2MHAA

Crystal structure of the major histocompatibility complex class i h-2kb molecule containing a single viral peptide: implications for peptide binding and t-cell receptor recognition
Total Genus 55
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
55
sequence length
270
structure length
270
Chain Sequence
GPHSLRYFVTAVSRPGLGEPRYMEVGYVDDTEFVRFDSDAENPRYEPRARWMEQEGPEYWERETQKAKGNEQSFRVDLRTLLGYYNQSKGGSHTIQVISGCEVGSDGRLLRGYQQYAYDGCDYIALNEDLKTWTAADMAALITKHKWEQAGEAERLRAYLEGTCVEWLRRYLKNGNATLLRTDSPKAHVTHHSRPEDKVTLRCWALGFYPADITLTWQLNGEELIQDMELVETRPAGDGTFQKWASVVVPLGKEQYYTCHVYHQGLPEPL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CLASS I HISTOCOMPATIBILITY ANTIGEN (H-2KB) (ALPHA CHAIN)
publication title Crystal structure of the major histocompatibility complex class I H-2Kb molecule containing a single viral peptide: implications for peptide binding and T-cell receptor recognition.
pubmed doi rcsb
source organism Mus musculus
molecule tags Histocompatibility antigen
total genus 55
structure length 270
sequence length 270
chains with identical sequence C
ec nomenclature
pdb deposition date 1993-07-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00129 MHC_I Class I Histocompatibility antigen, domains alpha 1 and 2
A PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2mhaA02
3.30.500.10 Alpha Beta 2-Layer Sandwich Murine Class I Major Histocompatibility Complex, H2-DB; Chain A, domain 1 MHC class I-like antigen recognition-like 2mhaA01
3QDMB 4PGCB 3SDAA 1FHGA 1EZVY 3DI3B 4FXGB 4G6KL 1JZ4A 3GBLA 2KKQA 2X4NB 3UBXI 4AYFA 2CUIA 1LE9B 3O2WL 1J1PH 1XEDA 2Y23A 5FUZL 2R8SL 2LVCA 5AAMA 4XNXL 4S1DD 4DN4L 2OP4L 4EUPG 4OKDA 4LP5A 3V6BR 1GC1C 5ICXB 2ATPB 5C0RH 1U36A 4HIEA 4M7KH 4LGSB 3STZB 1N8ZB 1WZLA 1IILE 4X6FA 1IL1A 4MA7H 3X3GL 6FABL 2D7MA 1JMXA 3GSQA 3C8HA 4CN4A 1OAKH 2IBGA 5J1TC 3ES6B 4Z0XA 2VC2L 32C2B 3GUTB 3HC4H 3I75B 5GS0L 2FJFA 3MLSL 4ELKA 5AUMB 2HKHH 5HGBA 5DJDB 1T2JA 5INCA 2F53D 3QISA 3LHPH 1ZLSH 5HYJB 1KC5L 3GSNL 1H8NA 3AM8C 2OTPA 4XXDB 4CADB 4ELMF 3DHMA 3Q48A 3RIFF 4RQQB 4X9GA 1T1WA 3EYUL 5GZOC 3N0PB 1KIUA 1ZVSA 1X5GA 5KVDL 1F90H 1VCAA 1IAII 2QSQA 4XCEA 4P4RA 4EXKA 1TQBC 5HDLA 4OD2B 3S4SG 3T3MF 4POZD 1KEMH 3MLRL 3MRRA 4JE4B 3QQ4A 1OGAA 2P43B 5JO5B 2F8VA 5FOBA 3T2NH 2P5ED 3PWPD 2R0KL 3IJSA 4OCNC 2BFVL 3MNVB 2OK0L 1CBVH 1G0XA 2FO4B 3O9WA 2VUOA 1R3HB 5DK2B 3TPUB 1F00I 1RJLB 4OFVA 4I8DA 1LQSR 1S3KL 1UB6A 1VA9A 4JHWL 4HWNA 3GRWL 4PRHE 1FIGL 3VFTA 3A6OA 3L5IA 3I3DA 3QB7C 3MA7B 3NIFF 3RGVD 5EUKB 1RZJL 5JPNB 5GS1A 1A1OB 1DEEB 3D85B 3B8SA 1HWHB 4HHAB 4EQ3A 4Z7WA 3MRFA 1OP9A 3DVIA 4GJTB 3WNOA 3SGJC 35C8H 5CEYA 1RJYB 1LO4H 3V5HA 2VAAB 2B0SH 4P3WA 1QA9B 4DUVA 2IWGA 2RIKA 1OTUD 5I1JH 1OGAE 5DYOA 2QQNL 5IT2L 1QBBA 3ZKND 1ZANL 1YMMA 4L5FH 4MQSB 3DNKA 2XI9A 2JJWA 1QNZH 4LNRB 1CFBA 3MGTA 4WTZA 2DKMA 1S9YA 3DX8B 4J3SA 3WHXB 1FL3A 1XZ0B 4YXLH 1FRGH 1IC7L 3PJSB 5EBWB 3QUYC 4MXWH 2NY1D 1C08B 2XYCA 3ZYZA 1GSMA 5C0IB 3U46A 4RAUA 5MHSE 4WNQB 5DHVH 5I1AB 4NBXB 3NTCL 5I18L 5T1DL 2R69H 2QBWA 5DJZB 4JDVA 2NY2D 4EBQH 5DWUH 3Q3GA 3W9DA 2YRPA 4LLVA 1S7UB 2J6EL 2WUBL 3DSFL 4OLXL 3LCYA 5BS0E 4Z7WE 3RJQB 4FOMA 4M48H 3SGKA 5IB1A 2HP4A 3MUHL 4WV1A 3FTGA 4LCCA 1HOCB 1TJGH 3OF6A 4JDTH 1M6OB 1M7DA 1FPTH 1P6AB 2AEIT 4X5WB 1NBYB 3F62A 5M95B 2ZPKL 3PHSA 4NQSA 1SJHB 3QCUL 4GW5A 2IJ0C 1NUNB 4XMLH 1YQ2A 5F96L 4M7JL 1EHLL 5IESH 1Y0LB 3WXVH 4GRMB 4OCSH 2E27H 3FO9B 2DM4A 1C5CL 1YMME 1EEYA 4PRHD 2VXVL 2WMPA 4CNIB 2H32H 5J11B 2FZ3A 3CFDB 3PWUB 3KYMA 3H9SA 1B90A 2ARJB 4LSRL 2WUCL 3BYYA 5GSRB 2F53B 5JA8B 2K7QA 4NN6C 1CE1L 4GQPH 3WIIH 3IU3A 2W38A 2A2QT 5C0JA 3PGFL 5J11C 2UWEB 1ZLUH 5E2VH 1N2RA 2VOTA 4ESKA 3MXWH 2DQDL 3QYCA 1S9VA 1U8QA 1GGCL 2ICWA 4PJHB 3KHQA 1UQSB 1NANH 3MGOA 2F74B 5IBTL 4H26B 5FA3A 1F2QA 1HHIA 1L7IH 5DHXB 4UOW1 3TO2A 2DQJL 1E6JH 1DLHB 2P5EB 2VYRE 3PWPB 5AZEL 5FDWB 4U1IA 1IRAY 4N8PA 3U4EA 3HR5B 4QF1A 4YQXH 5D1QB 2WIIA 3EOAB 2CRIA 5DRZA 4H1LB 2V5RA 5FK9A 1YQVL 2CIKB 2VDPL 5I75C 4YO0B 4KUZH 3VI4E 3EYQD 2X9YA 5EOTB 3UO1H 3RBSA 2VQ1A 2G2RB 4UQ3B 5FM5O 4PG2C 2X1XR 4C57C 5MHSD 4OGAD 3CH1B 5JW4N 4D0BA 1QPXA 3QWRA 3RGVB 1VENA 1F11B 4PRIA 1DBAH 2RGSA 5KSUA 3IDGA 4MD5A 3MFFA 3GJFA 1WBZB 1X5IA 2WWKO 3J7HA 3U9PH 1X7QA 2P24A 4QRTB 1F4WL 1KIPA 1OAQL 5BS0D 2AJYL 5IWLA 1JNHA 3PHQA 5L7XH 5JXED 3ZMRA 3RGVC 2B1HL 5KTEL 2BSTB 1ZLVK 3HAEA 4HZAA 1I8MA 3RNKB 1YPZA 2BHYA 1YECL 3SDCD 1CN4A 2V2TA 4MJIA 1RZKL 2G5BB 3HNVL 1CZ8L 3LSOA 4D3CH 5GRYA 4JFXB 4NNPH 1GGBL 2A9NH 4KMLB 1D5XA 4NZTL 1JI1A 4OLZL 3O3AB 3WFDL 3LEYL 3EFFA 5DR5H 1BX2B 2G9HB 2NY1B 4Q9CA 4QY8A 3EZJB 5BCAA 5BVJB 4NO3A 3D18A 4GFTB 1NC4D 3ZKNC 4X7TA 4XAWL 3QCTL 1PZ5A 3LDBB 5CGYD 3SDAB 4PJFA 1DQJB 3VJ6A 3Q6GL 5IVNA 4GO6B 2NY1C 1A4KA 1Q0YL 5F3HB 3QG6B 3VWKA 1O5DT 4M3KB 4TNWK 1UM5H 4OCLC 3VD3A 5J13B 2EDYA 1OT1A 1AGFB 2ZCLL 2W9DL 2NY2C 3GIVB 2FJHB 3WJLA 3LDBC 2QADD 3DX7B 5DJXA 4NUGL 5JOFA 5HGHA 1LDPH 4IJ3B 3R06B 4XI5D 4LFHG 2NX5A 3REVA 5C6TH 2JIXA 1JV5B 4Z6AT 4X6FB 1W72A 4U6VL 3TNNA 4HBCL 3C5SB 1D5ZB 5H37G 5C0BE 1RZIB 5BQ7B 4G8IA 2DI7A 4YDVB 4LEXH 2MOVA 3BXNB 4M1DH 2VRAA 4PRHB 2V2WB 1SYVB 1X5FA 4Z0XB 2XNAA 1NEZG 1NGYB 3LY6A 4FQJH 4UILL 4KI5C 5C86A 3GJEB 4NOFA 1JE6A 5DI8B 3BPNB 1CXEA 4MXQA 3SDDD 3E3QA 5TQ2H 2RJMA 4JHBA 1RHHA 2ZG1A 3V8OA 3GMLA 3WIHL 3QULA 5GIRB 1ZMYA 1F3JA 3QZWG 4X6CF 4IEFB 1OARH 1T1WB 4PJFE 5DRWA 4OBRA 2VDLH 5EBMB 1BF8A 5T5NF 1CD9B 1RURH 3ULUL 3DRTA 5BMFL 4P4RB 2FX9H 1LP9F 1CR9H 2WQ8A 1U93B 4M62H 3MRRB 3VWJA 5FKAB 1OGAB 5CBEA 3DBXA 1ZGLA 5FOBB 1WZ1L 2BERA 2IPTH 4JO3H 3QXTA 3IJSB 4L3AA 4R3SA 4TVPE 2RHEA 2XKUA 5FHBH 3RWGB 2BY3A 1FIEA 2YA1A 2D4FA 4NRZA 4ODTL 4GXVH 4QOKE 4WFEE 3VFGL 3TBYB 1QSEA 2E7LA 2C7UA 5EU4A 2NY5C 3MUJA 4HCRL 4ZO8A 2DQCL 1WFOA 2VJXA 4D8PB 1CTOA 4QHMB 4WI9A 3WLWD 5JW5A 4G3YH 5DRNB 1WBYA 3BZEA 2IADB 2LTQB 1UGNA 2AXFA 4MD0A 3UTQB 2R0ZL 4KDTC 3S3SA 5DC9B 5JIPA 4Q0XH 5AG9A 4HUWA 3CFJB 5ACLA 3TBTB 2AJUL 3EYQC 3QRGH 1ND0A 3CDFA 1DFBH 3KDMA 3QEUA 1FFNB 2X4UB 4OGAC 5BS0B 4Z7WB 1U8NA 5FUOL 4AMKL 3EKCA 4PB0L 3BKYL 4OFDA 2KDGA 3B8YA 4D0CA 2LTQC 2GT9A 1I7RB 5C09E 1Z9MA 1Z2KA 5DF0A 3OPZH 3SDCB 2VXSH 3TYGH 5E8PB 3DV6A 4AT6A 3I02B 3WFHA 5I76B 5MENA 3O8XD 4MCZA 2OLDA 4FQ1H 5JXEC 3N9GL 5LWYL 5C0BD 1UH4A 3BW9B 1YMMB 2EDHA 3VXPB 3RVTD 3KPOA 3L7FA 5D7JA 3MGTB 2OL3H 4AEHL 4GBXA 2X1WL 3GSRA 5ALCL 1VEPA 3SDCC 1UACH 5T3XE 5CGMA 4YNYB 1DQMH 3BESR 4V3EB 5T1LD 1MCKA 2E7LE 4JO2L 1N6UA 1AGCA 1MUJB 4P2RA 1NDGB 1QP1A 3TGXA 2DWDA 4CU6A 5EO9A 5FXCH 5I1KH 1UWEL 4AJ0A 1DBBH 1GVIA 1YUHA 3GJFK 5HD8D 4WEUD 4NT6A 1F3RB 3TN0A 4JDVB 4UI2A 4IMKC 5CJ5A 3VFRB 4H88L 1DDHA 3GHBH 4G43A 4OCRH 3VG9B 3QO0A 5TE7H 5CD5D 1I1AA 1NJ9B 2IPUK 5I1EL 4M7LT 2FATH 3DI2B 2J8UA 5E7BA 3LKPB 1EO5A 1H3PH 4Y8AA 4XPFL 5L0QB 1XGUB 2QADB 3QIUC 5CGYC 5L88H 5FA4A 1NUDA 2MTPA 5ILTL 1JF1B 5C7XH 2XWBA 2Q8AL 3VG9C 5GGVL 1YNKH 3HS0A 3THML 4JG1H 5C0FA 1D5MA 3EOBA 4TVPD 1B4JL 5IHUL 3AXLB 2P8MA 5L0QC 5MENE 4CVXA 2R1XA 3CLEL 4DW2L 4F7TA 2QADC 4QOKD 4WFED 4HWEH 5SV3A 2Y06H 4K8RD 1N59B 1I1FB 4JN2B 4FXLA 4XI5C 4Z78B 2IGFH 1TVHA 2CGRH 1KXQE 2VDRH 3NGBB 2HKFL 2FZ3B 5BO1L 5IBLC 3RA7H 4LVNC 3KYMB 1BECA 2FH6A 3TFKC 1JNJA 2DIAA 4QHNA 4XGZB 3SDDB 1A1MA 4GMTH 1EHAA 2ATKA 5I74B 4KK5D 5K9KA 1JNNL 3TT1L 1MWAL 4J3OC 1AC6A 2IBBA 1KLUA 4OV6F 1WICA 3NGBC 4J3VA 4K3JL 4M3JA 4OZIA 3AAZB 1X3DA 3EGSB 2ZJSH 4YDJA 4KXZH 1XGRA 1U8QB 5C09D 2HFFA 2R0LH 4I3SH 4QT5B 4Q2ZB 4HDIB 5FA3B 3MXVH 3SKOA 4FNLH 3OXSA 4IOFD 3QQ9D 4WHYH 4K07A 1JZ3A 3V0WH 1HQ4B 3UCRA 1BEYL 3U4BL 1YY8B 2YKLH 1FCGA 3HN3A 5F7DA 3O6ML 2OTWA 3LKRB 3IDNA 3MLWH 1RU9H 5IKCB 3VXRA 5IW1A 2RFXA 2L0DA 4JRWA 2WIIB 3QPXH 5T3XD 5FK9B 3BDXA 3AY4A 1L8JA 5MP6H 1R3LA 2VZ3A 1A2YB 1D7FA 4Z7NF 2VE6A 4F33A 3BWUC 1KELH 1BGXH 4D0BB 3QG7L 1AJ7H 4CW1A 4MNQE 1KB9K 5I8EA 5KSUB 3IDGB 1YZZA 1Z6JT 2BVPA 3VRIB 1BBJB 4F58L 4JM2D 2P24B 2Y5TB 3V5DB 3QBTB 4PTTA 1KIPB 4NO5A 4QLRA 4KJPD 5ANMA 3PHQB 2L7JA 3O6LH 4I13B 4KAQH 1UC6A 3B3IB 5E9DA 2VDQH 1ETZA 4G7YH 1R3KA 5E56A 1LEIA 3X3FH 5F97E 5E0QA 1WEJL 3BHBA 2VN4A 3S36X 3O8XB 3MC0A 1T1XB 1RJZA 4TUJB 5C0BB 1S7TA 4OD1L 5EU7E 1HXMA 1MSPA 2OXHA 4G6ML 3HG1D 1AD0B 5DTFB 5I1LB 5I71B 3T1FA 2W65A 1LO2L 2NY5L 2ZSWB 3ULUF 3MBEA 4WI8A 4C58B 5T1LB 3O8XC 3MRDB 4H5SA 5IF0A 5EC2B 5GGTH 4PJ7A 3S34L 4JHAH 3DYMA 4X7SH 3V2AR 3RVTC 3G5VA 3SKNB 5EU6A 5I71C 5L8KB 4RMQA 4P5MA 1HIML 5DT1L 1IGIL 3WCYA 4LAQL 4PJFB 1KGCE 4HXAL 4JDZB 3VJ6B 1MNUL 3RAJH 1E4XL 5CJQL 5F93C 1BIIA 2OR8A 4BQ9A 4GKZB 3IJYA 1L7TL 4ODWA 5I19H 5C92A 1E4WL 1ZVHA 5DJXB 2VUYA 3H7LA 4ODSH 1QHPA 3ESVF 2VR4A 5E9DE 4EZMA 3E6FA 3P30L 1MJ8L 5CD5C 3L3OA 1CFTB 5LXGL 3O0RH 4HWBH 4AL8L 2HYMA 3AM8A 4ODHL 3FRUA 4HUKB 3KNBA 1YMHA 4Q6YA 1T5XA 3ARYA 4QOKB 2YA2A 1YDPA 5D7LA 3QUMH 1MY7A 4NDMB 2EKJA 4TNVF 7FABL 2W91A 2IH1B 4QRUA 4N8CL 4MXVF 1FL5A 5I1HL 4U33A 1G9MH 2MHAB 4UQ2B 2UWEF 4OTXH 1BJ1H 1WAAF 5DMIL 4MNQD 4K8RC 1FFOB 3OKDA 4XP6H 4PJ7E 4CU7A 1IKFL 2F58L 2XZAL 4I3RL 3A6CH 1EUUA 2Z31A 4LSUH 3GMLB 1A6ZA 1F3JB 5DRWB 5FUCE 4U1SA 2EZ0D 5C09B 2E7CA 4RGNE 1WWCA 1JGDA 1BFVL 4FQCH 3GBNH 1TXKA 1DR9A 1XFPA 3X13A 3MUY1 5IVZA 1ZHNB 4DGYH 1J0ZA 4Y2DA 4YIQA 1PAMA 1ZGLB 4OCWH 4LVEA 5MEPA 1T3FA 3DYOA 3V8CA 4KQ4L 3BT2H 4IOFC 3QQ9C 4CMMA 4F57L 5AD0B 5CP7B 1YEHL 3CU1A 4ZFGH 3KPQA 5EU4B 1FVEB 1FZJB 4X9BA 5FGCE 5BW7A 3ARBC 3VGDA 2HAZA 3BZEB 1QLEH 5CZKA 1MI5A 4RX4D 3PP3K 4HG4J 1VACA 4LQFH 1KGCD 2E7MA 1JPFA 5JR1L 4QHLB 5CJ8A 4JM2B 3DMMD 1WWWX 3QEUB 3KDMB 4DTGH 3VFSA 3G04A 3ZTNH 5EZJA 4PJ5E 3LS4H 4XVTL 1YJDL 2IQAB 3FOLB 2V17L 3I50L 5F9JB 2GT9B 4BSVA 3BIAX 1Y6MR 1KFAL 4ZO9A 5IQ9A 3D25B 5EU3B 4JGMA 4JM2C 3WE6A 3TC9A 2D03H 1ADQH 1FNEA 1DBML 1NAKL 4WCYH 3IFPB 4FQHB 3O4OC 3DV6B 4V3DB 3WFHB 5MENB 5KANG 4KJPC 2D7TL 4ETQA 3SQOL 4X6DE 1K9TA 1MCWM 2B20A 3LOWA 4UZGA 3D39E 4PRBA 3RHWF 1OCWL 3GSRB 4O5LH 2H3NB 2AJSL 4LSQH 1RZ7L 4GKNB 4R7NA 4WI4A 4PJAA 3S35X 4TULH 5HGGS 2FGWH 4H8WL 1HHKA 4BZ2L 1X6NA 1N4XL 4DKFL 2DWDB 4AEEA 5EO9B 1JPTL 2H9GA 4MWFA 4NNYA 2PW2A 4UTAH 2FX7L 3KWWA 5D1XC 4ZS6D 3BKCL 4K2UH 1WC7A 4XPTL 1L9MA 4Z9KB 3QXAB 4QXUH 1DDHB 5KVFH 5CUSL 2SEBB 4PY7A 3BPCA 3HE7D 4RGND 2MFNA 4XCYA 1U91A 3BGAA 5IB5B 4PGEB 3P2TA 4U0RB 1F8TH 4XPAL 1JFMA 5FA4B 4Q6IA 2O61B 1ZA6B 1RI8A 3DUSB 4OLUH 2NXYD 3ARDA 3IB4A 3MOAL 2C26A 5TE4L 2NY4D 2VIRA 2IFFL 1A6AA 4K7FA 3FRPA 1JWMA 4XCCL 5CBAA 1FE8L 4OKVA 2OI9A 4WUKH 2DQHH 1IKNC 4NBYB 1T1ZA 5C0FB 4XX1E 4C55A 1BFOA 4X5LA 2EDJA 3UX9B 4ZMAT 3O2VL 1JJUA 4XVUD 3JWDC 3I6GA 2GJJA 5LGHL 4LRIA 4K94C 1ITBB 5GGVY 4HMEA 4XNYH 4JG0L 3P9MB 3H2WA 4FQIL 1JMZA 3P3YA 3MJ9H 2FDBP 4MMZC 1YEKH 3SQBA 3LQZA 4KU1A 3E2HB 2PYFA 4MNQB 4QHNB 2B4CL 1X5JA 2Y07H 5AWNL 5E00A 1RV6X 2JK5A 2Y7QA 1OAXH 3QI9D 5K9KB 3DETD 3MJ7B 2HG5A 1R0AL 3ZHKA 2BNQA 3DOSA 3QWOA 3QNXB 5FO7B 1AQKH 5EOCL 4PJ5D 1KLUB 4WEMB 2DRUA 3N85H 3WL9A 3E2HC 2Q76A 2X5PA 4WI7A 4E9LA 2QQQA 1A7BA 1UWGH 1KXTB 2HFFB 2XN9E 3H9ZA 4YHML 2C3GA 3QDAA 1ZLVH 3EIFA 3FT3A 4O2EB 5LQBH 1KT2A 5C0EA 3F7YA 5BVPH 2JJSC 2LU4A 2EZ0C 4PJ8A 3MODH 5F7DB 5IOPA 1Q9LA 1QACA 3T65A 1KCUL 2OTWB 4PGBB 3ZE1E 1TFHA 2YR3A 3BZ4A 3ZZ1A 4HD9A 3D39D 1J5OH 2BSED 4LPTA 4EDXA 3U82B 2RFXB 1JHKH 5DDHA 5F3BA 3NFSL 1LEKB 1MCPH 4TVPL 5LBSL 3MCG1 5B38G 1HKLH 3C5JA 1KPVA 2EDBA 3ETBF 1MCEA 1K2DA 1W72L 3FB5A 4QRQB 1WK0A 3JBG7 3KLDA 4Z7WF 4F33B 1LE5B 3RUGE 2ICEA 4CW1B 4JFQB 3DMMB 4M8QB 2BVPB 3EJJX 4H20L 2DDQL 3LQAL 5AZ2H 4QHUA 2O5XL 4PD4K 2IAMA 4LIQE 3W2DH 4WFHE 1XCQA 3TJEL 2A6IB 3BMWA 4Q58C 1C1EH 2GTWA 2YD7A 2R4RL 3BEVA 4X80L 5E9DB 4UT7H 5HPMB 5BRZE 2AJ3B 1CL7H 3DMMC 3IETA 3MJ8B 1FZOA 4R90L 4JZOA 3U2SA 5TGBA 4AG4H 2QJDA 4Q97A 3QNYA 1VFUA 3RNQA 3L5WA 4PLJD 4U6HA 2ILLA 3LN5A 4ONGH 4F9LC 1TTUA 3QDJA 1TQCB 1KXVC 2MKWA 4HF5H 1BOYA 3TA3D 3WUZA 2I5YH 3KPTA 2ZCHH 4NFDA 3QEQE 3MBEB 1CFSA 3FB7A 4KMTH 5CEZH 4XVJH 3FN0L 4Y19A 5IF0B 4NJAL 4KZEL 4BQ6A 4JY4B 1BJ1J 4PJ7B 4RFEA 1TQCC 3BPOC 1XGYL 4O4YL 5T3XL 3G5VB 3L1OL 2Q20A 1KUMA 3CXHK 4JKLA 1OW0C 3BIKA 2VLME 1WIPA 1EBAA 1F45A 3LKOB 1FLRL 1FVCA 2V5TA 3HE7B 1VADA 4RGNB 3NA9H 5H94A 4MHHI 2X1PA 4LLMA 4JANB 2XN9D 2R2EB 1KV3A 2ED8A 3MZTA 4Q9RL 3IJYB 5HDBE 4ODWB 4X99B 2NXYB 3B6SA 1OAUL 4OZFH 3HPJA 5FUCC 3VI4F 1A3RL 2YZ1A 5GRJH 3HE7C 4RGNC 1QLFA 3DECA 5D5MA 2FYYA 3BP6B 12E8L 5E94A 3CVIL 1T1YB 5F7UA 2Z0BA 1A1NA 3VDCA 4F37K 1S5HB 1H3TA 2NXYC 4KQ3H 2NY4C 2YPLE 3AMLA 5GPRA 3TH2T 2J7LA 3IS0X 5J1AA 2BVOA 5FGCB 1XR9B 4QRUB 1CD0A 4MSWB 1U8MB 5E4EB 1Z9OA 4DFHA 1JPSL 3T0VA 3PABA 3FQUA 1QD0A 1CVRA 3MJ6A 1JPGB 2XTLA 4YXHH 4Y19E 4XVUC 4W4OA 1FCCA 4NQDE 3LAFA 3VA2C 4OCXH 1H15B 3T4YA 4PJ5B 3VXNB 5D6DA 5E4EC 1A6ZB 4WFHD 5DLMH 4DVRL 3DVFA 2L7UA 4NWUL 4U1SB 1JZ2A 1QFOA 1U92B 4FQ2H 3HKFA 4HC1L 3V7AE 1PY9A 1MAJA 2FEEL 3QI9C 5BRZD 3DETC 3EHBD 2Y6SC 2VABB 4KVNH 1E28B 3C2AL 3X13B 2A6JA 3FQXA 4FN0A 2H1PH 1AXSA 1EFXA 3HNTL 3QXDB 4X6DB 5I8KH 4R4FH 5EH1A 2E3VA 2W9LA 3D39B 1A6VH 1FN4B 3BUYA 4RMUA 1T3FB 3CK0L 4DJMA 3O4LA 2R56L 3JWDL 3QEQD 5I9QB 4K94L 3KPQB 4OUOA 1HINL 4YBHA 4I2XA 4QRPA 3VXQA 5BJTA 2Y36L 4J1UA 1J0IA 4M4PA 1HEZB 3M1BB 2R2HA 5MERA 1S9WB 1WIOA 1YEFH 2BC4A 3GJFH 2XQYK 3ULSA 2NNAA 5SX4H 1P4LA 2VLMD 1YY9D 5I16B 1AHWA 5I9QC 1S5IL 4XCNA 4KXZI 2JCCA 4MA8L 3V4VH 3NAAL 5FYKH 1KLGB 2AP2A 3LV3A 2XRAL 4RCAA 2AJVH 4MA1B 1MJUH 5EWIH 4B5EA 1XGPB 2BP3A 3ARWA 3HAEH 2AABH 4UT9H 1KCVH 1IGCL 4U0QB 2NLJB 4RDQF 3CPLB 1DQQB 3TV3H 2VITB 2IMMA 1U6AH 3JXAA 3DGGA 4QHKJ 2DOCA 3LEVH 4MA1C 5I1CH 1FDLH 3V5KA 4JFEA 1XIWC 3STLA 5HHPA 4V2BA 3KJ4B 4HS6B 5FGBC 2RQ8A 2YPLD 4WU5B 2X42A 3UBXA 1MFEL 4KKBD 5IG7A 3PQYE 1OP5K 1AGDB 4HKZA 5T1KA 1U8IB 4HMDA 4R7NB 3MZGB 3BZFB 2M1KA 3PGCB 4PJFF 1QFWI 3S88H 3PE9A 2C1OA 1BLNB 4WW1B 4I2XE 4QRPE 3KJ4C 1JHLH 3MV8E 4M6ML 3TA3C 2DQEL 2A6KB 3QHZL 4LVOC 5EORL 4NNYB 2H9GB 3JWOC 4P4KA 4PTUB 3PV6A 1PZUB 4NQDD 4RMWA 1P4BH 2QHLA 4NPYB 5IB4A 3HLAB 4PGJA 1DUZB 2PYEA 2JCCE 4PY7B 2XN9B 3BPCB 1ZS8A 3CSPA 2WBJD 4LF3A 3VXOB 3TF7C 5JLZA 3TFKA 3N50A 1OWWA 2X9XA 5GGQL 2DI9A 1NCAH 3ARDB 4LHUA 3S96A 5J12B 1SJEB 5I0DA 1MIML 2EXYD 1AIFA 3UZQA 4FZEH 1A6AB 4LEOA 5DK0A 3F7RA 1T2QL 1RUKH 2A9ML 3JZ7A 1O7VA 3DX6B 5EFIA 2BHZA 5FDYA 1U8OA 2I25N 4QNPE 1BFOB 2NW3A 2L4OA 1CIUA 3CDGB 3RVVD 1FV1A 4DN3L 5J1SC 1NH6A 5J12C 4B53A 1Q72L 8FABA 1T7YA 3I6GB 2D0GA 2FX8L 4NYLA 2X7LA 4HPOL 1KN2L 2WQRA 3PF2A 1JYNA 4Q9QH 1YNLL 3BPLB 3RUGB 2VXTH 3CZFB 3T0XA 5LG1A 2PYFB 3GO1H 5E00B 3T0BA 5JHLH 1DSFL 2X4TA 4AH2A 2EEAA 1H5BA 5K9OA 2DI8A 1BM3L 1TCMA 3MLVH 4MD4B 1TVBB 2DQGH 2DQTH 1AY1L 3HC0B 3JUZA 2DD8H 4OIBA 1U58A 1A4JA 4Y1AE 2YPVH 2Z8SA 5L8JB 1M71B 3BPLC 3FO1A 4HAGA 43CAA 4S1RH 4JO4H 43C9A 2ORBL 5KVGH 4BKLB 5BRZB 3CAFA 2VKWA 3QAZB 5FEBA 1C5BH 2HJKB 2ZUVA 4P5KB 1HCVA 5D72L 1JTPA 4IRJA 1YEGL 3L7EB 3E8UH 4U3XA 4QXWA 5IOPB 1Q9LB 3T65B 3O2WH 1ZGLP 5F44A 2V9QA 3BZ4B 4JZJA 5JORB 4DN4H 1N6QL 3PQYD 1I8LC 3QEQB 4G8EB 4CVUA 3T0EE 1UJ3B 3BE1H 2OR9L 1P9MC 5J8OA 1AGEA 3K81A 5C0AD 3OTTA 4JM2F 3MV8D 4U4BA 4MAUL 5ELIA 3V6FB 4WW2A 5IIEA 4HT1H 3C9NA 4U1NB 2P42B 4S1QL 1MIEH 3ABZA 1UJ3C 1A6PA 4PRNB 3PWNA 1MAMH 4UIKL 4KHTL 3V79C 3ZDXE 1HZHL 4PJ9D 3T0AA 4MNGA 1CICC 5ESAA 1BFTA 1K8IB 3UDWC 1ACYL 2H45A 1CGXA 3DV4A 4NRXA 2XPGA 2IALB 2YD8A 1MLBA 1YY9C 4HK3N 2H6PB 4OFYA 1E0OB 3BEVB 4HWZA 4PY8J 4L4VE 4JZOB 5CHNA 3CFKA 2FJGB 1LO0L 2YPLB 1MF2L 1JRHI 2BY1A 4ZUWB 2DAVA 5DMYA 3SCMA 5I66A 3VMPA 4P2QA 1ZSDA 1NGQL 4O2FB 3MLRH 1EV2E 3FAWA 1GZQB 5I1IL 3EYVA 3GKZA 4JRYD 2JKXA 4Y19B 4B41A 5C0GA 4NQDB 3MO1B 4RMTA 4XNQA 1H3WM 3F7VA 4G6FD 1KPUA 1U3JA 4YDKH 4Y16A 3VFUB 4LASH 2UVFA 4N90D 4Y1AD 3B5GA 1KJVB 3OAUL 1RZFL 5HHXL 4D9RD 1MCRA 2GKIA 2WBJB 1UM4H 4Y0GA 1RQ5A 4N0FA 3WJJC 5TQ0L 4Y4HD 4GLRI 1RZJH 2EE9A 5C2UB 2E9IA 3FO0H 4DKDC 3B6SB 4GRWE 3U0PA 1HI6A 1OPGH 3KYKL 1MVFA 4YPGA 5IR1A 1NGWA 4NNXA 5D2LE 3SY0B 1SVZA 2C3WA 1QLFB 3KYAA 1T04A 4KHXL 5DZOA 1T4KB 2WBJC 2IMNA 2PETA 4XC3L 3CFBB 2UZYB 3T0ED 4HLZG 2EXYC 4RA0C 1T89A 2BVOB 3PIQB 1YEEL 5EIVA 3SKMB 2HT4D 3MUZ1 4WTZG 1B0RA 4OQTA 2QQNH 5JPMA 3CMOH 2JELL 3JWOL 3MLTB 3PP3H 4NO2A 4EEEA 3RVVC 4KGJA 4TTDD 4J8RB 2R4SL 1JK8A 4M4RA 4KJQD 1Y18B 2ITDB 1KJMA 4M9PA 3VXME 2MQCA 4U6XB 5EZLB 1HYRC 5E4IA 1D6EA 1BZ7B 1CLCA 2OTUB 3VU2A 3H3KA 4QHKI 2YRZA 5T1DH 4DEPB 2Y4SA 3HI5H 5JIIA 1CD1A 3ARBA 1A7NH 4POYA 4L4VD 3WDIA 4A6YA 5EU5B 1HHJA 3NH7H 1KCRH 3VGHA 4X5XA 5E1HB 4KMQA 1IEBA 1EA9C 2PXYA 5DVNA 1JGUL 1F4HA 1U3HD 2H2SD 4JFYA 2C3VB 4KK8D 4Y5XA 2HJLB 2ZSVA 1DQDH 4Y2OA 3PQYB 4PREB 4DEPC 4OM1H 1P84K 3U9UA 3OGCA 1SBSH 4P48A 2DQFA 4O9HL 1EK3A 4NJ9L 1A6UH 4Z5RA 4P59L 1KIQA 4I2XB 4IOSD 2CK2A 4QRPB 3MV8B 3LMJL 3KYNA 4L8CA 1FG9C 2WSKA 5A2IH 1WISA 3OZ9L 1U8LB 1WT5A 4DK3A 4M7JH 1FC2D 2J88L 3VD7A 3OQ3B 4YFLI 1YEDA 4NC1E 5KG9B 1AHWB 1P2CB 5ESVB 1RK0B 2JCCB 2VXVH 4UB0L 4WEBL 3GFUA 4WWID 2EDXA 3LV3B 3I2CL 1MCWW 1RFDH 3BWAB 2HH0H 3GM8A 4OZHE 1CE1H 2F54A 1E4KA 2VZUA 3QJFA 4LIQL 4PJ9C 3PGFH 5J0BA 1V3LA 4APQD 4QRRE 2AV1A 2EDTA 4NCC1 1DQLH 3LS5H 4XP1H 1FBIH 4M02A 3KVQA 4PPTA 4DAGL 4GS7B 1PVHA 2HTKD 1F58L 3X12A 4D94A 1DANT 4PJ7F 3WD5L 1GC1H 2IH3A 4FQXA 3HC3H 4OF8A 5F70A 3EUUA 1MFDH 2GFBA 2C4XA 5E95B 5AZEH 3NCJH 2C1OB 4U7KA 3G6JE 4GS7C 1H3GA 3UJTH 3CSYA 4KRMB 3TJHD 2APTA 3VXMD 2FL5A 3LH2L 4JFDA 1NCCL 4Y1AB 5DJYB 1D5BA 3DARA 4S10A 3VGAB 2BNRD 1P6FA 2JB5H 2PUQT 5EZOH 4HQQL 1EJOL 3GMRA 4Y4HB 5HHQA 5I1GH 5DJ2A 4UV4H 4PRDA 2GY7B 3W81A 5TPWH 5TDOA 4G5ZL 1T20A 3MRNA 4FQQB 1KF9B 2FEDD 3L3GA 3GSUA 1A6TA 2IPUG 5BOZG 3RRQA 1DEDA 3IFNH 3WKML 1F4WH 2AJYH 3HAEG 2WLZA 4Y4HC 1U8OB 3T0EB 2NW3B 3BIBX 1FO0A 3BGMB 3EYFB 4F8TA 4RDQG 1KB5B 3RWDB 1HSBA 2CIIA 1NGZA 5DVLA 1RK1B 5C70A 3VFNA 5EUOA 4R7DA 3EO1A 3FONA 3IXAB 3DUUB 4NYLB 1XH3A 3JV4B 2LQRA 4PB9H 2CLZA 4C54A 3JV6A 3WO3B 3U7YH 4GKSB 3O6KL 3WV0A 3T0EC 2P5WE 5B21A 2OJZL 1PBYA 3T4AA 1ZEAH 4FS0A 1A8JH 5TDPB 4P57B 3IDIA 1H5BB 2VZ1A 1EMTH 2HT4C 3K2UH 4JPWH 2FBJH 5EC1A 3VXTA 3P9WB 1H0DA 5SWZA 2RR3A 1A4JB 2XACC 4JY6B 3QCTH 4HEPG 4X6DF 43C9B 3U6RB 5IFAH 4GUPB 4TTDC 5SWSA 2G60L 4L4VB 1EXUB 1QSFE 2NZ9D 4QXTA 1FFQA 1T21A 4QRRD 5J89A 4KPHL 4DVBB 5FYKU 1U3HB 4XP9L 2Q86B 4J12A 4R26H 4NHUA 5D6CB 4GG6E 5LAXA 3VE0A 3MUGA 2ZCLH 2BSRB 4HW6A 4JZJB 2BNUA 4ZQKB 3MRHB 4G7VL 1JVKA 2AEQL 2EECA 4CMHB 1U3HC 2R23A 1AGEB 4KK8C 4UUJA 1XMWA 5EOQL 4TQEL 3VG0L 4YHZL 1UM6L 1LQVA 4OIIL 4LSSL 4F2MA 1YNTB 4LU5H 4M8VA 2QL1A 2IANA 3PWNB 2WWMD 2FB4H 4UILH 2NW2A 3QUZA 3QA3B 4KC3B 4CMHC 1MREL 1YEJH 4MJ6B 2OR7A 2EH8L 1YYML 4YHLH 2CR3A 4LSPL 4QGTA 5IHBA 4J3XA 5SX5K 4NRXB 3ZHLA 4Z7VA 1T22B 4MVBA 4GRWB 3KPLB 1KULA 3RPIB 1MLBB 3NCBB 2ZWLT 5D2LB 1CGSH 4APQB 4ZUUA 5SWSE 4NGHH 5MEQA 1J05B 5GJTL 1JYVA 4E5XB 5CHNB 5F1IA 1L4IA 3IVKB 5IEKA 2VO5A 2DMKA 5GGSA 2Q87A 1CQYA 4APQC 3RVWD 1YEIL 3AC0A 1ZSDB 5ERWA 4NKIL 1ES0B 3EYVB 3IFLH 3WN5A 1RMFL 4QTHA 2E9WA 2VDOL 2HTKC 2P5WD 3KYOA 4DZBB 3VXMB 4S1SL 4UDTA 1NFDE 4NHCH 1I7TA 1D9KA 4HCRH 3BFOA 4OSUH 4YPJA 2DIJA 1MCLA 1KYOJ 2ZNWA 1IM3A 2R2CA 2LVEA 3WKNA 2APBA 3R0NA 1KACB 5INDA 3S37L 3RWJB 4LGRB 1PKQA 1QSFD 3TJHC 4N0FB 4CGTA 5F72S 4W6WB 3S4SB 4G59A 4PJGA 3HB3D 1CG9A 4Z7VE 1E4JA 4UT6H 3RDTC 3U0PB 2F5AH 1KTRL 3QXVA 4JEGB 3GMPA 3GSXA 1NKOA 4YPGB 4K7PX 3JVGA 5FUOH 1QYGL 3BKYH 5GRVK 1A3LH 2ED7A 1VFBA 1FYHB 1T7WA 2VISA 3IJHA 2W9EL 4WUUA 3RUGF 2FEDC 2Q6WB 2C9AA 1PSKH 5DQ9A 2CKBA 3CCHB 4W4NA 1UCBH 1LHZA 5D2NE 4WJ5A 3V4PL 1HDMA 4N0RA 5J57B 5JMOC 1VFAB 4WDIA 3O6FA 4HKXB 4YXKH 4GRLA 4BZ1L 3AU1B 3JTSA 3FT4A 1KJ3H 3CLFH 3QUKA 25C8H 3PUCA 1F6AA 5E03A 1RIVL 5GGUB 5HGDB 5ADPH 1WFTA 3KS0H 1JK8B 3KAAA 4MA3B 1UEYA 2EDDA 2EICA 5DUMH 4FQLL 5IHZA 5K9QG 5F1NA 4LDOB 2A83B 4OZHB 4EVNB 1HHHA 3UJIL 1JGLL 4TTGA 2EH7L 4XZUB 4BZYA 4H1LH 5HI5D 3GI9H 4QRRB 5ADOL 3A6BL 4M1GL 4G6AD 1KTDA 1QR1A 4NUJA 3N1GC 4PJGE 4X5XB 2YSSB 4K3DL 2AERT 3BSZH 3QO1B 3SE4A 2NZ9C 1U2HA 3T8XB 1NCTA 1OP5H 3SGEH 4LSTH 5E2UH 3OGCB 2Q8AH 4PUBL 4WFFE 4FABH 1PYWA 4WY7L 3THMH 3FFCA 3G6JB 4U1GB 3MTRA 4JY5H 1EAPA 5IHUH 3OKLB 3TCLB 1P4IH 3DIFB 3SDYL 4L4TA 3CLEH 1LO3L 3ESUF 5MEOA 1R6VA 5C8JB 5HDBF 1XIWA 3FMGH 1KB5L 5CMAA 1DCLA 1BVZA 3GMQB 3DVGB 3GSOA 4XCFL 3FQTB 4U1GC 4OUUA 1CXIA 3NCYP 2EYSA 1FYTA 1MELA 5AAWA 2DN7A 1OTSD 4E41A 3L3JB 4LKXA 3KPSE 5B4MD 4MVBD 2WWMC 1A14H 2X70A 4CRPA 3BO8A 1R5IA 3SJVA 4K3JH 4AEIH 4OT1H 4YHIB 1CK0L 1I7UA 4KDWA 4LFHD 3C6SA 2CMRL 4HJGA 5F71A 1A9EA 3GHEH 1ZLWK 5DGRA 1JP5A 2AK1H 3X12B 1RAMA 1U8HB 3OB8A 1NBVL 3K74B 5I6XC 4TSAL 3PHOA 4G9FA 1BEYH 1DLFL 3ARVA 2NMSA 4JKPH 3T3ME 3CXDL 1FL6A 3MLZH 5DQJA 1MCOL 2P5WB 4O51A 4GT7A 1I3GL 3ORJA 3TIDA 5KAQF 3FFCE 3UP1A 3F6IA 3D3VA 3NN8A 4G8GA 4L9LC 3RVWC 4MDIA 2F15A 2PN5A 3BP4A 4QWWD 3ROOA 2X09A 3UTZA 3WNLA 4DZ8A 1RZ8A 1LMKA 3UYRH 1DBKL 2LAGB 3MMEA 4FFWD 1SEQH 2M8XA 4N0CD 4HUXA 2HN7A 4HIXL 4K9EH 1ORSB 1QSFB 2X4PB 5B8CB 5D5MF 3QG7H 1MEXH 2G75A 5B39A 5HHQB 4ODXA 4ZFZB 3BUTA 4YGVB 3CUPA 4KTEL 5E5MA 3MRNB 3OX8B 4F15B 2PTTA 3GSUB 3SE9H 1A6TB 5DVKA 1UVQB 2IPKA 3NIFE 4GG6B 1X44A 3C5ZA 3OR7A 3EO9L 4KJYA 3ZT7A 5B8CC 2A38A 1MHHB 1A21A 5A2JH 3HB3C 5E1AA 3K3QA 3BQUA 1SYSA 1K4DB 3MNWA 1BZ9A 4LRNL 4NSKB 4WFFD 4L8SA 2WK2A 4F15C 1NGZB 1UXWB 1BBDH 4ZOAA 2E5EA 1NBZB 5I15H 3Q5YA 4XH2B 5FKPA 3WO4C 4G9FE 4ZD3H 2UZIH 5KW9H 3G9AB 3ARED 2NXZD 4G6MH 1IQWL 1RULL 4HH9A 4U1LA 1MH5A 1TZHB 5IMKA 2NY5H 4DGIL 4JHZA 2B2XL 2H32A 4R4ND 1XF2B 2DLGA 1NEUA 1PQZA 5HHVL 3FN9A 3OAZK 2VZOA 4Z7UA 1A0QL 4WO4D 3R8BB 5KN5A 4IRZL 1TETH 3CSBA 5D8JL 2R1YA 1INEL 3NCCB 3S34H 2HA1A 4KFZC 3KPSD 5KVEH 4XTRD 1CE6A 5SWSB 5GHWH 4W6YB 1QFUH 3HRZB 1SY6L 3DROA 4TPRL 3NFPA 5CJQH 5E8DL 2E6JA 3ULVE 1T0PB 5E2JA 3ARZA 3O2DH 3HI6L 3OKEA 5DRXA 4KVCH 5IB2B 1DJSA 2D0FA 5H2BB 4BQCA 2VSDA 5LAXB 5HI5C 2ADJA 2YRLA 3VE0B 3MUGB 4IMLA 4NKOA 4J4PD 3TYFB 4G6AC 2BNUB 1EEZA 1G7MB 3B2VL 1MY5A 3MA9L 2DLFH 3NCFB 2J2ZA 4YBLB 3G5XB 5FECB 1AC0A 2ERJB 4ODHH 5KANI 1UYWH 2DQUL 2CXGA 2JCCF 5DUBB 4UUJB 1G7QB 3R1GH 1C7TA 3ROLB 2O93L 1NFDB 2ADGA 1MQKL 3C8KB 1AQDB 1QUNA 2LU3A 4F2MB 2FLBT 3FB8B 2AXGB 2OZ4H 2O5YH 4M61B 2YPKB 1ZK9A 2HFGL 3PL6D 4FXKA 2VKXA 1MFCH 3GM0A 4YBLC 3IDXH 2ERJC 1KCGC 1KCSL 4XAKE 1X4ZA 4OQTL 4N5EA 1Q1JL 4I18B 2JE8A 1NLDL 4JPVH 4LLAA 4QNPF 4PJDE 4Z7UE 1NCBL 4Z7VB 4QCIB 2MCPH 4JM4L 4BH7B 5DO2D 1UKSA 1WWAX 4TUOB 3GB7A 4NN5C 1A5FL 5MEQB 4R2GD 3OR6A 1J8HA 3PDOA 4I18C 3L5XH 4ZPTB 2OSLA 1EH9A 1OTSC 4UTBL 2CSPA 5E99L 3E0GA 2P46B 3FOMB 1F4XH 3VDBA 4RAVA 3V6OA 5D2NB 4O00A 4MZ3A 1NEZB 4G9FD 3U0WH 2QQKH 4I48A 5GRUL 4X6EA 1XCTA 4Y5VA 2XA8L 5IFHH 3BYTA 1IM9A 5D71H 5DMJB 4Y4FA 4J2XA 3MGAA 4M1CD 5HHNA 3VD5A 3U0TA 5D2NC 3S36H 2ZCKH 4K55A 1I7TB 2HRPH 3OJDB 4KUCD 2ADIA 4OJFL 1EEUA 4AM0A 4E0RA 3M8OL 4P2OA 3RWEA 4WTXA 3ZLQC 5GJSH 3L6FB 2BVYA 5INDB 3LPFA 1QPPA 4XNMB 3RX5A 3Q1SL 1OM3L 5J06A 1NC2A 4JR9L 1W0VA 2EYRA 4QWWC 1QVOA 5KZCD 2V5YA 4OV5A 1I9JL 1N5AA 1QRNE 5BOPA 1OP3K 1OGTA 4PJGB 2XY1A 2UV3A 4FFWC 1IGJB 3ULVD 3H7BA 5ETUB 2RBLA 3MRJA 1I9RH 1TZIA 1FNAA 3O3DA 1W8OA 3O41A 4GAFB 4N0CC 4CVZA 4FA8A 3JTTA 3VXSE 1VFBB 1F3DJ 1IAIH 3IDJA 5IMLB 1EZVX 1KNOA 3KPRA 3W39B 4WU7B 2K9UA 3B4NA 4EOWL 2ZOLA 2GITB 2D3VA 3ZDXF 3LKSA 1G1CA 1NAKH 1DBMH 3BAEL 4YDIL 3HRPA 5DUPL 1V05A 2H2PD 3AREB 3UZVB 2EDRA 2NXZB 2VZSA 4FFYL 1NSNL 1IGYA 1WZKA 2AW2A 3IT8D 1B6DA 3UZEA 3L3IA 1BQLL 3MSPA 3QUKB 3DO7A 1AE6L 1BD2E 4HUVB 3LZFL 1F6AB 3A67H 2CDGA 1M7IB 3D2UD 3MOBH 2FGZA 4LMQI 3V95A 3OKMB 4WO4B 4FZ8H 4XAKD 2CO7B 1P1ZA 3AB0C 3F65A 5IHZB 3I3EA 4BZ2H 3AREC 1FZKA 2NXZC 1FG2B 3KPSB 1QFHA 3DRQA 3GSVB 1RZGA 4ZUTB 1GPOH 3K80A 4MJ4A 2VL5A 1G1YA 2MPAL 3QNZB 2OQJB 2VAJA 5FHAL 1DVFD 4R4NC 3TEUA 4M6NL 1CLZH 1MJ7L 1MPAH 3MLXL 4MCYA 4ZDHA 1OQXA 4WO4C 2BDNL 4PP2B 2Z9TA 4PR5A 2BX5A 1L6ZA 4OCMC 1ODAA 1MFBL 3FRPG 4XTRC 1LEGA 3P0YL 2XWTB 5TFSH 3HFML 4WW2F 3BISA 1N3NB 3VXUA 3QQ3A 1ZKAA 4YHKL 5J56B 1GH7A 3C8DA 2VLLA 4XCCH 2AJZA 4MQXD 5IMOA 3FFCB 1KCKA 3ZE0E 2BVUA 4Z0BH 1EAPB 3MLPA 1JYXA 4J4PC 4EI6A 2XOTA 1B88A 5GS2H 2A0LD 3PL6B 4GRWF 1DL7H 3GSOB 4FQIH 4ALAL 3CC5B 4TRPL 4JPKL 3U4AA 3G6DH 4Z18A 4N5ED 1QRND 1NMAL 5BV7B 5HDQH 3CGTA 3PL6C 4XMPH 1PG7L 3MLYL 1R0AH 5C0DA 5CSZB 5ALBL 2X70B 3VFVB 2BCKB 5D9SB 5LVEA 3P11L 4R2GB 2QHRH 3BKJH 4GXUM 1ONQB 1Z3GH 1H9VA 3VXSD 4JPIA 5IQ7H 1E27A 1I7UB 3MRLB 3C6SB 3L3HB 2D7NA 5DO2C 5BV7C 1FH5L 1XGTA 3H3PL 3NACH 3QDGE 4EN3A 5F9AC 4YC2B 1HH9A 1QQDA 1NDMA 5GS0D 4G9FB 4R2GC 1NGPH 3BMVA 4M7ZB 4X98B 3VXUE 1C8PA 3ALPA 1FL6B 3BH8A 3IU4H 3O45A 1MRDH 3QH3A 4MQTB 4O51B 1BD2D 4G42B 3TIDB 3ZL4H 3H9HA 1D5IH 3FZUD 1IM9D 5E5RB 5IVXE 2OL3A 3RL1A 4OCYH 5C2BL 1RUMH 3EW3B 3BP4B 4YC2C 3V0AC 4DZ8B 4R8WH 3RI5K 2AKRB 4TVPH 3M17A 4MAYA 1ZT4B 5IP4A 3KJ6H 5DS8B 5L9DL 3HMWL 1TJIL 4XBGA 3BDYL 4ZAKD 3MYJA 3QWQB 1WJ3A 4M1CC 5DHVB 1TZGL 4K8RH 5KZCB 4JQVA 2G75B 2XTJE 4BK5A 5KJRH 4TUKH 4RFOH 3S35H 2CO6B 1RY7B 3TO4D 3OJVC 5DA4A 2PTTB 3RIAK 4Q74A 4GAJL 1VGEH 3QFJE 3IF1A 2R29L 1I9EA 5I73B 3TJEH 4KJYB 2FD6H 4RWYH 2QV2A 3ZKXB 5IROA 3NFNA 3BKML 2CK0H 1L0XA 4JFFA 4FRWA 3ULVC 3BQUB 3V4UL 3AROA 4L8SB 3REWB 4JFZH 1WVZA 4KY1H 4ZG1A 5EBLB 2XA3A 1MHCB 2QSCL 5ICYA 4OZHF 2F8XC 1C12A 1Y6NR 3F58H 5IGXH 3ZKXC 4HH9B 4KKCD 3D2UB 4U1LB 4NQEA 5IMKB 1Z0MA 1JTOA 4F3FB 1LWRA 3KPPA 4L3CA 5ESQA 2H32B 3OKOA 2H2PC 2XFXA 4B7IA 4WI2A 1IC5L 4Z7UB 4PJDB 4GMSL 5SX5H 4A6YH 3BP7A 2R1YB 1HHGA 5H8DA 4XPBL 5KAQG 3P9LA 1KPRB 1DVFB 4WRLA 4P3CL 1CE6B 1DP0A 4GG8A 5BZWB 5FYJH 4WHDA 5CJOH 5D7IA 4Z76A 3DROB 3TZVA 4QRSA 1ZHBB 4R4BB 2VDML 2XKNA 1X5ZA 1IARB 4I0KA 5L6YL 1CU4L 5DJ8A 3G6JF 3MROB 4YH6A 1DVFC 2ADJB 2YXFA 3QDGD 3MRIA 4LPUA 3U83A 4I0PD 4NC0B 4NQCA 1R5VB 4I0CC 1S7VB 5J9PB 1EEZB 3DURA 4ONHA 1V3KA 4DGVH 3VXUD 4LARH 4ISVA 1BVLB 4LKCA 1KENH 1A02N 3MV9E 2ADGB 4E42A 3EJYD 1IVLA 2DL2A 3I9GH 4KTDH 5TE6H 5C0RL 1C16B 4M7KL 4MQXC 2VLKA 2DBLH 1UWXK 2QSTA 4EUPA 5CFHA 1ED3A 1BVKB 3L3KA 3B2UD 4XPHH 5LKNA 4MA7L 3WNNA 1DN2A 1QRNB 2WANA 4XHQA 1ZT1B 1DBJH 1TMCA 4OI9A 1EVUA 1CXKA 2A0LC 1OAKL 4JRXA 4PJXE 3MRPA 2P4AB 1J1OH 1UZ8A 4WHTA 4LCWA 3QFJD 3D69B 3SGDI 1JPST 3HC4L 5FF6A 3P4MA 3VXSB 3GMNA 2V7HB 3B43A 3QUXA 5D7IE 2HKHL 3T77A 4ZYKB 1JGVH 3HCVB 2E6QA 3LHPL 1ZLSL 1O0VA 5DJ0B 3UEZA 1P84J 3UMTA 4UU9A 1T7ZA 5DZNA 1AKJA 1Q9KA 4M43H 2X4OB 1U8JB 1U95A 5K59E 1K8DA 1NLBH 2A73B 3RDTA 5IEHA 5AG8A 1F90L 1BD2B 3TNMA 4Y5VB 2ICWJ 2WP3T 1XF3B 1IM9B 1NCWH 2BJMH 3QIWD 3H42H 4Y4FB 5TH2A 3WUWB 2DKUA 1SBBA 3P73B 5EZIH 5GS0C 5E6ID 3RKDD 5LGKA 3T2NL 2FWOB 4JFOB 4UNTA 3PWLA 5GGTA 4ZAKB 4GG6F 1CBVL 5D7SH 3IFOB 3FZUC 4NP4H 4WTWA 4KRLB 2EDOA 5FB8A 1NC2B 3TO4B 1S5IH 4Z7NE 1OGTB 1MHPH 4HK3J 3HE6D 3MRJB 1FO0H 1ZE3C 4CJ1A 2VLJA 1I85C 4ZOCA 2GCYB 2PCPB 2AJXH 4NIKB 5FFLA 1M05B 1NCUA 1KEGH 3Q6FB 1NL0H 3TO4C 3U48A 3QHTC 4OGXH 3GKWH 1S7WA 2YS4A 1BAFH 2ZOLB 2VWEE 5EPMB 5DSCB 4HWBA 3G6AA 3ECBA 4F8QA 3UBXG 3AVEA 4Q7DA 3MV9D 3QFDB 5H35A 3ZTJG 3QUMA 1IGYB 4L1HA 5GQBA 1LO4L 4R97C 2YK1H 1YA5A 2B0SL 2N56A 4ONFH 3F12A 2CDGB 5I1DA 4TYUA 2ARWA 4HG4K 5I1JL 4Y5YB 5HJ3A 1RIUH 2EC9U 4L5FL 5F8RC 4F7PB 2JJVA 1QNZL 4PLOB 2VL5B 3RJDA 3C08H 4WFGE 2BMKA 4G80A 3DYPA 1K5NA 5E5UB 2DTMH 1FRGL 2E8YA 5ID1B 4MCYB 4MXWL 4ZDHB 4NM8L 5EOCJ 4Y5YC 3DJ9A 5CJXA 1ZLWH 4D2NA 1U9KA 4LHUG 4EI5C 1JHTA 2R69L 3QDGB 2FSEA 4RGOH 3KHOA 4EBQL 2NR6D 4I0PB 4LCYB 5DWUL 1NFDF 5CGTA 1HK6A 3GMOB 3ULVL 3RZCD 4RMSA 1JWUA 4LPXA 3VXUB 4QXGH 1VGKA 3U7AA 3MCKB 3BRDA 4ZXBA 2UVEA 5ID0B 4H25B 4HXBH 5IVXB 1CDCA 5D1ZA 2D31B 4M48L 4I0PC 2QKIA 4EI6B 2CH8A 1OB1A 1TJGL 1IGTA 1Q72H 1AP2B 4Z7VF 4JDTL 4YK4C 1FPTL 1P7QD 2DL9A 3EYSH 3PP4H 1FGNH 2R39A 4ZNCD 4OGZA 3EJYC 4XMLL 4BUHA 2J4WH 5IESL 3RWHA 4OCSL 1E4XI 3D85D 5CIPA 5ACZB 1DSFH 4IOIA 1HQRB 4C83B 5ITFA 1BM3H 3QFJB 3P77A 4NKMA 4L9LA 5D93B 3B2UC 4PRPA 1FVDA 4KV5E 4XMKH 1VEOA 4KJWD 5EO0A 3TBVB 2W60A 1HSAA 1BF2A 2HJFA 2V2XA 3D0LB 3QUXD 2NY7L 3WIIL 2AK4E 3O3EA 3BH9B 5D72H 5IM7B 3FCTA 5D93C 4ZSOE 5HHMA 1YEGH 4AIOA 5E2VL 4AK1A 1LD9A 4MDJB 5DEFB 1V3JA 3MXWL 4PJBA 3SPVB 2YC1A 3DX9A 5IK3B 4JGJA 3QIWB 3QH3B 4YAQB 2V7NB 3CDYA 1OLZA 3V6ZA 3H9HB 1M4KA 1L7IL 5E6IB 3RL1B 4J3TA 5DVOA 3I6KB 1BOGA 4FTVA 5JTWA 2OR9H 1QR4A 4KWUA 1E6JL 4PJGF 3ULUD 4IS6A 3DXAE 3CVHB 2OJEB 5A16B 1CCZA 1HILA 1R3JA 3QIWC 4ZTOL 4YQXL 2V6HA 4WFGD 4IRSA 1YC7A 5IJVA 5E6IC 3RKDC 4KUZL 4M93B 3HE6B 3UTSA 4LGPB 3UO1L 2YEZB 5IMMB 4P9MH 5HHOA 2GTZA 3C87A 2Q8BH 1AR2A 2CKBH 4MQ7A 4PRPE 1DBAL 4P5TA 2C1PA 3B9KD 4XXCA 5CZVH 1HH6A 4M93C 3NFNB 3HE6C 2EDWA 4NQTA 3X14B 3U9PL 1ZTXH 2VLRE 4JAMA 4ZPVA 1UENA 4P46A 3MV9B 1JF6A 3TWCH 4CDGC 5B38B 3GEWB 1AD9A 5E24E 2YUVA 3C6LA 5ICYB 1G6RA 4HJ0D 4UINH 1SM3H 1LK2A 1J1XH 5DJ6B 3KPPB 1QTYT 4QGYA 4WWKA 1J0JA 1IEAB 3MJ9A 4WVRA 2H26A 4L8DB 2JJTA 3IDMB 4HUUA 4PJXB 1JZ5A 2A9NL 4D0DA 2BSSA 1T7XA 5F1OB 3C60A 5GGSY 3P9LB 4NOBA 1G6VK 2VDKH 1B2WH 5DR5L 5KOMC 3WS6C 1T83A 4M6OL 4AIZA 5D7IB 1QBLL 3OAUH 2XZCH 1RZFH 1Q94B 4QRSB 3WS3A 3IDUA 4JO1H 2XKNB 4LPWA 4V1DA 2AK4D 3W9EB 2X89D 4KGLA 3RZCB 1RZKC 5I8CA 2ICWI 2R1WB 4OLVH 1UFUA 3QJHB 3KYKH 4ONHB 3SEPA 3MX0A 3OKKB 2DYPA 4LKCB 1UM5L 5D1QD 3X11B 1INQB 1CFVH 5C71A 4X8JA 2NR6C 1NFIA 5KSBA 4JJ5A 3KPNB 1CF8H 1UA6H 3RZCC 1LDPL 1RHFA 3MV7A 3N06B 5FV2A 1P7QB 3DXAD 5C6TL 3D87B 1ED3B 3MRKB 3ZKSD 3L3KB 2BY0A 5DMGD 2HFEA 1MJJB 4FQPA 3JWOH 1TMCB 2HLAA 1YN7A 3P4NA 1OP3H 4M1DL 1IAKA 2R4SH 4FQJL 5AYQA 4GAYB 2FHFA 3P4MB 2YD9A 4HK0A 4PRPD 2GAZB 5JDJA 2CDEB 3QUXB 5TQ2L 1XF4B 3S5LA 4V1DE 1FJ1A 4OM0H 2VLRD 1OHQA 2FECL 4ZFOB 1Q9KB 5FCUH 1A7QH 1OARL 1OAZH 4M5ZH 2VDLL 4HIHA 4KJWC 4KUCF 2JJUA 4OF6A 1S7XA 1K8DB 2PKDA 1CGYA 1RURL 2HT2D 4LPCA 4PS4H 1GZPB 3NCMA 3ARFD 4JQXA 5J6GA 1CR9L 4G8FB 2VWEC 4LLUA 3G08A 4QTIH 1SHMA 4M62L 2FR4B 5KSBE 1XF5A 3LN4B 4O9HH 4CN1A 3BOVA 2YXMA 1A9BA 3ULVF 3OG4B 3JTCA 3VFWB 5E70A 2BVTA 2VZTA 3TVMA 3SDAD 5FHBL 1G7HB 4OLEA 4GXVL 1K6QH 2FBOJ 2PR4H 3VFOA 1MVUB 3ULUC 4NKDB 2EEDA 4RWHA 5F9OH 2A77H 4Z8FL 2N1KA 3CNKA 1ZHKB 1I8KA 5C0ND 1EHXA 4K3HA 3B9KB 4Q0XL 2P7TA 3L3DA 1I8IB 4C4KT 2EIZB 4XP5H 5JDSA 3QRGL 4OZFA 3EOTH 5FYJU 5CEXA 2XXCB 5DJCA 4S1DC 1IT9H 1UB5A 2APVA 3WLBA 4K23H 4XBEH 2EDEA 5DFTA 5HVGB 2OCFD 2PW1A 4ODUA 1OSPH 2CLRA 3B9KC 4DAGH 3VW3H 5D70H 2R2BA 4Z7UF 4PJDF 2Y1VA 1MCBA 2I26N 2KUTA 3C6LD 5HVWA 1ZV5A 3OPZL 3TYGL 2VXSL 2EKSA 4BH8B 3F12B 2GK0A 2IG2H 3E6HB 1HNGA 2NTSP 4FQ1L 4MGXA 3FQWA 2BRRL 4ELMA 5E8OB 4HJ0C 5HSFA 3MRQA 1T66D 2OL3L 3WYRA 1EUTA 1I1YA 1Q9OA 4Y4KA 1MHEB 1K5NB 4UBDD 3CSGA 5JHDA 1DQML 2YD5A 5GGRB 2Q7YA 3HPLA 3CVHL 5F88B 4D9LH 1G9MC 1T0MB 5I1KL 2AK4B 1HYSD 1DBBL 1EJOH 5I8OH 2PO6A 3SKUD 3ELAT 1WBXB 3NMEA 3KPMA 1QFWM 1TJHH 5CINH 1OGAD 4ZSOB 3EBAA 2FH8A 3IYLW 3L95A 1KBGH 3UJJH 3GHBL 4OCRL 1XGQA 3MLUH 4POZC 5C07A 5TE7L 1OQOA 1VGKB 2FATL 1CDGA 1H3PL 2D0HA 2ZNXA 3O9WD 3S3JA 4MS8A 4YE4H 4YHPB 2P1YA 3DTXB 2HTLD 5L88L 4HIIA 5C7XL 2QKIB 3VCLA 3INUH 3EYOA 4NWTH 3UYPA 1IAOB 3SBWC 4OLYH 2BRQA 3TH3T 2GJ6A 1G7LB 4O58L 2F5BH 1J87A 3DXAB 1YNKL 5FOJA 4RRPA 5IV2A 4JG1L 5D1QC 3H9SE 1AI1H 1AXTH 3HZKA 4L29A 5JQ6H 4ZUSB 2BOBB 4HWEL 3DVNA 2Y06L 3ARGA 3IRPX 3HMXL 5DMKA 2CGRL 3FB6A 4F7CB 2VDRL 3KXFA 5ITFB 4IM8A 4ODVH 3RA7L 5DMGC 5JIHA 1S7QB 4PLKD 4PRPB 1FVDB 5TDNA 4GMTL 5KVMC 5JUEH 3QHFH 5ISZA 3MCLH 2V9TA 4X0KA 3ALXA 2VLRB 3O3EB 4U2ZA 2ZUWA 3MQIA 1MCQA 1NAMH 1CDUA 3WHE1 5HYSA 1VKXA 3CU7A 1LD9B 4LLQA 2ZJSL 4U1JA 1NUFA 1YMMD 3DX9B 1BQHA 3ARFB 4U1MA 1MWAB 2R0LL 4XBPA 4I3SL 1T5WB 1QEWA 1OTUC 3MXVL 4FNLL 1AO7A 3FFDA 1S7SA 1IC4H 3WXWH 1BOGB 4EJ1C 1F4YH 2HT2C 4XPGH 4PGDA 4P9HH 1QHOA 2GJ6E 3MLWL 4IS6B 1RU9L 2C4FU 4JB9H 3ARFC 4LPYA 5ICZA 4PRIE 2XZQH 3MACH 4Z95H 3QPXL 1GGTA 2MCG1 2NYYD 1FNSH 3VRJA 5MP6L 1BJMA 4XNZB 2FEEI 4F7EA 5DA0B 3QIBA 1S9XA 2DMCA 4U3CA 3SDAC 3ZE0F 2JB6A 5FYKE 1BGXL 3DLQR 4X4XA 1AJ7L 5E2TH 5C9JA 1JWSA 4HIEB 5A2FA 3OF6D 5KSAA 1A6WL 1YPZE 4U1HA 5ISZE 1IL1B 4XNZC 5J13C 4MJIE 4UV7H 2XWJA 1VEMA 3GSQB 5C0NC 3GI8H 4XNUH 4FFZH 1J8KA 3RVUD 4L8BA 3O6LL 4PJIA 5IUSA 4IJ3C 4KAQL 2VDQL 4G7YL 2I07A 3C6LB 3X3FL 4XP4H 2HMID 4KKNA 4ZFOL 4PP1D 1YEIH 2FJFB 1UWXH 3H9SD 3S7GA 4ELKB 5HGBB 4U6YA 5DD6A 5INCB 3F8UB 1GHFH 2KPNA 1NMBL 2ENSA 3QT2A 3WIFA 2AS5M 5DD3H 3VFPA 4LNVA 4IIQA 4ERSH 4XVSL 3NZ8A 3C60B 4S1SH 1A7RH 1IZJA 4U7MA 3GK8H 2X44D 3BPNC 1PD6A 1ZVSB 1L0QA 1IGMH 4HS3A 3QR2A 1SQ2N 3JV0A 4XCEB 2W07A 5GGTL 3BN3B 4X7SL 5EO1A 4ZTPH 4V1DB 1T66C 3J8F7 3QQ4B 3BD4A 1EBPA 5IVXF 3RAJL 2NX5E 1WQVT 4W70A 3O9WB 1HYSC 3MREA 4NO0A 2CDFA 5I19L 2ITCA 1HXYA 3D0VA 3ZDZE 1EO8H 5KSBB 1UB6B 3CFCH 1CI5A 2NY6D 4ODSL 4R0LA 3V7MA 2M2DA 4ORZC 3RL2A 3VFMA 3VFTB 3O0RL 4HWBL 3STBA 3HI1A 3EFDH 3NABL 3O9WC 2QQLL 1Q9WA 3ERYA 1XR8A 5T3ZH 3QWRD 3U7WH 5DD0H 1U0QA 3RIFK 2BVEA 4PRID 5GS1B 3E3QE 3HZMA 3QUML 2ARJQ 4LDEB 2GHWB 3T09A 2HLAB 3P4NB 5JOPE 1V8HA 3MRFB 2B5IB 2A74A 1WCBA 4HUMB 4JLRA 1G9ML 5CEYB 2Y25A 5FYKD 3GZKA 4GSDH 4OTXL 3X17A 2KQNA 3V5HB 5GS1C 1JUFA 1DZBA 2Z35A 5HDOA 4MJ5A 4XP6L 3GSNA 2OS7A 2D9QB 3F5WA 5ADOH 1X4XA 3A6CL 4LSUL 4MJID 5DYOB 3RY6A 1Q0XL 4PLKC 4ZOEA 4ORGA 1S7XB 3H9YA 1S9YB 3LB6D 3RU8H 1FL3B 3K8KA 4FQCL 3GBNL 1QSEE 3RTQA 3SO5A 5IJKA 3L9RA 5F7YC 3U46B 4NRYA 4M7LH 4RAUB 2XXMB 4WHCA 5L2KA 2ZUTA 5IW6A 4PV8A 5E2WH 2NTFA 4DWHA 3BRGC 3Q3GB 3W9DB 4J6RH 3BT2L 1VFOA 2WZPD 4LLVB 3ARRA 4Y8DC 2KH2B 3VWKD 4P23A 1NCDH 5IB1B 1QLEL 1I8KB 3I6LE 1A3QA 4WV1B 3FTGB 4LCCB 4OGYL 4LQFL 2NYYC 4S2SA 1OSZA 1M7DB 2ESVA 4G6JH 2P47B 1PEWA 2NX5D 2Z92A 2QR0A 3SO3B 5CEXB 2EE6A 4NQSB 4DTGL 2JIXD 4GW5B 3ILPA 5I2IA 1UB5B 3ZTNL 3LS4L 3GNML 3SGKC 4Z7QE 4ODUB 4WV1C 4LCCC 5C08A 3Q0HA 1EEYB 4POUB 4PJXF 4XC1L 1ZA3A 5DXWA 2BXYA 5C0CA 1OF2A 3T0DA 3H9SB 2D03L 1ADQL 2F19H 2YN5A 2EKSB 4K7PH 4P2RE 1IGFH 2EIBA 2N4IA 4MXQD 4MX7A 1P7KA 3RVUC 2I9TA 1YYLH 3IU3B 1OLLA 5C0JB 5D7IF 1I3GH 5L2KE 2RAMA 1ZHLA 5JOPD 3FQNA 3MBXH 2HMIC 3IKCA 5ITBH 4PP1C 2NQCA 4YFDB 4N0YL 4IDJH 4RZCA 1N2RB 4N9GA 4O5LL 4CKVX 3SDDC 1I1YB 4LSQL 1YJDC 1S9VB 1ZWIA 1RUPH 5C3LD 2ICWB 4NZUH 4ZUVA 1ROWA 2VR9A 4TULL 2FGWL 4W81A 5B39G 4ODBD 4HGKC 5I74C 3QPQD 5BXFA 3HZYA 2J8UE 5K59F 3MGOB 4PJEA 1LK3H 7CGTA 1L6XA 4UTAL 1HHIB 4K2UL 1V7MH 3G5ZA 3TO2B 3VWJD 3HUJA 3WFCH 4U1IB 5J6HA 3L95B 4PYGA 4QXUL 5KVFL 1IFHH 3U4EB 4QF1B 2J6EA 3IGAA 4TVSa 5DRZB 3EO9H 4YUEH 2EEBA 1W0WA 4K3EH 1WTLA 1CFNA 5FGRA 1QSED 5IBUG 5LGJA 1NMCB 1F8TL 1PLGH 2NY6B 4OLUL 3PGDA 2VQ1B 2YUWA 4FFVD 4EUPH 1K3IA 5CWSA 1UXSA 2Z93A 4H8WC 1NKRA 4LRNH 5T5FH 3QEGH 5C0CE 4AIXA 3ZT6A 3UTTA 4WUKL 2VH5H 2DQHL 2CRYA 4UNVA 2NY0B 5M94B 1TNMA 4PRIB 1RUAH 1QFWH 2DWEA 4HV8A 4MD5B 1ORQA 3MFFB 2UUDK 2ZUSA 3HZKB 3GJFB 2LFGA 1NMCC 4TOYH 4JFPA 3TBWA 3WLWC 1X7QB 1D6VH 1INDH 4BFBD 5DMKB 2J3SA 1JCKA 4KRNA 4PDCE 2B2XH 1JNHB 1IMHC 2FNBA 4XNYL 4OZIE 3MJ9L 1YEKL 1A0QH 2Q3AA 2GSIA 4GAGH 3I6LD 3O11A 5D8JH 2Y07L 1HNFA 4MNHA 3HAEB 1I8MB 3P4OA 4M5YL 3CH8A 1YPZB 4PJCA 1OAXL 5ISZB 1FNGA 4DQOH 2V2TB 4X0KB 4PRAA 3WEXA 4MJIB 3S8WA 5MEND 3T0WA 5IWLC 3LSOB 2DJ4A 4P3DA 1AQKL 1G7IA 4TPRH 4M00A 3HUJE 3N85L 1D5XB 5E7FA 1JNLH 5D7JD 1UWGL 3QDMA 1EAJA 3EFFB 4PGCA 3VXRE 3DWTA 2VN7A 4GBXD 4U1MB 4WI3A 3WSQH 4RNRA 4QY8B 4UOW0 1G9NH 4FXGA 5LQBL 2YD1A 4NO3B 3FFDB 3D18B 4P2RD 1FZMA 5BVPL 5C1MB 4X7TB 2X4NA 3RQ3A 2B4CC 4P0DA 3MODL 2UY6A 4KROD 1LE9A 1PZ5B 2XG4A 3LB6C 5L2KD 1CDIA 3TP4A 1KLFA 1J5OL 3TN0D 1WFNA 5DD1H 1I7ZA 1A4KB 1JHKL 4OFIA 5ICXA 2ATPA 5EA0H 5F1SA 3O3BA 3VWKB 1I1AD 1MCPL 3VRJB 5HD8C 2EYTA 3STZA 1HKLL 1N8ZA 1S9XB 5ANME 1LNUA 4N1EA 5JOFB 2JB6B 2Z4QA 5JNYA 4X4XB 1NCBH 5HGHB 5JW4M 2VZVA 2B1AH 2C3HA 4JM4H 1J0HA 3ES6A 15C8H 5IFJA 2DJUA 2NX5B 3REVB 4OLWL 3VWKC 1E6OH 2JIXB 32C2A 4OD3H 5AZ2L 3GUTA 1W72B 4RAHA 1Z5LA 3TNNB 3W2DL 3WJLC 2G5RA 3GBMH 3LPWA 4G8IB 2WY3A 1C1EL 4L8BB 4NCDA 5HYJA 3K0WA 1VSCA 2XNAB 4UT7L 2I07B 1CL7L 4XXDA 2ZUXA 4HKBA 1VPOH 4ZFFA 4AG4L 4RQQA 3IAQA 5K33A 4X4ZA 1V3MA 3WUWG 2QTEA 1CDJA 4KV5F 5DD6B 1RHHB 4OD2A 4ONGL 4LP4A 3RX8A 4HF5L 2AXJA 5EU6E 3QULB 3LQAC 2I5YL 5F21B 1ERNA 2ZCHL 1B0WA 5JO5A 1T03L 1D3CA 4KK5C 3DRTB 4RISL 4MXQC 4KMTL 3E3QC 4XVJL 4U7SA 3MNVA 4PP8C 2FO4A 4HULB 1CLYH 3ZKMD 3KR3H 1R3HA 3LIZH 5DK2A 2R0WL 5EB9A 1OM3H 3TPUA 1RJLA 3VWJB 4FFEX 5CBEB 3DBXB 3K8LA 1VDGA 3QPQC 5AYUH 4R3SB 3NA9L 4DOHE 3SGJA 4NRZB 1QLRA 4KK6D 3VXRD 5D7LE 1J86A 1QSEB 2C7UB 3MA7A 3MREB 1JRHH 2CDFB 5JPNA 3VWJC 1A1OA 2OYPA 4HMCA 1DEEA 4R0LB 4HHAA 5JW5B 1WBYB 3L5HA 5GRJL 4MD0B 2AXFB 2AGJH 2DS4A 5CIPH 4HUWB 2E7LC 1I3RA 1NSNH 1RJYA 3W11D 1ND0B 2E8ZA 1NQBA 1X4YA 4FFVC 1X5HA 4KQ3L 1KYOK 1N7ML 1CXHA 3SKJH 1RUQH 1U8NB 1QA9A 3WNMA 4D0CB 3QUYA 1RSFA 2Z8VC 1URLA 5E9DD 5CP3A 4LNRA 4YXHL 2I27N 3DX8A 4MB3A 3WHXA 1XZ0A 4AT6B 4GLRH 1N5YH 3F5WB 4OCXL 4MCZB 3WIHA 5EBWA 5JXAL 1CGUA 1C08A 5DLML 1WUNT 1FORH 2JTDA 1I3UA 4WI6A 3U1SH 4WNQA 3KPOB 3L7FB 4FQ2L 5D7JB 5I1AA 4GBXB 5DJZA 3MNZA 4KVNL 3MBED 5EBGA 1BFSA 2J1KA 5IB3A 1AGCB 4P2RB 2HWZH 5GGRY 1A7PH 2H1PL 4KROB 5I8KL 1S7UA 5K9JH 5L2KB 1YUHB 5EG6C 1C7SA 1L9NA 3RWFA 5D7JC 2YMXH 4NT6B 4PV8B 1A6VL 5EU6D 4GBXC 3TN0B 2D7PA 1ACZA 1IEHA 1MI5E 4OQ1A 5HPOA 8CGTA 4G43B 2UYLA 5CJBA 3QO0B 1I1AB 4HCRA 5FIEA 1B4RA 1M6OA 2J8UB 4X5WA 4KROC 1NBYA 4CL7A 4P23B 5T33H 1SJHA 1YEFL 3TN0C 5F7EH 4OB5H 1Y0LA 2XWBB 4GRMA 3FO9A 4NZRL 1LILA 2HLFD 3MYZA 3HS0B 4S2SB 1I1AC 2LU7A 4CNIA 1D5MB 3V4VL 3EOBB 4JN1H 2Z92B 5FYKL 3PWUA 2QR0B 1MCNA 5DD5H 2P8MB 4CVXB 2R1XB 4F7TB 2AJVL 2ARJA 5FCSH 4U0RC 5EWIL 4FMFA 5D7LD 2F53A 1G6RH 1P5UA 2APWA 2AABL 4UT9L 5I0ZA 1KCVL 1N64L 4OF5A 1TVHB 4N5UA 1U3YA 5I30H 5C0CB 3TV3L 1OF2B 2UWEA 3HNSH 1U6AL 4PJAE 2W0KA 3LEVL 1A1MB 5I1CL 1FDLL 2ATKB 4PJHA 4MX7B 2CLVA 1UQSA 2I9TB 2F74A 4H26A 4U6TA 3FQNB 2Z31D 4N0UA 4U49A 4OZIB 4N9GB 5FM8A 4L9DA 4YDJB 1DLHA 1XGRB 1ZWIB 2P5EA 3PWPA 4PG2A 4LQ1A 5BXFB 2CXKA 4GQ9H 1J9CT 1JHLL 3C09B 3HR5A 3SKOB 3OXSB 3EOAA 1TZGH 2RCSH 4H1LA 4KKAD 1P4BL 4JVWA 2CIKA 4Y2DD 3WNPA 5EOTA 3HUJB 5KSBF 4UQ3A 3IDNB 1CGWA 1F6FB 2APXA 5IW1B 3VXRB 3ZKMC 3RGVA 1JL8A 1F11A 2NCMA 4HS8H 5LGJB 4EIGB 1REIA 5EU7C 1R3LB 1NCAL 1WBZA 1MFAH 3PGDB 4QRTA 5CWSB 2Z93B 1CXLA 2VE6B 4KK6C 1MI5D 1XF1A 5I8EB 3OB0K 3AY4C 1ORQB 4TNWF 1AFVH 2BSTA 5H37H 4XWGH 4LBEA 3H0TA 4I4WA 5F7MC 2BNQE 3GIZH 4PTTB 2D9CA 4NO5B 2G5BA 4N0UE 5ANMB 4LK4A 4Q9QL 1ETZB 1PW3A 4JFXA 1R3KB 2VXTL 3W11C 1G84A 1LEIB 3TT3H 3GO1L 1GAFH 4MNHB 4XPBH 3BHBB 3O3AA 5JHLL 4PRAB 3MLVL 3WEXB 1RJZB 1BX2A 5F9WB 2G9HA 1P53A 4LSVH 1S7TB 1HXMB 2DD8L 5DK3A 5CSGA 2YPVL 1DUYA 4S1RL 4JO4L 3BP5A 2W65B 4WHYG 3T1FB 5KVGL 1CU4H 3BX7C 1X6LA 1C5BL 3RZWA 1DQJA 4WI5A 4OFPA 3EOYG 4H5SB 4RNRB 1BWWA 5F9WC 5F3HA 3QG6A 1FZMB 3E8UL 3UC0H 4NBZB 2PTUA 5EU6B 4HJJH 1AGFA 5F6HJ 4P5MB 1KN4H 3GIVA 2FJHA 2YD6A 3DX7A 3MBEC 1DN0A 1TLKA 1I7ZB 5FYLH 3BE1L 3R06A 1UKTA 4ZO6A 1C5DA 3O3BB 4HUNB 1BIIB 4ZS6C 2CR6A 2EYTB 1YC8A 4NKQB 3FJTA 1SMAA 1JV5A 3H3BC 3F7QA 1JZ8A 2RB8A 3C5SA 4XT1C 4HT1L 1D5ZA 1LNUB 1EX0A 1MIEL 1RZIA 2Z4QB 3ARDD 5BQ7A 4YDVA 5JNYB 3ZT5A 3BXNA 3K8MA 3E6FB 3JUYA 1KJ2H 3L3OB 4YFEA 4PRHA 4YJZL 2V2WA 1RVFH 1TDQA 5CLWA 1MAML 1SYVA 5IFJB 3FRUB 3SE8H 3KNBB 4LLWA 1NGYA 1YMHB 4DOHB 1T5XB 3GJEA 1YDPB 5D7LB 5A2LH 1JN6A 2CPCA 1Z5LB 5DI8A 5GISH 2DQIH 3QDJE 2UY7A 1TQBB 2HLFC 2CUMA 1FL5B 4O02H 2BY2A 5GIRA 4HKBB 4ZFFB 3V52H 5EBMA 5DJAA 3SOBH 3OKDB 4LPVA 2Q1EA 2Z31B 1GGYA 1U93A 2BNQD 3TESA 3QCVH 1VB9A 5FKAA 3D9AH 1V7NH 4U2YA 1JGDB 2FO1A 4I77H 4J3WA 4KI5E 3RWGA 4KDTA 4URTB 2Z31C 5IVZB 3TBYA 3TH4T 4TSCH 4YIQB 4Y2DB 2DLIA 4YDKL 3OHXA 1G7JA 2DLHA 4K71B 2AEPH 4LASL 4PJ8D 1FAIH 4D8PA 4TNVK 1FGVH 4QHMA 5D5ME 5MEPB 5TF1H 5DRNA 5MI0B 3O2DA 2IADA 4M9OA 1QLRB 2XQBL 4CMMB 3UTQA 1UM4L 4KKAC 5EN2A 5BV7H 3ZSSA 3CFJA 3TBTA 4Y2DC 4HZLA 2E9JA 3S3PA 3FO0L 4K71C 4YX2H 3MRGA 1OPGL 1FFNA 1CLOH 4EDWH 2BHUA 2B7DT 2X4UA 5BS0A 4LLDA 1WIUA 5JXEA 5MI0C 1MI5B 2EDKA 1VACB 4BSWA 1OTTD 1MLCA 1JPFB 1I7RA 5DHYA 4DFIA 1VFMA 1I3RB 1WLHA 2MWCA 3VFSB 1P5VA 3G04B 2OZ4A 3SDCA 5E8PA 2D7QA 5EZJB 1YPZF 3I02A 4NM4H 5BW7C 3SE3C 2IAMD 4JGUA 5I76A 1IBGH 5F1KC 3QUYB 2D4DA 5CCKH 3KLAA 4TSBH 4BSVB 1HWGB 5IQ9B 3CMOL 3BW9A 3PXJA 4WENB 3VXPA 4LCIH 3WE6B 3ARTA 1QO3A 1FNEB 5SWQA 4IMKA 4YNYA 2AQ2A 1PG7W 3OBAA 3HR6A 4ETQB 1MUJA 1NDGA 1NC4A 4NM8H 3ET9F 4HGWA 3QDJD 4X7EC 4PRBB 4AY0A 3QIUA 3HI5L 3O4LE 3MNZB 1A7NL 2V5MA 4PLJC 4PJAB 2IQ9H 2A1WH 3VFRA 3ULVH 2QSVA 1KCRL 3NH7L 5IB3B 1HHKB 1U41A 4V2CB 1NJ9A 4Y19D 1CS6A 4MWFB 3LKPA 2PW2B 3KWWB 3LRSA 5CILH 1WC7B 3RWFB 1XGUA 1DQDL 4OM1L 1JF1A 3MJGX 2VTFA 2UYLB 1SBSL 4XCYB 1A6UL 1U91B 1OD7A 5I17A 1RIHH 4FP8H 1AXIB 4HFUH 1I1RA 4DKEH 4KI5D 3AXLA 4Q6IB 5FGSA 3WFEH 1MCDA 2AI0H 2VIRB 4NN6B 2VDNH 4K7FB 3ZDZF 1N59A 1I1FA 1JWMB 1MRCH 4JN2A 5CBAB 4Z78A 2OI9B 4OKVB 4PJIF 2VXUH 3B9EA 1JZ6A 1T1ZB 5SV4A 2R15A 3EAKA 3RHWK 4AQ1B 4JFEE 3SDDA 4XGZA 1RFDL 2HH0L 4Q6IC 3ARDC 4OF0A 2NY7H 4N1HB 2OI9C 1QBMH 4JQIH 3RFZC 2DIBA 3LQZB 2B39A 1OAYH 3AAZA 3LS5L 1DQLL 4XP1L 3EGSA 1FBIL 2JK5B 2Y7QB 2UUDH 3P0VH 2CLVB 5JA9A 4QT5A 2HG5B 4Q2ZA 4HDIA 4LRIC 2BNQB 4QYOA 3QWOB 3VA6A 1EVTC 1MCSA 1GC1L 4N0UB 5HYFA 1HQ4A 5I75B 3HC3L 1YY8A 3ARPA 3WL9B 2Q76B 1MFDL 1MCIA 1KG0A 1EGJH 2PYEE 3ARXA 3MFGB 3LKRA 3NCJL 3ZKQD 3FT3B 5IKCA 4ZTOH 5KSVA 1KT2B 3UJTL 4G6KH 5C0EB 3BGFB 3F7YB 2VERN 1EFXD 4PJ8B 3RY5A 1A2YA 5FUZH 2R8SH 3EHBC 4XNXH 2JB5L 3QAZC 5EZOL 2OP4H 2E7BA 4EDXB 3NZHL 5E08L 3O4LD 5DDHB 5F3BB 5I1GL 4UV4L 3BGFC 4JKMA 5TPWL 3VRIA 4BQBA 2JLLA 4PJ8C 5F6HI 1BBJA 4QRPD 3C5JB 1KPVB 5DC4B 3UAJD 3X3GH 6FABH 1K2DB 3FB5B 2Y5TA 3IFNL 3V5DA 2ICEB 2WBWB 3B3IA 4KDVA 2VC2H 4F9PC 4QHUB 5GS0H 4LBEB 2IAMB 3H0TB 4JCMA 4I4WB 3O8XA 3MLSH 1XCQB 1T1XA 4TUJA 3S9DB 1OTTC 5C0BA 3UXFA 1KC5H 2GTWB 3GSNH 5DEGA 4PB9L 1GGUA 2AVGA 3U7YL 1AD0A 4Z7QF 5DTFA 2EC8A 5I1LA 3IETB 1FZOB 3U2SB 3MRCA 5TGBB 3EYUH 2ZSWA 1ZEAL 3QNYB 2IAMC 3RNQB 5T1LA 1EMTL 3L5WB 5KVDH 4U6HB 3K2UL 4JPWL 4IHOA 3MRDA 1H3UA 2FBJL 4JFED 4M6OH 5EC2A 3LN5B 4J23A 1QBLH 3TIEA 3QDJB 1DUYB 3SKNA 3BP5B 5IFAL 2I24N 2NY2B 4LHJB 3QIUD 5T1KD 1CFSB 3FB7B 4ACPA 1UG9A 4JDZA 1KOAA 4RGMB 2R0KH 1QKZL 3SHSA 2BFVH 4KZDL 2HT3D 2OK0H 4RFEB 4KKBC 4R26L 1MAKA 4XB7A 2J8UF 4GKZA 1UH3A 1ZAGA 4UMGA 4P4KD 3BIKB 1FP5A 1S3KH 4JHWH 1UCTA 3GRWH 1FVCB 1DN0B 1JI2A 1T0NA 1FIGH 1VADB 4RGMC 5H94B 1CFTA 2PYED 4MNGE 4LLMB 1C5DB 1F13A 4QOKA 4KH2A 5IBLD 2GUOA 4OF3A 2YWYA 3TFKD 4NDMA 4R9HA 4LU5L 3HPJB 4LHUD 3OMZA 5D5MB 2IH1A 2VL4A 2FYYB 3OGOE 5E94B 4LLWB 2FB4L 1A1NB 1YEJL 2MHAA 3S5LG 4UQ2A