1ZVSA

Crystal structure of the first class mhc mamu and tat-tl8 complex
Total Genus 67
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
67
sequence length
278
structure length
278
Chain Sequence
GSHSMKYFYTSMSRPGRGQPRFIAVGYVDDTQFVRFDSDAASQRMEPRAPWVEQEGPEYWDRETRNMKTETQNAPVNLRTLLRYYNQSEAGSHTLQRMVGCDLGPDGRLLRGYEQYAYDGKDYIALNEDLRSWTAADVAAQNTQRKWEAADVAESMRAYLEGQCVEWLPRYLEKGKETLQRTDPPKTHVTHHPVSDHEATLRCWALGFYPAEITLTWQRDGEDQTQDTELVETRPAGDGTFQKWAAVVVPSGEEQRYTCHVQHEGLPKPHTLKWEPHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords MHC class I antigen
publication title First glimpse of the peptide presentation by rhesus macaque MHC class I: crystal structures of Mamu-A*01 complexed with two immunogenic SIV epitopes and insights into CTL escape.
pubmed rcsb
source organism Macaca mulatta
molecule tags Immune system
total genus 67
structure length 278
sequence length 278
chains with identical sequence D
ec nomenclature
pdb deposition date 2005-06-02
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1zvsA02
3.30.500.10 Alpha Beta 2-Layer Sandwich Murine Class I Major Histocompatibility Complex, H2-DB; Chain A, domain 1 MHC class I-like antigen recognition-like 1zvsA01
4JFPB 1KOAA 5EIVA 1E4KC 1GC1H 1OAKL 4X98A 4P2OC 1A14L 3C60C 5BVJA 1I7RA 2AK4E 2HT3C 1CIDA 5HHPA 1U9KA 3ZTJH 5LXGH 2R23B 1QO3A 4HKBA 2VH5H 3V2AR 3AB0B 2HKHL 3RWGA 3QBTB 4CL7A 4EDWL 1I75A 4ZPTA 5HHXH 2X4PA 3RA7H 2R8SL 1J05A 5IV2B 5F9WC 3BHBA 3VFOA 2P5EB 4PJ7B 4TQEH 4PD4K 1OAUL 4FQIL 2WUCL 3MROA 5F7EH 4BUHA 3IJHB 3SE8L 1UJ3C 1A6PA 4N1EA 1A7OL 5I8KH 4UT6H 4M6ML 4OTXH 3IAGC 3MJ8B 2BVQB 1NMCB 4X6DF 4U6HA 3FN3A 3RVUC 3WSQL 4DW2L 2OQJB 2OMNA 3C6SB 4H25B 2J3SA 5EU3A 3A6BL 3N1GC 3OKLB 3QCUH 4Y4HA 3VFSA 1EEQA 3CSPA 4QHMB 2ZSWA 4K3GA 3ZTJG 4L29B 4WTZA 4G7VL 3OXRA 3UTTA 1CS6A 1NBVL 3WXWL 4OZHB 5FYLL 1MCKA 4H1LB 1J1OH 3ZMRA 4RA0C 4U1LB 4N90E 5FCUH 2PUQT 4X6DA 1MIMH 3CFEA 4WUUD 2H6PA 2Q86A 4PLJC 4DAGL 4JCMA 5F9OH 1KUMA 3ZKNC 2AQ3A 3HCVB 1U58A 5D9SB 2I9LB 1JIBA 3ARVA 5EU7E 3BEWA 4H1LH 4PJAF 3LQAL 3OV6A 2HYMA 1K3ZA 5GS0D 5DA4A 1DEEA 2CGRL 1P4BL 3C5ZC 5L9DL 1PDKA 1X5GA 3IDMA 3AROA 2VDRH 1NUDA 3HE7C 2JJSA 3DVGA 2EO1A 4IS6B 2C3HA 5D96C 1ADQA 4YBQC 3RWFB 1R24A 1TTFA 3HNTH 4MD5A 3WE6A 2AK1H 4KK8D 4EI5D 4PJAA 1JYWA 3CNKA 1TVDA 5GZOD 3U0WL 4XPFH 4UBDD 1OP3K 4BFIA 3K4ZA 4HUUB 4NM4H 4V2CB 3B2UD 4M02A 1HWHB 4S11A 4TUKL 5JNYA 2B39A 2DAVA 3PGDA 4I0PA 1G0XA 3H9SE 1F6LL 1DN2A 2I26N 5FKAB 4WJ5B 3BPLC 3DO7A 4YNYA 3RWHB 1UZ6E 4JM2D 2WBJC 5D5MB 1CN4A 3MRHA 1NKRA 4UOW1 1FRGL 2LFGA 4PJDF 3L5WB 1RV6X 2WLZA 1N0XH 1YJDH 2HWZH 5EIIA 1S7SB 2AK4D 4FTVB 1OGTA 3T08A 1LEIB 5ESQB 2O5ZH 1TTUA 1TFHA 4MJIB 4I48A 1XGRB 12E8L 2FCBA 1Z5LB 1S7WB 4J1UA 2IFFL 2XWJA 1HQRA 5DJDB 5H94A 1MWAA 3VXSE 4DTGH 2XFXA 4PJHB 4XP4L 1GAFL 4GS7B 3VRLF 5DD5L 2W60B 2XG4A 4OZ4A 1EO5A 3P73A 4PJDA 4LFHG 1II4E 3VFPB 1OSPL 1O5DT 4K94L 5B3JE 3EZ8A 1U3ZA 2YPKB 3LEXB 4ERSL 4LOUC 4Y4FD 5HYEA 3TBVA 3CMGA 3UJTH 4AH2A 1KEGL 5CS7A 2XQYK 4OF7A 1L9NA 1OT1A 2NY0B 3MRRB 4HWZA 1UQSB 4QF1B 4I1NB 3VRJA 5KS9E 3UPAA 2YUXA 4FQLL 5E8EA 4JO2H 1HHGB 5D1ZB 1VENA 3MRNB 4CW1B 4F9PC 4GW5A 3S96A 3CUPA 1HH6B 2IPUK 3O6MH 4J23A 4MA8L 2EH7H 1VEMA 2DWDB 1LMKA 4L4TE 1JTPA 3FCTB 3E2HC 3IFOB 5DC4B 4CN4A 1XFPA 3ZE2E 1FG2B 3BQUB 3W9EA 1ACYH 4Y4KA 4XCFL 1DTUA 2E27L 4X5XA 1JGEB 1HK6A 3GHBL 3H6JA 4LLQB 2EXWC 4WIQA 3WJLC 4PJCE 4MAYA 1UACL 2LVCA 5F6IC 5D71L 4E42B 5DVOA 3SN6N 1PKQA 4GRWE 2HVKA 4NKDA 1FO0B 3MBEB 2D31B 3ROOB 5HYQA 4ZOCA 4N0UA 5SWZA 2OK0H 2QSTA 2B5IC 2J5LC 5EZJB 2ESVA 3L7FB 5I1EH 1YY8B 5JOEA 4F7EB 2XT1B 3FQNB 5BRZE 4KAQH 1SYVA 4XHJC 4K3HA 2MQCA 1Y0LB 3WIFB 3OKMA 4HKXB 4JJ5A 1LNUB 4KRMB 1FO0H 3QUZB 4NP4L 4TOYL 4MQ7A 1I85C 2GJ6D 1YECL 3QIWA 3NCFB 5TDOA 4PRDA 2W65A 2ERJC 1XGQB 1U36A 2Z35B 4L8DB 4PJIA 3WNPA 1UYWL 3C09C 3P9WB 3AMKA 3H9SD 3ECBA 3P11H 4NJ9H 3O9WD 2VDPH 3I6KB 2NY3D 1QBLH 4PRPA 5EO0B 1PGRB 2NNAA 5I74B 5C2BH 1DQTA 2R39A 3RVXD 5EO1A 3KHOA 3RBGA 4OLZH 2NY4D 5DTFB 3QUML 3AXLA 1CFBA 2C1OA 3PL6B 1BBDL 5JLZA 3K8KA 4G8GB 2XXCB 1JZ2A 5IR1A 2NY7L 1M7XA 2OI9B 4WV1A 1QFOA 2E7BA 4TVPL 4Z5RB 3U79A 1J1XL 1CXFA 1PEWA 1XCQA 2E7CA 4P5MA 4Q7DA 2ICCA 4FQ2H 3P0YL 3VXSD 3B3IB 4OV5A 5FV2A 1QR1B 1VFMA 4MD4A 3PDOA 4Y1AA 1HSBA 1Z0MA 1PG7X 1Q9WB 5HYJE 4DEPC 3MOBH 3TO4A 5IHLB 2CUMA 1KPVB 4URTB 2A77H 2R29L 1YZZA 3QWOB 4LCWD 3FONB 4MCZA 1YEEH 1SMOA 4UT7L 3UTZA 4CRPA 5GIRB 3QDHA 1HINH 1KN4H 4DGVH 1IAIL 1UXSB 3PXHA 4R4BB 4ZXBD 2HRPH 4Z77A 2RGSA 4NDMB 4JDTL 3TA3A 5J1SC 2R1XB 2AV7A 1BX2B 3LKRA 3MXWL 4FZEL 3RWDA 4Y16D 3NPSB 4AZ8A 4WUUA 1A1NA 4Z7VB 4WO4D 3JV0A 5T1KA 2J12B 3EKCA 4L4TD 3RAJH 4HBCH 5DO2D 1HDMA 4HPYL 1Y6KR 4S1SL 3VMPA 1T22B 4P2CG 1RVFL 5L7XH 2ZUXA 2FJHB 4X0KB 1CI5A 3VXNB 2D3VA 1IKFL 1LK2A 3DSNA 5DF0A 3ARBC 3IU4H 5TE6L 1RK1A 2VMFA 3F7RA 4FQJL 4HZLB 1MCNA 5E9DB 3V0WL 2DTSA 4KTEH 1H3TA 2VN4A 3T0EE 5M95B 1QHOA 3EO9L 1ERNA 4L3EA 3HUJF 3QQ4A 4KHTH 1CLOH 1TMCA 3VDBA 2APTA 1KCRH 4PRIB 43CAA 1FH5H 3EDKA 4G8EB 3GMMA 4JM2F 3AREC 1H3VA 3UJJL 4LLMB 2DYPD 2HFEB 4HXAL 2V7HA 5I8CA 2LE9A 5ICZA 4OF8A 5JIIA 2PCPA 4PJ9D 4HF5L 3DARA 1RZKH 1FPTH 4K23L 5BRZD 3FB8A 4OKVA 4BH8A 1RJYA 2UZIH 3HUJA 3SGDI 1YY9D 3QJHB 2R0WH 1NFIB 1E4XH 4S1QH 4Z95L 3TN0C 4ZTOH 4KUCD 3MMEB 5LKNA 3SKOA 1CE1L 2CLZB 5E2WH 2FWOB 2BY1A 3P9MB 3RIAK 15C8H 5ADPL 3AS0A 5DR5H 2AK4A 1F4WL 1KYOJ 5JHDA 1JWUB 3FT3A 5CD5D 3P0VH 2HTLC 2V2XA 3ULSA 3OJ2C 1FL6A 3ESUF 4KQ4H 5DJCB 2PTTB 4IDJH 4KHXH 2UWEE 5CZVH 4NQSB 5ALCL 4KKBD 1AXTL 2G9HB 2AEPH 1FFQA 3CVHA 1JNNH 3CZFB 4X4ME 1FNEA 5L6YH 2ZNXA 1QFPA 3U0PA 5IB3B 2FBJL 3WL9B 3HZYB 4DFIA 2OZ4L 2Z9TA 4Y4FA 3F7VB 1OLLA 4IMLB 3BUYA 3S4SG 1PX3A 1JWMB 4Y8AA 2AJ3A 4JRXB 2EXYD 5CJOH 1F00I 2X4NB 4J4PC 2VXVH 2W0FA 4GAFB 5HYJD 3SE3C 4DGYL 3JV4A 3KYMB 4JR9L 5AD0B 2GQHA 1HHJA 5A43C 1JPTH 4MS8A 2L4OA 2P47B 4FQXA 3W0WB 3O3AA 3W39B 3VFMA 3VXQA 4JHAH 2VLJD 3QUKB 4UMGA 4L5FH 5KN5B 2FBOJ 4JZOB 4PG2C 4HCRL 2PW2B 4JKPL 3SKJH 4JRWA 4YGVB 3B83A 3L3KB 3Q5OA 4IRJC 4OZGB 3O45A 5D2NB 2EE3A 2WAHA 4Y2DD 4Y7MA 1A2YB 2HVJB 5TFSH 3BXNB 3UYPA 5JW3H 4CVUA 4RNRB 1RURH 1WWBX 2R2HA 4LSDA 4YBHA 1T5XB 3X3FL 3VG9C 2HLAB 2IH1B 5HBBA 3NA9H 4DVRL 1RD6A 5HY9B 3HHRB 3T0ED 4XNQB 1GCFA 3SBWA 2F15A 1UWXH 3O8XA 4RIRB 2CPCA 4KGLA 2CUHA 4QY8B 5ID0B 4OKDA 4I77L 3T4AB 5CZKA 4J6RH 5EORH 1UZ6F 4UB0H 2YD7A 3WFDH 2K7QA 4QYOB 4F7CA 4DQOL 4JANA 4JO1L 2DBJA 2QQNL 5DRWA 4PP1D 5LGJA 3D39B 1X4YA 1F4YH 1DLFL 1G7LB 1HHKA 5DWUL 3TBSB 4EQ3A 5DC0A 2BSTA 5KJRH 3LQZB 5D7LE 2I07B 3OWEA 3QXAA 3VXMA 1ZOXA 2WINB 3S88L 2YBRA 5C07B 1T7WA 4P4KB 5DHVB 4GRLA 4EDXB 3U4EA 2FL5A 1RFDL 3B6SB 2VERN 4R0LC 4QRSB 1E6JL 4OQ1A 3SJVE 3VXTB 3I9GH 4ZAKB 5B3JF 3ZKMD 1XR9B 5DK0A 5KVFH 1F4HA 1QNZH 4HBQA 1WV7T 1VFOA 5DHVH 5ICYB 3BN9C 5ECJE 5JDJA 1FBIL 2XRAH 2ZCKL 4HKJA 4XGZA 1MFNA 4NQCE 1FFPA 5I19L 3VXSA 1PSKH 1S7RB 1IL1B 5B22A 4MZ3A 1NAML 5KS9F 3KYOB 3SE9L 4UT9H 2Q76B 3OJDA 3SDXB 5I73B 1S7QA 5JUEH 4FQHB 3QPQD 4HXBL 1JK8A 4NKOA 3MV8E 4QRRA 3B5TA 3VFTB 3RWJB 1IKNA 5IIEB 1T66C 2BSRA 4OI7A 3LKOA 1T04A 2BZDA 5JQHC 5DZNA 4HQQH 5DD0H 4GW4A 5GRUH 1KPRB 3ZE2F 3LDBC 4AEEA 3V7MA 4EIZC 5DQDH 3THML 4HLZG 4KPHL 3KJ4C 4AG4H 1QSEE 1BIHA 4JCLA 2VDOH 4OCWH 3KG5A 4OZHE 1WSST 5DQJA 4IJ3C 5C0EB 4OT1H 4LSSL 4LHUB 4PJCF 4L4TA 4GMSL 2QHRH 1J5OL 4XNMA 4GRWF 3JV6B 2AS5M 1T1YB 2ZZUT 5TE4H 2Y6SD 4HV8A 3RY6C 4XMKL 3BESR 2UYLA 1CGSL 1YEIH 3CAFA 5F3HA 1AO7E 4PB0H 3PQYB 2CDFA 2AVGA 1HIMH 3SEPA 2ATPB 4ZSOA 1NEZA 4F2MA 3IDXH 4HH9A 1HQ4A 2DM2A 1DCLA 4PJCA 2EYTB 5B8CC 4KUCF 1SVZA 1VGEL 1TZIB 2NXYB 5IMKA 4FQ1H 3TNMB 2DYPA 1IMHC 4W81A 1R3LB 3UBXA 4XCYA 2F74B 5BW7C 5FECA 1EFXD 1DQJB 3HPJB 1E4KA 5DSCA 4YDVA 3MV7E 5DLML 2A83A 4P2OA 5L88L 4PJGA 1LP9A 3IFLH 3K2UH 3HS0A 5FKPB 2FSEB 5HGHB 1LE9B 1GSMA 4TUOA 1ORSB 1T0NA 5IB5B 2HTKD 1C7TA 1P2CA 5F7LB 2EE6A 2AQ2A 3FFDB 2VL4A 4ORGA 3FTGA 5FF6B 5IVXB 3NTCH 1UWGH 1MNUH 1B4RA 1EX0A 1BQHG 4ZDHB 3O2DH 2FNBA 3MJ9L 3HLAA 3EAKA 3D6GA 4UNTA 3TV3H 2JJVA 3JWDC 2YRZA 1I9JL 4ZUVB 1G7HB 4LL9A 4FMFA 4Y19E 1I1RA 4WTXA 3F65A 1UJ3A 3PWJB 4HWEH 4LLYA 1NGPL 5J12C 3QO0B 1MJ8H 3SJVD 3UYRH 4HUNB 4PJ5B 5E7FA 4M7KH 3L9RA 1T89C 3WIHA 4KKCC 2AXHA 2AJZA 5E2VL 2EKSA 1NLDH 2A6KA 4O2CB 4ODTL 1QFWH 3V52H 1YDPB 2PXYB 3WDIA 2WY3A 1AQDB 2BFVL 2DQDH 1HI6B 2IQ9H 5JXEC 4NQCD 4WUKL 4X6CE 5BV7L 2IAMD 5T1MB 5E2TH 1JF1B 1GIGL 4I9WE 3T65B 3DRQB 2BVTA 3PP3H 3VXUB 4WGWB 1E4WL 1ITCA 1TJGH 4O51B 4FS0A 4JFFA 1AGDB 3F6IA 1IVLA 3GFUA 5HYJA 1P4LA 3Q48A 4NGHL 4GBXC 3ZHDA 5KVMC 1HHHA 2LTQB 3K46A 4J3UA 1KIRA 4D9LH 4UV4H 1BIIB 5DMIL 4DGIL 3R0MA 2I5YL 4XZUB 4ENEC 1J9CT 4LPCA 2YEZB 1OTSC 2Z8SA 3SO3C 1K8DB 3DXAB 1AGCB 1MELA 1QSED 1BVLB 4HK3J 5ALBL 3C5ZA 1UB6B 5BS0A 1S8DA 4UU9A 3VGAB 4TSAL 4Y5XB 2EZ0D 1A9EA 4PB9H 4U1IB 4BSJA 1RZJC 1BD2B 4UNUA 3TT3L 5CUSL 3HE7A 4N1CA 4X7SL 4GMTH 2B1AL 4UIMA 1T7ZA 1EAPA 2G60H 4NQXB 2VZOA 1JV5A 4HX1B 1DBJH 4YE4H 1V8HA 2YSSB 3MGTA 1ETZA 4ZFOL 1I8MA 1YNLH 4G6AD 1AO7D 3TCLA 4UINL 2DJ4A 4XBGB 2ARWA 1T5WA 5F71A 3T0EA 1AE6L 4J3TA 2O26U 3KPPB 1A7PH 2VDML 3QZWG 1CR9H 5HYIA 1PAMA 3QXUA 1AD0A 4WU5B 3U36A 4DKEL 4LFHD 3SY0A 4UUJA 4HEPG 2JK5B 4XVTH 4NQVA 4HWUA 2AJXL 5L8KB 5E8DL 1JNHA 4G6ML 2Y4SA 2VZUA 1TQCB 4X7TA 3GKWL 3EHBD 4FG6D 3F5WB 3HZVB 1BGXL 4ZNEA 3GJFB 1PLGH 3MV7D 1FORL 3CXHJ 4FXGA 4PY8J 4NHUE 2OS7A 3O4LA 3OZ9H 2OMBA 5SWSA 1UA6L 2D7TL 1RIUL 3LZFL 2UWEF 5IK3A 1U8MB 1WAAE 4J3OC 2E7LC 3RVWD 2E6PA 3GJFH 1I3RA 1QSVA 3Q6GH 1H3GA 3N85L 5BMFL 2BMKB 1DE4B 1NL0H 2Q7YA 1ZVSA 1MOEA 1X5XA 4QHLA 5EBMA 1TQBC 5I0ZA 2OTWB 4RFEB 1IZKA 3N06B 3QEGL 4MXQC 4Y19D 3GMOB 3BMWA 2DIJA 3KPOB 3IDGA 2ORBH 1QYGL 4MJID 3G5YA 1CT8A 1EIBA 1IEBB 4RFOH 4ZYKA 1UJTA 2P48B 4JRYE 4OLXL 4Y2OA 5HJ3B 3B9KB 1BBJB 4PS4H 4G6FB 1GZPA 2KQNA 3HZMB 4ELKB 5J06A 4UTBL 5DRZB 3L3HB 4I9WD 3CH8A 2LU7A 4PP2B 1OTTD 2X1WL 4KC3B 4NHCL 3NABL 3PHOB 4HLJA 1KLUA 4XNXH 2X41A 4XWGL 4QRUA 5HDQL 4O2EA 2YD1A 3BKMH 3MUZ1 3VFRB 2H2PD 3QIBC 2NX5A 4PJEB 5J3HD 4C59B 4L9LA 4ELMB 1A3RH 2XA8H 3MLTA 5T33L 2XWBA 4UQ2B 3SDDC 3WJLA 3FB5A 2WBKA 3BD5A 5DUMH 5B38G 5K9JL 4V2BA 5DZOA 5JHLL 2WWKO 4FFZH 3DV4B 3U6RA 5D6CA 4TULH 3GSNL 3ILPA 1IGFL 5B39G 5AWNL 3DECA 3X11B 5DEGA 1K6QH 3FOLB 4PRBA 2P46B 1CU4H 1EVTC 1X5AA 1FNGB 3QQ9C 1VERA 4G7YH 4OB5H 4LIQL 2WUBH 2V2TB 4XPGH 1NKOA 1T0PB 5GS0L 5DD6A 5DK2B 2J6EL 3OKNB 4WFGD 4YXKH 1BWMA 3BP6A 4CMHC 5IMLA 5F88A 4F9LC 1AGFA 2GTZB 1L6XA 1MAJA 4S0UC 3FOMA 4EIGB 5HPOA 5CIPA 5I76A 3TO2B 4YUEH 3MNVA 4Y8DC 2VE6A 1EEYA 2WWMD 3OMZA 4M6OL 4P3DB 3VXPA 4XAWL 1AFVH 2H32A 1EHXA 5D7IE 5JO5A 4JO3H 2CH8A 3H9HA 1QLEL 3CFBA 2F58H 1BLNB 4ONGL 1U92B 3PGFH 2BDNH 1IM9B 3TWCL 2PF6A 5D7LA 1B88A 1WC7B 3IXTB 3QXDB 2HN7A 3H3PH 4X9GA 5F7YC 3WUWG 3DX7B 2V9RA 2Y5EA 2BNUB 3P9LA 5KBNC 1DVFC 4MX7B 1RIVL 1UM5H 1NC2A 2E9WA 5GS1A 4WW2B 5TH2B 4JN1L 4TTDC 3MX0A 5C6PB 1DQLH 1ZHLA 3FFCB 4WFHD 5D7JB 4CNIA 4F3FB 4QGYA 3NFPB 2FH6A 4OIAA 4NO3B 4PGDA 2UVEA 2X70B 4PGZA 5C0DA 3O3EB 3KPMA 4PV9B 5JZ7C 5CJQL 3GMRB 2D7NA 1DFBL 1MCOH 2EIZB 3D3VE 4NZDA 5KZCB 2JF1A 1F3RB 5EO9B 4JRYD 1KEMH 1MHPH 1LQVA 4C4KT 3ARTA 3LPFA 4NRXA 5F6HJ 2F8VA 2EDXA 2PTVA 3QDGB 4ZTPH 1RZFL 3MV8A 1CK0L 4JE4B 2YD6A 1MFEH 2YUWA 1G7IB 1HHIB 1MCJA 2VABA 2YPLB 4HJJH 4U6YB 5E5MA 4XWOD 3B2VL 2XY1A 3GEWB 1ZWIB 5FYKU 3O3UN 3FZUC 4XMPH 1QPXA 3CU1A 5DMKA 3W9DA 1N6VA 1OARH 3ARBA 5DEFB 4CADB 3WD5L 3ZZ1A 1Q72H 2CK0H 2FGZA 4S10A 5AZEH 5IBLD 1XGYH 3WKML 4KRPD 1MJ7L 3MZTA 1PVHA 4XP5H 5INCB 1TPXC 3BE1L 3CC5B 5KSBA 2UZYB 1NEUA 3QEHB 3AREA 4RMWA 1LE5B 1RQ5A 3MRMA 1YEHL 2FJFA 1FIEA 2VLLB 1OCWL 2AGJH 3VGEA 3FQUA 4K55A 3MNZB 3SCMB 1BREA 5DA0B 5HI4C 1G7PA 4XC3H 3C5SB 4UDUB 4MVBD 4P2QB 3NGBB 1NJ9A 5I16B 5CINL 3BEVB 4OGYH 2IQAA 4GKOA 1BEYL 3MRPA 1S5HA 1CFTA 1C5DA 1VDGA 4HEME 4N5ED 1MEXL 3TN0A 4YDIL 1MPAH 3VWJB 1F4AA 4Q9RL 5T3XE 3BO8A 1RULH 4NZTH 1NLBH 3NCJH 1ODAA 3HI1A 3W82A 2VWEE 1OL0A 1ULVA 3MV7A 4HC1L 4XVUD 3SKMB 2B0SH 4DOHE 3IU3B 3KLAA 5HGAA 5T5FL 2QR0B 2GSIB 3R06B 2JJTA 5DI8A 3OJMB 5IHBA 3IAPA 4WY7L 3MUGB 2O5YL 2CRZA 1NBQA 5FUCC 4OUUA 1KCUL 5CD3B 4D8PA 3IB4A 5TF1H 1BJ1H 2NTFB 3SPVB 4QHUA 3TVMC 4RBPK 2UV3A 1KNOA 2FATL 1TJIL 1MF2L 3BKCL 3UO1L 1X5JA 4JAMB 5B4MD 4W4OC 1Y18B 1XF2A 2ICWA 4X6CF 1PZ5A 1CF8L 4ODWB 1A7RH 4LVOB 2MHAA 2A9MH 4NN6C 4HDIB 1JWSB 2QADC 5F1IB 4N1HB 4G59A 2F5BL 4J4PA 3G6JB 3HC0B 3PF2A 4FQQA 2A0LC 4K3DH 1NC4D 4JGJA 3JTSA 5D1XB 5C0NC 3SDYL 5C3LD 3HRZA 3HB3D 4U3CA 3Q0HA 1WQVT 1J8HB 4WHCA 4M3KB 5FOJA 3ERYA 3Q1SH 3BVNB 1JHKL 4JQVC 5GHWH 1Q0XH 4X6CA 3NVQA 5CEYB 4KK5D 3D3VD 4WWKD 3FB6A 4KJWD 3L3IA 4NYLB 2XKSA 4BKLB 4GSDH 3PWNB 2ZPKL 2WK2A 4IRJA 2ZOLA 5HYSB 1DDHA 4OCRL 5JPNA 4IOFC 4YHKL 2OL3H 3QXVA 4QRQA 4UV7H 4ZUUA 4CMMA 3BT2H 2ZCLH 4ZQKB 1A6UL 3HKFA 3LHPH 1F2QA 3HG1B 3W0WD 5EBGA 3OAUH 4NN5B 5IW1A 4YO0A 5IHZB 1KTDB 3W11D 3TIDA 4KZEL 4Y5VB 2ADJB 4YXHL 1A7NL 1GGYA 3RKDD 3SQBA 3S37H 1I7UA 3EYVB 3OAYK 1VFBB 4LNVA 4LNRA 1CG9B 4X4XB 1S7VB 4OCYH 5GGRB 3IDIA 3GMQB 3ZYJA 5LBSL 4M7ZC 1N4XH 1A3LL 3QHTC 4GFTB 3MUJA 5ITBL 2VC2H 4PV8B 4OCSL 1XF3B 1D5IL 5DFTA 1WTLA 3NAAH 5E08H 3BW9A 2IFGA 1V7ML 2VSDA 2Z92B 4LEXH 4YAQA 3V4VL 2MMXA 3F7YA 4KMTL 4LRNH 1DUYB 4MA7L 4DVBA 3IT8D 4ZPVA 1CWVA 2CJUL 4Z7WB 2CIIA 3EO0B 4E41B 4XAKE 1ZK9A 4JPVH 1WAAF 3DROA 3MV11 3S34H 2ZUTA 4ZODA 4TRPL 5BZDA 1V3JA 1D5BA 4F80A 4R0LA 5FOBB 1X3DA 2X4OA 1Z3GH 3RPIA 3KWWB 4YPGA 5IWLC 1LO0H 2GAZB 3VWKB 4NBYB 1QA9B 2C1PA 5MERB 1MFCH 3EYOA 2AQ1A 4XPTH 1BJ1J 2A73A 2NLJA 1FFNA 3EOYG 1WAAA 4KROC 3L3JA 1KJ2B 1W72H 3DETD 2ITDA 4DZBA 5IOPB 4OF5A 2A1WH 3ILQC 4TPRH 2JIXA 1EEZB 1RUQH 3ALWA 1OP3H 1FAIL 4FXKB 1R5IA 5HDOA 2APWA 4CBPA 4J2XA 3C08L 3IKKA 3LV3B 1S9XA 4OD1H 1BOGA 2DTMH 5E4EC 3QI9C 5CWSB 1KJ2H 3HNSL 1BZ7B 4TUJA 5EFIA 4MSWB 1KLGA 3IXAA 2VDLL 5T1DH 5DQ9B 2MTPA 5ESAB 4X5WB 1TETL 1N3NB 4JRYA 5IVZA 1GPOL 2X44D 3Q5YA 3RL2B 3FQWA 4KJYA 1N8ZA 3BSZH 1A6ZA 3IDYC 2IG2H 3ULVC 3C6LC 2X40A 2ITCA 4CN6A 1EGJL 1MCIA 4KY1H 5KVDL 1A1MB 3QDJB 1B0RB 4GLRH 4R9HA 2BY0A 3EBAA 3I75A 2C3VB 1TVBB 2G5BB 5CAYB 4L8BA 5F1NA 3ARZA 1KN2H 3FMGH 2X9YA 4NBXB 4PD4J 2Z0BA 2EDKA 5MP6L 1NCAL 4LEOB 4H88L 3DIFA 1EHLL 3L3GB 5CEZE 1SBBA 3QR2A 4RCAA 4U0QB 2MCG1 1MUJB 3U2SA 3TYFA 2ICES 4U49A 2F54E 1HYRC 3G5VB 3EYUH 2OLDA 3CCHB 4LHUD 2ZUQB 2CLVB 4LPTA 2BJMH 2N4IA 4EI6A 2DOCA 1KF9B 1JL8A 1S9VB 2VQ1B 3SDCC 1G9NH 3LH2L 1S9KC 5D1QD 3HI6H 1JTOA 2FLRT 5I1DB 2BSSB 4A2LA 5KTEH 2ENSA 5E99L 3K1DA 3LKNA 4EN3D 5IHUL 1Z9LA 4ODVH 1TCMA 5D7IF 4X9BA 4KVCL 5DFVC 3K1KC 4N5EA 4KKLD 1YEDB 3AB0C 3MZGB 2VR9A 2BY2A 1S78D 5FGBA 5I18L 1P84J 1CDIA 5CBAB 4NPYA 1T2JA 4X8JB 3GGWA 1KG0B 1ZEAL 1A22B 2NXZD 1Z9SA 2BCKA 4XP9H 3S4SA 4RGMB 3BKYL 1MI5B 4XAKD 3U0TB 2A74A 3PWUA 1F90H 3AFLA 3VRIA 3LEYH 4YHPA 4NSKB 2DQCH 4NKIH 3DMMB 4ZFZA 1H0DB 3TIEA 5FA3A 3Q6FB 2XQYG 5D7IA 3MGAA 2XACC 1NMCC 4HWBL 4WWID 2IBBA 3UPCA 3G5XB 1T89A 3C8KA 2QV2A 1ZT1B 5FYJH 1CQYA 2J7LA 3EFDL 1AP2A 4PGJA 2R1WB 5GGRY 3QFDB 2WLYA 5KSAB 3N1MC 2QLVB 2X7LB 4J3XA 5EU4B 4PRNA 3MRFB 1X6LA 4KKNA 5IQ9B 1KIUA 4MJ6A 8FABB 2HFGH 1CFQA 3T2OA 1K2DA 1ED3B 4X9HA 2MCPL 4L8CA 1WWWX 1MCPH 3L5JA 1NC4A 2AJYL 3T8XA 3O41A 4F7TA 1RZ8B 4GBXA 1U3HC 1QRNE 3MV9B 1IM3A 1R3HA 1CXLA 1IBGL 4P59L 3GDBA 2GFBA 3FB7A 2Q8AL 2AV1B 3KPQA 4DN3L 5ISZB 4F58L 3GSQA 2PXYD 4ZFGH 1I7TA 4NO2B 5E6IB 4NN7B 5ANMB 1GGBL 1HXMA 2NY2B 4HH8A 1MHCA 4KJQC 2YKLL 4YEFA 4IHOA 1NFDB 4PRHE 1A3QA 3F58L 3F8UB 2IH3B 4O9HH 1P1ZA 1MRDL 1LEGA 4YHNB 4P5TB 3X13A 1VFUA 3Q5TA 3N9GH 1ZXQA 1OWRM 2GJZB 3S36H 2XNAB 2VLRA 3V9FA 4ELME 1I9RL 3ZL4H 1YC8A 1ZHBA 4WI3A 2IANB 4M62L 2AW2A 5EZLB 3EYSL 2X1OA 1Z6JT 2XN9E 1ZA3B 4O02H 5E95B 2PR4H 4P99A 4WFFE 3GK8L 2RQ8A 1CDJA 4MMZC 2R2CA 3QEQB 3ULUC 3UYOD 2WSKA 2F54D 4MNQB 3P4OA 5BJTA 4NQEB 4JHZA 3LB6D 4Q0XL 3PP4H 1ZHNA 1SQ2N 4J3SA 5IFAL 3O11B 5CBEB 2L0DA 4PY8I 2OTUB 1M05B 1W0WA 1YEJH 5GGVH 3EYFA 1EO8L 2CLRB 2H45A 2W9EH 4LPWA 3UZEA 3BZ4B 3U1SH 3ELAT 2EDJA 3BPOB 4JPIB 3PHQA 2V5SA 1AQKH 1F58H 2AEWA 3KJ6H 3F6LA 3ZT6A 3K7UA 3KS0J 4H5SB 4AMKL 3TBYA 1UKTA 2FEDC 3GIVB 4NRZA 3BP4A 1NCBL 2OP4L 4PJBB 4XPBL 1G6VK 4XC1L 2IF7A 4CVZA 2PO6B 2XZQL 4MXQA 2A9NL 2EIEA 4HS6B 4I2XB 3MNWB 4JFXA 3X14B 1CDCA 5C6TH 5IESH 1GC1L 1WWAX 4JPKL 5FO8A 1QFWI 2OYPA 3VGFA 4ALAH 3DYMA 2XXMB 4LLAA 4X80L 5EOTA 2NY0C 1S7XB 5LXGL 1EAJA 2XZCH 3IKCB 3WNMA 3STZA 1XZ0B 4GUPB 5I66A 4JG0L 5D1ZC 5FA4B 5HHXL 5DGRA 3GUTB 2AJVH 1AXIB 2X4SA 5EG6C 5CJXC 3JTTA 3BYTA 2X4QB 4R96B 3S35L 2VUYA 4TQEL 1KB5B 5I9QB 5F7EL 3MLRL 2FB4H 5FCSH 3BQUC 1QRND 1YUHA 5IBTH 2COQA 4OTXL 5C2UB 1Y6NR 3D25A 1Q9OA 3B9KD 5I71B 4NQTA 5C0RH 1KB5H 3SDDA 4GKNB 3QO1B 1FG9C 3ARQA 1MAML 4MAUH 3QCUL 1XF4B 3GSVB 4QHNB 3MBEC 4JZNB 4PRHD 5KSUA 2XKNA 4G8IA 3DUUA 2GEEA 3CMOL 4IRSB 1DUZA 1JPSH 1JI2A 3QRGL 4KK6D 1C5CH 4PIRF 4Q6IA 1LQSR 3DRTA 3JUYA 4YR6B 4FFVC 4RQQB 1AC0A 2EDRA 5FCUL 1F2XK 2DQUH 4I3GA 1KIQB 1MIML 4IDLA 4YHIB 4S1DD 1G7JA 4M8VA 2P8MB 4U6VH 5DS8B 3QUZC 4DZ8A 3QSKB 3E6FB 1FLRH 4LCCB 3UZQA 3QWQB 4D3CL 2XN9D 1PQZA 3MJ6A 4UILL 4PR5B 4F9LA 4LAQH 5D1QA 3SGKC 1INQA 1P7KA 5KVEH 1ZA6A 1BVKA 1NCDH 1INEH 1QFWM 1T7YA 3FO1A 3NPZB 2VOTA 1SYSB 5DVKA 5I2IA 4EN3A 4X6EB 2HT4C 5F9JB 1NPUA 3GSRA 5TGBA 2HH0L 3QH3A 2VDRL 4OBRA 3PL6C 4UZGA 3KPRA 1L0QA 2DLTA 2ENYA 2RBLA 5CMAB 5A3IC 4UQ3B 4K9EH 4NO5B 2KH2B 1T1XB 2AK1L 3DV6A 5EOCH 2OI9C 4HJGA 3BGMA 1IE5A 3T77A 4XPFL 2P1YA 5D93B 4X99A 1Y6MR 4X98B 5CJ5A 3QP3A 1EMTH 1I7RB 4NM4L 1B3JA 3LKPA 5I1AA 4Q9CA 1DVFA 3DUHA 2B2XH 5HHPB 3GZKA 2FRGP 2RCSH 3DSFH 1H9VA 3WKNA 1QO3B 5F21B 4PLNC 3RWGB 3RGHA 3MLUL 4ZPTB 5F70A 2X4PB 5FYJU 1WK0A 3RJQB 3I6LE 5DJ8B 1TNNA 3MXVL 1KPUA 3BHBB 1HH9A 1PJ9A 3O6KH 1N0XL 2HWZL 3VFOB 3U4AA 4QOKA 2RHEA 3QUXD 4L3CA 4NO0B 3RWIB 3TT1H 3MROB 2W9DL 3DBXA 3H0TA 3D0LA 3TH4T 3O3DA 4J3VA 3I02B 1NCUA 5DURB 4YXLL 5GISH 1NGXA 4N8VG 1U2HA 4U6HB 3VW3H 1A5FH 1J7VR 3G6JE 3QDME 1KCVH 4AM0A 4BM7A 3FFCD 5HHNA 1IILE 3CSYA 4JFEB 1XF1A 4UIKL 4Y4HB 3VFSB 5FGCB 2CRMA 4G5ZH 2ZSWB 3IFPA 3RJDA 5EUKB 1U8JB 3UJTL 3OXRB 3UTTB 1URLA 1U91A 4C56E 3MRKA 1JGDA 1GZQA 3B4NA 4GW1A 4X6DB 1D5MA 1RZKC 4HHAA 2H6PB 2Q86B 2OSLB 3QNYA 3TH3T 1KIPB 4LQFH 5FK9A 4MB4A 4DK6A 4JO2L 1U58B 5MENA 5F96H 4HIIA 3O6ML 4L8SA 3BEWB 1K4CA 4K8RD 4C83A 1GJIA 1V5JA 3TJHD 3QEUB 5C0CE 2CQVA 4Q2ZA 1ZSDA 3WO4B 3OGOE 3IDMB 5HHVH 2Z31B 3RX8A 5JXAH 3EOBA 2F54A 3DVGB 4I0CC 1DQDH 1R24B 5KG9A 4MD5B 3WE6B 4GAJH 4PJAB 4LSVH 4PTUA 4OLVH 3VFGH 1RY7B 3K8MA 3KYKL 3N1FC 4HPOH 1TJHH 1NDGA 1UKSA 1KYOK 1JHTA 4BFIB 1JRHH 1ADQH 4YK4C 4MXVE 4P2QD 2OK0L 4M5ZL 3U9PH 1I8KA 3EJYC 1YNTA 2XOTA 3MRBA 3PGDB 4I0PB 4XP1H 1YYMH 4OLWH 4F15B 5I1EL 3QG6B 3DO7B 4KAQL 4YNYB 3TVMA 3KDMA 3P4MA 3MRHB 1MJUH 5CILH 1FO0L 4OAWB 2ZG2A 4J7RA 4ODXA 4W4OA 1XGTA 3VGBA 4NC0B 5EBLA 5EIIB 3WFCH 3PABB 1JGVH 4QRPE 4ZMAT 5DHYA 5BO1H 4PPTA 2ARJA 4I48B 2GIYA 3OB0K 3P11L 4IOSD 4NJ9L 5F7DB 2VDPL 3MSPA 4WU7A 1QBLL 4J1UB 5BZWA 2XWJB 5H94B 5C2BL 5JORB 1MWAB 3E3QC 2XFXB 2GYSA 2Z8WC 3ARPA 4LDLB 2HLFD 2MSPA 4HIXL 3QPXH 4OZ4B 2CXKA 3SKNA 3P73B 4PJDB 5EUOE 1JPFA 5FGSA 3WHXA 3CFIC 3G04A 2X1PA 3T0AA 4JQVA 2GUOA 2AXGA 3ARGC 5HHME 5DMYA 4JKMA 1MWAH 3TBVB 4AH2B 2P5WA 2XZZA 3MC0A 4PGEA 2C3WA 2YUZA 4HFUL 2QTEA 4RISH 4PDCE 3QG7L 4FQ2L 2FIKA 3G6DH 3QDMD 1QRNA 4HWZB 3VRJB 4XX1G 5E8EB 1N0LA 5I30L 4UTAH 1J8HD 4ELMF 1L7TH 4GW5B 2GJJA 4RRPG 3CUPB 3S96B 2A77L 3UTPE 3B43A 2D9QB 4GRMA 4FN0A 4LPXA 1EBAA 5C0BE 4C56D 4DGVL 1HINL 1KN4L 3FO2A 1T03H 4YHOH 3X3GH 1OSZA 3FO0H 2NW2A 1CD1A 3L3OA 5D7KE 2DWEA 4Y4KB 2FX9H 1KJVA 4JFDA 2V7NA 3LRSA 4YDLB 4LSPH 2XTLA 1INDH 1QEWA 5J57B 3HG1D 1FYTB 2DM7A 3PWPE 4R7NA 1YMHA 1IRAY 3RAJL 4HBCL 3HMXL 3WUWA 2CXGA 4OSUL 4HAGA 2XN9A 4G6JH 5C0CD 1PKQB 2VZVA 2HVKB 4K71B 4P2RE 4NKDB 5HYQB 4W68A 3T3ME 3G5ZA 1T83C 1NGQL 1X5IA 3IU4L 4B0MM 4WW1B 3GMNA 2ESVB 5F3BA 2R0KH 3T0WA 4JZJA 4KQ3H 4KHTL 1EDQA 2LU4A 1PG7H 1SYVB 3RHWF 2EECA 3AS2A 4R2GC 1KCRL 4JJ5B 1M7DA 4ZAKC 1RZIB 3TFKC 5IWLA 1MCLA 1SJXA 3QIWB 4OI9A 3X17A 4PRDB 3G08A 4C54A 1A6VL 5LQBL 3BPCA 4YIQA 1NUGA 3ECBB 1RZKL 4QHKJ 4PRPB 4R4NC 4YHLH 1S9YA 4KK9C 1MFAL 2UZIL 3ROLB 5EO1B 2R0WL 3HAEG 4I3SL 1E4XL 4S1QL 4ZTOL 2YD5A 3ULVF 3AXLB 2HFFA 2C1OB 3RU8H 2X4RB 5JLZB 2FGWH 1FGVH 4HUVA 2ADIA 2BRRH 3B5HA 4QRPD 5IR1B 1P5VA 2XTJE 4WV1B 3G9VA 3VWKD 3QI9A 1G9MC 3MUY1 2SEBA 1E27A 3NACH 5DR5L 3QUXA 1W0VA 1ITBB 1XCQB 3P0VL 3V6BR 3MREA 3WN5A 2VZTA 3ZTNH 4WEBH 3RGVD 2EYRB 4OV5B 4KQ4L 4MD4B 4Y1AB 3QCVL 4IDJL 4KHXL 5CZVL 1RU9H 4ONHB 4AL8H 1UH4A 3FN0H 3OKKA 2AEPL 4QEGA 1S5IH 2AJUH 3C6LA 1JNNL 3CLFH 5DD1L 5L6YL 1RUKH 4MCZB 4U1SA 3U30B 4YHMH 5T3ZH 3UJIH 1JMZA 1EERB 4O4YH 4OQTL 4K07A 3A67L 1SJVA 1L6ZA 3VI3E 4Z77B 4XNZB 3IDJA 3NN8A 3FQTA 3QYCA 3VXRE 5CJOL 1T20B 4NJAL 3RWCA 1R3IH 2VXVL 3QA3A 3LKRB 4EXPX 5SV3A 2CIKA 4WUUB 1JPTL 1U41A 1V7NH 5T1KB 5J9PA 1J87A 2NXYC 1HDMB 3BWUC 4JHAL 5IW3A 4KTDH 3SDCA 4MNGA 4XCCL 1NMBH 2O5XH 1ZTXL 4XNUH 3T3PE 5IKCA 3WDHA 2GY7B 3UAJD 5E1HB 1LK2B 5HHOE 3SKJL 1MREH 4YX2L 5D2LA 5T1LD 5D7KD 5IBUG 3E8UL 2XA3A 1TMCB 2R23A 3QEQE 1IC5H 3PWPD 4OFYA 1TNMA 2Y36H 2R9HD 1MQKH 1RURL 3GMMB 1VACA 4NWUL 4OLUL 4P2RD 1JNLL 2V7HB 4EI5B 1QRKA 2P5EA 2DLHA 1F11A 5ICZB 2PCPB 3NA9L 5K9OA 4I4WA 4NNPH 3MOQA 3R8BB 4GG6E 1RJCA 2M8XA 5HVWA 2NZ9C 1WIOA 2BVPA 1AGEA 3GM0A 4HSQA 3FB8B 4JKWA 4MXWH 1RJYB 3HUJB 4OKVB 3O0RH 4Z7UE 3ARFC 4BFEA 1FN4A 2BVQA 2MQ3A 4J6RL 5EORL 4NNYA 4UB0L 3VJ6A 3WFDL 2J8UE 2FX8H 2IWGA 2KL6A 1RUMH 4O58H 4JM2B 3EJZD 3CXDH 3H42L 3KPSE 4H25A 1FZJA 4LHQB 3SKOB 5AG9A 3DUSA 3KNBA 3OKLA 3V0VA 1F4YL 2ARJQ 3DNKA 5GGTA 3ZDZE 1CGVA 3RVVC 1JTTA 1MHEA 2AK4B 1GHFH 3FT3B 2V2XB 3ULSB 1QBMH 3BH8B 1MCCA 4I2XE 5K93A 1FL6B 5EN2A 4U1LA 2Y25A 5C7XL 1TCRB 3G6JF 1MVUB 4RGNE 3DURA 1U3HA 3SDAD 2AAVA 1HNGA 3CVHB 2XTJD 4BFBD 3E6HA 1FNEB 1Z9MA 4IIQA 1MJJB 4XI5C 3V8CA 3K4AA 1O7VA 3U0PB 3S35X 1IAMA 4DUWA 1JZ3A 4FFWC 1P7QA 1JYXA 4Y4FB 1XIWC 3GI9H 1KACB 2AJ3B 3VGAC 4GLRI 4Y5XC 3CVHH 2ADGA 3MLYH 3ULUF 4X9FA 3WNLA 2NY1D 2W0FB 1QTYT 4BQ9A 1DQML 3JV4B 4UT9L 2J4WL 1OY3B 1BFVL 3QFJE 4MZ2A 4JVUA 4M1GL 5JUEL 3RWFA 3WO3B 4R97C 3OKDA 3WLWD 1TVHA 3O3AB 5JOPD 5CJ8A 5AUMA 2EEAA 1KSRA 2OL3A 5HD8D 4XRCA 1X4ZA 4I18B 5E6ID 2XG5A 4G42A 3VXRD 4HQQL 5DD0L 1WVZA 4C56A 1R6VA 2NY2D 5GRUL 1WEJH 1CTNA 1X5YA 3HE6C 4NNXB 5DQDL 3O45B 4AG4L 3VFNA 2VDOL 3NZ8A 5J13C 4L9DA 4XXCC 1T4KA 3TF7C 1NGZA 2DQFB 1G9ML 2R2HB 4OT1L 3P30H 4WFEE 5D5MA 1XH3B 1TQCC 4NOFA 2F53E 2JCCE 2DD8H 5HHOD 2QHRL 4K2UL 4BSVA 2D7QA 1S7SA 1OAUH 1YPZE 4FTVA 3DX9A 5TE4L 5CSZB 5J56B 4MXVF 3IDNB 4QRTA 5ESQA 1QLRA 2AJSL 1YEIL 2RJMA 2HFTA 3O8XB 5FHAL 3QJFA 2ZOKB 1Z5LA 1CGUA 3QEQD 4PB0L 1S7WA 1NGWA 4KVNH 4ODHH 1HIML 5DJDA 4L1DA 1WTGT 2C26A 1I3GL 1FNFA 4F7CB 1G0YR 4DW2H 4JANB 4TNWF 1GL4B 5DRWB 5GRYA 5LGJB 5IJVB 4FQ1L 2BP3A 4S0SD 3IGAA 2GHWB 4G7VH 4NQUA 3QXAB 1KJ3H 1WWCA 3WXWH 3MLWH 2YBRB 2CSPA 3O9WB 1DBBH 2NY3B 3IFLL 3K2UL 1ZLUK 4GRLB 3U4EB 2FL5B 1IT9H 3KPSD 3BP5A 2VXUH 4YH6A 1D6VH 2NY4B 3D48R 7CGTA 4MNHA 5D1ZA 5EUOF 4CW1A 2NY6D 1IGJA 1HH6A 4YZFE 5DK0B 5F97E 3NTCL 1W72A 1UWGL 1MNUL 4POZD 4QRPA 2V5TA 4HWNA 3O2DL 2PO6D 3VA6A 3SGDH 3TV3L 3QUYD 3IFOA 2VITB 5L9DH 1H15A 1Q9KA 4NCC2 3UPRA 2VIRB 4J8RA 3JTCA 1NANH 4XGZB 3UDWC 5GZND 1GH7A 4FP8H 3CDGA 4JFOA 2RAMA 3VXSB 1RJLA 4RGND 3BQUA 4OF6A 3RGVA 2EDBA 4RX4A 1A6WH 4QO1A 3CIQA 3OJDB 4RMVA 1S7QB 4LLQA 5EUOA 1JK8B 4M7KL 1X4XA 2EEBA 2DI7A 5J11B 1NLDL 2BSRB 5HHMA 5JW4M 1I4FB 1QFWL 3V52L 2HJLB 3V4UH 2R4RL 2VZSA 3LKOB 5EH1A 1T04B 3KHQA 2DQDL 2IQ9L 4GW4B 1A1OB 3ROOA 2DQIL 5F8QC 2MKWA 2RR3A 4TUKH 5FGCE 5EZJA 3QFJD 5TPWL 1TJGL 1UCBL 2F8OA 3RVTC 4F7EA 2LU3A 1J12A 3FQNA 2F9BT 4HGKC 4N9OB 5DQJB 3BD3A 4HKXA 4P23C 4B7IA 1LNUA 4H8WC 3QUZA 1FRGH 4WO4B 5DJ0A 5IGXL 4D9LL 3LSOA 4L4TB 3WFZA 5D72H 4JY5L 4XCEB 4XNMB 2B8OT 5C0BA 1ES0A 3T3MF 3SGKA 4HV8B 5DMGC 5FYKL 3KLHC 3CFJA 1IEAA 2UYLB 5FO9A 5CHNA 12E8H 2NYYD 4IRSD 4G3YH 2CDFB 2IFFH 3HTLX 1MCBA 4MB5A 2DQGH 4F2MB 2Y06H 4WFED 1MCEA 5E8OB 2F53D 5DTFA 4GMTL 3E1F1 3PWPA 2EC8A 5DD5H 1HQ4B 1GRWA 4PJCB 2APFA 4I5BA 3BRGC 1YN6A 2G60L 1OSPH 1AHWC 2M2DA 4K94H 1DBJL 4XT1C 4GRWB 1OP5K 2DYPB 5FV1L 4P2RA 4YE4L 3UBXB 4XCYB 4L1HA 1MLBA 2XV6B 3OL2A 3O6FC 5JQ6L 1YNLL 5A2KH 1X5LA 4QKXB 5DSCB 4YDVB 3ES6B 2A83B 5AZ2H 1A7PL 1JHLH 5BVPL 3HS0B 4FXLA 5BRZB 1CR9L 4TUOB 2J8HA 1TTGA 1QR1A 5DC9B 4E5XA 1CFVH 4GRWH 4XX1E 4R90H 2NW3A 3OR6B 3PG2A 3V6FB 2HKFH 1GXEA 1P2CB 3O3BB 2XZAH 3OAYH 4KV5E 4ORGB 1KPVA 5F9WB 3REWA 5C9KA 3ARDD 3NCBB 1R3JB 3AMLA 1JVKA 1PLGL 1FYHB 2IBGA 3HLAB 1B6DA 3U7WH 3H9ZA 2X89D 4Y89A 5I1CH 3HMXA 4F7MB 2C3XA 1H5BC 2H2SC 3PDGA 4UAOB 5C8JB 4LLYB 2R1XA 3CDYA 2FJGA 3DLQR 3P4NA 3GHBH 3EGSA 4O2FA 2QQQA 3WFHA 4NFCA 3L9RB 4Z7VA 4N0CC 3SDAA 3Q6GL 2DKSA 3SGJC 5E2UH 2AJZB 3FJTA 1NEZG 1NL0L 2A6KB 2EKSB 4CDHA 4OM1H 2BVUA 1T22A 3OKOA 1WFOA 3INUL 1JJUA 3VXNA 3VI3F 3B5GA 3W2DH 4NCDA 4QTHA 1FFOA 2ORBL 2NR6D 3W5NA 2YK1L 4B53A 4PBWD 1LO3L 3LMJH 5TDPB 5ACZA 2GSGA 1B0GA 1NDMA 5HYJB 1CE6A 5DURD 1P4LB 3MRGA 5TDNA 4RFOL 3D18A 4HUKB 4XB7A 3BZFA 5LJYH 1KIRB 5CGYD 2HT2C 4TOYH 1A8JH 4PS4L 4LLMA 1YECH 5C0FA 1CGWA 3T3PF 5EOQH 2HFEA 3RNQA 3DX8A 4DJMA 1HN1A 2ICEA 3SCMC 4X6FA 1PYWA 1CDYA 1QSFE 1BQLH 5GQBA 5F89A 1FDLH 3WXVH 3NGBC 3C5ZB 3UTTD 1S8DB 4UU9B 4XNXL 1O0VA 1H8NA 1A9EB 3QJHA 3I50L 2EDTA 4Y2DB 2PYFA 1U8KA 1QQDA 5D96B 3VWJC 4HMEA 4P3WA 1BBDH 4UIMB 2XA8L 2GT9B 1JV5B 3FO9A 5F7HA 3BZEA 2NY7H 5ELIA 4Y0GA 3MGTB 5HHOA 1V3KA 4GG6F 2X05A 5DGQA 4FFZL 3TCLB 1J1XH 1I7ZA 1UEYA 3ZKQD 1T5WB 3S97C 1B90A 3T0EB 3P0YH 1X5HA 4E0RB 2I60H 4Z7UF 1B2WH 4GAGH 3UP1A 2JE8A 4N0UE 1K6QL 5SWZE 2PTTA 1AD0B 1CGYA 1CU4L 2J8UF 3OPZH 4OQTA 4WENB 3U36B 3U46A 3SY0B 4UUJB 5CP7A 4CVWA 4NQVB 2WUBL 3RTQC 2R1YA 4JY6B 4XPGL 1SBSL 4HIHA 2ZSVA 3RHWK 1KCGC 5MI0C 2R29H 4GG8B 3ZDZF 4YXKL 4XVSH 4JEGB 4LPUA 1XGUB 2Y9RT 3RQ3A 4UT7H 5EPMA 4LVOC 4FXGB 2WZPD 3FT4A 3V6OC 4JDTH 5SWSB 4Z7UA 4PJIE 5DJ2A 1U8QA 4MD0A 4EUPA 3L5HA 2FEEI 3VFVA 5IK3B 2BVYA 4O5LL 2J8UA 1S9WB 4LGRB 2AP2A 4FZEH 1YMME 5D1XC 5INDA 3KPSA 4PY7A 1JZ6A 3KLSA 4JO3L 2Q7YB 4HPYH 3W39A 2F58L 1ZVSB 2P7TB 3S7GA 5EBMB 5IEKA 1RVFH 1T1WB 1N6UA 4HIJB 2BDNL 3RIAF 2HJKB 3U48A 1XAUA 3ARGA 1L9MA 2PW2A 3H3PL 1CGTA 3L3KA 3IDGB 4FQJH 4M1CC 3G5YB 1D7FA 2UWEB 2X6MA 4KKAD 4XHQA 1CT8B 3LQAC 3SO5A 2R2BA 2IBZY 2E8YA 5IMOA 3BXNA 4ZYKB 4GXUN 4PYHA 5CKGA 5ADOH 4RNRA 4WDIB 5I8OH 5T3ZE 3MJGX 4PJ8C 1KXQE 1GZPB 4NN5C 3O2WH 3M07A 4MA3A 2HLAA 2WNGA 2VLKE 3KPLA 4NC1E 3DI2B 4Y5VC 3IAQA 4XNQA 5F72S 1D9KC 1UM4H 1BQSA 3R4DA 1KLUB 4NM8H 4Q6YA 4QRUB 4QY8A 4O2EB 1MHPL 4MCYA 3MLSL 4ZTPL 3DGCR 5GSRB 1TENA 3OHXA 4L9LB 4KZDL 4Y5YB 3MLTB 2JCCF 2XWBB 2EH8H 3FB5B 4HJJL 1YPZF 5E2JA 1QSFD 1QVOA 5GS2D 1A9BA 3U6RB 5D6CB 2I07A 3ILPB 4XMPL 1T83A 2B5IB 2J5LB 1UT9A 2R56H 4BQ6A 3VD7A 2FO4A 2CK0L 5AZEL 1XGYL 5DK3A 1U3YA 4KJPC 1LO4L 4XP5L 4N0RA 1JRHI 2F53A 1U8IA 4L3EE 2VYRE 4P9MH 2Z8RA 3VXTA 2EYSA 1MFDL 2JCCA 4ZAKA 2E7HA 5ABDE 5IM7A 3MYJA 2OTPA 2AGJL 2LABA 3BP6B 4MAYD 5IMLB 4ZOEA 1AGFB 2ERJB 1P9MA 5ICYA 3FOMB 3MRLA 4XC3L 5CIPB 5I76B 4PLKD 2VE6B 5SWZD 4N8VA 3CVIH 3D9AL 3MA7A 4EEEA 1S7RA 3MRCA 3KYOA 1OD9A 3ARRA 4C4KO 1HYSD 4B7LA 3VXPB 2H32B 5JO5B 5HPMA 3GO1L 1YYLH 1MPAL 4E9LA 5GRZA 3H9HB 5IB1A 4YZFF 2P8PA 4MDIA 2DBLL 2ZUUA 1NLBL 3NCJL 5CIPH 3OSKA 4KRNA 3ARDA 1UB5A 5D7LB 3C9NA 2HN7B 3EIFA 3L1OH 1IC1A 2X89A 4GXVH 1PG7W 3DVNA 3P9LB 1N6QL 4PRPD 1NC2B 5JHDE 5JW5A 5GS1B 2Z4QA 3SJVB 4NQDE 5TF1L 1ZHLB 5GGSB 2F8XC 4CNIB 3ABZA 3K4DA 4PGDB 3PXJA 4S1RH 5C0DB 4BA8A 3VI4E 4JVPA 3NFSL 4DVRH 1ZLWK 3KPMB 5JW4R 5GRWA 2Y5TA 5F7UA 2CRIA 4NQCB 1A7RL 1AY1L 4LVHB 2IAMB 2A9ML 3EO1A 3PQYA 3BGFC 3WS6A 4LVNB 4GOSA 4D0CB 5T3ZD 4Y1AD 3MV8B 4DQOH 4LLWA 4P23D 2QQNH 2D2OA 2EYTA 2OXHA 4AENA 3MCKA 3TPUE 3TO4D 1TZIA 1FL5A 2VLKD 3CFCH 1SJHB 4P46C 1DLFH 3CX2A 1R3LA 5FUOH 3STBA 4KGJA 5GHWL 3C87A 2DQJL 1DQJA 4BZ1H 2FZ3A 3W9DB 3S88H 1QSEB 4GSDL 4P0DA 1NQBA 4R6UA 5CZXD 1CLCA 3ZSTA 2DS4A 2IMMA 5D6DC 2YPVH 3TA3D 1ORSA 4OLEA 1RFDH 4NZUH 4UV7L 1E6JH 5F7KC 1JGUH 1X5KA 2XWTB 3RKPA 5AYQA 3LHPL 1P84K 3FFDA 1UGNA 3AREB 5T1KD 3MRMB 5FF6A 1XT5A 4UI2A 4S2SB 3FQUB 1Q9LA 4LDOB 1HNFA 4RGMC 4ZS6C 5GGUB 1FV1A 1MRFH 1FBIH 1AO7B 1G7PB 1AR1C 1KCLA 2EDNA 1GGCH 5I19H 1NJ9B 1TZHB 3DMMC 1K85A 3S37L 1WLHA 1BWWA 2IQAB 3CFDA 3O6LL 1S5HB 1CFTB 4L3ED 5ESVB 5FB8B 1C5DB 3ARFA 1YEFL 4LLUA 3TN0B 4PJ5A 4KV5F 1EJOH 1IAOB 4HJ0D 3BO8B 3PNWA 1C8PA 2VC2L 1OAQL 4O2CA 2CKBA 4TNWK 4YFLI 1SM3H 3T1FA 5KSAC 4LEXL 1A47A 3VE0A 1HI6A 3MV7B 1H3PH 4LRNL 3RZCC 1I1CA 3KLAB 5HGAB 3VXUA 3U9UA 4HK0A 1AKJA 4CU6A 1A6AA 3M45A 2FECI 1KENH 4KXZH 4OUUB 3S34L 3VXME 1HE7A 2DICA 2VXSH 4D8PB 4RRPA 1CD8A 1KFAH 5TQ0H 4QHUB 2JJUA 1KNOB 1CFSB 4GMSH 4LSTH 3PHSA 3ME0A 1Z2KA 3FHQA 2QSCH 1XF2B 3M17A 1PZ5B 4NN7C 4XMKH 1I1AC 1AGCA 4Y19B 1JFQL 1RIHL 2MHAB 5JHDD 1MAKA 1XIWA 4RMTA 4XPTL 5IG7B 1CICD 4NQDD 2Q1EA 1U95B 3ZE0E 2ADFH 5C0JA 1BD2A 4FQQB 1MH5A 3JTSB 2M26A 4MHHG 2A1WL 3HRZB 4P5TC 1I1FA 1RUQL 1VGEH 1BPVA 4X7FC 4M8QA 4OGAC 4H0HB 2YD2A 1T3FB 4X6CB 4X7DC 4OD1L 2DTML 4QRRE 1KJ2L 3FB6B 1G7MA 3VA2C 4W70A 3L3IB 5DLMH 2B7DT 4IOIA 2DIAA 3KPPA 2ZOLB 3HE6A 1DDHB 1HZHL 5T1DL 5JPNB 5HDBE 5ERWA 3OQ3B 3TJEH 4ZUUB 1UWEH 4CMMB 4DWHA 3BIKA 3BSZL 4Z18A 4QWWC 4MS8D 2PW1A 4FQXD 3K2MC 5IW1B 4YO0B 1BOYA 3LRHA 1QSFA 4Q58C 3VG9B 5GGSY 1P6FA 3TIDB 4GKSA 3IJYA 1G6RA 1HSAA 1KN2L 1UH2A 5I1LB 1I7UB 4WI4A 1PEZA 2VKWA 4XCNB 2H26B 2DKMA 3HAEA 3ZDYF 4N90D 3EJJX 1MQ8A 4TSCH 4HAFA 3T2PA 3BPOC 1U8MA 4MQXD 2D7OA 2P24A 1U8HA 3IDIB 4BYHA 4RAVA 4OD3H 2H3NA 4ZSOE 1CXHA 2GK2A 5E2VH 2BMKA 3EYUL 2BJML 5JOFB 3BW9B 1P4IH 2AXFA 2ZCHL 4YAQB 4RFEA 1M7IA 4YFLF 2BNQE 3F7YB 1FIGH 3HI6L 4DVBB 1J0IA 4ZPVB 3BWAA 3RZWA 2ID5A 4WI2A 1F6AA 2CIIB 4PJIF 4N0FA 1RZ7H 4U1KA 5KTEL 1OD7A 5GRJH 1KLFA 4R3SA 3O8XD 3CDCA 3H2WA 5HI3C 3DROB 3RDTC 3LN4B 3J8F7 1D5BB 4ODVL 1IEBA 4NGHH 4G6KH 4PJGE 3V4PL 1LP9E 1BAFL 1BM3H 2X4OB 3RPIB 1SEBB 4YPGB 4JQXC 2I5YH 4ELKA 2HMID 2C1PB 3L3HA 1RUAH 4WHYH 4XP9L 4NHUB 2D7MA 3GBMH 3T0BA 4PP2A 2Y7QB 5I9QC 5FDWA 1LGVA 4UNVA 3VXMD 3PHOA 3HNVL 2A73B 3LEYL 3UDWA 4ACPA 4NKIL 3L3JB 1YMMA 3WIIH 4GQ9H 2ITDB 4GRLD 4X7SH 4I13B 5JA9A 2B1AH 4AIXA 1UKQA 3FRPG 1X44A 1JMXA 5I71C 1R5IB 1JF6A 5A2LH 5H8DA 5FYJL 3EOAB 1S9XB 5JDSB 1BOGB 2H9GB 4KI5C 1N7MH 3D69A 2I24N 1A0QH 5EFIB 3OAZK 2VDMH 3BDYH 3IXAB 4TNVK 3MACL 4AEFA 5IVNA 2ICWJ 3GBNL 4AQOA 1FVEA 3KJ4B 4LSQH 3RBSA 1WBZA 3VD5A 3FOLA 4JRYB 5IVZB 2HFGL 3FQWB 2P45B 2N7BA 4KJYB 1N8ZB 3BPNB 1MCPL 4UOJA 2V2TA 2R0ZH 3QIUC 2AJXH 3MR9A 4IJ3B 4JFFE 5C0AE 1NAKL 4P23A 1MCFA 2X42A 3OB0H 4WHYG 3GKWH 1IAKA 4QRRD 1DBAL 4LCCC 2VLKA 1FORH 1LDPL 4NOBA 3I75B 1F97A 4ZFGL 1XF5A 4L8BB 5F1NB 2B4CC 4M5YH 1MCSA 4UOW0 3TO2A 5A16A 1UA6H 4JFHE 1RIUH 5C71A 4AK1A 3H3KA 2DI8A 4P3DA 4KRPB 5BS0E 6FABH 1FCGA 3TYFB 1OGAE 4TVPE 3N85H 5BMFH 3HRPA 4ZUTA 4EI6B 1F3DJ 1SJEA 5BQ7A 1AHWA 3QCTH 3S36L 3IXTA 3QXDA 3ZL4L 5HI5D 1CDGA 1K8IA 3O6FA 1U3JA 5D93C 3CFKA 4O02L 3PV6A 1WJ3A 2PR4L 3LKNB 2BNUA 3ZE1E 3BI9X 1AIFA 1UCTA 4KUZH 2HAZA 2H8PB 4HZAA 5E94A 1VB9A 3OG4B 1FJ1A 1YC7A 4OUOA 4G9DA 4NPYB 2APXA 4WEMB 3NBNA 1T6WA 2MNUA 3NFPA 3GGWB 1VGKA 4WGVB 4XPAH 2NY5C 4NWTH 3S4SB 3WYRA 4NZRH 1I3UA 1HXYA 2F19L 4PV9A 3CLEH 4U3HA 4NHCH 2BK8A 1C08A 1YEJL 3NABH 5H35A 5L2KA 4TSBH 3VRIB 4ZNEE 5J7CC 4P2OD 1H5BA 4XWGH 3C60D 2HT3D 5HDQH 4ZO7A 5EO9A 4K3JH 3TIEB 5FA3B 4MB3A 3U1SL 5D7IB 3O4LE 4P57A 5SWSE 4FFEX 1GVIA 3I2CH 2YN3A 4JGMA 5I1KH 1AQKL 1NANI 3KJ6L 5FDYA 4N0CA 2FIRT 3JWDH 2YPLA 3HR5A 5JTWA 3VI4F 3N50A 1ZAGA 3UTOA 3GRWA 5JHLH 3GIZL 3QHZL 4HD9A 1N26A 4Y4HC 1M6OA 2V5MA 3VU2A 3BYYA 1IGYB 4PRNB 3L95B 5C6TL 1I1YB 1LD9A 2P44B 5AWNH 4MA1B 1CICA 4ALAL 4MJ6B 1FC1A 4NQDA 3HC3H 2LVEA 1CFQB 4PRAA 3LKQB 3FRUA 1EJ6A 4L8CB 1NC4B 1ZV5A 1T0MA 3T8XB 4HS3A 1D3CA 3V7AG 4GBXB 2XZCL 3AGVA 4JGUA 1IM3B 2PNDA 3RVUD 4A6YA 1LE5A 3FB7B 4YLQT 3KPQB 1DR9A 4U1GC 3VH8G 3GSQB 3MA9H 3MNZA 3SCMA 1E0OB 2BNRE 3D3VB 2FR4B 4WWKB 1HXMB 4M48L 1MHCB 4J12A 4NRYB 1WFUA 2IGFL 3IS1X 3BEVA 4GKZA 2Z31C 4JFFD 4GAYB 5C0AD 3V5DA 4XAWH 1P1ZB 5JMOC 1LEGB 2D0FA 3TPUA 4Y88A 3X13B 2KBGA 2YUVA 1Q1JH 4PLJD 4D9RE 2BRQA 4ONGH 3ZKND 1BJ8A 1KB5L 4JO4H 2NX5E 2VLRB 1BZQK 5F9AC 3E0GA 2YXFA 1ZHBB 2DDQL 1RZJH 4JFHD 4MAUL 3IU3A 3HMWL 2GSIA 2UZXB 3GMLA 4JM4H 5HGDA 2CDGA 4N5UA 2J88H 1UC6A 2XI9A 5BS0D 3C5ZD 3EZJB 5F1SA 2ILLA 3VFUA 4I0PC 2KQMA 1JPSL 4F15C 1ZS8A 1C5CL 4TVPD 2FDBP 3P4OB 5EU6E 1OTUC 5BJTB 3LS4H 3HE7D 5L2JB 1RZGA 2NTFA 3RTQA 1ZHNB 4YBQD 4WHTA 4DKDC 3GSUB 3L7EB 1B9ZA 1FLRL 3HI5L 4WHDA 3UBXI 3N1QC 5SWQB 4K7FB 5CJQH 1FNLA 4LAQL 1DFBH 2K1MA 2EDHA 5KVEL 4M61A 3V6OA 1N2RA 2DN7A 5IB4A 1NCDL 1INEL 4X5LA 1BZ9A 3DJ9A 1OB1A 5SX5K 3PHQB 1RZFH 5D1XA 5BV7C 2R2EA 1LEKB 4B5EA 3BVNA 2B20A 3TBYB 2WBJD 3MRDB 2B4CL 2CMRH 1A4KA 3M1BB 5IQ7H 2P49B 4NRZB 3BP4B 4DOHB 5EOCL 1KTLA 1A6TA 2A38A 1NBZA 5T3XH 4NYLA 4QXTA 1MCHA 2VDNL 5FO8B 5FXCH 3ZE0F 1EMTL 3O4LD 5SWSD 5EOTB 2B2XL 1R5VA 1SEQH 2RCSL 1WICA 5DUBA 3STZB 2AABH 4HLZH 2FX7H 1YEHH 4PJ8A 5EZIH 2X4SB 4BJLA 5SX4I 1F8TH 4XTRC 3JTTB 4JQIH 1FCCA 1KTDA 2FEEL 3V79C 4LOUD 4BSWA 2FLBT 5HDBF 3TT1L 1D9KA 4APQC 5CINH 2A6IA 1YUHB 1NCCH 1ZANL 4Y4KC 1Q38A 1MEXH 4MJ5B 1LILA 1G84A 3D25B 3DVFA 1Q9OB 2NY5L 4YDLC 1ZVYA 5C92A 1FNSH 2BNRD 2YD9A 1HKFA 1ONQA 5MEPA 4MJ2A 4K71C 4G5ZL 4L3AA 1R0AL 4HGMA 2XKNB 4Z7WA 4G8IB 4E41A 1X6NA 3DUUB 3EYQC 1DUZB 3TESA 5I1HH 1CXKA 4Q6IB 3DRTB 1NUNB 1O7SA 1PBYA 2NX5D 2FATH 1TJIH 1MF2H 5DJ6A 1G7JB 3HC4L 4LQFL 4ZUWA 1RPQA 1BQHB 3RRQA 2EXWD 3RUGE 3ARSA 1S7UB 4DZ8B 4HUXA 4V1DE 5KSBE 3V5HA 5F96L 3QIWC 3TZVC 1PQZB 3LRGA 5MERA 2NQCA 4LCYA 4G9FE 5D1QB 1INQB 1P7KB 2LAAA 1BVKB 1CD0A 3FO1B 5I2IB 4EN3B 4PJGF 1LP9F 3GSRB 5HHVL 5TGBB 5JXAL 5BOZG 3QH3B 1AI1H 2W92A 3SDYH 1MCWW 4XHJD 1DQDL 1FZOA 4FQCH 2BNQA 4GH7B 4ONOA 3DV6B 4WV1C 5CCKH 2NXZB 4GAJL 3BGMB 5CWSA 1Z0NA 4OLVL 3VFGL 1E28A 1BZ7A 2OR9L 4YHYB 1TJHL 3CU7A 3MLZL 3T77B 4MSWA 5IJKA 4X99B 4XP6L 4OCRH 5DQ9A 1ADQL 3LKPB 4YBLC 3ZO0A 5E8NA 3C60A 3QRFM 3U9PL 2D7PA 3VGGA 1N3NA 4XP1L 4X4ZA 4OLWL 1FE8H 2PTUA 3ZT7A 1ZMYA 1U8LA 1JGLL 1DBKL 4K7PH 2I25N 4P49A 4NKMB 3GSWA 1MJUL 1A1MA 1KPUB 1LK3H 4PP8C 1HH9B 3AAZB 3EUUA 3U30C 4YGAB 2C3VA 5D7LD 2G5BA 4JDVB 1GOFA 5ICXB 3WFCL 4L3CB 3BZDA 4PG9A 3DBXB 1A4JA 3H0TB 5BO1L 4XNZC 3D0LB 3O3DB 1NC2D 3GSOA 5E4IA 1WIUA 1NGXB 4U1JA 1JN6A 3U4BH 1WZKA 3VCLB 3OG6B 4AM0B 5E0QA 3CCHA 5D8JH 4GQPH 4U0RC 3ORJA 4WI7A 3QPXL 1ZLUH 2X10A 1MLCA 4RWYH 4P46A 1LVEA 2BC4A 1SY6L 4CDGC 4MA7H 5IB2A 2K9UA 3QZWB 5GS0C 3IFPB 1MWAL 4XMLL 4LU5H 1CFNB 3JV5A 1EXUA 4JHBA 4G80B 1U91B 1WISA 3FAWA 5FEBA 2EE9A 3MRKB 1CGXA 3G6DL 4Q74A 3OR7A 3BJ91 5C0AA 1IAIM 4NT6A 2VB5A 3P4LA 1D5MB 1QHPA 3RL1A 4HHAB 3MV8D 5FK9B 1FL3B 1FSKB 3GI8H 1KGCE 4UTAL 1L7TL 1KG0A 4HIIB 2GK0A 4L8SB 3STLA 4KK8C 4EI5C 1K4CB 1MI5A 5C08A 1X9QA 3KXFE 4C83B 3QUMA 3C8DA 1OW0C 5GZOC 1L7IL 4R7DA 3ZE1F 5I8EA 4UBDC 5DRNA 2W0PA 3ARBD 1DN0B 3DMMA 4Q2ZB 1T03L 5CP3A 1RSFA 4YHOL 3B2UC 3X3GL 3WLBB 3QULA 1OGAA 3FO0L 1NGYB 4WI5A 4H0IA 2F54B 5J1TC 2FX9L 3PJSA 1CBVH 4JM2C 1INDL 2EDQA 3ARED 3C08H 4ISVA 5ILTL 5CEZH 3QFDA 4PTUB 1AXSA 5KSAA 1ZKAA 2X7LA 5EBWB 4G6JL 5CFHA 1NDGB 3SE4C 3RZCA 3K8LA 1JHTB 2VDLH 1NUFA 3MRFA 3NH7L 4RFNC 4HIEA 5DT1H 5HVHB 5C09E 1TETH 1I8KB 5GXBB 1YNTB 3MRBB 1TZGH 4D94A 2R0KL 5EC2A 4F37K 3TPKA 1RZ8A 2VTFA 3TN0D 5I15H 2P42B 3MV9A 4PYGA 3TVMB 3KDMB 3QQNA 5DDHA 3CPLA 2JB6A 2X4TA 3P4MB 2BVOB 2WBJA 4ODXB 4ZOBA 1JP5A 4LKCB 2ZUSA 1OVZA 2QQKH 1OQXA 5AG8A 1I1AA 1OQOA 4Y4FC 2ARJB 2HTLD 4X4YB 3MO1A 5MP6H 4Z7NE 2K7PA 2BHUA 1MCWM 1OP5H 5AAMA 4WU7B 1EHLH 4YHLL 3QAZC 5TE7L 1L0YA 4ZFFA 4P5TA 5J8OA 4PUBH 5B38B 1RK0A 4L4JA 4N8CH 2AERT 3SKNB 3WHXB 1JPFB 3H7BA 3WMSA 3IVKA 2FGWL 1FGVL 3G04B 3L5IA 3LH2H 3A6OA 1Q94A 3EFFA 4XNYH 2AXGB 1WZ1H 5B39B 2IANA 3UCRA 4I18C 1ZA3A 1ZT4A 3NACL 2WIMA 4PGEB 5E5UB 1IC4H 1ZGLM 4LGSB 4FOMA 3ZTNL 4AEHL 4K7PY 2GY5A 4J4PD 1QRNB 4P5KA 5LG1A 2Q8BH 3VMNA 1KC5L 1ORQB 1WFTA 2RB8A 4OZIE 4AL8L 1K4DB 2Z91A 2Y07H 3FN0L 5EU7C 3TH2T 4JFYA 2AJUL 4PGCA 3VFWA 3AS3A 5FAAA 3O11A 3CLFL 4F9PA 5IFJB 2BNRA 1M05A 1RUKL 2D0HA 1WZLA 1VPOH 2MKLC 3KYNB 4YHML 4HMCA 3SBWC 3UJIL 3FO2B 4O4YL 4PRHB 2FD6L 4IRJD 1DSFH 3E2HA 1YA5A 3GHEL 1OSZB 5KW9H 3PUCA 1CD1B 3L3OB 2DWEB 1HKLH 4OV6F 1KJVB 3LRSB 1KGCD 3F62A 4OZFG 4JFZH 1QEWB 2H1PL 4DN4H 5CGMA 4XBPA 1V7NL 4R7NB 4KWUA 1YMHB 1EZVY 3KXFD 3WUWB 3JUZA 1DLHA 3GIVA 1PD6A 4KTDL 3BUTA 2XN9B 1NMBL 4P9HH 4AIZA 1EK3A 4OLYH 5E00A 1MREL 5DRXB 4MHHI 5EU6A 3O9WC 3GMNB 2NY3C 3RDTA 3AU1B 4FNLH 5F3BB 3LEVH 4JZJB 1ZGLA 1QFUH 2MQ0A 3RVXC 3V7AE 2OZ4A 1BQUA 2NY4C 1IC5L 1XZ0A 5FA4A 5AYUL 1M7DB 2Y36L 9CGTA 4QCIA 3GUTA 4KXZI 4JQXA 4DN3H 4YQXH 1VESA 4EKXA 3BRFA 1I85A 1UENA 3G9AB 4R96A 4PJXE 3G08B 5C09D 3OGCB 3RX7A 3M8OH 1IGMH 3BPCB 4YIQB 3DX6A 1J88A 4LLDA 1CD9B 1YQVH 4TVSa 2ZKHH 4HCRA 5CSBA 2Q20A 4MLSA 2HFFB 2FX8L 4AT6A 1W2KT 4O58L 3CXDL 2CR6A 5J11C 4HUVB 2ADIB 4NIKB 3WFEL 2EIBA 3T0XA 4M62H 3QI9B 2ICWI 4XPHH 2RFXB 4A2MA 1XF4A 2SEBB 4QHNA 1E27B 4ETQA 3BN9D 3QUXB 1W0VB 4LIQE 1GHFL 3GK8H 4ONFH 3MREB 1WBYB 4QTIL 3WN5B 4ZXBC 1QBML 3IJSA 2B1HL 2HRLA 4G43A 4EJ1C 4AJ0A 4HS8L 3EOTH 3QIUA 2PYEE 4ZD3H 5DFWH 2JIXD 4Y16C 1CDBA 3C6LB 4WO4C 4P4RB 2OJZL 5IVOA 5DO2C 3LS5L 1T66D 1MCDA 4PR5A 1SMAA 3PGCA 4B41A 5EWIH 5JPMB 3GI9L 3ULVH 5E8PA 4ODUA 3IDJB 3NN8B 2DL2A 1SYSA 3U7YL 1K9TA 5KOMC 5EU5B 4F57L 3CVHL 3MLYL 3RWCB 3JWOC 3I3EA 3QA3B 4TYUA 1IC7H 5LWYH 2CIKB 4U4BA 3RUGF 4CVXA 5KSBF 5HDLA 2O61A 4XXDB 5J9PB 4UQ3A 4NO5A 1W8OA 2HP4A 4LMQE 2XZQH 5IKCB 2A9NH 1A7QH 2VLRE 2UY7A 2VL5B 2YD4A 4JPKH 1UEMA 3AM8C 4PJ9C 5D2LB 3VXOA 3GNML 1WEJL 1QBAA 4X80H 1DL7L 3PWLA 4XH2A 1ZLVK 1YY9C 4YWGL 4JG0H 3RUGA 4M9OA 5A1AA 5JA8B 1T1ZB 2WMPA 2LAGB 3GB7A 4V1DA 3V6ZA 4R8WL 4F33A 4K8RH 1KELH 1VACB 3P30L 5DJ8A 1NAMA 4G9FA 2JB5H 2DD8L 3S35H 5B21A 4Z7OF 2P8LA 2EDOA 1F11B 3N1PC 2GW5A 2YA1A 5K9OB 4I4WB 5E03A 4NO0A 3RWIA 4FFYL 4DKFH 5CD5C 3MLRH 4BQBA 3B8SA 2W07A 1QLFA 2BVPB 4Z0BH 5M7QA 1AGEB 5TQ2L 1NMAL 2GITA 4UAOC 3S98A 3KR3H 4N0YL 2APVA 4OCXH 3GMPB 3I02A 2DQTH 2DQHL 1IGIL 4KVNL 4ODHL 5F7MC 1FN4B 4NC2B 5IEHB 4NNYB 3VJ6B 4KKBC 1JYVA 4KDVA 2WW8A 2E7LE 1FZJB 4IEFB 3DUSB 4JFEA 3KNBB 4LSUL 3V0VB 1MAMH 3QQ3B 1JUFB 1MHEB 4Q9QH 1GGIH 35C8L 2D9CA 1OPGL 2Q6WB 4HUWA 4PBVC 5EUKA 1U8JA 4OJFH 1ZGLP 2DI9A 3CMOH 4MYWB 1KJ3L 5FUZL 3DHMA 3MLWL 2EC9U 3QRGH 4LLVB 4X6BA 2EXYC 5EN2B 1DBBL 4Z8FH 1I3VA 1FZKA 1NSNH 1R5WA 2WP3T 1HOCA 4OIBA 5GGTH 3DURB 1IT9L 2OSLA 1U3HB 2VUOA 1G0DA 1KIPA 2VXUL 1D6VL 3E6HB 4KKCD 4IIQB 4G8FB 4D3CH 3K80A 1TITA 4UILH 4CN1A 1NH6A 1P5UA 1M4KA 4H26B 3CSGA 1P7QB 2MFNA 3QEUA 5JXED 4RSVA 3QHFL 4OD2A 4ZNCD 1XMWA 4WNQB 4Z78A 2BOCA 4FP8L 2ADGB 1A21A 2Z31A 2HH0H 4JJHA 4M9PA 2PYED 2IADA 4Y2DC 5HGBA 3QDMB 4YDKH 1A6WL 1C1EH 3KLDA 4XVJH 1FVCA 3SE3A 4GBXD 4XBEH 1T7XA 5IUSA 3ALPA 3OKDB 1TVHB 1DEDA 5AUMB 2OL3B 2DMKA 4YFEA 1QG3A 4ENED 3V4UL 3LN5B 4XRCB 1EEUA 1XR8A 4PG2A 5MEOA 1OTSD 2GJ6E 1Q0YH 3BAEH 4G42B 3MJ7B 3T0EC 4C56B 4IRZL 4D0DB 1CZ8L 1RHHA 3BN3B 4ODBD 3VFNB 3LPWA 1BECA 3WBDA 3QG6A 3MJ9A 3NZ8B 1ZLWH 5FM8A 4WVRA 1QPPA 2QSQA 1T4KB 4LDEB 3TLRA 1VHPA 3MLUH 3ZKSD 1NGZB 4BELD 4H1LG 3C2SA 5ENWA 4FQPA 3MXVH 4PP1C 3QXTA 4OAWA 3D85D 2VLRD 3KXFA 5D72L 3ULUH 4BSVB 1PZUB 4EBQL 2XQBH 5LGHH 3PABA 2HJFA 3DX9B 5C0CB 2W9DH 4QRTB 4LCUA 3HFMH 1QLRB 1SY6A 1UXWA 3QJFB 5F7DA 1N59A 3FRPA 1NGWB 4G3YL 4YXLH 1VADA 3LD8C 5JORA 2DQGL 2Y06L 5IF0A 3A6CL 5C0GA 3IF1A 4F7PB 3UTQB 3TYGH 3ZYOA 1KT2A 3ZKMC 2D4FA 5E70A 4L4VE 4UIKH 1F4XL 3ZLQC 3KPRE 2YRPA 3IGAB 4Z7NF 4LCWE 3JWOL 2EC9T 5C09A 4RWHA 3NA4A 1FGNH 5AZ2L 1U8OB 5C9JA 1JHLL 2C4FU 5D70L 4UDTA 5K9KA 1CFVL 5T3XD 4R90L 3BP5B 3MRJA 3TCXA 1LO2H 3QPQC 2HKFL 4MNHB 4FA8A 2XZAL 2PETA 5ITFA 5DJYA 1IGJB 1C16A 1OF2A 1W72B 4KTYA 4QRPB 2E9JA 5DVMA 1DANU 2QHLA 3U7WL 4MXQD 4DFHA 1H15B 1Q9KB 5I1CL 1D5XA 3UPRB 4J8RB 4APQA 4QOKE 3CDGB 4JFOB 1RJLB 3RGVB 3WFBH 2BXZA 4ZFOA 1AR2A 4OZIF 1JF5A 4CJ0A 4L9LC 4LBEA 5EUOB 1ZLSL 4Y5YC 7FABH 1FYTA 5E2UL 5HHMB 4OM1L 3KYKH 2Y6SC 5MEQB 1X7QA 4NBZB 3W2DL 4M5ZH 2YD8A 4ETYA 4WW1A 3WIHL 2WQRA 2JELH 3LMJL 4OZIA 1OAYL 3QIBD 2PN5A 1OLZA 3R1GH 4LMQI 4U6TA 5DJ0B 1RZIA 3LSOB 4EQ2A 4U1NB 2W91A 3SDDD 1OAXH 3TZVA 5EOQL 5C0BB 1ES0B 1AD9A 3SQOL 5MENE 1T2XA 3CFJB 3MBXH 1IEAB 3RY6A 1BQLL 4X7CC 5FO9B 5CHNB 1F6FB 1FDLL 2D03L 5T1LB 3WXVL 1R3KA 1UM6H 4MDJB 4GT7A 3ROLA 3P77A 2HTKC 3QQ9D 4FZ8H 5I1IL 1GC1C 3PWPB 4HIXH 2X4RA 4I5BB 1YN6B 3WEXA 4ODSH 5IMMA 5B8CA 5F7WC 2HG5A 4PJXF 4BZ2L 4P2RB 2BY3A 3LPGA 3NIGE 1MLBB 3ALXA 4N9GB 1K5NA 4LKXA 3G6AB 2J8OA 4HFUH 5DJXA 5BW7A 4BH7A 3T2NL 1B4JH 4RZCA 3QG7H 5KANG 1PY4A 4PREA 2C4FT 2EDEA 4HT1L 2EYRA 2I60L 3D0VB 5GS1C 1B2WL 4GAGL 3ZSSA 5LAXB 4E5XB 3OF6D 3LOWA 3OPZL 2NW3B 3BGAA 4Z9KB 4ONHA 5I30H 5FUCE 3VH8A 5IW6A 2E8ZA 3MTRA 4L4VD 4JB9H 3KPRD 3REWB 4PJXA 1DANT 2R69L 1YEKH 1RMFL 3DTXA 4XVSL 3MLXH 5CKAA 2VLJE 1OOAA 3JXAA 3KS0H 5EB9A 4LVHC 3FT2A 4Z6AT 2IAMC 3GJEA 5KVGH 1DVFD 4LVNC 1T20A 2FJGB 3P4NB 1IGCH 2KDGA 3EGSB 3GSNA 3O2VH 4YDJA 4O2FB 2YMXH 4TTDD 1OM3H 3WFHB 4M6AA 3SDAB 2QQLL 2XTJB 3HMXH 4OSUH 3OKOB 4HFWB 2BXYA 3IFNL 4JLRB 4JG1H 5F7NC 4QOKD 2QJDA 4LASL 3W81A 5JZ7D 3AC0A 2J6EA 5JXEA 1NGQH 4QTHB 32C2B 4Z7QE 1FFOB 4U2ZA 1CLYH 3UTSE 1AH1A 2EZ0C 2P5WE 2GSGB 4OCNC 1FZMA 3IYLW 5ACZB 2NY1B 1B0GB 1NDMB 3ARXA 1VKXA 2PYEA 3O4OB 1CE6B 1IFHL 3MRGB 4U7KA 5TDNB 3D18B 1OT2A 4M1DL 2XPGA 5ADOL 3BZFB 5I8OL 2NTSP 5IT2L 1RJZA 5C0FB 3RNQB 3REVA 3DX8B 1DBMH 2A6JB 3O2WL 2IEPA 4EI5A 2ICEB 5J1AA 4X6FB 1A6VH 1PYWB 4AYFA 5LQBH 4JFQB 1OW0A 4DK3A 4G6AC 3FZUD 2IPTH 5F89B 1HCFX 5DJAA 3VXRB 5A40E 1S7TA 5A2JH 1UM4L 1AGBB 4NM8L 5J6GA 3OKEA 1MFAH 2J1KA 2GTWA 4I3SH 2PYFB 3L6FA 3OAZH 1U8KB 1QQDB 5KAQG 1NCTA 1V05A 1JYNA 4JM2A 2ZJSH 1HILA 4JFDE 2VO5A 3FO9B 5DZLA 5MEND 3BZEB 2EH8L 3EHBC 4FG6C 3D85A 5DUPH 5I75B 2Q7NA 2IPKA 4NUJA 5HHOB 2JJWA 3OXSA 4RAUA 4LCIH 2F5AL 1I7ZB 3SE4A 1DQQA 1T2QH 5HI4D 2JJTC 4B50A 5I1JH 4YK4B 3BH8A 4N8PA 1YQ2A 4LK4A 5CEZD 2R56L