1ZVSA

Crystal structure of the first class mhc mamu and tat-tl8 complex
Total Genus 67
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
67
sequence length
278
structure length
278
Chain Sequence
GSHSMKYFYTSMSRPGRGQPRFIAVGYVDDTQFVRFDSDAASQRMEPRAPWVEQEGPEYWDRETRNMKTETQNAPVNLRTLLRYYNQSEAGSHTLQRMVGCDLGPDGRLLRGYEQYAYDGKDYIALNEDLRSWTAADVAAQNTQRKWEAADVAESMRAYLEGQCVEWLPRYLEKGKETLQRTDPPKTHVTHHPVSDHEATLRCWALGFYPAEITLTWQRDGEDQTQDTELVETRPAGDGTFQKWAAVVVPSGEEQRYTCHVQHEGLPKPHTLKWEPHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system
molecule keywords MHC class I antigen
publication title First glimpse of the peptide presentation by rhesus macaque MHC class I: crystal structures of Mamu-A*01 complexed with two immunogenic SIV epitopes and insights into CTL escape.
pubmed rcsb
source organism Macaca mulatta
total genus 67
structure length 278
sequence length 278
chains with identical sequence D
ec nomenclature
pdb deposition date 2005-06-02
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1zvsA02
3.30.500.10 Alpha Beta 2-Layer Sandwich Murine Class I Major Histocompatibility Complex, H2-DB; Chain A, domain 1 MHC class I-like antigen recognition-like 1zvsA01
4Z8FH 4J3UA 2XG5A 1XGUA 3ZE1F 1MAML 1JK8A 5A2FA 3NZHH 1U42A 1I9RL 2O61B 4OM1L 3WN5A 1T0PB 5DD1H 1S7XA 2A6KB 2GUOA 4PJFE 4RDQG 3T1WA 1LDPL 1FL3A 2NTSP 4PGDB 2BMKB 4GAYA 4P9ML 4AM0A 1ZTXH 3G5YB 4JZJA 3CH1B 3UBXA 3FO2A 3WFDH 5CLWA 3QO0A 5KSVA 3MV11 1Q9LB 3KLAA 1S9KC 4I3SL 1RIHH 4OLWH 3LMJH 1YPZF 4HWEH 3MV9D 1MF2L 3VWJC 2BSSA 5J6HA 4S1DD 4EI6A 3MBEB 32C2B 4R4BA 5DMGD 1AGEB 1SEQL 4YBLB 3WHE1 5GRJL 4YXHL 4ZOEA 4CW1B 2ZNXA 3MLPA 3K4AA 5DJ2B 4XMKH 1A6TB 4PJDA 3TGXA 4KK9C 4KJPC 3HC0B 2NY2C 5FECA 1G9EA 2VZ3A 1K6QH 1BBJA 3JV6A 2X9YA 1MCQA 1YUHA 4LDOB 4LIQE 4X6CE 3U1SH 5AEAA 2A2QT 2JB6B 2OXGA 5EC2A 4IOSD 1CIUA 1K4DB 4ZFOL 1OWWA 3IDYB 2X1XR 4K7PH 1SY6L 2J8UA 5DJCA 5D1QB 3BGFB 4J7RA 1BLNB 3WIHH 4ONHA 1CZ8H 1A8JH 2VJXA 5CSBA 2UWEB 1UXSA 3UTTB 1ZKAA 4WFFE 2LFGA 3L5HA 3QG6B 4N0RA 1U8QA 5DZNA 2R9HD 4LSDA 1EHLH 2F19L 4NC1E 1UM4L 3WL9B 2E7MA 3V95A 5KOVC 1NCBL 4PP1D 4YGVB 2A83A 4OCLC 2VR9A 2CIKB 2KQMA 1CGTA 2C1OB 1YQ2A 4S2SB 1FQ9C 3WLBB 4P3CL 2AJXL 4Z95L 2R0WH 4JY4A 5L0QC 1RZKL 2IG2H 3GK8H 4GT7A 2WANA 4U1LB 3OB0K 3BPNB 4BFEA 1IAII 4H1LG 4R96A 4ZTOL 4NHUE 2WIIA 2AXGA 2JJSA 2OX5A 2XN9B 2FYYA 4MAYA 5EOCH 3U30B 2BSTB 2VN4A 1CYGA 3KPQA 3IKKA 1F4AA 3VFRB 2P8LB 3NCBB 1H3XA 4ODTL 4PJIB 2DWEB 3WS3A 2EYSA 2NY5L 1HSAB 4Y19A 4XP5L 3V6ZA 2HN7A 5D72H 1QKZH 4X6DE 1BIIB 3EJYC 1RZJH 5EOCJ 1IZJA 1PSKH 2WMPA 3EFDH 2ICWA 2VXSH 2XY2A 3TBWA 3VGHA 3E6HA 4I77L 5C0IB 1U8LB 1RUQL 4PFEA 4PGEB 3SDCC 4TQEH 4MA1C 3T08A 4M5YL 4XC3L 4NZRH 1GAFL 4QRTA 1FNLA 4QRPD 5CJXC 2XZAH 3ULUC 3CFDB 1AGFB 2Q7NA 4WI7A 1NJ9A 1NBYA 4JZNB 1IEBA 1ZHNA 3SDAC 1UZ6E 3RWCA 1QSVA 2AEWA 3HCVB 5HI5D 2CRYA 3U0TA 2NX5D 3EW3B 4J1UA 1YEDA 1P4LA 1RVFL 4DKAA 4WEMB 2GEEA 5GS0C 4X4YA 3CNKA 4NNXA 1OTUC 1BJ8A 4M8QA 5F72S 3RIAK 5DA0B 5E6IC 3S9DB 1A5FL 3MLUL 4X7FC 5F3BA 5I1EH 2HMID 1RULH 4ODWB 4LU5H 4P9HC 1MAKA 5E6ZA 3MODH 4M61A 4P23D 5IQ9A 4G7VL 3P9MB 4XXCA 1MHEA 1AI1H 4M43L 2A74B 1F4YH 1T2QH 2APXA 3LKSA 1F6AA 4PJCE 4BKLA 2DJ4A 2AJSL 3VXRD 1RURL 5KJRH 3WXWH 1PZUB 1BVLB 1N8ZA 2VWEC 1FGVL 3C8HA 5J7CC 4WJ5A 2CLVB 5I18H 5A3IC 1L7IL 3DX7A 3QQNA 5KN5B 1C7TA 3CDCA 1YECL 2X9XA 3MFFA 1WWBX 4ONFH 4JFEE 4X99A 2Q7YB 3FT2A 4JREC 4F37F 3DMMB 1HH6B 2DTSA 2DMCA 3MNWB 4M62H 1QFWL 4PRNB 1W2KT 3N9GL 1JYWA 1IGJB 2AQ2A 4XCNB 1UWXK 4PTUA 5HYQA 5KAQG 5FB8B 3U4EB 1XGPA 4X0KA 1BD2A 3FO0L 5A40E 1EBPA 4ZUUA 3FO9B 2MWCA 5EZLB 1GVIA 1JHTA 3WUWB 2Z93A 3HZMA 1OPGH 4U33A 3FL7A 1IILE 4PJXE 3V0AC 2R8SH 3QPXH 3TBYB 4J4PA 1WEJH 1B6UA 2GJ6E 2O26U 2Z91B 3OR6A 3RWEA 3WO4B 2OJEA 1CLZH 1JNLL 4ZAKB 3AXLB 4L8SA 4YLQT 1VDGA 4HUWB 2Z35A 3BI9X 1Q72L 1OAQL 3LPGA 1JPGA 3DO3A 4DGIL 3GHEL 3W2DL 3MX0A 3PL6A 5JDJA 2ARWA 5DUPL 1MJJB 3LPFA 2BVOA 2YPLD 2CLRA 2H3NB 4JY5H 2IANE 4UTBH 1VERA 2CKBH 4HKZA 2H41A 3MGTB 2WUBL 1HXYB 2C3VB 3ZL4L 1JN6A 3EYQC 3KPRB 1MI5A 1ORQA 2R4SL 1JTPA 3P77A 4KWUA 4DGYH 4QHKI 4YFLI 5I8CA 1KIRB 2P44B 2X1QA 4LARH 4JR9H 3F5WA 4G5ZL 1FL6B 2NW3A 3QCTH 1D6EA 4ELMB 3PABB 1F6LL 3T3PF 3WIIH 3HUJE 1J0ZA 4QHNB 5D2NA 1PY9A 1N3NB 2EDLA 2IALA 43CAB 2XFXB 5DRZB 4M9PA 1TJIH 2R69H 3OAYK 3HG1A 3NACL 1DP0A 3BOVA 4RFEA 5FHAH 4JHWH 3UX9B 3D18B 4QF1A 4BQBA 5DMIH 3PWNB 4YFDB 4HIIA 2EH8L 4HUMB 3SDDB 4G8EB 2ZCKL 3SGKC 3VXPA 2YD5A 1QR1A 1MNUL 4HUXA 7CGTA 4B7LA 3GI8H 2G5RA 4MHHI 5I30H 1UVQA 1WCQA 1YC7A 5ICZA 1DQLH 3NPZB 1MHCA 2QBWA 1KB5B 1DFBL 3PWUB 1HEZB 2F54B 4KVCH 4WV1B 1D9KA 1YNLH 4I0PC 2QADD 4G6ML 1S9XB 4CL7A 1RJZA 3RBGA 1S7QB 4GBXC 1AJ7H 5D1XB 1ZT4A 3N1QC 3QDGA 5C7XH 5JXAL 3V4VH 5I1HL 2BVEA 3TO4A 4WHTB 4WUKH 5IJKC 1KEMH 4YDJB 2H2PC 4LEOA 3TBTB 1XF5B 1A1MA 2DQIL 2V17H 2B0SL 3OKMA 2EIZA 5I2IA 3KDMB 4N8VA 7FABL 5C0CE 4JHZA 3B83A 3S36H 1XGTB 4YHPB 1MRDH 2XG4A 3W11C 3GBNL 4JRYB 4LKXA 1PAMA 3RWHB 3F65A 5EBLB 4WWKD 4POZC 1U8OB 3QEGL 3NFSL 4R3SA 1T7VA 3BGMA 4JEGB 5IWLC 3KPMB 5DVMA 1NBQA 1A0QH 3CDGB 4MNGA 5DJAB 2W9DH 3RDTA 2Y06L 1FCGA 2P5ED 2UVFA 5D7IA 4JO4L 2VLKB 1C08B 4C4KO 4V1DE 2H26B 3NCYP 2FGZA 4ZFOA 3BP5A 5D7KD 1TMCB 3HE7C 1MCCA 5J06A 5IFAL 1SY6A 4ODXA 4HX1B 1AQKH 1LP9E 5HGAA 3FCTA 4WW2C 1TETH 3D1MC 4EJ1C 4NNYB 2IPTL 1FFRA 1QQDB 3OXRB 4G6AC 1YMMA 4JDTL 3TCXA 3X3FL 1I1AC 5ISZB 4GW4A 4PP2A 1N5AA 5J13B 3VRLF 5EZJA 2OL3B 2EH7L 1G7MB 5I1JH 2UZIL 5TJWK 4M7ZB 2BSRB 4Q58C 4X6BB 4NC0B 3SKJL 5FYKL 5D70L 1FYTA 3A6CH 1IC1A 4M6OL 3NOIA 4PUBH 1I7ZA 3LDBC 3B9KB 5AD0A 5FUOL 1BAFL 3LEXB 2BVQB 4MCYB 4D9QE 1IT9L 5C9JA 2FJGA 3O41A 1KYOK 3BH8A 1KPVA 5I16A 4MVBC 1VFBB 3F58L 2GHWB 2NZIA 5HD8D 3M07A 2V5RA 1FVEA 2HH0L 2B4CH 4EOWH 1OAKL 2VKXA 1T1YB 3MC0A 5D7JB 3O4OC 1W72L 1HZHH 4AMKH 1A4JA 3BDYL 3ZTJG 5TE7L 4OF8A 1N2RB 1U36A 1LP9F 4WFGD 5MEQA 3S4SG 1B9ZA 5IEKB 4XCEB 3L1OH 1G7HB 4XPTH 1HILA 4PJEE 2CLZB 2Y25A 5EU4A 1WGOA 1G0DA 5SWQA 3STLA 3BZ4A 4G8GE 4ODHH 5CP3A 4DCQB 1NUNB 5T3ZL 4MMXC 1VEOA 3WBDA 3C2AH 3EYUL 5EOTA 2M2DA 2OLDA 4M02A 4UUJB 4BFIA 4NBXB 3FFCA 5LGHH 2EDYA 5FYJL 3MRHA 2XT1B 3K2MC 2Z31B 1H9VA 2EZ0D 2X4OB 3MUJA 3OAZH 1A6AB 3OKDB 4XXDB 5SWZA 3FN0H 5M94B 4MNHA 1K2DA 3T77B 1FNGA 4G9FA 4MA8H 3ARGA 3VXNB 5ID0A 3NFPA 3P73B 1HYSD 5EU5A 2WAHA 4KKCC 4Y4KC 1P5UA 4PBWD 1KB5L 2F53B 1S9YA 2DM3A 3L9RB 3NA9H 3QUMB 4C83B 3O6FC 4FOMA 2JKXA 2AK1H 1GZQB 1S7RA 3G9AB 4WFHE 4CNIB 5J1TC 5FHBH 4FQCL 4PGDA 4XPAL 2F8XC 5DGRA 4AEHL 4HGWA 5B21A 5F7LB 1AD9B 3UJJL 1J8HD 1JIBA 3MV8E 1NGPH 5CHNA 1EJOL 4NRXB 3OX8A 3T65A 5BVJA 2OI9C 2IFFH 5DFWH 1OQXA 4YXLL 5JZ7C 5D8JH 3M45A 1U8JB 1FZJA 3RWGA 1GC1C 1V7MH 4JM4H 4KKAD 2ZUVA 4RWYL 1KJMA 4KROB 5DJYA 5EUKB 4LHUB 1A6TA 3NH7L 3D69B 3MRNA 3HC0A 5F7EL 1B6DA 3VA6A 5CZXC 1FC2D 1KJ3H 3AFLA 3QFJD 1LILA 3BEVB 2JB6A 3TBVA 3TPUB 1I7UB 2V5TA 1K4DA 3T4YB 3FRUB 4KQ4H 4CN4A 2ORBL 3UDWA 4I9WE 3CFIC 4NO0A 5CILH 2IWGA 4LGPB 2C4FU 3FQTA 5D1QA 4YHIA 3ZHDA 3L3OB 3TYGH 4XP4L 3MRBB 3UTTA 4YHKL 4ERSH 1JPTL 2BZDA 2IC2A 1G7IB 1J5OL 1BOYA 2A9NL 3CC5A 3G6AA 1B0GB 3C08H 4LMQE 1X5LA 5C09A 3EZ8A 4WWID 1DBML 1L0YA 3ULVC 5D1ZA 1SJHB 1WBYB 4RA3A 1XH3B 4NJ9L 5D2LE 3W0WA 2XZCH 5J8OA 4U1LA 4OD1H 4TOYL 4IRZL 4KTYA 3LKQB 3M8OL 1ITBB 4OLYH 4OD2B 3VFWB 1NGZB 4K2UH 4A6YL 4EUPG 4I48B 2YMXH 3DROB 3JWDL 4YDKL 2JF1A 4OJFH 2Q86A 4LPUA 1X5XA 2KZWA 3IU4L 4J12A 2YA2A 1FRGL 1BVKB 4ETQB 5JQ6H 4TVSa 4IDJH 4AH2A 4KAQL 5I1GL 1BIIA 1JPSH 3LEYH 5HPMB 1IARB 1ITCA 4ZFFB 1K3IA 4FP8L 3BQUD 3KPPA 2CO7B 5A2JH 4Y2DB 5C0IA 3TN0D 1J1XH 1U8HA 1A2YB 2ZOKA 5GRVL 4OGXH 5E03A 1L6ZA 5F6IC 1JMXA 1OSPH 4JZNA 3LIZL 3IFPB 4HULB 3BYYA 3ZDZF 3HCVA 2AJUL 4K8RL 4P46B 4HUVA 2VXUL 5MI0B 2QR0B 2CUHA 1LEKA 3TH2T 3LEVL 4Z7UF 2A6DB 4YGAB 3T0ED 2CMRL 3F62A 3OKNB 4QT5A 5I1IH 3TESA 3PV7A 1K8IB 1E4WH 5LG1A 5FK9B 2O93L 1H5BA 3KHOA 4ODWA 4HXBH 5C0JA 5DD5H 4PJBF 3GNML 4Z7QF 5TF1L 5E8OA 1AGBA 4NKIL 2EKJA 4UILL 4MAUL 3SCMD 5C9KA 4C57C 2A74A 4KKBD 1F90L 4NCC1 5ICXA 2E7BA 1TQBB 2YUZA 1V5JA 2IBZX 2X2YA 3MBED 5ADOH 1KEGL 2MQ0A 3QUML 3GFUA 3FOMB 3LS4L 3FO1A 1BVLA 2ATKB 3RU8H 4KI5D 1XIWA 3MSPA 1CGUA 4WW1B 1TCRA 3G6JE 3E6FB 1A7OL 2DQDH 4F33B 2PF6A 1I3RB 4PP8C 4Z7OF 3PWVA 1MFBL 3BZDA 1AO7B 3MQIA 3MXVH 4PLOB 2QSCL 1A9EA 2Q7YA 3EYOA 1U3JA 5I66A 3QUXA 4WO4C 3GMRA 4PJHE 1QRNB 1U6AL 3MNWA 3VD5A 3GSNH 1ZHKB 1KCUH 2FZ3A 5KTEL 5IIEB 1NLBH 1TXKA 2E6JA 4KK6C 2PYFA 3QDJD 2V2WA 4WY7L 2VDNL 1ZEAH 2ZKHL 4JFZL 3FT3A 3ROLB 5DK0A 5HHOA 3HN3A 3U7YL 5FCSH 5EU7C 5CEYA 4F58L 4NQCE 5INCB 4JLRA 2UY7A 1N7ML 4HC1H 2Z91A 2VAAB 3H9HA 3RI5K 5C70A 3BPLB 4UINL 1RZIB 2BRQA 4L3EA 3Q6GL 1MIMH 3BJ91 4FQ1L 1TZGL 3TCLB 3BW9A 3SJVD 1N59B 1P69B 2C1PB 4P99A 5CIPH 1DZBA 2XN9D 4LASL 3G6JF 4TSBL 1OTSC 4PJGF 1LO2H 3H9SB 3C60C 4RAUB 3QG7H 4L9DA 5CEZD 5SV3A 5DURD 1E4XI 1W72A 4N9GB 1JYXA 2CSPA 4LLYB 4UU9B 3VFOB 4FXKB 4O2CB 4PJ9A 3DJ9A 4PJHF 4XNMB 4KKLC 3DIFA 3EDEA 1UM6L 4IRSB 1NAKH 1URLA 1KIRA 5F93C 4R4NC 3LS5L 1P5VA 1FL6A 4J3TA 5EU3B 1LE9B 1ZANH 3IKCA 3UYPA 4X9GA 4S0UC 1T1XA 1WC7B 4KI1A 3U9UB 43CAA 2X4UA 3P9WB 5DRZA 1H0DB 1EEYB 3QIBD 3EJZC 1JE6A 3SKUD 3ET9F 4LCWE 4FQQB 2QSTA 4HKJA 2XXMB 5IW1B 2IGFL 1EK3A 1UKQA 2HJLB 3ELAT 4R90H 3O3UN 3P0VL 4Y5YC 1O5DT 1BBDL 2ZZUT 3CDYA 4M93B 4O5LH 3WD5H 5KSBF 1YEGL 3QQ3B 4QRRA 1E6JL 1T1ZB 2AERT 4E41E 1KB5A 3IGAB 2M8XA 4NKQB 4FA8A 2A1WL 3PWUA 4LL9A 1OAXL 2F54A 1ES0A 3SO3B 1S7QA 1CR9H 1XAUA 4JQVA 3OGCB 1TVBB 1A6UH 2BNQE 5GIRB 2XACC 3E2HA 3HRPA 5FM5O 1U2HA 3MNZB 3HHRB 4XVUD 4WHTA 5ECJE 3N06B 4IBLT 1G6RB 1IC4L 3N85L 4TN9A 4Z6AT 1HHGA 2AABH 3AM8C 3FB5A 4OFVA 2YZ8A 1D5XB 1F3JB 4P2RB 1XR9A 3HPJA 4GKNA 4Z18A 4G42A 3NPSB 3SOBH 3DMMD 2VO5A 2EKSA 1AGCB 2NY1C 4Z76B 3FB8B 4Z78A 1TPXC 2DYPA 4IOIB 4TSAH 3CSPA 3TLRA 3CDGA 1ZLUH 5E08L 3K46A 5JQHC 2PYEE 2PW2A 3GSUA 5F3HB 1JV5A 2BRRL 1C08A 1GGTA 2VLKA 2H26A 3O9WD 5DLML 2NY5H 1CE6B 5I74B 5L8KB 1TMCA 3AB0C 3B2UD 4FZ8L 4EI5C 1JWSA 4ZAKD 4XNXL 1WIPA 2BSED 4NNYA 4NUGH 2R0LL 4O4YL 1FZKB 4X83A 3NFNA 3HC4H 2VXVL 1S5IH 5ISZA 5JXEC 1HDMB 1HXMB 3H3PH 3SKMA 5IHUL 4XC3H 3B2VH 1JGUL 4F9PC 3DXAE 4KV5E 3LCYA 1G7MA 1FL5B 2W0PA 3TFKA 4MA3A 2PO6A 3NAAH 5AZ2L 4HG4J 4LGRB 4X6BA 4F8QA 3W39B 3QQ9C 1JZ7A 2BXYA 3KPRD 4LSTH 2DDQH 1S3KL 4MCYA 2CIIA 1BVZA 4WUUA 3VD9A 5L2JB 1RZJC 3T0VA 4OZIF 5E9DA 3UTSD 4L4VA 4A6YA 4JGJA 1T7WA 1WZ1L 4PJDE 1PEWA 2EEBA 3EO1B 4JN1H 4NO3B 1IE5A 4RGMC 3BKJH 3MLWH 2QHRL 5C0EA 3L5XL 4OB5L 2B1HH 2OTWA 5HVHB 4PRBB 2DLEA 1RJLB 3MV9A 4OFDA 1T1YA 3DYMA 1DN2A 1CDCA 5D7JA 2J88L 4U7MA 5IR1B 4XP6H 1N2RA 3LRGA 2J8UE 4AT6A 3OKKB 4KRNA 3QIUA 4YZFF 1R3LB 5BZDB 1AFVH 2CLZA 3HE6A 4Y1AA 3SDDD 1INDL 1E27B 2VC2L 3P4OA 1CD8A 4NYLB 1KNOB 4DCQA 5JW5B 1DL7H 3FFDA 1EZVX 3TV3L 2N56A 5DO2C 1C5DA 3LRSB 2CGRH 4N0FA 3O3BB 2I9TB 2VIRB 3PWPB 4F9LC 3RZCA 2Z31A 4O2FA 2X4OA 2C3GA 4FQXA 3C5ZB 4MD4A 2FECI 1A6AA 1YEFL 2AJZB 3OKDA 5D1XD 5KVGH 2Y7QA 3WCYA 4PRIB 2ZSWB 1HHIB 3VXNA 1QLRB 4ZS6C 3P73A 4OZ4A 1NGXA 4MD0B 3VWJB 5CBEB 5ELIA 3EYSH 3GRWL 4MJ6B 5H35A 1P2CB 4UB0H 3IFLL 4Y19E 1GZQA 2BHYA 4JRYD 4Y4HA 2DQHH 1AD9A 3U36A 2CPCA 2NY2B 1QNZL 5DUPH 3RA7L 1G0YR 4KMTL 3DNKA 2DQTL 4NSKA 1G6RL 1FFOB 4LKCB 5EO1B 4LSUL 3FN3A 5C0NC 1NSNL 4C55A 2IPUK 5GHWL 2FNBA 5I8EB 3G6DH 2K7PA 1Q9KB 5JMOC 1G9NL 3PF2A 4TNWF 2EDBA 1F42A 1IM3B 4NNPL 3RVUD 2BVYA 1BWMA 5HGHA 3O3EB 3C5SB 3VI4F 3EYFB 3LHPL 2DBLH 1DJSA 2NLJB 3TEUA 3D69A 3QDMD 4LP5A 2PNDA 5B38G 5FA4B 2W9LA 3QDAA 4TVPE 2WQRA 5IMKB 1FE8L 3PWJA 4YX2L 2LU3A 3BEVA 2FGWH 1CG9B 3T4YA 3FRUA 1JWUA 1XGYH 4XCFH 4G43B 3HI1B 4OBSA 3NIGF 1RZ8B 1I3GH 2MHAA 4GW5A 4NN5B 1INEL 2VDML 3WXVH 2MQ3A 3L3DA 2WWMC 3GEWB 5HY9A 4APQC 2W1NA 4JKPH 5HDQL 3L3JA 3EFFB 2HLAB 4LGSB 3T0AA 4Q9RL 1MEXH 1AE6H 1CS6A 1MJ8L 1B0GA 3KYNB 4DFIA 3MOBH 4LCIL 4KGJA 3MRIA 1J1OH 3E8UL 1YY9D 1EHXA 4LMQI 4NFCA 4EDWL 3D39A 4JFXB 3QO1A 4G6JL 3GSRB 4UT7H 4ONGH 2MJWA 2APWA 1RMFH 1S9VB 3LKQA 2VDKH 5DTFA 3QAZC 3VFWA 3V52L 4MXQA 4JO3L 5F9AC 4JCMA 1FO0H 3SDCB 1BD2E 1RUAL 4L8BA 5E2UL 3QCUH 4RGNC 4GRLB 2P5EE 4HJGB 4HFUL 3SDAB 1EMTH 1CFVH 1T2JA 4MJ5A 3X13B 1RUPH 4S1RH 1BZ9A 1ZT7A 5BV7H 3L7FB 5JHLH 1FDLH 5HPMA 4FFVD 1H3VA 1RK0A 1P7QD 3IXAB 1RHHB 4HHAB 1J86A 5FM8A 1MQKH 5FYLE 3RTQC 2FEEL 2VZVA 4XP9H 4QCIB 4S0SD 5IV2B 2WLZA 2VRAA 3BD5A 4J6RH 3T2QA 3V7AG 3PV6B 4BSVA 1UA6H 4U6VH 3RVWC 3WV0A 4XPFL 1RIVL 2Y07H 1HHHB 3BAEH 3MXWL 4HIXL 3ARXA 2ZUYA 3IFPA 4X4ME 4R0LC 5JOPE 4P46A 3BDBA 1HSBA 3AAZB 2F53D 3HNVL 4U1GC 3TO2B 3VGFA 1MI5E 3V4UL 5HJ3B 2DB8A 2RR3A 5L7XH 3RWDB 3VRJB 2GJZA 1C8PA 1JWMA 1D7FA 5EDXA 1JHLH 3NIFE 3ZKQD 4FQIL 1R3KA 3WJLA 2XNAB 3FB6B 5GGTL 3L7EB 1SM3H 3O8XA 1C16A 4CKVX 4R9HA 5D2NE 4YEFA 4N90E 2OSLA 1BFOA 3BH9B 4JREB 4X80H 1FLRH 2XTLA 4PV9A 1A6WL 2DTML 3SQOH 3HG1E 3ZKSD 1FFPA 4CDHA 2QQNH 3V0VA 1O7VA 1U0QA 5SWSB 1H3PH 1CF8H 4KROD 5C2UB 4WW1A 4LHUD 1T0NB 2WIMA 3PIQA 4KXZH 3TF7A 2NY3C 3I50L 3SE3C 1L0XA 1AO7A 1YEEL 1T1WA 2YPKB 5TFSL 5T1DH 5FO9B 5EC1B 4FQ2L 5T1KB 1CDUA 1TNNA 4LLQB 3QHFL 1ZHKA 4XWGL 5IIEA 4PJ8C 3JV4B 3KPSD 3MLRL 3W9EB 3OV6A 3HNSL 3CFBB 1CICB 5E2TL 4OCYH 3QDGE 3VG9C 5J6GA 3DWTA 4P5TC 4TULL 4QTHB 4YUEL 4LSRL 3NIFF 3PQYB 5DZOA 1ZHBB 3ARQA 4FZEH 3LKNB 2DWDB 3ROOA 3BX7C 4NQEA 1FZMB 3QNZB 3WEXB 4R8WH 1JFMA 2B4CC 5HHMB 3GKWH 1W0WB 2HKFL 3BKML 1UB5A 1RZIA 2QSQA 4PY8J 1M7DA 4GG6A 3ZTNL 3EOTL 1K85A 4XVJL 4Y2OA 1IGYA 3D3VB 5HI4C 2HAZA 1FAKT 1N59A 1NCDL 4KRLB 2DLGA 3C09C 4DVBA 2YXMA 4UV4H 1QSEA 3H9SA 4MNGE 3DHJA 3GBLA 3UYRL 4IM8A 5D7IE 4H1LA 1BOGA 4ZYKB 2Y6SD 3RWIB 5K9JL 2V9QA 1DUZB 2J3SA 15C8L 1EAJA 5F97E 5IVXE 4UU9A 4EUPB 1RZ7L 5TDNB 1HH9B 4TNVK 1KC5H 5GISH 1NANI 5HYSA 5TH2A 3MTRA 4FFZH 4IRSA 5L6YH 1QBBA 4M48H 4UNUA 1UZ8B 2GSGB 3VXUA 3STZB 1YMME 4Y2DD 2VSCA 2XA8H 4YFEA 4LCCC 3RAJL 4ZS7L 3AS2A 2KQNA 4JFDB 1AP2B 3GSQB 3ULUL 1H0DA 1NAMH 5D4QA 3H3KA 3VW3L 1MCPH 1OAUL 2AGJH 2CK0H 4OFYA 3TC9A 2FX9H 3VFGL 2D7PA 5GQBA 3SE4A 1J0KA 1FYTE 2X40A 4UT6L 5IW1A 1QR4A 5GS0L 1R5VA 3DTXA 4BFBD 2QTEA 5C07B 4HWNA 5ALCH 2W0LA 3MLXL 3RNKB 2AEQL 5IB3A 2WUCL 2E27H 5IW6A 1DANU 2VLME 3OJ2C 4P9HL 1CTNA 3MREA 1T20A 3QQ3A 4YBQC 1QLEH 2AI0H 1T1ZA 2QHLA 3GRWA 3DRTB 3IGAA 2XRAH 4KKNA 4AEEA 2UYLB 3PP4H 4EIZC 3RGVA 1JP5A 3LKOB 1QSZA 3P0YL 5AYUH 5IVXF 2D7TL 5GIRA 4GFTB 4FQHB 5C71A 5LBSH 1A1OB 3BIAX 5FUZH 5GGVL 2VLJD 4A2MA 4EN3B 2E6PA 1G6RA 3SE9L 4MAYC 4U1NA 3IFNH 1OGTB 4HPOH 5HHVH 1PG7H 3KYMB 4LF3A 4S10A 1DBMH 4M7LT 4HCRL 2O5ZH 1VFMA 1SJVA 4YDIL 3FFCE 4KHTH 2Y36H 1QRND 1AGCA 4OGAD 5FKPB 1YEKL 3BPCA 1ADQH 5IOPB 2XTJC 2NR6C 4KZEH 1FG2B 1T83A 4IOIA 5SWZE 2Q8AH 3MO1A 4G8FA 1BFVL 1ZA6A 1JFQL 3BPOB 4G9FE 3S37L 3S5LA 1PFCA 4XBEL 5HI3D 4X6CB 4ZDHB 4UDTB 2BJML 1CE6A 4H88H 2DLIA 4I2XA 2D0GA 4EVNA 5E94B 5GZND 2DQGL 5GZOC 3IDMA 3QPQD 5INDB 3UAJC 2HFTA 5FGBA 3OKLB 1G1YA 1CGYA 1Q94A 4WNQB 4NWUH 2IF7A 1IFHL 1DBKL 3K1KC 1V3JA 3UBXI 1IKFH 2XKNA 1GSMA 5CMAB 5AAWA 1A14H 4XMLL 2OZ4H 1ZVHA 3WLWC 3O4OB 3IF1B 1FGNL 4LLAA 4OZFH 3SPVA 5B8CA 4XXCC 5TQ0H 3SDXA 1CTOA 1VENA 2ITCA 4P3WA 3J7HA 5KG9B 3TP4A 5BRZB 2FJHA 4AL8L 4DUXA 5L2JA 4PB9H 1TZHA 4NHUB 2A6JA 1XCTB 4X7CC 3QHZL 4NO3A 1CFNA 3UPRA 3BVNB 2OK0L 5E8PA 4ZODA 1OHQA 2FX7L 2MNUA 1OSZB 3ZYOA 4KK5C 3WFHA 4GKSB 5C0BA 4PRBA 4OLUH 3IDIB 3UJTL 3D9AH 2P49B 2R2HB 2ESVA 3TH4T 2H1PL 2VXQH 4Z0XB 4X6DB 1JRHH 3HR6A 3QXTA 3ARZA 1L6XA 2VZUA 3TJHD 3VU2A 3U9PL 3HTLX 3OKKA 4JRWA 1KTRL 3TT1L 4OUUB 3UTTE 1X7QB 2VZTA 1N5YH 5IMLB 1KLUB 4JFFB 3VXQA 3PWLB 5K59E 4NYLA 3CJJA 5JW5A 1QEWB 5EORH 1KCRL 1R3HB 5A1AA 3Q2CA 3G08A 1BQHG 3LRSA 5C09E 5JW3H 1FNEB 3V5DA 2I9TA 2FD6H 2VIRA 3O6FB 3PWPA 2OJZL 1RJCA 4IHOB 2EDOA 3DVGA 1Z9SA 3P9LA 4ZD3H 4NPYB 4FS0A 3P4MA 4DAGL 3W0WE 1IBGH 1MIEH 5DT1H 2AJZA 5CEXA 1M05B 4OSUH 1UCBL 3BKYH 3MA7A 4CMHC 4IIQB 2G60H 4KI5F 4GAJL 4PRIA 3SDYL 5DJDA 2VUOA 1UEYA 3CUPA 4N1HB 1QLRA 3L5IA 3WFCL 5GGTA 1Z3GH 2YD8A 1B0RB 3TZVC 1CQYA 3VWJA 5IESL 4OLXH 1CL7L 1JPFB 4FTVA 4MS8D 4I3GA 2FO4B 1EEUA 2F9BT 4LEXH 3RVVD 1X5KA 2MSPA 5CJQL 4MA7H 4JG0L 1X6LA 4P2RD 1F6FB 1KJ2L 4UIKL 5EO0A 4MCZA 4PJCB 4LQFL 2K3TA 3DUUA 2OBGA 5E2VH 3O0RH 1Q9OA 1TTUA 1JZ2A 2XYCA 1I1RA 2D31A 3IETB 1S8DB 3IYLW 5DQDL 1PZ5B 2ICWI 1SBSL 2UWEF 1FFOA 4DGVL 4LAQL 1R3IL 2FIKB 1VFAA 5ACLA 1P4BL 4MQXD 4WHYH 4JFEB 5JDSA 2ILLA 1J88A 1D5BB 3CSYB 3FMGH 1AR1D 4XTRC 4GRWF 1IM3A 2R1XA 5IMMB 3C5SA 4F2MB 3EYFA 3VH8A 5C2BL 2GY5A 4RMTA 2NLJA 4GO6B 3LS5H 1CXEA 3FHAA 3QNXB 4PJ7B 3AUVA 3OAZK 3P40A 5LCVL 3D2UD 2LTQB 4K9EH 3F7VB 1ZLSL 4HBQA 4PJXB 3RY5A 1O0VA 2B2XH 4PD4J 4PJIF 4RAHA 3UBXG 3HI1A 3JWNC 1CBVH 1NBVH 5CFHA 1MCHA 3KYKH 4JPKH 2PXYC 3ZSSA 4RRPA 1M7XA 2H2SC 3P0VH 2FBJL 5ALBH 3DV4B 5F7FA 3HRZB 1NGYB 1V05A 1HK6A 1DLFH 4CN6A 3U83A 2OTUB 1FVCB 1UKSA 5HHPB 5FF6B 1ETZA 1NDMB 1U91B 4U3XA 3S35H 2X4NB 2SEBA 3QT2A 3TWCL 3M1BB 1II4E 3O45B 4LLWB 3MYJA 1BQSA 3SGJC 2VDLH 4NQSB 4F7CA 5H2BA 2YUWA 2R15A 5CCKL 3O6LL 1ND0A 2V2TB 5HHOE 1CGSH 5F6IB 5F70A 1RUMH 5CJXA 3GMNB 1OOAA 1M4KA 4HJGA 3SDAA 4RNRA 2YBRA 3Q1SH 5I8OL 4MQ7B 2PETA 3X13A 3CCHB 1BZ7B 3KR3H 3S4SA 5FYKE 5L88H 1T3FB 2IAMD 4QKXB 4BYHA 4DZ8B 3DYPA 3O4LD 4AQOA 4L3EE 5DD6B 2D3VA 4HHAA 5E8DL 1DQJB 2GTZB 1PX4A 1GGCH 3C5ZD 4DK6A 3FT4B 4OCXL 5IGXH 1VGEH 5E6IA 4C56B 2D7NA 2WBJD 1RU9H 1IM9B 1EXUB 3GHBL 4IDLA 3HB3D 4QHUB 3EOBB 3MRMB 5I1CH 1KELH 3ALPA 4U6XB 4JM2D 1VACA 1WZLA 2WLYA 4ORGB 4QLRA 1X5JA 1UB6A 5HJ3A 3ZDXF 4BUGA 1A9BA 3DUHA 1F4XL 5EPMA 5BZWA 2BNRA 4JFQB 4ZG1A 5FEBA 2OR9L 2XNAA 4ELME 2DLFL 1AD0B 1ORSB 1T22B 4X4ZA 1IEHA 3HR5A 4HCRA 1Z9OA 4GMTL 4WEBL 5T3ZE 5JORB 3BH9A 4K7FA 1ZS8B 1GC1L 3PGDB 4WGVB 3BKCH 5FYJE 4N0YH 2LABA 2X4SB 4K3EL 1CXIA 1IQWL 3WSQH 1KOAA 3TBSB 1E6OL 5FO8A 5GRZA 1DLHB 1T0NA 4GG8B 5IEHB 1OARL 5C92A 2QHRH 2E7LE 2CXGA 4OLVL 3CK0L 1L9MA 1DN0B 3UTOA 4QRRE 3TJEH 5IVNA 3ZYJA 4TPRH 2VDOL 1CFSB 4DZBB 4L4TB 1XF2B 1R5WB 2F54E 4LLDB 4UTAH 5DRNB 3ARBC 2HG5B 3WNNA 5B38B 1DEEB 1PD6A 3QUKA 1KG0B 5E99L 2AV7B 1S7SB 2D7OA 1WJ3A 1OAZL 1AKJD 3VXMB 4P5MB 3HFML 5BS0A 1INDH 2YZ1A 3CZFB 3PQYA 3ZYIA 1RIUL 4DQOL 4TTDD 1RUKH 1I8IB 3QNZA 4ELMF 1A47A 1EO8L 5ITBH 5DD3L 1QA9B 2BOCA 5JNYB 3ULVL 1KENH 5ADPL 1J9CT 1W0WA 2W9EH 2AEPL 5C08D 1VKXB 4K55A 2HLFC 5F8RC 4P2OD 3VMPA 1J18A 5BO1L 4TRPH 4HH9A 3L3KA 3GZKA 3U4BL 5BCAA 5DS8B 1BF2A 1WFOA 4QRQA 2YSSB 1WCBB 3V5HA 3SDCD 4YDLC 3KLHD 3VFPA 5JMRA 5DVOA 3E1F1 4F15C 4HLZH 4ZPVA 3AC0A 4GRLD 5F1SA 2VLKE 4ZYKA 3RWIA 4BA8A 2FH8A 4S1SH 4EUPA 1CQKA 1FNSH 1HH9A 4JG1L 2XZQH 5FOBA 2FRGP 5DEZA 5T3XD 2K7QA 1UZ8A 4NP4L 3H9YA 3SGKA 3IDXL 4HWZB 2VSDA 4FFEX 1WSST 3LN5B 4R7NA 5FCUL 3HMXL 5ISZE 1V7NL 1NMCB 2DJUA 4G8GB 4GSDL 2YRLA 4Z7VF 5JA8B 1OGAD 1AP2A 3GSQA 3UO1H 25C8L 5GJSH 2PN5A 3MZTA 4RWHA 4PBXA 4I0PA 4GBXA 2FHBA 3C6SA 4KJQD 4YNYB 4Z0BH 4PS4H 5AWNH 2ZOLB 4W6XB 4WGWB 3CXHJ 1UM5L 4MXWL 5C07A 4WUUE 3WNLA 4L4VE 4ZO6A 3L3GB 3MZGB 4X5WB 2DQEL 3F7PC 1A7PH 3DRTA 4QWWC 3IRPX 5IFHH 3LKOA 4ZO8A 2PTVA 1KJ2A 4YDVB 1R0AL 1Q1JH 1RFDL 5D1ZC 3LKRB 1RJYA 3I6LD 1Q0YL 5DHYA 1K4CB 4Y4FD 3MCKB 1J0YA 4LBEA 4AJ0A 4E42B 5HTSA 5SWSD 1S7TA 1TPXB 4F37K 5MEPA 3QUZD 2I26N 1N0XL 5IWLA 3MV8B 4M7KH 4HJJL 5D9SA 5C6TL 4OAWB 4ZXBD 3RL2A 3IJHA 1KCKA 4U0RC 2MCPL 1JNHA 3EDFA 5I17B 1OGTA 4ZUWB 4Y1AE 1WWCA 5E5MB 3L5JA 1A7QL 4PTTB 3HE7A 2XWBA 4P48A 2GYSA 5DQJA 4CVZB 1TLKA 4WW2A 4EI5B 3RPKA 1HKLL 5T1KD 3W5MA 4Q2ZB 2DIJA 3S37X 5C1MB 5IOPA 3NN8A 1I1AA 3X3GL 2WBKA 3S3PA 3BRFA 1CICD 1X5GA 4P4KD 5J1AA 2ITDB 3RBSA 3HS0B 4J3OC 1GXEA 5CS7A 2EDNA 3KJ4B 1NFDA 4ZDHA 2NNAB 4CVXB 5TPWL 4UDTA 4HS3B 1KCVL 3CFJA 5EU6B 4OZGA 5ETUA 2Y23A 5HHMD 3HPLA 2DN7A 5CZKA 5ERWB 2EIBA 3OG4B 2X42A 3Q6FA 2VE6A 3H3BC 1LMKA 3MACH 3QJHB 4R97C 5KSAC 3D3VD 4WCYL 5K33A 1BFSA 1Q9WA 4D0CB 2R2CA 4MVBA 3FOLB 4QRSB 4YIQB 5F1NA 4LSQL 4RGMB 4WNQA 1PYWA 4ZOCA 3F6IA 5C3LD 1IGIL 4RIRB 5EZIH 1EBAA 4V2BA 3KXFD 5C0RL 4WI5A 4RX4D 3T2NL 1X6NA 4KMQA 3RUGA 4PLJD 2JJWA 5KG9A 5BRZA 2MCG1 5BV7C 4UQ3A 5EO9A 4JQIL 1KFAH 1NEZB 3VGDA 5ACZB 3EHBD 3B43A 3ZE0F 4ZFGL 4X8XA 5F88B 4EDXA 1AXTH 2HTLC 3ZKXB 4GKSA 4Z8FL 2R23A 2WW8A 1NCWH 4XAKD 4JFDD 1ZLUK 3UTPD 3NZHL 1DCLA 4Z0XA 1LEIB 5KBNC 3BN9C 4U05A 4LFHD 3L3IA 1D5MB 3EGSA 3QUXC 5DD1L 1MQ8A 1I9JH 2WP3O 5E70A 1GPOH 4EXKA 4HG4K 4Z77B 2JB5H 3LAFA 3S88H 5GRWA 1ZTXL 4OUUA 3TIDB 3OJDB 5IMLA 4BK5A 4JFFA 3WFDL 5KANI 4PREB 1EAPA 4Y4KA 3KYAA 2BX5A 1QEWA 1QBLH 1RIHL 4OLWL 3LMJL 4HWEL 2R2BA 4DVRH 4AEIH 1E28B 1LO5B 3CLEH 4G6KH 5FYKU 3O6FA 2J8HA 5F9JA 3SO5A 3N50A 4IHOA 3FKUS 1Z6JT 5EBMA 4B7IA 5D5MB 1CVSC 4I1NB 3D85A 4JQXC 3H7LA 1U93A 4XMKL 1PDKA 1M1SA 5TGBB 1UKTA 2OI9A 2CR6A 1B0RA 1DDHB 4JFPB 1K6QL 1NC2A 3QXUA 1B2WH 4EN3D 3SGEI 2FO1A 4OZHF 4UAOB 2FO4A 3M17B 3U1SL 3TVMC 3K8KA 2ZUWA 1CFQB 4K7PL 4RA0C 2KKQA 8FABA 4TYUA 4PJ9C 3WIHL 1S8DA 5DJ0A 4E5XA 1CZ8L 1EH9A 4U1MB 5DFVD 3AY4C 1PZ5A 2GY7B 1F8TH 4LPXA 3VFUB 1EHLL 5F9OH 2W07A 4H26B 2CKBB 1F4HA 1YEHH 3D6GA 4ODVH 3VMOA 4R2GC 4ETYA 1FHGA 3R8BB 4GLRH 2W38A 4QOKA 4R4FH 3QUYA 2R0WL 4JFYB 4PG9B 1H3TA 2HTKD 2IG2L 5IMMA 3GK8L 3JXAA 2UUDH 4JRXA 2NYYC 3ARDB 5DHVA 4WFFD 5EOCL 5EUOF 4MNQB 3ARFD 2JCCB 1BJ1H 1V3MA 4IRJD 1KGCE 1WIUA 4CADB 1NKRA 4BH8B 3MRPB 4I4WB 5E1AA 5D72L 1QKZL 5KZCD 1X4ZA 2GAZB 3QI9B 3QAZB 4X8JA 1QLFA 3MJ9H 1RZJL 3O2WH 1OL0A 1XMWA 2VISB 4JQVC 4JZOA 4NJAH 1PSKL 3C8KB 4QXGH 1IGFH 3EFDL 4U4BA 1BJ1J 4MGXA 1HIMH 2VXSL 3E2HC 4P5KA 1BREA 2NZ9D 1NGYA 3GIVB 4FG6D 4TQEL 3TNMB 3NCJH 5HSFA 4W4NA 4M8VA 4NZRL 2NY6C 2OTUA 1CWVA 1FVDB 2YXFA 1AO7E 5HHPA 3LQZA 5I9QC 5JHDA 3VXSB 4AG4H 2XZAL 2I60H 3RQ3A 1U91A 3SQBA 3VFSB 2D9CA 1V8HA 2X4NA 1E0OB 4JFOA 4UBDD 1MY5A 4NQDB 4HK3N 4GRWH 1KIUA 3M1BA 3MGOA 5K9KB 1J1PH 1DQQB 4LLWA 4Y16B 1I1YB 5DK3A 3RTQB 1OB1B 4MJIB 5DJXB 4PRDA 4WHDA 2CDEB 4UT9H 3HMXA 3BD3A 2N4IA 5I1EL 2ED7A 1RULL 5H94A 4KRPD 4LU5L 4NQEE 3CH8A 3MODL 2EDRA 2AV1B 3CCHA 1AI1L 1N4XH 2JIXA 1F4YL 5CEZH 1T2QL 2DM2A 3KPNB 2ZPKH 3BFOA 4RGOH 3IAGC 1KN4H 4FXGA 1DQJA 5KJRL 1OT2A 3WXWL 3FT4A 1U8NA 3KPSA 4I18C 5L9DH 1U8IA 2X70A 3V6OC 1Y6NR 4ZQKA 1C7SA 4KXZI 5I18L 2XQBH 2BC4B 2X4PB 1U3HD 5DEFB 4AIZA 5JIIA 5HPOA 2I5YH 1HWGB 5HYFA 3EOBA 1QSEE 3H9SE 1R3JB 1C12B 3DX8B 3N1FC 4ONFL 3OG6B 4ORGA 3GB7A 1YJDH 4HAGA 3I6KB 4M62L 5FA3A 5DJZB 1OP3H 2V2XA 2HT4D 2YS4A 2I9LA 4PBVC 4GKZB 4GAFB 3BO8B 4L8DB 5LGJB 5EUOA 4F7MB 5DUMH 1T22A 3BEWB 4G80A 1OPGL 4WO4A 2R8SL 1CIDA 3QPXL 1MWAB 3SHSA 2VL5A 1WEJL 3HZKA 5DMYA 5DUBB 4JFED 4NOBA 1ZHLA 3RIFF 2X4SA 1CLZL 4S1DC 1UXWB 2L7UA 5DMGC 3TBSA 1VPOH 5GS3A 3VG9B 4P5TB 3N1GC 5AZEH 1X5AA 3DUSA 1GYAA 4MJ2A 4JKLA 4P2QB 1CDYA 1TITA 5E5UB 4JANA 1XGUB 5HHXH 4JY5L 4AYFA 4YPGB 4CU7A 4UTBL 2CKBL 1OF2A 3GSVA 2VUYA 2BNUB 2H1PH 1ZOXA 1W0YT 4L4TA 3LD8B 4Q9QH 5DRNA 3CGTA 1S7XB 4MZ3A 2GUOB 1FAIH 2NY0B 4D0DB 3U0WH 2E5EA 5E7FA 4DGYL 4HMDA 5EBWA 1IL1A 4AM0B 4LARL 4F7PA 4P5MA 4JR9L 3C09B 1ZAGA 4JZJB 3UBXB 3FO2B 2JJVA 3QCTL 1T6WA 3C60A 4PJAB 1KUMA 3WIIL 3KLAB 3MRLA 4NT6A 4OGYH 2IAND 1UYWH 2R9HC 4OIBA 4A2LA 3QCVH 2WY3A 2BY3A 1NCNA 2ADJA 5MENA 5J6HB 4EI6B 1VKXA 4PP1C 1TJIL 2R69L 4XPBH 1WFNA 1L9NA 1RZFH 4PRPB 2EEDA 5FHAL 4JHWL 4Z5RA 3PJSA 2ZP0T 5DMIL 5C3TA 1C1EH 1UEMA 1VEPA 1I8MA 5DS8A 4PJDB 1MJUH 1CT8A 2EE9A 4Y4HC 2YSSA 4LCCB 2D7QA 1WCBA 4O2EA 3OB8A 4M5ZH 4U6TA 3BE1H 1BBJB 2GCYB 3JV6B 3VWKA 3GI8L 3B9AA 5I30L 1YUHB 1WTLA 1BQUA 3JTSA 4AIXA 1DQLL 4PR5A 3P4LA 1T5XA 4KVCL 4M6MH 1YNLL 2J8UB 5DJCB 4KPHH 2VAJA 1AJ7L 2NQCA 3VGAC 1OD9A 1MCWM 4Y5YA 1YC8A 4WTXA 5C7XL 1CD1A 3V4VL 1DQDL 2Y5TA 4C56D 2KUTA 1IM9D 4WUKL 3F7QA 1KEML 1NMAH 2V17L 2A83B 3VFMA 1U2CA 5JIHA 2EO1A 3S96A 3PNWA 1KIQA 3S36L 5ILTH 1MRDL 3HC3H 3IFOA 1OWRM 1A4KB 3MRJB 4Z7WB 5E95B 4NBYB 5HI5C 3HLAA 4R96B 1LK3H 4XCCH 2FYYB 4MAYB 3QSKB 1CD9B 3KPQB 4X5WA 2PW1A 1A0QL 2OTPA 3F6LA 2W9DL 5SX4I 3AM8A 5C0BE 4IOFD 1YYMH 3T2PA 2ZUQC 5IM7A 5F89A 2EYSB 4H20H 4YDVA 5C0CD 4Y19B 3QEQB 3V6ZB 2HN7B 2GFBA 3LKRA 4P23C 1MAJA 1AQKL 3VE0B 2XTJB 3MCKA 2FEDD 4E42A 3K74B 1HHJA 2QJDA 3WIHA 1TETL 5JPNA 4YE4H 4P59H 3FQNA 3TBWB 3BWUC 1CXFA 5BMFH 5I17A 4ZUWA 2GSIA 5E5MA 4JHBA 4H5SA 4HUUA 5CAYB 1UH4A 4K9EC 4NKDA 3EYVA 1LQVA 3QB7C 3EO9H 4V1DD 2C7UB 1NBYB 1IEBB 1ZHNB 2MTPA 5I1JL 1X5FA 4EI5A 3PWPE 3BZEB 3A6CL 3U0TB 3OPZH 4PUBL 1P4LB 3LVEA 3Q5OA 4KDWA 1S9WA 1MFNA 4X4YB 1S7VA 5JXEA 3AMKA 4NNXB 4W4OA 3O11A 3QA3A 4PRIE 1QSFB 5KOMC 4KVNH 3HS0A 5HXMA 5IVZA 2Z8SA 4ODSH 5D7LA 3ZZ1A 3TA3A 4YC2C 4CVXA 3WS6C 1I1FA 4FTVE 1A64A 4M61B 2B4CL 1MVUA 4OD3H 4EOWL 5EU6A 5IQ9B 1MHEB 4W81A 2VOTA 4NM8H 1CFBA 3IJSB 3HMWH 3LKSB 1F6AB 3CVIH 3QWOB 1HZHL 4HDIA 4AMKL 3HNTH 2BY0A 4D9QD 5T1LB 3QH3B 4HT1L 4YIQA 5D71L 3L1OL 2CRMA 3QIWD 4WJ5B 4XPTL 1PX3A 1JGDB 1TQCB 1IC7H 3JWOH 5IQ7H 4LVHB 4ODHL 3WJLC 1MCLA 3SGDI 4MS8A 3NCEB 3C2AL 4BUHA 2IH3B 2QLVB 2OL3H 4NZTH 5LGHL 5BVPH 3AGVA 3E3QC 1BP3B 3GJFA 4MLSA 4Y5XC 4WU7B 1A7NH 3FN0L 4PTUB 5HYQB 3MNVA 5CD3B 5F88A 1J11A 5ESAB 4MA8L 4NKMA 4ZUUB 2J2ZA 1DBAH 1JHTB 1BIHA 4G8GD 2P43B 4XRCA 1NMBH 5I1LA 2Z93B 1JHKH 3HZMB 3ALXA 4F9LA 2JJTA 1LEIA 4RMWA 3OR6B 3NA9L 4JM2F 1D5MA 3U48A 2OJEB 4JDVA 2AK1L 4CMHB 1F97A 1UWEH 4XNUH 5FHBL 2B20A 4PY7B 1JPGB 1HINH 2W59A 3OJDA 1NGPL 3TZVB 4PREA 2BVOB 2CLRB 1T6VN 2IFFL 2EDJA 2NY4D 2AXHA 4XZUA 4KTDH 3I3EA 2DMBA 1JN6B 4JVPA 1V7ML 4JM4L 1IKNC 3CSGA 5D5MA 1QFHA 3QJFA 4WFHD 3P77B 1ZLVH 4OM0H 5DVKA 4L1DA 2QADC 2V6HA 4X9IA 1FORH 2Q3ZA 5TGBA 1PJ9A 1TTGA 2HKHH 3F5WB 3MV8D 5F96H 1DDHA 2NW3B 3V6FA 2JK5A 3KYOA 1XR8B 3ULUE 1KJ3L 2DM4A 2IALB 4IMLA 2DQUH 3JVGC 4WEUD 4KQ4L 3HG1B 5CILL 4DFHA 1CFQA 3QWRA 5CLTA 4J2XA 4QF1B 3V9FA 3BP4A 1LEGA 4OZFG 3TYGL 2GW5A 4U1MA 4KHXH 4ERSL 5FAAA 4OF0A 2E9BA 4WWKC 5CIPB 2GK0B 3VXPB 1QR1B 4HUXB 4DEPB 1QRKA 3C08L 1WF5A 4UV7H 1UVQB 1JGVL 2KZ1B 2VLRB 1SYVB 5ICZB 1MHCB 3AROA 4JFYA 2EEAA 4I9WD 6FABH 1RJZB 2XZCL 2E8YA 4OD1L 4JO1H 4APQA 1DTUA 1NC4B 4JB9H 2VWEE 4YFLF 4ZOBA 1ZT4B 4OLYL 4K2UL 5DGQA 1QVOA 5KS9A 4MNQA 2YMXL 4WI8A 1MUJA 4RFNB 5CUSH 1CE1H 1KACB 2BNRE 2JCCA 5SX5H 4OJFL 2P48B 4MDJB 4LEOB 2QKIB 3TT3H 1A1MB 4BH8A 2JELH 4OQTH 3OKMB 2EIZB 1KPUB 2YKLH 2VXTH 4M6NH 5JQ6L 4QGTA 3IRZA 3RGVC 2DJSA 4NN6C 1JPSL 3LEYL 3Q3GA 5I0DA 3MRKA 4MXWH 1TVDA 3F8UB 3C8KA 1YZZA 1I1CA 3ARTA 4R3SB 1F02I 4NC2B 5L8JB 1FIEA 1J1XL 4HGMA 2EXYD 3TNMA 4OGXL 1SVZA 4XHJC 3RDTB 3VXSA 5D7IB 1RPQA 1OSPL 5HD8C 4ZFOB 3S3SA 4HS8H 5K9KA 4ODXB 3RZWA 1DQQA 1G1CA 3BP6A 5HGAB 3FCTB 1OM3H 4DWHA 1OB1A 4PD4K 1JNNH 1RK1A 2CDEA 4N0UB 5I1IL 1YMMB 4PGCB 1I4FA 5ESVA 3EZJB 3ILQD 1HNGA 4OGZA 5BS0E 4GW4B 4PP2B 1E4WL 2BDNH 3PQYE 1SHMA 4GXUM 4HXBL 5FM5M 4LCUA 5EZJB 4LVOC 4R0LA 5DD5L 3RWFB 5D6CA 4MWFA 3G5VB 1FBIH 1L4IA 3UCRA 5HGDA 4L9LC 2GTWA 5ADOL 4WRLA 5AD0B 4WHYG 3RU8L 1MOEA 1J8KA 2VQTA 3F7RA 4GKOA 1AXSA 2FJGB 3O41B 1BQHA 3BH8B 2EZ0C 2ICES 1KPVB 1AKJA 2DQDL 2BHZA 4U49A 2X4PA 1LDSA 3MXVL 3OTTA 3RJDA 1HYSC 3MRFB 3ES6A 4HEME 4F80A 1QO3B 5HYJB 3ZDYE 5B8CC 4Q9CA 3GSNL 3I6KA 2VKWA 4P2OA 1KCUL 5KVFH 3EOAA 4H25B 1N64H 4TNWK 1NLBL 5IB2B 5FIEA 1PBYA 5MEQB 3O3AB 3RY6C 1ZEAL 3BO8A 5LGJA 4HV8A 3LH2H 4PYGA 5A16A 1HILB 3SE3A 1RZGB 5LKNA 3QRGH 3BEWA 5EU4B 5CJOH 4QNPF 3Q0HA 2ZSVB 4XAKE 2F5AH 1O7SA 3KAAA 4HC1L 4U1KA 2VNCA 1ZK9A 1G6VK 3R4DA 3A6OA 3S34L 1EZVY 4PJ8A 1IMHC 3D0VB 3MRHB 1KV3A 2ENYA 1TIUA 1MIML 1YDPA 4P5TA 5C07E 3B5TA 5ID1B 3ARDD 1KJVA 4MNHB 1UJ3A 3ME0A 1FNGB 4HLJA 4G9FB 5ID0B 5L2KB 3NFPB 3SKNA 5EU5B 4YPGA 1LO2L 2YEZA 4NQCD 2K1MA 4ONOA 2BNUA 3QG7L 1M7IB 5CZVH 3CLFH 3Q5YA 1S9YB 3FZUD 4J23A 5GS1C 1DUYA 4D0DA 2VQUA 1S7RB 2E3VA 1KXQE 5EN2B 4EQ2A 3QI9D 3KJ6H 3ZDYF 1JGEA 3GM0A 1NAKL 4HGWB 4H0HB 2LV4A 5IBLD 2B5IC 1MCRA 3FQRB 5C0AA 5CHNB 4PJAA 1ZANL 4F15B 1WFTA 3OX8B 3T65B 5BVJB 2R0KH 3D5OF 4ZUSB 2A9MH 2NTFB 1F5WA 1FZJB 2NXYD 5BJTA 3V4PH 3RWGB 2Z92B 3GMLB 4PRPA 3RX7A 3ZT6A 4NQDD 2VTFA 1WK0A 3TM6A 2HFFA 2Q3AA 1KJMB 4MXVE 2X6MA 5DJYB 4Y16D 2OR7A 3RTQD 4J3WA 2AP2A 3PHQA 4LCCA 4GQ9H 4JHAH 3MRNB 4MJID 1NCTA 4R90L 1MJ7H 2GCYA 3B9DA 5TDPA 4O5LL 2W65A 3WD5L 1JI1A 4M1GH 2FL5A 3WFBH 4FQLH 1FH5H 1NH6A 3TBVB 4HF5H 4N5ED 1AHWC 2ZNWA 4OZGE 4NO0B 3T04D 1MELA 1G0XA 5C6WH 2ICEA 3DI2B 4LCWD 1CR9L 3FQTB 3H8NA 5EIQA 2MPAH 1A6UL 4PJFF 4YHIB 4UNTA 4FRWA 3PHSA 4H0GA 4OCRH 1DQMH 3X17A 3BQUC 5I73C 5F9WB 3N0PB 1CD0A 3CC5B 3S36X 3G6AB 1I8LC 1MRFH 3TN0C 1IGCH 1LD9B 2GT9B 5C09B 4E41D 2AABL 5D1ZB 5JW4Q 4Q7DA 3RUGE 3T4AA 3SOBL 3W0WB 5BRZE 2HWZH 1A4KA 3MRJA 4O9HH 4Z7WA 8CGTA 5LVEA 2BNQD 4U0RB 2OR8A 3K8LA 4TSAL 3T0EC 4OTXH 4B5EA 4K3JH 5HYSG 4W6WB 1KULA 1L7TH 2GQHA 2Q86B 3P30H 5IHZA 2HFGH 5J9PB 3HAEH 2R4RH 1DVFD 4X6CF 4DTGH 3QEQA 4PGBA 3WIFA 4AH2B 5MP6H 3SCMC 3VE0A 4KKBC 4NUGL 3KPPB 5DR5H 2FEEI 3HC4L 3IU3A 4KI5C 5LQBH 1U8HB 1S5IL 3TYFA 2ZOKB 3MBXH 4JFFE 3H3PL 1TVHB 2FR4B 4P2QD 3B2VL 1YPZA 3CXHK 4PLKD 2PYED 3UROR 4IJ3B 3NAAL 2C7UA 1K3ZA 2X1PA 3MJ8A 4XCYB 3EO0B 3BZEA 1OCWH 12E8H 3DBXA 1BGXH 2FHFA 4HUVB 4LSTL 1QHPA 4HLZG 2DDQL 4R97B 5KSAB 2NY0D 4NWTH 1LEKB 3W81A 4MD5A 3GJFH 4OV5B 4NO2A 1CGXA 1HN1A 4QT5B 1JYVA 1QSFA 4AENB 1FO0B 4N8CH 3CIQA 4JN1L 1CVRA 4M3JA 5J12B 1MFEH 1H5BB 5CWSA 3BKJL 5DJ8B 3MLWL 5C0JB 1YN7A 3B8YA 4K71C 1E4KC 3F12B 2B1HL 3DXAD 5E8OB 1AGBB 3MCG1 4I0KA 1AIFA 1I3VA 3OJMB 5ICXB 3IJSA 1C5BH 3QEUA 1A7RH 3QWOA 4XP6L 5TF0A 2E7HA 3FO1B 2HVKA 2ICCA 3LPWA 4X6DF 4OCMC 1XIWB 3DRQA 1DSFH 5T1LA 3QH3A 2R29H 4U6YB 3L3HA 1TCRB 1AFVL 2AK4B 2HT3D 1JGDA 2JJUA 2CRZA 3BPNC 1U8MA 4U1HA 4QTIH 5HDBE 3PWVB 3U30C 1DL7L 1U95A 4QXWA 2IH3A 1A9EB 4MB4A 3EYOB 3UZEA 2CGRL 5I66B 3QUXB 3GMRB 3S5LG 4QOKE 1UZ6F 3RKPA 4KDTC 2IQ9H 2FZ3B 1QFUH 2NPLX 4WU7A 4JRXE 2PYFB 4JO2H 2V2WB 5KVGL 5CD3A 4G59A 1IAIH 4P49A 1YYLH 4PJ7E 5ESAA 3FT3B 1FNAA 1IEAA 5DK0B 5HHOB 1TJHH 4HWUA 2WWKT 5CEYB 4JLRB 4Y89A 4LLMA 3ULVE 3EYSL 1ZVSA 3H9HB 4UB0L 1H8SA 2FHCA 1YJDC 3QIBC 4L3EB 3MV7A 4PJCF 4PY7A 2DQHL 4JPIB 4PIRF 4LPYA 3BW9B 3TZVA 2VLLB 2YPVH 4MAYD 3VGGA 1N6QH 1X4XA 2H32H 4B50A 5I1AA 3TVMB 1KCGC 1DBBH 1M71A 3G6DL 5JHDE 1SQ2N 1W72B 1Y6MR 3GSNA 4Y19D 2HFEB 4LHJB 4OI9A 1PLGH 2FIRT 4PJ9B 1OAYH 2WM0A 3DIFB 3DV6A 4Z7UB 3RPIA 2HP4A 2DBLL 3C6LA 3WHXB 1EFXB 1KSRA 1XR8A 3IKCB 1P84J 5GXBB 1T1XB 1GCFA 4PJBB 3U0PA 4R2GB 4HC1A 4XVUC 2FGWL 2X4UB 4PJXF 3PGFH 4WENB 5ENWB 1XGYL 5TDOB 4XCFL 2CDFA 4HKJB 1I3GL 2G75A 3WXVL 4ZTPH 1TJGH 4ESKA 5K9QG 1CXHA 3RNQB 2OMBA 4PRHA 3DMMC 4HS6A 2FB4H 5CKGA 4C56E 5CIPA 2GK0A 4JKPL 1T89A 1Y18B 1MEXL 4TVPD 1AE6L 5GGRA 1ULVA 3MOBL 1J1OL 2VLRA 1SYVA 4QRRB 1MLBA 2BOBA 3OF6A 3O9WC 4UT7L 3GBMH 4ONGL 3NTCH 1ES0B 1FN4A 2PXYA 5BW7C 1KT2A 5DA4A 1RMFL 1NC4A 1TNMA 3B2UC 1X3DA 2VDKL 4HSQA 1T0MA 3E2HB 3QXAB 3WO4C 1S78D 4FMKA 4ZAKC 1DQDH 1CXKA 1FO0L 1MY7A 4TTGA 3A6BH 4KJWD 4MDJA 1T7ZA 2QKIA 1WICA 4KY1H 3MV01 3QCUL 4PJ5B 5KSUA 3HUJF 1KPUA 4U0QB 1NAMB 2BY2A 1HHGB 2XWTA 1EMTL 1CFVL 1FLTX 3FB5B 4AK1A 1NFKA 2DIAA 1RUPL 1XR9B 2F8VA 3HPJB 4GKNB 4S1RL 4G42B 5BV7L 4K3DH 3SGJA 1FDLL 5JHLL 4HIHA 2EKSB 4G3YH 3RHWF 5FO7A 3JV5A 3NCMA 2ADFH 4M3KB 2NXZB 1WBZA 5DD0H 4Z78B 3B5HA 1MQKL 4UOW0 5IT2H 2DYPB 4XP9L 2CD0A 5JUEH 5EU7E 1BD2D 4YHNB 4J6RL 4XGZB 3VH8G 1UA6L 4U6VL 2PW2B 5EIVA 4AY0A 3GSUB 3S98A 1JV5B 3R1GH 2Y07L 3BAEL 4FFWC 1YY8A 2XKSA 4J4PD 4L4TE 3RP1A 1FIGL 4I18B 1JWSB 2EO9A 4HFWA 4NCC2 1H3GA 5L7XL 4N0UA 3MCLH 4PGCA 3NFNB 1F11A 5FYLD 2UUDK 4QYOA 1EV2E 3VXME 1JHLL 3PL6D 3SKMB 5JW4R 3U7WH 1SM3L 4RRPG 2FJFA 3RWFA 3SDDC 4MA3B 2PO6B 3G5VA 4X80L 1FLRL 3E0GA 5JOPD 3CMOH 2GJ6A 3SQOL 3VD4A 4QHKJ 2QQNL 4XP1L 1MI5D 1CLOH 5FKAA 1H3PL 2CIIB 4WUUB 1A22B 1CF8L 4WV1C 5E9DB 4L4VB 5T3XH 4A6YB 5D1XC 1GHFH 2QQLH 5C0EB 5KSBB 4P3DA 5F1KC 2OTWB 4EQ3A 3A67H 3MRFA 4N90D 2IANA 3MV9B 5GPRA 3MLZH 2X89A 1QO3A 3QULB 4XTRD 5T1DL 5HYJA 4I5BA 3B6SA 2ADGA 1NGQH 3DX9A 3HG1D 5DRXB 3VXOA 1I8KA 4H25A 4OV6F 4I8DA 4AT6B 5IB2A 3O3AA 5DC9B 4HT1H 3QIUB 4LRIC 1QP1A 5D71H 4OCYL 4NUJA 2F8OA 1RZGA 3HE6B 4Y1AB 5IB5A 2ZSVA 3P4OB 4FZEL 3IAPA 4X9BA 3FFDB 3EAKA 4O02H 5FUCC 3ARBA 1C5DB 4R8WL 4C54A 4N0FB 3GKWL 1XEDA 4DKDC 3D0VA 2VQ1A 2AJYH 3RZCB 4O2FB 1D9KD 1U3YA 4FQXB 4MD4B 2OXHA 3V7AE 3WO3B 1GOHA 3DVNA 5ID1A 3O2VH 3RVUC 1ZSDA 2Y7QB 2K9UA 3QDGD 1F3RB 1XGRA 5L2KA 2APBA 4OZ4B 1NGXB 3QBTB 5CBAA 4YWGH 2D4DA 4QXUH 4OF3A 4BSJA 2A73A 3TO4D 3ULSB 1IC5H 4UV4L 4KUZH 3JWOC 1P1ZA 1CL7I 1M7IA 2LVEA 2FWOA 5H35B 4YQXH 2Q8BH 5GISL 1KC5L 5EN2A 3S7GA 4M7ZC 2P24A 4FFZL 5L6YL 4M48L 1Z2KA 4Y4HB 3MJ6A 3U36B 1QYGH 3FQRA 1OP3K 1KTLA 2ARJQ 4F3FA 2XA8L 4NSKB 4YK4B 1S7UA 3MJ7A 4PJEF 4ZUSA 2OQJB 2NTFA 3RDTD 3P4NA 1NAML 4IEFB 2UZYB 1MCPL 5JR1H 3ISWA 2AGJL 2CK0L 2Z92A 1YY9C 5AAMA 2WZPD 3DPBA 3JZ7A 2FX9L 3GMLA 3KWWB 3VGAB 3JUYA 5HGHB 1JL8A 4OKVA 5M7QA 5ALCL 1A02N 1YMMD 2E27L 3PWJB 5KW9H 5D7LE 2FH6A 4PPTA 1QLEL 2AI0L 2W0FA 5J0BA 2XRAL 1OVZA 5T5NF 1G7QA 5EU6E 1JWUB 2R56H 2W0KA 3LSOA 3PP4L 3WMSA 4ZPTA 1FYTD 3QUYC 2MHAB 4GW5B 2M1KA 5AYUL 1LP9A 2NX5B 4NM4H 1J10A 2YOCA 3L3DB 4FFVC 4MZ2A 5CGTA 4D0BA 3ESVF 1LNUA 5LBSL 5HY9B 5FUZL 1MPAH 3TIEA 1HI6A 1HKFA 3L3JB 5J11C 1CDBA 2A0LD 5FM4A 5B39A 2VLMD 3IFNL 4HPOL 4HK0A 1JGVH 2ZUQB 3MRIB 5HVWA 5HHVL 1LD9A 2GT9A 1PG7L 4HMEA 5DDHB 1R6VA 3D39B 3QO1B 3C9NA 1K8DA 2O5ZL 4KHTL 2Y36L 1KLGA 1WAAE 1T5WB 1KIPB 5DTFB 1ADQL 3QXDA 4MQTB 4KZEL 2Q8AL 4UOJA 4MB5A 5ESQB 1VESA 2XA3A 2NW2A 1NUDA 4L8BB 2HVJA 1TZIA 3NIDE 5J9PA 3UEZA 4MYWB 1NGWA 2RCSH 2Z0BA 4H88L 4MJ5B 2C4XA 3T3ME 1E4JA 4KZDH 1BZ9B 1ZT7B 2DMKA 3FFCD 3HI5H 4JN2B 1RK0B 1IRAY 4HKBB 2XXCB 3WUWG 4LAJH 5SWZD 4KK8D 4NDMA 1ZGLP 4KROC 4YHYC 4YC2B 1TVHA 3EBAA 4NWUL 2FR4A 4G9FD 4XBGA 3ARGD 1A6ZB 3OHXA 4BSVB 1IKFL 1DE4B 3NCYS 1A14L 2OZ4L 4LRNH 4XCYA 3EO0A 3R06A 1HSBB 1A3LH 5TQ0L 5KSAA 4TUOA 2X41A 5D5ME 5D2LF 1WAAF 4Y7MA 4OV5A 4PB9L 4ISVA 4KU1A 4TSCH 2GJZB 4AENA 5JW4N 2DD8H 1FO0A 1JWMB 1S5HB 3U6RA 4XH2B 1LE5A 1R3KB 5DJ8A 1FPTH 3F12A 5D96B 2YPLB 3O8XB 1C16B 4OLUL 3UTQA 1J0IA 5E00A 3D9AL 2OSLB 3DARA 1BFOB 4LIQH 2YA0A 4PV9B 2VXQL 3TNNA 1KPRA 1JRHL 5T5FH 1D6VH 1FFPB 4Y5XB 3V0VB 4GJTB 5F6HI 1LO3H 1GZPB 4U6YA 2B8OT 3H6JA 1CDGA 1MCKA 3PIQB 4FQJH 2AK4A 1N5YL 2X4TA 5E6YA 3BP7A 1FFNA 1F4WH 1T1WB 1SJEB 5EORL 1EO5A 2DKUA 4P4RA 1R5IB 5JW3L 4JKWA 2FD6L 1NDGA 4YR6B 5DYOA 4NO0D 4ZD3L 4XI5D 2Y6SC 4K3HA 4RQQB 2P7TA 3CDFA 1IBGL 1MIEL 1P7KB 4TUJB 5DT1L 4OSUL 5D1QD 1P6AB 3BKYL 3O6MH 3B5GA 2G60L 5EIIA 1MRCH 3CU1A 1T21B 1WQVT 3CXDH 5J6GB 3UTTD 1FZOB 4JDZA 5KS9E 1Z3GL 4MNQE 4OF5A 1CK0H 4EIGB 2JCCE 3LQAH 4OLXL 1TENA 3ROOB 4NQEB 3L5WA 2JTDA 3FONA 3NMEA 4JGMA 4QWWD 4L3CA 5C09D 4LEXL 3S34H 2XOTA 4MA7L 5D1ZD 2F15A 3I02A 4GS7C 1XF3A 4RMVA 1UB5B 1CN4A 1D5ZA 1M7DB 4JQXA 4GG6B 2QADB 2EYRA 5E2VL 1QBAA 3W0WD 3O0RL 1IGYB 4JPIA 4NQXA 4ENED 5B4MD 5MI0C 2VLLA 2ZG1A 4CU6A 3VG0H 4GAGH 4HBCH 4RGNE 4DVBB 1QTYT 3CPLA 2VDPH 3TVMA 3FRPA 1QSEB 1HNFA 1EJ6A 3D48R 2R0ZH 3VXSE 1QFOA 3PUCA 4H1LB 1BOGB 4JFHE 5D93C 1PW3A 2HFEA 3FMGL 5E4EB 4NQDE 3OXSA 3IXTA 5HYSB 3DGGA 4Z7UA 5TH2B 2IH1B 1TQBC 5E2WH 3AY4A 1LO4H 2AJVH 3IDGB 1CU4H 4MJIE 1Z0MA 3VXUB 3WHXA 1EFXA 1F3DH 4JVUA 2FSEB 4K9EL 4OQ1A 4PJBA 3Q48A 5CSZB 3D25B 3VWKC 2B2XL 3MLVH 5ENWA 5TDOA 2YR3A 4BZ1H 2AJ3A 3QFDA 2QL1A 1CBVL 2G2RA 1NBVL 1JF1A 2Q76A 3CFCH 1R5VB 3DTXB 3KYKL 3RNQA 5J89A 1KCLA 4JPKL 3WFEH 4RMQA 1F3DJ 3KLDA 2BCKA 4OGAC 1Y18A 2F74A 5IB3B 5F7NC 5ALBL 2GKIA 3GM8A 5IW6B 2P5WA 4LLUA 4LSSH 3MREB 1T20B 3GSXA 2P4AB 1DLFL 3H42H 1TCMA 5HI3C 3EJJX 5F7YC 3GSOA 1VADB 3RGVB 4NN6B 3S35L 1T03H 2XV6B 1VB9A 3ILPA 4KGLA 1VSCA 3AREA 2I25N 4R26H 5GGVY 2VDLL 3QXAA 3I3DA 4XPHH 1SVCP 1XIWD 2C4FT 1ZLVK 5LAXB 3VFTA 4ZNEE 3QNYA 3QPQC 4U1NB 4UDUB 1CGSL 1RUML 4PJ5A 5IFJA 1MCFA 5FDWA 4LF3B 1NAMA 3Q1SL 2A77H 1KN2H 4KH2A 4XWOD 3AU1A 5EA0H 3RVTD 3N1MC 4HQQH 3KR3L 3W82A 4X7TA 5L88L 5CJBA 3QUXD 2PR4L 3O3DA 5GSRA 1BM3H 1XCQA 2X44D 2RGSA 1BQLH 3BPCB 4PGJA 1GGCL 2OP4H 5IGXL 1VGEL 2Z8WC 3NCFB 3PGCA 3QDHA 3MO1B 4G8FB 1RU9L 1ZA6B 3G6JA 4YHNA 5EG6C 2OYPA 2A6IA 4P2QE 4XGZA 5HHOD 3QZWA 3S5LB 4PJGA 3OAUH 1OP5H 4XNYH 2ERJC 4YHMH 5I1CL 1KELL 4I2XB 4XMPH 1IGMH 5FYKD 4X9HA 1E4XH 1LK2B 1NUFA 2CJUH 1XZ0A 4EVNB 4PJHA 5J57B 4I18A 1YEIH 1MFDH 4L3ED 3IDMB 4DJMA 3V6OA 2F58H 1Q94B 4LLVB 4W4OC 1KB9J 1U3ZA 2DRUA 3KGRA 1H15A 4LNVA 4WI2A 5C0AE 4PJAE 4BQCA 1B4RA 2W60A 2XKNB 3QWQB 4BZYA 4XNQB 3HZVA 4NQVA 3TA3C 4HIEA 5GGQH 5SX5K 4NQCA 1U8KB 4M93C 1C5CH 3PDOA 3SPVB 5B8CB 3BKCL 2J4WH 4N0YL 3SDXB 5ICYB 2ITCB 4PRPE 4X98A 3PDDA 1ADQA 2FJHB 2QEJA 4PJ9D 3WSQL 1TZHB 3KLSA 4F57H 4O51B 5FV2A 1NLDH 3EIFA 4JJ5B 5EWIH 2A6JB 1J8HB 1CFNB 3UPRB 5E8PB 4AZ8A 3K2UH 2BFVH 5KSBA 3WFHB 3I3BA 5C0BB 2ZCLH 4UNVA 3C2SA 2RB8A 5T3ZD 4XBPA 2O5YH 2ESVB 3QULA 3TJEL 4MS8C 4TPRL 4JKMA 2AW2A 5FYJD 1JF5A 1LVEA 5DRXA 4UTAL 5LJYH 2BERA 4PGZA 1P4IH 1N6VA 3RVVC 3O2DA 1LO0H 1WUNT 1A21A 2NY7H 5C0FB 2EYTA 3BRGC 3VXQB 2J5LC 4G8IB 3CVHH 3BHBA 1RUKL 1GGBH 2J6EH 2OZ4A 5ITBL 3BT2H 3QFJB 3G08B 4KV5F 1KENL 4OZFA 5GS1B 4QRRD 3V5DB 1W0VA 2W9EL 2JJTC 2F54D 1KBGH 1JZ3A 4MQXC 3DVGB 3P9LB 1YQVH 1NFIA 3P4MB 4TRPL 5CEXB 1AR1C 1JGLL 3OKOA 1G7JA 3GGWA 3MA7B 4Z7WE 3SKOA 5HHQA 3GI9H 3UXFA 5DJDB 3CUPB 5DWUH 2GIYA 1D5IH 4PJDF 3WNMA 3TH3T 2X7LA 4J3SA 5K93A 3ULSA 4GXVH 3ZE1E 1T04A 1YEJH 4FTVB 1XT5A 2DI9A 4ORZC 4UQ2A 2PUQT 4WDIA 1IGTA 4LDLB 3S3JA 4S1SL 3QEQE 1FNSL 5EO0B 4MCZB 2XZQL 2XTJE 3DUUB 1A6VH 1Q9OB 1SBBA 2J8UF 2OM5A 2D31B 2NXZD 2DYPD 1P7HL 5I75C 4D9LH 2CR3A 2EDKA 2ID5A 3WKMH 4YHOH 4KQ3H 2OQJA 1VFAB 1YPZE 3UO1L 4HJ0D 5SV4A 5GJSL 4BJLA 2VLKD 3IS1X 2PCPA 5JDSB 4BZ2H 2APVA 1GGIH 3KWWA 5MHSD 4R7DB 3EDJA 3BSZH 1MCOH 2R1XB 4Z0BL 4PS4L 5AWNL 3BXNA 1UCTA 3VH8B 4OZIA 4QHLA 3BQUB 5FGSA 5I73B 4OLZL 4M7JH 1QSFE 5T33H 3I75A 3SY0A 3FAWA 5ISZD 5GGUB 1RAMA 4KRMB 1A7PL 1CCZA 1QBMH 2MOVA 3FB7B 4QRPA 5L0QB 2IPUG 3TFKD 1F2XK 2PO6D 1ZA3A 5IFHL 1Q1JL 2W91A 1OW0C 2NX5A 5T1MA 2IAMC 3B9KD 1ED3A 1KXVC 4WUUD 1EEZB 1PG7X 3T0EB 4M7KL 4HWBH 5E9DD 4L4VD 3C5ZC 5J1SC 1G7PA 5HVGB 2WBJC 4QRUA 2XWJA 1AY1H 2GI7A 5DDHA 5AUMA 4X6FB 3DXAA 5F7MC 1RSFA 3HB3C 3INUH 4P23A 3SCMB 5E24E 3C5JA 1ETZB 3UJIH 5GGSB 5D7JD 2SEBB 1T5WA 4JM2C 1KIPA 3U82B 3MYJB 3VXRA 3ERYA 3D87B 4F7CB 3RIFK 5H2BB 1UWGH 5GS2D 3H7BB 4N0CD 4S11A 3QIUD 1ND0B 4MA1B 5IB1A 5ESQA 5LWYH 4NGHH 5I8KH 3HE6D 4Y1AD 3BISA 4RNRB 2YBRB 2COQA 5TQ2H 3I6GA 3DETD 3S4SB 3ZKMD 5C8JA 3K8MA 3T8XA 3GO1H 4NKOB 4K8RD 4JN2A 1RI8A 3I2CH 3X12A 1EO7A 4HKBA 3RZCD 1Z5LA 2Z31D 3MACL 1CFTA 4FQXD 4OCSH 1GGUA 5I15H 3MV7E 4HAFA 5E6IB 1T66C 3QDJB 1EGJH 3WS6A 4M1CD 4K71B 1A6ZA 1ONQA 1DE4A 5EZIL 2PTTB 4D8PB 4Q74A 1FJ1B 2VYRE 3MUHL 4NHCH 1VACB 2YK1L 4GRWB 1FIGH 1UB6B 4H8WH 3FQUB 5KVEH 1KFAL 1A9BB 4Y4HD 5B22A 4LSVH 1FYHB 1S5HA 4ALAH 5EPMB 5CJ8A 4NN5C 1ZT1B 5BZWB 2BNRB 4XH2A 3SJVB 5JPMA 1AXTL 4D3CH 1OTTD 2YPLA 3VFVB 3HR5B 4PB0H 1NCWL 3GMPA 4TTDC 4K7FB 3KG5A 5IHLB 3G9VA 1N26A 3MLSH 5DURB 3E3QA 4F7TA 2C3XA 3IDNA 4Y5XA 2DI7A 4XP1H 1F2QA 1GZPA 1I9JL 1GPOL 3X14A 4P2OC 5FO8B 4PRHE 3S88L 2JB5L 5E56A 4LPCA 3I9GH 4UOW1 4NRZA 4Q6IC 3NZ8A 4BELD 4OT1H 4BQ8A 2YD4A 1CDIA 3OL2A 1QBLL 1SJEA 5F71A 2GITB 5HDOA 1IQDA 3CX5J 3S97C 4DVRL 2RQ8A 4AEIL 3KLHC 2VLRE 1R5IA 2YRZA 5F9DC 3CLEL 4G6KL 3RVXC 2ADIB 1MFCH 4YR6A 3CFKB 1MCJA 4GRLC 5E8EB 4S1QH 3TPKA 3VA2C 3QIBB 4LVNC 4RQQA 3PE9A 3HAEG 3QUKB 2NMSA 4TUJA 1P7KA 2YN5A 1HCVA 1T21A 3JTTA 3REVB 1FZOA 3GJFK 5BS0B 1UJ3C 1JJUA 1ACZA 3V0WH 1B2WL 2BOCB 1TFHA 3ECBB 1IKNA 3D39D 3OSKA 1INQA 2F5BH 4OI7A 4ZFZA 3OKEA 4IS6B 4HH9B 3BDXA 1Y0LB 3L3KB 4KJQC 1JTTA 5J3HD 3ALWA 3R0MA 4MXQD 4QRQB 3U46A 3V5HB 1F8TL 5F9OL 3VFPB 1B0WA 3R8QA 3JVGA 3HI6H 4ZPVB 5HGBA 1VGKA 1YEHL 4W70A 2V9RA 4ODVL 3MMEA 4R4FL 4ZSOA 1UFUA 2D2OA 1MHPH 2HRLA 3VDAA 5FOBB 1PKQB 2IH1A 1K5NA 3IDGA 5L8LB 4WWKA 1ZXQA 2WINA 1YN6A 2LE9A 4Y4FC 5ITFB 4N0UE 3SE8L 4R7NB 5ABDE 3QUZC 2ZJSH 5F1OB 4L4JA 3T3PE 4L29A 4PDCE 2RHEA 2FSEA 4XVTH 4ZXBC 2B1AH 4WU5B 5CSZA 3D25A 3BIBX 2P5EA 3O9WB 2BHUA 4I0PB 1I9IH 4LNRA 4V2CB 2Q87A 5JOFA 4GBXB 2EXWD 3DO7B 4FNLH 4P46D 2O5XH 3C6SB 3VCLA 3MJ9L 3O2WL 4RISH 4UZGA 2HJFB 4NJAL 5DQ9B 4QXGL 1IGFL 5J56B 1HIML 4OKDA 3UZQA 43C9A 2AKRB 3OGOE 4NBZB 4LSPH 3S35X 1CICC 1KGCD 3NCJL 4P4KC 1U41A 2EDTA 3O8XD 1Q0XH 4JPWH 1MCDA 4AG4L 3OMZA 2HT2D 2I60L 3NA4A 1HQ4B 1VADA 4GW1A 5D7IF 3MUGA 3DGCR 1KJ2B 4X4MA 5HYJE 3P11H 4MX7A 1P84K 1S7WA 1WZMA 5I71C 1RJYB 1J1PL 5CGYC 5DHYB 3REWA 5IB4A 4LBEB 3IB4A 1S7TB 1EDQA 5MEPB 3DYOA 1PQZA 4HW6A 5LAXA 5I1KH 4XAWH 3UTSB 5D9SB 3RL2B 4UT9L 3IJHB 5CINH 4KJYA 3DOSA 4Q6YA 1R24A 4UDUA 1JNHB 4DN3L 3BN3B 3ZKND 3UPAA 4M7LH 1AO7D 3HE7B 2XWBB 2DBJA 5DQJB 3PHOB 1N4XL 1GGYA 3K7UA 5CEZL 2I07B 4WW2B 2ZPKL 4RGOL 1KN4L 4PLJC 3NN8B 1BHGA 4U3HA 4AEFA 5L9DL 3BZFA 1I1AB 3LZFH 2FLBT 1CI5A 3DSFH 5E7BA 1NPUA 5J1AB 2LQRA 1NL0H 5L2KE 2MKWA 3EHBC 2XQBL 1NFDB 1I3UA 4Z9KB 4NIKB 2I5YL 4L9LA 1UQSA 4NQED 4HD9A 3U2SA 3CFJB 1IAKA 3AS3A 4OZGB 5ETUB 2YRPA 1LK2A 4HXAH 3HPLB 3LDBB 4XPGH 1YJDL 2DQFA 1U92B 5IKCA 3Q6FB 1NANH 2VE6B 3O2DH 5DJ6A 5E4IA 3OZ9H 4OF7A 4RBPH 1IAIM 4XC1H 1Q9WB 3RKDD 4LLVA 1BX2A 5F1NB 3AS0A 1PYWB 3EOYG 5DUML 4X7SH 1WBXA 4ZOAA 4Z7VB 5I19H 4XNQA 2YD6A 3VRLE 1QSED 3G5XA 3H9SD 1U8KA 4TUKH 5DI8A 4QHMA 4DUVA 4KDVA 3RUGB 5ICYA 3MFGB 2HA1A 5HYEA 2CKNA 4UQ3B 4DW2H 5EO9B 3RY6A 1NCCH 3WJJC 1VPOL 5IBTH 4O51A 4IRSD 4U6HA 4URTB 5IK3B 4JJ5A 1J8HA 5AZEL 3VXUD 4RFOH 4EDXB 4DN4H 3QQ4A 4NCDA 1I7TA 2R23B 3QYCA 5HHXL 4HGKC 3BIKB 1J0HA 4RAVB 2R1YA 3MLYH 4EN3C 2BP3A 3ZO0A 4Q9QL 4OFYD 3L3IB 3EGSB 3QEHA 1FAIL 4RSVA 5IVXA 4XB8A 4L1HA 2IADA 3U0WL 2D03H 4O58H 3GJEB 5C0FA 5DZLA 3V5KA 4YHLH 1KF9B 3QDMB 5C0GA 4G8IA 3B3IB 5F1IA 35C8H 1EAPB 4Y4KB 5DFVC 1MCIA 3LV3A 1WITA 4U1JA 2R2BB 3QFJA 4OGYL 1UYWL 3BPOC 3QCVL 5GS1A 5I76B 5F9JB 3J8F7 4PV8B 4K94H 4XPBL 3RGVD 5EBMB 1MWAH 3MPCA 1RZFL 5FXCH 4M4PA 3SN6N 2V5YA 3D85B 3CFEA 1X5ZA 2HTKC 2ATPA 1C1EL 1DQTA 1U93B 1F58H 1MJUL 4XNZC 2YA1A 2OI9B 2DI8A 4M5ZL 4HPYH 4XHJD 3BE1L 1NC2B 2DOCA 1YNKH 3ARFC 4NZJA 3MLTB 4IRJC 4NC1C 2ZUTA 4K7PY 1DBJH 4I3RH 3VD3A 3L6FA 4M6ML 2V5SA 3QP3A 2I27N 5DMKB 4B41A 4KMLB 2XY1A 4KPHL 8FABB 3G04A 5DJ0B 2J12B 4E5XB 1L8JA 5GJTH 3GMOA 5FGRA 5F21B 1JYNA 1HOCA 3C6LC 4B53A 1ZE3C 2Q1EA 4ELKB 2CQVA 2DQCH 1NMAL 5K59F 1AHWA 3LQAC 3L95B