1ZVSA

Crystal structure of the first class mhc mamu and tat-tl8 complex
Total Genus 67
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
67
sequence length
278
structure length
278
Chain Sequence
b'GSHSMKYFYTSMSRPGRGQPRFIAVGYVDDTQFVRFDSDAASQRMEPRAPWVEQEGPEYWDRETRNMKTETQNAPVNLRTLLRYYNQSEAGSHTLQRMVGCDLGPDGRLLRGYEQYAYDGKDYIALNEDLRSWTAADVAAQNTQRKWEAADVAESMRAYLEGQCVEWLPRYLEKGKETLQRTDPPKTHVTHHPVSDHEATLRCWALGFYPAEITLTWQRDGEDQTQDTELVETRPAGDGTFQKWAAVVVPSGEEQRYTCHVQHEGLPKPHTLKWEPHH'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords MHC class I antigen
molecule tags Immune system
source organism Macaca mulatta
publication title First glimpse of the peptide presentation by rhesus macaque MHC class I: crystal structures of Mamu-A*01 complexed with two immunogenic SIV epitopes and insights into CTL escape.
pubmed rcsb
total genus 67
structure length 278
sequence length 278
chains with identical sequence D
ec nomenclature
pdb deposition date 2005-06-02
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1zvsA02
3.30.500.10 Alpha Beta 2-Layer Sandwich Murine Class I Major Histocompatibility Complex, H2-DB; Chain A, domain 1 MHC class I-like antigen recognition-like 1zvsA01
1F00I 3DVIA 5GRJL 2F58H 4TOYL 1T1XB 5IM7A 4J6RH 4OCWL 1W0VB 1DQDH 4M00A 4LLQB 3MRIB 2BNQD 4OZFH 1FVEA 4U49A 2C9AA 5L7XH 4LARH 3UPAA 2JF1A 1GHFH 12E8L 4N0RA 1KCLA 4TYUA 1HXYA 2VDQL 3DSFL 3EOAB 1IT9H 5MEPA 1R3IH 1G7LA 1CTNA 3D0VB 1U92B 2YMXH 5C0BB 2YPKA 5D1ZA 4X0KB 3IU3A 3KLSA 2F19L 3ZYOA 3X3GH 3QHTC 2EDOA 4X6DE 4ZUUA 3ARFB 4P59L 1BM3H 2C26A 2YD3A 1C16A 3W0WA 1RJCA 1XCTB 1CD1A 1UB5A 4E0RB 5BMFL 2H2SD 5DJXA 5INDB 5C07D 2WBJC 3U0TA 1D7FA 2WQ8A 2BNRD 2W0FA 2EDBA 2NCMA 4GMSL 4X4MA 5MENA 2YPKB 1QFOA 5D1ZB 3CFEA 3CK0L 3HZVA 3JVGA 4JY4A 2GJ6E 2MPAL 4X7EC 4U0QB 4ZSOE 3JWOC 1CXKA 3STLB 3BQUA 2GCYB 4ZOEA 2BY1A 4M7KH 4PJCE 5IKCA 1YYLL 2HN7A 2ESVB 3LKNB 4PRHA 3QDME 2BNRB 4BZ1H 3T65A 2R0WH 1OSZB 2EIDA 2EC8A 1UM5H 1C5DA 4K07A 1T1XA 3GSRB 5DUMH 3PQYE 1MELA 3RNKA 4XWOD 2IALB 1OWWA 5IOPB 2CR3A 3GMQB 4U6HA 4JQIL 4APQC 2X4UA 3QIBB 3PF2A 2N7BA 1LE9A 1OAQH 1F2XK 3MLYL 3VXPA 3KPMA 3VFOA 3IDIA 3HZMA 1X5AA 5IB1B 4M6NH 5GRXG 4P2QE 4WEBH 5GQBA 3OZ9H 2W0FB 4U7SA 1XT5A 5KAQG 1NCAL 4EOWH 2XN9E 2YN3A 4TNWF 2YA2A 4GG6F 2PCPA 2D7MA 3SGEH 2BVPB 4Z8FL 1RZ8B 4RGNE 1EX0A 1P7KB 4G6KL 4LEXH 3OKNB 2V9TA 4HZLB 3O2DL 5SWSD 1TJGL 4JFFA 5ACLA 1DBBL 3QFJB 4XVJH 3LD8B 4WO4D 2C4FT 4Y16D 2OSLA 4PJBA 4PD4K 4QRUA 4G43A 4S1DD 2G60H 1CF8H 3VXQB 3GMQA 4M5YH 1JZ5A 4ZTOH 3G6DH 4JO1L 3GRWL 2WWKT 2ARJB 1VEMA 2J8UE 3BPLB 2EE9A 2AJXH 1JYNA 4XHJC 2N7AA 3QNYB 4TUJB 2GT9B 15C8L 1A9EB 5DYOA 3WDHA 1TVHA 3H42H 1YQVH 2R56L 1U8HB 3CU1A 4KK6C 2Q8AL 3VFGL 1UWXK 2XKNA 4OIIH 5DEGB 5JO5A 3UCRA 4DWHA 3B5TA 1OAXL 2VITB 3S4SG 3D39A 4GW1A 1RUPH 2R0ZH 4M1GH 3WIHA 1NBZB 4L4VD 4FFWC 4WWKA 5EO1B 2YEZB 4J4PC 4NNPL 3MV8E 3CPLA 4OGAC 5F1SA 1F4AA 2KL6A 3VXUA 2IJ0C 1H5BB 1PKOA 4OZFA 3W5MA 1MFDL 4WTZA 1A7OL 3FMGH 3MACH 1HQ4B 2CPCA 5CZKA 3K80A 3CVHL 1WFUA 3K8LA 3W0WB 5BQ7A 4QEGA 4G8GB 2FJFA 2HWZH 1KN2H 2EXWD 2O5ZL 5D71L 4IS6B 2W9DH 5HVFB 3U46B 1GYAA 2ATKA 3FCTA 3VRLF 1JNLH 2HLFC 1SJVA 5GRJH 5LAXB 4WI9A 5GS0L 3QJFB 3KYAA 4LRIC 2MHAB 1H3TA 1DCLA 1JV5B 4PTUB 5DJ8B 2JLLA 3SDAB 3V2AR 5TPWL 2HRPH 3QHZH 4HUUB 4HGWB 3MA7A 4W4NA 12E8H 2DBJA 5IOPA 1YJDH 1F58H 1A4KA 1T5WB 2AQ2A 3HN3A 5FB8B 5E94A 3DSFH 1JP5A 2EDKA 3QUKB 1P7QD 2B1AL 1D5MB 3ULUD 4M1CD 4OSUL 3U6RB 5J11C 1ZXQA 1T83C 2NX5D 3QUXC 4AEIL 4L8DA 4F37F 3FQXA 3G6JA 3RZCC 1LEKB 3FQTB 4YPJA 4OF3A 3MBXH 3MNVB 5ACZA 1KV3A 5KANI 1NC2B 1VSCA 1CCZA 1UEYA 4NSKB 1XGRA 4KKCD 3RX8A 2R9HC 3QQNA 1K2DB 3G5YB 5A2LH 4NN5C 3RNQA 1N7ML 1Z5LB 4MAYD 3RX7A 2WY3A 1EVUA 4M61B 5H2BB 3BUYA 1UKQA 3CK0H 1U8OA 4M9OA 4KKBC 2VLKD 2E6JA 4WO4C 2WP3T 3FRUB 2Z92B 3SDYH 2ICWA 1BD2B 5FYKU 2VDOL 3WFZA 1E4XH 4X5XA 5E6IB 4BFBD 3QIWD 1CFTA 2Q7NA 2AK1H 2GFBA 3TNNA 5ICXA 4PG9A 3WFCL 4NZUL 2CDEA 5DUML 4OLVH 4U1LB 3WUZA 2VLJB 2BVQA 4XAKD 3C6SA 4G6FD 5T3XD 3VFPB 4MXQA 4U6XB 5E56A 3MRHB 3OR7B 2F54B 1RUMH 1KCRL 1T22A 1ZHBB 2VABB 4P49A 5C0CB 1QSED 4JCMA 4YGVB 3UAJD 4DVBB 1H15A 5GSVA 1HQ4A 1BVLB 5J12C 1OAQL 3L9RB 3CVHB 2VLKE 4M03A 2ZOKA 1KTKE 2J12B 4I3GA 2IFFH 3U82B 5IP4A 4YR6A 5JMRA 1UACH 4P2RE 1VGKB 2IPUK 3RZCD 5DZLA 2KZ1B 3U9UA 2VOTA 1JHTA 4HCRA 4LOUD 1AGBA 1WAAF 1L0XA 1CN4A 2NW2B 4KRPB 4HXAH 5KG9A 2PW1B 1ACZA 1MCWW 3RUGF 5ITFA 1K6QH 1EFXB 2VZ1A 1HH9A 3O2DH 2C4FU 3TNMA 1UM4H 3TA3D 4ZYKA 5DS8A 1UB6B 4Y8DC 2PR4L 4EVNB 4ZOBA 2NY0D 2EC9T 1FL6A 4P57A 1QBMH 1RZFL 3QWRD 1FGNL 3FB6A 2YKLL 5MEOB 1IMHC 3ROLA 2E7LA 4KQ4H 3SDDB 1HHGA 1E27B 1IAIM 4APQB 3CDYA 2WIIA 3IFLH 5I1IH 3SDAA 3N50A 4XMPH 1BOGB 5JORB 2IQAB 4ZDHA 4X4ME 5MENE 3ARED 1J7VR 4J23A 1FSKB 4XNUH 1T7YA 2Z31A 1I7ZA 3HR5B 2D03L 2NY2B 4JN2A 1DANT 1C12A 3H42L 3DSNA 1A4JB 1KEMH 3I3BA 3MJGX 2R56H 4U1HB 4RNRA 4XVSL 3PIQA 1WT5C 1A4JA 5EU7E 1AH1A 3G5ZB 4K7PH 5IJKA 2KKQA 1QLEL 5AYQA 4EKXA 1OAXH 4U1MB 3L3OA 1GCFA 1PY9A 1RZGB 3QISA 3DWTA 1WEJL 4YDIH 1X5KA 3PWUA 5DGQA 1EPFA 1J1OL 3MBEA 5F96L 3SDXA 3MRPB 2W9EL 2R23B 2BERA 3JTCA 2HJKB 1MFDH 1YZZA 5CLWA 3FT3A 2IG2H 4LHUA 3NH7H 1KN2L 5FDYA 3BZFA 3LMJH 5C07E 1CXHA 1TVDA 2W9DL 1E6JL 4U3XA 2P8LA 5KOVC 1JNLL 1S7XB 1OSZA 1CFSB 4HJGB 1CFNB 3E3QC 2GJ6B 2DYPB 5IB3B 1DVFC 3AROA 2RFXA 4Q2ZB 4Q7DA 2P5EE 5IFJB 2AJSL 4YO0B 1JGVL 3SCMD 1F6FB 3MNZB 5A3ID 4IRZL 4TPRH 1AGBB 4LSRH 4JFEB 3VCLB 1FLRL 4UTAL 4EN3C 3P9LA 1FG2A 4ZO9A 5EBWA 4R9HA 1DL7H 1KJVB 1XF4A 1DBKL 4N8CL 3WN5A 4MVBD 2F5AL 4XVTH 1OT1A 3OKNA 1WJ3A 1RK1B 3NOIA 4AQ1B 2KQMA 4R90H 1FZMB 1QBLH 3O8XC 4F7MA 4Y4FA 5F1NB 4OF0A 1WF5A 1GC1L 1SMAA 3EBAA 5C09A 3N1FC 1A7QL 1RZKC 3VI3E 3KPNA 2NY5H 3MC0A 3STBA 4LL9A 5J8OA 1EO5A 4LSPL 4GAGH 2BNRE 1N7MH 4RRPG 1YC7A 4M7ZC 2VRAA 4HW6A 3DHJA 1MCLA 4U0RB 2XQBH 4PJ7A 3ZHLA 1HXYB 3BGAA 1LO2L 5HY9A 3U0PB 1JIBA 3OR6A 4A6YL 1CD0A 2DTML 1NUGA 3TYFB 3JBG7 2X09A 1EAPB 3RVTD 4M9PA 4XMKH 4LLQA 4MZ3A 1FE8L 3U7WL 3CX5K 5FA3A 4QOKD 2Q7YB 5EIIA 1T80A 1S5HB 3FB8B 5D6DC 1OAUH 2NNAB 4LDEB 2EE6A 4XPTH 5EUOB 1EJOH 1ED3B 4OZHF 2PO6A 5LGJB 2OR9L 1NGXB 3ARUA 3JZ7A 4OUOA 1AFVH 4UIMA 2NTSP 1QBBA 4K7PX 1J0IA 2VN7A 3GIVB 2XT1B 3EOBB 3O4OB 2OP4L 5FGBA 4GRLD 3LEYH 1H3PH 1J0KA 4X6EA 4OT1H 5CINL 5GHWL 2WBWB 2WMPA 4ODSH 5CEZH 3U0TB 5KS9E 5KVFL 1UJ3B 3N0PB 1S7TA 1ZANH 2Y36L 4BZ2H 1OP3K 3LEXA 5AWNL 2FX7H 5L88H 2H32B 2FHFA 3U1SL 2HTKC 5BS0A 1HHGB 2OM5A 3PWVB 3AAZA 4MWFB 3QUXA 1LNUA 3GIZH 1QSFB 5D2NB 5HGAA 5I2IA 4ZODA 5ALBL 3IS1X 4YHNB 2FR4A 1IGFH 1OPGL 3BXNA 4YHIB 4PRPB 1KIPA 4XAKE 1FGNH 2DLFH 4K23H 3W5NA 3ECBB 1W0WB 1T89A 1NQBA 3ZL4L 2Z93A 5JTWA 3I6LD 5I1IL 5TE7H 2VL4A 5I74B 1SJHB 5EUKA 2VXVL 2B4CC 3E6HA 3L3HB 5SWQB 3GMPB 1U6AL 3OMZA 5EUKB 4I0CC 1S9XB 1QVOA 5FUOL 1ZT7B 3ARYA 5B4MD 4I3SH 4ESKA 2FJGA 4XVSH 1OTTC 4GRWB 3HE7A 4I0PB 5EULV 4G42B 2R2EB 4FQCL 3DMMB 3ECBA 1YEFL 3FN9A 2ARWA 4JRYB 1JPST 5E1AB 4YNYB 3VFPA 4M5ZL 1R0AL 3MV8D 4BUHA 2CKBA 4NT6A 3QO0A 3LQMA 5B38A 5AZEH 3CLFH 5IEKA 2GITA 4JG0L 4JQVA 2GAZB 3HE6D 4X6CE 4YX2H 1W2KT 2BNQA 1NGWA 2AV7A 4FFZH 5C8JB 1LK2B 3S98A 1P69B 1N2RA 3V6FB 2K3TA 4X6FA 3LMJL 5J89A 2ICWI 3DX6A 1QG3A 4HF5H 1INDL 1MH5A 4JM2F 5J12B 3MUGB 1AGDA 1AKJA 4PRDA 5DRWB 3MJ8A 3T0BA 2RHEA 2CKBB 4NT6B 2QSTA 4PREA 5D1XC 5TE4L 2CKNA 4HQQL 4LVHC 2AS5M 2DQFB 4YNYA 4OFKA 4V3DB 1F4WH 1CIUA 4AL8L 4HFUH 1S7UA 2XY1A 2ZSWA 3EYOA 1OTUD 3GSNB 3JV6B 4UDUB 1EHLH 2FWOB 3MMEA 2Q1EA 5BXFB 4ETYA 1FLRH 1MI5D 3FQNA 5C0GA 4KDVA 1PX3A 4KFZC 5CMAB 4WENB 2DQIL 3UPRA 5F9OH 2D7QA 3ALWA 1FO0H 4LASH 1I9RH 5IBTL 5ESAB 1XH3A 3H7LA 2Q7YA 1SM3H 3QIBA 3V0VA 1MLCB 2UY6A 4LF3A 1R24A 1OGAE 1F97A 1YY8B 2VISA 5I8EA 1A6UL 1MLCA 1JTOA 4LF3B 2O5YH 3TCLA 5FCUL 3B2VL 1AQDB 4F58H 2ED7A 2VSCA 2F5BL 2PO6D 1E0OB 4WIQA 5L9DL 3BKCL 3X12B 4PJIF 4XP9H 1LO2H 5MP6H 3KPTA 4JCLA 3UJJH 4NZJA 1LK2A 4UV4L 4G3YH 2EEDA 4X7DC 2Z8RA 3FKUS 2P42B 3BQUD 3S36L 3WBDA 4ZFFA 3L5XH 1CBVH 2R2BB 3O0RL 2OJEA 1EJOL 2Z8SA 2R2BA 3ARQA 4WO4B 3MCKB 1U8LB 4E0RA 5FKPA 3D39B 4GW1B 4R6UA 2OK0L 5HYQB 3EOTL 4P3DB 3WS6A 4ZUSB 2YRPA 5T1MA 5TQ0H 3RBGA 1MHEB 2EDHA 5I0DA 5ACZB 1L8JA 3E3QE 4PGZA 5IESL 3LEYL 3SQOH 3PWLA 4Q2ZA 4OT1L 3QNZB 4YXKH 4RFNC 3AU1B 1KTDB 2G5BB 4BKLA 1QSEB 5E8DL 3HC3H 1U0QA 2IAMC 5HYFA 5KW9L 4LAQH 4GBXA 5E95B 4WUKL 5E8OA 2Z4QA 3DV6B 3T2QA 2OMNA 2HT4D 1IGJA 4ZPTA 1A1MA 4UB0H 3O3EA 1N5YH 3WKMH 4OGAD 4K94H 1INQA 4K9EC 4L3CB 4P5TD 5E99H 1G7PA 2R1YB 3A6BH 4QRPB 4RGNB 3BEWB 3JTSA 2OSLB 5JHLH 4Y0GA 3UTSB 5I1DA 1U8JB 3O4LD 2CD0A 1A02N 2P43B 2NTFA 3CDFA 2H2PC 3MJ6A 1YEDA 1KXQE 4PPTA 4K23L 5DTFA 1YJDC 5KVDL 1MNUH 3P0YL 4OLZH 1EGJL 3D9AH 3WEXB 3V4UL 2QJDA 4XI5D 3F6IA 3TM6A 1EUTA 3VXSD 5TH2A 4JPIA 3MXVL 4GAJH 3ZKMC 3RWHB 1H5BA 4MMZC 4PIRF 4Y19D 2FB4L 4QRTB 3TH3T 4G80B 3W9DB 4FTVE 4DGVL 4EUPA 3CC5A 1ES0A 3TA3B 1NLDH 3VFSA 1JF5A 3QRFM 3IU4H 4QCIA 3WEXA 1RZ7L 3BH8A 3CSYA 2ZCHL 3IJHA 1NGWB 2PKDA 5KVEH 1JF1A 1ED3A 2N56A 4JKLA 4GUPA 4U1KA 5EU5A 4UTBH 4N9GA 2BOCB 3OKOB 4YXHH 1DQML 3N1PC 4LVEA 3BAEH 4NO0B 5DI8B 5A2KH 1FQ9C 4WRLA 1FIEA 2I5YH 3HUJA 4M7LL 4MJID 2XPGB 1X9QA 3KYKH 3Q6FA 3AM8C 3LPWA 4CJ1A 3IDJA 2VR5A 5ADOH 5C7XH 4R4NC 4J8RA 1MSPA 4NZTH 4XPHL 4DZBA 3ARDC 3D3VB 1WFTA 1JCKA 3TIDA 5IVXF 1B0GB 2NW3B 3VGAC 5EB9A 4X6CA 1JF1B 2PYFA 2Y07H 1I1FA 5K9OA 3R8QA 4N5UA 5EO0A 2N1KA 4OCMC 3RVUC 5H37H 3VDBA 3D69B 1ZLWH 2OL3H 3ZKSD 1A1NB 1BFOA 1N4XL 3TYFA 1NC4D 3U7YH 4UZGA 4YHIA 4JN2B 1OP5K 4Y4HA 5HHOA 5HGGS 3C60D 1F11B 1I9RL 3E0GA 2FDBP 1XIWB 1X4ZA 4G5ZL 3FB7A 3CZFB 5IB5A 4KROD 4JFYB 2BHUA 1FFNB 4NJ9L 5D7JB 5F88A 3QUYA 4OZHE 4FTVA 3RIFF 2O5YL 4R3SA 5J13B 3DX8B 4JY5L 2W1NA 4F58L 1V7MH 1FNSH 1S3KL 3MUY1 2DLEA 4W6YB 1MEXL 2BRRL 3WIHL 3CX2A 3JV4B 3P40A 5DMYA 3BPCB 1DBML 2KPNA 5EBWB 5MP6L 1A9BB 4P4RB 4R0LC 5EO0B 3MRCA 4KGLA 3HRPA 1G6RA 4NN7C 5GPRA 1NUDA 4MLIA 2HJKA 4OLUL 1TNMA 3OGCA 3O4LA 3V5KA 2WK2A 4TULL 3I3DA 4HIJA 5D7SH 1JHTB 4EUPH 3NAAH 2W60A 2B1HL 3BKMH 3HAEG 4XNZC 1MJ8H 1G6VK 2P8LB 2AK4A 5I6XB 5FGBC 4RRPA 4LSQH 1JK8B 3QSKB 3RGHA 4CDGC 1I75A 2DQUH 4GBXD 2KBGA 2E5EA 3VFVB 3KPQA 3RAJL 4HWUA 3HAEH 3BGMA 2DQHL 5AUMB 4OUUB 4OZIA 2CMRL 3GFUA 4X4ZA 5BV7C 5IHBA 1HSAA 3F65A 3QQ4A 1GAFL 2CDEB 3MBEB 4UDTB 5B39B 3NABL 2YSSA 2R4SL 5DK0A 3BD4A 1WWWX 2X4NB 4YE4L 2AVGA 3KAAA 2JK5B 1XGYH 3LV3A 1FNEB 3WIIH 1GIGH 4LBEA 2ICWB 4LPXA 4IRSC 2HTLC 2F15A 3F7YA 3WKML 5I1GH 5EU6E 4YHYB 3WLWD 3A0OA 3LDBC 1JPFB 5D6CA 4ONGL 4MA8L 4PV8B 5FGSA 2OZ4L 3ZMRA 1SVZA 3Q48A 4D9RD 1T7VA 4YHOL 1F90L 1FDLH 3NZHH 1NAMB 4WUUB 4ZXBD 1MHPL 4HXBL 1OTTD 1MNUL 4OLZL 4OCSH 1QSVA 4WDIB 2I24N 1HI6B 1U91A 3HPJA 2UUDK 2MCPH 3BW9B 5HHVL 3SO5A 2VIRB 4NO3A 1MJJA 1B0GA 2NW3A 2B5IB 1KPVA 2YD5A 2H9GA 1H15B 5SV3A 4XPAH 4UBDD 4BFGA 3QEQA 1RZ7H 4TUKL 1NAMH 1P84K 3BIBX 2ZCHH 3MV01 3K1DA 5E8EB 4CNIB 1JE6A 5GZND 4JANA 3DX9B 4FFYL 4ZFOA 3DMMD 4NWUH 2XRAL 4UTBL 4KY1L 2OS7A 2P49B 1NC4A 5EU7C 2V2WA 5HYJB 1I8IB 4MX7B 1TVBB 1GPOH 4EN3B 3DARA 4JFOB 3WS6C 3NIFF 1MCPL 1XGTA 4F7TB 1HQRA 3ZDXE 3I9GH 3MROA 4GRWH 2NZ9D 4U1GC 4JFDA 3VXSE 5D9SA 4NQVB 3QZWA 4BSWA 4W6XB 4OF8A 3PL6D 1RI8A 2BSTB 1Z5LA 3INUL 5FAAA 1S7SA 1I7UA 3QA3B 2DQGH 5EPMA 1GZPA 4NZRH 5JA8B 3GIVA 3GBML 3S97C 3LZFH 4YH6A 3UEZA 3BKYL 4O2EB 5FYKL 4PBVC 1XR9A 4PRID 3RWJB 3JV5A 1C5CL 4IMKA 3KHOA 4MSWA 4PBXA 5CJOL 1BD2A 1TVBA 1KIRB 1R3JB 5IBUG 4EN3A 4QHMA 3RUGA 5BV7L 5HVWA 1QQDA 4YHKH 3KYMB 4GS7B 3DGCR 5C0FA 1F45A 1WAAA 3RNKB 2C1PA 3UPCA 3SY0B 4LFHD 1Q72H 5EZLB 4ZNCD 5DT1L 2QLVB 2XFXB 3PWJA 3RIAK 4V2CB 2DL9A 2H32H 3CFBA 3CJJA 5J9PA 4P9MH 4C54A 3FQXB 3ARFD 4NO3B 3WNLA 1AC6A 2BRRH 3WIHH 2FSEB 4HS8L 1RHHA 2IPTL 4KTYA 5IWLA 2VERN 5T3ZD 2AW2A 1WC7B 5GRVK 5DHVB 2X4QB 2R1XB 3QNXA 1AC0A 1BBDL 3OKMB 2IQ9H 4WO4A 6FABL 2I26N 4L8CA 3EGSA 1XF2A 1FH5H 4OCNC 5J6GB 1Q94A 4LEOB 5CFHA 3D6GA 4Z9KB 4PJHB 4Y5YB 3GSOB 4XNZB 3UROR 5C71A 2J8UA 4JFXB 3NFNA 1UH3A 1LO4H 1U8HA 3S88L 2OTWA 2VDNH 3RAJH 4CJ0A 2X44D 3ZSTA 3RWIB 4ODWB 2AXFA 2NR6D 2R0LL 5EBGA 3F7RA 4FXGB 5F9WB 5F70A 3LKSA 1GAFH 1HSBB 5DJ2B 3TP4A 4F57H 4PG2C 4M6OH 1JGDB 3BP4A 1G0YR 4ELMB 3EZ8A 1EO7A 1MVUB 2NY7H 4FQXC 4LVNB 3I50L 3BP6A 5DEGA 3MV9D 3BZ4A 4FA8A 2OTWB 2A1WH 4MDIA 1MRDH 1ZLUK 2OJZL 2Z8VC 4I2XE 5I1GL 3OKKA 1U9KA 4R8WH 5I8CB 3BISA 3B3IB 4JQXC 3V6OE 1VACB 1W72H 2E7CA 1BWMA 3EO9H 4CBPA 1KCUH 1ZHKA 5JW4N 4ZXBB 4F9LC 3VWJA 3BJLA 4KDTC 3NFPA 2D4FA 3EO0A 2ARJA 1MHPH 1T89C 1MRCH 3QCTL 3L3IA 5E7BA 3F12B 1CDUA 2WBKA 1GGBL 1RIVL 3NBNA 3HUJB 4HGWA 2Q87A 1JGUH 2Y4SA 4JFOA 3T0EE 4J3XA 4PREB 1ZA6A 2YD1A 3IFNH 4N68A 3HE6A 1IQWL 4ETQB 1VFBA 5L2JB 5IVNA 5HBBA 2FJHA 2XNAB 1S78D 4U7KA 1DLHA 3GI8H 2G5RA 2APBA 2ARJQ 4CL7A 4QRPD 4JFYA 4G9FE 3KLHC 2BXYA 4BQ8A 2IALA 5ALCH 5ILTL 4OLEA 4OM1L 5M95B 1YC8A 4HLZG 2JJWA 5GS0C 3MRDB 1FZOB 4NQDA 1ZLVH 3TZVB 4YDKL 1KTLA 4P2OB 1S9WA 1JWMA 1NBYA 1BD2E 5CSGA 1Y6KR 4JPIB 2CRMA 2WUCL 5DC0A 2W0LA 1JNJA 4PJ9A 1AXSA 1M7XA 3VFWB 2C3XA 4PGBA 4LLUB 4GXUN 4PB9L 2EYRA 1J0HA 3I9GL 4LLUA 2IGFL 3OAYK 4NO0D 3SKOB 5J1AB 4N0CA 4ONFL 3QFJD 4JY6A 3SDXB 2DQTH 4TTDC 2WBJA 5I17B 2P45B 4ALAH 4Y19E 5BO1L 2LFGA 4PY8J 5C2UB 1FO0B 4WV1B 4FXGA 5DJXB 5DFVC 3O6KH 3GBMH 1RIUL 4L4TE 2GQHA 5HI5C 3Q6GL 2EZ0C 3BKYH 5FYKH 2HN7B 3BUTA 5E00A 1FNGA 5EU6A 4LGPB 4PJEA 1C5CH 1DQLL 4Z7VA 1QFUH 1LP9A 4I5BA 4POZD 3FFCB 1S8DA 3VRJB 5DDHA 5F89A 3IT8D 3RVWC 1RZIB 1BWWA 4FOMA 4IIQA 2HFGH 5EZIH 5KSBE 5ABDE 2VKXA 3JWDL 5T5NF 3VD3A 4QTIH 1DSFL 4JG1L 4GUPB 3EGSB 4KKLD 3MCG1 4LU5H 4M93C 4ONHB 3UZEA 4OZIE 5T1MB 3VD9A 1GGUA 1ZEAH 4XX1G 3TV3L 3VW3L 2VB5A 1N59A 3DGGB 43C9A 1HWHB 3MYJA 3THMH 2FATH 1WC7A 4O58H 3BDYL 4AIOA 4G6AD 1JRHI 2Y7QA 2B0SH 2ESVD 2H1PH 4E41D 1AO7E 1Q9KA 2XOTA 2YPLB 1E28A 2VIRA 5I15H 1WZ1L 3SDCB 3MNZA 2YC1B 4K2UH 4KAQL 4QNPF 2WM0A 3EJYD 2X9XA 4YFLF 3D3VD 3OAYH 4WDIA 3V9FA 2R4RH 1SEBA 3UJIH 6FABH 3QYCA 1BAFL 1RVFL 5FECA 4JPWL 5IMLB 3NMEA 4ELMA 5DMJB 2PTVA 1TZGL 2VUOA 3PDGA 4MNHA 4U1JB 3WUWA 3TF7A 5ERWB 2HKFH 1IZJA 3PGCA 1AD0B 5L2KA 1AQKL 2BNRA 1MFCL 5HDQH 1U8QA 4EIGB 2VDPH 1YN6B 4EDWH 2XTJC 1HHHB 2MWCA 3P4NB 1OL0A 4CN4A 4JREB 1I1AC 4NQEB 5DD1H 2JKXA 2B7DT 2DQCH 2HFFA 1Q8MA 1TTFA 3WNOA 5D2LE 4QRSB 3WXVL 2Y7QB 4XC3L 5C92A 2R39A 1FFOA 4LVOB 4BSWB 3IKCA 3MRGB 3WLWC 4NOBA 2A9NL 2AK4D 4AH2B 3IGAB 3L5WB 3HZKA 1QRNB 2P8MB 4P3CL 2OJZH 4QHLB 4R4FL 1SY6L 4AG4H 2YEZA 4HC1A 3DX7A 4NKMB 1W72L 2VC2L 1K5NB 3EO9L 3MO1B 5KN5B 1AJ7H 2WBJD 5DJYA 3O4LB 2ENSA 3ZE1F 2GKIA 4FHBD 5HYSG 3HCVA 1LP9F 4H88H 2AJVH 2VZSA 3V4VH 4GXUM 1Z9MA 3WUWG 4LRNL 3TVMB 1DFBH 1D9KA 3WUWB 2VQ1A 4GT7A 5FYKE 4TVSa 1P5UA 3TT1L 3OKDB 4LRIA 4OKDA 5ELIA 1GC1C 3GI8L 3IJHB 2XV6B 3QXAA 3O45B 3O2WL 5JW3H 4YAQA 4ELMF 1JV5A 3QCUL 4POZC 4OM1H 3VFSB 3PV7A 1V3LA 3BPOB 1OB1A 3KPRB 4KUZL 1JPTL 2AJUH 2IMMA 4HIIB 3VD7A 1T3FA 4D9RE 2CO7B 3PL6C 2CDFB 2Y06H 4PP1D 4L3ED 4I3RL 4LQFL 4CVXA 3SBWC 4GRMA 4AH2A 1T7ZA 4CMMB 4NRZA 2MKWA 3IFPA 3DXAB 4PJ7E 3QDGA 1WBYB 2I60H 1KCGC 2VLJA 1J86A 4QRRA 5GJSL 2ZJSH 3GB7B 5FO9B 1WGOA 3FO1B 5DJAB 1ZTXL 5GS2D 2QQKL 4J6RL 5LQBH 3VWJD 3IDIB 5H35B 1O0VA 4DCQA 4I77H 4JFZL 1RIUH 1ZS8A 1DQDL 3DX9A 3L5HA 4ZFOB 3Q6GH 5GZNC 1UZ8A 1VKXA 1GSMA 5GJTL 3MLSL 1G7QB 4JFHD 1I9EA 1SQ2N 3X11B 5E4EB 3BHBA 3PWNB 4LCUB 1H8SA 4Y4HC 5J6HA 1K4CB 4PY8I 4OGXH 4X6EB 4QTIL 1DSFH 5FFLA 3OKLB 5JHDB 1Z9OA 3KGRA 5SWZE 2ICWJ 5DRZA 1EXUA 5L0QB 4JHZA 3CFDA 4CADA 3REVA 3SDCA 3THML 4JKKA 2AJ3B 2RIKA 3G6JB 4HAFA 1KJ3L 3ZE2E 2I9TA 1YEGH 43CAB 5D7JD 3QDJA 3AREA 3OAZK 5T1LA 1YQ2A 4OD3H 4PP8C 2OQJB 3NTCL 1BX2A 2C4XA 3RVXD 3IF1B 3VWKD 5JA9A 4N5EC 3L9RA 1TCRA 2FO1A 3FHAA 1DE4A 5LWYH 1KBGH 3EKCA 4HLJA 3MRNB 4PRIE 1W0WA 4CU8A 5CBAB 3UJIL 5GGRB 2F54D 3TO4B 1RVFH 2BC4B 4GH7B 4J2XA 4DW2H 3HC4L 5E08H 1MHHA 4JFFD 2ICCA 3GJFB 4LNRB 2X1XR 3UC0H 3PP4H 3HE6B 2PYEA 1ONQB 1CDCA 3O3AA 3PP3H 1W8NA 4PRBB 4ZNEA 4AT6A 1BFOB 1AO7A 3GHEH 4LSUL 2C3HA 1IAOB 1HH6B 3JWOL 3MLYH 3OJDA 3HRZA 1Q9WA 3DIFB 3SO3C 1OAZH 2NY6D 3OZ9L 1Z0NA 1J11A 5T5FH 4UU9B 3AS1A 3R0NA 3OGCB 3LKRA 3M1BB 1NANH 5L2KD 1NFDA 4YO0A 3CFJA 1HINL 4NUJB 5GGTA 1OAKL 4DQOH 3B2UD 4M3JA 4E41B 1KB9K 1TQBB 5GRYA 2DYPA 1ADQA 4KDTA 5I16A 3IXAA 1TJGH 4QOKE 3OAZH 1IAKB 4X83A 2IADA 5EIIB 3OKOA 3MJ8B 3KLDA 2EEAA 4IJ3B 2BFVL 3WD5L 4D9LL 1T1WB 3VFMA 1T20B 3RUGB 1OCWH 1XCTA 4NP4H 3PXJA 4HG4K 4JQXA 3ZO0A 5DGRA 4WNQB 4KRMB 4M5YL 5C6WH 1ZS8B 3AS0A 4XBEH 5K33A 2FJHB 2R23A 3FOMA 1PLGL 5KSAA 2GUOB 4M1DH 1OTSD 1U92A 4MB3A 5T1KD 1U8MB 2JB6B 1C5BL 4U6VH 2GTWB 1BZQK 4H1LB 3UYRH 3G08A 3OG4B 2AQ3A 5E1AA 1BOYA 3R8BB 1FYTA 4ZS6D 3LKQA 4R0LB 1RJYA 1TENA 4OIIL 4JRXB 2FJGB 1TPXC 2QSVA 3QO1B 2FEDD 5I1LB 4NQDE 5C0JA 2EDLA 4ZUWA 3WL9B 3VFNB 4EDXB 1JNNL 1B4RA 2BVYA 2GUOA 1KT2A 1NJ9A 3BRFA 4LCWB 4IEFB 2WIIB 2XKNB 1MAML 4NHCL 3HG1B 4LCIH 1S7VB 3SGDI 1A47A 3CFDB 4JHAH 1A14L 2HWZL 3H8NA 2VLRE 4NBXB 3BP4B 1A9EA 5D71H 4OZIF 4TSCH 3T0VA 2ZJSL 1A3LL 4NNXA 5AAMA 2ERJB 3VXRE 4KKLC 3ARGB 4MNGE 2UWEB 4HUMB 4JFZH 3PWVA 1B90A 3KYNA 1K4DB 2CRIA 2HRPL 4MJIA 4PJ5E 1LO5B 2MQ3A 3REWA 3F5WB 4R26L 1UWEH 1S7VA 1KIRA 2WUBL 3RWCA 4L1HA 3HPJB 5GJTH 2VJXA 1U58B 1J0JA 5EORL 1MI5E 2H32A 4LCWA 1IAMA 5GRUH 3T4AA 2BNQB 2P5WE 5C3LD 3PWPE 1J8KA 4L5FH 3LEVH 2EDRA 5AZ2H 5E9DB 5DFVD 2X4TA 4OSUH 3VFNA 1G1YA 2BSRB 1WWAX 4R2GB 1ZLVK 4KQ3H 4F7PA 1UENA 3OKMA 4Q9RL 1JL8A 4HV8A 4NZDA 4Y5VC 4RAUA 3EOBA 1JPGB 4EI5D 1YA5A 4R2GD 3X14B 1CU4L 1XGUB 3V6ZA 1WITA 3VG0L 3UDWC 5KSVA 1KCVH 3QXTA 2PYEB 2DWEA 1W72B 2BCKB 2ADGA 1QO3A 4OD3L 3FFCD 3UX9B 5HYJA 3QQ4B 5C0AA 1A5FL 1FRGL 5C09E 4JM2B 1T6VN 2P5WD 4MYWB 1JZ6A 3SJVE 4D0BA 4I18C 2UZIL 4KROC 1D5XA 5E9DE 3RGVA 3IYLW 1KF9B 4QHNA 4DUWA 2X7LB 2ZUSA 5TFSL 5E1HB 3LVEA 1CTOA 1N64L 1YEIL 1M71B 5K59E 3TN0B 3OR6B 3HC4H 4KK8D 1CFVL 3WN5C 3KYMA 4Y5XC 4ZO8A 3T65B 3P30L 4M02A 4E41A 3GJFH 4CVZA 3D87B 3HFML 4PRAB 3ALXA 3PV6B 4UT6L 4G6JH 3VXMA 2WNGA 1YEJL 3I85A 4G9DB 5A2FA 3GHEL 5IHUH 2NMSA 5I73C 4LFHG 5JUEL 4ZUSA 2O26U 1KELL 3SDCD 3TN0C 1I9JL 4OKVA 1KPUA 1EHAA 3GO1L 4NYLA 3PABA 4Z7WE 3QIBD 2YUXA 3EFDH 3SKMA 1VHPA 4JM2D 5DVNA 4XP6H 1JPFA 4RGOH 1RAMA 3UJTL 1QEWB 4PY7A 5IEHA 3C8DA 3VE0B 1K8IB 3O3UN 3HAEA 4HD9A 5GZOC 3HA0A 4FFEX 1HINH 1OAKH 3RWCB 3TT3L 1RFDH 3TBYA 3PV6A 1S9KC 5KS9A 2MQCA 1OM3L 3MLTB 1UM4L 5EO9A 2PO6B 4YJZL 1IGMH 4RDQG 5FO9A 1Q0YL 1WV7T 3SKUD 4NO5B 1MHCA 2YPVH 1CI5A 3G5VB 1QBML 1CLZH 3L3JA 3L5IA 2Q3AA 5ISZB 2ZSVB 3EYQC 3ZKXC 1G6RL 1NCCL 4OD2A 3IFLL 3QDGD 1J18A 4X9FA 3T4YB 4C83A 3DYPA 5F7DA 1PLGH 3G6AB 1A6VH 5CJQH 3KDMB 3HZYB 2ITDB 5ESQB 5I71B 5D7IB 1DBJH 4U6VL 4JB9H 3ILQD 4LCYB 4IDLA 3UYRL 5CMAA 5F7HA 1NBVL 3GM0A 1F8TH 5FM5O 4M1CC 1I1CA 4N8VB 1TTGA 3RA7H 3MODH 4MD5B 4ODUA 3PQYD 2R1WA 1OTUC 1P4IH 1EIBA 4P23B 1JWMB 1NBYB 2A6DB 1XR8A 2X5PA 4OV6F 4BYHA 4PV8A 1JNNH 1INEH 4W6WB 4JLRB 5I18H 5D1XD 4J3OC 1CLOH 3QQ9C 4M8QB 1WICA 1PZ5A 4Z7NE 2YBRB 1V3MA 4NKQB 1SYSB 5J7CC 3V8CA 5AYUH 4NHCH 4LCIL 2AABL 4D94A 4HUUA 2VDKH 5BS0B 4PJAE 1A14H 3P4OA 5EFIB 1RIHH 3U2SA 1GOHA 2E9JA 1J1XL 1WWBX 3Q5OA 3PE9A 5F1OB 5HGHB 4QRQA 4XP1H 4AEEA 3QFJA 2EYSA 3FO2B 2E27L 1ZA6B 4Z77B 3VGEA 4OI7A 1HCFX 2VXTH 3P0VH 3U48A 2A6DA 4GKSA 1UA6H 3NZ8A 5F71A 1WVZA 2WAHA 5D7LE 1UWEL 1U42A 2WUBH 3QDMA 5ITFB 4GXVH 3KLHD 1QLFA 1T03H 1X5FA 3QUZB 1C7SA 4XCCL 3MV8A 5D4QA 3MX0A 4HPOL 1U8PB 4F7CB 4ISVB 3L3KA 1R3IL 2ZCLL 2DD8L 3AS2A 3B2UC 1FZJA 3GMPA 2Q3ZA 4XNQB 1N8ZA 1T7XA 1A2YA 2EDQA 4HIEA 3QXDB 3FN0H 3S5LG 5C08D 2E7LC 4Q9RH 4YAQB 2VAAA 1HHHA 1INQB 4I8DA 4P59H 3L3OB 1QBLL 4U1IA 3BE1L 1BVLA 2R2HB 4HFWB 2NY6C 1QFHA 4MLSA 1NUNB 5FF6A 2XPGA 1A1OB 5BMFH 1NMAL 2Z4QB 3DV6A 4XVUC 4LSPH 1MCQA 3TVMA 1IZKA 5E2WH 2E9WA 4X6DA 4WFHE 1F3DH 4XCEA 4NFCA 4Y7MA 3SDAD 3FO2A 2XQBL 1A5FH 1V3JA 1OGAA 2VLRA 1QBAA 3FZUD 2MPAH 3TBSB 1NGQH 3GKWH 1G7MB 3MRQA 3TGXA 3P4OB 4M7KL 4XMKL 1FE8H 3VGFA 5TFSH 4FQIL 1BBJA 2LU7A 3IDYC 5GGQL 1N64H 4N0UE 4OTXH 4BZ1L 3MO1A 3TA3A 3VG9B 4UOW1 2OYPA 1OAUL 3A6CH 3MUJA 4GKZA 1A6ZA 2CR6A 4JZJC 2R1XA 4EXKA 4NCC2 1BHGA 1EFXA 2HFEA 1AFVL 1YEJH 5BVPH 3B83A 4G7YH 2EO9A 2VMFA 3KJ4B 3O3BA 1I1FB 1IKNC 2FL5B 3X12A 3EFDL 2ZCKL 4WEBL 4XP6L 4MD0B 5E8NB 3TJEH 1BIIB 2AERT 4U1SB 4BQ9A 5IV2A 2NLJA 3HMXA 1NCAH 4N90E 1Z2KA 3P9MA 1MFEH 4XRCB 3UTTA 3U1SH 3CFKB 3TT3H 1RFDL 5DD0L 1JFQH 1OF2A 2QBWA 1ND0A 4LEXL 4GBXB 4EQ3A 4Q97A 1XH3B 4WWID 2ED8A 1CFBA 3MRPA 5HGHA 1GL4B 3K8KA 3ARFC 1IKFH 2DQJL 5HJ3B 1OPGH 4ZUVB 3MRBA 3V5HA 1SJEA 1X7QB 4NKIL 4XMLL 3RPIA 3TO4A 1CT8B 3ULVH 1JJUA 4PGBB 4ODHH 2UY7A 1NCCH 3WFHB 1B2WH 3G6DL 1FYHB 2O5XL 1F3JB 4U3HA 2OI9C 1T5XB 4G8FB 5INCB 1T0NA 3E3QA 4HIXL 3QZWB 1U6AH 1H3XA 4UQ3A 4XPBH 1A6TA 5TH2B 1KC5L 3RDTA 3I02B 3P4LA 4Y88A 3BGFC 4I3SL 5IB2A 5DFTA 1B0WA 1AP2B 4ORZC 3GSUB 3F5WA 1FLTX 4M1GL 4GLRH 3MLPA 1A8JH 5DUPH 4YBHA 3VH8B 3FZUC 1DVFD 1MCSA 2VQ1B 4I9WE 4KDWA 3HB3C 4BFIA 4JFQB 2J88H 4YUEH 5AZEL 4PJGB 3CDGA 1X5GA 4FMKA 2UZXB 3BHBB 3PWNA 4IRSB 1A1MB 2AABH 5IIEA 2C7UB 4NHUB 1CXFA 2XG4A 2WLZA 5FM4A 4PUBL 1D5XB 4C56D 2H9GB 2X4SA 2O5ZH 1WCBA 3V5DA 3BJ91 3QJHB 4FG6D 5H35A 1C08A 3MFFA 2E27H 3MGOB 4JFDD 5SWQA 3HNSH 3W81A 5GS0H 2RB8A 1YPZB 5EC1A 4L29A 1W72A 1U93A 3MGAA 4UINH 4O51A 4LSDA 2XWJB 3ZSSA 3BWUC 5AG8A 1A64A 2FIKA 4E42A 1MPAH 5JXED 1CGSH 1LGVA 4HPOH 1PKQB 2X1PA 3G08B 4QRTA 1S9WB 4PJ8D 4G8FA 3MLWL 1PKQA 5DK2B 4D0DA 1UXWB 4AEIH 1GXEA 5D9SB 4LASL 3WE6A 4HBCH 5IBTH 2IWGA 3WFDL 1UVQA 5IROA 2J4WH 4P9HH 1RD6A 3RTQA 3D0LB 3KJ4C 1MF2L 2FIKB 3T1WA 1M1SA 4U6HB 5T1KA 2IPUG 3KYNB 4L9LB 2G9HA 2P24B 1PQZB 3B2VH 2PTUA 1HHJB 4OLWH 1NGZA 5T33H 3JWNC 3PABB 2AI0H 5J13C 4LVOC 5KVGL 2NY4C 2JIXB 3GKWL 1SMOA 1UGNA 2C7UA 1OW0A 2CK0L 1G9MH 5C0IB 5GGQH 3MV7B 2NY2C 5IMKA 4XXDB 4NKOB 3UBXG 1J1PH 2AK1L 1ZHKB 4JO2L 3X13A 3L5XL 3ZKQD 1CBVL 5F7KC 3E6HB 5DMIL 3NFSH 4M4PA 5D7IA 1U36A 5IQ9B 1MCIA 1KCRH 3U36A 2OK0H 3EOTH 4PB0H 1HH6A 3EZJB 4U4BA 3VGHA 1L6ZA 2Z9TA 4HUWA 4XT1C 3QG7L 4YHZH 3BP5A 1UCTA 4BM7A 4FQ2L 3CCHB 3QUYD 5KSBF 3SQOL 2C1OB 5FA4A 3RBSA 5IHLB 2I07A 2ZCKH 2P24A 5D2NA 5HGAB 3VGAB 5HHMB 2ADGB 4DOHB 5MEPB 4LAQL 3O9WB 3FTGA 5F88B 1IGTA 5C8JA 1NDMA 3QPQD 3MLXH 4O2FA 3UBXI 2PYED 1SJEB 1AP2A 2RQ8A 1G9NL 3RPIB 5BQ7B 1LO3H 4NKDA 5DD0H 4LLMB 1A6WH 4WU5B 1F11A 3S4SB 3EYUL 5E99L 1B4JL 1WFOA 1W0VA 3RDTC 3T0AA 1QNZL 4FQQB 4NC2B 3KNBA 2I07B 4OD1L 4OZGB 1WUNT 5FGCE 2JJUA 1ZVYA 5I17A 2DQJH 5FF6B 3VFVA 4H0HB 1O5DT 3LQAL 4NQXA 5DQDL 1EGJH 3D9AL 4UOJA 4O5LL 4ODXB 3OAUL 4KKCC 1B2WL 3SGDH 1A7RL 1VADB 3MXVH 1KNOA 2MSPA 1CGTA 3MQIA 1UXSB 5EUOA 2DLGA 4XPBL 2CIKB 4DGVH 1VEOA 3MRMB 4Z95L 3H7BB 1U3ZA 1FFPA 4JFPA 5K9JL 5C0DB 3WXWL 3GSNH 2XWBA 3QI9A 2FWOA 4JGJA 4F8TA 2ZUQB 3CUPB 2JJSA 5C08A 3MV9E 4NM4H 2XY2A 3QIUB 1KIUA 4PRPA 1QLEH 1BLNA 3FT3B 3SE8H 4QRUB 1WEJH 4YDIL 3V52H 3DROA 1YYMH 1ZHLA 3KG5A 2M1KA 4XAWH 4H25B 5I71C 1QR1A 2RR3A 4OQTA 2ZG2A 4QHMB 4QXWA 2ATKB 3FCTB 3MRLB 3L7FA 1IGYA 3ARGD 1G7MA 4GG6E 3GM8A 4M6AA 4Z7VB 5JPNA 5MHSD 3QIWB 3T8XB 5J57B 1NCWL 1DANU 4ZFZB 1BREA 2Q20A 3RZCB 1DN0A 4OZ4A 4WFFE 3DPBA 4MB5A 2DM4A 5I66B 3MV7E 4OLYH 1JVKA 2X1WL 4RFNB 1DTUA 1IEAA 1QSZA 2ITCB 5ADPL 2LAAA 2Y07L 3B9EA 3B3IA 2EH8H 1D6EA 2HAZA 4PJDB 1S5IL 2X4PB 5HHPA 1ZT7A 4X7FC 2UVEA 3QEUB 4UT9L 5DRNA 4ZTPL 3U83A 1ZGLB 5MERB 4IMLA 1F3RB 3T0WA 1E4JA 3KS0H 5DVLA 2JIXD 3RWEB 5L8KB 4L4VA 4KPHL 5D5MB 5KTEH 1PW3A 4FXLA 3WNNA 5DYOB 1VFUA 3LB6C 1KENH 1JWSB 5I75B 3DROB 4P5TC 3SJVB 4MDJB 3VDCA 4RZCA 2XIDA 4EBQH 1IQDA 3KPOB 4FQXD 2XA8L 3VFTA 1A22B 4R90L 1WZLA 3X11A 5I73B 2EKSA 2MCG1 4JN1H 2AEQL 1F3DJ 2BJMH 2NR6C 1JPSH 1JWSA 3HZVB 4JY4B 1FNSL 1S3KH 1G7JA 5E5RB 3ZHDA 1FFQA 4C56B 1DBMH 1IVLA 4ISVA 1JYWA 3QFDB 2VXQL 1MWAH 1C7TA 4KZEH 3CZJA 5F9WC 1CD1B 1UB5B 4XCNA 1FP5A 1EBAA 3M17B 3RDTB 3U7WH 4OLUH 4LQ1A 5CLTA 4TUOA 3OR7A 4ZUTA 3QUXD 5I1CL 3GMNB 1RHHB 4I13B 5C6TL 4JO2H 4Q9CA 4G7VL 3W9EB 2LU3A 4X99A 2QV2A 3PHOA 2B1HH 3TYGH 3RVTC 1SEQH 5CCKH 4I48A 1JTTA 2HJLA 5D7JA 1UYWL 5DD6A 3LIZH 4ODBD 3FTGB 3QG7H 5E70A 4OGZA 4LGSB 2OP4H 1EEZA 4HDIB 3KYOB 2W65A 1ZLSH 2QR0B 2ZKHH 3LOWA 3IF1A 3ARDD 5C0ND 4Z7OF 3KJ6H 4BZ2L 1TDQA 3TNMB 3OB8A 3RWIA 4YE4H 3O3EB 2FX7L 4Y4KC 1ITBB 2LAGB 1GIGL 5ETUB 5H94B 1G9NH 3FQUB 5FHBL 2YC1A 4KJWC 4PLJC 3EYUH 1FYTE 3DVGA 3QNZA 4OD1H 4JFHE 1T6WA 2OZ4H 2Y25A 4JDVB 1B6UA 3ZDYE 5IW1A 4KKBD 4U6YA 1S9VA 4KXZH 3O9WC 4OBSA 3QUZA 2DLFL 2FO4A 3LQAH 3T4YA 1WBZA 4QRRD 4C83B 4O5LH 3U4BH 2BOBA 1CWVA 5HYQA 1H8OA 3O2DA 1D6VL 1KG0A 4KHTH 5I8KH 5E8PB 5H37G 5HHVH 1WIUA 4KTDL 3EYFB 3OJMB 4HT1L 1NPUA 4N9GB 4XNYH 3MOQA 5HDBF 4ERSL 1AE6H 3DX6B 4KMLB 3VGGA 5J9PB 2N4IA 5EFIA 3U2SB 4XI5C 1KTRL 3D18A 4BFEA 5FUOH 4YHPB 5FGCB 3GSNL 4IS6A 1BJ1H 1UWXH 3TBYB 3VRJA 3I6GB 2LU4A 4NRZB 1A6AA 3HB3D 4QNPE 3CDCA 3ES6A 1YEFH 1TJHL 4KY1H 2VL5B 1ZHNA 2FEDC 3CLFL 3UO1H 4NRXA 4L4VB 1AGCB 1QKZH 1CLCA 1QOKA 1OSPH 1LEIB 2K7PA 1NCWH 3GNMH 2QHLA 3S8WA 4UUJA 25C8H 4JPKL 2E7LE 2BCKA 3X13B 3KDMA 4TSAL 4NJAH 2DQGL 4PJBF 3ULVF 1NMBL 4HQQH 1HDMA 4PJ8C 4WW1A 1F4WL 3NACH 1MFNA 5BZDA 1DQQB 3O4OC 1S5IH 4JKPH 3MROB 4HKXA 2XKUA 2OTUB 4KJQC 1JGLH 5J0BA 4X7SH 1FL5B 4PJFE 4XC1L 5B4MC 1ZA3B 3L95B 1I1YA 4PV9A 3NN8A 2EYSB 3BO8A 3KPLB 2HT2D 4HH9B 1BEYL 5EU5B 4EEEA 4UQ2A 2Z91B 3BO8B 3NPZB 3QI9D 1YMMA 2WZPD 3KPQB 1X5HA 3KLAB 2OTUA 1JRHH 3LDBB 4P2RA 3FONA 4GAYB 1FIGH 2AEQH 4WW2C 5F7UA 4MA7H 5CSZB 4P9ML 1JPSL 5IT2H 4LIQL 1EZVY 4WHTB 4WCYH 4HKBA 4PLKC 1PG7X 2IPTH 5KG9B 3H9YA 3UJJL 2A9MH 1CICB 1TCMA 1QLRA 4YIQB 5CD5C 5D72H 3K8MA 4Y2DA 2NPLX 1KYOJ 1YEDB 4DFIA 2GY5A 3GUTA 3QG6B 4KJWD 3O0RH 3NCYP 2DM2A 3EYSH 1KJMA 2MTPA 2ADFL 1GGYA 2E7MA 1PG7L 3HRZB 1SEQL 5CCKL 5A40E 3K2MC 1EVTC 3NCBB 4I0PD 3FB5A 4L4VE 5HSFA 1I3VA 4OQ1A 1LQVA 1MCEA 1FYTB 1NAKH 1JHKH 3OJVC 5C0BD 3FQRB 5I30L 4PJGA 1L7TH 3O9WA 4XVUD 3ARSA 4YC2C 2WINA 2ZKHL 4YXKL 3QUMH 2NY0C 3MLTA 4F57L 2FD6L 1BJ1J 5D1ZD 1Z0MA 2DI9A 5I8OL 2FX8L 3VFRB 1TZHA 1FJ1A 3HC0B 3QNXB 3FRUA 2UVFA 5D5ME 1TZHB 5FHBH 2F8OA 1JK8A 4UQ3B 3FO9A 4DEPB 1U8NB 2IC2A 4H1LG 1JMXA 1B0RB 1NBZA 4FQHB 3JUYA 4NC1E 4Y1AD 1XIWC 3C9NB 1BZ9A 3WFHA 1MRCL 3MV7A 3MRQB 4G9DA 2VLKA 3REWB 4U7MA 1CIDA 1EXUB 5F7FA 1GGBH 2X89A 3IDJB 4GAJL 2VZVA 2HH0L 4HJGA 5ENWB 4DFHA 4HJJH 3SN6N 4OQTL 3WNPA 3NIDF 3UYPA 4Z0XA 3HMWH 5CGYC 1A7BA 2Y23A 4Y4FD 4WEMB 35C8H 5IFHH 2UYLA 1T2XA 3TEUA 3DECA 3Q3GB 3MOBL 5D1QA 5HD8D 2NXYB 3LKRB 5ICYB 3N1MC 5ALCL 5HHOD 5C0EA 5K9QI 4I48B 4K3EH 1Q94B 4LEOA 3T77A 4YDKH 4YDJA 2DWEB 4ZUWB 3BAEL 1X5JA 5CSBA 1GGTA 4DJMA 1F4YH 3QDGE 5BZWA 4M62L 5CSZA 1LMKA 3QUMA 3ZE2F 3FQWA 1AGFA 1P5VA 4Y4KB 3G5XB 3ILQC 3PWPB 4AEFA 4ZOAA 3KLAA 4HV8B 2Y5EA 1KXTB 1OSPL 3CAFA 4HWBL 4NGHH 3ZDZE 4P9HC 4DKFH 1C16B 4XPHH 2YS4A 1IL1B 4KV5F 3UTZB 2YK1L 3OQ3B 4TVPH 5A16B 1R3HB 4QTHA 1D9KC 3RKDC 3LN4B 3B5HA 4ALAL 1BQSA 4Z76B 2WINB 3K0WA 5KSAC 4GMTH 3NN8B 3T4AB 3IAGC 2AJ3A 1MHHB 1XF5A 5DEZA 1EMTL 5A43C 4YDVA 1RMFL 1T1ZA 4HHAA 5GRWA 3RVWD 1RZJL 5JW4Q 2R8SH 4CAGA 5IB3A 2PXYD 3UYOD 4FXKA 4JLRA 5EWIH 5BJTA 5CGTA 3BSZL 1FVCA 5FK9B 4AENB 4Z6AT 4G5ZH 2R2EA 4G42A 4P46D 3WJLA 4URTB 2I9LA 4JREC 4NJ9H 4U6TA 4MSWB 4KUCD 4B53A 3H9HB 1QLRB 4P3DA 5CUSL 1XF3A 5EC2A 1ADQH 2BNQE 1R3HA 5HYSA 2BSTA 1U8NA 5DJZA 5C0JB 4MCZA 1VPOL 4S11A 4MXVE 5SX4I 5JIIA 3O81A 4ZFZA 3SKJH 1KOAA 1OVZA 3VFRA 4QOKA 2ZSVA 4W68A 3BEVA 5HDLA 2F54A 4WTWA 5IHZB 3D1MC 1CDIA 1T3FB 4P23C 4JPWH 2K7QA 4H8WC 3L5JA 3UTTE 2X70A 1BFVH 3WNMA 2VLMD 1GOGA 4KKNA 4DN3H 4Z76A 1X4YA 1MJUH 5FUZL 2ADFH 4Z5RA 3BKML 5GGRA 4RWYL 1D5BB 1MFAL 1Y6NR 2FLBT 2AV1B 1HXMA 2VLLA 3VE0A 5F6HJ 3DUHA 3SDDA 1FZMA 1I7TA 3E2HB 3OPZL 4Q0XL 4JZJA 5I30H 4CVXB 2MFNA 3P4MB 3SDAC 4HX1B 5EBMB 5IQ9A 5ESAA 2CIKA 1ERNA 1N0XL 4K8RD 3FJTA 3NA9H 1ROWA 3WXVH 2FD6H 3RVVD 3IDGA 4GW5A 2V17H 3QDJE 1BQHB 1VADA 3CFIC 4JO3L 3C60B 3VMOA 2FX9H 1U41A 3WIIL 2VR4A 2IANA 3VGDA 1BZ9B 5HHXL 1WT5A 2FEEL 4R4FH 2YD8A 3BD5A 1UH4A 3H0TA 1N6QL 4PRIA 5FO7A 5IW6B 2BRQA 3BT2L 4ONGH 3LAFA 4PJ7F 1NUFA 4I18B 2COQA 1D5ZA 2ED9A 2DJ4A 1PVHA 1FDLL 3NZHL 3FONB 5T3XH 3HZKB 5DQ9B 5CIPH 1JNHB 2OXHA 2R29L 3S4SA 1EAPA 1H3WM 4DVBA 2XACC 5EZOL 1HNFA 4DKAA 4AM0A 1P2CA 4NQTA 1FFOB 1P6AB 4O2EA 1JZ8A 3V4VL 2HH0H 2FYYB 4UAOC 3QDJD 3NIGE 4M43L 5DD3H 2A6IA 1HNGA 5CP7B 3ULUL 2HP4A 3VXUD 3LHPH 5FYKD 4RGND 2NXYC 35C8L 1GGCL 3HNTH 4QYOA 3DMMA 3S35H 1YY8A 3O2WH 5JW3L 5DHVA 3IRPX 1LE5A 5J1SC 2HVKB 5ANMB 1QVOB 1I7ZB 4NWUL 4KVCL 4MNHB 4U1JA 1P7QA 4PS4H 3DVNA 4K3EL 1A2YB 3LD8C 3L3HA 1JZ4A 2AJUL 3OHXB 4QHKI 4M62H 4PGCB 1GPOL 2HLFD 4UT7H 3H9SA 2AJYH 3FHQA 4I3RH 4DGIL 3TBVB 4PP2A 5DVKA 4NQEA 4JDZB 2W9LA 4HWBH 1TVHB 1QPXA 4NUGL 4DKFL 4JJ5B 3FB5B 1S7RB 4OJFH 2DMCA 4PJIB 1IQDB 3KPOA 4NWTL 5DD5H 1WTGT 1A0QL 3ZT5A 2OI9A 1JMZA 3INUH 3V7MA 4PJIA 3UXFA 2QQKH 3MRKA 2NY4B 5C0FB 4I77L 4DEPC 3QHFL 4DZ8A 5CJ8A 4HDIA 4S0SD 3IJYA 4K8RH 2P46B 5GGSY 5SWSA 4OIAA 1RZJH 4MNQB 3VXTA 1U2HA 1CFQA 3BH9A 4FQXB 5I74C 4G8IB 4QCIB 1CICA 4YIQA 3WIFB 5C9JB 4YHMH 4XCYA 3CZFA 2VR9A 3A6OA 2V9RA 3CC5B 1LDSA 5EWIL 2JE8A 4EI6B 4ZG1A 1T2QL 2BVOA 2OR8A 4YC2B 1NFDE 2X10A 2DDQH 1HIMH 3UTQA 1U8KB 2JB5L 4TUOB 5GSVB 1NCTA 2FBOJ 1DLFL 1G0DA 1JGEB 1JZ2A 3L3IB 4AMKL 5I1JH 2DBLH 3MRHA 1MVFA 5IROC 1DUZA 4U6YB 1XMWA 1BVKA 5DUBA 2MOVA 2HRLA 2H26B 4HLZH 3D85B 5J56B 4CRPA 1F5WA 4G8EA 4G9FD 5I8CA 5DK3A 1S5HA 5E6IA 3KPMB 3DURB 4HS8H 5DC9B 4IIQB 4IJ3C 2GJ6D 3SOBL 1VCAA 5ETUA 5K9QG 3UP1A 3BN9C 3SHSA 4QY8A 1HEZB 4FP8H 5CEZE 3QUZD 5FYJU 4NM8L 1KULA 1CICC 3K4DA 2NXZC 4QXTA 5IK3B 1FNGB 3AUVA 4OCRH 4HULB 1UADC 4PGJA 3MR9B 2GT9A 4L3EE 1TPXB 5B21A 1HDMB 4LAJH 4ODVL 1BFVL 1FNFA 3TJHD 5CD5D 3ULUC 5GISH 3HG1D 2HG5B 3DXAE 1LNUB 1HH9B 2BHZA 3ROOB 2V2TB 2ESVA 3MV9A 4UUJB 3SEPA 5F7LB 4S2SA 1ZSDB 4F2MA 4RDQF 3CNKA 5TJWK 2R69H 1LEIA 1TIUA 1LO4L 3S88H 2XZCH 3RY6C 2PUQT 1BQHA 4LHJB 4ODXA 4BUGA 1GGIH 3HNVL 3WFEL 3QAZB 1BGXH 4EUPB 4XWOC 1K5NA 3H3PH 2DQEH 1NEZA 1IL1A 1M6OA 2MNUA 3UTZA 3KNBB 4J3SA 3SDXF 4HPYH 3SPVA 3GSWA 2NY7L 1UKTA 5D5MF 1QP1A 5I76B 3U0WH 4PJBE 1RULH 4JHWL 4XWGL 5FCSH 4U6XA 5EZJB 1ONQA 1LHZA 3IU3B 1N6QH 1KPRA 3K4AA 3U4EA 4D0CA 3ARPA 2BZDA 3C2AH 5JIPA 5TQ2H 4Y1AE 4H25A 3P11L 3U46A 3SCMC 3ZLQC 5HGBB 2BFVH 3WD5H 4K71C 3BGMB 5D7KE 1BVZA 2R29H 1FAIL 2P5WA 1PD6A 3SO3B 5E6ID 3WV0A 4N0UB 1RIVH 5BRZD 1IC4H 3B43A 5DLMH 4XBEL 4GBXC 4KHXL 3WO3B 4OF7A 5DJZB 3CX5J 4PJAA 5IQ7L 1ZVSA 3K3QA 5ANME 4GRLB 4NPYA 1YN7B 3AS3A 1IQWH 2W65B 4POUB 1C5BH 3ULUH 5L0QC 3SKNA 1CXIA 1EGJA 3MLZL 2A38A 3SKOA 3P3YA 2FGWL 2NY3D 4LSVH 3OF6A 4MD4A 1QA9A 3HNTL 4WI5A 1NFDB 4NIKB 3REVB 3EYVB 3OTTA 4MD4B 4PJ9B 5HDBE 4LKCA 4IRJC 3S7GA 3DV4B 1K3IA 4PJEE 5SWSE 3BZDA 3G04B 3SQBA 4JR9H 4RAHA 3F7PC 5EN2A 4QF1A 2HLAA 2DQDH 2WWKO 2IANE 5HHME 5F6HI 4RSVA 3T0XA 5BOZG 1UZ8B 7CGTA 1II4E 4PB9H 4NRYB 4IOFD 3HPLA 1E27A 2JCCE 2Z91A 4Q74A 1AKJD 3AREC 4CKVX 1QR1B 4TSCL 3D2UD 1Q0XL 3GBNH 4ZFOL 5FO8B 2YR3A 3GJFA 4Y5VA 5JQ6H 3ILPA 4LSSL 2X70B 4TOYH 4EVNA 5BO1H 4KI5C 2AGJL 4RBPH 1RJZB 1S7XA 4PJFA 3MNWA 2WANA 3O6KL 3FOLA 2CQVA 1LVEA 1DEDA 2R1WB 4PJ9D 4R26H 4F37K 5L7XL 1DQLH 5TDOA 1QFUL 5EORH 3VFTB 4FZEL 2CDFA 4Q58C 2DLIA 2ZUTA 3SY0A 3ZDXF 3CFCH 5GS0D 1IT9L 1MREH 2GIYA 5L2KE 1KJ2A 2HYMA 1P53A 3BW9A 4CW1A 3ARDA 4WI4A 1ZGLA 4LPUA 2DLHA 2DS4A 5F7DB 3VW3H 4HMCA 2XWTB 3ZKND 1DLFH 2GHWB 4I2XA 4V1DB 2X4RA 4CU6A 5GSRB 5DRZB 4CDHA 2DBLL 3P77B 4XB8A 1VESA 2Z31D 1O7SA 3LS4L 1RPQA 4RX4A 2CLZA 4WHTA 1YEEL 1IEBB 1T21A 3QZWG 5D93B 4F33B 4BFIB 2GTZA 2XTJD 1Q1JL 4LCUA 1FRGH 5T5NG 3UAJC 4GAYA 1AHWB 1HYRC 4K2UL 4KAQH 4ORGB 1SVCP 2XZAL 4NM8H 5CZXC 3FT2A 5MERA 4WNQA 3OKEA 5IW3A 2XNAA 4ORGA 1XR9B 2DKSA 2EH7L 3T2OA 5KBNC 3CFEB 1FNHA 2YBRA 1M7IA 1FL6B 1R5WB 2DYPD 1F4XH 3B5GA 3OXRA 5TDNB 3ULSA 4X4YB 5ESVB 5EN2B 2IEPA 5LGHH 3CVIH 4X7CC 5E8EA 1L9MA 4OF5A 1AQKH 3HFMH 4UT6H 1OP3H 4JQIH 5C07A 4BQBA 3DI2B 2XZCL 4K8RC 1GGIL 1W8OA 5DD1L 4O51B 4PGEB 5LXGL 3TFKA 1CR9L 4P4KC 2XTJB 4O4YL 3C87A 3E6FB 3TN0D 4L8DB 2DQEL 1IGIL 3DVGB 3FAWA 3BEWA 3JTSB 3I3EA 1OARH 5FXCH 1G6RB 1WCBB 3QQ3B 3V5DB 1MJ7H 4BH8B 1PDKA 4Z7WB 3QIUA 3U0WL 2IPKB 2Z93B 1FCCA 3VD5A 4P3CH 2P5WB 4IRSA 3VI4F 3T0DA 2DJSA 4KK8C 4H5SB 2BVQB 1LWRA 1DUYA 1J8HD 1UXSA 3P11H 2YPVL 4JPVL 5T1KB 3F7YB 1CLZL 1R3JA 4PD4J 2AKRA 4TNWK 5IKCB 1RY7B 4EI5B 5DMKB 5ICZB 3MGTB 2JELL 2WLYA 5DD6B 1FNEA 3RWJA 5J11B 3D0LA 1IC4L 4Y4FB 5F1NA 3AGVA 4HK0B 1CYGA 4KHXH 1NAMA 4WUUA 4LRNH 1B0RA 3W2DL 4F7EB 3WKNA 4X4YA 1FC1A 1ACYL 5DF0A 3JWDC 2CK2A 4AEHL 3G04A 1LE5B 1AKJB 3TO2A 2ZNXA 3RNQB 1DBAH 1PZUB 1A6PA 1CVRA 3RA7L 4M7JH 1CG9B 3S3PA 4S0TD 4PRPD 5EOCJ 1BECA 5T1DH 1P4IL 1PKQE 1UFUA 5FEBA 1NGXA 4PJXE 1RUPL 3LQZA 4D8PB 2V2WB 5GS3A 3MV9B 5HJ3A 4RMUA 4KUZH 2YSSB 4J4PA 1IGCH 2LTQC 4FZ8L 1T1YA 4A6YA 2PO6C 1TLKA 1TNNA 1BD2D 4FQ1H 3WFBH 4KJYA 2FNBA 1IEBA 1T21B 4AIZB 5C0IA 2C1OA 1QRND 5F1IB 4W70A 3MACL 5D2LB 1JYVA 2DAVA 4MS8D 2VDKL 1G0XA 5KSAD 2LE9A 5JOFB 5DQ9A 5GSRA 2VTFA 5BRZE 1TMCB 2GJZB 2YWZA 1J1XH 2BNUA 3CDGB 4MAYB 3WYRA 1IFHH 1D5ZB 3TIEB 1KPVB 5C86A 3RJDA 3GBNL 3H3BC 1Q0XH 4PJGF 1N5AA 3QWQB 5KZCD 4H8WL 3FFDA 3WJJC 3RUGE 3VA2C 4R97B 5LQBL 1SJHA 2VXTL 1EZVX 2H26A 3P0VL 3DUUA 3ORJA 2OR7A 3QHZL 4U1MA 4K3DL 2ZPKL 1T03L 3LKQB 4FZEH 4R0LA 3EYOB 5DVOA 4Z7VE 4HKJA 3RL1B 1MREL 4Z7QE 5BZWB 1UEMA 3WCYA 2DD8H 3HG1E 2VXSH 2X40A 4OGXL 3T0EA 2JB6A 2EE3A 3GMNA 3T77B 5GGVH 3RZCA 2X4TB 1Y18A 2W92A 1G7HB 4PLOB 1I9IL 1X5XA 5FV2A 2IQAA 4ZDHB 2BMKA 1S9YA 4YPGA 2HT4C 5CGYD 1LE9B 3GMOB 4UILL 2AV7B 2ZUUA 3UTSD 4KK5D 4UQ2B 1VFBB 1NC4B 5FOJA 5SWZA 2CXKA 3NTCH 5DR5L 1QYGL 4HWNA 4ZXBC 1A1OA 1RUKL 2DOCA 2F53A 2XWBB 3K2UH 3QI9B 2V5YA 4FQIH 2QSCH 1J8HA 2EDDA 1QA9B 2EXYC 2K9UA 2EH7H 5F3HB 4MJ5B 4WV1A 2GSGB 4Q9QL 5GGUB 4HWBA 1AR1D 3BIKA 4IRSD 4NZUH 3FFDB 3H6JA 4WEUD 3RY5A 5D5MA 2WV3A 4FQHA 3A6CL 2QHRH 1KNOB 5BVJB 5CILL 2GK0A 5CEYA 5TGBA 1P7KA 3ELAT 5GXBB 1IBGH 4NQSA 4K7FB 4L4JA 2P1YA 5IB4A 3RWFA 5DJ2A 1CR9H 3L3JB 2KQNA 3ARWA 4G6AC 4NQDB 4MJ6A 5C0BA 5SWZB 3S5LA 5EG6C 4OCLC 1AD9A 4DTGL 4NO2A 1CFTB 3ARTA 3ZTNL 2X9YA 3C5ZA 2VH5L 1MFEL 3NFNB 4G8IA 3BDXA 5DMKA 3DI3B 5JXEA 1H8NA 1KEGL 2BVTA 2X42A 1RK1A 5E2JA 4FMFA 4MJ6B 3GMRA 3NPSB 1YPZE 4NKIH 4XMLH 4KQ4L 1A7PL 4N5ED 4LCCA 1AGFB 3KPSD 4DGYH 2IANB 5HI3D 5HI5D 4XPFL 2CJUL 3LH2H 3QR2A 1IC7H 4C56A 2Z35B 5BRZB 1TQBC 2R0KH 4H26A 4WJ5B 3BZEA 1EJ6A 4PGCA 4L4TA 1MRFL 4LCYA 1Q9KB 2Z31C 4HIXH 1X6LA 1ACYH 3PWLB 2D03H 5E5UB 5C0EB 5CBEB 4Y5YC 4F80A 1L0QA 3C5ZC 3TIEA 3C5SA 5I9QB 5FA3B 3K4ZA 5MEQA 3AXLB 5KSBA 3NCYS 3CFKA 3OX8A 1MVUA 4F9LA 4FQPA 3AB0C 3FAXA 1U8LA 3U30C 5IV2B 4NNYB 1C1EH 4YGAB 4AJ0A 1J1OH 1KTDA 2G5BA 2Y6SD 5JHDE 4WFEE 5CAYB 2W9EH 4D0CB 2D7TL 1SBSH 4QRRB 4Y19A 1IM9A 1MAMH 5ITBH 3QUYB 2YD2A 3ISWA 4L3EB 4YPGB 1X5YA 2HJLB 2VSDA 3X14A 3FB7B 4OZFG 4WGWB 3B4NA 4X6DF 1I8LA 2OL3A 1BQUA 5IVZA 4XCEB 1A3LH 4IOIA 5HHOB 4KKAC 4I18A 3ETBF 3HR5A 4G6ML 3U79A 4OFDA 2VQUA 4ZUTB 2E6PA 3AREB 1B3JA 2Z8WC 1XGQB 4MHHI 4QKXB 2IBGA 4JY6B 2AJSH 4PP1C 3S96B 1JF6A 2FECL 4LARL 1GHFL 3L6FA 3CH8A 4KK9D 1EHNA 1OHQA 2VDQH 4HWEH 2MMXA 4Q6IA 1YDPB 4X4XB 1N8ZB 3BRGC 3ROOA 3NIFE 2VXSL 3MLWH 2VE6A 1X5ZA 1DBKH 4N8CH 1KTLB 4P2OA 1WISA 3U6RA 3FQNB 1Z6JT 1KB5L 5C0GB 3TO4C 4YXLH 3TN0A 4JZOB 3D85D 1LEGB 1MF2H 5JZ7C 2B5IC 3GMLA 3P0GB 4JDZA 1KIPB 5HVHB 4YHPA 4HBQA 1QSEA 3B9KD 3IDNA 5DA0B 3QT2A 3D5OF 4PJDE 4GMSH 1VGEH 4GRLC 3FO1A 5DJAA 2ICEA 3L3KB 5KVGH 3IDYB 4IMLB 4A6YH 2DTMH 3CVHA 5HHOE 1WBYA 2UZIH 1M05A 1CK0L 4PRHD 4G8GA 4OI8A 2PCPB 5E2VL 1YYLH 5DEFB 1FN4B 1FBIH 4S10A 4NDMA 4JFEE 1CFVH 1J1PL 4Q9QH 2R0WL 3O4LE 1T5XA 5INCA 2FH6A 4Z77A 2Z31B 2YUVA 1R6VA 3RL2A 1NH6A 2QQLH 3P30H 5EA0L 4PLKD 5C1MB 5FHAL 4HH8A 5EDXA 3OWEA 3UTSE 4LK4A 2QKIB 1T7WA 2IAMD 3BH9B 2CLVB 2V7HB 3O8XB 1ZWIB 1KELH 3KR3H 4FQ2H 5E6YA 4OAWB 3GO1H 1XZ0B 4M6NL 4ODSL 1ORSA 5CEZL 4Z0XB 3BKJH 2J5LC 3IDNB 2J8OA 4XPGH 4M61A 4Q6YA 5I1HL 1JZ3A 1BQLH 4ZQKB 5I6XC 1XR8B 4DTGH 5I16B 1KJ2H 4H0IA 1YEHL 4WTZG 2J7LA 5L88L 1I8MB 1VA9A 1QHOA 4UMGA 4X9BA 2BVUA 1KEGH 3QDMD 4GW4A 5TE6H 4XVJL 1IGML 3VXOB 3GIZL 3BZEB 3LQZB 2FL5A 3HZYA 5ESQA 2B39A 5A3IC 5CWSB 5DQDH 4QRRE 4X6CF 3ZL4H 2HA1A 3EAKA 3M17A 3WJLC 4DGYL 3L5WA 2DKUA 4QXGH 2MJWA 1IC7L 3BPCA 3F62A 4HZAA 4XZUA 1S7TB 1JHLL 3ARFA 2BDNL 4XGZA 3DBXB 1NGZB 3O3AB 3MNWB 5IF0B 4IDJH 1DBJL 1YEKH 1E4XI 3S37X 4DOHE 4IHOA 3V7AE 1OWRM 1F8TL 4HS6A 3EFFB 3PGDB 1FAKT 3MODL 3P9WB 4PJCF 4LLYA 3D39D 4YBLB 3O6FD 4NM4L 1IM9B 4PJEB 1K4DA 2VZUA 4WHYG 3S3SA 4FQCH 5I76A 3UZVB 2VYRE 3CXHK 3O6FA 1FV1A 3LB6D 3HE7D 3M45A 1LO0L 2V9QA 3TC9A 5B3NA 3C6LD 5FKAA 1H0DB 1I1AB 4M5ZH 1NEZB 5HPMB 1UM6L 2ZOLA 4CVWA 4U33A 2PTTB 2VNCA 4OFYD 4JG0H 1SBSL 2EZ0D 4HUWB 1DEEB 3CVHH 3UTTB 2DWDB 3SGKC 1NC2A 3SDDC 1T66D 4RFEA 2I9LB 1S9XA 2VZ3A 5B3JF 1INDH 3A67L 1S7QA 2YWYA 3RHWF 5GGUA 4BSVA 2NNAA 3TBWA 4Y16A 5ADPH 5I1LA 1F6AA 1HHKB 4LHUD 4RMWA 3KPNB 5GRVL 1NLBL 3MRCB 4AL8H 1KSRA 2Y5TA 3C5JA 5IMOB 4L8BB 4U1HA 1AO7B 4ZTPH 4AQOA 1K85A 4XCCH 5EIVA 4F7PB 1K3ZA 5GS2H 3OB0H 5IBUB 4PJBB 1QSFA 2DQIH 4D9QE 3EOYG 5F9OL 3VH8A 3STZB 1FO0L 5EBLB 5JXAL 4YQXL 2BSSA 4KV5E 3MBXL 4C58B 1REIA 1CGYA 1CE1H 4JN1L 1G1CA 5I1EL 3ROLB 3S9DB 3RTQB 3BEVB 4HEME 1YMHB 1UCBH 3VFUA 2BJML 3WS3A 5FCUH 1A3QA 2IBBA 1FFRA 4QF1B 3RTQC 5K59F 4K55A 5HXMA 2DIBA 4TRPH 3WN5B 1HOCB 4XNMB 4TVPE 5CGMA 5L9DH 5ID0B 3TPUB 5F7NC 3KPSA 2JJVA 1TXKA 4RFOL 1A1NA 1OD9A 4BQCA 4V1DA 4G3YL 1F02I 4X5WA 1DZBA 3MRBB 3V5HB 3OJ2C 1H9VA 2BY0A 1I7RA 3OSKA 3T08A 4MZ2A 4G7VH 4LLWA 1C08B 1HOCA 4XNMA 1DQJA 3P73A 1OW0C 4C56E 1CD9B 1OF2B 2AXFB 1J9CT 2IAMB 3GSVB 5CP3H 5JOFA 1ZT1A 3O6LL 5EOQH 1BZ7A 3LIZL 3HMXH 3QWOB 2E7HA 4ZMAT 5TQ0L 2W91A 4JFXA 4HS6B 5IESH 1T1ZB 4HHAB 4YHNA 1WQVT 4FABL 3RIAF 2IFGA 1L9NA 4R2GC 5HHMA 3UZQA 3QUXB 1UACL 3BKJL 4NBZB 1T4KA 4ZFGH 4XPGL 5I1HH 1BQLL 4XHQA 3TJEL 4MVBA 1BOGA 3KJ6L 3NCJH 1KJ2L 1MWAB 3MA9L 4F3FB 1ETZB 2B8OT 3QO1A 4MXQD 4WW2F 4AY0A 4J1UA 4R96A 3LEXB 2K1MA 4L8BA 1XGQA 1MQKH 1K6QL 3FQWB 4K94L 3U36B 5HGDA 3T0EB 2OQJA 1RV6X 1DDHA 5I66A 2A83A 4P2OC 3Q1SL 1Z3GL 3EJZD 5FO7B 3VXNB 3HKFA 4EUPG 3OKYA 2XG5A 1N26A 5K9KA 3HZMB 2YKLH 1IM3A 3LN5B 5AG9A 2ZUYA 3FQRA 4DUVA 3ULVL 2SEBA 1W0YT 3LRHA 3SBWA 1D6VH 4KHTL 4QXGL 2LV4A 2KDGA 3FQTA 5D2NE 1LEKA 2IMNA 4CN1A 1JHLH 5GS1B 2BDNH 5SWZD 5T1LD 1H5BC 1T1WA 3VFMB 1DP0A 4KTDH 5CIPB 1TZIB 3FB8A 1ZHLB 3MRKB 4XNUL 4HKZA 4LVNC 4LPTA 1K8DB 4ERSH 5J1TC 1KC5H 3RWGA 1KEML 1HXMB 4HMEA 4U1IB 4BH8A 3F58L 2ATPB 1J05B 3C60A 1PYWA 3LN5A 3GSOA 1LO0H 2X1OA 4PJ8A 5DUPL 4A6YB 3KXFD 1NCUA 1EO8H 2YD6A 2QADD 2WSKA 1TITA 5D93C 1IILE 1KLUB 5JHDD 2A83B 3S6CA 4YUEL 4HMDA 3UO1L 3N85H 5BXFA 3O3BB 2PW2B 2JJTA 1GZQA 4MCYA 1JGEA 3AM8A 1CG9A 3ULUF 3DRTB 5EIQA 1B88A 1OTSC 3B8YA 1KG0B 3MYJB 4XCNB 5ADOL 4JZNA 1U8KA 5EUOE 2VLLB 4X9IA 3GMRB 1U3HD 3A67H 4JPKH 1U3HA 1XCQA 4M7LT 5F6IC 4E5XB 1KLUA 5TDPB 4MA3B 5ISZD 1G7IB 5JW4M 2DIAA 1JWUB 4UINL 1WAAE 3PQYB 3NACL 4WW2A 1JGVH 4PJGE 2AEIT 3RWDB 1ZGLM 3W39B 4TPRL 1CGUA 4HJ0C 4LSRL 2OL3L 5CBAA 4X7SL 4ONOA 1ZT1B 4JZOA 3DMMC 5L8JB 4LSTH 4V1DE 2P7TA 5EU3B 1LQSR 5IJKC 5IM7B 5L6YH 1N6VA 1EEUA 5JXAH 4XVTL 2EIEA 5B22A 3SGEI 4HBCL 5HYJE 4LP4A 1MIMH 2APWA 4NQSB 4P9HL 2VISB 5I8EB 5DQJB 4BK5A 3IXTA 4QXUH 1GC1H 5I1EH 2FZ3A 3LPGA 2CSPA 2NY5L 4PJDA 5D7KD 5DVMA 5ACMA 4GAGL 5IT2L 4NKMA 4PG2A 2AEWA 4NKOA 5T33L 4YK4B 1Q9OA 3B6SA 4QLRA 1F3JA 4RFOH 3QUKA 3CH1A 4PBWD 2XZZA 5KANG 2HMID 2LVCA 3PWPA 1HQRB 3TPUE 4H20H 4QYOB 3R0MA 1G9ML 3C6SB 5D7SL 1IC5L 2VQTA 5EO1A 4PTUA 1RUAL 2L4OA 2AJZA 2X4OA 1ZV5A 2NY4D 3DXAD 3EYSL 4QHKJ 1G7JB 5TDPA 3HLAA 2CDGB 3BMVA 3NFSL 4Y5XA 5DMIH 2I27N 2OR9H 3OKEB 4AM0B 4LSQL 3RI5K 4F15C 3O11B 3O6LH 1NSNL 5SWSB 4D3CH 3MOAL 2NYYC 1NAKL 1JHKL 3RWGB 3DRTA 4WU7B 2PNDA 3WLBA 3LSOA 4HUVB 1MAJA 4XTRD 3QNYA 5HVHC 1F6AB 1H3PL 2CMRH 4Z7VF 4ZFGL 3MRRB 2BY3A 3IXAB 3NABH 1QACA 1IARB 5FYJD 4U1GB 1XGRB 4OI9A 4OCXH 3ZTJH 4M6ML 3VXRD 2NQCA 1IM3B 4KI5F 1MQKL 1LK3L 2MQ0A 2EO1A 5KN5A 2XYCA 1A6WL 3VFWA 2IF7A 2NXZD 1BF2A 1B4JH 1ITCA 2HFTA 4G9FB 5MENB 4P46B 2JCCB 3FN3A 1ZHNB 4EDXA 3V0WH 1Z3GH 4WTXA 3TCXA 1IGFL 1RZ8A 4FXKB 4Y2DD 1T5WA 4Y1AB 4OD2B 3VFUB 5I0ZA 2I25N 1T22B 1ZHBA 2VABA 3MFGB 5C0CA 5D96B 1CS6A 5I1AA 4L8SA 2MCPL 4I4WA 1IAIH 4PJ7B 1EV2E 4AZ8A 5DXWA 4B5EA 5MI0B 3TBTB 2DRUA 4MQSB 4OQTH 4NCC1 4OB5H 3G6JF 4E5XA 4ZO6A 4P2RD 2EDJA 5LCVH 1KCKA 1NDGA 5IHZA 5K9JH 5IFHL 4XPAL 2AEPH 3FO0L 4TUKH 1P84J 1PEZA 4YDLC 4HFWA 4H0GA 3QPXH 3JTTB 2P5EA 4O2CB 1JUFA 2Q76A 2Q8BH 2VWEE 4Z7UE 5L2KB 2HT2C 2FO4B 1UH2A 4IIQC 3X17A 3FT4B 2G75B 2XI9A 4KRPD 3V52L 1YYML 2IADB 4TNVK 3QXDA 4CGTA 3V6OC 1EO8L 2YRZA 5CBEA 4MHHG 1YY9C 1I7RB 5CS7A 4IBLT 4L1DA 4XNXL 3JSSA 4U2ZA 4JKMA 4KKAD 2VKWA 1X7QA 4LCCB 1P9MC 2RFXB 1PSKH 2X89D 3DJ9A 3SDXE 4GRWF 4TVPL 2YZ1A 3D2UA 3IB4A 3I6KB 1BPVA 4N0CD 4NO0A 5DI8A 3MRJA 4PJAB 3WS3B 1NC2D 1EBPA 5TE4H 1ND0B 3GSQA 3V4PL 3MCLH 1EMTH 3ZYIA 4LIQE 2V7NB 1SEBB 4RISL 1YNTB 2CLVA 4QRPE 3PNWA 5KS9F 3BH8B 4M48L 1KLGB 1R5VB 2CIIA 3RGVC 2FBJL 5BV7H 4U2YA 3F8UB 4LSTL 3TH4T 4V2BA 4IHOB 1OD7A 1GZPB 1KENL 3ZYJA 3BSZH 2Q86B 3N1QC 1IAII 3MJ7B 5EZJA 3DBXA 1CDHA 1DVFB 1MIML 1SM3L 4GKNB 3WDJA 4FFVC 4MXWH 1A6UH 3QEGL 3GSWB 3C8HA 1TCRB 5CHNA 1FO0A 3ZKMD 5DFWH 1ADQL 5GIRA 1OB1B 3S34H 5E5MA 2APFA 4PJHF 2ADIB 3TZVD 3EYQD 5GS1C 4XXDA 1CFQB 3VD4A 3BIAX 5DDHB 2VXQH 5F89B 4UV4H 3AY4C 5B38G 2UV3A 4CU7A 5IMOA 3UBXB 4LLDA 4C55A 2VLRB 1GVIA 4PJXB 4WI8A 1I3RA 1RUAH 4D9QD 4QT5B 3ARBA 4JAMB 1UJTA 1OGAD 1JI2A 4MWFA 3E8UL 1S7QB 4L9LA 2A73A 4J3TA 1MFAH 3KWWA 4R7NA 4R97C 3MRFB 3UMTA 4D3CL 4RX4D 5GGTH 4NQCA 2VDNL 5DZNA 3VRIA 3D18B 1VDGA 4MAYC 1D5IL 5F72S 2R0LH 3LN4A 4DAGH 5B39G 3RL2B 3NA9L 3MREA 2EKJA 3DUSA 5B3JE 1WCQA 3G9VA 3TA3C 3RWHA 3VI4E 4OCXL 1FN4A 1FPTL 1RZKH 3I50H 4Y4KA 4LKXA 4UB0L 1CGVA 2DMBA 3C60C 5M94B 1AY1H 1LK3H 3LV3B 2QL1A 4UAOB 5JPMA 1NDGB 4PJFB 4HIIA 4WV1C 3DNKA 4KMTL 5D7LA 5JHLL 1KB5B 5B39A 2E7BA 3ZDZF 3EDDA 4N1HB 4OUUA 2ZUWA 5IBLD 4C4KT 2ZUVA 2XFXA 3TCLB 1TTUA 4XZUB 3MRNA 3U4BL 1FVEB 1CDYA 4KK5C 4HC1L 1GH7A 5I8KL 5HI4D 5D2LA 1DQQA 4JKWA 1JGUL 2BHYA 4XCFH 1S7WA 4KMQA 1QFWM 4GQ9L 2XICA