2MHAA

Crystal structure of the major histocompatibility complex class i h-2kb molecule containing a single viral peptide: implications for peptide binding and t-cell receptor recognition
Total Genus 55
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
55
sequence length
270
structure length
270
Chain Sequence
GPHSLRYFVTAVSRPGLGEPRYMEVGYVDDTEFVRFDSDAENPRYEPRARWMEQEGPEYWERETQKAKGNEQSFRVDLRTLLGYYNQSKGGSHTIQVISGCEVGSDGRLLRGYQQYAYDGCDYIALNEDLKTWTAADMAALITKHKWEQAGEAERLRAYLEGTCVEWLRRYLKNGNATLLRTDSPKAHVTHHSRPEDKVTLRCWALGFYPADITLTWQLNGEELIQDMELVETRPAGDGTFQKWASVVVPLGKEQYYTCHVYHQGLPEPL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of the major histocompatibility complex class I H-2Kb molecule containing a single viral peptide: implications for peptide binding and T-cell receptor recognition.
pubmed doi rcsb
source organism Mus musculus
molecule tags Histocompatibility antigen
molecule keywords CLASS I HISTOCOMPATIBILITY ANTIGEN (H-2KB) (ALPHA CHAIN)
total genus 55
structure length 270
sequence length 270
chains with identical sequence C
ec nomenclature
pdb deposition date 1993-07-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00129 MHC_I Class I Histocompatibility antigen, domains alpha 1 and 2
A PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2mhaA02
3.30.500.10 Alpha Beta 2-Layer Sandwich Murine Class I Major Histocompatibility Complex, H2-DB; Chain A, domain 1 MHC class I-like antigen recognition-like 2mhaA01
2GITA 4M03A 3DXAA 4I2XB 4HKJB 4PP8C 2W1NA 1MIEL 1RD6A 3VDAA 5CEXB 1NDMA 3T77B 3CXHK 5DI8A 5E2TL 2A73A 2KUTA 5GHWH 5EDXA 3RIAK 3WFHB 4PJ8D 2G5BB 1QSED 4KI5F 3OXSB 4IOSD 4NO5B 1IAKA 3GMLB 3PWVA 2YPVL 1LK2A 5SX4H 5SX5H 1FVCB 4JRYA 4XZUB 1WIUA 4DUWA 5D1XB 3LZFH 3QG6B 4GSDL 1N6QH 5JXAL 4D9RD 4CNIB 5EA0H 4YFLF 2DTMH 4E0RA 2P5EA 3MV9B 1KIQB 3IKKA 4N0FB 1IGIL 4NZUL 1KCUH 1XF5A 5ESQB 4KUZH 3VFOA 3CDGA 4GBXD 2X4UA 1U6AL 2BY3A 4X6CE 3WXVL 2B5IB 1G1YA 4L4TD 1TMCB 1JYVA 1OLLA 1GGYA 2HAZA 4LHQB 3JWNC 1YPZA 3D25A 1QBLL 2R2CA 4HCRH 4I0KA 4JY6B 4CN4A 2DJSA 1XGYH 3IETB 3VFVA 3QIWA 1ADQA 1MHEB 4N8CL 15C8L 3BPOB 5MI0B 3T2QA 3G6AA 3O3DA 4MHHI 3VGBA 1C5CH 4Q2ZA 1RJZA 2AJXH 4OLXL 4KK8D 4RSVA 3OKOB 5EZOH 3DUUA 4HDIB 1ES0B 2GJJA 2P8LA 1K4CB 1UJTA 3D2UB 5B3JE 1U93A 2K7PA 3BXNA 3V0VB 3THML 4ZFOB 4NRZB 4XCYA 1WQVT 2MTPA 4HIXH 5FUZH 1H8OA 1A6WL 5IR1B 1S9XA 5DEFA 3UTZB 2ZSVA 5CBEB 3FCTA 3VGAB 3ARFC 4LSQH 5FO9A 3WHE0 4J3XA 1MCPH 3PWPE 5FOBB 1U3HD 3TO2B 5IVXB 2LTQB 3VFVB 1BFOA 2LE9A 4KPHH 1QHOA 1NLDL 4I48A 3RVXC 3V6OE 1Q9OA 3PUCA 3BISA 2IQ9L 3K3QA 5EOTA 4JE4B 5C9KA 3OTTA 1I1FB 1RJZB 3HAEG 4LLDA 1QPPA 4MJ4A 1FFRA 2CQVA 4O58H 3KLHC 3TBYB 3PNWA 1JHLH 4M1CD 2X05A 2O61B 2NLJB 3ILQD 3CLEH 4L8SA 5KSUB 3PP4H 3CU7A 2VAAA 3SGKC 1I9EA 4F57L 5ESAA 3L5XL 3TCLA 4KZEH 3QIUD 1FZJA 1G0DA 4EVNA 3BEWB 4N9GA 1JGLH 5ECJE 3L5XH 4KZEL 2LAAA 2WUBL 5IF0B 2Z93A 5IB1A 1Z6JT 5DHVA 1I9JL 2NY1D 5I73B 3EYFB 5AUMA 5BMFH 4NOFA 2HFEA 3PGCB 3DX8B 3E2HA 4P48A 1EJOL 2HYMA 3T8XA 4JZJC 4XH2B 1IAKB 4M5YH 4ISVA 4NQCE 3GJEB 4QT5B 1JFQH 5IFAH 4XPFL 1NDMB 4K71B 3W9EB 3QIBB 2E7CA 4NZJA 3RY6C 1XF1A 3AC0A 1CFSB 2BZDA 4N8VA 1JHTB 1KB9K 3KPRE 5DJ8A 3WNMA 2ADGA 4UBDC 1S7VA 3BEVB 1F3DJ 2BNQB 4AH2A 5BOZG 3EJZC 2QSCL 1NGYB 4O2EA 5ESAB 1SM3H 5DA0B 4P9HC 3C6LC 2PYED 4Q9RL 4XC1L 3UP1A 4X6DB 4GUPA 4EUPG 3BP4A 3P9WB 3LPWA 1BFTA 4CVXA 5IP4A 3LPGA 1YPZB 3VW3H 4XHJD 1J0IA 1OY3B 5LCVH 4JFPA 2APTA 3FMGL 4LSPL 5FHAH 2NY3B 3VXSA 5SWSE 2WBKA 1G7LB 3FRPG 2Q7YB 4WU7B 4F9PA 1Q0YH 3IDGB 4NUJA 2V5MA 2IH1B 3MJ7A 4LPVA 2V2XA 1FFPB 4JPVH 5D70H 3I6GB 2GQHA 5HHOE 2XZZA 5E8OA 4DN3H 2PN5A 5DUPH 3KS0H 1MLCA 5B4MD 1N0XL 2PETA 3VFSB 1NC2D 2ADGB 3REVA 2P8PA 4HCRA 1KOAA 1NCUA 4NRZA 2WIIB 4LRNH 1QLFA 3L3JB 3HNVH 5KG9A 5F7YC 1GGTA 3U30C 3IF1A 5E2VL 4L9LC 1QA9B 5AZ2L 4JFYA 3DV4A 3A67L 1HIML 2JJVA 3NFSH 4FZEL 3TYGL 2B8OT 4YHPB 3WUWG 4MAYA 1HIMH 3NFSL 4WIQA 3GSNA 5EFIA 4D9LH 4Z7OF 4Z95L 1BFSA 3O0RL 1G7LA 5TQ2L 2EZ0D 4R96A 1B6DA 3NFNB 4YDIH 4Z95H 2Y06L 4Q6IC 2VB5A 5C70A 1YY8A 4ONGL 3PQYB 5F7FA 4BH8B 2B1HH 3PL6C 3LEXA 3T77A 3ZE1E 2EYRA 2YSSB 1L0YA 3LIZL 1A6AB 4TPRL 4XVSL 5CWSB 1JFMA 1P84K 1JK8B 1SEQL 3QHFH 1E6JL 2DQCL 5F97E 1CZ8H 2JIXD 2VL5B 4OCXH 4BFIA 1FAIH 1T1WA 5C0EB 3U82B 3DO7A 1R5IB 1ADQH 2NXYC 3K74B 5I30H 4HWBA 3FN0L 2X4SA 3T3PF 5D6CA 4O2CB 2I24N 4AENA 4GBXC 3LKSB 1CDGA 1A1NB 2FRGP 2VXQH 2ARWA 3WFDH 1DBAL 4EDWL 3A6CL 4GFTB 2CO6B 4K3EH 4OZ4A 5GZOC 3DVGA 4EDWH 2DQJH 4WJ5A 4JPIA 5HDQH 2YPKB 5I1AA 4P9ML 3CDFA 3B9AA 1VGEL 4MQXD 5TH2B 4TNWF 4WWKB 3ULVL 4Y5XB 1E0OB 2DQFA 1JGDB 2ITCB 4KK6D 2A77L 2Z8VC 3I3EA 2ITDB 1T1YB 3DXAE 1YY9C 2YD5A 3SDXE 2VISB 4GQPH 5GRJH 3OF6D 4P3WA 4FFYH 3P30L 1NBZB 1I1AA 5IJKC 2I60L 1A2YA 1J0ZA 2IFFH 12E8H 4X6DA 3CZFA 5JHDE 3QH3B 5EC1B 3CFBB 4UUJA 3V9FA 3GK8L 1RU9L 2WINA 3VFPA 4F7EB 4X6BA 4KKBC 1WF5A 2Q87A 2NY5L 2D9QB 3ME0A 1HXYA 1UCBL 3STZA 3M45A 1FNSH 4DOHB 2E9JA 4GMTH 4XMKH 4HH8A 5EO9B 3ET9F 1RIVH 5TFSH 5KSBA 5FYLD 1N6VA 3KG5A 2FJFB 4EJ1C 3TEUA 1F3RB 2H2PC 1IQDB 3E6FA 1BWMA 4MCYB 1F58L 2NY1C 4PGCB 3T2OA 3RA7L 1T3FA 5DSCB 3V0WL 2AXFB 2CIKA 2IG2H 2DQGH 5IM7A 2J88H 4LQ1A 4H26A 4QYOA 3X17A 3QG6A 2VLLA 4M9OA 4GXVH 1PKQA 1JTPA 3W82A 4WNQB 4U1JB 3UJTH 1K8IA 5CMAA 3ZDXF 1JZ2A 5J6GA 1NCNA 4C59B 1GZPB 5EOQL 1WFTA 1VB9A 3LZFL 3U30B 4PJFF 3VFUB 3QULA 5BZWB 4MD4A 1TZIB 1A7RL 4UTBL 4UBDD 3R0NA 3KPLA 4Y89A 5GXBB 4WI7A 2YHGA 4HKZA 4WUKL 4NFCA 1R0AH 3PGFH 2NY6D 1J8HA 2Y25A 2BSRB 5LKNA 2HJFB 4OD3L 6FABL 3QPQC 3QIWB 2MFNA 1OSPL 5I74C 4TSCL 1H9VA 3BE1L 1SQ2N 1TPXB 1JPTL 1CK0L 3ARVA 1H3VA 1UXWB 2AJ3B 4M6NH 2EZ0C 5ENWB 5D1ZC 1A6AA 5INCA 5D4QA 4MLSA 2MQ3A 1T6WA 5HHPB 15C8H 3ZYOA 4G59A 1CLZL 1U3HB 2EDOA 5EU6D 3UTPD 3K1DA 4G43A 2AK1H 3ZKMC 3QIBA 2HFGH 3JBG7 1FNGA 1E4WL 3VXMA 3UC0H 1A7PL 2DLTA 2NX5A 1N0LA 1S5HA 5BV7H 1WAAF 3DBXA 3EOAB 4ETQA 1A6TB 3MRCB 2F58L 3BWAA 1AGBB 5D7IE 3O2WL 1Q94A 1UH3A 2GTZA 3G5XB 1ZA6B 4WO4A 2Q3ZA 3O3UN 5BVJA 1WC7B 4PUBH 4WV1A 4JANB 1JGDA 4Z77B 1U8KA 3V8OA 4HS8H 4LCUA 4PRPB 1Q72L 3BDYL 3WNLA 4MQXC 3M17A 5TPWH 3L3DB 4X8XA 1A6UL 3QNXB 3FO2B 1PYWB 4R90L 2XQBH 2V5SA 4ZFGL 1P7QB 2BRQA 5F9WB 1ORQB 4AZ8A 2JELH 2M26A 4IMKA 4FQJL 3VXUB 4YQXL 3SJVE 5EC1A 4HK0B 4EZMA 1FVEA 1MSPA 5HYSA 1XF5B 4X6BB 4HV8A 4YDKH 1NC4D 4N1EA 1U95A 4RGMB 2KQNA 3MYJA 4ZS6C 4X6CB 4QRPD 1FL3A 4XP9H 1JWSA 4YXLH 5I19H 3MUGB 3Q6GH 4U6YB 3HI1B 3VXUD 5ADOL 4WI9A 1AC0A 1OAZH 5I8OL 2X4PA 4P4RA 5D2NB 3G5VB 1II4E 2H9GB 3ZTJH 2R1WB 4LIQH 5GRYA 3NTCH 4HIJA 4OGAC 1U8LB 1RZ7H 4N0YL 5HHMA 3VRLE 5ANME 4KPHL 1B4JL 4OAWB 4X7DC 5KSBF 3OKYA 3DGCR 2B0SL 1XF4A 4OCSH 3RJDA 3RDTB 3GJFH 3JWOC 1FV1A 5FKAB 4Z7UA 1TJHH 4GBXB 4PG9A 3RVWD 1FDLL 1FL6A 3UBXB 4NQDD 5J1TC 1CLOL 2W0FA 1AQDB 4TVSa 5HPMB 1VCAA 1HWGB 4PJCA 1PGRB 3DLQR 25C8H 4J3WA 4IRJC 5IW6A 5AZEH 3LB6D 4D0DB 4FG6D 1JYXA 4PV8B 4CJ0A 3GSNH 2EXWC 1KF9B 2PKDA 3RL1B 3L95B 1P2CA 4WHYG 5KW9H 3ALWA 3E1F1 1IC4L 5J57B 4YHYB 4XC1H 1MRDL 2QSTA 2VZ3A 3HUJF 2ZSWB 3BW9A 3U4EB 1U8IA 4APQB 3K8LA 3S4SG 4AK1A 1MRDH 5GGTL 3RWGB 3F7PC 3U2SB 3FQXA 5LCVL 4NZUH 5MENE 3WO4C 1X9QA 2EH7L 2E7HA 1XIWC 1FN4B 1BIIB 3G5YB 3IS1X 2P5ED 1U3HA 4XNZB 4AQOA 2UZYB 1XF4B 3EDEA 2A9NH 5F8RC 5J4MA 2NR6D 1Q0YL 1G1CA 1X5GA 4R4BA 2RAMA 2OQJB 3LEYH 1QNZH 1MY7A 3TA3B 5BXFA 4JKMA 1LQVA 1J12A 3WIIL 1LO3L 1ZSDB 1UACH 3HAEH 4YHLH 2AK4D 5HYQB 4AMKL 4XBGB 1WSST 3L3JA 1R3IH 1YEIL 2NY5C 3HRZB 1BVZA 4PRAB 4XC3L 2D2OA 2AV1B 3RAJH 3KYNB 3S35H 3TIEB 3OXRB 4QRRE 4XPTH 2HLFC 1R3LB 1OP3K 3AB0B 4XPBL 3K8MA 5GS0C 4JN1L 1X6LA 3X14A 5TDPA 3V2AR 3WN5C 3BRFA 3CVHB 1ZT4A 4HZAA 3EFDH 1YYLL 2FD6L 4WO4B 2DB8A 3MRDB 1OAQL 5FA3A 4PY7A 3TNMA 1AGDA 1WWCA 2G2RA 3KPMB 4YFLI 1TTUA 1AO7B 2IC2A 3QIUB 3VFWA 5IB4A 2GKIA 4F15C 2O5XH 1JPGB 3NA4A 4D8PB 2X89D 1ETZB 1T2XA 1C1EH 4XVSH 4HGWB 1PW3A 2DQDL 4YO0B 1GGIH 3LAFA 4GAYA 4OJFL 1A4KB 1GH7A 1QTYT 3L9RB 4E41B 2CKBH 4KQ4H 3MCLL 4PRAA 3LQAH 3MRIB 1UT9A 3QT2A 3T0ED 5EIIB 4OFDA 1RJYB 3PHQB 5F9AC 2CUHA 2J6EH 4MNQA 2CDGB 3D9AH 4KDWA 5I2IA 4BKLA 4QO1A 2C1OB 2OTWB 1R3HA 3NH7L 4KMTL 4RWYL 4JREB 2MKWA 4J6RH 2ADJB 5TE4L 5E7FA 4UT9L 1XGRA 3EUUA 3GIVA 4M4PA 2BY0A 3K4AA 1LE9A 3I75A 4HGKC 4BQBA 5FFLA 2GEEA 1LNUB 5SV4A 4DKFH 2IPKB 5HGDA 4OB5L 2BRRH 2J8OA 1V3MA 4M6AA 4TNVF 4WVRA 4XX1E 3W11D 32C2A 3QXAA 1FBIL 1X3DA 3O6FC 1I1YA 2X4RA 1ROWA 4D0DA 2WW8A 4QOKD 1RULH 5D8JH 2F8VA 3LN5A 4FTVE 4S1RL 3FKUS 4HLZG 5HI4C 3RL1A 3WFCH 1U8JB 3RTQB 1OSZA 5IGXH 1ADQL 4YHZH 5LWYL 5CHNA 1DZBA 1BECA 4NBXB 4PJGF 5EO1A 4M5ZH 1IC5L 4Y0GA 5SWZE 3IU4L 1P84J 4HJ0C 1INEH 4L4VA 4NM4L 5CUSH 5D72H 5AWNH 5ILTH 5C0NC 4NM4H 3KR3H 1DQMH 3RY4A 4L8BB 4ZYKA 3UTQB 1VFMA 3PE9A 3VE0A 4N1HB 1FFNA 5SWZB 1QSEE 2QADD 3QG7L 5D6DC 1F11B 1YMME 4PR5B 3EKCA 3HE6D 3GMOB 5DEZA 4MJIE 5EU7E 1BBJA 3T3ME 3TVMD 1MLBB 4KVNL 5B39A 5CJ5A 3QWQB 1Z0NA 2V17L 3W0WA 4LEOA 4OFYA 4ORGB 2J88L 5HHNB 1JN6A 4EN3B 1RUML 4N90D 1WLHA 4UQ3B 5I16A 4MXWL 1G6VK 4JFOB 1BAFH 2IFFL 4MS8C 2VERN 4XCCL 1BQHA 3O81A 4H1LH 1J9CT 2Q3AA 3IXTA 3DVGB 5FGSA 1S3KL 1IGJB 5JDSB 1IMHC 3O4OB 4JPKL 4MZ3A 1EIBA 1HHJA 3NIFF 1U8OB 3G6JA 3KWWB 1JNHA 4G6KL 1IAMA 2F9BT 3T0DA 4YE4L 1MFAH 1R6VA 5AG9A 3A67H 1RHFA 2HRPH 43C9B 5C0RH 1RZFH 3VFNB 2R29L 3V6ZA 2BSSA 5E99H 4NWTL 3V8CA 3TP4A 2KKQA 5FGBC 5FV2A 4JZJA 2BVQA 2DI9A 1CGUA 2OP4H 3BH8B 3CFBA 2R1XA 4H8WL 5ESQA 3O3EA 4MXQA 3SDDB 4OLZH 1VHPA 3DBXB 2V7HB 4XCEB 5E8NA 3TPUA 2XZCL 1AXIB 3E8UL 1G9NH 2IQ9H 4MNQE 1R3HB 5MHSD 5C09E 4Y4KB 3R8BB 1OPGL 3LY6A 4JFEB 4LPWA 3MZGB 5E7BA 4ODTL 2ENYA 3IDMB 3FN0H 3WJLC 5EU4B 4I2XE 4CN1A 1EV2E 1DFBL 1VFAB 1EEZA 3H9HA 1CFVL 4X8JA 5FB8A 4D9QE 3RPKA 3BD3A 2A6IA 3CNKA 5BJTB 1FL5A 2VSDA 4KTEL 1SBSH 1DBML 5K9KB 3LQZA 1AXTH 4Z7VF 4CMMB 3TPUE 4PJHA 1IL1A 3OKLB 3MNWA 1F02I 3RGVC 3SDXB 3CXDL 3V6BR 1AXTL 3WLBB 3PWPB 3RGVA 1GC1L 4OF8A 3PIQB 3JTTA 1U8MA 3CXDH 5JO5B 1UM4L 2B1AH 1MJJA 4YBHA 4JM2F 1MJ8L 4BFBD 3MUGA 1JYWA 4L9LB 5I66A 3ARWA 5FYLL 5HJ3A 4OV5B 4LBEB 1CT8B 1QLRA 2F58H 4GW4B 3H3BC 3MUHL 4EI5D 3V5HB 3N1QC 2IAMA 1J7VR 2C5DC 3GSRA 3MV7A 3VWKB 4J3UA 5ENWA 1GIGH 2OJZL 5AYUH 4UOJA 5C0CA 4X8JB 3BUTA 5DO2D 5FB8B 2AW2A 3VXNB 5I8OH 1RU9H 1F5WA 4RMVA 4JM4L 3S5LG 4Y16A 4OV6F 4Z7WE 4R26L 4L3EA 5J89A 1BBJB 1PSKL 3NCCB 3MUJA 3BHBB 4FQXD 2D7MA 1BX2A 2UWEE 4NZDA 2EE3A 4HUKB 1VADB 3CVHH 2FHFA 1HOCA 1FNGB 3GSWB 4Q7DA 4HKXA 4K8RH 2VMFA 4P3CL 1HH6A 2WM0A 5E08L 2IADB 5C2UB 3NOIA 4P3CH 1MRCL 5C3TA 3MACL 1LP9E 4KMLB 3GI8H 3LKPA 4G80A 4G9DA 1HZHL 3QO0B 1FYTE 5DMIL 3SDYH 1HQRB 1RSFA 4GXVL 4Y1AE 5GJTL 1U8IB 4YUEL 3EYQD 4XCFH 4KGJA 4LDLB 5JOFB 2Q76B 3TVMB 4ZTOL 3RBGA 1ITCA 2OR7A 4OZFB 1OP5H 1KTDA 5D1ZA 1NDGA 4JHAL 3KS0J 5D9SB 1LEKA 2KPNA 1N2RB 4MXVF 4NQSB 5HHOD 4RQQB 1U8OA 2NY3C 4GT7A 1JNHB 5F9OL 4YR6B 3HG1D 3I6LD 3BJLA 4GJTB 3VXSB 1DLFH 3G6JF 3WFBH 3JXAA 1LNUA 5T3XL 4LL9A 1ORSA 1IM9D 1I8MB 1LP9A 3L3OA 4MS8A 1TTGA 4HKXB 1J8HD 2XTJD 2HLAB 4TVPE 3WNOA 1HINH 4P2QA 4RMUA 4GXUM 4J1UA 1QNZL 4NO2B 2X44D 5MEOB 3AAZB 4AEHL 5E94B 3QUML 5D6CB 3O11A 5SWQB 3SDCD 4G8EA 3MO1A 2OL3L 3W2DL 4A2MA 1KLGB 4JFPB 3D18B 1OLZA 1OTTC 3W2DH 1J1XH 3PWLA 4P2OB 4MA3A 2HH0H 5JR1L 3UTSB 3Q0HA 2AXGA 3KDMA 4F33B 2QL1A 2Q8BL 3ARDD 1REIA 3JUZA 4QXTA 5C0AD 1IT9L 5C7XH 3L3GA 1FFOA 1N4XH 3EFDL 4QHNA 2GJ6B 5JIPA 3O41B 3TJEL 2OLDA 2VLRE 5IVXE 3H8NA 1CFQA 3QYCA 2OR9H 5DQDL 5J11B 1T22A 2O5XL 4LCWB 2Q8AH 5C0JA 4FA8A 1LO3H 5DQDH 4K7PX 4HKBA 1FJ1A 4WTZA 3LQMA 4OLXH 1YPZE 4IIQC 4UIKL 2PW2B 1CGTA 2XWJB 5JQHC 2JCCB 1OGAA 4U31A 1I8LA 3L5WB 3F7VB 4M1GH 5GSRA 1ZOXA 5L8JB 2NZIA 3DX7A 3LCYA 3H7BB 4YHIB 4WHTA 5LGJA 1BFVH 2HVKB 5IQ9A 2J1KA 5C3LD 4WI2A 3DWTA 5IROA 4JGJA 1KIRB 4KMTH 2YSSA 1F4WL 3RFZC 4AEFA 4OCLC 1Y6NR 5MI0C 5EB9A 4Q9QH 3NCJH 3WKML 2I9LB 3BSZH 4C56D 1E28A 3VFRA 4U1SA 5HHME 3WKMH 3V6ZB 2PXYB 4ENED 4DAGL 1EAPA 4GMTL 2F5BL 2R23B 3FONB 2WWMC 5C0BD 4OJFH 3T0XA 2F5BH 3MLRH 4F7PA 1C5BL 2FX9H 5LXGL 3ZLQC 5L8KB 2WSKA 2HA1A 5ALBL 4UV7H 3CFKB 3H3PH 5IGXL 5DD3L 1QFOA 1VFBA 4Y4KC 5E6ZA 4LPCA 5DXWA 2Y23A 3KXFB 4GG6E 1ONQA 2BOBB 5KOMC 25C8L 4WWKA 4BSWA 3EGSA 4XP6H 2WLYA 1Q9KA 2R69L 2ZCKH 2I5YL 4MD5A 1Z9LA 1KTDB 4TVPL 3DVNA 1JPGA 4DN4L 2R2EA 1YN7A 1H3GA 5HYEA 4S0SD 2DBLL 3S34L 1AP2B 4Z0XA 4LEOB 1XR8A 4ORGA 2PXYA 1ED3A 1B0RA 4U1IA 1WT5A 4OFVA 5K9JH 4I18C 1R0AL 3WIFA 1CFTB 2PR4H 3O11B 1GHFL 4L29B 3MQIA 3PHQA 2X4TA 3LKOB 5JZ7C 2A6KB 4F7MA 3QWRD 2CXKA 2P5EE 4PB9L 5I2IB 3FQRB 3LEYL 5E94A 3TZVC 3SDCC 5DC4B 3RVVC 4PB9H 4JLRA 2X4QB 3CK0L 3SKJL 3IU4H 1TVHA 5EG6C 2NW3A 1KLGA 1PY9A 3J8F7 4GAFB 4YGVA 4JANA 3QQ3A 3HN3A 1G7PB 4PJCF 1FFOB 3MV7B 3N06B 1J8HB 3CFDA 4CADB 5IMOA 1NFDB 5EIQA 4JY5H 2IF7A 3TBSA 2AS5M 5TF1H 3H2WA 5CILH 3ZTNH 1BFOB 4JFED 2BHZA 2V2TB 5BV7L 4OLYL 3C87A 4WI6A 1T22B 5EPMA 4OQTH 4U1IB 4PGJA 4XNQA 2BP3A 2EEBA 3UTOA 5DD5H 1HE7A 5F9JB 2CRYA 3MRRB 4X9GA 2OX5A 1TZIA 3NFPB 3BGFB 1RUMH 3I9GL 1URLA 4X4YA 1TZGL 5DC9B 5BOPA 5KZCD 5L7XL 4PB0L 3NIFE 3OGCB 1S5HB 1KELL 1KJMB 5LGJB 4N9GB 4YC2C 4I3SH 3V5KA 1F6AB 1OM3H 3S7GA 1K3ZA 1U8LA 1NEZB 4NKIL 2CJUH 3RX5A 1B0GA 2H1PH 1QKZH 3AREC 4U7MA 2YD3A 5MEND 3RWHB 1A5FL 1ZE3C 2XA8L 1V7NL 4CKVX 5DURD 3GMPB 4JQXC 3SJVD 3T3MF 4K3JH 4PJ9D 1WCQA 5A3ID 2D7TH 4OD1H 5C07A 2H32H 5H37G 3ARSA 4UV4H 1VEPA 5DJYB 3ARBD 2D7TL 1TQBC 4HH9A 4MB4A 4WUUE 2VYRE 4YHKL 3MRCA 1MJJB 4M48L 5GRVL 4ELMF 2QADB 3QWOB 4P57B 4ZFOA 3ZDXE 4MMZC 5DLMH 5IV2A 3PJSB 4HV8B 5D1QC 2XN9D 4OV5A 2A1WH 5EOCL 5ICYB 3SKOA 3DUHA 3PF2A 1A1OA 3UTTE 4OGZA 1I1RA 1YNKL 4MVBD 3SCMD 1UG9A 2AEIT 3ILQC 5DHYA 1FE8L 3IDYB 4Y16B 2VQTA 1IC5H 5CEXA 1AI1H 4WY7L 4LU5H 1RIUL 5JQ6H 3CPLB 1K5NB 3GSNL 3BT2L 3VG0L 1ZSDA 1BF2A 3I02A 4K9EL 1FGVL 1QVOA 4Y4FA 2IPTH 5HGHA 3BT2H 2A6JB 1PDKA 2MQ0A 4D3CL 1N7ML 5E8NB 4B50A 4KKAC 4RCAA 4H5SA 5E6IB 2FO4B 3QDMB 3TPUB 5GGTH 2JJWA 2APVA 4PTTB 4EEEA 4HUXA 3PWJB 3E3QA 4RA3A 1MRCH 3BP7A 4FFYL 5JW4M 3MGOB 1XZ0A 1C7TA 1QBLH 1J10A 4HCRL 5GSRB 1U92B 1SVCP 2QQNL 4I0PB 3MRLA 5E6ID 4WO4C 4ZPVA 1T6VN 1VPOH 5F7MC 3UAJC 3MFGB 1GIGL 2OJZH 4LOUC 3TLRA 1WT5C 3EJZD 3EYSL 3P4MA 3MLVL 5LAXB 3K4DA 4FQIH 3ARDC 2I07A 4OKVB 3QA3B 4HF5H 4R7DB 3MROB 1TLKA 3MNWB 2EDJA 2P47B 4OGYL 5FECB 1F4YL 5I1LB 3VXOB 4LCYA 4BK4A 1IAIH 4XPTL 3PWUB 2Y7QB 3NZHH 5TF0A 1F4YH 4PJBB 4K8RL 4QOKE 2Z4QA 4G9FD 1IGTA 4QXWA 3RUGF 3OGCA 5ISZA 1HQ4A 1RZFL 4HUUB 3GSXA 2PW1B 1YEDB 2VDML 4ZOCA 3LD8C 3Q48A 5FGCE 4NWTH 5D7KD 3U9PL 2AV1A 3SE3C 2HN7A 3PWLB 1JF6A 1TCRB 4IDJL 1SJXA 4U6HA 3OB8A 1IGCL 2BC4B 4YHMH 5EOQH 4GKNA 1RZGB 1MY5A 1MCWW 4Y19E 2X4NA 3M8OH 5KAQG 1VERA 3HE7B 3T0EC 5I1CH 2Q7YA 5CAYB 1Q0XH 1AFVH 2HJLA 3DURA 1WWAX 4PD4K 3LQAL 3V4VL 5KSAC 1FNLA 4X9BA 3GKZA 2EDFA 4MNQD 4XWGL 5F6HJ 5C09D 3DHJA 5IVXF 1PKOA 2J6EL 3T0EE 5INDB 5I8CB 1H0DA 3B5TA 4LIQE 5BRZA 5T3XD 2DRUA 2WBJB 4JFQB 4XHJC 1I1AB 5CHNB 2Q8AL 3T0AA 3WV0A 5BVPL 3VA2C 2XT1B 3G04B 4OT1L 2P8MB 2A6KA 3Q5OA 3AUVA 4MJ6B 1L7IL 5BMFL 1QBBA 5TQ0H 4LHUA 3GB7B 1PD6A 3QUZD 1W8OA 2WINB 5FDYA 2BC4A 3QWOA 4P57A 4F7EA 3IXAB 3LOWA 1C16A 4ODVH 5KS9B 3VMOA 1KN2H 1AD9B 1E4XI 5AAMA 1P7HL 2X1QA 5SWZA 4LCWE 4P23B 2Y07H 1GVIA 3MLWL 5C7XL 4MCYA 1PZ5B 2Y9RT 4HJ0D 1I4FA 2P5WB 4RISH 1HCVA 4Z7NE 4DVBB 4PUBL 3ARED 2GFBA 1OF2B 1MCWM 1A6WH 3QUXB 5LBSL 4EKXA 2FHCA 5E6IA 5GSVA 1O0VA 3C5ZA 2I9TA 1Z9MA 5HVWA 3HZVA 2YUWA 4Q9RH 5D7IA 1RIHH 4IEFB 4FZ8H 2X4RB 5JW4N 1T5WA 3INUH 4GS7C 3AREB 5EN2B 2FR4B 5H94B 2QR0A 4I0PA 1MI5B 3LKSA 4YHNB 3FMGH 2DYPA 1AO7D 2BHYA 1W0VB 4KKLC 5CZXD 4ODXB 3TVMC 1IFHL 5F1SA 4S1SL 3FFDB 5IHZA 3I2CL 4M4RA 2R0ZL 3KPPA 4XI5C 3KPSE 2XN9A 3EIFA 3ULUC 3QZWB 2IH1A 2CO7B 2GJ6E 1LD9B 1KYOJ 2GYSA 1BAFL 2VLKA 1SEBB 3RIFF 4ZO9A 1J0KA 4NO5A 1D5ZB 2HKFH 3O4LD 2ZUQC 2OXHA 2X40A 3MCKB 4KV5E 5L0QB 1TETL 4C54A 5J12C 4HUUA 3BPNB 4MNGA 1TJHL 4CRPA 4JM2C 5E4IA 3SQOH 4Y5VB 4KK5D 4MXVE 2GUOA 5DVLA 1KCVH 4XNMB 1FC2D 4MWFB 5CP7B 1M7DB 2N56A 1IGJA 1J11A 2YA2A 4KK6C 2KZ1B 1Q94B 5DHYB 2IQAB 1DUYA 3MRJA 5JORB 3AGVA 3RIAF 4X5XA 4NQVA 3MV8E 1QRNE 2CK0H 5JIIA 2YD2A 1MLBA 2FWOA 3N1FC 3CX5K 2XQYK 4O9HH 3BRGC 5EBWB 4DN4H 4L8CB 3A0OA 5FM4A 3PV6B 1CZ8L 4CBPA 4R3SB 4H26B 1CS6A 4KUCF 3UAJD 4IOFD 4QWWD 3RWDA 4LSPH 5JO5A 3U4BL 2VXUH 2FO4A 3QDMA 1NCAL 2ZNWA 1Y6MR 3RZCB 1KG0B 4XB8A 5BS0D 3MA9H 4YAQA 3EDKA 3RVTD 3MOAL 5T1LD 3FOMB 4TSAH 3RWCA 4JZOA 2ZKHL 2FX7H 4M3KB 5F1IA 2FNBA 1FNAA 3JV6A 4NWUL 2WK2A 2XKSA 4M7LL 3LEVL 4UAOB 4HKJA 4JFXB 4HC1L 4QRRB 2NYYC 4H1LA 4HXBL 4EDXB 1UM4H 3UJJL 4UMGA 3JV4A 2ESVB 3P30H 3U9UA 4JR9L 1MVUA 4HMCA 2A9ML 3HG1A 3KYMB 4MAUH 1UADC 4OCWL 2DLEA 3QRGL 4OCYH 3IRPX 4L1HA 4XAWL 3QUYA 1NQBA 4G80B 3EBAA 5EUKA 4GO6B 4M7ZB 3ARQA 2D4DA 3LDBC 4UAOC 4OIIL 3JWDL 3OJDA 2ZPKL 4ZPTB 2ED8A 1HYRC 3ALPA 3TV3H 1O7SA 2DIBA 2W65B 1RMFL 1WJ3A 4RAHA 5DLML 5D5ME 1RZJL 4Y2OA 2QKIB 2A6IB 4M8VA 1RZGA 3BKYL 2NXYB 4ZD3L 2BNUA 2BNRD 2OJEB 3IJSA 1A9BB 2NXZD 4R4FL 5I30L 3N1MC 2EIEA 5CZVH 2X41A 2QQLH 2HJLB 2DD8H 5IEKB 5BZDB 4QRUB 3OX8A 5MEPB 3O2DH 5DHVH 1QLEL 3EYQC 1T89C 5JA8B 2FLRT 3SDXF 4MDJA 5ADPL 4F37F 3MRRA 3WFDL 2OM5A 4R4BB 1CD0A 1E6OH 3V5DB 4Z9KB 3WHXB 1NMAH 3VWJA 1IZJA 3T1FA 2VLJB 3DIFB 2M1KA 3ULSA 3PWJA 1X4XA 1YEKL 3ULVH 4EUPA 1SMOA 1M7DA 2EO9A 3DSNA 1RZ8B 1UXSA 4G3YH 3VG9C 3B2VL 1Q1JH 1J1OL 2QQKH 2BNQD 5T1DL 3F62A 1RV6X 3DRTA 1S8DB 4J7RA 2OTUB 4MLIA 4OLUL 4PJEB 4RRPG 4NQDB 1RUQH 1VA9A 1A6PA 1MH5B 2VDQL 2Y6SC 3SDAD 2WMPA 3QA3A 3RWFA 3Q5TA 2DQUH 5F7DA 3CK0H 3QFJA 4AEHH 3LKQB 4ZUSB 5D7JC 1J0JA 5F7WC 3TBYA 1EO5A 3GK8H 4JFFD 1AGCB 5IK3B 5ID1B 4OD2A 5KSVA 2XI9A 4PJEF 1UM5H 3CC5B 4PJXE 3UC0L 2ORBH 3O9WC 4K2UL 5AEAA 5TF1L 1AXSB 2GY7B 2NX5B 3ULUD 2PTTA 4WUUA 5DJDB 2HLAA 1OARL 3O8XD 3C6LB 5F6IC 4OZIF 4OQTL 2WQRA 2AAVA 2HN7B 1KGCE 5K59F 1KV3A 1KCUL 3BKJH 2HFEB 5I9QB 3NCYP 3RY6A 3WNNA 1MF2H 5F89A 4K71C 1FZOB 5GRUH 1G7IA 5FDWB 1MFBL 5ICXB 3TH4T 3KPNB 4JZOB 3SPVA 1V8HA 1H3XA 4XI5D 5GRUL 3O6FA 3K4ZA 1QRNA 3ZSSA 1P4LB 1SBBA 4ELKA 3CVIL 4P5TD 3KAAA 4KI5E 1A7RH 4GRLD 4UTBH 4HIIB 4IRJD 3G6AB 3O3DB 1WITA 3CUPA 4ACPA 5IM7B 5IMLA 4LMQI 2YD4A 3H9YA 5F7LB 4QF1A 3EDDA 4X80L 1FP5A 2HRPL 4P99A 3MPCA 4ODWA 4WNQA 1OTUD 4YFEA 3MLYH 5DEGA 4O51A 3P77A 1U92A 3GGWA 2XYCA 3QI9A 5HVGB 5IIEB 3SGJA 4HZLA 1CXLA 3QUKB 3EFFB 1TDQA 1JJUA 4P4RB 1MELA 5D2NA 5JW5A 3OJDB 1W0WB 4NN7B 4EQ3A 1JV5B 3AMKA 4Q9QL 2AV7B 4HIJB 2OJEA 3QQ4A 1TJIL 2CDEA 5CBAA 1KB5L 1DUYB 5TE7H 4DAGH 4S2SB 4KZDH 4I2XA 1YN7B 1HHGB 1OTTD 3CMOL 4NNYB 1IGFL 1L7TL 3W9DA 2HMID 1BQLL 3HNSH 1BHGA 1AR2A 3VXSE 4PG9B 3CFJA 4M5YL 3V5DA 3DPBA 3V0AC 5HHPA 1ZHBA 3RIFK 3PWVB 2C1PA 4QWWC 3CSYA 5EBLA 5DMGD 1T5XB 1XCQB 4I4WA 4JO3L 4WY7H 5LBSH 4XNUL 4KTEH 1MOEA 2CLRB 2JCCF 1JUFA 5IF0A 2RBLA 3U36B 2F8XC 2ESVE 3NIGF 5F1KC 2IMMA 3T1FB 3NMEA 3VGHA 4TOYH 1RK0A 4BSVA 5ITFA 1FVDB 2BOCB 4JM2A 1RFDL 4PJGE 2C9AA 5EO9A 1MQKL 1RZ8A 3WE6B 5LVEA 5F21B 3OKEA 3VXQA 3MLUH 5B3NA 5T5NF 2Y72A 4DQOL 1A1MB 3WL9B 3WO4B 2GTZB 3G5XA 4Z7NF 4X83A 4GRWB 1XGRB 5HI4D 1DUZA 1YUHB 1XIWD 1ZK9A 4DQOH 1T0PB 3HAEB 4G8GE 5T3ZE 1PX3A 4W70A 2BJMH 4HWEH 4X5WB 5HYJA 1V5JA 3WIIH 3C6SA 4PJDA 3WS6C 2FL5B 1F4XL 3L7EA 1DSFL 3MRHB 1UACL 3IRZA 4GKZB 4OD2B 4G8FA 3MLVH 5MENB 1MFEH 1TNNA 3G04A 3MGAA 5DVNA 3F6IA 2DL2A 4LSSL 3CGTA 4ZO7A 2NCMA 5C9JA 3IFPA 5IKCB 3QUYB 5I1EH 1C5DB 2UY7A 4XCYB 2CLZA 4JY5L 1KJMA 3HNVL 3KPLB 4JGUA 5ERWB 3TFKD 2ZP0T 4NUGH 3B9KA 2IBZX 2W65A 5H8DA 3T0EA 1QSFB 5FOBA 2E7LE 1UB5B 1IFHH 5IB5B 5FA3B 3IDMA 4WW1A 5GGUA 5T1KA 2VLRD 5IROC 1BP3B 3GMRA 4OLVL 3V4UL 1V3JA 3HPLB 3C09C 4ZTOH 2P43B 1NCWH 4I3RL 2R15A 4G8IB 2VDOH 2ICES 3EYVA 5K9KA 4MDJB 5I1CL 1FO0A 2YEZB 5HXMA 4HUVB 3K0WA 3VGFA 1U8NA 5T3XH 3AREA 5KSUA 4PV9A 3NIDF 2VDLL 1ACYH 1C5DA 2J12B 4OZGE 3QEQA 5I75B 3O9WD 5F88A 5FHBL 4KHTL 4XMPH 2J7LA 3QQ3B 4DW2L 1V7NH 2XPGB 4XNXH 4ELME 3ZT5A 3H9ZA 3BO8B 3GMNA 1FO0H 3N85H 4UDTB 1JIBA 1NGXB 2BFVH 4FQHA 2BDNH 2VO5A 3ARBA 4PLJC 4MXQD 4C56E 2RHEA 1ZLWH 4LCUB 1H3TA 1T2JA 1DN2A 4WDIA 5IT2H 4R96B 1PG7X 2VLJD 3FN9A 2BX5A 3SE9H 1TCMA 5EH1A 1KCRH 4FFWD 5GGVL 3VFNA 4RGNB 4ZNCD 3BN9C 3LN5B 1SEQH 3MREA 4KKBD 4R2GC 4NKOB 3R8QA 5BO1L 2X5PA 3BD5A 5B21A 5CJOL 4AH2B 2A74A 4QHLB 4Z76B 3GO1L 3MV01 2R1YB 1YEEH 4IHOB 1CDYA 2VXTH 1JZ5A 2BOCA 2QHLA 4M7KH 4YDVB 3LH2L 2ICCA 3R06B 3KYNA 3K2MC 3CSBA 1JF5A 5TDPB 3TJHA 2E5EA 4V1DA 1TQCB 1ZHLA 4N0CD 1OP5K 1MWAL 1UCBH 1KJ2B 3OB0K 3RGVD 2PCPA 5DZLA 2GAZA 2DQDH 1MWAH 2AJ3A 3AU1B 4LSUH 4NWUH 1G9NC 4KKAD 2CRMA 3TBVA 1OGAD 4Z7UF 2FL5A 1XGTB 4OAWA 4GKSA 1A8JH 2V17H 3IFNH 4G8FB 1NUNB 1D9KC 4GW5B 4WEBL 4DGIH 1XT5A 5CSGA 1WZMA 2NY1B 4LPTA 1B4RA 2GTWB 1B2WL 4Z18A 1QVOB 3QDAA 4Z0BL 4YO0A 4OCWH 1FLRH 1HQ4B 2DMBA 3ULVD 1IM3A 1F2QA 3VGGA 2YR3A 2A6DA 1AKJB 3QDGD 4NP4H 3O3BA 5DMKA 2CXGA 2AI0L 1U8HA 2P44B 4FQIL 3MO1B 4LEXL 3P11H 2Z35A 3CFEB 3KWWA 5GGQH 4WCYH 1WCBA 3ARUA 5DSCA 5EFIB 2UUDK 1UA6H 4N5UA 4GG6A 4V3DB 1ZLWK 4LCWD 3H0TB 4UV7L 4DVRH 2ERJB 4P0DA 1P7KA 3SE4C 4PGEA 4OM0L 1B3JA 1MCFA 4N1CA 5I8CA 5M95B 2XQYG 4OSUH 2C1PB 4WWKC 1I8LC 5J1SC 4PTTA 2HP4A 2VL5A 4BFIB 5FUCC 5C0EA 4R0LB 3BDXA 5IEHA 2IMNA 4K2UH 2NY3D 1N6QL 3TZVB 5DJXA 3OWEA 4GRWH 2C4FU 1LDSA 3HPJA 3M8OL 1KCKA 3LKPB 3NCFB 5FEBA 2VTFA 1SY6H 3LS4L 3C60C 1JRHI 1KULA 1A64A 5B8CC 5EU4A 4I18A 1TCRA 4RFNC 2QQKL 3IJSB 4Y5XC 1WEJH 1N8ZB 2CKBA 1C12B 3IU3A 3TT1H 4LP5A 3S4SB 1R24B 2N1KA 1XGPB 2ZCLL 5T1LB 1CK0H 4IRSA 3HE7A 5CINL 1CDCA 1UXWA 2F8OA 1A6UH 1C5CL 3BKML 2VKXA 4Y16D 5TQ0L 3BH9A 4OF5A 3RUGB 5HTSA 4OZIE 4J3OC 4XVTH 3ROOA 3RP1A 3NABL 1EJ6A 1I8IA 4NYLA 3VRIA 4NC0B 5C0AB 5CCKH 2VNCA 1U91A 2N7AA 4F7PB 4KJQC 4Z7VB 4YPGB 2DM7A 1MEXL 4EI6B 4Z77A 3B9KB 1I9RL 4LRIA 1TMCA 1S7UA 4GXUN 2EEAA 4JM4H 3WLWD 4TVPD 1J5OH 3IU3B 4TSBH 3F12B 4WV1C 4H88H 1NH6A 4HJJH 4UQ2B 3E6FB 2K9UA 2R39A 4PJAE 2ICWB 2Y1VA 4LFHD 1F4AA 4UT6L 4NQEA 4ZUVA 3OB0H 5TE7L 3RDTC 1KXTB 4NBZB 4CW1A 2OSLA 4FFZL 1ZVYA 2E6QA 4JRXE 3FO2A 4ESKA 3LN9A 4OZHB 4PRDB 1ES0A 3RUGA 2SEBA 3QCVL 4JFQA 3OKDA 4O2EB 4CGTA 1KJ3L 2AQ2A 3BP6B 2AJUH 2X4SB 3BWUC 4MNGB 5GSVB 2EDEA 1IEHA 2CD0A 5DMIH 3SDYL 3O3BB 5DMKB 5EZIH 5IJVA 4PV9B 4QRSA 2VZVA 4PGBB 2FZ3A 5JLZB 1JTOA 2VQ1A 5K59E 4YPGA 1AJ7H 5I17A 5CGYC 3QCTL 5IB2A 1SBSL 1NUFA 3OR7A 4MNGE 5JOEA 4WHTB 1NBVH 2F19L 3PHOB 3SGEI 4W81A 5C0BA 4PJIF 1TETH 3KGRA 5FO7B 4I0CC 4X9FA 1LILA 4WFGE 2VXSH 1J1OH 1O5DT 1LMKA 3VFSA 4G9FE 4Q58C 5EC2A 4X9HA 3RVWC 2VXSL 4HUWB 2AKRB 1FORH 1UWXH 4AY0A 1LDPH 3HTLX 4HUMB 4PJIB 2ZUQB 4UINL 3BN9D 5SWZD 3LKNA 4F8QA 3U0PA 1NCDH 5HHVH 3ULUF 3X12A 1GGCL 2DMKA 4X6DF 2DM4A 3RZCA 4G6JL 3UTTA 1GGCH 4KKCC 4PLNC 3ECBA 3N0PB 2QSCH 2X4UB 1A02N 2IPTL 3MJ9L 1DBJH 3FOMA 1CDBA 5DQ9A 1DANT 4X0KA 3K2UH 3U2SA 4P5TB 4OTXL 4QHUB 4AYFA 3WFEL 4JFDE 3OAYH 5BW7C 2DTML 5IMMA 3CD4A 2NMSA 4WI3A 5HJ3B 3IETA 4XPBH 1IT9H 1RFDH 1PY4A 3MV9D 1KJ2A 4P5MA 1A3RL 5CSBA 5KSBE 1CXKA 2UWEA 1P9MC 1UZ8A 1U3HC 1I3VA 4NQVB 3TZVD 1TVBB 3KXFD 3WJJC 1P9MA 5HY9A 4HWEL 5C08D 3VCLB 1QSZA 1LGVA 2A9NL 4XBGA 4PBXA 3D87B 4JQVC 2Z31D 2BSED 4I3RH 2DJUA 5F93C 4O02L 3BESR 4P23C 1FJ1B 4X7SH 3DYMA 1TIUA 3ZYZA 3C5SB 3ESUF 5JXEC 1BJMA 3ARDA 4GMSL 4KI1A 1GC1C 4NQCA 3IB4A 3DXAD 4H0GA 5DD6A 4GRLA 5I1AB 1FPTL 4PTUA 2UY6A 4YNYB 4GRWE 5JOFA 5F96H 3OAYK 3TYGH 3P9MA 2MWCA 3ZHDA 2Z91B 1XR9B 1BD2D 1DN0B 4M43H 1LEKB 1GXEA 4IBLT 1MJ7L 3T4YA 2CR6A 3BSZL 1FVCA 4JRYB 3W5NA 2E7MA 3AB0C 2V2TA 4ONGH 2C7UB 3W0WB 1MHPH 4OIIH 5EPMB 1UH4A 3CZFB 1K85A 3DX6A 5JR1H 3PHSA 1KB5B 4K55A 4PRDA 5GGVH 3LHPH 2Z92A 1UC6A 3MRBA 3QISA 2FYYB 3LHPL 5K9OB 1WBXB 1E27A 1HXYB 5GRZA 1GSMA 3WFCL 1IC1A 2FIKA 3L7FB 1BQHG 1UCTA 4ZUTB 1L6ZA 5C09A 3C9NB 1VESA 1ZLUK 2LV4A 3C60D 4V1DB 4LLAA 3DHMA 2AJZA 2VITB 1T2QL 2NY0C 5FGBA 2DM3A 4PJEA 4F57H 4UILH 4NJ9L 3OR7B 1U36A 2V5RA 2OMBA 4KDTC 3VWJD 1ITBB 4XH2A 1MCIA 4YBQC 3VFTB 4KI5C 2EXYD 4M8QA 3X3GH 5T1LA 5IOPB 5FYKD 1SYVA 5IG7B 2BHUA 4HS6B 4QRPB 1B0RB 4UTAH 1NBYA 3FO1B 4QRUA 3GMMA 1FAKT 4MCZB 4G3YL 1KTLA 3P0YH 3FQUA 1T1WB 4HPYL 5KANG 4RIRB 4RWHA 3GM0A 5F1NB 3P0YL 4MA7H 3QDJE 5C0JB 2I60H 1QQDA 4KUCD 4LSTH 3VXTA 4RBPH 2XPGA 4G9DB 4LLMA 3BP5B 1YNTB 4AENB 3OXRA 3AS3A 4U2ZA 1NLBL 1YEFH 3P0GB 4JVWA 5C08A 4L8BA 1G7JB 2AJZB 4FQQB 2B4CC 5TJWK 4ZAKD 1NLBH 1YEFL 3D0LA 5GJSH 3V6FB 3OMZA 3SQBA 3O9WA 5MEQB 4W6XB 2YPKA 3KPTA 4PP1C 3WNKA 3QUYD 4PRIA 5FYJH 2YD8A 4JFFE 2IWGA 1RJLB 5DFVD 4CMHC 5C2BL 1P4LA 4ELKB 4NQDA 3DETD 2UYLA 3E3QE 3JVGA 5A2JH 1EFQA 1AO7A 3QIUA 3VFWB 1EO8L 2UZIH 3VH8A 4XP5L 3VXMB 2ZWLT 3BRDA 2IANB 5EORH 1BOGB 4WFEE 4POZD 4W4OC 2UZIL 5D1QD 2VLKE 4IOIB 4KRLB 1G7MB 1U8MB 1MCLA 5EORL 4OSUL 4Y16C 1X5HA 5T1KD 4JQIH 5GHWL 1S5IL 1DVFD 5C6PB 5I6XB 2ESVD 1HEZB 3HE6A 3V7MA 1ZHLB 3I50H 4PTUB 3DRQA 2BCKA 2R8SH 2P8MA 2AQ1A 3HUJA 4NFDA 1BEYH 1QFPA 4P2OA 1S7QB 2R8SL 4NKIH 5DD6B 2CJUL 4J3TA 1ACYL 4KROB 3LS4H 3IXAA 5D5MB 3RWHA 3P3YA 4RRPA 5EU6A 6FABH 3SOBH 3SQOL 1NKRA 2NTFA 1LE9B 3L3GB 4I8DA 3W9EA 4HMDA 4HLJA 5I9QC 3JV0A 3DI3B 4WGWB 1D5IL 2BMKB 1IBGL 1HOCB 4ALAH 4F3FB 2EE2A 1MFNA 4D9LL 1JK8A 1W72L 2EC9U 2YPLD 4MSWA 4BSJA 4X6EB 2Z92B 3VDCA 1R5IA 1PKQB 2H6PA 5EUOF 3BVNA 4XWOC 1FLTX 5ALCL 4O4YH 5DJ6A 4KROC 4NKQB 4JZJB 5D7JD 4GRMB 2OI9C 1B90A 4WO4D 3BIBX 4U6YA 2P49B 1CE6A 1RK0B 4BSVB 5C0CE 5HI5D 4L3EE 1KPVB 2HTKC 3LRSA 4U4BA 2WAHA 4ZOAA 5CJOH 5JIHA 3QPQD 3O6FB 1MNUH 1S7XA 5BJTA 4JJHA 2HVKA 1NANI 2J5LC 2GSGA 2VXTL 4JFHD 2ITCA 2EDNA 1CQYA 5FUZL 5IG7A 4Z6AT 5FKAA 2DQHL 2R4RH 1G9MH 4LHUD 3RNKA 4HAGA 1T7XA 2EKSB 4HXAH 1KT2A 4ZS7L 5JUEH 3AS1A 4TOYL 1A2YB 3GSUB 1DE4B 1BMGA 2APFA 3I6KA 3ROLB 4N5EC 2HT3C 2D0GA 1KEGL 1P6AB 1T03H 4FQJH 4ZFZA 2I26N 4UQ3A 4ONHA 3IFPB 5IKCA 3SDXA 5F9JA 3QO1A 5I75C 4MNQB 4O58L 2HVJB 5GRJL 4LKCA 2XA8H 4G6FD 4QTHB 1AQKL 1YJDC 3BFOA 5I8KH 1R5VA 2GK0B 3D39E 4ZFOL 4A2LA 4PJ8C 5I8KL 5FYLH 5L6YH 2ED7A 4RBPK 5GJTH 3CMGA 1AD9A 4BQ6A 5D93B 3HCVB 3SO3C 4N9OB 3QUYC 3VMNA 1NBVL 2F19H 1F3JB 3DARA 5DT1L 5FCUL 2XICA 3MRJB 5JORA 2J6EA 3SGDI 1CGSH 3CSYB 1MCOL 4PLJD 2RCSL 4LPXA 4K3DH 3WJJA 4KAQH 1EGJA 4RFEA 4JRXB 4PJHE 2GT9A 3LKRA 4NO0B 3V0WH 4DVRL 3UTTB 3ZHLA 4Y88A 5EU5A 2VKWA 3L3IB 1MAKA 2MPAL 3HUJB 3NBNA 1MIEH 4MQ7A 5C9JB 4YHML 3HRPA 5E2TH 1M71A 3AXLA 1N2RA 4NQSA 5H37H 4RFOH 4XCFL 3SKOB 3NACH 2LAGB 4RMTA 3UDWA 4ZUWA 3TVMA 3WFEH 1GGUA 2UVFA 3D25B 5IMOB 4JN2A 2ZCHH 3KPPB 4WUKH 1EPFA 3PGFL 5IB5A 3GMLA 2WP3O 2ARJB 2H6PB 2O5ZL 5ICZB 5GRVK 3V6OC 1I7RB 1T66D 4Y19B 4NO0A 5BRZB 4LNRB 3ULUH 3TJEH 2QQNH 3ZT6A 5IVZA 4LCIL 3EYVB 4UINH 1KEMH 1VDGA 2OR9L 5D7LE 3ULUL 5ACZA 3MUY1 4PJXF 1KEML 1MUJA 4NZTH 4NDMA 1F8TL 1RAMA 3BKMH 4LVNB 1S7RB 1UM5L 2GSIB 3S88H 3F5WA 5SWQA 2KL6A 3NPZB 4XVTL 3NIGE 1FIEA 3V5KB 3NABH 5DEFB 1DP0A 5JPMA 4R2GD 2Y07L 2RR3A 4OTXH 5CCKL 5CD5D 2P48B 3AS2A 2IPKA 4G7YL 3GSOA 3G6JE 5F96L 2JJTA 1MCKA 3OV6A 3SDCA 4DTGL 4D0BA 1K6QL 1ORQA 2BSSB 2DLFL 5IEKA 1X7QA 1BREA 4M7KL 3HZYB 3VH8B 3D2UA 2NY4B 2XV6B 4IDJH 1KPUB 4KH2A 2EEDA 2QJDA 2LVCA 2X70A 3FB8A 3UJIH 5E2WH 3SKMA 5ACZB 4HUNB 4UT6H 1YJDL 3UJIL 4AIOA 2DLGA 4GQ9H 3X13B 4X7SL 3FQRA 4FFZH 5EN2A 4KK8C 4G5ZL 4QHUA 4GMSH 2YWZA 1GOGA 4WTZG 3TM6A 1GPOH 1UWEH 3NN8A 5DWUH 3U1SL 3MJ6A 5F1IB 5IVOA 3S3JA 4LLWA 4JY6A 5D93C 3MLTB 4F9PC 4BA8A 1JWUA 3UROR 1D5BB 3P4NB 3TNMB 2ZCKL 3LMJL 1OCWH 4Z7OE 1DBAH 2XACC 2ZUXA 3AU1A 3MOBL 3VJ6A 1OAZL 4D94A 5ADOH 1KIRA 4K3EL 3QHZL 3MRQA 5SWSA 3C6LD 3T8XB 3TH3T 5BVPH 2VOTA 3VRLF 5IB4B 5HDQL 3MXVL 1VFUA 1MVUB 1ERNA 3S5LB 1IEBB 3RVXD 3MRFB 3RVTC 3PWPA 4DEPB 3UTSE 1BPVA 3T0WA 5FM5M 5GGQL 4JO4L 5DJXB 1CFBA 4JAMA 5EIVA 3BWAB 2BVUA 2OI9B 1EFXA 1I3RA 5D8JL 2DQIH 4M1DL 1KIPA 3DUSB 4L9LA 4D0CA 3B3IA 3G6JB 3DROA 2IALA 1QFWI 3E2HB 3V7AG 4M6MH 1QEWB 1ZWIA 1OB1A 3TO2A 4NQCD 3MV11 2AP2A 5GGSY 3CFEA 4JDTL 1CF8H 3SGKA 1JP5A 4XPHH 4JDZA 4YIQA 5EOTB 4APQD 3QR2A 1HHIB 1HHHA 4JQVA 3U6RB 2ICEB 5C71A 3DX6B 4QCIA 4KVCH 4JHBA 4OF6A 4KVNH 4XBEL 1NCAH 1DQDL 5IBTH 4CDGC 5HYFA 1JI2A 4WI4A 5SX5K 5F71A 1YPZF 4WI5A 1BVKA 2VLMD 2D9CA 3B3IB 3GRWA 3L6FB 3TZVA 1OGAB 4EI6A 4LASL 1R5VB 4X6FB 1EDQA 4PB0H 3CX5J 4FS0A 1NAMB 4NQXA 3W81A 2Z8WC 3GNMH 4DN3L 1KXVC 2DYPB 1AR1D 3OKMA 1HH9A 4M1CC 1T4KA 2DWEA 5K93A 1JHKL 1E4XH 1AE6H 2VH5L 5E8OB 4WHDA 1FL6B 1MFAL 1WVZA 3L3OB 5J1AA 5KZCB 1KPRA 1ETZA 3S37L 2DYPD 3T3PE 1NFDE 3S37H 3CC5A 4XAWH 3DSFL 1LE5A 1HI6B 1LO5B 4KTDL 4N5ED 3BPCA 4M7ZC 4I5BA 4PRBA 3N50A 4CVZA 5I1JL 1C1EL 4QNPE 3HFML 1RZJH 3BP4B 5I8EA 4PJFE 3D69B 4TQEL 2ZJSH 5E5MB 1KYOK 1YDPA 4TPRH 4PJ9B 2VDKL 3G9AB 1FFQA 3BAEH 3MNVA 1C16B 2ADJA 1QG3A 1P53A 2CR3A 1R24A 3CU1A 3BHBA 3TN0C 1UFUA 4HQQH 3PQYA 1U2HA 1AC6A 5C8JA 1BX2B 2R0LL 5IBLD 3QNYA 1W0YT 5C1MB 3HB3D 4ZFFB 4JG0H 3S96B 4DW2H 1H15A 2ATKA 3RTQD 4LHUG 3TA3A 2AVGA 1UEYA 3O8XC 4HEME 4K7FA 5JPNB 1X44A 2ERJC 2CUMA 2BDNL 4X5WA 1X5JA 3AM8A 1NMAL 3C6SB 4PJDB 1N64H 1JGUH 3KJ6L 3BIKA 5T5NG 2ZKHH 2FJHB 4U0QB 3ERYA 2NZ9D 4YLQT 4R90H 1TJGL 3GSXB 3IT8D 4WWID 4M48H 4E0RB 3FT4A 1T7VA 1Q9LA 3C5ZC 4PG2C 1S7RA 3DV6B 1I75A 2PXYC 4ZNEA 2YN5A 5TE6H 3PV7A 3E6HB 4F2MB 1T0NB 4R97C 5L8LB 2WQ8A 3RWCB 4KFZC 3JV5A 3NCEB 4R8WH 4YGAB 5L6YL 3CPLA 1NFDA 4I1NB 3WO3B 2M2DA 2R2BA 4TULH 5D72L 5E4EB 5ILTL 1FL5B 1A14L 4R4ND 1DQML 2X1XR 3L3KB 4EI5C 3RL2A 5ISZE 3I3DA 3REWB 3MRIA 1RZ7L 2IFGA 3ISWA 5ETUB 4AIZA 2X42A 2VZ1A 3QDHA 4JO1H 3HG1B 4DWHA 2A6JA 5CEZL 1N7MH 3BKYH 1KENH 3JTCA 1NMCB 3STLA 1GZPA 3MLXH 4X4YB 4XP5H 1MRFH 4CAGA 3QQ9C 3O4LB 2X9YA 2X2YA 2E8YA 5I1DA 4QXTB 1WV7T 2ZSVB 3V5HA 3H3KA 4JPIB 2YKLH 1QFUL 4G6AD 3SE8L 3CXHJ 3RNKB 1VPOL 4X5XB 2QBWA 4LOUD 5ACMA 3HMWL 2ADFH 4JPKH 1T4KB 2YD7A 2A73B 1U42A 5JXED 3PWUA 5GIRA 2I07B 4OKVA 4JPWH 4Y7MA 4G42B 3REWA 3HI6H 1IGYA 3RJQB 2HTLD 3MROA 4JPWL 1IEBA 4PJ7F 4K3DL 4PJ7A 5D7LB 1J05A 3FRUA 4L4TA 5MENA 3QFDA 2IADA 2Q86B 4HHAA 3DGGB 1AH1A 2FYYA 3MREB 3TESA 3BE1H 4LCIH 3WXWL 2FR4A 1B6UA 3CDGB 1NL0H 1XF2A 2G5RA 2AJVL 3QJFA 4YK4C 3DYPA 2OP4L 2CDFB 4YHLL 3TWCH 3HLAB 2NY7H 1ZWIB 3QNYB 1FQ9C 4FXKB 4M02A 2HFGL 4K94L 2Q1EA 3GMOA 4HFUL 5JXAH 4WW1B 4NO3A 1IGFH 2H41A 4M8QB 3MMEB 4K8RC 1OTUC 1HYSD 4LQFL 1FCGA 1QR1A 2XXMB 4L3ED 1WEJL 3LKQA 1B9ZA 3MSPA 2EDLA 4J3SA 3MA7B 3QUZB 2JJSC 2Z0BA 1AGCA 5KSVB 3EOYG 4XNUH 4UU9B 5FV1L 4P2QB 1YEGH 5DVOA 5IW3A 1CL7H 3CFKA 1QUNA 4LHUB 3VFUA 4ZS7H 4YBQD 2XNAA 4W4OA 5ID0A 3FT3B 4X6CF 3U0WL 1BLNB 3WKNA 3IDJA 3X3GL 4QHKI 4MD0A 1G6RA 1BZQK 3D3VA 1E4KC 3MBEC 4PJ5B 2BSTA 1X5IA 2CMRH 3P0VH 3O45A 3WD5L 2Z31B 1F45A 5DWUL 3U1SH 2BJML 3ARBB 1KCGC 4PD4J 2CMRL 2E27H 1ZEAL 3P4MB 4PGDA 2BNUB 3H7LA 1YMHA 5DYOB 3FT2A 1TTFA 2LQRA 2R0ZH 4B7LA 3RNQA 2UVEA 2ILLA 5L2JB 1FSKB 1F4WH 4EI5B 2X9XA 3MLYL 3PV6A 3ZYIA 3OX8B 3JTSA 4S1DD 4UOW0 4Z7WA 1BOGA 5A2FA 1CXHA 3O3EB 3QRFM 4YHYC 3UZVB 4XXCA 2O61A 1L4IA 2HJKB 4JHWH 4NDMB 5SV3A 3QEHA 3BGMA 4XBPB 1TJIH 4ZUTA 4FN0A 3S98A 1MI5A 3UTPE 3Q3GA 1IQWL 3QHTC 2X4QA 3HZMA 3NAAH 2YS4A 3SDAA 3EHBC 4KRNA 3MFFB 5E08H 3MV8A 4G5ZH 4XX1G 3L95A 5IHLB 4MXQC 5B38G 1SMAA 1OAYH 4YHIA 2AEWA 4RNRA 4X4ZA 1PG7L 4FQQA 5CZXC 3D3VE 5IQ7H 2GHWB 4WV1B 4XT1C 5CJXC 3TH2T 5FUOL 4PJBF 5GQBA 5CJXA 4M5ZL 3KLHD 3PP4L 1HXMA 5CBAB 3Q6FB 4LHJB 4XXDA 1B88A 4QRPA 5T33L 1D5ZA 4Z7QE 3TNNB 4JQIL 2WY3A 3HZKA 3NA9L 4F58L 3KYMA 2X70B 3FB8B 1LD9A 3VD9A 3S34H 1BWWA 1XEDA 4XP1L 4RZCA 3B9KD 4P2OD 3T1WA 2OZ4A 2EXYC 1AIFA 4AEIL 3FQTB 1WK0A 4BUGA 3V0VA 2NZ9C 4L4JA 4UZGA 1XCQA 1GHFH 1AHWC 1MI5E 3SDDC 9CGTA 3KLSA 5IWLA 3T04D 1AKJA 3MV8B 4NYLB 1BBDH 2NX5D 4NKMA 5F9WC 1ZLSL 5IVXA 1CG9B 4IMLB 3DYOA 5KN5B 1AGFB 3HNTL 2JJTC 4XHQA 4Y4HC 4I9WE 1A9BA 5D7LD 1HSBA 2FEDC 1D6EA 2G5BA 3OKKA 1J1XL 2VE6A 3ULVE 1S3KH 3C60B 4HS3B 3R4DA 3K2UL 4R3SA 1VFOA 2VWEC 4XPHL 5I1EL 3EJYD 4ZAKC 4DVBA 2P7TB 4HIIA 4NQEB 3SE4A 4L5FL 4YDJB 4M93B 3WJLA 5EBWA 3MC0A 1IKFH 3CLFH 3QAZB 5CEYB 4RX4D 5BO1H 3WHXA 4L8CA 2J5LB 1LO2L 3ILPB 2AJSH 2VAAB 4U1MA 4IJ3B 4PJCB 1OTSC 5DD5L 1QFWH 1FZJB 2DBJA 4G7VL 5CIPA 2FEEI 1YEDA 1OAQH 4OGAD 3DSFH 1OP9A 3L5WA 3WHE1 1QR4A 4X4XB 5IJVB 1QZ1A 1W2KT 5HYJD 1UH2A 1TZGH 1CE1L 1DEDA 3IAPA 4LF3B 1QSEA 1NDGB 5E9DB 5CFHA 3D0VA 3DV4B 3MOAH 3H42H 3HFMH 1UQSA 3GBNH 5J7CC 2PCPB 1RZKH 1EZVX 3BDBA 4OLWH 3M1BA 3MJ8B 3RI5F 4NM8L 2W9EH 4NSKB 4P2QD 2HT3D 3MCLH 4LLVB 1G9NL 1KEGH 5LQBH 1T03L 3AFLA 1UGNA 3LS5L 1OPGH 1QO3B 5D7SL 1WICA 4FMKA 2NYYD 3BZDA 3OGOE 4DFHA 3LB6C 4NHCH 4JB9H 5AZ2H 2XA3A 2MOVA 3O2DL 4K8RD 2R23A 4MX7B 1EHXA 4N0CC 1NJ9A 5L2KA 2IANE 1FO0B 4PBVC 4HHAB 5EWIL 4N0CA 2AEQH 1FG2B 4NCDA 4OCYL 5CMAB 1E4KA 4Z78B 4GLRI 3MGTA 1HYSC 4YDIL 2Y06H 5C0AA 5FO8B 2DN7A 1XIWA 4DKFL 4LF3A 4C57C 1UEMA 1LP9F 2C3XA 4WCYL 2ZPKH 1ONQB 5KS9A 1S9WB 3X11A 5A16B 1ACZA 4WGVB 1CGSL 1A22B 2BVEA 3QQ9D 5DF0A 3MJ8A 2A1WL 4X0KB 4ZUWB 2W91A 1Q1JL 4L8DA 2MSPA 5J8OA 1OOAA 3H0TA 3DNKA 1LWRA 4KJWD 2D0FA 2XY1A 4OLUH 1LEIA 5E4EC 3CZJA 5DRZB 2OR8A 4M6ML 1T2QH 5HSFA 2EDTA 5HD8C 5CGYD 4NJ9H 2UUDH 3WS3B 1EMTH 1ZT1B 5DR5H 1E6OL 3DECA 4MDIB 4KDTA 4MJIB 4ZTPL 1J8KA 5CJ8A 5I16B 4M7JH 4TNWK 5DC0A 1X5XA 1QRKA 3UPRB 1T1XA 4I77L 3ZKXC 4X7EC 1JV5A 4KUZL 2C3VA 3IFNL 4XRCA 4I18B 3B2VH 4YJZL 3I84A 3G5ZA 4WW2B 1I1CA 4MJID 5BRZE 1OQOA 3QFJB 1FG9C 1AHWB 1UWGH 3S9DB 3MNZA 1S8DA 4IRSB 3D85B 2R0WH 5EU7C 5H2BA 1M05B 1FLRL 4N8CH 3GMQA 4TULL 2YRLA 3ETBF 5IVNA 1IEAA 2IGFH 3QEGH 2IBBA 4NZTL 5E8PA 1QHPA 5GS1C 4J12A 3JV4B 3QJHA 4Y5YA 2X7LA 3AMLA 1IKNA 3RZWA 1FNSL 1HILB 5C2BH 1F13A 3U0PB 5J6GB 3D1MC 2D31B 4XAKD 1UA6L 1U91B 3QULB 5BZWA 4G6ML 3SHSA 1U8PB 2X89A 4Z7VA 3D0VB 3FZUC 5F70A 2CGRH 4GH7B 3GEWB 5D1XD 4YX2L 4Q97A 4ZNEE 3FO9B 1I85A 4FXKA 1N6UA 4RNRB 1IGCH 3DVNB 4R9HA 2H9GA 3UBXG 2OL3H 3WEXB 2R9HD 1D5XA 3MRQB 2D7PA 3DTXA 1XH3B 4ERSH 4OFPA 2JLLA 1OL0A 4GQ9L 1KCLA 3IDXL 2E9BA 3AM8C 5MEPA 4LLUB 3E8UH 1Y18A 3VCLA 3GJFK 5FECA 1CTOA 2R0LH 5BS0A 1XGQA 3FB7A 5FK9A 3MZTA 1IGIH 3STLB 7FABH 5MHSE 4TYUA 1AIFB 1KIQA 1D5IH 1G9EA 3EYOB 3QEQE 4QHKJ 3VFPB 4GAGL 1YEGL 1JMXA 1JPTH 4IRJB 4M6NL 1QFWM 3AROA 5FKPA 1EHAA 2DMCA 3QNZB 3QXVA 4J23A 1OCWL 1T89A 3SGJC 1ZHNA 1B0WA 2VZOA 1EVTC 2QSQA 3UZEA 4I0PC 4NO0D 3QHZH 1WWBX 1FNFA 2V2WA 5DK0B 3VWKA 5KVDL 4MQTB 2XOTA 4Z7WF 2ZUWA 4D0BB 1HNGA 1OGTB 1RVFH 2BXZA 4U3XA 1M4KA 3U46B 2ZUUA 1IL1B 1U0QA 1T83C 4U1LA 3TBTA 1J0YA 1DVFA 3JTTB 5JOPE 1K4CA 4YBLC 5DVKA 1YEHL 3VXUA 3NCBB 1G7HA 3BH9B 1G9ML 4RMWA 2FH8A 5F88B 3NCJL 5CIPB 5KOVC 1E27B 1RIHL 4K9EH 4OZ4B 4MJ6A 3EW3B 2XTJB 1ZHNB 1IQWH 4E41D 5BV7C 1D5BA 4A6YH 1FRGL 3OKMB 1VACB 1C5BH 1RHHA 3EYUH 3GMPA 4L4TE 1S78D 2VXVH 5BS0E 2N4IA 1BJ1J 3I2CH 4WTWA 4XBEH 1XGUB 1QR1B 1A1MA 3WL9A 4LLDB 5EZIL 4X98A 4YR6A 1QO3A 3RZCD 2DIJA 4NC1E 5D1XA 3D85A 1SYVB 4AM0A 2AERT 4YXLL 5IBLC 5HYJB 4KRMB 1R3KA 5GS0H 3LSOB 1S9VB 5I18H 2C26A 2C3HA 3VD3A 3ALXA 4BZ2L 5DURB 1E4JA 4HF5L 3NTCL 2YA1A 5C0IB 4JFZH 2GY5A 1T20B 2QSVA 2GI7A 4PJHF 1B4JH 1G6RB 1I7UB 4O51B 4NQED 1DLFL 1E4XL 1QA9A 5EO0A 4X7CC 3NPSB 1YZZA 5I15L 4XMPL 3KPOB 2OTUA 3B5HA 5EZJA 3PP3H 3STBA 3ZKMD 4HD9A 1NMCC 3V52L 4AG4H 3VXPB 4OCRH 3S4SA 4QGYA 2FEEL 3C60A 3OKOA 2XN9B 5TQ2H 5C0BB 4KK5C 5J9PA 1KCSH 1A3LL 5B8CA 4G6JH 3FFCE 2BVOB 3KPSB 4YZFF 2C7UA 4ZOBA 2IJ0C 2H2SD 2VLKB 3S8WA 4YXHH 2HJKA 4B5EA 1NCWL 4HFUH 2R4SH 3GHBL 2YD6A 1NFIB 2XFXB 3IJYA 2VZTA 3HE7C 3MRBB 3KLAA 2VLLB 3QEUB 2OL3A 5KJRH 3D18A 1BZ9B 4OCXL 3OG4B 5H35A 4J8RB 2O5ZH 4XCNA 1I3UA 1H5BC 3QO1B 3G08B 3BPCB 1ZVSA 3EO1B 4QOKA 3UPRA 4ZQKA 4UILL 1GCFA 1HH9B 2OXGA 4MWFA 1ZANL 5HVHB 1IAII 3DO3A 1BBDL 3S6CA 3TN0B 3I9GH 3IDNB 5D70L 3BPOC 3FZUD 1INDL 3FHAA 3OJ2C 3HAEA 3F7YA 2BXYA 2YN3A 4S11A 2XKNB 3V4PH 4UNVA 3FQWB 4DCQA 1NBYB 3FO1A 3SE9L 3REVB 4MGXA 3V4PL 4Y4KD 4HWZB 4XVJL 4NHCL 3TCLB 2J4WH 5HYSG 4XMLH 1OAUL 3RWDB 3EOAA 1LO0H 3RPIA 3ZE2F 1FNEB 3OHXA 4JRXA 1QYGL 4PBWD 5IMKB 1QBMH 1K6QH 1UXSB 3P77B 2F54A 4K3JL 4IRSC 3QCUH 2EC9T 2HTLC 1SJEA 2XG5A 1QYGH 4QRPE 3LV3A 5T5FH 1ZVSB 2CLZB 2GCYA 4RGND 1YEEL 2J2ZA 4JKPH 5D1XC 4POYA 3V6FA 4B41A 4JFFB 3VXRA 1GRWA 3X3FH 1HSAA 1T83A 1XGTA 1XF3A 4F33A 1RIVL 1CD8A 4PYHA 1RJLA 4DZBA 3FTGB 3N1PC 1JCKA 4P3DA 1KGCD 2XKUA 3C8DA 2ZG3A 4MHHG 2DQCH 4JDVB 3LS5H 4HIHB 5EC2B 5ALBH 5J13C 4RA0C 3D9AL 2VLME 2YA0A 4CN6A 5FUOH 1QLEH 3P73B 1CI5A 5EULV 4HUVA 3IYLW 3MRGB 4J6RL 5IMKA 4LNRA 4FP8L 3RTQA 5HHQB 4G6AC 3GFUA 1CDUA 4Y5VA 1ZVHA 1R3LA 4IOFC 1FGVH 4X99A 2NW2A 1INQB 3DX9A 3HMWH 3EGSB 2ADFL 1S9XB 4LAQL 5C07D 1U2CA 1CICC 5IESL 3MJ9A 3WE6A 1PEWA 2FX8H 4HX1A 1HHKA 2COQA 3SO3B 3SY0A 5T1DH 4YGVB 5DK0A 3HCVA 1CDHA 2JB5L 4M61B 3VD7A 4HPYH 4LSDA 4KWUA 4PR5A 3WXVH 4LSTL 2R0KH 2R9HC 5GGRA 2W0FB 5IFHL 5CINH 3ZL4H 4OM0H 2H2SC 1E28B 1YYML 3VFRB 3P73A 5JW4R 1EEYA 1CLZH 4O4YL 3S36L 1YYMH 1NAKL 5DJ6B 3MGTB 4J8RA 1NUGA 5B3JF 3QH3A 4PYGA 1IRAY 4H8WC 1HNFA 3MLSL 1T0MA 4PRNB 5HHMD 3DVIA 3EFFA 2Q20A 4APQA 2R1YA 5I1GL 5D2LE 3VXSD 5LJYH 1QQDB 5DGRA 4F37K 2C1OA 1SJHB 3QQ4B 4BH7B 1FZMA 4UI2A 4WFED 3WDIA 2VLKD 1BF8A 3P40A 3MLZL 1TPXC 3WUWB 4FHBD 1I9RH 3DX8A 3GI9L 1U8KB 4LLQA 4MB5A 3MA9L 5D2LB 1S7WA 1X4ZA 3SDAC 2EC8A 1P6FA 2Z91A 1MFBH 3U4AA 1IE5A 5CJQH 4X9IA 5HGDB 4YHOL 2VSCA 4EI5A 5A2LH 3MMEA 4PJ7B 1FH5L 5SWSB 4AM0B 1I1YB 3B8SA 3U7YL 1NGZB 3K46A 4J3VA 2XZQH 4ZFGH 1JHKH 5J12B 1RURL 4NFBA 2XG4A 4GG8B 2XZQL 1KJ3H 4PLOB 1T0MB 4IOIA 4G6KH 3DO7B 2AJUL 2B2XL 4XWGH 3ARRA 2F54E 5E8DH 2E27L 3CVHA 1EFXB 1I3RB 2CLVA 3NCMA 3UXFA 4F8TA 4Q0XH 4U1HB 5JHDD 4RGNC 3CLEL 3HI1A 3LV3B 2QKIA 4J4PA 3UTQA 5F89B 3KJ4C 1N5YL 1UZ6E 3KPRA 1A21A 1AHWA 3IJHA 5F7KC 5D2LA 3ZDYE 5EU6E 2R56L 2F74B 2D3VA 4JO2L 4NPYA 5DZOA 2ITDA 4H88L 4TQEH 5FYLE 5TGBB 2YUZA 4F15B 4OZHA 5J9PB 1NC4B 3O3AA 2DQFB 3W39B 4KAQL 1DQJB 2NY4C 5DRNB 1E4WH 1MCDA 4Y4HD 4GBXA 1LK3L 4M93C 3T65B 1LP9B 5DTFB 1FORL 3VWJB 4E42B 4JFEE 3MRKA 5CZVL 1QSFD 3NFPA 1S9KC 4RISL 1I9IL 5ERWA 1YC8A 5HGBB 4FQ1H 4Q9CA 3TGXA 3FO9A 2DQHH 2PO6A 2R4RL 3KJ6H 3CSGA 3SE3A 2OTPA 1UB5A 1CT8A 1QLRB 2P1YA 3SKNB 1F4HA 1Q72H 1DBJL 3B9KC 4PGCA 1K2DB 5DRWB 3JWOL 1MIMH 1SM3L 2A0LD 2ZCHL 1D9KA 3AY4C 1V05A 4PRIB 4EDXA 2OZ4L 4MNHB 4A6YL 4HS3A 2GSGB 3OPZH 1WFOA 1YY8B 2YC1A 4LVOC 5KTEH 2MCG1 4LGRB 1WZ1L 1JZ4A 1K4DB 2RQ8A 1Q38A 1XGQB 5ICZA 2AXFA 1MJ8H 1AKJD 2CIKB 2ZUYA 1MCJA 5FYJE 1MREH 4S1SH 3BZFA 3CCHB 3BMVA 4BK5A 1S9VA 4R8WL 5C07B 3KYOB 4E42A 2A2QT 4MVBC 1X5ZA 2VDQH 2JJSA 5GGRB 4PY8J 4JCMA 5JA9A 1BM3L 2N7BA 4QRTB 4NCC2 5J56B 4IRJA 5AYUL 1A14H 4NHUA 3GSUA 3CFCH 1BM3H 4U2YA 1CVRA 2VIRA 1PQZA 3Q6GL 2I27N 3H9SE 4N0UA 2JK5A 5HDLA 1A3QA 3K8KA 2JB6B 5DT1H 2YBRB 2AK4E 5EO0B 2HT2D 2V9QA 4PJAB 2GCYB 3F7RA 2IEPA 5E8EA 5EZJB 4OGYH 4C4KT 3VDBA 3Q1SL 4G7YH 2RJMA 5A3IC 3MLXL 4XVUC 3B9EA 5DK3A 3U46A 5L88L 5FIEA 1G0YR 2V2XB 3ARBC 2EICA 2FH6A 3SO5A 1IAOA 2VABB 4WENB 1YEJH 2G2RB 5DJ0A 5F7UA 1ZXQA 5L88H 1I3GL 5C0GB 3VWKD 4HFWB 4OIBA 5IMLB 2VRAA 4CMMA 1ZS8B 4JKKA 3QUZC 3SE8H 1A6VH 1U8QB 4P23D 2BY1A 1JGEA 3WLBA 2YUXA 5E6IC 4QHLA 3OSKA 2FHBA 4U1NA 2DQEH 2Z31C 5F1NA 5D7KE 4EVNB 2CK0L 3QEUA 4M9PA 2FBOJ 3CVIH 5H35B 2YMXL 3TO4D 5IHBA 4F7CA 4JFOA 4OGXH 1CFNA 2F5AH 4PGBA 2OYPA 1YN6A 4JFZL 5JXEA 4PJCE 1JL8A 5EU3A 2QLVB 4TN9A 3UYRH 5C92A 3OF6A 3MGOA 4CU6A 3VWJC 5FHBH 4PJBE 3UYRL 4P2QE 1HSBB 4GW1A 1DN0A 1S7XB 4XNXL 1KUMA 3DURB 2DWDA 4XPGH 4P9HH 2H32B 4S2SA 1CGXA 2EIZA 1CLYH 1CGWA 1ZANH 1RPQA 5E00B 5KBNC 2DDQH 2AJYH 1LHZA 3JZ7A 4GW5A 1ZKAA 1U58A 3RU8L 4PRHB 4Y2DB 4OT1H 3SCMA 5T3XE 3F7QA 3QDJA 4LCCC 1L7IH 4WU5A 3BEVA 4NN7C 3J7HA 4HK0A 4LLYA 3T4YB 1JGEB 3KJ4B 1T5XA 3S97C 1H8SA 1A6ZB 5E2UH 3MUZ1 1OF2A 1EEYB 1MJUH 5D1ZD 1OAKH 2JE8A 3X12B 3QBTB 4WTXA 5D96C 1K8DA 1OAKL 2J4WL 1OSZB 3DUSA 1N26A 2NY2C 4XAKE 4F7CB 5IW1B 1FNHA 5C0FB 3ZE0E 5E9DA 2HMIC 4ZS6D 2L4OA 3OKNB 1AD0B 1UQSB 3EAKA 3KPNA 1OB1B 2EO1A 2GJZB 4LDEB 1JPFB 3O6ML 4F7TB 3EDFA 2DWDB 5KVGH 1CICD 2CKNA 1C7SA 4LK4A 1NC2A 4WI8A 4B0MM 2D03L 4FXGA 1HDMA 3ARGC 5HGAB 4FZ8L 3HR5B 1HHHB 1X5KA 3R1GL 4U6TA 2J8UE 3T2NH 5E24E 5DDHA 1GGIL 1MAJA 2CUIA 4K7FB 3QIWC 4QRTA 1P4IH 4E41E 4U1SB 3BQUB 1CCZA 4BUHA 4KRPC 1BFVL 2JB6A 1KPUA 4JG1H 2J8UB 3QI9B 1OAUH 2MKLC 4JRWA 2EDBA 1G7JA 4YHNA 2ZNXA 1WFUA 1F4XH 43CAA 1UVQB 1Z3GH 1ZLVH 1AD0A 3X13A 2EKJA 4W6WB 2AXHA 5GS1A 3GHEH 2G75B 1YMMB 3VXTB 5I18L 1JPST 2OTWA 3BN3B 2CDEB 4JHWL 3KPSD 4PJXA 5FM5O 1JF1A 3UJTL 1RZIA 4OF7A 1EH9A 1FIGL 1U3YA 3QSKB 3NFNA 4LSSH 3UYPA 5T1MA 3E6HA 3SY0B 3P11L 3F58L 5DFVC 1UKSA 2NQCA 4WW2F 1NUDA 4OB5H 5C0CB 4HFWA 4DFIA 1RY7B 1T21A 2NY6B 2F53B 4P46D 2HFFB 2P5WA 4ZAKB 3UBXI 4ZOEA 4Q9BA 3VWKC 3C08L 5CZKA 2WWMD 3RPIB 2CGRL 1D5MA 1J8HE 4F9LC 2Z8RA 4KTDH 5FYKU 5IUSA 5KAQF 3T2PA 3HC3H 2W59A 2OS7A 1GAFH 4UU9A 1H5BA 2XRAL 2ICWI 1JZ7A 1WAAA 5JW4Q 3RRQA 1ULVA 4HH9B 1CF8L 1GAFL 1MUJB 3AS0A 1QFHA 2P5EB 3MLSH 3MV9A 1G6RL 5D7IF 1JWMB 3PJSA 5J6HA 4HQQL 2H32A 2XTLA 4ODTH 5EBMA 1S7WB 1V7ML 2FWOB 2WANA 4KVCL 4OUUB 4ZFFA 4WDIB 3VU2A 4U6VL 1M6OA 3WFHA 3ZDZE 1DFBH 4QKXB 4X7FC 1EFXD 2UWEF 1FGNL 2VXUL 2Z31A 4N90E 3RVUD 2YD1A 5KVFH 3MRHA 1KACB 4X6EA 4H25B 1EHLH 4KY1L 1MF2L 3ARFD 2IH3B 1R3JB 3RUGE 3RNQB 3TBTB 4N68A 4O5LL 3OAUH 1NGZA 2HT4C 1HHIA 4HC1A 1EAPB 5I71B 5E1AA 1Z0MA 4O5LH 3I02B 5D7LA 1RJYA 3ZKNC 1EERB 1U8PA 1MFCH 4R0LA 3P4OA 3S36H 4FNLH 2VN4A 3KNBA 4JZNA 2NY2D 5DGQA 3BXNB 4MA1C 3HC4L 1AGBA 2JELL 5TE6L 3GRWL 4HT1L 2X1WL 1JZ8A 3RX8A 3V6OA 4F2MA 3HG1E 3I6LE 3OKNA 4RX4A 4JR9H 4K23L 4G7VH 4ENEC 1PX4A 1MNUL 3QCUL 2ATPB 3O6LL 2AXGB 3KDMB 1C12A 4EN3C 3D39A 3PWPD 3LQAC 3QWRA 1BIHA 4X98B 5JOPD 3VD5A 3FFCD 1MCQA 5HBBA 3FB7B 5FK9B 2P8LB 4N8VB 3X3FL 3WCYA 3EOTH 1UM6H 3T65A 5KVEH 3CVHL 5DHXB 3GSWA 4ONHB 4LNVA 35C8L 5DUMH 2RCSH 2X4OA 4HBCL 2MHAA 3LPFA 3QCVH 5DUML 1DE4A 4QTHA 4JZNB 3IAQA 4OCSL 3EYUL 1F6FB 2GSIA 4JG0L 3H7BA 4TUOA 1EGJL 1BLNA 3TBWA 3VFGH 3ZYJA 5KANI 4F9LA 5DHVB 2IAMC 3MODL 4YUEH 1F11A 4CU7A 5E5MA 3L1OL 2ATPA 1JF1B 1KFAL 1KTRL 4GOSA 1JGUL 1N64L 1XAUA 1KBGL 5DK2A 4J2XA 1U3JA 1MIML 2F53A 1VEMA 2NTFB 4LEXH 2BVOA 1OQXA 3BMWA 2VDRH 1OHQA 3UBXA 5C07E 3OKLA 1ZGLM 1WIOA 4JFDA 4FTVD 3BPLB 3TJHD 3S3SA 4YXKH 1FE8H 1BD2E 3QIWD 3BIKB 4E5XB 2YWYA 2WBJA 4GAJH 3QI9C 1BVKB 1Z5LB 2WNGA 4M7LT 1DCLA 1I9IH 3ES6B 3TA3D 1CE6B 2WBWB 3MBXL 3BP7B 3PGCA 1RIUH 5JQ6L 5I76B 5F3HB 3BYTA 1BZ7B 3IXTB 1IM9B 4XTRC 1KB9J 4P5TC 4FTVB 3S88L 1RHHB 3GB7A 2F74A 3LRSB 3VG0H 4K94H 4NQXB 4BELD 1JPFA 3PP3K 1WTLA 3B9DA 3RAJL 3HUJE 5D2NE 3P4NA 1XGPA 3S3PA 1PBYA 1CQKA 3LEXB 4NUGL 4L3CB 2B39A 2OZ4H 1EBPA 3BZEB 1I7RA 5E6YA 3ULUE 5B22A<