1ZVSA

Crystal structure of the first class mhc mamu and tat-tl8 complex
Total Genus 67
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
67
sequence length
278
structure length
278
Chain Sequence
b'GSHSMKYFYTSMSRPGRGQPRFIAVGYVDDTQFVRFDSDAASQRMEPRAPWVEQEGPEYWDRETRNMKTETQNAPVNLRTLLRYYNQSEAGSHTLQRMVGCDLGPDGRLLRGYEQYAYDGKDYIALNEDLRSWTAADVAAQNTQRKWEAADVAESMRAYLEGQCVEWLPRYLEKGKETLQRTDPPKTHVTHHPVSDHEATLRCWALGFYPAEITLTWQRDGEDQTQDTELVETRPAGDGTFQKWAAVVVPSGEEQRYTCHVQHEGLPKPHTLKWEPHH'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords MHC class I antigen
publication title First glimpse of the peptide presentation by rhesus macaque MHC class I: crystal structures of Mamu-A*01 complexed with two immunogenic SIV epitopes and insights into CTL escape.
pubmed rcsb
source organism Macaca mulatta
molecule tags Immune system
total genus 67
structure length 278
sequence length 278
chains with identical sequence D
ec nomenclature
pdb deposition date 2005-06-02
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1zvsA02
3.30.500.10 Alpha Beta 2-Layer Sandwich Murine Class I Major Histocompatibility Complex, H2-DB; Chain A, domain 1 MHC class I-like antigen recognition-like 1zvsA01
4LLUA 5L8KB 1KELL 2XWBA 5IJKA 2VLRD 2YD4A 3MLRH 5TQ0L 3UTTE 3BE1H 3ZKNC 4IDLA 1BEYL 4PRBA 1QBAA 1M4KA 4Y4HB 1I3RB 3MNZB 2V9RA 3GSNL 3TBTA 4WI3A 4LLWB 1Z0NA 3DTXB 4LOUD 4KQ3H 1D5IH 2P8LA 4YPGA 1GGBH 2YD8A 4WI4A 1R3IL 4QO1A 2GJZB 1CTOA 1NUDA 4QHUB 1W0VB 4EIGB 4H1LB 4PP1C 3PWVB 1RAMA 1JWUB 4WJ5B 4PP2B 3BEWB 5HGDB 3NFNA 3NFPA 3DVFA 3IF1A 2PO6A 1NDMB 4A6YA 2V5YA 1JYNA 2FYYA 2B1HH 3QCTH 4Y5YA 4LLQB 3VJ6A 1FN4B 4XC3H 5FUZL 3S5LG 1ES0B 3MMEA 3MRJA 2AXJA 3JV4B 5C3LD 3EO9H 5T3XE 3IDXL 3TH4T 2PXYA 4LPXA 1XEDA 2HAZA 5BW7A 3U7YL 1F58L 4XVJH 3K80A 5ETUB 1N2RB 4M7LT 2VLKA 2P7TB 4HWUA 1S7RB 3ME0A 2Y5TB 1SM3L 4QRTB 2BRRH 4LSRH 5EA0L 4PJIE 3GM8A 1S7TB 2AQ3A 3WMSA 1LEIB 5DJYB 3JZ7A 4NNPH 5EIVA 3GJFK 5ESVB 5K59E 1NGXA 4X6FB 4I4WA 4KY1L 1IKFL 4QTHA 4ISVA 1VA9A 1NGQH 1REIA 4JFFD 4JFPB 5IFJA 4OGAC 2F8VA 4NZTL 5HD8D 4ZDHA 4HIEB 4FA8A 4R97B 3KPNB 1FFOA 3OKMA 4WO4A 4DEPB 4ODBD 4W4NA 1ACYH 4ODHL 5DVMA 4RFNB 5CCKH 5JPNA 3DRTA 5D1XD 5T3XH 4RAVA 4ZOAA 2BSTA 3M1BA 2Z4QA 1RIUL 1CXKA 1JE6A 4X6BA 1R24A 4LDOB 3GSNB 1RVFL 3G5YB 1FZOB 5FUOH 4OBSA 4OD1H 2BSSB 2MKWA 3ULUF 4N0CC 2NR6C 1IEBB 3ESVF 4KK6D 4NM4L 1TQCB 3V6BR 2IG2L 1P4LB 2H3NB 3VGAB 3BRFA 2ZSWB 4CL7A 3BDBA 2NY1B 1I3GH 3HG1D 5E8PB 4U1IA 3DMMC 2XXCB 5JHDD 3D3VA 2DM2A 2NY0D 2NX5E 5TGBA 4XB7A 4CVZA 2BVTA 4CNIB 1RV6X 2SEBB 4F9LC 4YGAB 5IV2A 1MIEH 4RCAA 4TSBL 3MQIA 5GRXG 5DJZA 1I4FB 4AIXA 2VDPH 5CGYC 4WTZA 1WBZB 1U3HC 3S6CA 5I2IA 4LKCB 2ZOLB 3KDMB 2D0GA 3IB4A 2MHAA 4Y88A 4O02L 5E4IA 3BGAA 4XBPB 4PRPA 2AJUH 4Y2DD 3HUJF 3WS6A 5HVGB 2CKBL 5EUOE 4ORGB 4IIQC 3S3JA 1X5YA 3H3BC 4MAYC 3SKMA 3UO1H 3SBWC 2PETA 3ZKXB 3GIZL 2OP4H 1CDUA 2H45A 1AIFA 4WFGE 4OLUL 1X7QA 3QIBD 1HHHA 1U8MB 1MIMH 4XAWH 4NO0A 4P3DA 1A6VL 2I9LB 5HGBA 4GS7B 5T3ZE 2XQBL 3QIWC 3ARDD 3VG9C 4UOJA 4P2OC 4WV1B 5DZOA 4FP8L 3MV8A 5SX4H 4LLMA 3WCYA 3H9YA 4NQDA 5J57B 1Q9LB 4XT1C 5MEND 2FDBP 5SWZE 3P77B 3CJJA 3IVKA 4TVSa 1KBGH 4IJ3C 1W8OA 2NXZC 1ZK9A 3MJ9A 3MR9B 2F19L 1X6LA 4LEOB 3OWEA 1JF6A 2IBBA 3BP4B 4Y4KC 4X5XB 5E4EC 1Q94B 4IOIA 4EDWH 3OAUH 5C2BH 5HGGS 5J1AA 5CFHA 1ZVYA 4FRWA 3CH1A 3ZKMD 4JO4L 4K71C 4LKXB 4PJCE 5IVOA 3T1FB 4HUWA 3UZEA 4DN4L 1OP3H 2VLJE 1BIIA 4TVPL 5DVKA 4G5ZL 3VWJA 5I0DA 3P9WB 2DQUH 1JRHH 3QEHA 3C5ZB 1UC6A 2IANB 2C3GA 4PYHA 4U1SB 4JDVB 1M7IA 4ELME 2GSGA 1IM9D 3DUUB 3DXAB 1LILA 3U4EA 5LCVH 5EG6C 4HZAA 2DQJH 1JNLL 4HUNB 1I1YB 3OR7B 3KNBB 4PRDB 3BJLA 3NGBB 3BSZL 4PJHE 3C6SA 5CD3B 3M8OH 4HIXH 5D1ZA 1H9VA 2NX5D 4RNRA 3BQUC 1H15B 3KJ6H 4U1LB 1MFEL 3SKOA 4JDTH 1MY5A 4PRHA 3BN9C 3SJVB 2DKMA 1FO0H 4KV5F 3NCCB 1WBYA 4YBLC 4Y89A 5ADPH 1LHZA 2H2SC 3NBNA 4EI6B 4RISH 4FXLA 4QNPF 3BKCH 4OZIE 4ZSOE 3A67L 2Z31B 1FNHA 3MRPA 4V1DB 3U83A 2EEDA 2Y36H 3O6LH 1J8KA 3OAZH 1ZA6B 2BNQD 4FTVE 5E1AB 4TNWF 4E42A 1U91A 1KTLB 5CSGA 2X4RB 5GS1A 4OZHA 3RVUD 3R1GL 2PYEB 1KB9K 2APFA 3VMPA 4Z77A 5C09E 1J87A 4JQXC 4LSVH 2X7LA 2APWA 1HKLL 1I7TA 4OQTH 1P7HL 1VADB 3BIKA 3SE4C 3QULA 4RFOH 2OZ4L 4ZFOA 4QXGL 4XCEB 2NZ9C 3MZTA 4K7PY 3DSFL 3CSYB 4WFGD 1CFQB 1KCKA 3G5ZB 5DEFA 4CN6A 4UAOB 4L4TD 4JHBA 3SOBL 3NN8A 1MFDL 2MQ0A 1A4JA 4OB5H 5DJ6A 3A6CH 4JGUA 2V2TA 2DQCH 2YC1B 4Y19A 4JE4B 3TPUB 5DQ9B 3TN0A 1DBBL 1FLRL 1OAKL 3LEYH 5LXGL 5I8OH 4GOSA 5SX5H 4KVNL 1J7VR 1U8OA 4J3UA 4BUGA 1CGSH 3WO4C 1NH6A 2HYMA 3L3GB 5D96B 2DB8A 2YRPA 1X4ZA 2DL9A 5DJXA 3WDIA 3DGCR 4H88L 1INDL 1KYOJ 2Z8SA 4DCQB 1R3HA 5GJSL 1A64A 2LAGB 3CXDH 2IFFL 4NRXA 1FORH 5JXEA 4JN2A 5E8EB 2EEAA 2I60L 4X9GA 1NCWL 1OGAE 3CH8A 4MJ6B 3QBTB 3MXVH 4F57L 3GBNL 2VXTL 3EOAA 3L3IA 4LASH 3GSUA 4DKAA 2P5WE 2Q1EA 1DQQA 4OIBA 5FF6B 4OD3L 25C8L 3I3BA 4YHZH 2IQ9H 2A74A 3TWCH 3FB6B 4GMTH 2H8PA 4G6FD 1TITA 2CIKA 4FABH 1K3IA 4O2CB 4K94C 2XKNB 4R4BA 5F8QC 2FJFB 4D0CA 2FHCA 3O2DH 3S96B 4PRNB 1QP1A 5DFTA 1MLBB 3DGGB 4JPIB 4OCLC 3EOBA 3TA3C 1LP9B 3RWEA 3ABZA 1A14H 3VH8A 4EVNB 3F62A 2A38A 1S8DB 2WSKA 4OLZL 3D85A 2XKSA 1LO3H 2QSCL 4UUJB 1FZKA 5EN2B 4LHUA 1N5AB 5FV1L 4F15C 5GRVK 5J06A 5I74C 5L2KE 1NQBA 5FXCH 4ZOEA 4KVCL 4FTVD 5K9KB 4JKPH 5B39A 4BZYA 4C59B 2D7TH 4PRID 5C09D 5D71H 1Z5LB 5D5MA 4NWUH 5F96H 4PJ8D 4YHIA 1FH5H 4P4RA 5A2JH 3JBG7 4MAUL 1HHIA 1IC4H 1CVRA 1D5BB 2QHRL 3GHBH 3MV11 4NO2B 1GGYA 2FR4B 5D7IE 1NAMB 4RGOL 4LDLB 1WTGT 1Y6KR 4NJ9L 3QWOA 3DRQA 2HVKB 2HWZH 4HS6B 1NL0H 1AGBB 5DUBB 2F5AH 1CK0H 2VDMH 3OX8B 1TETL 1NC2A 2EDFA 4JFZL 4I5BB 4LARH 4FQLH 4PB9H 3ZL4H 4A2LA 3BD5A 1N5YL 5DRZB 3BD4A 3RWJB 3ULVE 3UTTA 4M7JL 4MB4A 4HKJB 3O6KL 5K93A 1QRND 3GSRA 4L8DA 4PJDB 2XWJA 3FOLB 4OZFB 4JRYA 5EORH 2ORBL 1OAQL 5IVNA 4LDEB 2GK0B 2JIXB 5GGRA 4HWEH 3V52H 3CFJB 1XGTB 1U95A 2P46B 4XRCA 4R2GD 4H25B 1NSNL 4O5LL 3PHQA 3BESR 5GJTL 1LQVA 1OGAD 1L4IA 5DHYB 3C9NA 1BQUA 3QPQC 3BP7A 1FZMA 3OB0H 4MB3A 3FCTA 3DX7A 3L3OB 3QQ4A 3EYVB 4ZUWB 1LO0H 3VWKC 1JUFA 1E4XH 4IOSD 2FECL 2VDNL 5GS3A 3SE8H 3ARTA 5FO9A 5L6YL 1MWAL 1WVZA 1VGEL 3IXAA 3PGCB 4LSTH 4Y16D 1J10A 3U36B 3TCLB 3OAYH 3V95A 5C6PB 1HSAA 2ARJQ 2QSVA 4PJIA 32C2A 3TFKA 3G9VA 3TH3T 2FEEI 4NKOA 3GI8L 1KB5L 4JKLA 3D1MC 4PJCF 3L6FA 5C08D 3NVQA 5DD1H 1GZQB 4MGXA 3PDDA 4C56B 5BVPH 4D2NA 5IWLA 2JLLA 4X5LA 4EQ3A 1UXSA 3ARGB 3WLWD 5CKAA 3G04B 3TGXA 1DVFA 4PUBH 1FYHB 4HKZB 2UZIH 1J0KA 2A73A 2APVA 2BMKB 2FSEA 5DGRA 4HLZH 1AJ7H 4OUUA 2G75A 2BY1A 3DLQR 2F5BL 1B0GA 3I02A 5HHMB 4Y4HD 1IZKA 3WUWA 1U8IA 3PWLB 1QSEE 3OKEB 4TNVF 3C8DA 1OAUL 4NPYA 4N5EC 5EOQL 2IH1B 2N4IA 4PLJD 4HJGB 3FB5B 3GMRA 2A83A 4U05A 2R1WA 1HINL 4LAJH 4EN3C 3RRQA 2VE6B 4UTBL 3VGFA 2NXYC 2VUOA 3DARA 4PJ5E 3QJFB 2IWGA 2H9GB 3ARBB 2NPLX 1JIBA 2C7UA 1YEFH 3JUYA 3OV6A 2FIKB 3WXVH 1E6JL 2NX5A 5FB8B 5FO8B 1CF8H 4QHKI 2VDOL 2LE9A 1IAII 2CXGA 2A9NH 1MWAB 2LU7A 4UV4L 3ZT5A 1W0YT 4ZXBC 3V5KB 5F70A 3L5IA 2QQNL 3DX9A 4YH6A 5I16B 3V4UL 5SWSB 2F54E 2Q87A 4K3HA 1UWGH 3U4AA 4JFHE 4DOHE 4O4YL 1HHJB 3QIUB 5KSAC 1OAZL 4JM2B 5HVHC 3RUGE 1G7QA 5EUOA 2CGRH 3CFCH 3IJHA 2AK4E 1XGRB 4R8WL 4WENB 3E2HB 1I9EA 2P24A 4N90E 2VABA 3QFDB 5ESAB 2BZDA 4E9LA 3A6OA 3FB8B 2B1AL 3WFZA 4CU6A 3H7BA 3GNML 1A3RH 3MA9L 3PXHA 2YKLL 1P84J 1NGYA 5C0EB 1JHLL 2VAAA 3M17A 5CSZA 4APQB 3HE7A 4GKNA 4YDJB 4J3TA 5DDHB 5CP7A 5TDNA 3RWGA 2QKIA 5SWZA 5FA4A 1E6OL 5DD5L 4C4KO 3VXPB 1MJJA 4PLKC 5D7KD 1IAOA 3MRHB 2CXKA 2NY1D 1JPGB 4FQQB 3T0EE 5D7JA 2VC2H 1NAKL 5HXMA 4PJ9C 4PJCA 1OP5K 5D2LE 4K55A 2VLJA 5MEQA 4XWGH 1WIUA 4P3CH 3TF7A 3OKOA 3CFKB 3CVIH 5MEPA 3MRCB 1RZJL 5E2UL 4ELMA 1IT9H 2VN7A 3IDIB 4KHTL 1YQVH 4LSPH 2JELL 5IROC 3V6OE 1INEH 1JI1A 1SBSH 2OSLB 1D6VH 3K1DA 4M7KL 2VLME 1YEKL 4RSVA 4YNYB 4XC1H 4JG0L 4PJHA 1F8TH 4Y4FB 5CJXA 5H94A 5FYKD 4OQTA 1L9MA 1UB6B 4NNYB 4O51A 2R23B 3IT8D 1YY9C 1P6AB 1EXUA 3QNZA 1WIPA 5KSBB 3BGFB 5J1TC 3TVMB 2JK5A 2BVPA 1CZ8H 3UTZB 4GRLA 2XV6B 2AXFA 4F2MB 4N8CH 3P0VH 3KR3L 4PJFB 2IPTL 4HIIA 3RNKB 3V5DA 3VFRB 4JFHD 3NCJH 4OZIA 1NUNB 5F7DB 4YBQC 1N3NA 1CDBA 4XPTL 4M03A 4AYFA 4BFIA 4FTVA 2GTWB 2H41A 3KWWB 4F7TB 2XA3A 3QWRD 1BIHA 5GGUA 2DAVA 2LABA 3LS5L 5CINL 3TO4B 4ONFL 3HAEA 1TJIL 1J8HB 1IFHL 4PJ8A 12E8L 3TT3L 4TPRL 3NFSH 4N90D 1OD9A 3MLUH 1IGYB 1ED3A 1RUML 3QNYB 3GMMA 3O0RL 4K7PL 3RIFF 3GSVB 3ULVF 5EU5A 1U8QB 1ZHBA 1NLDH 5KAQG 3GB7B 4XMLH 1I8LC 1MJ8L 1MRCH 1ZANH 2ENSA 4PD4K 3REWB 1LDPH 2NQCA 5KVMC 5J3HD 2RR3A 1YN6A 1G7JA 4S1DD 3DXAD 1E4JA 5F21B 1GZPA 4MCYB 1Q0XH 3IDJA 3TJHD 3VD3A 5HDOA 1RJLA 3FKUS 3V7MA 1ZLUH 5EPMB 5DF0A 3L9RA 4P57B 5BJTB 2AI0L 3H9HB 4M8QA 5MI0B 3PQYE 3O2DA 5IVZA 5L2JA 1J0HA 1YEEL 2DWDB 3MOBL 4TUKH 1LE9B 1MAML 2JB5H 4X9IA 1YMME 4MA7H 1Z3GH 4U6YA 43CAA 1WGOA 4FQXB 3WIHL 1I8MB 1OGAA 3PWUA 4OAWA 3RX5A 4Z95L 1JWSA 3T4AB 3TT1L 4G8EA 1EGJH 2CD0A 2P5WA 4KKBD 5F88A 1QA9A 4DK6A 2Z31D 4ZS7H 1ZSDB 3ZO0A 4UILH 1VACB 3BYYA 1P5UA 5ENWA 2K1MA 2WBJA 1EERB 4WW2B 1A7PH 3P3YA 4U6VH 3VRJA 3P30H 1RZFH 4L29B 1UACH 5E2VH 1ZLVH 4JFYA 3G08B 5FM5M 1TVDA 2PYED 2DMKA 5CWSA 2PW1A 4PGEA 4KJWC 3FQUA 2P45B 4LQFH 3Q6FA 4BZ2H 4LCCA 5DURD 1MHHA 4NM8H 5IB5A 5BZDB 5I0ZA 1NMBL 1HOCA 1JGDA 4OM0L 4P99A 1S7QA 1JFQL 2EEBA 4G6AC 3SE3A 2FO4A 3OGOE 4YO0B 5DJCB 3NACH 1W2KT 5E2TH 5KANG 3MUGB 3QA3A 1FL6A 2DQIL 5I1GL 3PNWB 3MCKA 5JOPD 5IIEB 1KENH 1BFVL 4YEEA 4U1HA 5L2KA 1HQ4A 3RI5K 2G9HA 5BRZE 3TJEH 5IW6A 8FABB 3CDGB 3IETA 4XVUC 1NGWB 1G7IB 4YHOH 2NMSA 4UNVA 4YBHA 2HLAB 2X2YA 2W9DH 3B3IA 1NCTA 4KROB 3WFHA 4XGZA 1FVCB 4I9WE 3MRKB 1G1YA 1MCEA 2BOBB 5KOMC 2FWOA 3N85L 4P5KB 5D7IA 4LCIH 2WWKO 1KFAL 1NAMH 3QEUA 1KCGC 5I18L 4YWGH 1U8KB 4NDMB 3BPOC 4RGNC 3E6HB 3PDGA 4POZC 5GIRB 3QUXB 1NBVL 2QEJA 4J7RA 5J7CC 4H8WH 4HIJA 1DQTA 1BFOB 2EE3A 3P4NA 4K23L 2FBJH 4WI8A 3MROA 2EIZB 1OCWH 3GMNA 2F15A 4S10A 3B9EA 4H20H 1FC2D 3I50L 3RUGF 1U58B 3W11D 5ID1B 3G6AB 2V5MA 3FT3B 4ZUUB 2A6DA 1YMMD 4PV9B 4W70A 3QUZC 3PE9A 5EIIB 5JQ6H 4NJAL 4QTIH 1RU9H 1IEAA 3ILQD 1Q9KB 4LHUG 1LDSA 5T1MB 3L5WB 5EBLA 1T1YA 1INQB 4DQOH 2VZUA 4HFWA 1AD0A 5I71C 4I0KA 1L0QA 1FBIH 4FZEH 4K8RD 4KI5C 1ZLWK 1ZV5A 2GW5A 1LE5A 3OMZA 2FLRT 4P0DA 4XCNB 3ZKQD 3FO0H 1ZWIB 1XF3A 1FRGL 3HC0A 4YXHH 3SCMD 4OF3A 4ZFFA 2GSIA 4GRMB 3FONA 3MFFB 4DGYH 5MHSE 1EMTH 4L8SC 2HRPH 3VXNB 1FSKC 1OW0C 1MCRA 3Q6GL 2AV1B 2BCKA 3OG4B 2VISB 3G6JE 3ROOB 2B5IC 4HFUL 4LL9A 2PUQT 4MSWA 4ODVL 2I5YL 4FQHB 5IJKC 2BOCB 5JR1L 1Q9WA 5D2LF 3SDXB 4EEEA 2ZG1A 1CE1L 2OQJA 1T22A 4ZTPH 1RUKL 1LK3H 4MLIA 1SJXA 2OL3H 3ZMRA 2A77L 1WWWX 4YQXH 2YBRB 3BAEH 4I8DA 4RX4D 5CEXB 3N06B 5CJ8A 1VCAA 3RDTA 1XGQB 2CO7B 5TH2A 1LD9A 3U6RA 4DTGH 2X9XA 3D69B 4OGYH 3I2CL 2W59A 5D1QD 5IB4A 1QSEA 1QO3B 4L3EB 1CE6B 3MA7A 3LKQB 2PO6C 4YUEH 2PTTB 4Y5YC 1SEQL 3EO1B 4NUJA 3EDDA 2AW2A 5DI8B 3SE9L 4BKLA 2C26A 5C0IB 2CKNA 2E27L 4P9HH 1L6ZA 1K8DA 1FP5A 3AS0A 4ODSL 3IFOB 2PXYC 1JTTA 2VR9A 5BW7C 1F6FB 3MACL 3T0BA 4PJ5A 4JGJA 2D2OA 1HI6B 5I73C 3CDCA 2CMRH 1SMOA 1JGUH 2C4FU 4FQ1L 4NKMA 3QT2A 3R4DA 4HUXA 3D18A 4M5YH 2R29L 4JFOA 2Q8AH 1J88A 3MJ7B 2GFBA 4D8PA 4FQ2H 3KAAA 1NCAH 2VDRL 3MRGA 4Y1AB 5EU4B 1BQLL 1DFBL 2R4RH 2ZCKH 1C5BL 4FFVC 1I7RA 4OI9A 3VXMD 4LGPB 1B4JH 1J0IA 3BKMH 2C4FT 1F6LL 4PTTA 3QPXH 2J5LC 3WDJA 2F54A 5C7XH 2D0HA 1C5CL 2AV7A 3R0NA 1F4YH 1XR9B 4WO4C 3W9EA 4S2SB 4HF5L 3LB6C 4G59A 4GRWF 4KZDH 1JN6B 1DEEA 4NC2B 3GUTA 4KKLD 3RUGA 1T6VN 4NP4H 4C56D 2K7PA 4I2XE 2AK4A 3BZ4B 5DA0B 4AM0A 4MVBA 4YPJA 6FABH 1GAFH 1WC7A 4TSCL 3EFFA 3VD4A 4LBEA 1TDQA 5EC2A 1KG0A 4FFWD 5IHZB 4G6ML 5MHSD 5HHMD 1VGKB 5E00B 4POYA 2VQ1A 1ZMYA 3KYNA 2HLFD 1OPGH 5C07E 2ED9A 2N1KA 2OM5A 2R2EB 3BP6B 1BJMA 5DMGD 1HHGA 2VH5H 4HPOL 1KJ2A 4X6CB 5A16A 5C1MB 3MLYL 5FOBA 1DBAL 3DMMB 4HGWB 3O4LE 1SYVA 3FQRB 1CGTA 4OQ1A 1OTTD 5EO0B 2V6HA 5KVEL 2DI8A 2ITCA 3AGVA 3LEVH 2IPUK 4K3EH 5IT2H 4UDUA 1W72A 2HKHL 2B0SL 4NCC2 3BRDA 3T0EA 1FCCA 1U3HB 4JG1L 4JO3H 4UV7H 3N1FC 4Z7NE 4GJTB 2O5XH 1QFWH 5EO9A 4UTAH 3WFEL 2VUYA 5JIPA 1GC1L 1PSKL 3IFLL 5D2LA 5FDYA 4MQXC 3L1OH 4IIQB 3IU4L 2DQGH 1T6WA 4GG6E 3DUSB 1CFTA 1TNMA 3L5XH 4MAYB 4OD2B 1YPZB 5HYQA 3TIEB 1UM5H 4HV8B 3GJEA 4QT5B 3V6OA 1JPSL 5IVXB 4V3EB 4LFHD 4JM2D 5FHAL 4BJLA 4M3JA 3CSBA 5B4MC 2AJYL 2AJVL 5DUPL 1G9NC 3V8CA 2AEIT 3QIWB 2DQEH 4NRZB 3MFGB 4P2OB 3I6KA 1IVLA 5I1IH 3EFDH 1NPUA 5GGSB 3GI9L 3WL9A 1NANI 1CFSA 1OQXA 1HCFX 2EDXA 3QXDB 1HQRB 3LQMA 3N1MC 4IJ3B 2NXZB 4I0CC 1F90H 1ADQA 5AWNH 4IEFB 4R0LB 3GMOB 4HS3B 3KGRA 1RHHB 4APQD 4Y4KB 3L7EB 2HKFL 1XCQB 2UY6A 1YEDB 3D2UD 2JCCF 5EO1B 3CD4A 4Y5XA 1EZVY 3O6MH 4K71B 2HTKC 1G6VK 3DBXA 1NFDE 3O11B 4U4BA 1MFCH 3F6IA 4U1NA 3IRZA 3VWJC 5DD3L 4K9EC 1XGYL 4WDIA 2FX9H 3PUCA 3QO1B 2Z8WC 5HYJE 5BOPA 2PR4H 4YE4H 1NUGA 2WNGA 4NQSB 3L95A 1MH5B 3RGVA 3QQ9C 3QFJE 5DFWH 2Y7QB 5GS2H 4YHLH 5C07D 4M00A 1I9JL 5ICXB 2APBA 1NGZA 2CRYA 1U8HA 3E8UH 3LPGA 3VXUB 5D1ZC 3BQUB 4N0YL 5AYQA 4AQOA 5TE6L 5DRNB 4PREB 1AFVH 3ULUC 1BGXH 1C08A 3MXWH 4TOYH 3CX5K 5FYKU 1YDPA 2VJXA 3IDGA 4YBLB 4Y4FD 3PQYA 1PW3A 2OLDA 1JHKH 2UWEB 3VI3E 4QKXB 4IMLB 3TBVA 1JTPA 4XBGB 4FNLL 3TVMD 1YMMA 2BFVL 1HIMH 2BNRB 4GKZB 3WHXB 2JJVA 2A1WL 4KHXL 1RIHH 4TNWK 5C9KA 3HI6H 3QG6A 5FA3A 3RGHA 5BVJA 2EYSB 3QH3B 3SDDA 1FNLA 4EQ2A 5GS1C 1K5NB 2X70B 3KPMA 2CLZB 5MERB 3X3GL 4RMVA 3ROLA 1QRKA 4X80L 2XPGB 3G6JF 4MD5A 4YGVB 3KVQA 4S0UC 2VERN 2P8PB 4NCC1 2YPLB 5GXBB 1BJ8A 3IDNA 2NY5L 1S9YB 3B4NA 3W0WE 3F58H 5GGTH 1CLZH 1NBYA 4XNYL 4EUPG 3SCMA 5ACZA 3TO4D 1J8HD 5C0CE 3UCRA 4XCYA 5CBEB 4N8PA 1UCBH 3QB7C 1Z9LA 2RCSL 3TYFA 1P1ZB 4MA3B 1G7PA 3HS0A 4P9ML 3BD3A 2W0FA 1FG9C 1MJ7H 4ODXB 5IMLA 1JYXA 3AREA 3TN0C 5GS2D 2D31A 3OKLB 4AT6A 1IJ9A 5DJ8A 3SDCA 1U2HA 3WO4B 3H42H 5LGJA 2EDKA 4LRIA 5C0DA 2Z91A 5CGTA 5DJ2B 5I8KL 4UDTB 1YMHA 1DBJH 1CGWA 3IDMB 4GQ9H 5IB1A 5DUML 4RX4A 4W81A 1FDLL 5BRZA 3W39B 2AQ1A 4MNGB 2ZNWA 3KPSB 2YD1A 4XHQA 5JXEC 3IFPB 5JNYB 1ZEAH 5GZOD 1KPVB 4GW4B 2ADIA 2R1YA 5FDWA 43C9A 2QSTA 3O9WA 2PCPB 2ZUWA 3O2VH 4IRJB 4QYOA 1QYGH 4WI6A 5KG9B 1FNEB 4M1DL 4QRRB 1NMAH 3NH7H 3QFJD 3ZDXE 3CZFB 4HXBH 1IAIL 5BV7L 1X5LA 4OM1L 5DT1L 1YNKH 1KT2A 4U3XA 1I1RA 5TE7L 2PN5A 5EBWB 3U2SB 5FYLL 2J8UE 1T5WA 1KLFA 3V7AG 1HEZB 3TA3B 4LSDA 4ZOBA 4ZUTB 4M4RA 5AG8A 5IKCB 3SDYL 5I8EB 2W91A 1OL0A 3PXJA 5KBNC 1GHFH 4PTUA 3U9UB 1ZT7A 2XTJC 4WCYL 2H32H 1AQDA 4F15B 3ZKSD 3O4OB 5EBMB 5I74B 4HUMB 2IH3B 3BT2L 2EICA 1JNNH 4Q9QL 4ODUA 1RJZB 1U8NA 4KWUA 4KPHH 1KN4H 3BPLC 5IQ7L 2OL3A 4XP5H 3ZLQC 3DURB 1UVQA 1TCRB 3AU1B 4GW1A 3FMGH 1MRDH 1DN2A 1IL1B 2AJSL 2E7MA 4C83A 2Z8RA 5C0CD 1K9TA 2A6IB 5GSVA 1I1AA 4PJBE 4U6XB 5GS0H 2R0KH 4GBXA 2DLFL 2HT4D 2LTQB 5I1KH 2ICWA 5HHOE 3G6JA 1J1XL 2H26A 3U79A 4Z7NF 1TPXC 1Y6MR 3LEXA 3RIAF 5DMKA 2X1QA 3RKPA 5GRUL 4HCRH 4XWOC 3PGDA 1J05A 3MLTB 3GMPA 4G8IB 2Y9RT 1W8NA 1QR4A 4CMHC 5TE4L 4HUVA 4PJXF 4GG6F 3QUXD 1C5DB 1HSBA 3HPLB 1VFAA 1T0NA 2Q20A 2DQHH 35C8L 2IGFL 4UZGA 1I9IH 4I13B 4Q9BA 2VN4A 4X7TB 3J8F7 2VDLH 4GUPB 1AXSA 5GGVH 4NZRL 1CD1A 1MCNA 2DMBA 2OTUA 5E94B 5GSRB 1NBZA 1R5IA 5DRXB 1ZHKB 2ESVD 3P9LB 1FFPB 3VWKB 1ZTXH 3B9KD 4PV8A 3Q5YA 3VFUB 3W9DB 2V17L 4JFDE 4KAQL 1PX3A 1CR9L 1A1MB 2ATKB 1Z2KA 1AGEA 3BEVA 1RZ7H 2FZ3B 3K2UH 1WBXB 4G8FA 5FCSH 2WUBL 4YXKH 1A1NA 3NZHL 1TVHB 1U92B 2NNAB 1BBJA 2KQMA 3TFKC 1BX2A 1EO8H 3BUYB 4QRSA 4W68A 1H3VA 5GS0D 1EEZB 2DN7A 3AY4A 1NFDF 2GUOB 4PG9A 1QSFE 4RRPA 2IAMD 2CDFB 5E99L 2AS5M 5IWLC 5HPOA 1HH6B 2VIRA 3FRUB 3WIIH 1KEML 4KK5C 2MFNA 4JPKH 4FXGB 3OAZK 15C8L 3C8KB 2UUDK 4LLDB 1N59A 3PIQB 4N9GA 3ZKND 1DVFC 2M26A 5KVFH 1AKJB 4ZAKB 4W6WB 1ORQA 1NLBH 4I2XA 4Z7WB 1S7XB 1MAKA 4P2RE 3HNTL 1KJMA 2VKXA 3D9AL 3HMXH 1KLGB 2VDKH 1F4WH 1F2QA 1MCPL 5CHNB 4YR6A 4PP1D 4DUVA 4RWHA 4LLYA 5DTFB 3RWDA 5KSVA 1OAYH 3UJJL 1CG9B 1KJ3L 5CEZE 4QEGA 1P4IH 4X4ZA 1HZHL 4X4YA 1J12A 4L3ED 5JTWA 3S37L 5C07A 1X5GA 4RZCB 5CILH 3VI3F 5IMOB 5KJRL 4ZNCD 5E08L 3O4LA 1JBJA 5KS9F 4M43H 1OARL 5E2WL 1ZOXA 3LRSB 5D7LB 3MV7B 4ZXBB 1A7OH 4OCYL 5E6YA 2FX8H 1QSZA 4XP6H 5FFLA 3QDGB 4XPAL 1DBML 2G2RA 1XF4A 1CDCA 3PP4L 4NC0B 5HYSA 5JDSB 5B38B 4GXUM 1BVLA 1MVUA 4Z78B 3L3DB 4U2YA 4ETYA 2GITB 5DMJB 3H0TA 2B2XH 1S7WB 1A6UH 1AI1L 3MRDB 4Y1AD 2DIJA 5KSAB 4NQVB 2WZPD 5CEZH 5HVHB 4OGAD 4O9HH 2KQNA 2ILLA 2HFGH 4Z7VF 3KYAA 1UQSB 4GG6A 2EE6A 3S98A 4HKBA 4NGHH 4FMKA 2XZQH 4NC1C 5DS8B 4PGBB 1R0AL 3BXNA 5C0BB 1I7UB 4IM8A 1IGML 2O5YL 1ZHNA 4P5MA 5DHXB 3WFCL 3AXLB 2CR6A 5DR5L 4LVHC 1U93B 5I15L 1TMCA 5F7EL 1K2DB 2NW3B 4MXWL 3MOAL 1BQHG 2DJ4A 1J11A 4XXDB 4Z5RB 1BZ7B 4D0BA 5FKAA 1U8JA 3MLSH 3HC4H 4N0CD 2HJLA 3HE7C 5IEKA 3S9DB 2P1YA 3TZVA 2ZOKA 3B9VA 5TF1H 4DVRH 2EYRA 5DSCA 1B0RB 3DMMD 5ICZB 2WUCH 3U48A 3B2VL 5HDBE 3W2DH 5D7JC 2I26N 3U46A 3B83A 4M48L 1PQZB 3HZYB 4PJ9B 2ATPA 5J1SC 3VRIA 2X9YA 1DQJA 1UZ6F 2XA8L 1NFDA 1TZGL 1VHPA 5CGYD 1HYSC 1Y18A 3E6FA 4G43A 3GJFH 1U3HD 1TZHB 1BEYH 5I19L 3TF7C 4OIIL 2BJML 2R2HA 5HYJA 5CEZD 3QUKB 5ISZE 5T1DL 3SY0A 1MFBL 2F8OA 2P49B 1WWBX 3IAGC 5EUKB 4ZUVB 1R3IH 3QG7L 5IOPB 1IGFH 2RGSA 4MAYD 1CTNA 4EDXB 5CJXC 4EBQL 2P48B 3DVGA 3L3HA 1YY8B 1QBMH 3P4OB 5GGTA 2FLBT 1FC1A 3T3ME 4F7MA 1BBDL 4M7LL 2JJTA 4GRLC 1G7HB 3SO3C 2I25N 4OI7A 2D7PA 2EKSA 3QIWD 3IDXH 2JJSA 3O3DB 5HJ3B 1F58H 3JTSA 1FVEA 5KS9A 4JZJA 1N26A 1MHCB 5BZWA 3M45A 5SX4I 1XF5A 3EYOA 1SM3H 2MCG1 3KPLB 4L9DA 5F89B 2CK0H 3B43A 3P73B 1AXTH 5BO1H 4G9FB 5J11C 3QUYA 4QRQB 2BDNH 2CR3A 1S9VA 4KY1H 2I27N 1IKFH 4PJ8C 4QHLA 5H2BA 3RIFK 3OKDB 3Q3GA 4RQQA 5C6TL 5DJDB 3SGDH 1BVZA 4Z0BH 3W0WA 5A1AA 3LSOA 3QEQB 5IW1A 3PDOA 4G3YH 3GO1H 4G80A 3QDME 1YYLL 3PG2A 3ZDYF 1B88A 5C0CA 3GKWL 5A2IH 1OF2A 2YXMA 2ARWA 1UG9A 1JRHI 1DUYB 4OFPA 1HHKA 5EIQA 4D9LH 1QFUL 2ICEA 3WLBA 4RGMC 2IANE 1IQDB 1HXYA 5M94B 3QWQB 2Q8BL 1NJ9B 5DWUL 4NO3B 4M4PA 2G5BB 2YRZA 1YNLH 1B2WH 5IBUB 4F7EA 2J4WL 1N0XH 3ZE2E 3K74B 3O6FB 3RTQD 3KPRB 2EH7L 4XZUB 3VGBA 4NM4H 3BQUD 4AMKL 1VFBA 1GGCL 2IG2H 4ZYKB 2YK1L 3BN9D 4ETQB 4NN7C 5IBLC 3T04D 2Y06H 2H2SD 2G5RA 3AFLA 3I6GA 4JPWH 4I48B 3SJVE 2H32A 2PTVA 4XMKH 4MHHI 1WIOA 5D70L 2MNUA 2R0WH 5C0RL 2Q76B 3HE6A 5HDQL 2B4CL 3RY5A 4QOKB 3MNWA 2WBJC 1KTDA 3RWHB 2NY2C 1KULA 2IC2A 4HBCL 2FNBA 1KOAA 4RIRA 3FFDA 2PW2A 3QDJD 5IFAL 4CAGA 4QGYA 5IBTH 4K94H 2YEZA 1P4BH 1ORSA 2XZAL 4LCCC 1TJHH 4JB9H 2N7BA 2VWEE 2NZ9D 4LF3B 3CX2A 1R5WA 2FJHB 4UT9L 1Q8MA 3C5JA 4O2EA 1CT8B 4YEFA 3SE3C 3VFGH 3GSOA 3GMQA 3X11B 1F00I 2G60H 3GIZH 1MCQA 4MDJB 1IGJA 3GK8L 3FRPA 5F3BB 1NBQA 5EZJA 4MNQE 3HZMA 1WZ1H 3SKNB 1HNGA 1A6TA 5KSUA 5KTEL 4S0SD 7CGTA 1A6VH 4TVPE 4HCRA 2PKDA 5E8OB 3IGAA 2CQVA 5H37H 2WINA 1GGIL 4FP8H 2H6PA 3CVHL 2X1PA 1BFSA 3D39B 4ONGH 4BH7A 3QJHA 4S1QH 1N7MH 1J18A 4OCRL 1MPAL 1A6ZA 4CVUA 2F19H 3C60A 3KPSD 1VFMA 4WHYG 1EFXD 5BS0B 5J89A 3AVEA 4PJBA 3KLAA 2FJGA 4RGNB 3LH2L 3HFMH 5HVFB 5HHOA 5KN5A 1EAJA 4QRRD 3OR6A 5EFIA 3DWTA 3LMJL 3UTOA 1MELA 5J6HB 5IMMB 4GXVL 1AO7B 3ULVC 2R0ZH 2OJEB 3WD5L 4HLJA 3LQZA 2RIKA 1UWXK 4KK8C 1Z9SA 3HHRB 3HRZA 5I1LA 1S7SB 3TA3D 2BSRA 5E5UB 3QUZB 3K8MA 2BRQA 3EKCA 1GXEA 4L4VE 3NIFF 1AC0A 3I9GL 2IALA 3EUUA 4NKDA 5I71B 2ZUXA 2DD8L 2IPKB 1FNGB 4ALAL 4UQ2A 3V4PH 2EO9A 1JNHA 3EO0B 4ZFZB 2AXGA 3EOTL 1F11B 2ZUUA 1X4YA 4JY6A 2XY2A 3CFEA 3VI4E 4JFDA 3WFDL 4F33A 5IUSA 3T2NH 2KDGA 2OJZL 2NYYC 3IFNH 4LMQI 4KZEL 4OKDA 5IM7A 1EHXA 4QCIA 3LQAH 5J12B 5F7MC 3CVHB 5F7HA 3MRRB 4W4OA 3DI2B 1FSKB 3CU7A 2C1OA 3HMXA 4P4KA 1KLUA 5DVLA 1Q38A 3E3QE 5HDBF 1JGVL 4EI5B 5BCAA 1CYGA 5F72S 1ZHLB 1L9NA 5KZCB 3GRWL 2XWBB 3NAAL 3P9MA 3S88H 1DQLL 1SY6H 2AK1L 3KYMA 4Q0XL 1JV5A 4PRBB 1QSFA 4MNQD 3PWNA 5D72H 2DTSA 1O7SA 2JB6A 3KXFE 3TBTB 4UU9B 2H1PH 4M93C 1J5OL 4R9HA 3LHPH 2DF3A 1TNNA 3K46A 4YPGB 3RDTC 1JF5A 4NBZB 4AL8H 3U0WL 1X5ZA 4P46A 1DBBH 1EJ6A 1UH3A 3H3PL 3NFNB 4P2RA 1KN2H 1KYOK 3NFPB 3IF1B 3QCVL 4A6YB 2NLJA 4EXKA 4YDKL 2FYYB 3JUZA 1I3RA 4LP4A 5E7BA 3VJ6B 5GQBA 4LLWA 5I1EL 3DTXA 4WUUE 1N4XH 1INDH 1OM3L 3MMEB 3QPQD 3X3FH 4K3JH 5DJ0B 3T65B 3TIDB 5GHWL 4Z8FL 1VSCA 4QHUA 1W0VA 5GJSH 2PXYB 1LQSR 4H1LA 4PJ7B 5FGRA 2IFFH 1AC6A 1CGYA 1MQKL 3EJYC 4NNXA 5I73B 5C0JA 5EU6E 4OFYD 2I60H 3VWKD 1UYWL 1NCWH 3VD9A 5HGDA 1RY7B 2VXTH 1NDMA 4GLRH 4TYUA 1ZS8B 1E4XI 5E6IA 1A8JH 4LLQA 4R7NA 4FN0A 1T21A 2X42A 5D9SA 5ADOH 1OY3B 3MCLH 1NGXB 4I4WB 4QTHB 4ISVB 1WQVT 2VSDA 5IEHA 2J5LB 4L4VD 3QR2A 4ZDHB 1N2RA 2XZCL 5FGBA 5CKGA 1AD9B 1FFOB 3TO2B 2Y5TA 3OKMB 4S1SL 4WO4B 4QRTA 3L5JA 4WY7L 3TESA 1IM3A 5CJOH 1G1CA 4WTWA 5ILTL 5T5NF 4MZ3A 3TM6A 2OI9B 1RK0A 3DRTB 2W65B 4RAVB 1N6QL 1S9XB 2Z4QB 5AD0A 4N0UE 2ERJC 1I9RL 3MRBA 4X6BB 2E7LE 4OLZH 1R24B 3QXAB 3VA2C 5D7SL 2NY4D 3TH2T 4MVBC 2QSCH 4L8BA 1OOAA 1JPFA 3KPNA 4WNQA 1AKJD 3LD8C 3FTGA 5C70A 4KVCH 1EJOL 3BDYH 3G9AB 5ACLA 2FX7L 3CZJA 4N5ED 1MCOL 1X5AA 4JQVA 4X99A 3CC5A 3RWCB 5J3HC 3LS4L 5F9JA 2IMNA 4U1IB 1R3KA 3MRNA 3GSNA 4OLWL 3D3VB 4EN3D 5KVGH 5FM4A 5TGBB 4CVZB 2Y4SA 2BSSA 2QHRH 4U3HA 5HPMA 5IV2B 2DM7A 2NXYD 3NCYP 1MCWM 4HPYL 1CFVL 3KXFD 1MJUH 5F97E 3TNMA 3PHOA 4K9EL 3T0EC 3RTQA 2LVEA 4I18B 2P44B 2Q3AA 5I2IB 1P4LA 2H3NA 4OZGE 4M6OL 5IR1A 5E8PA 1IGIL 2EXYC 5D7LD 2MHAB 4L1DA 1V7MH 3WDHA 4ZXBD 4PRPB 1D5XB 5HYSG 4CNIA 3VG0L 1CBVL 3QDGD 2NY6C 3O6KH 4U6HA 4AEEA 1FE8H 3HZVB 1I4FA 2NZIA 1KGCE 1G6RH 1WBZA 5JXAL 5ISZA 4OLYH 3VXSE 1OAQH 4LKCA 5KSAD 3RVVC 3KDMA 3LKNA 1GOGA 3V6OC 5F7WC 1AIFB 3BFOA 1ZT1A 5M7QA 1NSNH 2FH8A 2IBZY 4XBPA 5KOVC 3T77A 5GJTH 2YD5A 4NO0B 3F7QA 4P3DB 5IFHL 5HGBB 1L7TL 4ORGA 2F8XC 4HC1L 4LPTA 3KHQA 5EWIL 5JW3H 4RAUA 1PG7W 4LLMB 1YUHB 4XCFL 5JMOC 3BPNC 2KPNA 4YDIL 1TZIB 3IVKB 4B5EA 2NTSP 4BH8A 1VGEH 1U8MA 4OCNC 4Z0XB 3ZZ1A 4HH8A 4NKQB 3MTRA 1QTYT 4ZFOL 4HBQA 2ARJA 1ZAGA 3ZHKA 2J6EL 5C9JA 5J1AB 4PLKD 4Y5XC 4P2QE 4HUWB 3G5XA 3BO8A 4AQ1B 1DQDL 3GI8H 1KB5H 3VWJB 4BUHA 4K2UH 2Z93B 4X6DE 3BKJL 4NZUL 3MR9A 3UTSD 5LQBL 4PJ9D 2GSGB 3LN9A 5F7UA 5F6HI 5EZOH 3BP4A 4PGJA 4J6RH 5HDLA 3QDMA 4FFZL 1Q94A 1JZ7A 4XPBL 3MLVL 3L3JB 1M6OA 4KRNA 2CPCA 3WFBL 1QLEL 2DTML 4P5TD 5FKPA 1YYML 3C6SB 1EAPA 4UIMA 1B4RA 5D1ZB 4RNRB 4KTDL 2EDTA 4F80A 2IANA 4U1SA 3SKOB 1LP9F 4JDVA 3MBEA 4PRHB 3DUUA 1OT2A 4LPCA 2YS4A 1A7QL 5HHNA 4BSVA 1SQ2N 1QEWB 1WBYB 1RZKH 1HINH 1YY9D 1I1YA 4UI2A 2CKBA 3E1F1 3IJSA 1U9KA 4WI5A 4TULL 2EDNA 4U7MA 5CD3A 3MRPB 3WHE1 2AQ2A 3VXRE 4B50A 4NYLB 4XPFH 4U1LA 3RBGA 4E42B 1U91B 1E6JH 3SJVA 4NFBA 5GS1B 4OZHB 3SDDC 2VDOH 4R26L 4Z77B 2E7CA 1G9MH 2FH6A 2Y25A 4YBQD 3M07A 1V5JA 3BIKB 4ZFOB 4ZTOL 4YC2C 2W0KA 3V4UH 4V1DA 5DEFB 4JO1H 3C2AH 3CFDA 4HKXB 3SCMC 1ZA6A 4WWKA 1DL7H 1KXVC 3ZT7A 1A4JB 2X4RA 5DJ6B 3DNKA 3UTQB 3I3EA 3STZA 2V2TB 2R1XA 4JO2L 1TVBB 4Y19B 2OS7A 3UC0L 2A2QT 3MUJA 3UPRA 3T4YA 4ZFGL 3SDAD 4R8WH 1VADA 4LCWE 3MLRL 3TN0B 3AREC 3BE1L 3U4BH 4XCEA 1VFOA 2Y23A 4KXZH 2VLRB 1CFQA 3C5SA 1U8OB 1CGUA 3SDCC 4RMSA 3RAJL 2L7UA 4LRIC 1P84K 4PJDF 2R8SH 3CSGA 4DGIH 1C1EH 3GBML 4QRPE 5DJXB 4MCZB 5LWYL 4TUJB 4KQ3L 1NFKA 1F4XH 1GGBL 3SQOL 1R3HB 3HMWL 1JHLH 4P2QD 2D03H 1IILE 4JN2B 1V8HA 1IAIM 3RVXC 4F8QA 2ENYA 3KPRD 1KIUA 2YWYA 3UBXG 1RMFH 2YMXL 5TPWH 1E6OH 3GSUB 2B1HL 1URLA 3QCTL 3O9WC 1DQQB 4BQ8A 4PJAE 3EBAA 4GQPH 2A74B 4PR5A 5CIPH 5I1AA 1ITBB 5JW4R 4EXPX 4NIKB 3FQTA 3EO9L 3T0DA 3ZE1F 2CIKB 5I1HH 4G8GE 4WFFE 1NAKH 4HUUA 4R4BB 4AK1A 4D0CB 3TBSA 2OTPA 3EOBB 4R7DA 3RWEB 4UINH 1CGVA 5FF6A 1YC8A 4MWFA 3VH8B 1DE4A 5CEYB 1N6UA 5FYJD 4HDIA 4KJWD 3GZKA 1NGQL 3QXWA 5E9DD 5EU3B 4O2CA 3HI5H 4M7KH 3V2AR 4J3WA 1FZKB 1R3JB 2WK2A 3VXRD 3S96A 3VFTA 1HK6A 1ACYL 4G6AD 3FRPG 3KLHC 5B39B 1DN0B 5CCKL 3OXRB 2WIMA 2DQFA 2OZ4A 1EX0A 3BPLB 3JWDH 4AEHL 5ANME 5D5MB 4YHIB 1P69B 4KKLC 2YUVA 4P4RB 1HHIB 2QQLH 4KDTC 3QAZC 5FUOL 3QZWG 4OD1L 2AEQH 1KCUL 5JUEH 4XVUD 3QQNA 1MVFA 5K9KA 4XI5C 3QWOB 1DDHA 1Q1JH 4KU1A 2WWMC 1I1AC 4NQED 1VKXA 4LVNC 2BVOA 4HWBH 1A2YA 4HGKC 1PZ5A 1I1FB 1A7RH 1I3GL 4U2ZA 4C55A 4LEXH 2E3VA 3E3QA 5CINH 4I3SL 4LCWD 3L7FA 1TPXB 1IFHH 3ZHDA 3TT3H 5BS0D 4TPRH 3DECA 1MREH 3UTTB 2NY0B 2FR4A 2EH8H 4P9HC 3O0RH 2Q86A 3GSRB 4L8DB 2VTFA 2XWJB 5ALBH 4CMHB 2HVKA 3S37X 4POZD 5ABDE 4YHYC 1LGVA 4HS6A 4QRPD 3MPCA 5DUBA 1KIPA 2VLKE 1EHNA 5GGRB 3OX8A 1QZ1A 4CDGC 4L8CB 4G42A 5I1CH 4XRCB 1A21A 4MYWB 5DXWA 4NQCE 3PHQB 1N64L 3CMOH 3U7WL 5DRZA 3RWJA 2DICA 1IBGL 3BP7B 4HKJA 4U1JA 1XF2A 1NUFA 4Z7UE 4XMPL 3FCTB 2HMIC 4JM2F 1B9ZA 3VE0A 3DX7B 5INDA 5T5FL 2JIXA 5BMFL 1MF2H 1YEEH 3MOBH 2WBKA 2IBGA 4WUUA 1RULH 1Q9OA 4XX1E 5LBSL 1MAMH 4H25A 5FO9B 4WFFD 2UZYB 4KI5D 3IXAB 4KGLA 5H35A 1XFPA 3MX0A 5JMRA 1HWGB 5EU6A 4H0GA 5F7KC 2EDEA 4B0MM 3O8XA 5E8NA 3TT1H 4PJIB 3EYVA 1L7IL 2YD6A 3Q1SH 2N56A 4DN3H 3VXOB 3C6LD 4KI1A 3RKDD 2DI9A 1WTLA 4NKOB 4QXUH 4WFHD 3KPQB 1B6UA 3AY4C 5C8JB 5MENB 2E6QA 3FZUC 1UXSB 3TCLA 5T1LD 4HX1A 5FECB 3N9GH 5KZCD 3ZDZF 4EDWL 1DVFB 1FAIL 4XNZC 1LO2H 4OGZA 2A73B 2FSEB 4OM0H 2ADGB 4OUUB 2G75B 1JFQH 3I02B 3NOIA 3VDAA 1D5ZB 2Z0BA 1L0XA 2YR3A 3WUWB 1U8IB 1ZKAA 1JRHL 2E7LA 4M6MH 4NPYB 5I1GH 3ARGA 2A83B 1EZVX 2FGZA 2R1WB 4YFEA 1EFQA 1MNUH 4HKZA 4MB5A 4NUGL 5F1IB 1GGTA 1G9EA 2PO6D 4LLVA 4WEBH 3M8OL 1II4E 3NCFB 1G6RA 2XICA 4P5TA 3PWLA 2C7UB 2ICWI 3KJ6L 1ZLWH 4H1LG 4R4FH 4JDTL 2NX5B 3PABB 5KSBF 1FO0L 1A4KA 1DBKL 2X4TA 2PXYD 3N85H 4CADA 2FIRT 1P2CA 5E6ZA 2VLKD 4PLOB 5A2FA 5I18H 1KTRL 3DX8B 3LKRA 2YHGA 3DX9B 4PJFF 4DAGL 4OZGA 4M1CC 2BX5A 1P9MA 4F3FA 1FG2A 2Y36L 3O6LL 5FAAA 4FFEX 2YA1A 4K23H 4NQDE 3GKZA 3KJ4C 1ZGLB 2BNQB 3WKML 3WS3A 1MWAA 1ROWA 5EUOB 3IJHB 1X44A 4JKMA 2GYSA 1E4KA 4OQTL 4GO6B 4XH2A 4WO4D 1A0QH 2ICCA 3VXSA 2P24B 1U8PA 2VABB 3JVGA 2QSQA 4QHKJ 2NW2A 3SKJH 4OB5L 2YPKB 3A6CL 1P7QD 2YSSA 1KB5A 3H7BB 3MJGX 1G9NH 5L9DH 3PWPE 3E2HA 2VAAB 3M17B 2K7QA 2EIDA 3LEYL 5CSZB 3SDAA 3HE7B 4GKNB 1NEZB 5TDNB 2QKIB 5SWZB 3GMLA 3QFDA 5FA4B 3TZVC 1MJJB 1IAOB 2XQYG 1VENA 1CL7H 1EVUA 4X8JA 1SHMA 4QF1B 3CXDL 1CQYA 3OKNA 5JA8B 1FORL 1I85A 5DZLA 2QQKH 1FO0B 1GVIA 5DDHA 2R56L 3MXVL 4P2QA 4ODVH 1WISA 3CMGA 4LASL 5E8DH 5TDPB 2VLJB 3MRHA 4PRAA 4X6DA 2IQ9L 5MEPB 1TQBC 3TWCL 4FQQA 4J8RA 4ELMB 1QFWI 2Q6WA 3IKCB 4GMTL 4PRPD 1LO4L 4WW2F 2QTEA 4BQBA 4FABL 4MQXD 1UENA 4OLXH 4N8VB 2ID5A 3O2DL 4PJHB 2C3XA 3IS0X 5KVDH 1A14L 1EXUB 3QNZB 4NRYB 1FJ1B 1ZE3C 2BVPB 1FPTH 5AYUL 2VXSH 3WHE0 3ULUH 1RK1B 3CUPA 1SEQH 4GRLB 4RFEB 1S3KH 2MKLC 5B4MD 2JJTC 2AXFB 3SO3B 4K7FB 1UB5A 1BWWA 2OSLA 3HUJE 4NO0D 4K07A 1GCFA 4HIIB 3UPAA 2E27H 3V5DB 2JJSC 1KCSH 4OZIB 4X98A 4ZSOB 3MV8D 4NNYA 4JKPL 4JZJC 1N3NB 5CZXD 3VXRA 4NQDD 5HHVH 4ZD3H 5C86A 1B0WA 4FTVB 4FQ1H 2XWTB 2HN7A 5D71L 4F58H 1KCRH 1SJVA 4NWUL 5F96L 5GGUB 1MCKA 1FH5L 5C09B 3W82A 4YK4C 1IC4L 3HAEB 3QUYC 4PJ8B 1BQLH 4LPVA 2DWEB 1C5BH 2W9EL 1JZ4A 3GHBL 4K3DL 3C87A 1LEGB 3DOSA 1ED3B 4JFXB 3GMMB 3WBDA 1C5CH 5EC1B 2HTKD 5EU5B 3IU3A 1NL0L 1KPRB 1UWEH 2GTWA 3GDBA 3KWWA 4HF5H 4F7TA 1CK0L 4J1UA 3FL7A 1H8NA 3E0GA 5JLZB 5T5NG 1PLGL 3ARUA 4FQLL 1YN6B 4TTDC 1XR8A 4PB9L 3ZL4L 3HI1A 1G7JB 3MC0A 4QHMA 5CIPA 3QQ9D 4LCWA 4AEIH 4RGMB 1MCWW 3IDJB 1HNFA 5L7XH 1UM4H 3QNYA 4DKFH 3MREA 4IMKA 3L9RB 1U8QA 1KC5L 5DD0L 4M8QB 5IVZB 5L2JB 2Q7YB 1NKOA 5D1ZD 2WANA 3OJDA 3OXSA 3ULUD 4MQ7B 1PVHA 4NN7B 43CAB 2BVQA 4PRHD 4MD0A 1BECA 2IQAB 1WAAF 4Y2OA 4MCYA 1D6EA 4Z6AT 1OGAB 2BC4B 3EYUL 2XTJE 3ELAT 1IAKB 1JWSB 3H9HA 5KVEH 5D6CA 2P5WB 3N0PB 4JM4H 1T0PB 3HE6C 5F88B 3CK0L 3RA7L 1LO0L 4IHOA 4AEFA 3O41A 4PJAA 2O61B 4YHKH 1E4XL 5ENWB 3FFCE 2J8OA 1OT1A 4H26B 3VRJB 1S5IL 5J13C 4MJIE 2NY2B 2OK0L 4RMTA 2BY0A 4JFYB 4LSTL 5AG9A 4FQXA 4KV5E 4G8GA 5K9QI 3OJVC 5CWSB 2PW1B 4JY4B 4PGEB 1BFTA 3FQUB 3IFLH 1CN4A 1M71A 1CS6A 4LCCB 3THML 1MHHB 1S9KC 1FGNH 3T4AA 1HOCB 3IU4H 4QNPE 4NOFA 1JGDB 4U1MA 4AH2A 3FQNA 2X6MA 4WW2A 5JW4N 2OR9H 3PJSB 3C6LA 2FO4B 3S4SB 4HS8H 5GS0C 4NHCH 4HWBA 2AVGA 3QA3B 4YHML 5IHBA 1JWMA 4Y19D 5FHAH 5C08B 4R90L 4WRLA 3SDXF 3MCKB 4JEGB 4LGRB 4U1HB 5L2KB 2HT3C 2X44D 3TN0D 5T1LA 1SJHA 5BZDA 5DUPH 1KNOA 1F4AA 2G9HB 2XY1A 2AGJH 2UZIL 4PY7B 4MNHA 1AP2B 5IW6B 2GQHA 3U1SH 4C54A 5ANMA 3TP4A 4YO0A 5L0QC 4IDJH 3WIFB 1RHFA 3H9SE 3B3IB 3GI9H 2HT2C 4JRYE 4XGZB 5DEGA 3F7YA 4NO5A 5D7IB 4IRSA 1J1OH 1V3MA 3C60C 5JXED 2HKFH 3LPFA 3CDGA 4HK0A 5T1KA 2XRAH 1NGWA 1NCDH 4KH2A 3PP3K 2HLAA 1YEFL 1ZT4A 3CCHB 4HQQL 4HIJB 3P4NB 1FVCA 1CF8L 2HRLA 3GMNB 2A9NL 4P5KA 3UYRH 5F3HA 2O26U 3VGDA 1GJIA 5BQ7A 4UB0H 1CIUA 3WIHA 4NHUE 4Q6IA 1HCVA 3KS0J 2NY3C 4JRXE 3DYOA 1A9BA 3HCVA 4NDMA 1JGLH 1YJDH 3E6HA 2LAAA 5DQDL 1F5WA 3ARFA 2P42B 1I9JH 5FYJU 4NQCA 1IEAB 5EZIL 1W0WA 2XTJD 2EIZA 4ZPVA 2GY5A 3D85D 5EBLB 5CBAA 4HFWB 2CGRL 1AD0B 3CFCL 1IMHC 3MRFA 4Z7UA 1MSPA 4LHUD 1KV3A 1HH9B 2JTDA 2VZ3A 3G6AA 4OF0A 3S35X 3FFCD 5FYKL 3G6DH 2XQYK 4YZFF 3KHOA 5KAQF 5AZ2L 1XF3B 2P4AB 3OTTA 3JWOC 2ZKHH 1EIBA 1UH2A 2BFVH 2GSIB 1FGVL 3ARYA 2A1WH 4KHXH 4WEUD 3NCBB 3WNNA 1A3RL 4XP4L 4W4OC 1P7QA 4PJGB 2BCKB 4P4KC 5FCUL 3WSQH 1BD2E 5ESQB 2CIIB 4XCNA 3X3GH 1LVEA 1F02I 4J3XA 4X80H 1PD6A 4BQ9A 2B39A 1G0DA 1Q9WB 1S7UB 5JW4M 2DS4A 2NY5H 2WLYA 4XBEH 1NC2D 1T22B 4N68A 3VFMA 3GEWB 4M93B 2VXQH 3VXNA 3B9AA 4XPGH 3K8LA 4XWOD 3MLWH 3UTTD 1I1CA 2EDYA 2EDOA 3BIBX 3IDUA 4G7YH 3G5VA 5TH2B 3U6RB 3V4VH 1QFPA 4P9MH 4FQHA 3MJ8A 5IB4B 4P46C 2XT1B 2E6PA 4JRYD 4XWGL 4L9LA 5JOFA 1ETZA 3ZTNH 1QSEB 5E5RB 3FO2B 1X5IA 3MOQA 3CVIL 2A6JA 2IADB 5CSBA 3UTPE 1YQVL 2F53E 2YBRA 4LSPL 3FN0H 1JYVA 1N8ZA 1YPZF 1INEL 1AE6H 1SBSL 3RL2B 5CEXA 1OGTA 5F6IB 3WXWL 1T20A 1D6VL 4OZFG 4BKLB 5HI4C 4KTEH 1XGQA 4B7IA 2KBGA 1FDLH 1K8DB 5IVXF 1F8TL 3BKYH 3TBYA 4PJ5B 1TXKA 1QO3A 1T66C 4NC1E 1CE6A 4HUXB 4JFOB 1CZ8L 3F7PC 5E6IC 2BVYA 4M61A 2GFBB 5T3XD 4D8PB 5DI8A 4N8CL 3NABH 4B53A 1DR9A 1VFUA 5BV7H 5IESH 2LV4A 3BW9A 1I7RB 4OM1H 3NCJL 3IFOA 3KPOA 4PTTB 1K4DA 1BVKB 2F54B 3TFKD 5FGBC 2WV3A 5I1DA 4Q9RH 4DOHB 3W9EB 2A0LC 2V2WA 3HNSH 4X7DC 2DQDL 3GUTB 3DPBA 3RUGB 2FD6L 4TUOA 3UX9B 3MSPA 2ERJB 4KK5D 4OLVL 3MLUL 4WCYH 5DK2A 4AM0B 3HZKB 1DVFD 1WC7B 4LBEB 5J0BA 1KG0B 5CD5D 1XR9A 4S2SA 3BT2H 4YFLI 4XMLL 1J0YA 1NCUA 1ZANL 1JN6A 3MV9E 2D7NA 5EDXA 3KYNB 4P48A 1MEXH 1FZJA 1KJ2B 5T3ZH 4Z7WE 5A16B 3PWPA 5IQ7H 3FT2A 5FOBB 3EOYG 5FUCE 3BZ4A 1SYVB 4DUWA 3EYSL 3VGHA 2CJUL 2ITCB 4BK5A 1X6NA 2AJSH 5DHVH 3HLAB 1VGKA 5E00A 3NCYS 4JFEE 4HGMA 4TUKL 3T0EB 4Y5VA 2BERA 3RTQC 1G7LB 2UWEF 4PGDA 3FOMB 4JHWH 2XTLA 5IG7A 2DLIA 5EO9B 1X5XA 4MA1C 1J1XH 2XFXB 4JANA 1IC1A 3EYFB 1RZ8A 5GRUH 3SGKA 2FEDD 3MV7E 1EGJL 2D4FA 1QR1A 3UTPD 4ZS7L 4G6KL 3CAFA 1S7VA 1T04B 1MUJA 1OB1B 1A7PL 4U6VL 5HYQB 2RBLA 3P30L 1RZFL 5ERWA 3GJEB 3FAWA 1UACL 5E2VL 2VZSA 2IGFH 2UUDH 2QV2A 3CLFL 1M7DB 2HVJA 4BZ2L 5ID0B 3R8QA 1U2CA 4NZRH 1MFNA 4JHZA 4XAKE 5D93C 4E5XA 3ULSB 1KPUB 5DURB 3PL6A 4MS8A 1H3TA 1AGCA 3P4MB 5LVEA 3O3BB 4M6AA 3I6KB 4P3WA 3BPNB 2VDQL 3NACL 1RQ5A 3VMOA 1FIGH 3HUJA 4RWYH 3WL9B 2YD7A 2AJXH 5T3ZD 2HG5B 4YXLH 4KAQH 4K8RL 2EYTA 1CR9H 5K33A 1MI5E 4E41E 1AR1D 1Q72L 5F7LB 3HE7D 4NRZA 3NZHH 2DDQH 2XN9E 5SWZD 3JTCA 3LDBC 2YN3A 4Y5XB 1OSPH 1F6AA 2WP3O 3DBXB 5I76A 2VQUA 4LAQH 2OXHA 2W9DL 4OCMC 4MQTB 3IAPA 1HQRA 3HAEH 4DW2H 5D7JD 5I17A 4WDIB 3MO1A 4EUPH 4R0LA 4LGSB 3GMOA 3SKUD 1NAML 1WCBA 2R9HC 3L95B 3QRGL 15C8H 5F1OB 4U7KA 1HYSD 2VLJD 1KUMA 5DD6A 2CK2A 1A47A 3O11A 1NGZB 4QHNA 1U8HB 4H8WL 1VEPA 2FBJL 4QXTA 3KPTA 3WNKA 1U8LA 1EEUA 3BUTA 3LIZL 3O81A 4PLNC 3HNTH 4H20L 2WIIA 1SEBA 4LU5L 4D9QE 1C08B 3DHMA 3D9AH 5KW9L 3MBEC 3V7AE 4LIQL 5CJQH 2CLRB 4JY5H 3TBWA 1CXFA 1YDPB 5C0GA 3IDGB 3IJYB 3PQYB 3JXAA 5JIIA 5ICXA 1Y0LB 2UVEA 4JZNA 5JQ6L 4PBXA 1YMMB 3S37H 1QPXA 3D48R 1ODAA 1RU9L 2E6JA 2UV3A 4AG4H 2MPAH 3PHSA 5C0FA 3K3QA 5KJRH 4GRLD 1BZ9A 5FA3B 4WI7A 1J9CT 5BVJB 1OARH 5E2WH 4XNXL 1FBIL 1EK3A 3SDDB 2YD3A 5IJVA 2CLVB 3MRMA 2ZPKH 3KPMB 3TYGL 5L8LB 1IARB 3FO0L 4YDVB 4JJ5A 3ROLB 1ERNA 2ZUTA 3FFCA 1T4KB 4XBGA 4YXHL 2DM3A 4MJIA 1DBMH 4YC2B 3IDNB 2DMCA 3BP5B 2R2BA 4DGYL 3EGSA 5ACZB 3SCMB 4D9RE 3CLEH 5FOJA 1EMTL 4YX2H 4WWKC 2EYSA 1AI1H 3D25B 4XCYB 5IHLB 1RUPH 4XNMA 4G9FE 2GJ6E 2VWEC 4KUCD 1G7PB 1SJEB 5ELIA 4W6XB 2W0FB 3SGDI 5HHXL 4KJQC 4MJ2A 1XH3A 4BM7A 2D31B 1S9YA 1R0AH 3QEQE 4ZTPL 4BFGA 3SDCB 5DJ8B 4L3AA 3OHXB 1IGMH 2FHBA 1NCBL 5BOZG 5C0DB 3DHJA 4HG4J 4R6UA 1MI5D 2LU4A 4YQXL 1UKTA 1A1OA 1V3JA 2Z91B 4PJEB 5CBEA 2AJ3A 3GGWA 5DR5H 5I15H 4MXWH 5IB1B 2M8XA 1QKZH 4YHNB 4S0TD 4OGYL 5GGVY 4GKSB 4ODXA 2R69H 2ZUYA 4M6NH 3UP1A 1BOYA 4LP5A 4DZ8B 4TQEH 5F9OH 3H9SA 5D1QB 2R1YB 5FDWB 5I1JH 43C9B 5HGAA 3O9WB 4A2MA 1PDKA 4QYOB 5IBLD 5DJ2A 4MMZC 1I8KA 4UDTA 2O5ZH 1IRAY 3B2VH 2MCPL 4P9HL 1KT2B 3W39A 2W0LA 4M48H 2P5WD 3IFPA 1DP0A 1T5WB 2VKWA 3BH9B 4GW4A 2WBJD 4JQIH 4M5YL 3V5HA 2Q8AL 4D9QD 2NY2D 5K9QG 4QOKE 4IRJA 5KG9A 3SGEH 4OIIH 1NCAL 2BJMH 4L5FL 5DO2C 3ULVH 3CZFA 4NHUA 4PTUB 3LQAC 4JRXA 1ZT7B 4OGXH 1AGFB 1MFBH 3BKML 3QHFH 1AQDB 1LNUB 3B5TA 1UADC 4XNUH 3TPKA 3U2SA 2V5SA 1WZMA 3VXMB 5C7XL 2WW8A 3X12A 3GSXA 4JCMA 1F4YL 2ZUSA 4X7CC 1FV1A 4I3RH 5IQ9A 4WGWB 5IKCA 2JJUA 4KZDL 5GRJH 4ODUB 1U8NB 4NP4L 1CDYA 3ARSA 4XXCA 3MGTB 3V6FA 4C4KT 4M7LH 2OL3B 1JF1A 4JPVL 5L2KD 6FABL 2Y5EA 1UVQB 1GAFL 4Z7WF 4N1CA 4J3OC 5D2NE 5EBMA 2NY4C 4C83B 4D9RD 4HH9A 1TFHA 1PG7L 4N1EA 4NFCA 1I1AB 5GSVB 5C3TA 1OPGL 4LVNB 2L4OA 1J1PH 2GJ6D 2ICWB 3E3QC 2FL5A 3BH8B 3LV3A 2H26B 1BD2A 3LEXB 2GCYA 1OSZA 4NWTH 2AKRB 3WKNA 5C6TH 4K3EL 1J05B 3GMPB 4Q2ZA 1MHEA 1NC4A 4PG2A 2M2DA 4YDLC 4YHYB 2JE8A 5CLTA 4HUVB 1O0VA 1FL5A 4U6XA 1FYTE 4WGVB 1DUZA 2WMPA 2CUIA 4JO3L 4UV7L 2MOVA 1T0NB 3VFNA 1QFWL 3KYOA 3TC9A 4UTAL 3ULVD 4OCWL 4WHTB 1AXSB 4KK8D 1CD1B 1QFUH 4HHAA 2PNDA 3L1OL 1AO7E 2OTUB 3MLTA 4N0FA 5L88H 4G8IA 2Q8BH 3JTTA 3L5XL 1RFDH 1R5IB 5IHUL 4MX7A 1QSVA 2F53A 1C5DA 1T0MB 5FGCB 5SWQA 1T5XB 2EH7H 4PV8B 3I75A 4AMKH 4CGTA 5DMIH 4DZBA 1G7MA 1OWRM 5IW3A 3D0LB 2V7HA 1YEJH 1CXEA 1AGEB 3BEVB 1ZGLM 4XX1G 4G8FB 4WHDA 2HJKB 5GSRA 2DQEL 1A1NB 4CJ0A 4E0RA 1IE5A 1ZHKA 3MBXL 3O8XC 1J0ZA 2B4CH 1YEHL 2NYYD 5I1IL 1BX2B 3EFDL 1R3LA 1CCZA 2IBZX 5GGSY 3X13B 3K4DA 4OV5B 4FHBD 4PG9B 4CBPA 4MXVF 1HKFA 1GPOH 2VIRB 1BM3L 3L5HA 4HIHB 1CDIA 1T2QH 4FG6C 5CUSL 3U82B 4ZMAT 1U92A 1N59B 1T7YA 4ELKA 4XNZB 3MGOA 4PIRF 3O6ML 4ODWA 5DHVA 3D2UB 1AGDA 1MFCL 4I2XB 2X9WA 2GUOA 3HB3C 2E7LC 2FX9L 1UWXH 2CDFA 1JPTH 1WCQA 4GMSL 3MNVB 3RDTD 2PR4L 4YE4L 3FRUA 3ARGC 4ZO6A 3C8KA 4YR6B 4LLDA 3PIQA 4LLYB 1MCDA 3LZFH 5ITBH 3RPIA 4J2XA 2PTUA 2HP4A 3MODH 1QSED 3MV9A 1A3LH 4ZAKA 5C07B 3E8UL 1GGIH 1M7XA 4OCSH 3ECBA 2R2CA 2P5EE 4Z7WA 3GHEL 4P5TC 1KJ2H 5CP3A 3O4LB 1AFVL 4WU5A 3MXWL 4OCRH 4IRZH 3EJYD 2HJFB 1CG9A 1JHKL 4PJ5D 4V3DB 4WEMB 1W72H 3BZFB 4JFEA 4M9OA 1HIML 2G2RB 3ZYZA 1XF4B 5IMOA 1RIHL 3P11H 4GLRI 3HR5B 1BVLB 1P9MC 3HI6L 2DQTH 3GIVA 1JCKA 2WBWB 3IAQA 2VZVA 3H0TB 2UVFA 2X4PB 3S34L 3K81A 3KJ4B 3MV7A 1QFOA 1XZ0B 1EEQA 2F54D 4HKBB 1E4KC 3O3EA 1IC5H 2QHLA 3BXNB 3F58L 4WIQA 1CLZL 5GGTL 5JDSA 3JVGC 4RA0C 4DUXA 4LSSH 2DYPA 3I9GH 1S7WA 5A43C 4GAJH 1H5BB 2AK4D 4UT7L 3LKSA 4YHPA 1UCBL 1BPVA 4MVBD 1UQSA 2Q7NA 1MAJA 4EUPA 5AZEH 3V0WH 3RJDA 1MJ7L 3CPLB 5FKAB 4D0BB 4MXQA 3E2HC 5DLML 4AIZB 5GPRA 4PGBA 1PKQE 5HHPA 2HJLB 3GBLA 3EOTH 3SDAC 2WWKT 5IEKB 1BF2A 2AABH 1XCTA 2EDBA 4GRWE 5ICYA 3H42L 3C09C 2ZOKB 3RU8L 2ZZUT 2VYRE 5F9WC 2YPVH 5FO7A 4KZEH 2EYRB 1CIDA 5DSCB 3LVEA 1MI5A 1ADQH 2OXGA 5B3NA 4GQ9L 4E41A 4GAYA 4I1NB 3L3KA 4XXDA 4HMEA 2XN9A 3U46B 1BZ7A 3BHBA 4MA8H 1BZQK 1MRFH 4X5WA 1I85C 2ATPB 1RUAH 1A6PA 1DQJB 3NAAH 2BNUA 1RZKC 3MLZH 2WY3A 1DQLH 3E6FB 3T0ED 4G43B 4OJFH 2AK1H 1F3DJ 2KKQA 3O2VL 3NA9H 3LPWA 1TQBB 3OZ9H 3NH7L 2EXYD 2R2HB 1B0RA 3C08L 5HYJB 4NN5B 4O2FB 5INCB 3SY0B 4J12A 3QFJB 1HILA 1NFIB 3HZYA 4GRWH 5A40E 2CO6B 2NY6D 4KRLB 4OF6A 2P5ED 3U0WH 1G9MC 3DVGB 1GOHA 3LKOA 4G6JH 1TZHA 3H3PH 3RVVD 2FB4H 1CD9B 3DJ9A 1QPPA 1BP3B 1U0QA 1GHFL 4F7MB 2VLMD 5TQ2L 5IROA 3MRQB 5I1EH 1OM3H 1TJGH 1FCGA 4CMMA 5J6GA 4CN1A 2EKSB 1V7NL 2X4UA 5GHWH 5JORA 4KKCC 2BVUA 4EDXA 1MFAH 3JTSB 4HWNA 5JPMA 4NQXB 4UIKH 1YY8A 5BZWB 1JNNL 2DBLH 4ODTH 4I0PA 5CZVH 4KPHL 1KN4L 3P4OA 2FECI 1UJTA 1E0OB 3RJQB 3P2TA 1RUQH 4QHLB 5MEOA 1Z6JT 3Q3GB 3OKYA 2X10A 1OTUD 4P59L 1QVOA 3W0WB 3LSOB 4HEPG 3S35H 2XZCH 5IW1B 1S9WB 2I07B 5DEZA 5GS0L 5IGXH 5C0CB 3DROA 3BX7C 4PDCE 1XGPA 3FO1A 4G9FA 2COQA 2GJ6A 2VZOA 4JLRA 4OTXH 4QRQA 3H9ZA 3QI9A 1HHKB 4HCRL 2ICEB 3RGVD 4OI8A 3WLBB 1CDGA 3KLDA 5DJDA 3VFSB 1HXYB 3RPKA 1ND0B 2JCCE 4IMKC 3QEQA 1A6WL 4EKXA 3VXQA 2IMMA 3OF6A 4Z7QF 1I8LA 3RQ3A 1NDGA 4U0QB 5D6DA 2DQHL 2FX7H 1CU4H 1VFBB 4YFDB 1I9IL 1DUYA 1RZGA 5FM8A 5GGVL 1RZJC 1P5VA 2MMXA 4U1KA 3RL1A 2YWZA 5CJ5A 4OLWH 3PQYD 3I6GB 4FQIL 1A7NL 2H32B 2G5BA 3UYPA 3HE6B 3QHZL 4KI5F 3LRHA 4WHYH 3O6FA 1ZLSH 3DSNA 1CFVH 2ESVB 3MNWB 4XZUA 1SYSA 3EDKA 1KTDB 5J13B 3NIDF 3B9KB 3V6ZA 1MHPH 2ED7A 3SDDD 4RIRB 1X5FA 3P4LA 1D9KD 3JWDC 1H3PH 1IGIH 1RZ7L 3K2UL 3P0YL 2J8UB 4L4JA 1ORSB 4YXKL 3INUH 4XCCH 5EOTA 3RY6A 3VG0H 2MJWA 4B7LA 4QOKA 5DRWA 1EO8L 3WO3B 4PBWD 3C5JB 1HDMA 1SMAA 4O2EB 1P7KB 5F7YC 3DO7A 1IEHA 4WW2C 1K6QH 3C6LC 3GSOB 3GMQB 3RKDC 5F71A 5C0AE 3MUZ1 4ERSL 1T1WB 1IGJB 1LMKA 3KYKL 3IKKA 5GRYA 3RZWA 3VFWA 4LRNL 1CD0A 1YNTB 2IAMB 4JPKL 3HZMB 5K9JL 3VFOA 3BGMB 1A6TB 5KSUB 4LLAA 3ARED 3LN5A 1L7TH 5LGHH 5HHQB 1QLRA 5KVFL 4HC1H 2WINB 3SDCD 4KXZI 4AZ8A 2VMFA 4BQCA 5L0QB 4XCFH 4BH7B 2X4NA 2DJSA 3T09A 4ZO7A 3QJHB 4KUZL 3WJJA 2VDKL 3REVA 1EVTC 1UKSA 1GL4B 5D2NA 4BZ1H 2QR0A 5BRZD 1A6ZB 3RZCA 5F1NA 3C60B 1JZ2A 1OAYL 4IRSC 1P4IL 3STLA 3WNLA 3RVXD 1FNSL 2F74B 4PJBB 5DK0A 2ADFL 2FJGB 3A6BH 5CILL 3RWFB 3VU2A 4OV6F 2D9QB 3O9WD 4I9WD 3MYJB 1CICA 4PJ7F 5HHOB 5KN5B 2OYPA 5EFIB 1B6DA 2WQ8A 1DQDH 4LCUA 3V8OA 3F7RA 4Z76B 2VL5A 4NSKA 1OAXH 1QFHA 3FJTA 5LQBH 1A7OL 4X83A 5CLWA 2FX8L 2NY3B 3MZGB 3LQZB 4XP6L 4Q6IC 1RJYA 1FYTA 4FFZH 2W60B 5F93C 2BSRB 1KEGH 2GIYA 3ARFC 4OZ4A 1EDQA 4FQCL 3HC3L 1YYMH 1CI5A 1A6UL 5CEZL 3B5HA 4OT1L 5IMMA 5J6HA 1AO7A 3MRLA 2EZ0C 2HFGL 1HXMA 4MDIA 4UQ2B 4BELD 4NGHL 2AXGB 1S7SA 2HFEA 3KLHD 5I30H 4JFFE 3QUZA 3H7LA 4JY6B 1BAFL 3CFEB 2Z92A 4U49A 3EAKA 5AAWA 5IM7B 2QADC 4QCIB 2GTZB 3ISWA 2XACC 4MJ5A 3VW3H 5F9DC 2C1OB 1KLUB 3MLSL 3HC4L 2D4DA 2BY3A 4I77H 4EOWL 4XI5D 3WNMA 2WWMD 5C0AD 3P9MB 1I1AD 1BQHA 4FFYL 1NCCL 5DYOA 3KYMB 4ZTOH 1PAMA 4GBXD 1JV5B 1QSFB 2Y6SC 4NKIH 3TNNB 5B21A 2XZZA 3CVHA 1G0YR 2JB6B 2EDDA 1OHQA 3MRRA 4OFKA 4PS4H 4FQJH 1CLOH 1V05A 4EI5A 2GKIA 3UC0H 2PYFA 1ZHLA 4ZFGH 3HG1E 2N7AA 3F5WB 3CIQA 5AUMA 5JHDE 4P46B 4L9LC 3N1GC 4P2RB 2GAZB 4KMTH 3BZDA 2NLJB 3F7VB 3RAJH 4PB0H 4UU9A 3GBMH 5LWYH 3ZYJA 4P23A 3SQOH 2HMID 1IGFL 3B6SA 3HMWH 5FIEA 4G7VH 3WS6C 4GAGL 4WU7A 4PJXE 4NNXB 5EZLA 5C0JB 2P5EA 4R4NC 4GAFB 3FAXA 1DSFL 1QBML 1TTUA 2YMXH 1UJ3A 2AJZA 5E6IB 4IBLT 4R7NB 3H6JA 1T21B 3MLXH 5D9SB 3U0PA 5DJ0A 3TIDA 3T65A 2DBJA 5FHBL 1DLHA 1OQOA 3PF2A 4PJ7A 1FFNA 1CGXA 5IEHB 4NZJA 3VG9B 1PGRB 5JDJA 3DX6A 4J3VA 5DC4B 1IM3B 1ZS8A 2CK0L 5HYEA 5CZXC 3ALPA 1RK0B 1AXTL 5BO1L 3RP1A 1JZ8A 1XIWA 1VPOH 3FZUD 3AAZA 5AD0B 2YZ1A 2BDNL 3MUHL 3MRBB 3K4ZA 3MGAA 5HTSA 5MENE 1UFUA 2FATH 4KTYA 5TDOB 1RSFA 4Z0BL 3I3DA 4L8BB 1EPFA 4HWZA 4ZO8A 1Q0YL 4G3YL 1JPFB 1AD9A 5E4EB 3TO2A 4WNQB 3GO1L 2A6KA 3FTGB 2W9LA 3GRWA 2OI9A 5TF0A 4F37F 3GJFB 2EDQA 3QQ3A 2W65A 1S9XA 4AEHH 4X99B 3CC5B 3FHAA 2RQ8A 4D9LL 1F3DH 5F9JB 3QXAA 2XG5A 1R3KB 3MRNB 4CDHA 1PKQA 5HPMB 1YNLL 1B2WL 4XP9H 1KCUH 1N0XL 3WN5A 2Z35A 1UXWA 1C16B 2R0LL 3BWAA 3TNMB 3KPPB 2BP3A 3PHOB 3O4LD 3RTQB 4Y5VC 1CXHA 1RURH 3RWCA 5IR1B 4MA1B 1GRWA 4RMQA 2Y06L 4I3SH 1T1XB 4S1RL 1CDHA 1DLFL 4JPWL 4KJPC 3CDFA 4XMKL 3SGKC 2R0WL 1TIUA 3OGCA 5HSFA 5D8JH 5JHLH 1FVDA 4OCXH 4OZHF 4M1CD 4U6HB 2VSCA 1JZ5A 4FQPA 5KS9E 4I18A 5ISZB 5IF0A 3LKNB 3OKKA 5GZNC 4KDVA 4MQSB 5IBTL 1ZT1B 3IXTA 4K94L 4BSWB 4PGCA 1P4BL 1N64H 1D9KA 3QDJB 1D5XA 3T77B 3U7WH 1WEJH 1TJHL 2BNQE 1CFNB 5D93B 4LQ1A 5EU7E 1IBGH 5B38G 4JB9L 3ILPA 3ZYOA 2D9CA 4XMPH 3VD5A 3HZVA 3PL6C 4MS8C 2ZCHH 4WW1A 4RAUB 2FEEL 2XNAA 3VFGL 3QUMH 5T5FH 3T2PA 4ZQKB 2G60L 1CVSC 5BMFH 1WFUA 2E7BA 5B22A 1OP9A 1VB9A 4RA3A 5LBSH 4BH8B 1RJCA 4Z7VE 2R39A 1WZ1L 4L4TE 4XTRD 4R3SA 1A02N 1DEDA 5C71A 1X3DA 4PGZA 4Y8DC 3LDBB 1ZGLP 2ARJB 4LNVA 3FQXA 4WI2A 3TZVD 4B41A 1L7IH 5C9JB 1YUHA 3VFPA 4ONGL 1TZIA 3BO8B 3G5XB 4N9OB 2YUWA 4S1QL 1N7ML 1CL7I 4Z0XA 3BWUC 2UY7A 3K7UA 4R0LC 3HRPA 3QDMB 1MLCA 1EFXB 2HFFB 4D0DA 1FAIH 3HFML 3QISA 1M6OB 1E4WH 2WAHA 1YN7A 5FKPB 2EDJA 1D5MA 3RWIA 1EAPB 4UIMB 5HYJD 4LSQH 2GY7B 2OR7A 3AS2A 1IQWH 2Z93A 2CDEA 2F58L 2R0ZL 3DYPA 1E28A 2JCCA 3LAFA 3MBEB 1OWWA 5HHNB 1UZ6E 4BSVB 3OPZL 1EA9C 1GC1C 4F9PA 3FQWA 3L3JA 2DLTA 3HPJA 1KTKE 2CKBB 4NUGH 3IJSB 1WICA 2P8MA 1JK8B 1CD8A 3CGTA 3UAJC 5F6HJ 3X14B 1EHLL 3CNKA 5EB9A 3V4PL 1BLNB 4U6TA 3NTCL 1DBKH 1QEWA 5CMAA 2W92A 5D5MF 2I24N 5HY9A 1T7VA 3FB7A 1RIVH 3T3PF 4HC1A 3T2NL 4JR9H 1KXQE 2MSPA 4DAGH 4JN1L 3IFNL 4X4XB 3I6LE 3CFDB 3LQAL 4NYLA 4WWKB 2BVEA 3QUYD 1J0JA 3STZB 2R1XB 3WKMH 1JHTA 4PRIE 3UPRB 3T4YB 3W0WD 5DJAB 3S88L 1SY6L 1PG7X 1QLFB 4Q58C 1KCVL 2ZJSH 5C0AA 3FT4A 3C5SB 1EEYA 2J6EA 5D72L 1T83A 4HKXA 4KJYB 1K4CA 3UJIL 4TTDD 3DV6B 1HE7A 4MNQB 1U3YA 2H1PL 4GT7A 4FZ8L 3UTQA 4OUOA 3LHPL 1UH4A 3BMWA 1MCIA 5A2LH 1TVBA 1QQDB 4LSUH 5KANI 4AL8L 1LEKA 2VLLA 2DOCA 2QQQA 3ZDYE 1DZBA 2VLRA 4GW5A 1KN2L 4H0IA 1YJDC 5J9PB 4ZOCA 4GSDH 4CVXA 1DTUA 1T7WA 4D3CL 1QRNE 1UM6H 3FHQA 3VFVA 1N4XL 4MCZA 5GRVL 4PR5B 2A9MH 4TUJA 3X3FL 5I1AB 4K3JL 5IBUG 3UZVB 3FQTB 5HGHB 2RFXA 4ZPTB 2VXVH 3QNXA 2YD9A 3HE6D 4HUUB 2CRZA 2FGWL 3S5LB 4JHAH 2R56H 3N1PC 3TBSB 4R7DB 1T03L 2B20A 4MWFB 4IRJC 3BZEA 1DE4B 4PJIF 5ADOL 3MCLL 3I85A 3F12A 4QXWA 4HDIB 1DQMH 5K59F 4LMQE 1LO4H 1YEIH 1AH1A 4LVOC 5T33H 3DVNA 5GISH 4HXAL 5BXFA 4L4VB 3VFTB 5CJOL 1NCNA 2DQFB 1PFCA 4ZG1A 5CEYA 3BPCA 2NY5C 2OTWA 4XXCC 1I8IB 5AYUH 5MP6L 2X4SA 5EU3A 2HT3D 5C08E 3LKPB 1WWAX 4JFFA 4PYGA 2V9QA 2NY4B 1GIGL 3O4OC 1R3JA 4L3CB 3I6LD 1RZIB 3JWOH 1I3UA 2NY7L 3ARQA 3BDYL 1DDHB 1DN0A 3OXRA 7FABH 5CD5C 4CU7A 4TNVK 2HT2D 1VKXB 2ZCLH 2BVOB 1A2YB 1PZ5B 5D1XA 2BSED 1F4HA 1JI2A 4ONOA 4DGVH 3L7FB 3C60D 4W6YB 5KVGL 4TSAH 5JO5A 1UA6L 4UOW1 2W9EH 1QFWM 4HZLA 2E8ZA 4K3DH 1X5JA 4EN3B 2ZUQC 3WJLA 2EDRA 2BY2A 5CGMA 2Q86B 4PG2C 3EHBC 4YDLB 3PGFL 1MJUL 5I66A 5HHOD 1QG3A 1SVZA 2NXYB