3TIDA

Crystal structure of the lcmv derived peptide gp34 in complex with the murine mhc class i h-2 kb
Total Genus 68
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
68
sequence length
277
structure length
277
Chain Sequence
GPHSLRYFVTAVSRPGLGEPRYMEVGYVDDTEFVRFDSDAENPRYEPRARWMEQEGPEYWERETQKAKGNEQSFRVDLRTLLGYYNQSKGGSHTIQVISGCEVGSDGRLLRGYQQYAYDGRDYIALNEDLKTWTAADMAALITKHKWEQAGEAERLRAYLEGTCVEWLRRYLKNGNATLLRTDSPKAHVTHHSRPEDKVTLRCWALGFYPADITLTWQLNGEELIQDMELVETRPAGDGTFQKWASVVVPLGKEQYYTCHVYHQGLPEPLTLRWEPC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system
molecule keywords H-2 class I histocompatibility antigen, K-B alpha chain
publication title Disparate epitopes mediating protective heterologous immunity to unrelated viruses share peptide-MHC structural features recognized by cross-reactive T cells.
pubmed doi rcsb
source organism Mus musculus
total genus 68
structure length 277
sequence length 277
ec nomenclature
pdb deposition date 2011-08-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00129 MHC_I Class I Histocompatibility antigen, domains alpha 1 and 2
A PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3tidA02
3.30.500.10 Alpha Beta 2-Layer Sandwich Murine Class I Major Histocompatibility Complex, H2-DB; Chain A, domain 1 MHC class I-like antigen recognition-like 3tidA01
4U6XA 4Y5YB 3BH9B 3CC5B 4PJ5E 3PF2A 2PYED 5JXAL 5FO7B 5LGHL 4LF3B 2Q8AL 4HKBA 4K94L 1C7TA 4D9RE 5DC9B 3MREA 5JUEH 1GPOH 3BZDA 1ZOXA 5D1QD 3RVXD 3FO9A 4AM0A 5L7XL 1VEOA 1CFVH 5TFSL 1FFPA 1TVBA 3QUYA 1NMCC 1RQ5A 2A6IB 2VZUA 3IDNB 4LPYA 4MJ6A 2O5YH 4HG4J 4J6RL 3SQOH 1A7RH 5TDPA 1A6AA 3ZDXF 4GS7C 2DWDA 3KYOB 5ILTH 3QHFL 3TZVB 5D70H 4TUKL 4IOFD 4PJ9B 4OT1H 3O45A 2Z91B 1NAKH 5DEZA 3FCTB 2VIRA 2AK4D 1C5BH 2BY2A 3IAGC 3JWOL 1U58B 4Y2OA 1ED3A 4HHAB 1RURL 2A9ML 5J7CC 2CIIB 3IFOB 4LLVA 3HPLA 3T4YB 3PL6C 4OGYH 5GZND 4CN1A 1T7VA 5ABDE 4E5XB 3E6HB 3STZA 3OSKA 2H3NA 3ULUH 5GGUA 4QRSB 4CW1A 3WIIL 5IMLA 4XGZA 4G6MH 2J3SA 2VZSA 4LMQI 3UYPA 3RIAK 1MJJA 3ZT5A 1WUNT 5EOQH 3U46A 1CGXA 1HH6A 4Q74A 5FHBL 3PL6A 4Y4HD 5HJ3B 2CK0L 1JF5A 3D3VA 3S37X 1RMFL 3L3HB 4JRXA 4L3EB 4OAWA 3QQNA 1D5ZB 4CMMB 1CG9A 2BOCB 4UTBH 5IB2A 1VFBA 5DHVA 4BK5A 1AHWB 2H26A 4P5KA 4G8GA 4K3GA 2H2PD 5CSZB 1REIA 3QP3A 4G9FA 5FKAB 5SWZD 5E4EB 3VXTA 4PJGA 3KXFB 2R56L 2F9BT 4MVBD 1G1YA 3LN5B 4HKZA 2VO5A 4L3AA 1VEPA 2Q76A 4JFDB 3ZT7A 2KPNA 3BPCB 2DMBA 4RRPA 3ULSB 3RUGB 2B1AL 3MJ9A 4ONGH 1YJDC 3WBDA 4EDXA 4Z8FH 3D48R 2BVYA 3KS0H 4JDVA 1UKQA 5EUOB 4YDKH 3WO4C 1J05B 2MJWA 5ADOL 3VMOA 1KN2L 5AEAA 2Y5EA 5KVGL 3H42H 2IPKA 2JJWA 1NJ9B 3OBAA 1A3QA 1J0JA 2K1MA 1INEH 1K4DB 2BVTA 1S9KC 2WUCL 3OB0H 1FZKB 3HN3A 2VXTL 2NZ9C 5CD5D 5CGYD 4P57B 5I1KL 2B5IB 4XP4L 1C12B 4UQ2B 1JZ2A 4GOSA 1YN6A 1U9KA 3MLZL 5JHDE 2BNQD 2DBLL 3VGDA 2VH5L 3DOSA 3MZGB 4OLUL 5GGTH 3EYSL 1RK0B 2WBJB 4URTB 5IIEA 5HGHB 3UTTA 2GITA 4PD4K 1NC2A 3LS5H 1ZWIB 4DEPB 2YPLB 4ZUVA 2QHLA 2FX9L 3REWA 1JGDB 5T3ZH 1T1XA 5EULV 3F6IA 3E8UL 3VFNB 4XRCB 2XFXA 2Y72A 4LPXA 4DAGL 1IGFH 1IGJB 2C5DC 2K3TA 1QBAA 4RAVB 4Y19E 5DURD 5F7YC 2YKLH 1RJZA 3RWJA 4EN3B 4XX1G 2AXFA 2VERN 2XN9B 1I75A 3VFVB 2QQNL 5HI4C 4X0KA 3SCMD 2BY0A 5BOPA 5FDWA 1OTUC 1CLCA 3QULA 4GRLB 5E9DE 2NY2C 4OZFG 1HXYB 4Z76B 5DUBA 2Q6WA 2GHWB 4L4VA 4QY8B 4HIEA 3PV7A 2P47B 2J12B 4JO1H 2BSSB 4WHYH 5FECB 1OSPH 1QHPA 3ZYJA 2WNGA 2BVOB 5FF6B 2YD1A 3R8QA 4P5TB 3WV0A 5DJZA 3HZVB 4Q0XL 5HBBA 1UEMA 3WFDH 3KGRA 4MB4A 1BVKB 4XNQA 4XWGL 3EOAB 1IAIM 1BOGA 1K6QL 4LSQH 3EKCA 1NAMA 2PYEB 3BKCH 5LCVH 2EIDA 2DM7A 3DUUB 3IYLW 4M7ZC 4X80H 5GGVH 1R3JB 1R5IA 5F1SA 4ZSOA 4CUCA 4PP2B 1A7OL 4LLUB 4LSTL 1AD0A 5HDLA 2BVPB 2VLKB 2BY1A 3P9MA 1NGZB 3QUXA 1WWAX 4UBDC 4NM4L 5CGMA 3CVIH 5D1QB 5KSBE 1CXFA 1PYWB 1RZKL 5C0NC 5L88L 3RBSA 5IM7B 2VDPH 5J56B 2NLJB 4XNYL 1INDL 5ISZD 4YNYB 2FJFB 1T4KB 4AG4H 2XOTA 3VFWA 1MFNA 3OJ2C 4UV4L 4PP1D 3CPLB 2X4OB 3BWAB 1M7DB 1H5BC 4HT1H 1U8MB 2VMFA 1AGBB 2HH0L 4YDVB 1K85A 3MA9H 1YEFH 3L7EA 5D4QA 2AK4B 4AIOA 1T03H 1FORH 3EYQD 4OLWH 5I1DB 1YZZA 2NPLX 4MJID 4LCCA 1UGNA 1S9WA 1Z9SA 5AYUL 1EO5A 4P9HH 5DHYA 2GT9A 4F7MA 4LHUG 1UCBH 4OFYD 4KJPC 2IMNA 4YEEA 9CGTA 4PBXA 3KPOA 3OJDB 3G5XB 3ZDYE 1EAPB 3KPNA 2AJVL 3WDHA 3AXLA 1C5DA 3NIDF 4Y4FC 5HYSA 2GIYA 2ADJA 4O4YL 3L5JA 4LK4A 1FQ9C 3QEGH 1HN1A 4Z7UE 5IHLB 4LL9A 1ZT7B 4OJFH 4HKXB 3KDMB 3QDAA 4E41A 4Y4HB 3I75A 4JFXB 1RZFL 2O5ZL 3B8YA 5IB4B 2I9TB 3FAXA 2LV4A 2GSIA 3UPAA 2AJZA 3O2WL 1RY7B 2JJVA 4G6JH 5E56A 5SWZB 3KPSA 5DMKB 4YQXL 1GC1L 1G7QB 1S9YA 5C2BH 4FXGB 3V9FA 1WFOA 4OF6A 3WSQH 3FOLB 1TMCA 4Y8DC 4RQQA 2HJKB 1P7QA 5JZ7D 5TJWK 3NZ8A 5LJYH 4FOMA 2W9DH 3MV8E 5IQ7H 4YHKL 3T0XA 5FAAA 4ZD3L 4FXKB 3S3JA 4D0BA 3MGAA 4G8EB 5HVGB 1FO0L 1MRFL 2Q7NA 4ELME 3KWWB 4LVOB 2VJXA 3W5NA 1QO3B 3QG7H 1I7RB 3QEQD 3EDDA 4G3YL 1T2XA 4OZFA 5EZIL 1XIWC 4XMLL 1DBBH 4LBEB 4PJHF 4FG6C 2E9JA 3Q5TA 4NZDA 4RGND 4NRYB 2P8PB 5L2JA 3SE4C 2A73A 4ODXA 5L6YL 5D1XC 3WD5H 1OAQH 2VNCA 4LDOB 4UU9B 5LGKA 5F72S 2VZ3A 1H15A 1SMOA 3PDOB 5L8JB 1XF2A 5D1ZC 1IL1A 4M1DL 4K7FA 5DVLA 3BESR 4YBQD 2BNQB 3FB7A 1XIWA 3V0AC 5FA4A 3C87A 4H1LH 2UZXB 4LOUC 5FXCH 1DQMH 1KB5H 4HIXH 3FB5B 4PJFA 4M7LH 3SE4A 1F3JA 4XTRC 5D1XA 5KS9F 4PJDB 4PS4L 3RQ3A 3GHEL 1QFWM 2X05A 1DFBH 3QSKB 4JDZB 5CEXA 4MD5A 4NUJA 5D1ZA 5DK3A 1P7HL 2PF6A 4PY8J 1J5OH 4U1SB 2AKRA 4PJIF 1MHPL 4XI5C 5DURB 1KENL 3BKJH 4OF3A 4WHCA 3TWCL 3MUY1 1K3ZA 1JPFB 2ESVA 3I3EA 2Q86B 1KB9K 3PGCB 1EDQA 4NSKA 2WY3A 2FX7H 1HQRB 5FM5M 5D6DC 3SCMB 3ARSA 3MLWL 3VWKC 5JA9A 1AQKL 5DUPH 1JHLH 4CRPA 4CN4A 3RWDA 2D9CA 1QR1A 2EIZA 2FATL 5JTWA 4JO4H 1HHHB 3L3GA 4Y5YC 5T1DH 1NUGA 1OP9A 1OARH 1U91A 1H3PL 3TA3D 4QYOB 3DVGA 5FO8B 4IRSC 1U8PA 5DZNA 3G5YA 1JYNA 2BXZA 2EYSA 3WYRA 2AEQH 3AAZB 5D6DA 2PTVA 1RUKL 3VWKA 3BXNB 1J8HE 3FRUB 4P2RD 3B8SA 3KNBA 4N0UA 3TBSA 4DVBB 4QWWC 3SE9H 4TNWF 4X5WB 3RNQA 3L5WA 4ZXBD 3K2UH 1R5VA 4LHUA 1M1SA 1A14L 3FQNA 2NY1D 2HKFH 4QRQA 1S7TA 1MCHA 3PWNB 3LQZA 4IRSA 4HX1B 5IESL 5KTEH 2NNAB 2OTWA 2OQJA 4OF7A 2OXHA 1FFNB 4GAJL 1YN7B 2IFFL 1YC7A 1Z9LA 2OBGA 5ISZB 4U6HB 1U2CA 3IDNA 4LNVA 4K71B 4ERSL 5E6ID 4B50A 4XCEB 2DLEA 1TJIL 4N9OB 4Z0XA 4LGPB 1WWWX 1G6RA 3MFGB 5CEYB 4TQEL 5C71A 1XT5A 5I1HH 4QO1A 4HK3N 1ACYL 1MIEL 3KYOA 3QWOB 4EOWL 4LASL 3HI5L 4X7EC 1JPGB 4GKOA 2EDBA 4L8SC 3V0WL 4OLEA 3ZE1F 1KPUA 4XPTH 5IW6B 2OMNA 1KCUL 4WEUD 4M93C 3C09B 4HWBA 4YXHH 1A22B 1T04B 4ZNEA 2YRPA 1HZHL 3LAFA 1JN6A 2XTJE 1FVCA 4P2QE 4UOJA 3NACH 4L9DA 3VRIA 1OAKL 2H32B 4KQ3L 4XPBH 4DTGH 4L8SA 3EYUH 4MD0A 2VQ1B 1AC6A 5J1AB 5IBTH 2VDRH 1PSKL 2R15A 4XZUB 1F11B 1GGYA 2CDGB 3O8XD 4J3OC 4NQVA 4X7CC 1D9KD 5MHSD 3ARBD 2J8UA 3BUTA 1DBKH 5DQDL 3V6FB 3FQUB 2ARJQ 4LSRL 1UH3A 1LEKA 3EHBC 3M07A 4M6NH 2Y36L 3HAEH 3LPGA 5CS7A 2WIMA 4X4XB 1BMGA 3FHAA 2ZZUT 2BOCA 3F7YA 4CBPA 2V17H 1YA5A 3K80A 4MSWA 3K8LA 4ZO9A 3X14B 4BH8A 4H0IA 1X5AA 4ORGA 3OR7A 3BJ91 1T1ZA 1G6VK 2HFTA 2LU3A 4HG4K 5CUSH 3D39A 3P9WB 5KOVC 3I84A 3BPCA 1XH3A 4RAUA 1HHKB 1QA9B 2QSCH 4ONFH 1JJUA 5CP7B 1T2JA 4QRRD 4NJ9L 1JF1B 4MNQE 3HC4L 3ZKQD 4L1HA 1BREA 4AIXA 4M9OA 4GW4B 3G9AB 3BVNB 5FUCC 3MODH 1UM6H 1T5WA 3QEQB 4KRLB 1GCFA 4Y1AE 5SWSE 1NGWB 3I50H 3L6FB 3V8OA 5JQHC 4QXTB 3NCCB 1YEJL 1RSFA 4XNXL 4RGNB 4LEXH 5JHLL 1XMWA 2X4NA 5IB5B 4RMUA 3K8MA 4HDIA 3UJIH 1MHHA 1Y0LB 5BS0A 2DIAA 1ZANH 1A9EB 3CSYA 1HWHB 2QKIA 3F7PC 3MRBB 4OZIA 4K8RH 3DLQR 1FIGH 4XNUH 4LARL 1T6VN 3CUPA 1YC8A 5D7LD 1EEYA 4LVHB 4YK4B 3U4BH 1SJXA 1B6UA 5EZLB 3O6FD 4DZ8B 1BZQK 1BFOA 4A6YA 2R0WL 3FO1B 5E6YA 3OKDB 3QRGH 3GUTB 4X4YA 3KLSA 4FFZL 3FT3B 2Y6SD 4X7DC 2WSKA 5EBMB 3DX9A 1JV5B 1B0GA 4AY0A 4JQIH 4I5BA 2B0SH 4XRCA 3PWUA 3G6AA 3R0NA 1XF4B 1RZGB 4YFEA 3TFKC 3X12A 1L9MA 1KGCD 3B9VA 4MAUH 1NLBH 2V2XB 4TSBL 2XN9A 3CK0L 4LSVH 1BECA 4FQLH 3GBML 4Y5VB 1BGXL 3VXQB 5F7DA 4PYGA 4QXGL 4P5TC 5H35B 4NNYB 4A2MA 4YHZL 4GKSB 1YMHA 5JW4M 1HXYA 4NHCH 3TFKA 3ZTJH 1KLGA 1I9IL 3TA3B 1Q38A 1BLNA 1UWXK 3Q2CA 4WHTB 1XGQA 3NVQA 1JF6A 4H1LA 5FECA 4JY5L 5CIPH 1C08B 4P2RB 4MHHI 4PGBB 1S5IL 5GJSH 1YEIL 3ZKXC 1I8IB 4ZXBB 1C7SA 5HYQB 2J8HA 3S4SB 3RWGA 2YUVA 2NY1B 2VAJA 5IEKA 1AXSA 2RFXB 4D9QD 2H6PB 4X9GA 1N0LA 2LU7A 1LDPL 3CSPA 3OGOE 4LVEA 2HWZH 2X4TB 3UTSD 3V5KB 5BW7C 3C2AL 1B0WA 1S78C 5I66A 1Y6KR 3EFFA 4LLUA 1ZLWH 1QRNE 3BH8B 4RFNC 2VLKA 1NGPH 1MAMH 3S35X 3WHXA 5KAQG 5TDOB 4Z5RA 2UVFA 5BRZA 1CBVL 4XPAH 4IOFC 3P4OA 2R0LH 1TZIA 3ULUD 5IFHH 3WUWB 5C7XL 2PW2A 5E6IB 3ARGA 3PABB 5D9SA 3ZYOA 4ORZC 4PGCB 4PJEA 4CJ1A 1U8KA 1CGTA 3T0ED 5CJBA 1FNAA 1X5GA 5ID0B 4XXDB 4ZUSB 2VSCA 3VFMA 4Q9BA 4TSAL 1OPGH 1AGBA 3JWDL 5GZNC 1E0OB 1F58H 1DVFD 3QT2A 4LSUL 1K4CB 3QCTL 1G9NL 4PJHE 5TQ2L 3RU8H 3NMEA 3GJFB 3S96A 3PWPE 4K2UL 3MR9B 1A4KB 4U1KB 5ANME 5D72L 2WLZA 3RZWA 5FV1L 1T6WA 4LDEB 2FWOB 1GOGA 2Y06H 3X11B 3HNSH 3RVTD 3HI1B 1IQWH 1KTKE 4R4ND 4EUPA 3QUMH 4OTXH 2YUZA 3MBEC 3SKMB 2FJGA 4PJ5D 2VC2H 3U2SB 3CFEB 5IMKB 5HHNA 3LEVL 5T3XE 4HH9A 5KS9E 1D9KB 3F65A 3ARBB 5AG8A 2OYPA 2A6KB 4WW2B 3O6KH 2NY7H 4D9RD 4Z7WF 2XWJB 4GSDL 4HKXA 4OZGA 2B4CC 5I1AA 4L29B 4V3EB 3GI8H 3MJ8B 2GKIA 4PJIE 3DTXB 5E4IA 1XGTB 1FLRH 2YXMA 1MIML 1MSPA 3KPLB 3EAKA 5HVWA 4QXWA 4X6DF 4R2GC 3MBEA 2I9TA 4G80A 4PREB 3MC0A 4HFUH 1MNUL 2CJUL 4F37F 4OV6F 2FCBA 1EFQA 1PG7W 3F58H 1FRGH 3WFEL 4X8XA 1MHCB 4NQEE 4LVOC 3BPNC 4LKXB 3VXMA 1DL7H 3QBTB 2OCFD 4YHLH 4GBXD 1A7PH 4TTGA 5JNYB 4H8WL 3CAFA 5CD5C 4QRRB 4GKZA 4YHIA 2EDWA 3FFDB 1UH4A 5IVZB 4X9FA 5J13B 3IFNL 2BC4A 4GRMA 4NN7B 1TJGH 3IU3B 4HLZG 3HKFA 4EI6A 1WZ1L 1YMMA 3QIWD 2UYLB 4I0PD 4PTTB 2OZ4A 2GSGB 2V7HB 1KCSH 4LBEA 1E4KC 5HI5D 5LQBH 3JV0A 2IBZX 3HAEA 1MLBB 1CFNB 1JRHH 2WBKA 1ZEAH 4JGJA 4OIIL 3V5DA 5T5NF 2D2OA 2AEPL 3IKKA 4BUHA 1AGDB 3HE6C 5D7LB 4YR6A 3MBXL 4G43A 3K4ZA 3O6FB 4MWFB 4W4OC 4X7SH 1E4KA 1MFCH 4YXKL 4BH7B 1ULVA 1A3RH 1T3FB 4XNZB 1VEMA 1WFUA 5E2UL 5ADPL 4NO2B 4ONHB 5F7FA 1VSCA 3S98A 4JDZA 1H3VA 5MENE 5DJ8B 3HE6A 4WU7B 2XKNB 4W4OA 3VXSA 3WKNA 3WDIA 4NNPL 3ZE1E 3L3KA 4Z0BH 1LO3L 4PJAF 1HQRA 1A0QL 3OKOB 2GK0B 4U3HA 3HFML 5EZJB 1NBVL 1S5HA 1TNNA 5DVMA 4M61A 5C0RL 1DUZB 1MFBL 1HHHA 4I3RL 4D3CL 2HJFA 5T3XH 4D8PB 4RFOH 1IJ9A 4HCRA 4M1GH 3FTGB 3C5ZD 3PIQA 2X7LB 1XCTB 1ZTXH 4XP6H 4F80A 3FRUA 4JKWA 4OI7A 2HP4A 3OB8A 3RPIB 1FVEB 2F8OA 1TNMA 3M45A 1EMTH 3D2UD 1P7KB 5JHDD 1M71B 3G6JB 3UTSB 3VXOA 3MUJA 3RHWK 1G0YR 1HOCA 3BZFB 3QG6A 2B2XL 5FYKH 3OPZH 3T65A 2NNAA 2QQKH 5DJ6A 4OF0A 1CE1L 3AY4A 5EU6A 3IGAB 3S34L 1G1CA 5IR1A 5IMOA 4FQJL 4PRNB 3ULVF 2XI9A 2UVEA 3B43A 1F4YH 1XF5A 4HIIB 3DVFA 3L3DB 4PUBL 1WTLA 1EFXB 4Y19D 1KXVC 5BZWA 1NSNL 5E2VL 1GGCL 3T0EB 2ORBH 1T21B 1OW0A 1W72L 2R2EA 4KAQH 4MA1B 5T33H 4IMKC 4NQXB 4CVWA 5HHMA 5C70A 3AM8C 5CIPA 1N64H 5E9DD 1DVFB 2ZOKA 4WW1B 4K55A 3DARA 3GM8A 3E3QA 3C5SB 3PGDA 5KSUA 1NDGB 1MCPH 1IC1A 1UZ8A 3JUYA 1AY1L 3U0PB 3RVUC 5EUKB 3QO1A 1T04A 1P4BH 3FRPA 4FQ2L 2NY5L 2IQAA 3LIZL 5TQ0H 4X6BB 1V8HA 1NFDA 4QRTB 4IMKA 5CHNB 3MRCB 3MMEA 2UY6A 1IKFH 1LP9F 5GSRB 4ZFGL 3DGGB 5JOFA 4F8QA 4MQSB 1MFDL 4ZUWA 1RUAH 5I1GH 4UDUB 1L6XA 1QQDA 2ICWB 4N8VB 4PJ5B 1IC7L 4N0CC 3S6CA 1Q9LB 1S3KH 4GRWF 3TT3H 2FLRT 5HHXL 4W68A 2VDLH 1X5YA 1GHFL 3P0YH 2JB6A 5JQ6H 3PWVA 5D6CA 4IDJL 3MROA 3TPKA 3TP4A 3WUWG 4NBXB 1LO2L 4WCYH 3NCJL 1GVIA 1D5XB 1EEQA 1U36A 1X4XA 4RWYH 5GGRA 3U36A 4Y4KC 1IM9D 3B9EA 4JE4B 4PRPA 2XACC 1U95B 5C3TA 4N0CA 1MOEA 1UADC 1KIRB 2L7JA 4Q9QL 2G5BA 4M02A 4U1HA 2XQYG 4UV7H 1IARB 3D0LA 3MRNA 4K3JH 4EDWL 4F58H 1WGOA 4ZO7A 5CAYB 4JZNB 5TPWH 5T1KD 3TBVB 4U3XA 4GBXB 5MERA 5KW9H 4ZQKA 5ALCH 4OM1H 1QA9A 1UT9A 4UAOB 3I6LE 4Y4KA 1X5ZA 3BT2H 1NBYA 4W6WB 2R0KL 1YQVH 1UWEL 4GW4A 5KG9B 3BEVB 2X4UB 3SDXA 3L95B 3LKNB 3QEQA 4O58L 2BK8A 4YBQC 4NQUA 3QIWB 5JR1H 4I0PB 1NQBA 1NGWA 2BHYA 3CD4A 4CU7A 4QXTA 2PYFB 4I2XA 3MLRL 1HKLH 4OB5H 4WU5B 2DYPD 4XVTH 3M8OH 3R1GL 5AAWA 1YPZE 3LV3B 3U7WH 4YHNA 4TTDD 1BAFL 3QXAA 3SN6N 5JIIA 3NZHH 1AD9A 2YN5A 4KMLB 2UZYB 3MRBA 3C8HA 4M8VA 1XGUA 2Q3ZA 4XNMA 1YDPA 4JDTH 4ZOCA 5D7JD 3OAUH 3IAPA 4DZ8A 2ZJSH 3QQ3B 1MI5B 3WIHL 4N8PA 3TPUE 3VD3A 2NY3D 3NFPB 3QNZA 4Y5VC 1ZAGA 1Q0YL 2JELL 4G42B 4Z78B 4RWHA 2VWEE 2XZAH 1UZ6F 3DV6B 3T0WA 1A1MA 1UM5H 2HFEB 4HUMB 4JFFA 2DF3A 4KZDL 1FZJB 1CLOL 2NX5A 1NCDH 3H9ZA 3GMMA 5HDQH 3CDFA 3MV8D 5SX5H 1BP3B 2PTUA 4ZS7L 5GGQL 3G5VB 4WEBL 4Y5VA 2CLZB 1P53A 2APTA 1NGYB 5H35A 1T7YA 3LSOB 5EBGA 3V6BR 3PWJB 5F93C 3OX8A 3RNKA 2BERA 3QJFB 5ALBL 1L8JA 3C5ZB 1OCWL 4NZTL 4GAFB 3OKEA 1HINL 1C08A 3LKOA 4K23H 3IETB 1P5UA 3ALXA 2Z35A 4OCLC 3MJ7A 1FG2B 1CDUA 1CICC 4Z7WE 5JIKA 3DI3B 3D2UB 3S4SA 3W0WE 5JHDB 1PX3A 5E6IC 3BP4A 3ECBA 4OM0H 2EH8L 5HY9A 1JGLL 2ARWA 5CINL 4QHNA 4DKEH 4X6DE 4FRWA 3V5KA 3OV6A 1O7SA 2GAZB 1CD1B 5DRXA 4MXQD 5AZEL 4XVSH 2E9BA 3WNMA 4MS8C 4TVPH 4HXAL 4KH2A 1L0XA 4Y7MA 4KWUA 4U33A 1CICA 5EA0H 1B2WL 1JZ5A 4OGXL 4V1DA 4ZD3H 1NLDL 4Y19B 4R7NA 5MEOA 5E6IA 4DZBB 4RA0C 4PGCA 5DD1L 4KU1A 3EZJB 1TVDA 3QQ4A 2FB4H 3INUH 4FXLA 5ID0A 1DSFH 3VFGH 1I7TB 4MS8A 3JXAA 1DUYA 1KF9B 4NO0A 3MXWH 5E9DB 2CGRL 1XR8B 1SBSH 2KH2B 1QSEB 1PBYA 4K3EL 5FIEA 3WE6B 2FL5A 1MREL 3TYGH 2D7MA 3QXUA 5EU4A 5IB1A 4BSJA 3RL1B 2CLVB 3ARBC 3FONA 4IDLA 2ZKHH 4WW2C 1J8HD 1FZOA 4RX4A 3T3PF 1SJHA 3VI3F 1KJ3L 1A6UH 4MNHB 2R2BB 1PGRB 1FV1A 4O9HH 1MCLA 4APQC 3LRSB 1LO4H 3L7FB 1ZVSA 4PJ7F 3U2SA 3ZTNH 2VZOA 2DD8L 5F97E 3W2DL 5LWYL 5BZDA 1E28B 4XC1H 2A6KA 4HUUA 4WW2A 3RKDD 4U1IA 5F9JA 5DK0B 1X5IA 1AO7A 1OLZA 3P3YA 3AREC 1OAZH 4NGHL 4L29A 2ED8A 5KSBB 4Q7DA 3MLWH 4XCCL 2AGJL 5TE6L 4XVUD 3KPLA 1IM9B 1HHGB 4XPGH 4APQA 3NCBB 5I15H 4K8RD 4PJAE 1TVHB 1J12A 1I7ZA 2C3WA 2AJ3A 1Z3GH 5C0CE 2ZNWA 5F9WC 1MHCA 3G04A 4N68A 1KB5B 4U6VL 2NW3A 1FFQA 5T1KB 2X42A 3OR6A 1PG7X 2I26N 4HUWB 3CNKA 4KV5E 2DI9A 3AREA 4KHTH 1IILE 4Y88A 2N4IA 3D0VB 4JG1L 1ZVHA 5DVNA 5C8JB 3HI6H 2A38A 1DEEA 5FGRA 2WAHA 2P24A 3REVB 2R1YB 4NKMB 4Q2ZA 3O41A 2IGFH 1UXSB 1YEHL 3AVEA 4QTHA 1G7MA 1S7RB 4PGDB 4CVZB 5DUMH 2C26A 4R96B 5DF0A 4JY6B 1CK0H 2XTJD 2UYLA 4P2QD 1CFTB 1VHPA 4PTTA 2QR0B 4PJCA 2HJLB 3OXSB 1G7LA 2DYPB 1D5MB 4NQCE 5GISL 1WBYB 4NFBA 3GB7B 3LEYH 5DLML 2FSEB 3FB8B 4XNZC 1W0VA 4KI5F 1BJ1J 1X4ZA 2P7TB 4BFGA 4PRBA 1E4XL 3T2NL 3RWCB 1RULL 4FABH 3CJJA 3E1F1 3O3BA 2A83B 3CDCA 3NPSB 4MA8H 3RWIB 4L8CA 4MCYB 4Z7UB 5BVPH 5DJYB 3UBXA 5D7JB 3ULVE 4PRIA 1QTYT 1VGKA 3ZKND 3A6CH 1RZ7L 4UDTB 3O0RL 3KYMB 3VXPB 3AS1A 2GJ6A 2R2CA 3C6SB 5ESQA 3N9GL 3UBXI 5IMMA 2NY3B 3Q0HA 4LASH 4AQ1B 4TUJB 1KPVA 2VDML 2EYTA 4X99A 3L3IA 2DQFA 1EHNA 2I07A 5IROC 4KPHL 2CRZA 3LHPH 3JZ7A 3LQAC 5GGRY 1P1ZB 4LCUA 5JPMB 3FO0H 2OJZL 1F4WH 1HZHH 4DFIA 3MV8B 1AXIB 3O4OB 3SEPA 4U2ZA 1H8SA 3W39B 2VE6B 1E6OH 4JM2F 4M6ML 4MNQD 3NCYP 1JPSL 1BM3H 2J7LA 1NMAL 1DUZA 3QCVH 3WJLC 4XMPH 4ELMB 1JYVA 5IROA 1G9MC 2CUMA 4Y1AD 4QOKE 5SWSD 4D8PA 1RHHB 1AFVH 3ES6A 4OD1L 3EDEA 4U6YA 3MQIA 5FM5O 4XB8A 1DEDA 4AL8H 3BDBA 2BSTA 1FNGA 5HGDA 3KPMA 5GS0H 1OM3H 1D5BA 1PVHA 3Q48A 4JRWA 1UH2A 1D6VL 1VFUA 2EH7L 1YYLH 2BCKB 1FCCA 4DWHA 3WJLA 4U1JB 3BEWA 2X09A 3KYNB 5I1LA 4OLVH 3V0VB 5E5MA 4HBQA 5HD8C 3BZFA 3QDME 4NKIH 1OWWA 4LRNL 1NUDA 4JO2L 4MJ2A 3BKYL 5DMGD 4PGEA 5FYJL 4MA1C 1EH9A 2MPAL 3G5ZA 3GSNB 4PJ8D 2QHRH 1JTTA 1F02I 3EJZC 1DVFC 2P8MB 5DMIH 4QTIL 4DVRL 4PJXF 3GHBL 4I0KA 1EFXA 4MA3B 4Y2DD 1S8DA 2VABB 1D5IH 2E27H 5GS3A 3U83A 2F5BH 3IRZA 3NABL 43CAA 1KCGC 1J1XH 4DUXA 1JFQH 1T1YA 3SDCC 4FNLH 1GZPB 2F53E 4JANA 1AH1A 3CXHJ 1RZJH 5A43C 3BIKA 2EDEA 4XHJD 5DDHB 5D71H 3C8DA 3C5SA 3EO9L 1TCRB 2FNBA 4KXZI 3ULVH 1L0QA 4G5ZL 1T0MA 4ODVL 1J8HB 2Q20A 3MUGB 3SDCA 3BN9D 1SQ2N 4P3CH 1NC4D 5CHNA 1BVLB 5DD0H 4ZPTB 1FG9C 3NN8B 2VL5B 1FHGA 3HUJA 4IOIA 1QBBA 5EIIB 5IOPB 3QI9C 4N8VA 2O61A 3M17B 3SDYH 5DS8B 2CLRB 1I8MB 5ICZA 1EJOH 1FL3B 3QNXB 2VLJE 1QRND 4F15C 4MXWL 4AEHL 3SGDH 3BP6A 4JFOB 1LO5B 1UZ6E 1PDKA 3U4EB 1E6JH 3P73B 2FBOJ 3QIBA 2W9EL 3QI9A 1ZT4B 4YHPA 5ENWB 5F89A 5GZOD 4XXCC 1MFEL 3Q5YA 4RIRB 1KIRA 3Q6FB 3QPXH 4O02L 1VDGA 1VACB 4LQ1A 2ARJB 2E6JA 4MQ7A 5GRWA 5FM8A 3QIWC 3EOBA 3S7GA 1MJUH 2CMRL 1T7WA 1RJLB 4GXUN 5EBWA 3VI4F 4LNRA 4ODTL 1CDBA 1OQXA 1S5IH 3F12A 3QZWA 5KANG 2E8ZA 2IANA 1H3WM 3PWPD 4WWKD 4JN2A 1A6WL 1TZHA 4ZAKC 3PP3K 4X4ME 2QSTA 1SY6A 1I1AC 2I5YL 2XZQL 2XTJB 2G60L 2Y7QB 4FFVD 3QIWA 4P2QB 1SYSB 5EFIA 3MGOB 2EDOA 2XPGB 1IM3B 4WUKL 2YRZA 1OAYH 5F1NB 4P48A 5IBUB 4FFYH 2X1OA 4GH7B 3W81A 4P23D 4LPVA 2O5XL 3TESA 3LH2L 3QDGA 2BRRL 2WWKT 5T3XD 4ZAKA 1GOHA 4TSCH 4PTUB 4QT5B 1WAAA 4ZOBA 5F3BB 1I1AA 3IFPA 5L2KA 1NGQH 3BPOB 1KIQB 4HC1L 3QXDA 3B9KA 1CLZL 1YY8B 3MYJB 1ZHBA 4ZDHA 3LS4L 5C0DB 1MI5A 5K9OB 3X3GL 3MV7A 4ZUUA 2V9RA 2AK1L 3GI9L 3NFPA 3MXVH 2FEEL 3LEXB 1S7WB 4NUGL 3WJJC 3R06B 3FQXB 1MEXL 4RFEB 5TH2B 4WNQA 5DC4B 5DD3H 2G9HA 5EU7C 1FGVL 1K9TA 2BHUA 2WBWB 4NQED 4JRYD 1ZS8B 4HS3B 5HYFA 1UQSA 2HFEA 4JPKH 4P2OD 1AQDA 5LAXB 3IJYB 4J3WA 5HYJA 4G9DA 2PO6B 2GCYA 1I7UB 5GPRA 5DGQA 1CFBA 1BD2E 4KZEH 4NRXA 1OGTA 3G5VA 4Z7VA 1F4XL 4MNQB 4F7CB 1EVUA 4GAGH 3WJJA 1SEBB 2X4SB 2R2HB 5IEHA 1G7HB 3T3PE 4CKVX 4CMHC 2UUDK 3LSOA 3VI3E 2ZCHH 3O2DH 4Y1AB 5SWSB 3CFJB 3LEVH 4LP4A 1IGMH 3KHOA 4I18C 4G6KH 3HC0B 4GUPA 1VA9A 1KCVL 5D2NE 1I8KB 1LK3L 5EZOH 1NCNA 2OL3H 4OLXL 3OJMB 1Z2KA 5CBEB 1FL5B 4Z9KB 5K9JL 3E2HB 3K1KC 1CL7H 4U1NA 4L4TA 4OCWH 3DX7B 4OBRA 2WINA 1F8TL 5I1JH 5MEQA 3VRJB 1RZIB 4K7PL 5DR5L 1KCLA 4I18A 1OGAE 3NA9H 4IEFB 3VE0B 3CLEL 1CD1A 2X4QB 4PJ8B 1CFQA 4NOFA 5FFLA 5J9PA 3QUMB 1HI6B 5GRUH 1M7IB 2W0PA 3MLSH 2YMXH 4DKAA 3MRKA 1JNHA 1MJ8L 2E8YA 1C16B 5MEND 5C0AA 5FDYA 2VZTA 4WTXA 2I60H 4Y2DB 1TETL 3B2UC 4CNIB 2C4FU 2X4RA 2VDNL 1XF1A 1U8QA 2PTTA 5L0QB 1ITBB 3C08L 4XBGA 3DXAA 2FEDD 1NKRA 4EJ1C 3RGHA 1I9RH 1DBAH 2DQIL 4F7TB 5EPMB 1MCOL 1S7QA 2DJUA 1QSEA 3W9DB 3P0VH 4BK4A 2QQQA 5B38B 4H88H 3B9AA 4X83A 2ZUTA 2HA1A 4D0DB 4KI5E 4O5LL 2MHAB 2YHGA 1NC4B 4F33A 5GJTH 1FE8L 5E8OB 4OZHF 4K9EL 1JPTL 2Q87A 3IS0X 2J6EH 2A1WL 1NCCH 4YUEH 4WDIB 1RZJC 3TVMD 1C8PA 1BF2A 1FYHB 1PX4A 3IRPX 3MRMB 1QSFA 5FUOL 4JB9L 4ENEC 1DQDL 3U1SH 1JNNH 1HE7A 1WBXB 4M6OH 1IC5L 4QLRA 1JGUH 1IAIL 5DJXB 3K4AA 2R23A 4XMKL 3D69A 4R26H 3QH3B 4YDIH 3P30L 4YX2H 5HHVH 4DK3A 2ADFL 2X1PA 2VLRE 5B21A 3WKML 3MRHA 2V2WA 2XT1B 1H3TA 2AV1A 2CUIA 3DRQB 3MFFB 4JHWH 1DLFH 4IIQA 1LE5A 1QEWA 4G7YL 4JGMA 4KJYB 4U1GB 1U41A 1X5KA 4GXVH 4KVNL 5GRVL 4FQIH 4TULL 5B22A 4R7DB 3EO1A 2YN3A 4KK8C 1YEEL 5EOTB 3D0VA 3P9LB 5ERWB 2NY0D 3TBYB 3REVA 4PJHB 2BXYA 3FQWA 5FA3B 3PWPB 4N0FA 4WWKB 3BZEB 5AD0A 3MOAH 3X3FL 1MLCA 4KUCF 5ANMB 2YBRB 1S7RA 3L9RB 4KK5D 1A6VH 4X5XB 1F90L 2H9GA 4Z6AT 5JMOC 4CVZA 2YEZA 1MUJA 3VGGA 5D7JC 1OB1B 4ZO8A 3HG1B 1IAKB 5IB3A 5ICXB 4KROD 1ITCA 1UKTA 3HZMB 3JTCA 4H0HB 3BI9X 1XGYL 1ADQH 5DO2C 4P23B 2HRPH 2FSEA 3O3AA 4R4FL 2JTDA 4J1UB 5HHQB 1KFAL 2HN7B 3GRWH 4OIAA 5KS9B 4R8WH 5C0IB 5I19L 2WUBL 2WP3T 4MCYA 4OSUH 5IVXA 3MA7A 3CCHA 1GGCH 2X40A 1R0AL 1T22A 4MDJA 1MCEA 3VW3L 4PJIB 4PJXE 4WFGE 1A6TA 1XR9B 3P4MB 5CJQL 3NAAH 5TF1H 3ARVA 4U4BA 3O4OC 2HT3D 3M1BB 4GLRI 2X44D 3C5JA 3SE8H 3GGWB 2WM0A 4F3FA 1WZLA 3STBA 5IBLD 5DVKA 4WUUE 4KTEH 3O81A 1R3HB 3QXVA 4GW1A 2DLTA 1E27B 4KDWA 4NQEB 4JRYB 5F71A 4P2OB 3MLXL 4ZTPL 5FUZH 3TO2A 4BYHA 5C07A 2HFGL 3SDDC 5T5FL 2OTPA 1ZGLM 3UTQB 4S2SB 1I9JL 3I6LD 2IWGA 1RIVL 4Z7OF 3WFBL 1ZT1B 1PFCA 3CH1A 4OIBA 1A21A 1PY4A 2LE9A 3BMVA 1CLYH 3QEUB 3S36H 3NFNA 1ERNA 5I16A 3UO1L 2XXCB 4HIHB 3IDYB 2R1XA 4XVJL 3EO0B 3FT2A 5IBUG 4HK0A 3SDDA 3GMNA 4X6CA 1V7NH 3IU4L 4D2NA 3GNML 4ONOA 1N5YH 1INQB 5ELIA 1K2DA 3QHZH 2YK1H 1OL0A 2BCKA 1CYGA 2VITB 4NZJA 1QBMH 5DRWB 5JUEL 1UACH 3N1PC 4U1JA 2V7NB 4ZNCD 1GPOL 3KYNA 4Q9QH 3UC0H 1VFMA 2DICA 5ESVA 3WFHA 2HLAA 4ELKA 4I3GA 1CFVL 4H0GA 1MWAH 2NXYD 2ZSWB 1F5WA 2OMBA 2JF1A 3HE7A 2CKBH 4JO3H 5CZVH 2VXQH 1ZSDA 4F7EA 5INCB 2O5YL 1XFPA 1V05A 3SQOL 4U05A 1A7RL 4UI2A 2KKQA 4L4JA 5MENB 4AIZA 1EJ6A 4BA8A 3VI4E 3OQ3B 5ILTL 3BIBX 3ZT6A 4NQSB 3MRLB 3EW3B 5D70L 4EVNB 5KOMC 2C4XA 4L3CA 4OT1L 3X13B 1NAKL 1EPFA 1C5BL 3RX5A 3BKMH 4P4KC 1QLEH 3BO8A 5EU3B 4YBHA 3TIDA 2P45B 4OQ1A 2CR3A 3BPLB 4X6EB 1TTUA 3NBNA 3NIGF 5FYLE 2AJSH 3D85A 3KPQA 5L9DH 3MO1B 1UYWH 4KUZH 4GMSH 1GOFA 2LABA 4OGYL 1AIFA 3QQ9D 5DRZA 4P5MA 3TJEH 4OUUB 3VGAB 1NANI 1IMHC 4GJTB 4P4KA 5BMFH 1DR9A 2DQJH 3ULUL 2EEBA 5BQ7A 3QPQC 4G6ML 1SHMA 2VL5A 4PDCE 3W0WD 3TVMB 1JWUA 3I6GB 4P2YA 5BV7C 1HYRC 2K7QA 1Q9KB 2HT4C 5F21B 3CXDH 3SKJH 1KN4H 2CLRA 4K3DH 1E4JA 1ONQA 3FZUC 3FKUS 4QHMB 3IT8D 2DI7A 3GSXB 2C1OB 4UTBL 4XAKE 4JFOA 1A1OA 1BZ7B 4KKLC 3VJ6B 5E8PA 1CDYA 3P73A 2D9QB 4QF1B 3LN9A 5EIQA 4JGUA 3LKPB 2IG2H 1LE9B 4H25A 2HTLC 2Q8BH 5D2LA 1X9QA 3Q6FA 4AMKH 2EXYD 4HV8A 3NOIA 1M6OA 2YRLA 1KG0B 4MQTB 3JV4B 5JW4R 4IMLA 4Z8FL 3STLB 5F9AC 2GY5A 5EN2B 1RIUH 4YDKL 4KJWD 4QNPF 2NY0B 3H42L 3DX8A 1DBJH 3GKZA 2ITCA 3CXHK 1IKNC 4EI5D 1FYTE 4AH2A 1INEL 3CZFA 4YGVB 5E08H 4JFPB 2PW1B 4ODUB 2EH8H 2VAAB 3BPOC 1ORSA 2Y7QA 4HWZB 2YC1A 4PJGF 4KROB 3UYRH 2VISB 2XPGA 2XWBB 3ZYIA 4LLQB 1MFAH 2AV7B 4HSQA 3MRFB 4WI2A 3AFLA 4YXLH 2FO4B 2VDOH 1IKNA 3T8XB 5HHOE 2R39A 5I75C 4UINH 5IT2H 1J8KA 1MRDH 1P2CB 4ZPVA 4PTUA 5BJTA 2F5AH 3LS5L 3VXRA 1PQZA 3RDTA 3SGEI 1KPRB 2P8LA 5J12C 1H0DA 3HPJB 2V2TB 4LLDB 5T3ZL 1F3DJ 5GS0D 5DJ0B 4PRAA 1CGUA 2PO6C 1W0WA 5F7HA 2Q7YB 1IGFL 4J12A 4FQQB 2YKLL 5FYLH 1GGTA 4G8IB 4FZEH 1SJEA 1WVZA 1S7WA 5DD6B 3R06A 3PP4L 3KPRA 1HHIB 2R69H 3P4NB 5C0CD 1BQUA 3MYZA 3RVWD 5JXEC 4J2XA 4N90E 4S0UC 5BO1H 2NTFB 1QLFB 4C4KO 3H9YA 4KDVA 2PO6A 5C0GB 3FFCE 1AGFB 2APWA 4J8RA 3HB3C 4IS6B 2JJUA 4HFWA 2MQCA 4M3KB 2VLLB 5E1AA 4B0MM 4XCNA 1ADQA 4HH8A 4GAYB 4PV8A 5FGCE 2YD3A 4JO1L 3RA7H 3RWHA 3QDJE 1I1FB 1S7XB 3OGCB 1OSPL 1U3HC 2BSRB 3Q1SH 5JXEA 3ARFD 4OZHE 2C7UA 5D5ME 1T0NA 3QJHA 3GJEB 1FNEB 2N7BA 2XTLA 4HKJB 5EOCH 3MNZB 5ID1A 3WFDL 4WV1C 1MHEB 4LSQL 3VWJC 2HT2C 5DJCA 5LCVL 3BKCL 4PJ8C 1FDLH 3CDGB 4S1SL 4X80L 1FL5A 5GGVL 5D7IF 3HCVB 3CVHH 4WWID 3ROOA 3VMPA 1U3HA 2SEBA 3H9SE 1ORQB 3QO0B 1BX2B 3ULVD 4J3SA 4N5EC 3CVIL 4YDJB 3IB4A 3SOBH 4POUB 2NXYB 1UVQB 4OCSH 4U6VH 2VDPL 4WV1A 3TPUB 4ODWA 1SVCP 3VWJA 5L0QC 3G6DH 1YEDB 4Q9CA 1A5FH 4AG4L 5F1IB 4OZ4B 5FYJE 2X89A 3SKNB 4F7PB 1YEKH 1J0KA 3T1FA 4D9LH 3QFJE 3IKCB 3BGAA 1M7IA 1FGNH 4XHJC 4HT1L 4GG6E 1JI1A 2Z92B 4V2BA 1ZK9A 4N5EA 4JJHA 3LDBB 1BPVA 4Q58C 3MA9L 1YEFL 3N85H 3ORJA 4UTAH 4C56E 1ZLVH 1AXTH 5JW5B 1T03L 5HXMA 1FORL 4LLYB 2GJZB 2QADD 4OLWL 2QJDA 5IUSA 2M8XA 3HR5B 4M8QB 1D6EB 5DSCB 2F8VA 4DGYH 1LWRA 3GSVA 4P9HL 3W9DA 3B3IB 1RZ8A 1UB5A 3CX5J 5B38A 5HPMB 1UCBL 4RMWA 2P42B 3JV6A 3B83A 2JCCA 4NNXB 4K94C 4P46D 1PZ5B 3FQTB 1N7MH 2VQTA 3RAJH 4NKOA 3VXUE 4Z7WB 2P48B 1TITA 2P5EE 3QEGL 1A1NA 3W0WB 3WL9B 4OJFL 4HF5H 1XF3B 5I8EA 2NZIA 3WFZA 5FCSH 3THMH 2FBJH 4M48H 4L8DA 3UPRA 4XH2B 4X6DB 4U1GC 1FN4A 2ITDB 3QDMD 1RI8A 4N9GA 4XCYB 4BELD 1JWMB 2BDNH 1U8HA 3HNVH 4Y5XC 3D6GA 4I8DA 4G6JL 1FL6A 3V5HA 5SWQA 32C2B 3P77B 2EEAA 4ZFOL 5J6GA 1Q94B 5C2BL 2R9HC 3O4LE 1AE6H 3WSQL 5DJDB 4WWKC 3NH7H 3FT4A 1JP5A 4Z7OE 2W9DL 5IQ7L 3JWOC 5EG6C 3JBG7 4DGIH 3H3BC 5EC1B 4Y5XA 1RK1B 2F53D 3PHQA 3A67H 3LZFH 5C0BA 4LGSB 43C9A 1WITA 5HGAA 5A3IC 4BZ1H 4MAYC 3P9LA 5ERWA 1C5CH 3T2QA 1JZ7A 3IDMA 3QG7L 1FJ1B 2X1XR 3EYVA 2EDYA 3TGXA 4EI5B 1DBBL 4WWKA 3QWRA 8CGTA 4FTVA 2ZP0T 1IVLA 1N8ZA 1Q9OB 4X5XA 3QUZD 4BQ9A 2ZUQC 2DMCA 3WD5L 1OAQL 1J10A 1T66D 4H26B 5T1LA 5DEGB 1DDHB 3HG1A 4UQ3A 5ICXA 1FFOB 4H20H 4PRHE 4HZLA 4WTWA 3KPPB 4MAYA 3MCKA 3OKMA 1X6NA 4XBEH 2CO6B 2EXWC 3QFDB 5KVMC 2HKHH 5AYQA 3L5XH 4J1UA 3HZKB 1DQML 1KB5L 4HIXL 3D5OF 2DQHH 4LCWE 4M7LL 3VA6A 4IM8A 4HULB 2L4OA 2VLJD 2DQGH 4I4WB 3EJYC 5E5UB 4LCIH 1BF8A 1DFBL 4NQDD 1JHTB 2A74A 1J5OL 3TJHA 3BKJL 4JREC 4PJAB 2QSQA 3LRGA 1N6QL 1ZLUK 2ZNXA 3BHBA 1R3IH 1N2RB 2FX7L 4RBPK 3MLYH 3I02A 1LVEA 3FAWA 2EYRA 4JKLA 5EU5B 4NYLA 3FJTA 3NIGE 3O9WC 1EHXA 3T1WA 5DUPL 3GMPB 5KVEH 1JHLL 1XAUA 4ODSH 3V52H 1QACA 3IVKA 4JO4L 3VD7A 4CL7A 2ERJB 3UTQA 1U8NB 3VG9B 4PJFF 2UWEA 5T1DL 3WEXA 1CGVA 2ATKA 4ETQA 1GJIA 3CFBA 4P99A 4ODHH 4G7VL 4PR5A 3ARFB 3O9WA 5DEFA 3SE9L 3IDGB 5I76A 1QBLH 3BQUD 2IH1B 4KKAC 3K2UL 3V4UH 4AEHH 4F2MA 2D7TH 4Z77B 2HKFL 4HJGA 1BQHB 1XGRA 1V3KA 2EDDA 5IQ9B 1PKQA 5KTEL 3BP5B 3L3JA 4JFEA 2VUYA 1A6ZA 4MCZB 3RI5F 3V6OC 5IVNA 1ZGLB 1G9EA 3DROA 4LMQE 2FEDC 1CFSB 4NRZB 4MJ4A 3OHXB 2RHEA 4NZRH 5I73B 3MRRB 4ZTOH 1FAKT 1C1EH 4NO3B 3QR2A 1KXQE 3C6LD 1KJVB 5I1HL 5I1CH 5F1OB 4QNPE 3V6OA 4LHJB 5TDNA 1PY9A 2W0FB 5JDSA 3GMRB 2GYSA 2CO7B 4JRXE 2ZSVB 1BD2D 4FQPA 2GFBB 4XPTL 5CZXC 1HDMB 2GUOB 2PR4H 4Q9RH 2QADB 5C1MB 4G8GE 4GT7A 3K0WA 4G9FE 1DN0A 4YIQB 3EYFA 4YXHL 1LP9B 1VPOH 4PJGE 5INDB 3MLTB 4LQFH 4KGJA 4F57H 4GMTH 4NM8H 2G75B 3NACL 4H5SB 2DKSA 3DMMD 4XPBL 4DTGL 3KLAA 2YA2A 3EYUL 3GBNH 4P46B 3Q6GH 3U0TB 1KULA 5C9KA 4GRWB 1B6DA 25C8H 2IADB 4NWTH 5IBTL 2D7PA 5MI0B 2VDRL 3TIEB 4D94A 3QAZB 2AJYH 3MOBH 2F74A 5KZCD 4NC1C 1MELA 4BZ2H 3D9AH 4KK9C 1RZKC 1U93B 1DBKL 4ZUTA 1EBPA 1FVDB 4GQ9H 2Z8VC 1Q9KA 4M6NL 3MLVH 5TE7H 1WCBA 3QDMB 3HS0A 5DJ2A 1OGAD 5A16B 2EE3A 4POZC 1TJHH 1LK2A 4QHMA 3L5IA 5M95B 4NN6B 1RVFH 4WI3A 2V17L 3DUSA 3TNNA 1VFAA 4XAWH 2FYYB 5ACZB 1J1PH 3HZYB 4RCAA 4JPVH 4NIKB 3O11B 5C9JA 5C0FB 5CUSL 3UTTE 5JW4N 4KK5C 2QSCL 1U8LB 4FQXA 2VOTA 4ONFL 5MEPB 5CBAA 5I1IH 2J8UF 3DO3A 4FP8H 2F53B 5GIRB 5A2JH 4KROC 5IJKC 5IG7B 3H0TB 1JGEB 4PRDB 2JIXD 2HFFA 3MODL 1UM6L 1JYXA 1N5AB 2PXYD 2BNRA 4OLXH 3I50L 2VXSH 1CZ8H 4JN1H 1U92A 3ZHKA 5M94B 2ZCLH 2OI9B 5IV2B 1U8OB 1CT8A 4HXBH 4KI5D 2Z93A 3QUZB 3H7BB 2CDEB 3DO7B 3UJIL 5DTFB 4JLRB 5I2IA 4HUNB 1CIDA 1T0PB 1ZANL 4ODBD 3PWLA 5DR5H 1EEZB 5IJKA 4LLQA 3O3UN 3S37H 4K8RL 1FIGL 3E6FA 3MRFA 4L4VE 4XNUL 1NCBH 4RDQF 4U1MB 3U4BL 1XZ0A 2DIBA 1ODAA 3BW9A 5IBLC 2CUHA 3NCEB 3QRGL 4LPTA 2C3VA 2VLJB 3OAYH 4JHAH 3ZLQC 1GC1C 1GZQB 4I48B 4G6AD 3ZSTA 2MQ3A 1RPQA 3S97C 1DP0A 4NQDB 3A6OA 4LLDA 4JQIL 1R5WB 1EGJH 3FL7A 3RWFA 2B0SL 5DHVH 2VLRD 5KSAC 2OL3B 3JTSA 4YFDB 3C2SA 2NR6C 2DN7A 3EGSB 4MAUL 4TUOA 1V3MA 1NLBL 2A6JB 3RJQB 4ZSOE 5E8NA 4UUJB 3GKWH 1X4YA 4WY7H 5EO0A 4LSVL 1KJ2H 4FQLL 4JM2D 4N0YH 4OZIF 5IJVB 3MJ9H 4OFPA 1QLFA 3B6SA 4OLYH 3SKOB 5KSAA 1JWSB 3FO2A 5K9QG 5IWLC 5A2LH 4NHCL 3SJVA 3LN4A 3RGVC 4N1HB 3NGBC 5T5NG 1H3UA 1FO0A 5I17B 1B0RA 1EV2E 4ZFFB 1HNGA 4JFQB 1VESA 5GJSL 1YJDH 4L8BB 3WO3B 1DQDH 2ZPKH 1WICA 1MAJA 3ARDC 3RGVA 2ICEA 1Q1JH 1GL4B 2HWZL 3CFKA 3HTLX 5GS1B 35C8H 5FOBB 3HCVA 2JK5A 1YQ2A 3RL2A 3WS6C 4HPYH 1JUFB 1NGPL 3I3BA 4PYHA 1MAML 3WS3A 5MP6H 5F7MC 3WIFA 2FZ3A 2ZWLT 3LDBC 4XPAL 4YWGH 2EDHA 4WFGD 2R0LL 3ARDA 4J4PC 4WI5A 1OP5K 5IFHL 1CQKA 1GGUA 3ELAT 1M7XA 4BSVA 2DJSA 4LP5A 2YZ8A 1HEZB 4WUUD 1A02N 1BBDH 3IKCA 3C60C 3C6LB 3W11D 3WS6A 1FAIH 3VMNA 4E41E 4PB9L 1OPGL 1A9BB 3HRZB 1F58L 4M7KH 3UYOD 1BD2B 1NEZA 3QEHB 4J4PA 4KKBD 1T20B 3RTQD 5JW5A 4JFYA 3DHJA 3V79C 3RU8L 3V6ZA 2GJZA 3LB6D 2R4SH 4IHOA 3HR5A 3KPSE 5EBLB 3C60A 4HUXA 1MY7A 2EICA 2DLFH 3I2CH 4RA3A 2Y06L 3HNSL 3DMMB 4HW6A 3LOWA 1IQWL 1J1OH 4PJEF 2BNUB 3RRQA 4PJ7B 1BQHG 3U48A 4OTXL 5SV3A 3BZ4A 5D2NB 1KXTB 2VC2L 2W65B 5IK3B 4BJLA 1HXMB 1OF2A 1NAMH 4NT6A 5KZCB 3HMWH 1J0ZA 2ATPA 3B5TA 4QRPA 2D31B 2NY7L 3O6KL 4S1DD 1PJ9A 1XF3A 4HGWA 5IKCB 3OF6D 3HR6A 2H8PA 3GI8L 4CVXA 2EXYC 3KLHD 4LLWB 1OGAB 1FLRL 3U9UB 5EO9A 1FC1A 4XCYA 3VFRB 5HPOA 4HFUL 3F58L 1X6LA 1FRGL 32C2A 1RIVH 3OWEA 5IF0B 3GFUA 1DL7L 2F58H 4R3SA 1JZ4A 1S7SB 4IRJC 3VGFA 3ZE0E 4YHLL 3IF1B 1A7PL 1UENA 3OKNB 4XPFH 4KK6D 4PJFE 3G08B 3K2MC 5F7LB 3UPCA 5B4MD 3QA3B 1VADB 2HG5B 4GW5B 5C09A 3ILPA 1RK1A 3CFCH 3JTTA 5AUMA 3PUCA 5ETUB 3S5LB 2JIXB 4OZGF 3W9EA 5FYLD 1MPAH 5F9DC 4U3CA 4AENA 1TJGL 2E6PA 3CMOH 4OKVA 2PXYB 2W0LA 2MMXA 2ESVE 3MX0A 4IRJA 1KCSL 5BVJA 2PN5A 5LQBL 2IAMD 2HLFC 1DTUA 4OLZH 4PJBA 4ZYKA 2P5WA 3SGKC 1Q9OA 1GH7A 1UJ3B 4O2CA 2LAGB 3ABZA 3CX5K 5A2FA 5K9QI 3GMOA 1JRHL 1KC5H 1ZEAL 4JVUA 4ACPA 3LKRA 3VFTA 4OD2B 4RNRB 1L7IH 4HWUA 1WEJH 2D0FA 2ED9A 4X7SL 4YO0B 3WXWH 1TPXB 5ITFA 3VCLA 1MFCL 5E00B 2OK0H 5D8JH 3SGKA 1JL8A 1A3RL 4N0UE 1QD0A 4R97B 5CP3A 5GXBB 4XAKD 2X9WA 1OD9A 1BZ9B 3GSOB 4J23A 2VLRB 5T3ZE 5JIPA 4LKCB 4OI9A 2FIKA 1JK8A 1YUHB 5TE4H 3GSWA 3TBWB 1NFIB 2XY2A 5H94B 3DECA 1A2YB 5JPNA 4Z0BL 1HSBA 1R24B 5GGSA 5DMYA 1EX0A 2HRLA 5EC2A 4JM2B 3ARFC 3RIFF 5EU5A 1MWAB 2XG4A 5IHZB 5A2KH 3FN9A 1VCAA 5T3XL 2FJHA 4BSWB 1CR9H 1XGPB 5ICYA 1X3DA 4RFOL 1FYTD 3D25B 4OZFH 1N59A 4M1GL 4B53A 3TBTB 2EDFA 4LEOA 4HD9A 4PB0H 1ZTXL 3ARFA 3HLAB 4C58B 4XP6L 3IDIA 3MLPA 2WK2A 4E0RA 1JGVH 3PE9A 2F54A 4WGVB 4ZG1A 2VYRE 4QHUB 1AR2A 1QPPA 3W5MA 1EMTL 2H2SC 4CDGC 2WWMD 3MRIB 4TRPH 1QP1A 4NDMB 3CSBA 5EO1B 1EGJA 3MJGX 5I71C 5HHOD 1H9VA 4ZNEE 5FYKL 3OPZL 2QQKL 2A2QT 3SBWC 2VN4A 4HS8H 1CS6A 1NL0H 3LVEA 1MCWM 3DHMA 1KJ2A 5F3HA 4PJXB 4X9HA 2Z31D 1F4YL 3DIFA 4R0LC 1AGEB 3L3OB 5C0EA 3LKSA 2XWTA 2EZ0C 5CMAA 1QR4A 2QADC 3VH8A 2AXGB 4WO4D 5JORA 2B8OT 2ORBL 2J8UE 3GMQB 4KAQL 4NO5B 5H37H 3SBWA 4BKLB 2EO9A 2YSSA 3P11H 3VGBA 4N90D 5T33L 4MJ5A 1T89C 5DJAB 1P4LA 3TNMB 2DWEA 3KPTA 1N64L 3VU2A 1WBZB 3MRPA 2OSLB 4HIJA 3U6RB 2DQUH 3FFCD 3GMRA 1DQLH 4X8JA 4R0LA 3RTQB 3U7AA 1K8DA 1ZLVK 1WTGT 3I85A 1LD9B 1QVOA 3F7VA 4F9PC 1MCPL 5KSVB 1WIUA 4M1CD 4EEEA 4LU5H 4OD3H 1K8IB 3QDJD 3VFPA 3GSRA 1P4BL 1LP9A 5JW3H 5TQ0L 4NN5B 2KQMA 2W60A 1T89A 1IKFL 3LKQA 3D39E 5E94A 3C9NA 4H5SA 3BRGC 1RUAL 1OTTD 5I1GL 2VRAA 1HILB 1OSZA 4S10A 2NXZC 2WLYA 4O2EA 1FZMB 1G7IA 5DK2B 4QCIB 4OBSA 4GG8A 2IADA 4F9PA 5D7KE 1LEGA 2EDXA 4HGKC 1S3KL 1JMZA 3KHQA 2A0LC 4X7TA 3TT3L 4HUVB 2JE8A 4POYA 2VDLL 1DLHB 3H9SD 3P0YL 5J6HA 5JQ6L 3QNYB 3PP4H 5BXFB 4JZJB 5ESAA 15C8H 3H9HB 1Y18B 4WCYL 2CDFB 2Z4QA 4P3DA 1UCTA 3RWEB 4HAGA 4RWYL 5BS0E 2A6DA 4JQXC 2ADGA 5HGBA 2XNAB 1NFDF 5FYJD 5GRXG 1SEQH 2CQVA 3V7MA 4UT7H 5FUCE 3RZCD 4OZIE 1IGYA 1JFMA 4YDLB 3JWDC 4UV7L 3IDJA 4K3JL 4F58L 3ALPA 4O2FB 4OCMC 2Y5TB 1T7ZA 1G6RH 5TPWL 4MDIB 4UIMA 1G9NC 4YC2B 3D18B 5KW9L 5ALCL 4OM1L 3L5HA 4M43H 2MTPA 4QXUH 5TGBB 4C56D 4BQBA 5T1MB 3H3KA 4M3JA 5DQ9B 4JQXA 4W6XB 4KUCD 3BT2L 1T66C 4NHUA 2X9YA 5JW4Q 1YQVL 4K3HA 5I9QB 1QFHA 1ZA3A 3TN0D 1YECH 3Q3GB 4NC2B 4HBCH 4HWBH 5EB9A 5JR1L 2RGSA 4KKNA 3MNWA 4S1SH 2XN9E 5AZ2H 5HHPB 2IAMB 1HKLL 4FMKA 4OB5L 5IV2A 4XVTL 3M8OL 1BBJA 4JZOB 2W9LA 3DURB 4P2CG 3MRQA 1AJ7H 3U7WL 2RR3A 4JLRA 3EBAA 4JY4B 2YPKB 3UCRA 1QLRB 3GIVB 3NZHL 2E7LC 3VXUD 2P5ED 3LQAL 2BMKB 4JJ5A 4JDTL 3OAUL 4PY7A 3MV9A 3FHQA 1G7PA 2ZJSL 5DRNB 1OY3B 4Z95H 3PNWA 5K9KB 3SDXF 4NQDA 3KS0J 3IXTA 2E7LA 1R5WA 4CADA 2ICWJ 3PHOA 3O6MH 4JCLA 1IEAB 1Y6MR 2XZAL 3FB6B 1S9VA 1IZKA 1LILA 1T1WA 4MNGA 1EXUB 3O3EB 3O4LD 4H8WC 1UM5L 3CVHB 3MRDB 3O3DB 4HS6A 4W6YB 2PCPB 5JLZA 3WNKA 1NCDL 3PQYA 4FQHA 3SY0A 1H5BA 5HDQL 2XY1A 2VLKE 2M26A 1U8IB 3TO4C 2MSPA 3S5LG 1TQCC 4J3TA 5IJVA 5BRZE 5IW1A 3VXNA 3NCFB 3BAEH 5DVOA 3OXRA 4BFIA 5B39B 1A8JH 1ZA6B 1JWSA 2Q1EA 1BJMA 2IH3B 4XPHH 4FQ1H 3UP1A 4PJEE 1FYTB 2VDQH 4P4RB 4RZCB 1FNSH 2DKMA 5GS1C 4NWUH 3UTZB 4XP9H 5I17A 2D4FA 3TO4A 3PV6B 4K23L 4JFQA 4YPGB 4ZFZA 1Z5LB 4UB0H 3VFOA 1YY9D 4PRHD 1HQ4A 5E2WH 1IEBA 5FKPB 5E8EB 4OM0L 4Y4FA 5HHOB 4DKEL 1S7VB 1SBBA 2R1WB 4LCWD 4A6YH 1U42A 1ES0B 2R29H 1T5XA 3PJSA 3UTPE 1S9XA 4XVSL 3IJSA 4TVPL 3MRGB 1IGCH 2GTZB 1LNUB 3IXAA 1F6AA 5D96C 5EA0L 5F88B 5E70A 2Z31B 2ENSA 1NMBH 1I3RA 5DI8B 3TYFB 3MNVB 1CCZA 3I6KA 4WO4B 1FC2D 1TZGH 5GSVA 2EDJA 4XWOC 1X7QA 3OKKB 1XCQB 3UJJH 3AGVA 3DJ9A 5FO9B 3INUL 2D03H 2FB4L 3C8KB 1DSFL 1Q9WA 4OZGE 3VFGL 4ISVA 1CDCA 3MXWL 3WLBA 3FFCB 5F7EH 3HC3H 3QUYD 5I74C 1SBSL 4MB5A 1U8JB 3ZL4H 4TN9A 3QRFM 3HNTH 1KNOA 1F45A 5FGCB 4AT6B 4PG9A 3TYGL 3MGTA 3QDJB 2CRIA 1CDIA 5EBLA 4BM7A 5C0JB 3RJDA 2FD6H 3VXME 2ZKHL 4U7MA 5B3JF 4OZHB 1NGXA 3Q5OA 1B3JA 3WN5B 1A6UL 2CPCA 2VXVH 4JKPH 5IP4A 4O9HL 2D3VA 3DVIA 4PJ7A 5FYJU 3CU1A 1RIHH 3S35H 1LO4L 3EIFA 3KAAA 5DXWA 3ZTNL 1LEIB 1CGSH 3VFSB 1UA6H 4N8CH 1DE4B 3RVVC 3ARUA 3H9SB 1HHJB 3QUKB 4XC1L 5HI3C 1YMME 2WZPD 4UNVA 4PLJC 2X4PB 1N6QH 5FK9A 3BX7C 2GY7B 1OAZL 3IJHB 1CE6A 5BOZG 1VKXB 1QPXA 5DYOB 4XPGL 2HVKB 1PAMA 4R4BA 5I15L 1M05A 3BSZH 3RZCB 5CD3A 1Z3GL 1UM4H 4PV9B 4PBWD 4Q6IB 2HTKC 2AW2A 1J0HA 2BVQB 2VTFA 3IF1A 4G7VH 4KHTL 1A3LL 3AMKA 2DTMH 3D3VD 1KELH 4V2CB 2BOBA 3HI6L 4C56B 4JRXD 5LGJA 1W72A 1TQBB 1UJ3C 4OCRH 5F96H 2IGFL 2NY5C 1GXEA 4C83A 4JAMB 4G8GD 1O0VA 2NW2B 4P59H 3DSFH 4LLMA 4G9FD 4KQ4H 1GAFH 2IPTH 4KDTC 3TN0B 4Y5YA 2HVJB 5DUML 1OOAA 3BH9A 4YAQB 3CC5A 2ED7A 3GSQB 1CK0L 3S88H 3VXSE 4U0RB 3ZDZE 5FO7A 3O2VH 2APFA 4LF3A 4OGAD 2ADIB 1TPXC 3BUYB 4OI8A 3HMXH 3LEYL 3V4PH 3BP7B 4R97C 4G6AC 4EUPH 4RGMB 3TZVC 4FABL 4PJ9C 3VXUB 4MD4B 4MA8L 3VFUB 2QEJA 2P5EB 4KDTA 2EIEA 2A6IA 5BVPL 1I1YB 3UX9B 1IGTB 4QRUB 1BIIB 2GTWB 1RJYB 3A6CL 5E00A 4ETYA 2DQTH 2J8OA 4JM2C 3MZTA 3TZVA 4PJ9A 1P9MC 2Z91A 1SYVB 4PJCF 3FCTA 3HHRB 2F19H 4YH6A 1WSST 3LHPL 3O4LB 4MX7B 1DQQB 4MJIB 3FO0L 1U58A 1F4WL 3DRTB 2OJEB 5H94A 4DOHE 4HHAA 2B4CH 1NC2D 4JVPA 2NZ9D 2CIIA 3IFOA 5IGXH 5EU6E 2KZ1B 4Z18A 1X44A 3T4YA 5J11B 1E6OL 1CF8H 5J3HC 2XKUA 1FLTX 4E5XA 1P9MA 3E6HA 4M62H 4Y16D 1BM3L 3QCVL 4XMPL 3A6BH 4GQPH 4I13B 2RB8A 2HAZA 3MCLH 3BGFB 1AHWC 4QRSA 1AFVL 2AEWA 2OZ4H 4AL8L 5E4EC 3AU1B 3T4AB 5GS0L 3FN0H 5HHME 3WNPA 1OM3L 3GSUB 1FNLA 5HJ3A 2XQYK 4YPJA 3VDCA 4PRHB 1YYLL 4WHDA 3L3HA 1MCNA 1MJ7H 4L3EA 1D5ZA 3TCLB 4CMMA 3E3QE 4L4VD 1R3KB 2Y9RT 3BRDA 3UTOA 1KCKA 1AHWA 4OLVL 5CSZA 2C1PB 5FKAA 5I30H 1HSAB 3GJFK 4LCWB 5HI4D 4NKIL 1CXIA 3KXFA 3W11C 1NFDE 3LN5A 2V5MA 1KLUB 1MQ8A 1F2QA 4JFDA 3BDXA 5C08D 2QHRL 4LSSH 4XP5H 1YNTB 2NY2D 1S7UB 4KRNA 4JFYB 3ULSA 5GRVK 2G2RB 3RUGA 4KKBC 4U6XB 5DMIL 3RTQC 4CDHA 1AI1H 2B5IC 1EHLH 5E03A 3TV3H 5EUOA 1J05A 4HKBB 1D5IL 2E27L 3WNOA 2F5BL 3UAJC 2X6MA 1J1XL 3MREB 4OCYH 1NJ9A 1JFQL 3QUXD 4FNLL 2WBJC 4NN5C 5DJAA 1UJTA 5B39G 1K4DA 3FO9B 4AM0B 4WFHD 5JOPE 4MQXD 3VGHA 1FZKA 1FFPB 1RZJL 1TVBB 3QUYB 4DEPC 3RY5A 3RTQA 1CWVA 4PRPE 4P57A 4MJ6B 2EECA 5D71L 1C12A 2W59A 4UQ2A 2LVEA 2R4RH 1OTSC 5JDJA 3KJ4B 3PDGA 5TDPB 1EHAA 3ULVL 1A6AB 1FPTL 4HCRH 2DWDB 4KVCH 1RK0A 2WBJA 4P3CL 4EN3C 4UBDD 5HGHA 2QQLH 5DD0L 5C0ND 3KLHC 1NMCB 2VIRB 1ZWIA 2YPLA 2GK2A 1N26A 5F9OH 4R9HA 1JGDA 4GRLC 3VFNA 4EZMA 1FP5A 3SDYL 1ED3B 5IHUH 3SDXE 3NFSH 1IGJA 3QEQE 4RAVA 1OP3K 1EJOL 1O7VA 5ITBH 4LLVB 5DWUH 4EN3A 3HPLB 2HMIC 4I2XE 3OF6A 4YC2C 3VFVA 3STZB 4BQ6A 4DK6A 3H9HA 2E9IA 1Y18A 1E6JL 2D7NA 1GIGH 2H3NB 3S3PA 5GGUB 4GRLA 4CW1B 1DQJB 5IMLB 1MY5A 2X9XA 3QPXL 4YBLB 4Z76A 2XV6B 5I9QC 1KTDB 1MJJB 4QY8A 4O2FA 4TNVF 3U46B 3HUJF 1PD6A 4AK1A 4E41D 2FECL 1MJUL 1F6FB 3PGFL 2BSSA 2I25N 3JWNC 4KMTH 3D18A 3D3VB 2DQDH 4UOW1 4JRXB 4OAWB 2AEIT 2BVOA 5FF6A 1CG9B 1VFBB 3GM0A 1CU4H 4P5TA 3WNLA 5D1QC 2H26B 4G8GB 3HZVA 3RVXC 4G9FB 1CD8A 4R90H 1BVKA 3VXTB 3EOAA 4PJGB 3MSPA 3Q3GA 4OGZA 4HKZB 2PYEA 1YPZF 4JFFE 2Q76B 3DUUA 2NX5E 1P7QD 1R3JA 1G7JB 1KEGH 4PP2A 1OAYL 4HLZH 3QB7C 2BVPA 4FFYL 1NGZA 4EDXB 2H32H 2VDKH 3VDBA 4JDVB 4PBVC 5D1QA 5LBSH 1KEMH 1PYWA 2H1PH 5IM7A 2NLJA 4TSCL 4YNYA 2IPKB 4L5FH 2FJFA 5F6IB 1T4KA 1NGQL 2DBJA 5BW7A 5FV2A 1TTFA 3CPLA 3KR3H 2X4OA 3BWAA 1M7DA 4M7JH 1U8MA 4PB9H 5F8RC 3MXVL 4RISH 4YDVA 3DPBA 2OR8A 3N1QC 2MCPH 1G0DA 3PDDA 2AK4A 5DD3L 3T0DA 1IEAA 3ZMRA 1XIWD 4I77H 4PLNC 5I1DA 5IIEB 4JPKL 1BFVH 4KY1H 4QHLB 2GITB 1NC2B 5D1XD 4ZUVB 4KZEL 1RD6A 1NCAL 1WAAF 3REWB 3HMXA 4Y4HC 1T1XB 3TH2T 4GAGL 2XFXB 4Y16B 5B3JE 3OJDA 3G5XA 1IGIH 4V1DE 2WWMC 2ZCHL 3O2DL 1EAPA 1RJZB 3RWJB 2J88H 2ESVD 2UZIH 4RMRA 4LOUD 2H2PC 3O8XB 4XHQA 1IGML 3QCUH 3GO1H 3WFCH 2RIKA 3I3DA 4G6KL 1ZT7A 4MVBC 4XTRD 3G9VA 1BQLH 5FDWB 3KDMA 3PV6A 3QULB 5D7IB 3RHWF 4Y4HA 2OP4L 1T2QH 5EZOL 2OL3L 3EJJX 4JFXA 5DUBB 5IB4A 2Q6WB 1G0XA 2WIIB 4L4VB 4XI5D 4HIEB 1CL7L 2BJMH 4OCWL 1IZJA 5I1JL 3N50A 5L8LB 4WO4C 4U6TA 4Z7VF 5SWZA 5E24E 5DMKA 1G7QA 1JNLH 2EC9U 3NA9L 4MVBA 5FYKE 1QSVA 4FXGA 4XCFH 3FOLA 3UJTH 5DJZB 2MNUA 2HJKA 5C08B 2NY2B 1E4XI 2GTZA 5E8DH 4MB3A 4XNQB 5GRUL 5T3ZD 3MLSL 1OT1A 1BOGB 1ZHNB 5CGYC 2YMXL 4FXKA 1NAMB 2I60L 4A2LA 1J9CT 2MWCA 4G8EA 1R5IB 4IRSD 4ZSOB 2E5EA 4U0QB 1L9NA 3KWWA 1QO3A 1AD0B 1F13A 1I7RA 3P9MB 2EDQA 5TF0A 3QUXB 1ZXQA 3OKKA 1AO7E 4QWWD 2E7HA 1RUMH 4JHZA 1U2HA 1I9RL 1DBAL 4NRYA 1VFOA 2P8PA 3UDWC 3OB0K 3SGJC 4M5ZH 4OKDA 4Q97A 2NYYD 4UU9A 2P49B 5D7SH 3VFWB 3P0VL 3PDOA 3RI5K 4H88L 2AI0H 1UG9A 1JZ8A 2BNQA 4FFWD 2YUWA 5GJTL 1FBIH 3FB5A 5HDOA 3L7EB 2EE2A 3UDWA 3SCMC 3SGJA 2J6EL 5DA0B 1NCCL 4PJDA 4YUEL 4RSVA 3CIQA 5GRZA 2KL6A 4LCCB 1S9WB 1LEIA 1MF2H 4U1SA 5H2BB 5DHYB 4PGZA 3QUKA 3U1SL 1JNNL 1NEUA 1JPFA 2GT9B 4M6OL 2Q86A 4F7MB 1JGUL 4PJCE 2X4PA 4YDIL 3PGCA 1FFRA 4R26L 12E8H 4YX2L 5HHVL 5LKNA 3KPOB 3SCMA 2HYMA 3UMTA 3K46A 5DYOA 3KPNB 4JHWL 3AXLB 1C5DB 1DLFL 1PLGH 5HYSB 2ADJB 4KV5F 1F2XK 4GXVL 2OLDA 2UV3A 2YXFA 5DGRA 4FQIL 4PRIE 5F70A 4E41B 4QYOA 4U0RC 5FO8A 2CR6A 3AAZA 5I0ZA 2GJ6E 3BXNA 5CEZE 4DVBA 4X5WA 2GSIB 5KVDH 1A7QH 3MOAL 5SV4A 3RKPA 1S9YB 3BMWA 4NP4H 4Y89A 1IT9H 1A6VL 4WJ5B 4K71C 4RQQB 3EHBD 3PWNA 4FMFA 5KJRH 3D39D 4PP1C 4HX1A 1IBGH 2EKSB 1ADQL 4I3SH 2HRPL 1FFNA 4D0BB 1YN7A 3LPFA 4EQ3A 5D7KD 1QG3A 3GRWL 1PZUB 4R8WL 5ISZA 4OCXH 3DUHA 4U6HA 3VFUA 4OSUL 3EYQC 4LSDA 4NPYB 4XCEA 2D4DA 2LFGA 3EDJA 3C09C 4QRUA 2Z9TA 4YJZL 5L2JB 2BX5A 2W38A 2AJXH 5CEYA 2A73B 4ODXB 3NAAL 5TF1L 5BS0D 3QWOA 4OFKA 4WENB 5E2TH 1PG7H 1H15B 3SE8L 2M1KA 2Z8WC 1XF2B 1IL1B 4K7FB 1JPGA 1N0XH 5C92A 4KTEL 4EKXA 1QZ1A 2DQCH 2Q3AA 4D9QE 3FB7B 2RCSH 5IW6A 1XIWB 2YA0A 1H3GA 1ZHKB 3U0WH 5FA4B 5FUZL 1DQQA 1GSMA 4MJIA 5I6XB 4PJFB 1BQSA 1F3JB 5D1XB 1X5LA 1DCLA 3AM8A 1W8OA 5IVXF 4OFYA 2XA3A 5CEXB 4MD5B 4NUJB 2H32A 1CLYL 3S36L 2E7BA 3IDUA 4S1QH 4FN0A 1LQVA 1NFKA 2AKRB 1WIOA 2VQ1A 2L7UA 3OTTA 5JO5B 2B1HH 5J1AA 1YNLH 2ESVB 4XZUA 4RRPG 1F11A 2FGWH 2QL1A 2ENYA 4NSKB 2CDGA 1VERA 3FMGH 2EDNA 5F7WC 1V7NL 3V6FA 3FQUA 1N5YL 4YFLF 3RWDB 5JZ7C 3QHZL 1QR1B 2EIZB 2YK1L 4X4XA 3ZHLA 3L3GB 1QBML 4KTYA 1A64A 5I8KH 1U91B 1UACL 4NOBA 4MYWB 5HVFB 1UWXH 3DVGB 3UC0L 3I9GH 1U8PB 4DN3H 2EYSB 2YD5A 3OZ9H 3X14A 1MWAL 1U3YA 3KNBB 2CKBL 4N0UB 4JO3L 3TBSB 5DFWH 5CZVL 2VXQL 2AVGA 3RNQB 3L5WB 5CEZH 4HC1A 4RGNC 4TVPE 1R5VB 1HHKA 1YNTA 3HUJE 4QHKJ 5I1EH 3FQNB 1DJSA 5CP7A 4OFVA 3SKUD 4X6CF 4QRQB 2V9TA 4UT6H 1OAUH 1S7TB 1JF1A 4Y0GA 3LQZB 4IRSB 3BVNA 4E42B 2OTWB 3KJ4C 1N4XH 2OQJB 4YK4C 1JHKH 2VLKD 4LVHC 5C6TH 1N3NB 3L6FA 3BKML 1QLEL 2FEEI 5BRZD 1Q0XH 5CCKH 1WF5A 2AJSL 5IB5A 1Y0LA 5CJOH 5L9DL 3EOTL 3ARGD 1UYWL 4J3VA 1A9EA 4KUZL 4Z0XB 4GMSL 3SDAD 1G6RB 3LQAH 1S78D 4ZS6D 4AEEA 3TJEL 5KN5B 4TYUA 5EZLA 5BMFL 2DQJL 3FO1A 3LRHA 1QFWH 3P4LA 2AABH 3OKDA 3GUTA 2DMKA 3FT3A 3EZ8A 1KPUB 2IANE 5EBMA 4XP1H 2BFVH 1JV5A 2XYCA 1G9MH 1CDHA 4YBLC 3CXDL 1XF4A 1RZGA 1CD9B 1KN4L 4K3DL 4UT9H 3SKJL 1JN6B 2J4WH 1FVCB 3UTPD 2V2XA 3TA3C 3VRIB 5E99H 4L8SB 2FDBP 4MD0B 4S0SD 5LVEA 3VXQA 5AWNH 4AEIH 1L6ZA 1FIEA 7CGTA 3QDGE 4M93B 3L1OH 1DQJA 4ZXBC 2IG2L 2VZ1A 4NNYA 4GKSA 4F8TA 4NQVB 2Q8BL 4AMKL 2J8UB 1WAAE 2VZVA 2Y07H 2NY1C 5L2KE 4N5UA 4KKCD 1KTDA 3TA3A 1LEKB 2JLLA 4K7PX 4WHTA 4OGAC 1RIUL 1F4HA 2XG5A 4TPRH 1MI5E 1SMAA 1I3GH 2IBZY 3MV7E 3U30B 2YZ1A 4P2RA 4PGBA 2PKDA 3MBED 4V3DB 3BE1H 1DBJL 3F7YB 4KXZH 1I8IA 4ZXBA 5HYQA 4MSWB 5DT1H 5E08L 2IJ0C 1T7XA 3F7QA 4BH8B 1AKJD 2RFXA 4K9EC 3VXMD 2H6PA 4ORGB 3OR7B 1T1ZB 5F6IC 3QYCA 4FZ8H 4KRMB 5SX4I 2X4TA 3EOYG 3D39B 5HYJE 1CI5A 3UYRL 1XH3B 4RAUB 1G7JA 4IBLT 4NJAH 5FGSA 1MFAL 3BH8A 5D2LF 4R2GD 4Z7VE 4WIQA 5TDOA 4YXLL 4IRZH 2VDOL 1DZBA 4U31A 5IT2L 4UINL 1MRDL 1T5WB 5EU7E 4LAQH 3WUWA 2F5AL 1NDMB 1YMMD 3PABA 1GGIH 4DFHA 2X4NB 1B9ZA 4QEGA 4HDIB 2X41A 1MHHB 2VKXA 4XXDA 4ZUSA 3NCYS 5BS0B 5HYSG 5FYLL 4FZEL 3CSYB 2QKIB 1CN4A 4OZIB 4Y16C 1V3LA 3GZKA 1DANU 1A7NH 2R69L 3CUPB 1K4CA 1EEYB 4L4TE 3LD8B 4LAJH 3GJFA 4ZFOB 3MR9A 1A4KA 1BFOB 2JKXA 1IAII 4U1KA 2AERT 5BO1L 4A6YB 2XA8L 3O8XC 3K74B 1D9KC 4X4YB 4QHLA 2A77H 5GRJH 3F7RA 3DX9B 1B0GB 2FWOA 3X11A 4I5BB 4I9WE 3HI1A 4AEFA 3RA7L 4Y16A 3MRJB 3PWUB 3G6AB 3X12B 2K9UA 3HE6D 5C0AE 2AQ2A 2DJ4A 3Q1SL 3SKMA 2E3VA 4LCYB 2DQEH 1KUMA 3WUZA 1UXWB 1SY6H 3CFEA 3VXSD 5IMKA 3O8XA 1D9KA 5EOCL 3ARBA 4U7SA 2DDQH 3TC9A 3SE3C 2XWJA 3DXAE 5F7DB 4LHQB 5D7IA 2XZCH 3MJ8A 1FDLL 3DTXA 1YMHB 1XGTA 3H6JA 1QYGH 2EEDA 4NZUH 3CVHL 1QSEE 2F15A 2WIIA 1KLGB 4PREA 3RIFK 1BLNB 5J13C 2O93L 1XGQB 4NN7C 3SOBL 7FABH 4H1LB 4YHOH 2XRAH 4OCSL 4LKXA 3IAQA 3SE3A 3QUXC 3G6DL 5DFTA 2W91A 3B2VH 1A5FL 1A3LH 5C08A 3GIZH 1YEKL 4PLKD 4D9LL 4MQXC 5JNYA 3RWGB 5IEKB 1AXSB 4QRRA 1FGNL 1ZHNA 1J0IA 3FFDA 2YPVH 5IVZA 1IAOB 4RMSA 3ILQD 5JA8B 3IDXH 1QSFE 4DGVH 1WISA 5I66B 3EFFB 3N85L 3IU3A 4UTAL 1AXTL 1BWWA 3WHXB 3O6FC 5EU6D 2GSGA 2V7HA 1NBQA 3ZKXB 2FX8H 4Z5RB 5BRZB 4GKNB 2EIBA 3W82A 3P4OB 1TZIB 2Y6SC 4WFFE 4ESKA 1JTOA 4DGYL 1MLBA 2NQCA 5H37G 1L7TH 2PW2B 1CFNA 3ARGB 5D9SB 4PJEB 2QSVA 4NCDA 3WXVL 1U8KB 3SDAB 3A0OA 4LCCC 1AGDA 3WLWD 4PLOB 1Q72H 5D7LA 4RFNB 1LQSR 3VFMB 1LHZA 1UWGL 2W07A 3O6FA 4MWFA 5GHWL 2F8XC 1N7ML 5HHMD 1U3JA 3RAJL 4BH7A 1T3FA 2FR4B 4NO2A 4JPWH 4HF5L 4ONHA 3S96B 3THML 2FBJL 4M48L 2DB8A 2Y4SA 5DJ8A 5H2BA 4WU7A 2IMMA 1RV6X 2XKNA 2BDNL 3HNVL 1E4WH 4MA7H 2AXJA 4Z7QF 4U2YA 3OKOA 1QSZA 4EUPB 2FIRT 2GK0A 2FJGB 4MMXC 5EZJA 1AE6L 1N6UA 2JCCF 5HHNB 5FOJA 4HH9B 5E7FA 3TM6A 3NH7L 1JBJA 3RVUD 1JVKA 5EORH 5IVXE 5A40E 4DGIL 1MH5B 3U7YH 2XQBH 4OZGB 2FGZA 5I1AB 3A67L 3LZFL 3FTGA 5JOPD 1LDSA 2X7LA 1XCTA 4BZ1L 1C5CL 3MBEB 4G80B 4PRPD 6FABH 5DQJB 3RPIA 1FVEA 4N0CD 5EWIH 3MUZ1 4WHYG 1QFWI 3ULUC 1AKJB 5I18H 2GI7A 1P7KA 4WJ5A 3VXMB 1M71A 3R0MA 3LQMA 3G6JA 3UTSA 5C07E 3VRLF 3T0EC 3DV4B 4B41A 2X70B 4BZYA 4H20L 2EKSA 1ZLWK 3MPCA 4R2GB 5DMJB 1F42A 3KJ6H 4GKZB 4LIQE 4XBEL 4Y4KD 4YHIB 4M5YH 4HQQH 3IGAA 2HKHL 2XXMB 3MACH 3L5XL 4HPOH 1SM3H 4PRNA 2LU4A 2BC4B 4GRMB 4HIIA 2DQHL 3L3DA 3BPNB 4EI6B 5DD5L 5I8OH 2CD0A 1YMMB 2DQGL 4NPYA 1IC4H 4LCIL 3T0EA 1MQKH 1T21A 3CH8A 1WQVT 4X6CE 5I6XC 8FABB 5FCUH 3HAEB 2ZCKH 4NQXA 3RVTC 5CKGA 3V5DB 4HLJA 1DVFA 4R4NC 4WW1A 2P1YA 1R3IL 1X5XA 4YR6B 3MLYL 4G43B 2BVEA 4LSPH 3V7AE 2IBGA 1NDGA 1ZHKA 2APXA 3U0PA 4K7PY 5HYEA 5KVEL 1FPTH 4ODSL 3DI2B 5EUKA 2JJTC 3V52L 4X6BA 4QRTA 3MRCA 5GSRA 3U9PH 3DGGA 3ZZ1A 4D0CB 3ZDXE 4UDUA 4ODHL 2FHBA 1A6PA 4LPCA 3HE6B 2ICWA 5JO5A 4PJ5A 4S0TD 1Q9LA 3VXSB