF5L 3TEUA 4C83B 1CGUA 3WS3A 2B4CC 1KYOJ 1R3IH 5E7FA 1AKJD 3GM8A 3VGFA 1MFCL 4UV7L 4M7LT 4HUUA 4ZXBA 4N0CD 5GS3A 4RAVA 1QQDB 1JGDA 2QQNL 3OX8A 4WWKD 1SJEB 1F4WH 5ANMA 5E7BA 1GAFL 3IDMB 2A6DA 1AD9A 1IZKA 4ORGB 5JTWA 1XGUA 2PN5A 4EN3B 4Y5XC 5D7IE 4DVRL 4KWUA 5JW3L 1CFQB 3BPLB 4H20H 4KZEL 3NIFE 1BZQK 4FFVC 4XP1L 3ARDC 3WDIA 1OP9A 1KJ3L 5J1AA 4LHJB 4XPAH 5IHBA 2HLFD 1R0AL 1NGWA 1CDUA 2MKWA 3EFFA 5C1MB 1BJ1H 2CQVA 3L3IA 3DX7A 5DJ8A 3QR2A 4TQEH 1B6UA 3FB7B 4U1HB 4ZOEA 1Z9SA 1AQKL 3LDBB 3ZTNL 3FTGB 2KBGA 3QIBA 5FF6A 5E8EB 3H8NA 4X8JB 3L7EB 3MRGB 4XAWH 4E5XB 5DD0H 3MO1B 1WUNT 2QSVA 5JA8B 2UYLA 1OSZB 5TQ2L 5FHAH 5D2LB 1D5MB 1KIPB 3EYVB 4YAQA 3WUWA 4UT6L 1DL7H 2GJZB 5J6GB 3K4AA 4HK0B 3I84A 2BFVH 1RZGA 1JWSB 5LAXB 4XX1E 1GSMA 1DEDA 1NC4B 5LGKA 4U1LA 2QQQA 3EYOB 3PDOA 2AEIT 3K8LA 4HS6A 4CMHC 1HSAA 2GFBB 3RTQA 4KI5C 4CADB 2NY3B 4U33A 3GI8H 5E1AB 3H3PH 5C0GB 4NN6C 4P46A 3FFCB 5DMKA 2GAZB 3QCVL 4Q58C 5I1EH 3GSOB 1PKQE 1Q72L 1KTDB 2MHAA 1Y18A 2VR4A 5CGMA 3QHFL 5FA4A 4KHTL 5L0QC 4QOKD 3KPRE 4WDIA 5J7CC 3VXRB 4L4TB 4MD4B 2IALB 2YD5A 2G2RA 1M7DA 3I6GB 1YUHB 3K81A 4H5SB 4HEPG 4JCLA 4S1SH 4P23C 2IANB 3OAUH 4LVNB 2UY7A 4ODTL 4LSDA 2UY6A 2YS4A 1N59A 4I0PA 3NCYS 4PJ5E 4HKXA 3QUYC 5GHWL 4KI5E 4AMKL 2PW1B 2Q20A 4D0CB 4LEXL 4R97B 4XB7A 1HYSC 4QXGL 2QSTA 2YUXA 1WT5A 3WO4C 1FFRA 4R7DB 1ZXQA 4ZFZA 1CDIA 5IHLB 3QT2A 5IGXL 4HUVB 5F7LB 1ACYH 1IAKA 4UU9B 5E99H 3D6GA 5LJYH 1FNGB 5I1DA 2YEZA 3CK0L 4GBXA 2WIMA 1KC5H 5D7KE 3GSQA 1KUMA 1RU9L 3FN0H 1CE1L 5DDHA 1IQDB 3IF1B 3VGGA 2LTQB 1MWAL 4QRUA 4U05A 2NPLX 1J0IA 4JCMA 3UTSE 2WP3T 1XGPA 4MCYB 3UP1A 3IDIB 4E41B 4GG6A 3P4NB 5I18H 5K59F 3EO9L 4Z78A 3U9UA 3HPJA 3UROR 4I3RH 2PXYA 3RWDA 1IFHL 1Q0YH 5CZXD 1JYXA 5JORB 3AU1A 5DUML 4LLVB 1KPUB 5IBUB 1ZEAH 3T77A 3OKOB 4TTDD 5MEPA 1ZGLP 4LRNH 4ZQKB 1BVKA 4PJXB 3WD5L 5DD3H 4ODBD 1FVEA 4ONHA 5IG7B 3ZYIA 3U7WL 2NZ9D 4NZUL 2HN7B 4JQXA 3G6AB 5CCKL 3L3KB 1G7QB 1ETZA 3ALWA 3MNWA 5I1CH 4BH8A 2M1KA 3MNVA 3MR9B 1AI1L 2AGJH 4K3JH 2BHUA 4KK5D 1VSCA 5BS0B 3JV5A 4UILL 4Y1AE 1HHKA 3Q48A 4NUJA 5I1JH 1Q94A 5IFHH 2Y7QB 3RNKA 1KLFA 3RBSA 3AREB 3BP5A 4KQ3L 5FKAB 1VKXA 2UWEE 1P69B 3NN8B 4OZGA 5KVMC 1QG3A 2R4RH 3VFMB 2OP4L 3L3OA 3OAZH 1PGRB 2F8XC 5EA0L 2Z0BA 1CF8H 1KBGL 2Q7YB 5DS8A 3EHBD 5CJQL 5C7XH 2BY0A 5D2NC 4JZNB 3SOBH 2A77H 4PY8J 3U9PL 4ZYKA 5FYJH 2F19L 4HCRH 3CFEA 3RVVD 3SO3B 3KHQA 3OG6B 5E8NB 2A1WL 3BZEB 3C60A 5C0JA 5ISZE 4IMKC 4ELME 1RZFL 5L88L 4EXKA 1JZ4A 3H9YA 4KMQA 3OKEA 4DN4H 5HGDA 5EUOA 3RIAK 5ESAB 3U79A 3C6LB 4JFXA 4C4KO 2KZ1B 4Z95L 2MNUA 1V8HA 4L8SB 1NMBH 4GG8B 3TF7C 4GW1A 5FYKD 5B4MD 4JLRA 4NZRH 3RU8L 1MCSA 2JK5A 3PNWB 5BOPA 1KEGH 1E4KC 4O51A 2PTVA 2FEEL 4JKKA 1A6WH 3JXAA 4LCWD 3MV7B 1JPFB 3O3BB 2P42B 3TO4D 1KB9K 4KJYB 1BGXL 5DMIL 1A47A 2PUQT 5D2NE 4YXHL 1CDHA 1EA9C 3SCMB 1F90H 4YZFE 5GGRA 5HHQA 3MRMB 1Z0NA 3K1KC 3L5XH 3QQ3B 3GO1L 3MA9L 4ZAKD 1AFVL 2EIZA 3LKQB 4QCIB 3MRIA 5ITFB 3V6OC 5KG9A 3UTTD 2DQEH 2NY6B 5FGBC 3MCKA 2QEJA 1LE5B 2HVKA 3THML 3SDDA 3ARBC 3CDGA 2HH0H 4H1LA 4PR5A 3ARFC 3KVQA 3Q0HA 3BDYL 3K2UL 2P1YA 4FA8A 2OL3H 1I1AD 3EOTH 5HI3C 5LXGL 1EGJA 4XNYL 4YHIB 4QRRA 1ZHNB 3V8OA 1CZ8H 3BVNB 1DBJH 2DM7A 4G6FD 3RWGB 1HH9B 2O61B 5L9DH 5E6ID 2Z93B 1B6DA 1ZA6B 2X10A 3SKNB 3ZE1F 1EZVX 4R7NA 5F96H 4TVPD 1IAMA 2YN5A 1ZHBB 4J6RH 5E2WL 4GJTB 4JJ5B 3V6OE 5J3HD 3H9SB 3G6DH 2ATPA 3NACL 4L3CB 4HK3J 2EDQA 4OKVA 3G9VA 1TJIL 3EYUL 4PJGA 4YIQA 2DQFA 1S9YB 1KIQB 2DMBA 3HMWH 3MJ8B 5DMGC 1I8KA 3EFDL 1BVLB 4TUKL 3WKMH 5ERWB 3V5DA 3X14B 4N9OB 5KS9F 2OYPA 4NNYB 3MRNA 4PJDA 1NBVL 5D8JL 3N06B 5K33A 4LSPL 2GJ6E 3JV4A 3BOVA 4L3EE 4ZFGL 4I77H 1W72L 2EDYA 4JJHA 4OZ4B 3GKWL 3EGSA 4ODHL 3H7LA 2BZDA 5HPOA 4MDIA 2BSTB 1MIML 4EQ2A 1UVQB 3PWUA 4JPWH 5TE4L 1BD2A 3GKZA 5F8QC 3DO7B 1AXSB 1AIFA 1CD0A 2XQBH 4FQLH 4MD0A 2DMKA 4ZNEA 1K8IA 1CIUA 1G1YA 5D96C 1TQCC 2ZUUA 2W59A 3BGFB 5JXEA 5LVEA 4LNVA 5L8JB 3MV9B 5J9PB 1UM4L 3MRCB 4AIZB 1OVZA 3LMJL 1EFXB 4KI1A 5C09D 3QJFA 4B5EA 3HCVA 1CGSL 5GGSB 5HXMA 3L5WB 1ZVYA 2PCPB 3SN6N 2DICA 1CDJA 4QHNB 2W60A 2DD8H 2BSRA 3HNTH 3BZDA 1S5HB 3BKMH 3RZCC 4D94A 4OCYH 2P5WB 3SE3C 1NGPL 4K8RL 2AP2A 2DWDA 1I7ZA 1KJMB 2BVEA 3G04A 1LP9B 1YC8A 15C8L 4KROC 4YE4H 5KSBA 2HLAA 5ADPL 1B0RB 4K71C 2DKSA 3L3JB 1U3HD 1KEMH 5DD6B 2ZUTA 1X5YA 1LEKB 4OGAD 3T08A 3ARUA 3QUMH 2I24N 5GS1A 4AYFA 2IH1B 2CKBB 3ES6A 1A7PH 4OD1L 4N8VA 4XNXH 3T4YB 4XVJH 4LCUB 3RIFK 3RPKA 4TSAL 4KXZI 1IM9B 3BKCH 5I9QB 1W0VA 1SBSL 1QACA 2V9RA 4ZXBC 2FSEA 3VXPA 1QR1B 2JJSA 3VH8B 1F02I 4V2CB 3KXFB 5BMFH 3G6JE 5EU4B 1L6XA 4Z7UA 1TIUA 3ZKXC 5DUBB 2V17H 1CXIA 4EBQH 3P77B 2F74B 4KY1L 5ICYA 4N0UE 1IKFL 4Z7VF 3CVIL 4N0YL 4ZUSA 4OZHF 3NGBC 3WIFB 2APBA 3MLSL 4WFHD 4FTVB 2CJUH 3SKOB 3QDGE 4OLZL 2A73B 3WXVL 2DI7A 4AEHL 4URTB 4TUOA 1EV2E 2R8SH 3L7FA 3CUPB 3EDEA 3H9HB 2PYFB 4CU6A 2DQGL 5L6YL 4UIKH 4AENA 2OJEB 2R0KL 2AJSL 2Q3ZA 5DA0B 1A7BA 1P5VA 1U8HA 2XXCB 1DFBH 4LCYA 4L1HA 2FECL 1C16A 1UT9A 3BPCA 4KVNL 1DQTA 4PS4L 4U2ZA 1H5BA 3QIBC 5EBWA 4Z5RB 2VLRB 5K9KB 4OCXH 4LDEB 4RA0C 1A7QH 4OM1L 4TNVF 1A6VH 3TN0B 4PJCA 2FEDD 3FFDB 2NCMA 1U8OB 5E2VL 1N6QH 5DFVC 1NBZB 4YHYC 1TVBB 4PUBH 4RAHA 5IEHB 3QPQC 5FYKH 5ID1A 1JI2A 2F54B 5F89A 3UBXA 3PL6D 1JHTB 5JW4M 4LPXA 1LK3L 1F6AB 3ZL4H 4WFFD 3EBAA 1ZS8A 4HDIA 1MFDH 4Z7WB 3MCLH 3JWOL 3I9GL 4OD3H 3QDJD 2HRPH 5DGRA 2Y1VA 4JRXB 1I9IL 3UTOA 3QG6B 4Y0GA 1MLCA 3DVNB 3A6BH 2RCSH 3DX8A 1JNLL 1UB5A 3WLBA 3JBG7 1C08B 4MMZC 1A64A 4HIEA 1ZT7A 2P7TA 3FT2A 4P46C 3GMLA 1WSST 2YWZA 2VLKD 3REWB 3BMWA 1RZJH 5J06A 1HSBB 4GKSA 5F7YC 2IAMD 4XP1H 2KQMA 1QPPA 1J05A 2J1KA 2NY0B 3VFTA 4D0DA 3VGAB 3BAEH 1R0AH 4PJ7A 4J7RA 2VDQH 3DNKA 3UTPD 1MREL 1U8KB 2DQIH 4X6FA 1TDQA 4I0PC 1Q1JH 2O5ZH 4X6EA 3A0OA 4PYHA 2DLEA 4Y5YC 1S3KL 3MX0A 3CLEH 4HC1L 4Z0BL 5JIHA 1YEEL 2ICEA 4YFEA 4JREC 3J8F7 5ESQA 1X4ZA 3HFML 1M05B 4RFOL 1B0GA 1DCLA 1WT5C 2APFA 2MTPA 2FO1A 2FX7L 4TVPH 4LLUA 1DBML 2QSCL 4UQ2B 5HVWA 3Q6FB 4F7MA 3PXJA 3NPSC 3HUJE 5HD8D 4A6YA 5D2LF 4FFWD 2A0LC 2V9TA 1A4JB 4JFZH 9CGTA 5JR1L 2X4QA 2YHGA 2SEBB 3RVWD 4QLRA 5DHVH 5HHME 3VFVB 3V4VL