2MHAA

Crystal structure of the major histocompatibility complex class i h-2kb molecule containing a single viral peptide: implications for peptide binding and t-cell receptor recognition
Total Genus 55
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
55
sequence length
270
structure length
270
Chain Sequence
b'GPHSLRYFVTAVSRPGLGEPRYMEVGYVDDTEFVRFDSDAENPRYEPRARWMEQEGPEYWERETQKAKGNEQSFRVDLRTLLGYYNQSKGGSHTIQVISGCEVGSDGRLLRGYQQYAYDGCDYIALNEDLKTWTAADMAALITKHKWEQAGEAERLRAYLEGTCVEWLRRYLKNGNATLLRTDSPKAHVTHHSRPEDKVTLRCWALGFYPADITLTWQLNGEELIQDMELVETRPAGDGTFQKWASVVVPLGKEQYYTCHVYHQGLPEPL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CLASS I HISTOCOMPATIBILITY ANTIGEN (H-2KB) (ALPHA CHAIN)
publication title Crystal structure of the major histocompatibility complex class I H-2Kb molecule containing a single viral peptide: implications for peptide binding and T-cell receptor recognition.
pubmed doi rcsb
source organism Mus musculus
molecule tags Histocompatibility antigen
total genus 55
structure length 270
sequence length 270
chains with identical sequence C
ec nomenclature
pdb deposition date 1993-07-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00129 MHC_I Class I Histocompatibility antigen, domains alpha 1 and 2
A PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2mhaA02
3.30.500.10 Alpha Beta 2-Layer Sandwich Murine Class I Major Histocompatibility Complex, H2-DB; Chain A, domain 1 MHC class I-like antigen recognition-like 2mhaA01
4PG2A 1TJHL 1A5FL 4YDIL 3EDKA 3HMXH 1HNGA 2VZ3A 1Q9WA 4LDEB 5DJ2A 3FOLB 1F11A 3BIAX 2X9XA 4PRPB 3MA9L 3GIVA 2R0LL 3O3EA 1NLDL 5DA0B 1OLZA 3MLWL 1NCBL 2X4TA 5K93A 2F53B 2X4UB 3ME0A 2ITDA 2NXZD 5IB3A 4JY5L 3GMQB 4QTIL 3H9HB 1GH7A 5DURD 4KJWD 2XACC 4AJ0A 2D9CA 2EYTB 1LP9B 4O2EA 3CK0H 4PJEB 4MS8C 2G75B 5IHUL 3D3VB 1QKZH 1HILB 2OJZL 3IGAA 4R2GD 3MV9D 4U3HA 5INDA 5BS0A 3KLAB 4X7FC 4U1KA 1IQDA 5TGBA 1IZKA 4Y4FA 3TFKA 4ZO6A 3IU4H 4X4XB 2PNDA 2C3VB 2W0FB 1YDPB 5GJTL 4M5ZH 4J2XA 3WJLC 3G04A 4X5WB 3DXAE 1NBZA 4OLVL 3RVVC 2IBBA 4OCRH 2DQTH 4MXQD 1ZSDB 1BVLA 3L3DA 4KAQH 3G6DL 4X4ME 3DMMC 1WBXB 2VDRL 2DM4A 3WXVL 2HJLB 1IFHH 2ADIA 2UVFA 3HRZB 3SDCB 3T65A 3WFHB 1WC7B 1JNNL 4LCIH 4U1HA 3VGAC 3B6SA 2CGRL 1KBGH 4TNWK 5A43C 1CD1B 1OP3K 4XAKD 1GAFH 4KKCD 4MNQE 1P4BL 2CIIA 3QIWA 5CLTA 4YFLF 1BFTA 5ID1B 2Q20A 3VJ6B 1SJHB 2AV1B 4P2OA 2X4RA 5CINH 3JVGC 4KTEL 4AIZA 1J1OL 1WIPA 3CU7A 1CF8L 5SX5H 5IKCB 2NX5B 5D1XB 5DK2A 5FYJD 3RGVA 1MFDH 1T21A 3PWNA 5FUZH 3TT3H 1MRDH 2QHRL 3P0YH 5FHAL 3ARSA 5FYKU 3QDMD 4IIQA 5J57B 4OGXH 4YHPA 4ZOBA 3MMEB 4PYGA 5L6YL 1RZIA 4P4RB 3MRLB 4HS6A 1QLRB 4BYHA 3WEXA 2F9BT 3OGCB 3PWPD 3LKQB 2VYRE 1MAKA 4TULL 3W9DB 5E99L 3GSRB 5AAMA 2MNUA 1EXUB 3VFRB 2IADA 2PO6A 1EMTL 1K9TA 5T3XD 3GSNA 3KYOB 4H0HB 4XVJL 5C0EB 5GS1B 4IRJA 4I48A 1D5ZB 2Z31A 3FFDB 3KYKL 1XFPA 4UQ2B 4JKWA 1VGKB 3KPRD 4YHKH 5C6TL 3L3GA 3UTQA 2GFBB 5ACMA 1JZ4A 1FVCB 1IAOA 4UV7L 5D7LA 5BXFA 2QR0A 4KVNL 2EIBA 3MGOB 4FZ8H 5ESAB 4NOBA 1QEWB 1G7IB 3DO3A 5FUCC 3D85A 5I66A 2VXSH 1KJVB 3VXNB 3MRKA 3H8NA 3IDIA 4WU7B 1OGAE 4KTDL 5I2IB 4G9DB 4KXZI 4PP1D 3RRQA 5IMKA 2VDQL 3U7YH 2VE6A 3KPTA 3MV8A 4S2SA 1ZHKA 4I2XE 1DL7H 4DK6A 3LRSA 2RFXA 3G08B 2NY3D 4D9LH 2ADFL 3C5ZC 3QB7C 4XVSH 5SWSD 4HIJB 4NHCL 4P57B 4WFEE 2F54B 1K2DA 3QNYA 5F1SA 4JR9H 4QXTA 3EFDL 1J05B 1U3HC 1OARH 3MPCA 1U2CA 4OZHE 4G42B 3SGDI 3WKML 2WMPA 5D1QC 2VXQH 5IQ7L 3W5MA 2VLRD 1PKOA 1U8KB 2BFVH 4JAMA 2CLZB 2BY0A 4F57L 4P23C 3VI4E 3CXDL 3X3FH 1T89C 3LQMA 3H9SD 3MROA 2E27H 3QEQE 4NCC1 1OAQL 3GHEH 3SKMB 3VXMA 3IT8D 4JFYA 2QQKL 3BPCB 4IOIB 4TOYH 4MWFA 2DKSA 2P8PA 1LDPH 1DVFA 1OTSC 4AQ1B 4HK3J 5IR1A 3BIKA 1H5BB 3UCRA 1QSEE 4X0KB 4TPRL 5IF0B 3TBWB 3DX7A 3QUMA 1CQYA 2DQFB 3MLSL 3PWVA 4X7CC 5IHLB 2E9WA 2V7NA 4KKBD 3WUZA 5C0CE 1KCSH 4OLUL 3GMNA 4KRPD 1O7VA 4YXKH 4YWGH 1JF1B 4HUWA 4L29B 4FQCH 3ZDZE 2PW1A 4LASL 4PTTB 3QULB 3ARPA 2FB4H 3ARFB 4Z7WF 3D48R 3HE6D 2O5YH 2UWEB 2PTVA 3AAZA 4NJ9L 3V6OC 3E3QA 4GLRH 2BNRA 4JQIL 4D9QE 4OFYA 3BOVA 1P4IL 4MNQD 1FGNL 1N0XH 3SE8H 4P46C 1U6AL 2NY2C 3CX5J 3ZTJG 4RX4A 2R2HA 2WW8A 1U8LB 2HT3D 1G9EA 4YR6B 4PJFE 2J7LA 3BPNC 2W0LA 1AGDB 1FFQA 1HNFA 4MAYA 2NZIA 3NIFF 2H3NB 3O2VL 5DD5H 4HXAL 3MRHB 1L7TH 4BQCA 1JYVA 4JO1L 4PR5B 4OLYH 4NNXA 3WJJC 3L3JB 5KSBF 2VKWA 3FZUD 4Q0XL 2JKXA 5E2TH 4F7TB 1CWVA 3KHOA 3K4DA 3HC0B 3LPFA 1MFEL 4M7LH 4OKDA 1OAXL 4GUPA 4IOFC 1A6VL 1RUQL 5ID0B 3HAEA 3KPSA 1QACA 5HYJA 1OF2A 1UM5H 1X6NA 2H32B 4Y16B 1UH3A 5IGXH 3FB5B 4IOSD 5IIEA 1JN6A 1P4LB 3VFTA 5F7UA 5DJDB 3IS0X 3D0LA 4L3EA 3OHXB 2HTLD 3DV6A 1KLUA 1FO0H 4PRHA 5D70H 2OTUB 3PUCA 5L88H 3CFEB 1DLHA 1E4XL 4HS8L 5I19H 5DD1H 3S37L 5H37G 4ODTL 1H3WM 4AH2A 3AU1A 3B9KD 3FFCE 4OCXH 3GEWB 4X5LA 4G9FE 4FA8A 5IM7A 1XGYL 5BZWB 1Q9OA 4CRPA 2VLKA 3HMXA 3UJIL 4DQOL 4EOWL 4IJ3C 5E03A 4KUZH 2HWZL 4YHIB 2CQVA 4HH9A 1FL3A 1VSCA 1QBML 1EUTA 3QPQD 4DUVA 3SKJH 4YBLB 3IDJB 1OGAD 4JG0H 1UWGL 4CVUA 4OF6A 3WJLA 1HINL 2AK1H 3OKNA 5EA0H 4WNQA 1AGFA 2F15A 5A3IC 4FFVC 5F96H 2F8OA 1OCWH 1WWCA 3IETB 1BD2A 4LVEA 4N0YL 1K85A 3MRGA 3JTCA 5DJZB 2Z4QB 4WFED 3DMMA 1CR9L 1AGCA 1LWRA 1YYML 4XNQA 4ZDHB 3UEZA 4WRLA 2BRRL 4GXUN 1F4HA 4QKXB 4PJCA 4X9HA 1XF3A 3DTXA 4XCCL 5JZ7C 2IH3A 3H0TB 2E7LC 4A2MA 3GSNL 4OM1H 3G6JA 4YGVA 1LO4H 1OAYH 2ZKHL 3D87B 3SQOL 1Y18B 3UTSE 3JVGA 2NY7H 4ZUVB 1ADQA 4GG8B 5D5MA 1FRGL 1A7PL 4XBGB 5LXGL 3GUTA 3VXUE 1SYVB 5IB4A 4CJ1A 2W0PA 2VC2L 4K94C 4CADA 4RFEA 4RISL 3VXPA 5IOPA 3HZVB 4NZDA 5KS9E 5D1ZD 3QWOA 4M93B 1YEIL 4ZAKA 4KZDH 3O6LL 1OQXA 3EO9L 1QSED 4LMQI 5DEZA 4LSVH 1AC6A 4NZTH 4HV8B 1X5LA 4OGYH 1CK0L 4K3DL 3TIEB 3I85A 2YPVL 1HYRC 3ZZ1A 1MJJA 3D2UD 1GRWA 1E27A 1KCUH 3V52L 3VFMB 4OLXL 3C6LB 2CLVA 5CBEB 1AXIB 3H3BC 4Z7UE 1A1MA 4ZG1A 1MRCH 3JUYA 5J3HC 4X99B 2YUVA 4TSCL 3QDJB 4P0DA 1JPFB 1J5OL 5B38G 3NCBB 5IMMB 4HJ0C 3MLZL 4NP4H 5GHWL 4HUVB 1RUAH 5BRZE 1CU4H 4M48L 2NW3A 1IQWH 1S9WA 1A0QL 4QTHA 5IW1B 5D8JH 3WFDL 4XMKL 1ODAA 4N0UA 3U79A 2XQBL 2BVOA 5TDPB 2XY1A 3DGCR 4OD2B 1JWMB 1G9NC 2CKBA 4KU1A 2XRAL 2FH6A 3LB6D 3SKUD 5C2BH 3VRLF 4C54A 4AYFA 2X70B 3MZTA 2GSGB 2XNAB 2F53A 1ORSB 1JVKA 1MCKA 3PWUB 5E8PA 1KN4L 1X5GA 5KVDL 5I1JH 1U93B 1RIHL 3VFSA 2YD8A 3C5ZA 2HRPL 4F7CB 2LE9A 4QCIB 3UXFA 4PJEA 3RA7L 5KW9H 1JRHL 5CBAB 1EFXD 1U3HA 2IQ9H 4JFDB 3WNNA 3QUML 5D1QA 3PQYE 3KLAA 2V5RA 5J1AA 2AK4B 1E4JA 4R7DB 4U6VH 2EZ0C 2ZUSA 5AAWA 4X6DA 3MRCA 3EO0B 3ZHLA 2VABA 4P23A 1ZHBB 2E7HA 4ZS7H 3RWGB 1T89A 2W0FA 4G8GD 1L6ZA 4QOKE 2QQQA 5E6ID 1JP5A 4X5WA 4AEEA 3FTGB 3CC5A 2C7UA 4R96B 5IBUB 1CICC 4L8BB 1T0MA 1BBDL 4G9FD 4ELMB 5F21B 1K6QL 4LLDB 1ZSDA 2OTWB 3RWHA 4WO4D 1UYWL 1WBXA 4JPVH 4M1GL 3OKMA 4HIIA 4J3SA 3EYVA 1RHFA 4Y2DB 3QQ9C 3WFHA 4LSTL 4DVBA 3TJHD 3BN9C 3SE3C 3ORJA 4TVPH 1QHOA 4UT9H 1DZBA 1PAMA 4UDUB 3ZE1E 1L9NA 1AO7D 3MJ9H 5T3ZE 3I6GB 1WFTA 1FNGA 5L7XH 4D0BB 3JV4A 5ID1A 1SJHA 1A6WL 4J3UA 4Q9BA 3UC0H 3C8DA 4PJIE 3CMOH 4NQXA 3ZKND 5C86A 3PL6D 4LHUA 4M6ML 5MEOB 5IKCA 4NRYA 4BK4A 4CU7A 3MRJB 5KG9B 3ARGB 3IFPA 1C7SA 3V6OA 4HS3A 1ORQB 2DI7A 3HLAB 1MJ8H 1R3LB 1JPST 2HN7A 2X4OA 4GW1B 4NCDA 3MRLA 1QLRA 1A14H 1PQZA 4TNVF 2BHYA 4PYHA 4WFHD 5DGQA 2AVGA 3LKQA 2YPLD 4YE4H 4KI5F 5EORL 5HI5D 3W9DA 3TH3T 1X5FA 3O6FC 4MB5A 1CIUA 3ARBD 4PLKC 1LD9A 3QISA 1KEGL 1B3JA 5LCVL 1H3TA 2VDML 4IRZL 1C8PA 4LKXA 3MOAL 3KYOA 5C0EA 2CRZA 5GS1A 3EDDA 3DROB 4NJAH 3LEVH 5HDQL 1KPUA 1LK2B 3UYRH 2YUXA 2IAND 3FT3B 5I1DA 1RHHA 4OZFB 3HMXL 4DK3A 3ARWA 4UQ2A 4KJYA 1X9QA 4HXBH 3QAZC 1VGEL 5ELIA 1INEH 3R8QA 4FRWA 3S3SA 1QBBA 3LN5B 1FVCA 1DLFH 1U8MB 1A2YB 2ZOKA 3K2UH 4JGUA 1NKRA 4UV4H 2VR9A 4LRNH 1I9IH 4HBQA 1DBJH 2IPUK 4GG6A 2UZIH 1QEWA 1WTLA 4LGPB 1G7IA 5C0GA 3CK0L 2P42B 3QXVA 1T1XA 4ZSOB 1QKZL 5DMKA 1B88A 2AI0H 1QO3A 3IRPX 2QADC 1ACZA 1RJYB 5MEPB 1CCZA 4HULB 1J11A 4L5FH 5BRZD 3IU4L 5DMIH 3RL2A 4U2YA 1D5MB 1CYGA 5E8EB 4B7IA 3RDTC 4M5ZL 8FABB 3CPLA 2R29H 4PY8J 2BP3A 3ES6B 4LKCB 4ODSH 3VXRB 3AS3A 3RVUC 5EFIB 3O45B 1MHHB 4PJ8B 1UJ3C 3JSSA 4OCRL 2DQTL 4E42A 1FO0A 1FLTX 1N6QH 1HHHA 5JOFB 1MCFA 1IFHL 2P46B 3DVFA 3U2SA 1Q0XH 1L0YA 4I18C 2DIAA 4LCIL 1KTDB 3SDXF 1I85C 2CRYA 1KBGL 3OJDB 1PG7X 1FNHA 3L5IA 4L9DA 1FL6B 5GSVB 3U7WH 3SKMA 1GAFL 1HXMA 2BNQA 5DJYB 4Z95H 3MLPA 1DBKH 3O8XD 3MLTB 3MXWH 3CJJA 4JFPA 3WS3A 1ZGLA 3U9UB 2EO9A 3PQYD 5AG9A 2OJEB 2WQRA 5A2KH 4PJDE 5CINL 2BJMH 3FQTB 5SWQB 4PJ5E 3SDYH 3SJVB 2PYED 3SGKC 2E7LA 1MFDL 5IF0A 3DHJA 5FUZL 3TT3L 1MRDL 3DARA 1MJUH 2A0LD 2DQFA 3P0YL 4QOKD 1U91B 3KJ4B 1AH1A 4L4VB 2X05A 3QIUC 4K71B 4OGXL 4NT6B 2NY6B 4P2QB 4X98A 1FZMB 2HG5B 4HGWA 1FLRH 1IGJA 4L29A 2NXYB 4PTTA 5HHMB 1I1AB 5LBSH 3TA3C 2PETA 5I73C 3ARFA 5DUPH 5K59F 2UWEA 5FM5M 4UOW0 1HHIB 4V3EB 3IXTA 2FJFA 1CVSC 4FXLA 1CFNB 3BXNA 4X7SH 1CT8B 1UWXK 3FCTA 4XRCA 3FL7A 3WN5B 4Y4KB 1BVKB 3UTPD 3N1GC 4GBXD 4YHKL 3H7BB 4FQPA 5BQ7A 1B4RA 3EYQC 5F9JB 2PCPB 1U8LA 3S3PA 5J9PB 2B8OT 4Y4FD 4FZ8L 2KBGA 3X17A 3MRHA 2K3TA 4PRDB 1YN6B 1I1RA 1OWWA 4YEFA 2VSDA 2VXSL 5FCUH 2WIMA 4YHZH 1D7FA 4F7TA 2OR9H 2XI9A 1UQSA 1HKFA 3VH8B 3U7YL 3HE7D 1A7BA 5F7EH 3GMPB 1E6OH 5FO7A 1DL7L 2KZWA 2EEBA 4XC1H 1JYWA 4D9LL 1JGDB 2NNAB 4XVSL 1QPXA 4HDIB 1A64A 4JR9L 2Y5TB 5CGYC 1OARL 2ED8A 1XF2A 4BQ9A 2AXFB 2X4QB 3BGFC 2VXQL 1EAJA 1Z2KA 2H2SD 1PEZA 2BFVL 1RULH 3NFNB 2VAJA 4F3FB 2FJHB 5BOPA 4GAYA 2OX5A 3X3FL 5C07A 2DBLH 1NGZB 2E27L 3TNMA 4APQC 3V6FB 4N90E 3H7LA 2CRIA 2NY1D 3GHEL 3ULUF 3CSYA 1C5CH 4N0CC 5CZXC 3EYFA 4YHIA 5I16B 4IRSC 3TPUB 3ERYA 3T2OA 1YC8A 4TOYL 1L0QA 4D0DB 4MNGA 1A3LH 3TIDB 1GGBH 4R97C 1LDPL 3V7AE 1C12B 3VE0B 1Z9MA 4I3GA 5FO8A 1BGXH 3MBXL 1CICA 2VR5A 5DTFA 3S4SB 4HGKC 2Z4QA 4M5YH 2GHWB 1V8HA 1UJTA 1HDMB 3QUXC 1YMME 2PO6D 2P8MB 2EEDA 3CFDB 2Z31D 1KCSL 1ZT4B 2ADGB 3SE3A 4YXKL 1AJ7H 3EGSB 4YWGL 1A7QH 1SQ2N 4FQCL 1WZLA 3HC3H 1EEZA 4JRXE 2FB4L 3V9FA 4PG9B 4MGXA 3H0TA 4RQQA 1FFOB 2E7BA 2O5YL 1MCQA 1RI8A 2EDOA 5F6IB 3PIQA 3HR6A 3DOSA 3MRRB 3BYTA 4NQCD 3KLHD 5TE6H 5HHOB 2IAMB 3D85D 1OW0C 1N0XL 2NXYC 3SE8L 2VL5B 5SX5K 1NDGA 1SMAA 4Y19E 4JO4H 1S7QA 2Z8RA 3U46B 2M2DA 3P30H 1JFMA 1CZ8H 5K9OB 4FTVE 5D6CB 2FO1A 4PJ5D 1MREH 1UGNA 5C3TA 4OFVA 2B5IC 1WJ3A 3VD5A 1NMAH 4DZBB 4NKDB 5DD5L 1L7TL 5EBWB 4Q2ZB 1DE4B 5HDBE 3U0PA 4OLYL 2JJUA 4P4KD 3GI8H 2LABA 3NPSC 3O6FA 3VFMA 5E2TL 2I24N 4FFWC 1DQJA 1PW3A 4M7LL 3KPNA 4DN4H 1CGVA 4H5SA 1T04B 5FECB 3Q0HA 2BOCB 2K7QA 5ERWB 2IEPA 3TEUA 1R3HB 1JMZA 5F3BA 4NKOA 2IPUG 1UM5L 5E9DA 5EU3A 5IGXL 1UC6A 1MLCA 3LKPB 4H1LH 1FO0L 5D70L 2XY2A 5FGCB 3ZYJA 1HSAA 3VXMD 5L88L 1T7YA 1MAJA 5I19L 5DD1L 3MFFA 1CXIA 2H41A 3V6BR 1FCCA 1OT1A 4DVRH 4NC1E 3AM8A 1BP3B 4OCXL 1JWMA 3KNBB 1B90A 1FZOA 3DUUA 5J11B 4EI5D 3BMWA 3IDXH 1SEBA 3S3JA 4K55A 2GSGA 4KUZL 4KQ3H 3RZCC 5LVEA 3EFFB 1CXLA 2NY0C 4DWHA 2FRGP 4QHKJ 3HS0A 3SKJL 4LF3B 3UZEA 4Z7WB 3EYSH 4JG0L 3BUYB 3L9RB 3DECA 3K0WA 5HGAA 2AK1L 5EA0L 4NYLB 2XWBA 3SGEH 5F96L 1H3VA 5FK9B 1UJ3A 1OCWL 5EOCH 4CAGA 2AQ3A 2CSPA 5A16B 3WL9A 1KB5H 1QTYT 4YX2H 4HIXH 4PJHE 4I18A 5C1MB 4WDIA 2VAAB 3NCCB 3GM0A 3T3PF 2AKRA 1L0XA 1UCBH 3QDGB 4MD0A 1I85A 4XNXH 4F7PA 3TO2A 1S7TA 1QHPA 4R96A 5EULV 4RX4D 2MTPA 4ELMA 1NFIA 4LLDA 4OM1L 1RJLA 1LO4L 3O11B 4WUUE 4QO1A 3RVWC 4PRPE 1OAYL 4N90D 1J86A 3QIBC 1FG9C 3BPOC 2NY7L 4Y2DA 5J6HB 4R26H 5GGSY 5EZJB 1E4WH 3SGKA 3OZ9H 2CO6B 3MRMB 1VERA 1ZLUH 3PWJB 2EXYC 1LP9E 4D0BA 3MV11 2B0SH 5I1LB 2GTWB 3QIUA 3H42H 4KZDL 1MCBA 3RWDB 3KPLA 5IQ9B 2K1MA 5EO9A 4LSVL 4M7ZB 4NZTL 4Z0XA 4OGYL 3QG6B 2HA1A 1H15A 2JCCF 5MEOA 3TA3A 1FV1A 2A83A 1KCUL 3ARGA 4L3ED 1BJ1H 5DJAB 1NEUA 2R2EA 1C16A 1R5VB 4TUOA 4KWUA 4PRIB 3STZA 4P5MB 3UJJH 4PD4K 3HAEG 3HLAA 3IDGA 5AEAA 1MRCL 1Z9SA 3I6KB 1HI6A 3JWDC 3QI9D 4XXCA 5J13C 4AEIH 2VQUA 3ILQD 3LRGA 2NZ9C 1P7KB 15C8H 1KIRB 4NP4L 5IROC 4OZIF 4JQXC 3NA4A 1RUAL 1DQQB 1CU4L 1I3RA 1IQWL 5EU6E 5LG1A 3AY4A 4HLJA 1L6XA 2V9QA 5D8JL 3U4BH 5JQ6H 3CD4A 3G5YB 1QSZA 2CKNA 3K2MC 1LK2A 2GTZA 5D7JB 5IFHH 1I1CA 4PV9A 4FTVD 1NC2D 1OD9A 2ERJC 5EBGA 1C7TA 1NEZA 5EDXA 3WDJA 5ACLA 3RVVD 5C2BL 3E6FA 4LGSB 4NNYB 4WI5A 3GMOA 3ZDXF 1Q1JH 5ITBH 4EQ2A 1WITA 5I1JL 5KANG 5EOTA 5D9SA 1MCHA 4P5TB 1YPZF 1VFAA 5KW9L 2IQ9L 4BH7A 1DQDH 4CL7A 4Q9QH 2YBRB 9CGTA 2W91A 2ATPB 3VG9C 3IYLW 5LGHH 5M95B 3HPJA 2P45B 4U6VL 4MJIA 5I76B 2VLJA 4QY8B 3SKNA 1TJIH 4ZS7L 4LPWA 3CFKA 2DYPD 3VXTB 4APQA 5E8OB 1E28A 4L4TA 4JFEE 1UEYA 4N0CA 1MHHA 3TT1H 1X44A 5A40E 4Q9RH 3BZFA 5KZCD 4IRSA 5CJ5A 1XZ0B 3M07A 4Z77A 1LO5B 3OKOB 4ZAKD 3OQ3B 3MQIA 4JPVL 5JOFA 1T5WA 2CLRA 1MVUB 3X13B 1T2XA 5EU4A 4MVBC 4TVPL 4UT9L 4MXWH 1ZHLA 3OJDA 3GSXA 3MJ9L 5GSVA 3RU8H 3QWQB 4MHHI 5JIKA 4PTUA 5L7XL 3QUXA 3KPPB 5DJYA 2XPGA 2GCYB 1KYOK 3MLTA 3W0WB 3U9UA 3BP4B 3UC0L 2EKSB 2I9LA 2OJEA 4XX1G 3CMOL 1MCJA 4X8JB 3HG1B 5DMGC 5SWQA 3KDMA 1CD9B 3OSKA 1IL1A 1HHGB 1JI1A 1MHPH 1CFBA 2YUWA 3BGAA 1MHEB 3X12B 4OIAA 5IEKB 1ZKAA 3P4MB 3N85H 2F54E 1YMHA 2HVJB 2ZPKL 3OR7B 4L4JA 4P2QA 2DLFH 1FZMA 2HG5A 1CFTB 3RIFK 1MJ8L 1T1WA 4YFEA 1NGWA 5J6GA 4XTRD 1MFNA 1A14L 2JIXA 4PRPD 2VZUA 1RMFH 1FQ9C 4OF7A 1I7UA 4GAJH 2XA3A 3RGHA 1TPXB 2F53D 4HUKB 5C08B 1K8IA 4NJAL 3LEVL 3UYRL 3WN5A 4N9GB 4KVCH 4KK5D 3BN3B 2Q8BH 1YEGH 3D3VD 1BVKA 4JFQB 4RAUB 4YBQD 4F33A 2GAZB 4HXBL 1QA9B 4MLIA 1INEL 2OI9B 2OMBA 5FYKE 4K3GA 4PJGA 1U3JA 1S5HA 3S96B 1DLFL 4RAHA 2DB8A 1YY8A 3IJYA 2F8VA 3K2UL 4NN5C 4UV4L 4LRNL 1I9IL 1SMOA 3I6LD 1DBJL 2UZIL 3C8HA 1PX4A 1TQBC 2XA8H 5IJKC 2IBZY 1YN6A 5D93C 1RZJH 1JPTH 1XGTA 3U36B 1MQ8A 3VI4F 1CE6B 5F7DA 4J3TA 3ROLA 1KIQA 5DXWA 2AI0L 2YD2A 2NY4C 3Q6GH 3VH8A 2EH8H 2YPKB 1U8NB 4O5LH 1JK8B 1P53A 1G7QA 5F9WC 5HVWA 2ZCLH 1TCRA 4L5FL 3VWKC 3SDCD 3TCLA 4KV5F 4KK8C 2YEZB 5DMIL 5DD6B 3RPKA 4YHNB 2DAVA 2DKUA 5JDJA 4RA3A 2R29L 2WBJB 4YLQT 4ODSL 2Y5TA 5IJVB 4OQ1A 3BZEB 3RZCA 2APTA 3MBEC 1RZJC 3VGHA 4H1LA 1QFWH 4X4YA 2PTTA 2ZSWA 1A6ZA 1QBLH 2V7HB 1WWWX 1N6QL 5EZLB 3D6GA 4GKZB 1Q0XL 1SY6H 4KH2A 4MHHG 5F9DC 1NGZA 1X4XA 2CK0H 3EJZC 1JUFA 2NX5D 3MGTA 5D1XD 3FHQA 3OKYA 1MCRA 1U8HB 2FBOJ 3U7WL 3ZDZF 3QFJB 4M6OH 1UH2A 2GKIA 3TPUA 4Z95L 5HY9B 1DBKL 3MXWL 3H3KA 4ZUWB 4ENEC 1T22A 3NGBB 5D7KE 1U8JB 2P7TA 2BJML 4LHUG 3KWWB 1HKLH 2P47B 3N1PC 3OKEB 4YAQB 3SDYL 1B0RA 1AGBA 3AREB 3NTCH 2NY5H 1RJZA 3MREA 5EBLB 1MJUL 5KSAC 3ZYOA 1HYSD 2D7TH 3QIBA 4PJFF 1KB5A 5ENWA 1ZT4A 3VRIB 4IHOA 3ILPB 3B9AA 2WWMC 4KZEH 3WO3B 1AQKH 3LQZA 5LBSL 3V0VB 4H8WC 5DUPL 3RJQB 3TBYB 3T0AA 3DX9A 3VMOA 3S34H 5F71A 1MIMH 1OQOA 2NY5C 4X7SL 5DSCA 2HTKC 1FC2D 1A1NB 1ZAGA 4PDCE 1EERB 2ED7A 5C0AB 1YEDB 4O4YH 2LU4A 2DLIA 2J2ZA 2FGZA 4O2CB 5FKPB 3U46A 5CCKH 4PRAB 4MCYB 4HH8A 4OD3H 1B6UA 3CZJA 5F1NB 2VWEC 1U58A 3WHXA 1AR1D 1YEJH 3MR9A 1CVRA 2ZOLB 5EU7C 1YN7B 4PP2A 3ECBB 5EBWA 2F54D 4W4NA 3MLUH 3ARZA 3FMGH 5IROA 4UIMA 3RWEB 4X7TA 5HHXH 4JQXA 5FCUL 4QWWC 2C4FT 4YHZL 1LNUB 1ZK9A 1NKOA 2OR9L 1ZWIB 2QL1A 2YWZA 1O0VA 4Z5RB 3KXFB 4N8CH 4NQEA 5F7EL 5GRZA 1T04A 1E6OL 5F6HI 3SDXB 4XC1L 5FHBH 4QHNB 2APXA 5ERWA 4BUGA 5D4QA 5JOEA 4YHYC 1FYTE 3QJHA 4GQ9H 5D7IA 1P2CB 5EU5B 3EW3B 1PVHA 4NWTH 2Q76B 1HE7A 4KKNA 5L2KA 4TTDC 1RULL 2E6JA 5FYKD 4LFHD 3T77A 4LRIC 4KJQD 2R23A 3TBTA 3RWJB 1MCWW 5I6XC 2DBLL 3IRZA 1AGEA 1BOGA 5F9AC 5IB1A 4CU6A 1C5CL 3FQUB 5CIPH 5C8JB 4OT1H 4YPJA 4RBPH 2ITCA 1BZ9B 1V7MH 4OGZA 1TETH 1OM3H 1M1SA 3T4YA 1D5XB 4KGLA 2BOBB 1A3LL 1GGBL 1NCNA 3BKMH 4K3HA 4AIOA 1UZ6F 1T5XB 2A73B 1ZLWH 1V3MA 1BGXL 3ARFD 4LQ1A 5FK9A 4NN6B 1ES0A 5F8RC 3NFSH 3ARVA 4M5YL 3QDJE 4HLZH 1LMKA 4M4RA 2RB8A 2FBJL 4MVBA 5FOBA 5C0RL 1AJ7L 3QDGA 1A7QL 4AEHH 1G7JB 3LN9A 3HC3L 4YIQB 5I9QB 2Y7QB 1ZT7B 4GKNA 1CXKA 1JPSH 1JHTA 4LSUH 2CDGA 1UZ8B 5TE6L 2CH8A 3G9VA 3FONB 2EE9A 1T3FA 3S98A 3MRDA 4Z7UF 3C60C 3JZ7A 3BVNA 4JO4L 3EJYD 3IB4A 3L5XH 3P30L 3ZTNH 12E8H 1CZ8L 1VB9A 5HJ3B 4Y5VC 4JFDE 1MREL 2BY2A 4XGZB 5E7FA 5CKAA 1QBAA 2J6EH 5IQ9A 1NMAL 1NUDA 5DJ8B 3O9WC 4JVWA 2COQA 3UAJC 5HHPB 4Y16D 3ZKSD 1VEOA 2E8YA 4PRNB 3GI8L 5DJAA 4NQDB 1IAKA 3LMJH 2R8SH 3UBXB 4QRSB 4PRIA 2Z35B 4DN4L 4LCCB 4YPGB 1UXSB 3AB0B 4MQ7A 3HKFA 1CLCA 4X83A 2RIKA 1UXWA 3QUZC 1P7KA 4ZMAT 3FO1B 4YBHA 1KIRA 1GIGH 1QQDB 1QSFA 1FNSH 1AD0A 1VFMA 4U1JB 4RRPA 4PJBE 2YA1A 4CMMA 5DZNA 4LEOB 4DVRL 1RZ8B 5B8CB 4GMTH 5IJKA 3D5OF 1NMBH 3RFZC 3DIFB 2P5WB 4QRRA 3C6SA 1FFNB 4XCNA 3IDXL 5KSVB 1IC7H 1XT5A 3BWUC 4JY4B 4KQ3L 3M1BA 4WEBH 5J89A 1FN4B 1H3PH 2AJYH 1DTUA 4XHJD 5GGVY 2F5AH 4YHMH 1XIWB 3EYSL 1PGRB 2VQ1A 3WNKA 4YZFE 5JW5A 3E6HB 1YJDH 1NAMA 5E4EC 3Q3GB 1Z0MA 3MBEA 2YBRA 3VD3A 1VDGA 5EOCL 2D4DA 3PWLB 4LARH 3HI6L 4XMPH 1KB5L 1XGRB 2FHCA 1G9MC 3RX8A 4YX2L 2E3VA 2GITB 5GGSB 4HIXL 4RDQG 2W1NA 4L9LB 3W5NA 2W60A 3W39A 4J3XA 4O51B 3VXTA 1EO8H 1UCBL 2N1KA 1TZGH 1RV6X 4XNXL 3ULVC 1QR1B 4FMFA 5B3JE 4TVPD 3N9GH 4PJ7E 1UCTA 3IAQA 1OAUH 4JANB 1XZ0A 1YJDC 2YS4A 4QXWA 3OKOA 5BV7B 3NACH 4OI8A 1IM3B 3FRUB 2RJMA 3MXVH 4YQXH 5EPMA 5JORB 5K9QG 1A7NH 2MPAH 4JZJB 4N5ED 4PGCA 2VR4A 4LSPH 3X13A 1FHGA 1KENH 1GZQA 1XCQB 4PGDA 4R26L 4LVNB 2R9HD 1X5JA 2CXGA 3KYMA 1SY6A 1E4WL 3OZ9L 4X9BA 5IUSA 4ZNEA 3UX9B 3C6LD 5KSAA 2DIBA 2B0SL 4ZSOE 5HSFA 1N2RB 3JWDL 1I7TB 4JM2F 3TO4B 3H42L 3TCXA 1MH5B 3IDMB 2OP4H 4XPTH 1F3DH 2EKSA 4NZUH 3IDNB 4X8JA 3HG1A 4JEGB 3QDJD 4K7FB 5I74B 4LOUC 4X4ZA 5BS0E 3FQWB 2LFGA 2MMXA 4MJ6B 4S10A 5L2JB 5IEKA 4FQXC 5A2IH 3VXSA 4F58H 2DIJA 3FQRB 2L4OA 3HI1A 3OR7A 3VFNA 4WV1B 3UJJL 1CFTA 4KROB 3O2DH 4POUB 3L95B 4RNRA 4ZFZA 4DEPC 2R69H 4AEIL 2X41A 3ZDYE 1U8PB 2D31B 4FP8H 15C8L 3OXRA 5FKAA 2WY3A 1EEYB 4BQBA 1IGCH 3BEVA 1MCPH 2KH2B 5ANMB 5JQ6L 3QCVH 3U4BL 1YUHB 1G7PA 2Z91A 1KXVC 1MY5A 1PZUB 5C0BB 5IFHL 4R4BA 2XTJC 2Z9TA 4G3YH 4JFDD 4Y1AB 4ZNCD 5IVZB 3D39B 1WAAF 2X1WL 3A6OA 1EAPB 2YC1A 5DQJB 2AK4D 5HGDA 3NAAH 1Q1JL 5ITBL 3U0TA 3GGWB 1RZGB 2KL6A 3SJVE 2WWKO 3RKDC 1H3UA 3HA0A 1LEIB 3BD5A 3QJFB 1CE6A 1EFQA 3GJFH 4OFPA 3ARDC 2AJUH 1DQDL 4LDOB 4W6XB 2IMMA 3MA7A 4NN7B 4Q9QL 3HCVB 3FN3A 3QH3B 2P5EB 2QTEA 5LGHL 5HHME 4C4KT 4LRIA 5BVJA 1TJIL 1GGYA 4Y2DD 3UTZB 1F4YH 1FJ1B 4FFYH 4ZUUB 5IV2B 4HEPG 3ET9F 5GISH 2NXZC 5FUOH 4XHQA 4M3JA 1BZQK 1LGVA 2BSSA 1BQSA 4KJWC 1Z6JT 5IBUG 2XKUA 4CVZA 1FDLH 3R1GH 3TT1L 1UWEH 1MJ7H 4Q9RL 3D0VB 1T03H 2I9TA 1JV5A 2JCCB 3F7VB 4R2GC 5T1KB 1WBZB 2EC9T 2Q6WB 5EZLA 4GKZA 4F9LC 1NC4B 1DSFH 2WV3A 4C57C 3U6RA 4MXWL 5FFLA 5D7LE 3ARGD 1A4KB 4ETQB 1WT5C 2BY1A 4MB3A 3RU8L 3QFJA 4MSWB 1U8IB 2W59A 2A38A 3CSBA 4YDJB 5CIPA 3QXAA 4OZIB 1X5KA 3B9VA 4JZJC 1EK3A 4MXQC 5DZOA 3BPLB 1BFVH 2FX9L 1MHPL 1TQCB 5DJXA 5FYJH 3W82A 4OI9A 4BUHA 4U2ZA 5GRVK 3N85L 4P5KB 2EKJA 2EDRA 2V5YA 5DA4A 2WBWB 2RR3A 4PY7A 2DLFL 3GMMA 2H9GB 4KKCC 3VRIA 4GKSB 3ILPA 4ZUTB 4D0CA 5IK3A 3BJLA 2X89D 3C60A 3P0GB 3DXAB 3G5XB 5MI0B 3QBTB 1N8ZB 2F74B 1RMFL 5FV1L 4GAJL 1GGUA 3TBYA 3HZMB 1YPZB 1V3KA 1F6AB 2YRPA 3BP7B 3OWEA 3O9WA 5T3XH 3ULVF 4Z8FH 1L8JA 4I9WD 4KVCL 2Q8BL 1YEGL 4KDTC 1NEZG 2ID5A 2IFGA 4FQ2H 5ALCH 4O2CA 3OAUH 3REWA 4AENB 2BSRA 1FYHB 3CZFB 5EUOA 3V79C 1WZKA 4MLSA 4LNRB 2ZOLA 4U3XA 1CD8A 3ZT5A 3ECBA 4O9HH 1CLZH 1KTRL 2J6EA 2XA8L 4E5XA 4BFBD 3QUZA 2W92A 3VXRD 3RWEA 1RZJL 1JPTL 1XMWA 4L4TD 2EDWA 2X09A 1JZ8A 5C09A 5CZXD 2VTFA 4PJ8D 1VADB 4UQ3B 3TZVB 1OSZB 1HN1A 3AUVA 2EH8L 2QQNH 4O5LL 2XQYK 1KTLA 2ZCLL 3S35H 4QHNA 3CDFA 5IVXF 4H20H 5SWZA 2GJ6A 4ONHA 1P2CA 1ZA6B 5DVMA 5EU5A 3E3QE 2BNRE 5L0QC 3QO1B 4HFWA 3HNTH 5A1AA 1FBIH 2Q76A 1QFWL 4EUPH 4ODUB 4HHAA 1EX0A 1QBLL 3DGGA 3KYNA 3LD8B 5D6DC 1ZMYA 2APWA 4PP1C 1SY6L 1N6VA 2GT9B 1LEGA 2XZZA 4GSDH 3DV4B 4JFOB 2CK0L 3P9LB 5DHYA 2DF3A 2NY3C 3G9AB 3MNVA 4XB8A 4DW2H 3UO1H 4M6OL 1N5YH 2FR4A 3PXHA 4L4VD 1MWAH 1BZ9A 1YEFH 2NY6D 3BZ4A 2VO5A 4P2QD 4LSSH 1M05A 1D5XA 2NXYD 3CNKA 1HKLL 5CJXC 1NBYA 5HHMD 4U31A 1II4E 3ULSB 4JKLA 1IGFH 1N59B 3TYFB 1ZT1A 3EIFA 3NTCL 2IBGA 2NY5L 1WCBB 4E41A 2H2PD 1DANT 1FVEA 1NCWH 5ETUB 2D7TL 5IMOB 3CSPA 5FGCE 4Y4KD 3CAFA 4M7JH 4N0RA 4PRHE 4EN3B 1G7JA 4KZEL 5DUBB 1M6OB 1AQKL 2CUHA 4JCMA 4YIQA 4XI5C 3EZJB 4Y5YC 4GFTB 5IVOA 1PJ9A 3FT2A 3UTTA 4JZNA 3S34L 1MIML 4OGAC 3O4LB 3QEQB 2MCG1 2MOVA 1FP5A 4O4YL 1M7DB 3A6BH 2ADJB 1J0HA 4KKBC 4NO2A 1A1OA 4Z7WE 4FQXA 4KRPC 5CCKL 1UFUA 1YEEH 5HJ3A 3MRPA 4OD3L 3OKKB 4PGZA 4NSKB 4XGZA 5E4IA 2YD3A 1F6FB 2Z8WC 3HE6C 1YEJL 5DJ8A 1S9XB 5K9KA 1MELA 3RQ3A 3MLUL 4DZ8B 3FB6A 3FMGL 5HHXL 2J12B 5C6PB 1OTUC 1CXEA 2FL5A 2UYLA 4LLVB 4NPYB 3VH8G 1VACA 2Y06H 5DWUH 2CIKB 4QRSA 4N8CL 5INCB 1I4FB 5C0CB 4B53A 1E4KC 4XPFH 1MCOH 4LPYA 1CDUA 3NIFE 1AXSA 5FHBL 4WHCA 1JJUA 1UKTA 1Z3GH 5TJWK 3SKOA 2DQGH 2D7MA 3CFCH 3MV7E 3G6JE 3FO1A 4GQ9L 4P2CG 2R0ZH 5CEXB 5KSBE 4V2CB 3KS0J 3T0WA 4H1LG 1FFRA 5EIIA 4NWTL 1CGYA 1G7LB 3AS2A 2DLHA 3DI3B 3FZUC 4MXVE 1KXQE 4LEOA 4K8RH 1ZHNA 4U1NA 1U95B 1J8HA 2ICCA 4EDXB 3ARDA 2A74B 2C4FU 3ZYZA 4HWBH 2CR6A 3BRGC 1K3IA 1RUPH 4PJFB 1OSPH 2A6KA 4XC3H 5GSRB 3OKLA 1EBAA 4P49A 4MA7H 4OT1L 4W4OA 1B9ZA 4XX1E 1OP3H 1YC7A 4NQSA 1V7ML 4YK4C 4NBXB 5AD0B 3LD8C 1TETL 1OM3L 4RCAA 3GKWH 5KSUA 2RQ8A 3BKML 4NDMB 5I17A 3VDBA 1KF9B 1QFOA 4HK0A 3VFWA 1U92A 3GJFA 5GGTH 5I1AA 3NFSL 3HZKA 5KAQG 1J0KA 1U3YA 4Z78A 3FB7B 1UG9A 1X4YA 4PJXA 5J7CC 4HKZB 4WW1B 5HHOD 4F9LA 1PX3A 2IAMD 4NO5A 3JWOC 2B39A 2OYPA 3F7QA 4AEHL 1DUYB 1FG2B 3QPQC 1WT5A 4X7DC 1TZHB 3ZHDA 5ACZA 2XWTB 3EOAB 4KK9D 2YR3A 4X6CF 1S7XB 5FUCE 4U05A 2VERN 4Z7QF 1JPSL 5FYLE 4LSUL 3FFCB 1AKJB 4LVOB 4JZJA 3X14A 2EDKA 3EAKA 4MXQA 1KNOB 1HHJA 3MRFB 3OAZH 2NZ9D 5MENB 4DKEH 2WK2A 5DK3A 1IC5H 3D25B 2VSCA 5T1LB 3L5XL 3ZTNL 4MQSB 12E8L 4C56B 2E7CA 2HP4A 5F88A 4ZYKB 3W81A 5D96B 1MH5A 2J6EL 3IDNA 4JO3H 4DOHB 3X3GH 5MHSD 3HI5H 3BE1H 1WZ1H 5GS0H 2VXUH 4DCQA 3DX6B 4Q7DA 4X6DE 3D69B 4QHLA 1A8JH 3LMJL 2R8SL 3FQRA 5L2KD 2GYSA 1WVZA 2APVA 3R06B 3WFZA 4GMSH 4WV1A 4Q74A 5EUKA 2BCKA 2HVKB 4QF1A 3WUWB 3L95A 4M7KH 1AIFA 4KDTA 3QDMA 5GIRA 4OZGF 4I4WB 1U8PA 1JZ7A 1JNHA 4FQQB 5CD5D 1G7MA 3JTTB 1GIGL 3B43A 1EEYA 4FXGB 3STBA 1FNSL 3UTSB 5GS0C 3PWPA 4OCNC 1FVDA 2AXJA 2IBZX 4OKVB 2XQYG 4GMTL 5E5UB 3VXUB 3WS6C 1NMBL 1T1ZA 5IG7B 4TSBH 4PJAF 1OAKH 3W0WE 5IVZA 4YDLB 1KELH 3NZ8A 5SX4I 5DQJA 4M9PA 1IC7L 2V5MA 3WDIA 3KPRA 5EZOH 2R2BB 4WEBL 1IEBA 1RZGA 1Y0LB 3DHMA 1H3PL 2XN9B 2AJYL 4F9PC 2ZG3A 4CMHB 2F5AL 4YHML 3BW9A 1XF4A 3OJVC 4MVBD 3QDGD 4D8PB 4ZPTB 1OTTC 3V6OE 1YJDL 5JMRA 1P5VA 4HEME 3VRLE 4ODVH 1R6VA 4JJ5B 1OT2A 4LARL 2ZUQB 3KPQA 4U6HB 4XMPL 3LB6C 1SBSH 4RSVA 4Z7UB 2YOCA 4UU9B 3UTZA 1FJ1A 5JTWA 1UH4A 1QRNA 4ZUUA 1EO8L 4MJ2A 5C08E 2IFFH 1TZGL 4PLOB 3WFBH 5C71A 5SWSA 1F8TH 1KIPB 1T83C 3QXWA 4GRWF 3N9GL 4TNVK 5C0DA 1C5DB 1OAUL 3I75B 5ESQB 1ZVYA 3K46A 2IQAB 4RBPK 4ONGH 3NACL 4YHLH 5E7BA 3JTSA 4MDIA 3MXVL 4YQXL 4BSWB 1IAII 1A7NL 2MPAL 4EUPA 3JXAA 1NC4A 4LSPL 5CJXA 1KENL 1FAKT 1BFOB 1VESA 2PR4H 3BP5A 4JRYB 3T0XA 4CNIA 2BVYA 2DJUA 3G5VB 2CMRH 4WVRA 1B0GA 5ILTH 4MA1C 5KOVC 1QFWI 2VLLA 3VRJA 1ZLWK 2OXGA 3H9SA 1KPVA 2J8OA 5HBBA 1HQ4B 1LEKB 1XH3B 3AS0A 3RVXC 4MSWA 5KJRH 4L8SB 5HGHB 3QA3B 1DQMH 2HFEB 4PRID 2YN5A 4HF5H 1NAKH 3QRFM 2D7PA 5JW4M 4XPTL 2OP4L 2Z92B 3DBXA 4NZUL 2Z0BA 1MWAA 3A6CH 4V3DB 4R4FH 4MX7B 1JBJA 4WO4C 2Q7NA 1K4DB 5GGQH 3DNKA 3SQBA 3TJHC 1QSFD 3QSKB 4F58L 2VISB 5DJ0A 1I9EA 1BQHA 2VLME 3PJSA 5DRZB 3KR3H 4XPBH 3FN9A 5BJTA 5D7JD 2SEBB 2ESVE 3FQXA 3O2DL 2FCBA 3QXDB 2V2WB 4GKSA 4JVPA 4RAVB 4C59B 2R69L 1F02I 1JE6A 1N8ZA 4YEEA 5EC2A 4FP8L 5TH2B 1IE5A 4L8CA 1G84A 3F12A 1M71A 5D71H 2ICEA 2DQDH 3ZKNC 1EGJH 1XEDA 2DQCH 3SDDC 3PL6C 1UT9A 3QRGH 1IGCL 4X4MA 3IFOB 1MCPL 2I27N 4RRPG 5H2BB 3QCVL 3HE6A 5JPMB 4Z0BH 5HDLA 4KK8D 2EE6A 3VWJC 1NCTA 5I71C 5HVHB 1NDMA 4YDKH 5CP3A 5E8NB 4P5TD 3B4NA 4G3YL 4ZXBB 2BNQE 4OF8A 4MNQA 4KI5E 1JZ5A 2K9UA 3BHBA 2JK5B 1NGYA 1UA6H 3QNXB 1Z0NA 4U1LA 3QEHA 4NQTA 3NAAL 2GY7B 1E4KA 4PJIB 4RIRA 1XF5A 5HI5C 2FZ3A 3ARBC 4ACPA 4ODXB 3EJZD 3FJTA 3BQUB 4QHUB 3DVNA 3FQNB 1K4CA 3RY6C 4OQTA 1M4KA 5FA3B 2AJUL 4HX1B 3P9MA 5CS7A 4GKOA 2VJXA 5ESVB 1VADA 1WBYB 3TZVA 4JPKH 7CGTA 4OUUA 2V2TB 4J4PD 4QRTA 1J8KA 3WFEH 3V4VH 1F4YL 2VMFA 3LKRA 4FFYL 5GISL 5FUOL 4XXDB 3WSQH 5B39A 4JM2B 2L7JA 4HBCH 4ZFFB 2WZPD 3QHFH 3QO1A 5CHNA 1FDLL 3R1GL 3BUTA 1MJ7L 1V7NH 5C0AE 4BH8B 1T03L 5C7XH 3W0WD 2O26U 3GZKA 4X6BB 3HG1D 1IVLA 3PABA 3N06B 2WLZA 1DSFL 5GGRY 4JFOA 5J12B 2BSTA 4Y4HB 4ELKB 3P9LA 1MCIA 4XB7A 5CGMA 4I0CC 4MYWB 5H94A 4JFHE 4HWBA 2BVQB 4ERSH 1P6FA 2D4FA 1PLGH 5GGUB 5DYOB 3V5HB 3BH9A 2D7OA 3HZYB 1V5JA 3KXFE 1W0VB 1W2KT 3V6ZB 3ULSA 1BFVL 1OGAA 4LLWB 3SDXE 5JW3H 2Q7YA 4N8VB 3RL1B 1ZV5A 3GI9H 1ZVHA 3TYFA 1UM6H 5FYJL 4ISVB 2OL3B 4I2XA 5C08D 1NFDE 2EC9U 1HH9B 1UADC 1FFPA 5GGTA 4M00A 2DLEA 2QHLA 3MO1B 3QZWB 3BO8A 4U7SA 2DM3A 4LCUB 4S1RH 4M8VA 2F8XC 2HJFB 4OZHA 5JOPE 3WLBB 1M6OA 1G7HB 2O61B 4AL8H 2IPKA 4FQ1H 5EIQA 2XZAH 2DKMA 4RMQA 5DK0B 1TZIB 2EEAA 5KVFH 4Z8FL 5T3XL 3P77A 3SY0B 1BLNB 5T3ZH 1S9VA 35C8H 4BQ6A 2A0LC 4J8RB 1I3GH 4FQ2L 5ALCL 4MJ5B 1CLOH 3OAUL 5I1HH 5FM5O 2AV7B 1KLFA 4O2FA 5DEGB 3MLVL 1TMCA 2LTQB 1S9XA 2AQ1A 2ZCKH 3QO0B 3Q6FA 4JREC 4PD4J 4O9HL 4F37K 1CLZL 4MA3A 5E94A 1QSEA 1S7UA 3FB8B 1FZJA 3KPOA 1JF5A 2AERT 1KOAA 3HTLX 4PGBB 1PSKH 3D2UA 1JGEA 3ZSTA 1I4FA 1I7RB 4J23A 4GBXC 1D5BA 2QQNL 4HZAA 4K23H 3C08H 5GZND 3S35L 3MFGB 1KCLA 3WS6A 1EIBA 3WIFA 4N1CA 3C09B 4H20L 1NMCB 1J88A 4Y4FC 5DD3H 5EO0B 5CEXA 4ZOEA 3H9YA 3QFJD 3HNTL 4S0TD 4TQEH 5E8DH 1FBIL 4OJFH 2D0HA 1G7LA 4QHKI 1N5AB 4F9PA 4KI5D 5I8KH 4BSJA 4RMWA 3VFPA 3HE7C 3NA9H 4GSDL 2HKHH 5DJCA 3CLFH 1O7SA 2UZYB 3GJFK 2ICWA 4RGNB 3ARED 1HHKB 3NCJH 2GUOB 4DW2L 4MD4A 3UO1L 4J12A 5BZDA 1N5YL 2X9WA 4ZTPH 1MWAL 3E2HB 1YEFL 5LGJB 3PGDB 5AD0A 4GS7B 4LSSL 4NQDE 5E6ZA 2NYYC 1S5IH 4Y0GA 2XKNB 2H2SC 5EZIH 2AEQH 3F5WB 3MRIA 1CL7H 1T83A 1XGUA 1IGFL 1UACH 4U6XB 4CVXB 2ILLA 1I9JH 3A0OA 2H45A 5HYEA 3ULUE 2B20A 1DP0A 2IALB 4Z7OF 3T0BA 4U1MB 1NCWL 1X4ZA 4JY6B 1UB5B 2FLRT 3Q5YA 2J8UE 2NY1C 3PNWA 4HLZG 5F7KC 4PB0H 1SJVA 5C0AD 3BSZH 1L9MA 4M7JL 4WCYH 2XV6B 4IIQC 1DUYA 1FG2A 3GMLB 3PV6B 3OF6A 5F1IB 5FA4A 3HC4H 3OXSA 5DRWA 1GC1H 1ND0B 2XWTA 5F89B 3RNQA 5KTEH 4HC1H 1S7XA 1IGYA 3Q5OA 4U0QB 5E2UH 3RY4A 4XH2A 4I0PB 2P5WE 2WIIB 3BKCH 4G80B 1G6RB 2R0WH 3FFCA 3GSWA 3RBSA 1AKJA 4G9FA 2QSCH 3OR6B 4EIGB 4WO4A 5DVLA 2PO6C 3LPWA 4LCYA 2YA0A 3A6BL 3G5ZB 5JDSA 3RVTD 2J5LB 5DHVB 2A6DA 4XPAH 2OM5A 3TJHA 5I15H 1WGOA 1AE6H 1OGTB 4OLWH 5IVXB 1NGXB 1YEEL 5CJBA 3IF1B 4ZYKA 5H35B 5HYSA 1QLFA 2H8PA 3S88L 3C9NB 2JB6B 5IMLB 2X4SA 3RUGF 43C9B 4TUJA 3NIDE 5TQ2H 2C1OB 2VDPH 4PJBF 2GJ6D 4KGJA 3DUSA 3GSVA 3KLHC 3LS5H 4XP5L 3DX6A 4KUCF 5CFHA 5HVGB 3SDDA 3PL6A 3OX8A 1KJMA 4LHQB 2Y06L 5DWUL 4KJPC 5JOPD 4FXKA 4XZUA 3IKKA 3R06A 1MLBB 3NCEB 1DDHB 3VWJA 4XPFL 1MCOL 4UTAH 4ORGA 3WUWA 1Z3GL 2DLGA 2DQGL 3IKCA 4G43B 4R7NA 4U33A 3CFCL 3DRTA 4JRXB 1QLEH 1T20A 2R0ZL 1JWSB 4YZFF 5A2JH 4QGYA 3QFDB 3F62A 3T1FA 2BXZA 4FXGA 3UTSA 4P4KC 2YPLA 1EGJA 1FPTH 1S8DA 1CI5A 4K8RL 4H26B 5JPNB 2X40A 3S5LA 4LPUA 3D18A 4Y19B 1I1FA 4D94A 1ROWA 2JB5H 1IEAB 3V95A 3DLQR 1S3KH 2IANA 3UYPA 4HWBL 3EYUH 5KS9A 1RUPL 3AS1A 1OSPL 3T0EB 3P4OA 4XC3L 3NFPB 4M61B 4MA7L 5B3JF 5F7MC 1N6UA 4PJ7F 3TBSB 3I3EA 3PDOA 4O00A 1FORH 1I8KB 3EUUA 1I7ZB 4PJ9C 1FNEA 2P24A 3TNNA 4D8PA 3GKWL 3O6MH 4ZPTA 1I3UA 3LPGA 1WEJH 2BMKA 2B4CH 3MRBB 2WNGA 5E08H 4GXVH 1MSPA 1FZKB 5GGTL 4U6HA 1LO2H 1A22B 1RJCA 2H26A 3RWCB 4AK1A 3DRQB 4EI5C 5I1CH 3MV9B 2EO1A 4M03A 1MAMH 1D6EA 4HT1H 1WV7T 4Z9KB 4FG6C 1CTNA 1Z9LA 3RHWF 3R0MA 1BIIA 5TDNA 5ANME 3MZGB 5BRZA 4U1GB 5FV2A 4ODWA 4FQXD 3ARTA 5C0BE 5EN2B 3HPLB 3LSOB 4P3WA 1B6DA 4HKXA 1CDCA 4YO0B 1C08B 1KLGB 3QNZB 4Y1AE 5FO9B 1RZFH 1OWRM 4WU5A 1ED3A 3T3PE 4V1DE 5DHVH 5HD8D 5CMAB 4DKEL 1KG0B 5C0ND 4EXKA 1IC5L 5JHDE 4JLRA 4NQDD 1HQ4A 1XH3A 3ZDYF 2Q86B 2ZG2A 3L3OA 4HAGA 4YJZL 3LRHA 2HFFA 4QRQA 3ULUD 4OZ4B 3V5KA 4JO3L 3C5SA 3CFIC 3L6FB 2P5EE 3CVIH 3X3GL 2QEJA 2YMXH 4PBWD 4OAWB 3HI5L 3BE1L 3PQYA 1WZ1L 5IFJB 1T0PB 2VXUL 5GS0L 1CFSA 5D72H 4LLMA 1J18A 3RNKA 1JPGA 4WW2F 1F4WH 2VISA 4R0LB 3MLXH 4PLNC 1QZ1A 25C8H 4JRWA 5AWNH 4GMSL 1ZLVH 3RKDD 4Z76B 4X6EA 4QOKA 2V2WA 3W11D 1LE5A 1EHAA 4M7KL 4XCEA 2JCCE 4AIXA 4JDZA 3I9GH 2R1YB 1T7ZA 4WUUB 4R3SA 4Q6IC 4NCC2 5DEFB 3PXJA 1XIWD 1WIOA 1S7SA 1S7WA 5GJSH 4TSBL 1OAKL 3BKYH 5F7LB 3MNZB 4XWOD 4OZIE 3SEPA 1MI5E 1KELL 3L3IA 3QI9C 2X6MA 1NBQA 3ILQC 5EZOL 4OV5A 4GBXA 4PBXA 5HDOA 3IS1X 3MLYH 4PJIA 3VD4A 5DI8A 1PYWB 3EOBB 3DO7B 3B3IB 3PHQA 4X6CB 2EIZA 3CDYA 3FQNA 1X6LA 2FWOB 2GJJA 1TVBB 4RGMB 2W65A 2IH1A 2HLFD 5ADOH 4G8IB 4ODVL 5ESVA 4XNZB 3W9EA 3ZDXE 5T1MB 1HOCB 1I9RH 1SBSL 4LPCA 1I8IA 1Z5LA 1Q9KB 3HE7A 1H8SA 4IBLT 5DRXA 4PGEA 3F58H 1TTGA 1YPZE 3PHOB 4UT7H 2FEEL 3HUJA 2IFFL 3WFBL 4ZFFA 3CFJA 1F8TL 5EU6B 5IEHB 5DUMH 1A6AB 2FDBP 2ZSVB 3TO4D 3MNWA 4ONGL 4YHLL 5IB5B 5IBLD 1KB9J 1UVQB 2A6IB 3JBG7 5ICZB 2PR4L 4ELKA 2YD6A 3LEXB 3BYYA 2CMRL 1KV3A 2ZNWA 1JZ3A 5ILTL 3FRPA 1JYNA 4ZPVB 2XKSA 4HKBA 5KJRL 4OZGB 1DQML 4HF5L 1NAKL 5GGUA 3V5HA 4KROD 3L5JA 5ICXA 5D7SH 1ETZB 3QWRD 3A6CL 1R5IB 4R4FL 4BFIA 4G6FB 4ZAKC 1AD9A 1ZVSB 3RL1A 1W8NA 2Q3AA 4IMKC 5GGQL 1I1YA 2ZUYA 3PG2A 4FZEH 5CILH 5AYUH 5C9JA 4PJAB 4XBPB 3OB8A 4RFNC 2FJGA 3GMRB 3ZMRA 2WM0A 3QPXH 2NLJB 5CAYB 3QZWA 3NZHH 3KR3L 3BFOA 4XPBL 3FOMB 5C0BD 5JNYA 2H6PB 2EDXA 3I3DA 1V05A 3MLRH 3OAZK 4YXHH 4BQ8A 4Y1AD 4JN2A 3WLBA 4JFEB 5DZLA 4JHAH 1S7RB 3D39D 3GSOB 1OLLA 4JPIA 5D71L 2DQDL 1EGJL 2DQCL 4QLRA 3QRGL 1FIGH 2VDNH 3E0GA 5IP4A 5DK0A 3X11A 4HC1A 4BELD 4ZQKB 4Z0BL 4LAJH 3P4NB 1R3JB 4YDKL 1N26A 4XP9H 3TH2T 3NCYP 1KCGC 3MRNB 4DFHA 1QNZH 4J8RA 3TBVA 4M6NH 4NQCA 2MSPA 1R3KA 3IVKA 4P2RE 3FO9A 5GZOD 4Q58C 2P5ED 4WTZA 1UA6L 4XTRC 5CWSB 4NQVB 3QUYB 3V0WH 1PFCA 5ICYB 1MEXH 1P9MC 4MAUH 4PJDA 2GY5A 4ZS6D 4GRWB 2DQUH 1QRND 4PJ5A 1GGCH 3AXLB 3STLB 4Y88A 2DWDB 3FB8A 3O41B 4U6TA 3ARQA 1RU9H 1XR9B 1JWUB 2X1PA 5FF6B 4KK5C 1T0NB 5FB8A 4JPKL 1HXYA 4P4KA 4PGBA 5F7FA 2F58H 1VFBA 3B5TA 3ZE2F 4YBQC 5T1KD 1I7RA 3U30B 5CLWA 1FSKB 2X4PB 5GGRB 4H25A 2YWYA 5F93C 5ITFA 3WFEL 1OY3B 1K8DB 5DS8B 1NC4D 3V4VL 3UPCA 3KPMB 4JM4H 3K8KA 5D2LE 3N1QC 5EO0A 3V7MA 3WSQL 1EBPA 3ARRA 1NANI 5KVEH 2DJ4A 4HBCL 1C5BH 4YFDB 4WUKH 1MHCB 1QVOB 3O4LE 3QHFL 4CW1B 4I3RH 4NBZB 3TH4T 2I07B 1V7NL 3U4EB 3GSUA 5TQ0H 5C7XL 4UMGA 3UPAA 2FECI 4LLQA 2UY7A 4PJ9A 2X7LA 4EUPG 5JIPA 4KV5E 5I8EB 3T3MF 5D2NB 2FGWH 3RPIA 4EI6A 2KQMA 3K81A 2C26A 4XI5D 3TN0B 3SDCC 1T4KB 4HKJB 1HHKA 4LP5A 3VGDA 5ISZE 4NNPH 1X5AA 1IAIM 5EBMA 4ERSL 4OGAD 4EI5A 4PP8C 1PLGL 3QDHA 4S1SH 3OB0H 5EC1B 1H9VA 1TFHA 2N7AA 1EHLH 3DXAD 3DVGA 5JW3L 1D5IH 3QEUB 5T5NG 3GI9L 4XP6H 2X1XR 2LAGB 4LL9A 4YXLH 4JZOB 4U1MA 3BRDA 1BQHG 3QQ3A 2C3HA 3MODH 5D1XC 3MUZ1 2NPLX 4HJGB 3MYJB 5HHQA 1MFBH 2OSLB 4ORZC 2EIEA 4NO3B 4S1RL 1OTUD 3L3HB 1H0DA 4FQLH 1MCLA 3T8XB 4X6FB 2EYSA 4AL8L 4E0RA 4FQ1L 2XZAL 4I0PA 3NH7L 3JV6B 4FABH 4HFUH 3LKOB 5KVFL 5KN5B 1OVZA 2X5PA 5T3ZL 4WWKB 5FGRA 35C8L 3LKSA 4NWUH 3CVHB 4HCRH 2G2RB 4PJCF 4K07A 1HYSC 1UB6B 5GS1C 1I3GL 2EYRB 2YSSA 5FM4A 1CLOL 3TZVD 4K7PY 3O3BA 5I1HL 1CDYA 3G6JF 2G5RA 3BWAA 5JHLH 3V8OA 4KK6D 4HUNB 3WE6A 1WSST 2ZCKL 1N3NB 1R24A 1WWAX 3RWIB 2DMBA 4MDJA 2HJKB 4MXVF 2IC2A 3SGDH 5IW6B 5D1ZB 3L7EA 2VB5A 4MNHB 5M7QA 1YMMA 2BC4A 4F7MA 2DD8H 4Q6IA 1PSKL 4RMTA 4K23L 3EHBD 1DDHA 5B38B 1K3ZA 3C08L 1Y6KR 4UUJB 2FIKA 2LVEA 1PY4A 2FATH 2XIDA 4G6AD 2DWEB 5H37H 5TE4H 4K8RD 4GH7B 3IXAB 4JRXA 5B39G 5DD3L 1AR1C 1CGUA 3QI9A 1JWSA 4MD5B 2HLAB 5JO5A 2BNUB 4TQEL 5E8DL 4OJFL 5MENE 1W0WB 3CUPB 3QQ4A 2YD4A 5F3HA 2EDQA 5J1TC 3P4LA 3QUKB 1YNTB 4MA8H 5FYKH 2OQJB 1HK6A 5I8KL 5HYQA 4GRLB 3CDGA 1LK3L 4HUXB 3IJHB 4C56E 3NA9L 4Y19A 1CG9B 3L5WA 3VXOA 5C0IA 2HKHL 3CLFL 1BBJB 1BX2B 4FTVA 5C6WH 1NSNH 3IDYB 1NC2A 3NCJL 4HUUA 4DOHE 1BHGA 2CDFA 2ICWI 4ZTPL 4L8DB 3B5GA 5HXMA 3CFBA 3FN0H 2IPTH 4M9OA 4J3OC 43CAB 3EO1B 1XGPB 1S5IL 4EN3D 4J6RH 3K74B 5EZIL 2AEQL 1CL7L 3IU3B 4KJQC 3ZL4H 1GOHA 4LCWB 1UACL 2PXYB 1I9JL 4PV8A 1A4JA 3UTOA 1H5BC 3F8UB 3RWCA 2PYFB 2BVPB 4GW5B 3QEQD 1FYTB 4PB0L 4KY1H 5E00A 4PJEF 3BSZL 4HIEB 1KEMH 4WCYL 1IC1A 3HR5A 1UZ6E 3HC4L 5EN2A 1GC1L 3E8UH 1HWHB 2DYPA 5KTEL 4HC1L 3MCKB 4IS6B 2AW2A 2OCFD 5E2UL 3ZKMD 1D9KB 2BSED 5EOCJ 1KLGA 1Q9LB 4LBEA 3BKCL 3C5JB 2R0WL 3ARFC 4X6DF 3CVHH 3LN4A 2QSCL 2DICA 5AUMB 1U9KA 5TE7H 3OTTA 3WKNA 5I1KH 1LILA 5CMAA 2VDOH 3DX8B 4WI4A 1DN0B 2XN9E 1KG0A 4IMKA 4XPAL 1NCDH 5I15L 2PW2A 1AE6L 5GS0D 3GO1H 4NM4H 4OLWL 2Z93B 4UTBH 3NABH 4XNYH 3ARXA 4OFIA 5C0CD 4TVSa 4OSUH 4QT5B 3WO4B 1PZ5A 2FO4B 4EXPX 4OZ4A 4WENB 3L6FA 2LU7A 5TQ2L 5GRXG 2VDPL 1IC4H 1KGCE 2H32H 4JFFE 1INQA 3ALXA 4JHBA 3LS5L 2NTFB 2Q3ZA 1RIUH 4NM8L 4KHTH 5BOZG 4U0RB 4U1SB 1Q0YL 4PJHA 4D9QD 4QHMB 5HI4D 3THMH 4UTAL 1S78D 3EJYC 4WTXA 5CSZA 1LE9A 1OTTD 5LAXB 1XR8B 1QLEL 1PG7H 4EVNB 3H3PH 1MQKH 3FOLA 1A7RL 4WUUA 4Y16C 4OIBA 1P7QB 1WIUA 4PRPA 1BJ1J 4JRYE 4OB5H 4QRPB 3RTQB 3T2QA 1P9MA 3TVMB 3GSQB 3SDAB 5K9JH 1FPTL 2HT4C 2VITB 2BHUA 2CD0A 5I8CB 2X4UA 5JLZB 2XT1B 2P8LB 3GMQA 3H9HA 2AJZB 1D3CA 1GVIA 2JB5L 2DQJH 1S3KL 2EYTA 1LP9A 1AHWB 3EYUL 1A6TB 2G75A 3D3VA 1S7VB 1HILA 3QP3A 1G0XA 4L3AA 4JDVB 3WYRA 5DFVC 4HZLB 2I5YH 1FORL 2OR7A 4WHYH 1P84K 3ZLQC 2NW2B 2VXTH 3O6ML 4YBLC 4X4XA 3VXSE 3OF6D 4LP4A 3SCMB 5J56B 2C3VA 5DO2D 1YDPA 1KJ2B 5E0QA 1WEJL 2B4CL 3CXHJ 3RVXD 3B9DA 5E08L 4GXVL 4DKFH 3LKNB 3H6JA 4P3DB 5E24E 1LO2L 3FFCD 1AKJD 5I1CL 1MAML 4GG6F 4MCZB 4NFCA 1BVZA 5E1AB 2DRUA 4HT1L 5MEND 3PHOA 4WEMB 2HJLA 3HRZA 3WLWD 3SDCA 1FL5B 3RAJH 2D7NA 4XHJC 1WC7A 5T1LD 5EU6A 4I13B 3RUGB 5EU7E 4ONOA 4PJBB 3VD7A 4JGJA 4C56D 1R0AH 3MJ7B 2R0KH 1CD1A 2ZZUT 2DI8A 1RZFL 1MUJB 1UVQA 5I75B 4UDTB 1SYSB 5HGGS 3VJ6A 3MV01 4GAFB 4N9OB 2O5ZH 4AQOA 2AV1A 4IEFB 4XPHH 2CDEB 4ZUSB 4Z7VE 3SDDD 1Q72H 1RVFH 5F7YC 3FO2B 3UYOD 2NX5A 1HQRB 5D1XA 3TM6A 5I1IH 5HYSG 2DQIH 3VWJD 1MCDA 4NIKB 3GM8A 4YGAB 1VKXB 1U8QB 3CVIL 4M93C 1KUMA 2YMXL 1MOEA 5E2WH 5FM8A 3MMEA 3O8XB 4WEUD 4X9IA 3W2DH 1MF2H 4N5EC 4P4RA 5D72L 4N1EA 3WDHA 3REVB 4PGJA 4X5XB 5L8JB 1J0IA 1F4WL 3UTSD 2R9HC 3OGCA 2XWJB 3GMRA 2VZSA 3MLXL 2FNBA 1KXTB 3OKDB 1CDBA 25C8L 2BZDA 2ATKB 2D03H 3GSRA 2H6PA 2MHAB 2PYEB 5AWNL 3WUWG 2Y23A 1EXUA 3C6LC 3VFRA 3VXUD 1LQVA 4Y5XB 1OOAA 1D5ZA 2OZ4H 3FFDA 1PKQB 3CCHB 4PJ7B 1ZANH 5K33A 3S36H 3I9GL 1VGKA 1Q9WB 1JYXA 2R2CA 5DJ2B 3A67H 1F11B 2GFBA 1YY9D 2XN9D 3VFGH 3O3EB 4GRMB 3S5LG 2X4TB 5GJSL 3MGOA 1RZKH 5ESAA 2ITDB 5IB3B 3BKYL 3AM8C 5CSBA 1KJVA 3VXNA 4YC2B 4Z7NF 3MLYL 2W38A 4WU7A 4WHTB 5I2IA 4G9DA 5HHVH 4PLJC 5INDB 5F7HA 2EIDA 5BS0B 2HFTA 1KJ2H 1INDH 1IQDB 2DWDA 5TGBB 3G08A 3O41A 1XR9A 4HIJA 2AEPH 1WAAE 4P57A 5ADOL 5FF6A 2F54A 1RZKC 2NCMA 5JW4R 3P0VH 1J05A 1I9RL 2X4PA 2AJ3B 4G42A 3G04B 4NOFA 1NBZB 4M8QB 1U8KA 2V6HA 4JRYD 4KAQL 2CLZA 3F58L 5JXEA 3L3DB 4UT7L 3CDCA 3ZKXB 2BVUA 2APFA 5MERB 1MHCA 2ADIB 3T65B 3NOIA 5DUML 4AZ8A 3U4EA 4U1HB 3B6SB 1E4XI 2LVCA 2F5BH 2J8HA 1FH5H 2DTSA 1UENA 1Q94B 3GRWH 5I8EA 1NFDF 4WW2B 3TC9A 5H8DA 5DFTA 1F4XH 3QIWB 3BPCA 4IOIA 5CEYB 1T4KA 4Y2DC 4P2OB 2X4RB 3JV5A 4AIZB 1H5BA 4XNMB 1KEGH 4X0KA 3TBWA 5DK2B 4LLYB 3RGVB 1T21B 3PWNB 5D7SL 1P1ZB 4YHPB 1JF1A 3SO3B 3V2AR 2LAAA 3N50A 4FZEL 5CILL 1RZIB 4HS6B 3QULA 5AYUL 2V9RA 3WEXB 1QD0A 3ARGC 3QPXL 2OTPA 2VXVH 3NZHL 1WFUA 2OSLA 4OZFH 3MLRL 1T66C 4ZXBD 2ARJB 2IADB 5IT2H 1HCFX 4YXHL 5T3ZD 3GSNB 2ZUXA 4JHAL 3T8XA 4IRJB 4I48B 1JZ6A 3B8YA 2Z31B 4XXCC 3RZWA 1T2QH 1CTOA 5FXCH 5CJQH 1FIGL 2VDNL 1YECH 3LKOA 4RGNE 3HB3D 5KN5A 3L3GB 4YR6A 2C3GA 4RDQF 4XP9L 1IAOB 3AY4C 1AGDA 3BQUD 3CVHA 1QNZL 5D7LB 5BXFB 2QR0B 2H3NA 4M6NL 4HWEH 1HCVA 3UDWC 2A6JB 4F15B 4PR5A 3O4OB 3L3JA 1YYLH 3V0WL 5I66B 1MEXL 3CH1B 3TGXA 4MAUL 3U9PH 3ULVE 1ZLVK 3HC0A 3IDIB 2DQUL 2ZWLT 2MQCA 4HWZB 3RWIA 1GGCL 5IMKB 2HKFH 4E41E 5ID0A 2VE6B 4JM2D 3MV8B 4S2SB 4LDLB 1ZHKB 3LRSB 1RU9L 4KQ4H 2RFXB 2H32A 4Y16A 2LQRA 4IDJH 3QG7H 3FB5A 1P4LA 4IDLA 1CE1H 5DJDA 5DF0A 2F58L 3QNYB 1XGQB 3OHXA 4QXTB 2VZVA 4LU5H 2OTUA 3IFLH 4UUJA 2DTMH 2NYYD 3CFEA 3SE9H 4HPYH 4KKLD 3ZHKA 4TN9A 4Y4HD 3TYGH 4JM4L 3IXAA 4UOW1 4JAMB 5KVEL 5GPRA 3ZO0A 1C5BL 4WUKL 3DSFH 5BZWA 2BVTA 4I3RL 2Y25A 2HFGH 4I1NB 3LH2H 4BZYA 5TQ0L 1W0WA 32C2B 3HNSH 4EOWH 3S36X 4PJ8C 2OQJA 4GRLA 5IVXE 5M94B 2J8UF 2BX5A 3IDJA 1VFOA 2FGWL 4DAGH 3FRPG 4EJ1C 4JFYB 4MWFB 2X44D 2C3WA 4NNPL 3O3AB 2P8PB 1DVFB 3BIKB 4L8DA 3IETA 1NUGA 4S1SL 5DJZA 3DI2B 1H3GA 1WFNA 1XGPA 3DX7B 1EHLL 5I1GH 4QRUB 4ZDHA 3PWVB 1JRHI 1IT9H 5F1OB 4Z18A 2R15A 3QHZH 3DURB 1D5IL 3GMNB 4XP6L 3PDGA 3T4AB 4YXLL 4XBEH 2PW1B 5CKGA 2LU3A 4NC0B 3MODL 4GW5A 3QZWG 2LV4A 5HI3C 1UEMA 1FYTA 1MFBL 5FDYA 4CUCA 5SV3A 1Y18A 1RAMA 1F97A 3KJ4C 3AAZB 3H2WA 2E6PA 2BNRB 3O2WH 4K71C 4ZUVA 1JHKH 2NY6C 3NIDF 4GG8A 4S1QH 4B50A 4FQLL 1B0WA 4XBGA 2NTSP 1SYVA 3SO3C 4IS6A 4KJPD 3EOYG 1I1AC 3IFNH 1A21A 4FABL 4HFUL 4LVHB 3HZVA 1WICA 4UT6H 3MJ9A 2R2HB 2H2PC 3T0EE 2V9TA 4ONFH 4NWUL 4PB9H 4N5EA 3DX8A 4G6JH 4HV8A 4MAYB 3WN5C 4FS0A 4AG4H 4W81A 3QQNA 3TIEA 4WTZG 4Y4KC 4UAOB 4U3CA 1TDQA 4NNXB 1P5UA 4QT5A 5JHLL 4DGIH 4DN3H 3C6LA 1MVFA 5CBEA 3FAXA 1QP1A 3VGGA 3QCUH 4GUPB 4XP1H 3MV9E 3VW3H 2NTFA 4X99A 3QDJA 3HAEB 1SHMA 1JPFA 3KPSB 5DD0H 5HYJB 1OF2B 5IMMA 5E95B 3NIGF 4HUVA 5IIEB 3OG4B 1JNJA 3VFTB 4EZMA 3D0LB 4PJ9D 5IW1A 4L3EB 3DV6B 1KLUB 4PRHB 2FATL 1RUKH 2R39A 5TE4L 5TDPA 1DLHB 1XR8A 3QT2A 3B9EA 4OD2A 4RGND 4AH2B 1K5NB 3AU1B 2AJVH 4FMKA 2N56A 1Q9OB 3B83A 2VLKB 3VGFA 2VITA 4XCYB 2X70A 2R1XB 3BI9X 2AXGB 2XNAA 3WCYA 5I8CA 4MA8L 1ORSA 4FG6D 5FYKL 2KDGA 3PWUA 5DDHB 5LJYH 1U93A 4HH9B 1FL3B 4F7CA 3BISA 4QCIA 1AHWA 1KCVH 4S0UC 1F00I 4XAKE 4FQIH 1NSNL 5CBAA 4JFDA 4L3CB 1ULVA 3OKNB 5KANI 2DS4A 4QYOB 4WNQB 1EPFA 1AGFB 1RIVH 2Q1EA 1BMGA 3FN0L 2IPTL 4HZLA 2AK4A 5B4MD 4R7DA 1BD2B 3MRGB 3EO0A 1EVUA 1ZHBA 4J6RL 3RWGA 3DMMB 3QHTC 1AGCB 4ETYA 3SCMA 1F3RB 4XNQB 5CUSH 3ZL4L 1DQTA 2Y6SD 3VGAB 3FTGA 4I0PD 4OCSH 4DKAA 4PJCB 3QDME 3DTXB 4L8BA 3S8WA 2IH3B 4MCZA 4K7PH 5E1AA 2OTWA 2ARWA 3MV7B 4KY1L 1QFHA 3G6JB 1KEML 5KSBB 1D6VH 4LPVA 3B8SA 5BMFH 3E8UL 4UDUA 5IB2B 3S37X 5KBNC 3MJ7A 3GUTB 3I6GA 1P69B 2D7QA 1MUJA 3CVHL 3OB0K 3WNMA 1OAZH 3M45A 4H0IA 4JN1H 4RFEB 1SYSA 3VXPB 5IOPB 3DUHA 5F6IC 1C1EH 3MTRA 4KRLB 5TE7L 5T33H 4FFZH 5I1KL 3QWOB 3KPRE 1DFBH 2CDEA 2IAMC 2VDOL 4HWNA 5FAAA 3LS4H 1NCDL 1YMMD 3GO1L 4NM4L 4X6CE 1KC5H 4UTBL 3NABL 3MRJA 4XNYL 5KG9A 2EDEA 3PP4H 4Z7QE 1MJJB 4OSUL 1E27B 4URTB 4XNUH 1U3ZA 4KK9C 1U8QA 3CLEH 3V7AG 1ORQA 1IC4L 4JRXD 3FAWA 4A6YB 4GW1A 1R3LA 2RAMA 1A1MB 2F19H 4WI8A 3REVA 1RIUL 5EIVA 4KHTL 4HG4K 2J3SA 4K2UH 2B2XH 3L5HA 4OF0A 3OKDA 5CZVH 3THML 2ATKA 1AQDB 3L1OH 2IMNA 2WUBH 1T6WA 1F3DJ 1S9WB 1CN4A 4Y19D 3DROA 1LO3H 1NL0H 2YXFA 2EDYA 4R6UA 3FT3A 4N0UB 4PJ7A 4OZFA 3UDWA 4HMEA 2J88H 1PG7L 3H3PL 1MQKL 2X89A 3T0ED 2UV3A 2CKBB 4MJ4A 4CU8A 4OB5L 2VLRE 1VGEH 5K9JL 3LN5A 4JFZH 1TJGH 4GRMA 2Y9RT 1V3LA 3TF7C 1U8MA 3C8KB 1A2YA 5E5RB 3H9SE 1PG7W 4OZGE 3DJ9A 4L1HA 2DQJL 5E8PB 4KC3B 3VFSB 3C5ZB 1KN2H 2EECA 4ZSOA 5HPMB 5F7WC 1U3HB 5C3LD 5CD5C 3V4PH 4WHTA 5J11C 2C4XA 4HD9A 1RJYA 5MEPA 5D1QB 2I5YL 5TDOB 3AMLA 1DJSA 5J1AB 4PJAE 2VXTL 4X6DB 3MRCB 3FKUS 2VABB 4P23B 4QNPF 1D5MA 5E8EA 4PJGF 8FABA 5E2VH 3ES6A 2RHEA 4LKCA 3VXRA 4DKFL 2A77H 2A9MH 5EFIA 2AJ3A 4DFIA 3O45A 3ARUA 2PKDA 3CC5B 4PJ8A 4M8QA 2C7UB 1J87A 1T7XA 1T0MB 4M43H 3MUGB 3T0DA 1ADQH 3RWHB 4OCYH 3OKMB 3RAJL 5MERA 4HIIB 3EYVB 1U2HA 4RMVA 4OBSA 1KTDA 4DVBB 1J1XH 1R0AL 2R0KL 3B2VH 1FL6A 4GT7A 3WXWH 1Q94A 4WW2A 1FNGB 2O5ZL 4F8QA 3JV4B 5CEYA 2DI9A 1AI1H 3FQTA 4XPHL 3J8F7 4GRWE 1Q72L 1RVFL 4NQXB 4LHUB 4XNMA 2ZNXA 3SJVA 4OUOA 4NRYB 5I1IL 3RI5K 2DQIL 1ZXQA 4LLYA 3IFPB 2D0GA 4A6YH 1U91A 4L4VA 3Q48A 4HS3B 3DETD 3HHRB 4JO2H 4NT6A 5E2WL 1P1ZA 4M7ZC 3U1SH 2X2YA 3W2DL 1MF2L 4WUUD 2HN7B 2X4OB 5HHMA 1NBVH 1I1AA 4U4BA 3S7GA 4Y7MA 1BJMA 4P46B 1PQZB 3P9WB 2XXMB 4YE4L 2NY2B 2D03L 1HHIA 4WI7A 2NR6D 1LD9B 4KMTH 4LIQE 3BPNB 1CFNA 1CT8A 1RURH 2ARJA 4ZO8A 4K7PX 4LKXB 5F9OH 2CKBH 2OZ4L 4NKIH 5FYLH 1ZANL 1KPUB 1KIUA 4Y4KA 1Q38A 5I1DB 1RHHB 3S36L 2DL2A 5GXBB 3H7BA 2WWKT 5D2NE 3A67L 5JQHC 5F9JA 5KAQF 2PCPA 2AJXH 4GLRI 3LVEA 4KJYB 2B7DT 3VFGL 5J9PA 1RZKL 2ZOKB 2VN4A 2NMSA 1J0YA 1EZVY 5D7JC 2A6JA 4PRDA 4GG6B 5C0GB 5D2LF 2YN3A 2ZUUA 1T1XB 3CH1A 3IJSB 1PD6A 3UP1A 5DMKB 4S1DD 5HHVL 4P9HH 4P3CH 3GMPA 1QO3B 2AABH 4HWZA 4KPHH 1KJ2L 1INDL 2X4NB 4POZD 1JGDA 2NNAA 5EU6D 2AEPL 4HDIA 4P5TC 1WWBX 3RL2B 3P0VL 5JXAH 3QEGH 1XGQA 3CPLB 2AXFA 2X4QA 1RK1B 2ESVB 4IJ3B 3AFLA 3K8MA 3NFNA 4F3FA 4E42B 1FO0B 2FJHA 3LCYA 4P9HC 1HHHB 2UVEA 3U2SB 4GJTB 3V6FA 1IRAY 32C2A 1JL8A 2F5BL 1J1PH 3CGTA 1FH5L 4IMLB 5I16A 3ALWA 3GRWL 1HXMB 2BNQB 4RMRA 4G6FD 1F4XL 4D0DA 5D7IF 4J4PC 1IZJA 4JFPB 3WS3B 1ZGLB 4LNVA 3VFVB 3TIDA 1B2WH 3O3AA 1C12A 3VE0A 1J9CT 2IGFH 3S4SA 4UIKH 3MBXH 1EA9C 1HDMA 2P8MA 3VFOB 4QRUA 1NCCH 3CFDA 4JFED 4ZODA 2OLDA 2AJSH 2ADGA 3DURA 5T5FH 3EGSA 1FLRL 4X98B 1R5WB 2WSKA 4HGWB 3T4AA 1IGJB 5IHZB 4PG9A 5FGSA 5B21A 5CEZE 1FFOA 5JA9A 3B2UC 2VXVL 1GOFA 4FOMA 2DN7A 4YNYB 3IXTB 3MRRA 2FJFB 5KVMC 5IT2L 3CSGA 1S9YB 5HHOA 2IAMA 3BXNB 1CXFA 4XRCB 3FCTB 4XCFH 4GQPH 3KVQA 1T2QL 2VL5A 3QUYD 5C0JB 2X10A 3RBGA 5CJQL 1YECL 5BQ7B 1YEKH 5K9OA 5D6CA 4YUEH 1TPXC 1NH6A 5E1HB 1AY1H 3F7YB 1X5IA 4DZBA 4NKDA 2CXKA 4HWEL 4M1CD 2PUQT 4Q2ZA 1DE4A 3PP3H 1IILE 3VI3F 1F4AA 1YYLL 1NJ9B 2IJ0C 2OI9C 3U9PL 4LCWE 1UQSB 4M6AA 5FECA 2HKFL 5JXED 1QR4A 2BOCA 5FO7B 1R3HA 4CKVX 4KQ4L 1NFDB 4IDJL 3QG7L 2E7MA 1CE1L 1EHNA 3LKPA 4G8EB 3MCLH 3TF7A 1A3QA 4LU5L 2KUTA 3IFLL 1XF2B 2DTML 5HGBB 4XP4H 1GCFA 3SE9L 4HPYL 4G8GE 3S9DB 3UZVB 3TYGL 2JE8A 4D9RE 2WP3O 3TN0D 3V8CA 1RFDH 1K5NA 3KNBA 4LMQE 3DSFL 1MCCA 4GAYB 5DQDH 4MS8A 1J7VR 2HFGL 4R4ND 5C07B 3LH2L 1MRFH 2WBJC 4UZGA 5HHNB 3TNMB 3HNSL 4XCYA 2R1XA 4NHUE 2AXGA 2V17H 3SGJC 3EFFA 3CSYB 4J1UB 5DDHA 3EYFB 4LFHG 1WQVT 4LF3A 5TFSH 4Z7WA 2K7PA 5GZNC 3QYCA 4G8FB 3BUYA 5JIHA 4DAGL 4XVUC 4ZD3H 3L9RA 1AO7E 4MNGB 4KRMB 1TVDA 4L3CA 4M1DH 2YD9A 4NYLA 4C55A 2EDBA 4QYOA 4I8DA 5FO8B 2W0KA 3UMTA 1CGSH 5A16A 1CICB 1N4XH 5DTFB 4R8WH 3KGRA 2ZJSH 5I1GL 1QOKA 1IT9L 4KI5C 4UNUA 3AVEA 2VAAA 3NGBC 1TIUA 3QHZL 4UBDD 4K94H 2VH5H 1NUNB 3CMGA 3GKZA 4XBEL 1E0OB 2APBA 2I60H 3AREC 1EEZB 3F7RA 2R4SH 4RQQB 4WWKD 3O11A 3MV7A 4NZRH 4QRPE 5KSBA 4WFHE 3PIQB 3O2WL 5J6HA 1JHKL 2W9LA 4S1QL 2W9EH 2YPLE 5IW3A 5IB2A 1LO0H 5EZJA 4Z7OE 2X9YA 5K9QI 1WCQA 3IFNL 3MRMA 5D7KD 1N0LA 3PWJA 1NDGB 1S7QB 3I02B 2IANE 4UT6L