1QLFA

Mhc class i h-2db complexed with glycopeptide k3g
Total Genus 69
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
69
sequence length
276
structure length
276
Chain Sequence
GPHSMRYFETAVSRPGLEEPRYISVGYVDNKEFVRFDSDAENPRYEPRAPWMEQEGPEYWERETQKAKGQEQWFRVSLRNLLGYYNQSAGGSHTLQQMSGCDLGSDWRLLRGYLQFAYEGRDYIALNEDLKTWTAADMAAQITRRKWEQSGAAEHYKAYLEGECVEWLHRYLKNGNATLLRTDSPKAHVTHHPRSKGEVTLRCWALGFYPADITLTWQLNGEELTQDMELVETRPAGDGTFQKWASVVVPLGKEQNYTCRVYHEGLPEPLTLRWEP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system/peptide
molecule keywords MHC CLASS I H-2DB HEAVY CHAIN
publication title Crystal Structures of Two H-2Db/Glycopeptide Complexes Suggest a Molecular Basis for Ctl Cross-Reactivity
pubmed doi rcsb
source organism Mus musculus
total genus 69
structure length 276
sequence length 276
ec nomenclature
pdb deposition date 1999-08-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00129 MHC_I Class I Histocompatibility antigen, domains alpha 1 and 2
A PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1qlfA02
3.30.500.10 Alpha Beta 2-Layer Sandwich Murine Class I Major Histocompatibility Complex, H2-DB; Chain A, domain 1 MHC class I-like antigen recognition-like 1qlfA01
3NA9L 5KW9H 4YNYA 1T0MA 5AAMA 4HF5L 3RGVB 4D8PB 1R5VB 3DX8A 1LE5B 2WV3A 4QY8A 2BOCB 1T83C 2F5BH 1CL7L 4P5MA 5FXCH 5KSBE 1UH2A 5FUZH 3TNMB 3UYPA 3KAAA 3QEHB 3BW9A 4Y1AD 2FB4L 3TT1L 3NZHH 3N1GC 2P8PA 4M7LL 3O8XD 4PGDB 4KMTH 5K9QG 1XT5A 2B1HH 1FBIH 4R97B 4RNRB 4HWEH 4M1GH 3FAXA 4FMFA 2YPLE 3CDYA 3WFBL 3BPCB 1NCDH 1BX2B 5HDQL 1WWBX 1KGCE 1P7HL 1KJMA 2IAMC 4NDMA 1LGVA 3TLRA 3RP1A 1G1CA 5ICZA 4X0KB 1W2KT 3X17A 5JPNA 3DHJA 5EOQH 4ZXBB 3STBA 1NBQA 4QYOA 4OLVL 5CD5D 2EDXA 4GH7B 3G5VB 3BPOC 4J3XA 3H3PH 4ZTOL 3M8OH 4HFWA 3HC4L 2EIEA 3QZWG 4FFZL 4MDIA 2YKLL 3TA3D 1T7VA 3VXME 3RGVA 1KUMA 1OVZA 3QCTL 1LE5A 2R0LL 2Z93B 2O5YL 5IMOA 2ZP0T 3SDAA 3QRGH 1NLBH 4PGCB 4BK5A 4Y4KD 2P45B 1T89C 3DMMC 5T5NF 3HI6L 4APQA 4ELMF 3MBED 2CLZB 1ZVYA 4KDWA 5EZLA 5FCSH 3O0RL 3OXSB 4KJWD 1NCCH 2Z92B 4YX2L 1F58H 3VXSE 4MA7H 1QPXA 1JHTB 3TZVA 3CVHB 1R3IH 4KROD 4FP8H 1QR4A 4BQ8A 3V9FA 4HHAB 1S9KC 1V3MA 3MV9B 1CICC 3VI4E 4EI6B 4ZXBA 3VFPA 3N1MC 5CP7A 1A2YA 1XGTA 2VRAA 1HXYA 3V6FA 2XFXA 4NQEE 1P53A 3STZA 1A1MB 1HKLH 4U6VH 2Z4QB 3W0WB 3OAUL 3U46A 4TPRL 1S9VB 3RTQA 3MRPB 5E9DD 4KQ3H 2OI9C 5SWZE 4XAWH 4JKPL 2DQJL 5F70A 1N5YH 4P2QD 3TT3H 2IH1A 3MUJA 3P30L 4LQFH 2FHFA 4LSTH 2H9GB 3SKOB 5BJTB 4GOSA 3OAZK 1TJGL 2CK2A 3H42H 2NYYC 3BJLA 4L8SB 4S0UC 2IAND 2XN9A 4LP4A 4UIKL 4XH2A 1HOCA 4WI7A 5EFIB 1R0AL 1YEIL 4RRPG 4LCWB 1Z9MA 1U2HA 5F7NC 4H88H 1LHZA 3INUL 3MLTA 4K55A 2D0FA 3OXSA 5K9QI 1IMHC 3K0WA 1HWHB 2Z92A 4JZNA 5FDYA 2N56A 3BN3B 1NEZG 1CFVL 2AABL 1CDCA 1T2QL 4OBSA 4C59B 1VPOL 4NNYB 3S6CA 5EBWB 1X44A 1FIGH 4OIBA 4V3EB 1ITCA 1XGRB 3RPIA 5SWSB 4HHAA 3U0WL 5FYJU 4OQTH 4G3YH 3JSSA 3RDTC 1L0YA 3BWAA 4P46C 4TYUA 2X4TA 3LD8B 1C5DA 4IMLB 6FABL 1FC1A 4MNGB 4LLWB 2X4SA 5DFTA 3WKML 2PYEA 5HGGS 3ZT5A 1F4WH 1LP9B 4ISVB 4JFFB 4LVOB 3GGWA 4ENED 1F4HA 3TEUA 4Q9CA 5BJTA 3HRPA 5JXEC 3WFCL 1HQRB 2EYTA 1KG0A 3PQYE 4XNUH 4H26A 4L4VA 4L8SA 3RNKA 1TTUA 1G7LA 2WUBH 4FFWD 4E42B 2BC4A 3IU4L 3VDBA 4NNXB 4PJCF 1NGXB 3QIWC 3V0WL 5GS0C 1IT9L 3WS3A 4JREC 3BVNA 12E8H 3ZYOA 5BRZE 4PJ7E 2DN7A 1ZTXL 4QTHA 4KZEL 3O41A 1CD1B 2J6EL 5LGKA 4LP5A 5C70A 3LPFA 3TPKA 2V9QA 1INDH 2FJHA 4G6KH 5IMLA 1SM3H 5IBTH 4MDJB 2GSIB 5DD0H 1LD9B 4N1HB 5I73B 1SJHA 2DAVA 2P8MA 4WTWA 5AZEL 1JGLL 1NFDF 3CFJB 4LRNH 4JLRA 4QHUA 3A6CH 2PO6D 4OCMC 4PJXE 2WBJB 4HS8H 2Y6SC 1ZT7B 2OMNA 3EYVA 1B4JH 1KB5H 4M1DL 3B5GA 4RISH 1ZHLB 5C6WH 3AREB 3L3HA 5IVXF 1NDMB 4A6YB 4R90H 2IWGA 5DO2D 1IM3A 1KCRL 4P5TA 1DN0A 5C07B 1EO8H 1LP9A 4ISVA 2GTZB 4KY1H 1HNGA 1U2CA 2VISA 3UYOD 1IQWL 1RU9H 3NCFB 3SKUD 2OP4H 3BQUB 3H9SB 1HQRA 4QTIL 5E2UL 1A02N 3BN9C 1XGYL 4ZOAA 3QIBD 2L7UA 4ZO6A 5FKAA 1WSST 1MREL 1HHKA 3GSQA 4L9LB 1FYTA 1KF9B 1YMHB 3F58L 4WDIA 2NX5D 5TH2A 5D72L 1OSPL 1U8KB 1S7WB 4U1JB 3BDYL 5DLMH 3IAQA 5IESL 1T80A 1JYVA 2XIDA 3Q5YA 1UXSA 5TQ0L 2EXWC 4MA1C 2NY0B 2UWEF 3DUUB 4ZQKA 4FG6C 1S7QB 4JGUA 4MDJA 4B53A 1QA9B 4KVCH 2Z0BA 2LU3A 4GRLA 4O2FB 3IDGB 5F96L 4UB0L 5FF6B 1AGDB 3HR5A 3LMJH 1J88A 4FQHB 3MGTA 3B6SB 3LAFA 3QHTC 4K8RC 5CINH 2YD6A 1A5FH 4LAJH 2DLTA 4WI8A 3ZTJH 4WW1A 3UX9B 3LV3B 5GS2H 4JZJC 1U8MA 4DGYL 4P59L 3BDBA 3CPLB 4G42A 5DVOA 3PP4H 5J13B 4BSWB 4MA8H 1G84A 5DI8B 3EYSH 1ADQA 1T1YA 5F71A 3NOIA 4M61A 5IROA 1OAZL 3HNVL 4LHQB 3SBWC 4DN4L 1F13A 1C5BL 2DL9A 4U1LA 3MOAL 2Q1EA 1CFQB 1OAYH 4FTVE 2J8UA 5KS9B 3AC0A 1WT5A 4OB5H 2GKIA 3ABZA 1JF6A 1JI2A 3CNKA 3L3DB 3P9MB 4HLZG 1XR9B 4MX7B 1OTSD 4ZSOA 1MJ7H 4KU1A 1T4KA 1P4IH 4ZS6C 4X4YA 2ESVE 2XQYK 4FQXB 4G80B 3HRZB 3GI8H 3IDGA 3NIFE 3NN8A 6CGTA 2HFGL 4NC2B 3GBNH 4F7TB 1G7QB 3GHBH 4Y4HA 1WAAE 1VFBB 3MRRB 1OP3H 3B6SA 2VDQL 1ZLUH 2CKNA 3TFKD 1DVFD 4PD4K 1NCNA 2Z31B 3D85B 5L7XL 3SDXF 2WLYA 3UCRA 2J2ZA 1G6RH 5MEPB 4EVNA 5C08A 1RFDL 1Z9OA 1JNJA 4HV8B 4KK5D 4NNPH 5E8PB 4OKVA 5DJCA 2PN5A 4TULH 4LLYB 3L1OH 3O3AB 3MRHA 2ICCA 4G8IA 2Z91B 3S7GA 4BSWA 4RGOH 3HCVA 4EOWH 3HC0B 2B2XL 2WBWB 1N3NB 4DW2L 3DUSA 5J57B 2VDRL 3EKCA 4JDZB 3KG5A 4Y19B 1N6VA 4PJDE 1CFQA 4HX1A 1F6AB 2D7TH 1DBMH 3BPLC 1JHKH 1O7SA 4LNRB 5DJXA 1UXWB 1XR9A 3FTGA 4MNQD 4GSDH 5ADOH 4RIRB 3ARYA 3HG1E 4WEMB 3O9WA 2E9JA 5C0RH 1YNLH 3N50A 1K8IB 4Z18A 3FQRB 4ALAH 4F57H 1DLFH 2R15A 2QR0A 3WLWD 1CF8H 1DZBA 5I9QB 4TTDD 3SDAC 4YDLC 1KSRA 3RX8A 2FBJH 3CD4A 4KKNA 4N8VG 3BP6A 3MV7A 4R7NA 5DHVH 2WZPD 3E6FB 1VFBA 2A6IA 3L6FB 4HC1H 5GS1C 1A6UH 1MJUH 1BLNB 4IOSD 2R56H 1WBXB 2VQUA 3C6SB 2Y5TB 4R96B 3IYLW 5C2UB 5HYJA 5F7HA 4PRDA 1QSEA 3GJFA 3T3ME 1FLTX 5E6YA 4OLZH 5GIRA 5C0IA 2OBGA 4GBXD 4LGSB 3KPLA 3QWQB 4Z6AT 4HK0B 5C3TA 3ZE1F 1M7IB 4OD2B 5CGTA 2XG5A 1IGML 1JTTA 2LU4A 1R3KA 2FCBA 1QSFD 2HTLC 2IG2L 4K23L 2AQ1A 2YD3A 2FECI 1P6FA 2ZG1A 5E6IB 3HMXL 3GIVA 4FFVC 1LDPL 1PVHA 1J0ZA 4S1SH 1OQOA 3TVMA 1HIMH 1FFRA 3MRCA 3WJJC 2VXSL 2CRIA 1ROWA 4XRCB 4M3JA 5EPMB 3HTLX 3QXVA 2GJ6B 3FFCD 2V17H 3WN5C 4UQ3B 4JHAH 2CDGB 3PWJA 1NCUA 4HCRH 3EYQC 4ZUUA 1AP2B 2Y9RT 3QJFA 1XCTA 4GW4B 4P3WA 1LO2L 1SQ2N 5GGTH 3H8NA 2RCSH 1UCBH 3ARBC 1ZSDA 4ODXB 4RSVA 2Q7YB 5C0ND 1U6AL 4HKBB 3MOBL 5H37H 4M4RA 3QI9A 3FT2A 4HGMA 3VWKD 3DGGA 5GZOC 2VERN 5E7BA 3P4OB 2BVOB 4Q6IA 2WIIA 1CLOH 5CZVH 5GGRB 3CH1A 4OF0A 5EBMB 4LAQH 1I1AD 3KVQA 3TYGL 4PJAA 3UJJH 3HUJE 4P3DA 1XIWD 3F62A 2B5IB 1J8HB 3DX7B 3DX9B 4TVPL 3D3VB 4Z5RB 2X4OA 4MSWB 4M6AA 5HGHB 1RMFH 3ESVF 4D9QE 5BS0A 1HNFA 3MNWA 3DXAE 5BMFH 1BPVA 2JLLA 2ZWLT 1DFBL 1Z3GL 2EIZA 3HC3L 5C0DB 1JTPA 1KIPB 1E27A 3MNVA 1CDHA 2AI0H 1DQMH 4K7PL 2H26B 3IFNL 4UT6H 1JE6A 2D3VA 3VG9B 5EU5A 2O5XL 3JBG7 4XCCH 5HHMD 3WIHH 3JZ7A 4AEHH 1CT8A 4LF3B 5DMIL 4N0FB 3O6KH 5IW6A 1NAMA 3QPXL 1RZ7L 5EC2A 3QDJA 3U0TB 3IJYA 4LFHG 4ORGB 4OM0L 1EXUB 4I2XB 4NQCB 3IXAB 1GJIA 3OZ9H 4BFIB 4GAJH 4FN0A 3S3PA 2AJZB 4TVPD 2G75A 4JFPB 3QUZD 3CDCA 4I0CC 4NHCH 4UT9L 1MRCL 2XV6B 5EBMA 4MJ5A 3BXNB 4HGWA 3H3KA 5I1EH 3P11L 2AVGA 4M6MH 5D1ZB 3CMOL 3DX9A 2YEZB 5D7KE 1F3JA 1JF5A 3MLZL 5HGHA 4ZO7A 3DO7B 1Q9OB 4XPGH 3VXQA 1T04A 1AR1D 8FABB 4O4YL 2DQCH 4D3CH 1A64A 1MCIA 3D39B 5K9JH 3Q2CA 3ERYA 3LKNA 3QUML 5SX5H 1VDGA 1AE6L 3V5KA 4PRHD 4WEBL 2H26A 4W6YB 3VCLA 5B4MD 1CDIA 4JO1H 1QNZH 3PNWA 1D5XB 5E8EB 3CDGB 4HJ0C 4LLQA 1WIPA 3RUGA 3VFOB 2AJYH 3EJYC 2VLMD 4YK4B 2EDBA 4OZFA 3K80A 3EHBC 4XMPH 1KCUL 5GGUB 4PLOB 2WWKO 1MNUL 4MJIA 5J11B 3AY4C 1S7UB 1IQDB 1A6VH 1LQVA 5EULV 4I9WD 4V1DD 3MRDB 1UWXH 2BNRA 5EZIL 4U1HB 4RA3A 3CFCL 2AJZA 2WWKT 1KTRL 3LKSA 3BEVA 3G5ZB 4CDHA 3MO1B 4NBZB 1CXKA 2P8LA 4Q2ZB 1S9WA 4HUVA 4AJ0A 3QXDB 32C2B 4LPVA 2KZ1B 2XTJC 3DO7A 3LKOB 1E4KA 1M4KA 3QDGD 1MFEH 3UMTA 5A2LH 3TBWB 1T7WA 1H3GA 2X89D 5B21A 5INDA 3HLAB 2ZCHH 3PWNB 1IKNC 5CBEB 1NFKA 3LEVH 4PRPD 2F54D 5MI0B 3MV9E 3V6ZB 5H94B 3I50L 3KR3H 1JTOA 4G9DA 5E8NB 3SE9L 1F42A 1JPGB 1KCKA 1GHFL 3KPRD 5D2LF 5D7JB 5CCKH 1AKJB 5FO7B 4ELMA 1ZLWK 4BUGA 2NY6D 2YS4A 1MFCL 2GT9B 1KEGL 4ONFH 4PRBB 3W0WE 1OD9A 4P57A 4Y5VB 1CGVA 3U7WL 3DVNA 1IQDA 1NCBH 1CGUA 2I9LB 1YYMH 1IAOB 3BZFA 1VGKA 5I1DA 1YNKL 2OYPA 2HVKB 1C08B 1MF2H 5B39A 3CGTA 2QQLL 4BELD 3UEZA 4M5ZL 1BQHG 3PHQA 5DR5H 5T3ZL 2QSCH 4KZDH 2VL5B 4LCWE 3QXDA 5HVHB 32C2A 1WLHA 1DBAL 5LQBH 1SBBA 3LKOA 1KLUA 4EDWH 3TBWA 1II4E 4U1IA 3EYUH 5F7FA 5D5MA 4H25A 3PWNA 5CBEA 2FX7H 4JO3L 5SWSE 2DL2A 3LQAH 2VLRB 4GW1A 2ZCLH 1YY9C 1T5WB 1MFBL 5E8OA 4OLWH 5L2KA 2BERA 4NWUH 5D93B 1Q0XL 1ZK9A 2BNQE 2GT9A 4G8GD 3UO1L 2J7LA 3QQ4A 4Y5VA 3HI5H 3PL6A 4MNGE 4NZUL 3ZHKA 3QNZB 4LKCA 3TN0B 4EUPH 4ZNCD 5BQ7B 3B9KD 1OGTB 4H8WL 1WZKA 4JFFE 4BKLB 2OJEA 2I9LA 5T3ZD 3JTSB 1I7TA 1IAOA 3QG6B 5LWYL 1A47A 1NFDB 5LXGL 1I7UA 4QF1B 4ZAKA 5D9SB 4I18B 4XWGL 5FOBB 1CVRA 5KTEL 3O2WL 5IVXB 5T1KA 3HHRB 3U6RA 4H1LA 4NO3B 2YC1B 3U1SL 2LE9A 4C4KO 5FECA 3ARWA 4U1KB 2A6JA 1NDGB 2NXZB 1MUJA 4OCXL 2FSEB 4V2BA 4PJBA 1EIBA 2AJXH 5EIVA 4JRYA 2CKBB 4UUJA 3KLHC 3I6GA 4PJCA 2GK2A 4Z0BL 1MCWM 4ETQB 3IS1X 4P2OB 3PGFH 4HXAH 4WWKB 5IR1A 2Y5EA 3VGGA 1DDHB 1FG2B 3V4UL 4GS7C 3ZKXB 4F7EB 3D69A 4QRPD 3QEUB 4OCYL 2O61A 4F33B 3VFVA 1YQVL 3GO1H 1CFTB 4R4BB 4Y1AB 4FXKB 1LO4L 3IVKA 5EU6A 5FHBH 4CVWA 4IOFD 5DT1L 1JRHL 1GGYA 3O8XB 3U7YH 2UWEB 3MACL 5C07E 3GKZA 1RUPL 3ALWA 3MLSH 4JHWH 1IC7H 1DCLA 1TIUA 3G6DL 3HZMB 4P9MH 4KRLB 2AJSH 2E7BA 2RFXB 4L8DA 3QG6A 3I2CH 3GSRB 3H9SE 1E6OL 1NUNB 2DWEB 1Q9KA 5DD5H 1HHIB 4CW1B 2QSTA 1P84J 1MSPA 2EZ0D 3ULVL 1YEEL 2J4WL 1MCNA 5GRYA 2EXYC 1IGCL 2K7PA 5DEFA 1CLCA 2LVEA 1TZGL 1BEYL 2A0LD 1Y0LB 1BQUA 3FQNA 3QSKB 1S8DB 3ULUF 5BO1H 3R4DA 3QI9C 2BFVH 4O5LH 1T21B 3NCYP 4KFZC 4Z7NF 2OTUA 4TSAH 4RGNB 4OUUA 4LU5H 1YMMD 4BYHA 1DBJL 2JIXD 5IB1B 4Q6IC 1SJXA 4NFCA 1OTUC 3VDCA 3IB4A 5L0QB 3NPSB 3VGAB 4B50A 1GH7A 4P49A 5F93C 4JR9L 1NCAL 1QFWH 2QLVB 2BHYA 1B0WA 4MAYC 3FFDB 2NLJB 2H3NB 5TE6H 2X40A 5D6DA 3CZFB 4OLXL 3WE6B 3QEUA 3GMMB 5MHSD 4MMZC 4X8JB 2R2BA 2W91A 3MQIA 3ULVD 3U4EB 2DQEL 5HD8C 3ZDYF 3BGAA 2IADB 5CIPB 3TH4T 3ROOA 1BHGA 5HY9B 2EH7H 4QHMA 3THMH 4L29B 2HJLA 5E95B 4JRXD 4IRSD 3QNYB 1FL3A 1NEZB 3P73A 1FORH 3IDMB 5EC1B 2BSSB 4HZLB 3SDXB 3TV3L 2IBGA 1F3DJ 1ZAGA 3ARTA 3TIEA 3VRIB 5KS9E 3MCG1 4R4ND 1S8DA 1RD6A 3BP5B 3CVHH 3T2OA 4KVNH 4JO2H 1T1XB 2ARWA 1MCWW 1T21A 4LSVL 5FO9B 1P84K 1EMTL 5JW5B 4LEOB 3UXFA 4KK6D 4OM1H 5C0BB 3FZUD 4OAWB 1KCSL 2HWZL 3Q1SH 5GHWH 3TA3A 2K1MA 4LOUD 4PLJD 5F6IB 4JO4L 4P2QB 3WD5H 5TQ2H 5GISL 2NLJA 4M48L 4EQ3A 1JYWA 4N5UA 3R06A 3GMMA 3EOBA 4Y4KA 2IANB 1KCVH 3VFUA 1BZ7B 3DI2B 1Q0YH 1LEGB 3MBEA 3NFPB 4KPHH 1TNMA 4XVUD 3NMEA 1WGOA 5C92A 1NMAH 1CE6B 5TE7L 4I0PA 2NY1C 1N59A 3OKEB 5I0ZA 2VDOL 4GMSL 3DJ9A 5JOEA 3IDMA 5EC1A 4Y19E 4N5ED 1CCZA 2EDOA 5GPRA 2HRPL 3DUHA 4U6HA 2A77L 5D8JL 2ICWI 3QULB 3MRKB 4X6BA 5DRNB 3NIGF 1JPTH 1MIML 1T1XA 3MJ7B 5FO9A 1HWGB 4X4XB 4O58L 2XZCL 5JW5A 1BOGB 4M7KL 2HH0H 4LEOA 2QQNL 5SX4H 1A6ZA 4ODHL 2BXZA 1FHGA 4JM4L 5E9DA 4XMLL 5DMGC 1XZ0B 4EN3C 1HSBB 1VEOA 5GGVH 4GJTB 5D7SH 4FQPA 3U9UB 3REWB 2HLAA 3GMPA 5F89A 4KC3B 5F8RC 1FH5L 4J3UA 4ZG1A 1MAJA 4PS4L 3I6KB 1KEML 1F90H 2MQ0A 2WY3A 2PR4L 2HFTA 2ENSA 1NLDH 2XWBA 1F4XH 2GFBA 5IM7B 3SN6N 3UJTH 1KJ3H 5JMRA 5DHYB 4BQCA 5JORA 3QYCA 1CBVL 2CIIA 1AGCB 5T3XH 1CE6A 1P5VA 4NKOB 3RY6C 3SCMC 4MXQA 4D9LL 4Z7QE 3GHEL 1A7BA 5FGBA 4AT6B 3LQZB 3SKJL 4XCFL 1R3LB 4HUWB 3KPQB 1N26A 4HS6A 2VABB 2EC9T 3DV4A 1A7NL 3MNZA 3QULA 4OJFL 3T2QA 3FHQA 1GAFH 4S1DD 2GJ6E 3BISA 3BKCH 3I75B 3RWEB 3QXUA 4CADB 4YO0B 1KOAA 1FFPB 3LKPB 3LN4B 4AL8H 4OIIH 3RPKA 3PWLA 4UINL 5KVEL 3UPCA 3Q5TA 2VR4A 5DURB 1C1EL 3QXWA 5C0AD 1HHJA 1IJ9A 1B0RB 1R5IA 2QQKL 1U8IB 4C56B 1U95A 3UTZB 3UTSD 3VMNA 5IM7A 4JJHA 4NWTL 3RVVC 1ADQH 1G0DA 2EDFA 3VI3F 1OGAD 2NX5B 2VNCA 1VFMA 3V4VL 4CU8A 3CCHA 1ZKAA 2GUOB 2IFFH 5DVNA 1P4LB 3JWDL 2YN3A 3SGJC 2YPVL 1J1OL 1J8HE 2GSGA 2X4UA 3FQXB 2P42B 5C0CB 3D3VE 1KPRB 3O6FD 5J1TC 1GGCL 4X9BA 2XZQH 1VKXB 5FYKD 3ZE2F 4FZ8H 2ZCKL 3ETBF 1PJ9A 2P47B 2PO6A 4I3GA 3WNLA 2PW2B 3PL6C 4EI5B 4QGYA 5DJ6B 2R23B 4Z78A 3HNSL 1FNGB 5BZDB 2BNUB 1GZPB 2YK1H 2EDLA 3TNNB 2ZUXA 5ICYB 3SE4A 1FFPA 3TO4D 3MXWL 3FT4B 3G6AA 2C7UA 1MCOL 4OT1L 3FQTB 5L9DH 2BVPA 3S34H 5DRXB 2Q6WB 5HI5D 2G60H 1FPTL 4WO4B 4PBXA 3AROA 3CFKA 5TF1H 4JFOA 3QIBA 4MJ2A 4PRIB 4I2XE 4NQCE 3BD3A 2J6EA 1NBVL 1P1ZA 4NO5A 3NFSL 2R9HD 2NX5A 5E1AB 3HE6C 3V5DB 4J6RL 2DRUA 1S7VA 3MCLH 4LSRH 3V8OA 4G6FD 3WUWA 4QEGA 5FM4A 4JM2B 3ZKNC 4ZS7L 5EORL 4OGZA 5C0EA 1ZLSH 3AGVA 4OZHF 4UOW1 4JFYA 1EHAA 2EYRB 4NCC2 4CNIB 4F37K 1DUYA 1JIBA 3ARQA 4Y2DA 3QEGH 5ADPH 4PB0H 2JJTC 3PGCB 3D39E 4TUOA 4OKDA 3ZYJA 4LCIH 4WFHE 5AYUH 4JQVC 4TUJB 1CG9B 3GM8A 5HBBA 5BZDA 1FNGA 2ZJSL 4DUVA 1GZPA 5ID0A 7FABH 1QFUL 3OJMB 2R1YA 3T65A 3GMOB 5ICYA 3ALPA 1NGPL 5DQJA 4KDTA 1GOHA 3RQ3A 2A6DB 1A7OL 3FQTA 4K2UH 3T1WA 3SKNB 1G9NL 2I27N 2R29H 4JQIH 4NKIL 3WHXA 4F3FA 2V2XA 3ZL4H 4DN3H 3TF7A 4KRMB 3QIUD 3OKLB 4Z95L 2J5LB 4NKQB 1JF1B 4IRJC 4PTTA 2VQTA 1MAML 2WK2A 1J87A 4ZDHB 2FX8H 1CQYA 2NY5L 3OB0K 1CXIA 3V5DA 3L7EB 5ESAA 1X3DA 4U05A 4JFQA 1BECA 5E2TL 4HIXH 5DRWB 4DEPB 1JJUA 2L7JA 1BAFL 1XF5A 4JB9L 5D2LB 2VSDA 1J1XL 7CGTA 1B2WL 4MNQB 1TNNA 5HYQA 5F1IB 2EDJA 4LKXA 3DWTA 1MRDH 1W8NA 1DQQA 4C54A 1JNHB 3RWIA 1SVCP 4XP4L 3RWGB 2WINB 1MFNA 5JHDA 1AO7D 4IS6B 4PV8A 2H1PL 1J9CT 1GC1H 1KNOA 5HPOA 3OHXB 4LLMB 3O2DH 4DTGH 5K59F 3VGFA 1WC7B 3EZJB 1EAJA 3L3JA 2FEDC 4NRZB 4TUJA 1NC4B 4Y8DC 4N9GA 5CEXB 4S1QL 5KBNC 5DD1H 3KJ4B 3TFKA 1DVFA 4KTEL 4ZTPL 1PSKH 3ARVA 3P2TA 1I8KB 1L7TH 3RAJL 2ZOLB 1OM3H 4GBXB 1AY1L 1QQDA 4AG4H 3IFOB 2ED8A 4ZPTB 4Y5YA 3UZQA 4OLEA 1AI1L 1HHGB 1CLYL 3WIIL 4OZIF 1YPZA 3OKLA 4K3JH 1FZJB 1W72L 4D9RD 5DMYA 5I71B 1LDSA 2R1XA 4TTGA 4LHUD 4X4ME 2DS4A 4CMHB 4Y2OA 5I74C 2MWCA 1I8IB 1SHMA 1B3JA 4JDTH 3GJEB 3MRGA 4C83A 3NCBB 3QO1B 3O6MH 1RQ5A 4K71B 2A9ML 4IS6A 4OZGF 4WCYL 4Y0GA 4JG1H 4YH6A 1TQBC 1ITBB 4JN2B 3ALXA 2OR9H 4Y4KC 4DZBB 1FZKB 2VITB 1F8TL 4KAQL 4G8EA 5K9KB 1WUNT 3VE0B 4ZUVA 2EICA 2CK0L 1XAUA 2VLRE 1DN2A 4JCLA 5F9WC 1IBGL 4BQ6A 1AJ7L 3GBMH 3T0BA 1KELH 3RVUC 4GBXA 4I0PC 1UB6A 1FL5B 1AC6A 4KTYA 1G9EA 3QXAB 3ARSA 3U0PA 2LABA 3SGKA 4RGMB 4LASL 4IIQC 3TGXA 1AHWC 1A9EA 5SWQA 4HBCH 5B8CA 4XBEL 5IJVB 3E3QE 4NP4H 1QSFA 4QHNB 5KSAA 1CDBA 5I1CH 2ZOKA 3X13B 2ADIB 4BH8A 3BKYH 4S1RL 1NFDE 5I15H 3QUXD 4GAGH 2NY4C 3R0MA 4WW2F 2CUIA 1YC7A 3FFCA 3PDOB 1H15A 3GJEA 4OCRH 4V3DB 5IVXE 1B0GA 2XT1B 4L8CB 4OTXH 3RVTD 1EJOH 2HAZA 1UKTA 1ZVSA 5I1GL 4QRQB 1FFOB 2HYMA 4ZUSA 1FZKA 1T2XA 3VGBA 1UFUA 2HKFL 1JCKA 2IPTL 2GYSA 4QXTB 3VE0A 3GI9H 1T03H 4XXCC 1FFNB 1HYRC 4YBLC 4QWWC 1MCPH 3VWKA 4OFIA 3LRSB 1RZIB 5D1XD 4XVSL 1NCTA 4KJQD 4JE4B 4MXQC 4EEEA 1AXTH 3C5SA 4P4KD 1ZA6A 5FGBC 3MRLA 5ICXA 5T1LD 5ISZD 1IZJA 2IPKB 2UY6A 3K1KC 4NO0D 5HHOD 2VDKH 4Y1AE 1I1AA 5HPMB 3HMXA 3UROR 4F9LA 1QEWB 1XIWA 3FO1B 5IJVA 1O0VA 3BIKB 2UWEE 5BOPA 4QHNA 4XVTH 1RHHA 3V5HB 3ZTJG 3D0VA 3QWOB 5AD0B 5FGCB 5KSVB 4WFEE 3D1MC 4G9FB 1BM3H 2VLJD 2EECA 2CPCA 4PRHB 3C8KB 5F88A 4Z7VB 3N1QC 5CBAB 1D5ZB 3QXTA 2R4SL 4G43B 2R8SH 1UWGH 3HNTL 4ENEC 2AJ3A 1CVSC 1JWSB 4L8BB 5HI4C 1ORQB 1U8HB 2AS5M 2ORBH 4MXVE 4JJ5B 4X6EA 5HHMA 1BVLB 4MWFB 3UTOA 3IGAA 4RGNE 2P46B 2CDEA 1A1NA 3KWWA 4PTUB 2ADGB 4PJ9C 2P5ED 2XNAB 1PQZB 4CBPA 1CZ8H 4DK3A 3JVGA 4MQ7B 2ARJQ 3X3FL 1E4XH 4K3GA 1J5OH 3T09A 3OJDB 4V1DB 1RIVL 1JGUL 3W2DH 3T0DA 3QUZA 5CWSA 1BBDL 2IPKA 4NQXA 3W9EB 1GGBL 5EBGA 5JUEH 4RQQB 3DSFH 1VACB 1BQHB 1IC5L 1TCRA 3LN5B 3S37L 1T7YA 4Q74A 2XI9A 2BVTA 4EXPX 4ELKA 1AD9A 1K8DA 1RUAL 2IAMD 4X5WB 4WU5B 4UMGA 4ZUWA 4XNMA 3QDGB 4LSUH 2AKRB 1TITA 4ONHA 3FMGH 3MLUL 3SDCA 1SEQH 1KJ2B 2VR5A 5T1DL 3SDXE 5JLZB 4CRPA 3MRBA 4CL7A 4Z7OF 3QUKB 1UACH 3DPBA 4JPKH 2YD7A 1JWSA 5ALBL 3VXRD 3A67H 4F37F 5ENWB 3CVIL 4OI9A 3STLB 5DQDH 5IB5A 3QIBC 5HYSG 4J23A 4K7FA 3GKWH 4PTUA 5C0BE 1QACA 2XNAA 2IH3B 2FLRT 4BZ1H 3SDYL 4X5LA 2E7LA 3W39B 1P4BL 1Q72H 4P2QE 3T0WA 3DMMD 1Z5LA 1SJEA 4V1DA 4P2RE 3VFWA 3MROA 1GYAA 1I3GL 3IF1B 3BZEB 4CMMB 1NUFA 1CU4H 1HINH 4N0UA 3V6OA 2P7TB 5CILL 4PJ5D 2IANE 3GMQB 4YHML 4FQ1L 2P49B 1JHLH 4QRRD 4Y2DC 1YUHB 3HE7B 1I9JH 1PKQB 3QUMA 1SYVB 4YUEL 5I17A 3RA7L 3JTTB 1YN6A 1QYGL 3QDGA 1FJ1A 3IDYB 2OZ4L 2Q20A 1CICD 4MA3B 4PJHA 2UZIL 2X89A 4H1LH 4M7JH 4XNYH 3X14B 2DQDH 2X4PB 1XF2B 5ANMB 4HBQA 2C1OA 3K46A 1D6EB 5EOCL 4PRPA 2F54A 2AEIT 1INQB 4PGBA 1AGFB 4HWBL 1FLRL 4L3EB 2N1KA 3KPRA 3IDIA 2BSTA 3ZE1E 4P4RB 4UIMB 1CE1L 3EDFA 5IIEA 4K94H 4UT7H 1MLCA 4HPYH 3KPSB 4KHXL 4RZCB 4HAFA 3QDMD 2NYYD 4HXBL 4RWYL 2OJZH 4HAGA 2FD6L 2AV1B 1T22B 1WFNA 3RHWK 1OAUH 1S9XA 5GGSY 1YEHL 2KUTA 3ZDZF 3VH8A 3GMNB 3M1BB 2DKUA 2F74A 1FDLH 3CSBA 5D7IA 2VQ1B 4PJIE 1JP5A 4MHHG 1CD8A 1C16B 5B3NA 3K2UH 4YHNB 1J05A 4ODTH 5JOFA 1SMAA 5H37G 5HJ3A 4LSPH 1YDPB 2ICWB 5I1HL 3ZKSD 5AUMA 2Q3ZA 2CUHA 3UZVB 4UILL 1T5XB 3FL7A 3EGSB 3UBXI 3WEXB 4HS3A 4DGIL 1N5AA 4X6DF 3RDTD 1ORSA 1QP1A 4P46D 3ZE0F 1U3HB 2VYRE 3KPMA 3WFEH 5CSZB 4NZJA 4Y5YC 4PG2A 5CJXA 4L4TD 4TUKL 3H7LA 2XRAL 4LCYB 1A14L 4JFZL 4ODSH 3DBXA 1IRAY 4LLVB 3LPGA 4YXHL 4M02A 4FZEH 4UQ2B 5EUOF 2YN5A 2DWDA 4QRPB 1M05A 1XH3B 2EYSB 4G8GA 1FVDA 5HHPA 1SVZA 5KVDL 1IGYA 1D6VH 5JXED 4PJFF 1D5BB 1FNLA 3D0LB 1WEJL 4BZ2H 1FN4A 2E5EA 3B9KA 3UAJC 1HSAA 1MHEB 2XZAH 3QIWD 5GS0D 3WS6A 3GMNA 4LLAA 4M6OH 3MREB 3WFZA 1ES0B 2GHWB 1PEZA 4C56E 1I3RB 4QRUA 1XGPB 2FYYB 4M43L 2VDML 5C6TH 2NX5E 3NCJL 1M7DB 1ULVA 4YPGB 3U36A 3GIZH 1PW3A 3P4LA 2C3WA 4LVOC 4PYGA 4PBWD 4PV9A 4JQXA 4EDXB 4ETYA 3PDGA 3MYJB 1TZIB 3FB8B 4L1DA 5C0CE 2Y06L 4Q0XL 1YMMB 2Y6SD 1A3RH 3TWCL 2JIXB 3NA9H 4B7LA 2OTWA 4NQSA 2OM5A 2HT4C 3DOSA 3DURB 4K8RL 1CL7H 5B8CC 4GKSB 4KI5E 4Z7UA 1VENA 4UQ2A 1DEEA 3MJGX 1J0YA 1X5FA 5KSAC 1GRWA 5BV7B 3WLBB 1LQSR 4M7LH 1CTNA 1PX3A 5IJKC 5I73C 3BN9D 4OZHB 2DD8L 1E4JA 5KAQG 3QBTB 1QHOA 2YWZA 3D18A 1NC2B 4NC1E 3F7YA 5BZWB 2WBJC 4PGJA 3ZSSA 4LRIC 3UTTD 4NQDD 1N64H 1V7NH 3WFBH 1T7XA 2WSKA 3CAFA 5D70L 1XF3A 3NH7L 4IRSB 4PJGE 4MJ6B 4PRIE 5HDQH 4PRNA 1ES0A 1BJ8A 5TDPA 1H3PL 1H8NA 4HDIB 5CEYB 3CUPA 5CIPH 1XGPA 4NM4L 4W4OA 1HH9A 2X4QB 2EXWD 4YQXL 4MHHI 4FG6D 3VRJA 4HJJL 2J8OA 5JR1L 1JZ8A 3BQUC 3SJVD 2R0ZH 1BP3B 2AEWA 2CLRB 4J2XA 3MJ8A 1I1RA 4JFDB 2A74B 4ZTOH 2NMSA 2JIXA 3NFNB 4K8RD 3P0VL 4YC2B 5E00B 3U79A 4L9LC 4QO1A 4FFZH 5FHAL 4OF5A 3WFDH 1OPGH 1Y18B 3WNKA 3QCTH 2X1XR 3W5NA 2ATKB 5INCA 4ONOA 3QEQB 4N0YL 1OAQH 3B3IA 3D2UB 4Z7WA 4ZFGH 4UTBL 2NY0C 1UM6L 2AAVA 2D31B 1W0VB 4IDJH 4N1EA 5F9OH 1KBGH 2H32A 1ZLVK 1CXEA 3O3DB 5D2NB 2B1AL 4YX2H 3VJ6B 4UV4L 4NRYA 3OR7A 4U2YA 4XP6L 3J7HA 2FR4B 4JRXA 4IRSA 4MJ6A 1D5MA 3ES6A 3PP3K 3OKKB 4YIQA 2OL3B 2DJ4A 3CFDA 1S7TB 2X4QA 1KIQA 1FV1B 3AAZB 1OAXH 1MI5E 1OCWL 2V2TB 3VRLF 5ETUA 3ARRA 2A2QT 5KJRL 1HI6B 2MMXA 5D2LE 5J13C 1TETH 4YLQT 4JANA 5F6HJ 4MNQE 4ODVL 2COQA 3PABB 43CAB 2CLVA 3MOQA 4FQ2L 1T7ZA 4QNPF 4M8VA 2VE6B 5DD3L 1C8PA 3VFTA 1EFXB 2PTTA 4JKPH 4CVZB 3MODH 4PP2A 3Q6GL 5IP4A 1A7RH 1RIUH 5TDOB 1U8LA 3P77A 1RIHL 1TJGH 4PYHA 4AQ1B 4WEUD 2CH8A 3C2AL 3OAZH 1BJ1J 1U36A 2EH8H 4D0BB 4Z8FL 1TPXB 1RZ8A 4FQXC 5FYJL 1G0YR 3BKJH 3OKNA 1R0AH 4ONGL 1ZXQA 4XX1E 2JCCF 5CKGA 4QOKB 3INUH 1ZS8A 2HN7A 3SDCC 1QRNB 2XOTA 1DLHA 3I02B 4NQTA 1K2DB 4R2GC 5DJ8A 4PJEF 3MZGB 2AABH 3R1GL 2Z31C 1KTDB 5EO1B 1RV6X 1T2QH 5EIQA 1EEYA 5DA0B 5DXWA 3PWPD 5KVGH 3IDXL 3IT8D 5E2WH 3ZHLA 2Y1VA 2VN4A 4N5EA 3PGDB 4MAUH 1WBYB 3WJLA 5IEHB 3U0WH 1A4KA 4FNLL 1TMCB 1P2CB 3AAZA 5GRVK 2V2TA 3VGHA 1VSCA 2V7HB 4ZO9A 3SDAD 1CLZH 3G5XB 4XC3L 5IV2A 1JGDB 3V2AR 2Z8VC 3WXVL 2DTMH 5KSUA 1RK0B 4OZIA 2FH6A 1IM9B 4LBEA 5C2BL 5F9JB 4R9HA 3L5XL 5FYJD 1ZHNB 5FIEA 2DBLL 1ZANH 4XPTL 3MV8B 4D94A 2E6QA 4LPWA 2QQQA 4OFPA 1T20A 1A4JB 5DWUH 4D0BA 1YN7A 3BUYB 3S97C 3IU4H 4WW2B 1ETZB 2DI7A 3KYNA 1K6QL 5HGDA 3UTSB 3V0WH 1IT9H 3L7FB 5JW3H 1C7SA 4YAQA 3W11C 5GSVB 2HTLD 4H0IA 2ZKHL 3AXLB 2I60L 3MLYL 1K2DA 4OZGA 1REIA 1IC4L 3BT2H 5I8EA 4KZEH 2J6EH 4YHOH 5CEZL 4ZPVB 3S4SB 1KTDA 4C57C 3RHWF 1N0LA 3UJIL 5DUMH 3C5JB 2XYCA 2VXVL 4JY4A 1FO0L 2SEBA 3B9AA 3FJTA 5KAQF 5E4EC 3HI1B 5I1KL 1KENL 2E27H 5AZEH 3ULSB 1JGLH 2MKWA 5HVFB 4LLUA 5F97E 5I76A 3QZWA 2HFFA 2GITA 4C58B 3ARBD 2F5AL 3G5XA 4X7SL 1BD2D 4OCSL 1D3CA 1I8LA 1PLGH 2XN9D 43C9B 1A7QH 1C12B 4NCDA 3PE9A 3MLRL 4JN1H 1KCRH 1MCLA 4U1SB 2HG5A 4HT1L 1NAKL 3EO1A 4XPFL 2X1WL 1JPFB 4D0DB 5GZOD 2OK0L 2EDTA 4JAMB 1MHPL 1IQWH 5C09D 2BSRA 5F3BA 1C5CL 4QTIH 3LKQB 3T77A 5C0AA 5E2UH 1J0KA 2MQ3A 3RX5A 4YDJA 1EEZA 3QFJB 1MREH 2EDEA 2ATPA 5CEZD 5T1MB 2GAZB 5DJAA 5D72H 1OGAA 2Q7NA 1GGIL 3AXLA 4OD1H 3ULUE 3BDYH 3OKMA 3TPUB 5IESH 4E0RB 3T4YA 3WIFB 2JTDA 1T66C 4NT6B 4Z7NE 1BJMA 2Z35B 1YEJH 2LU7A 4IBLT 3O3EA 2G9HB 1CFSA 1EAPB 3O6FA 2ED7A 1MWAB 2VXUL 1MJ8L 5C9KA 4MS8C 3MRJB 1UQSA 5F96H 2PYED 5FGCE 3FCTB 5J9PA 2XWJA 1SBSL 4G9FE 5EH1A 1KTKE 2WAHA 4JRWA 2V6HA 4NUGH 1BZ9B 2A1WL 5ITFB 5TGBB 4MXWH 1KJVA 1JUFA 4PRHE 1UADC 4LDEB 4L4VD 4XP1L 4Z7VE 2HVJB 1MCHA 3AMLA 4M93C 3TO4A 1I4FB 5CJBA 4P59H 3WS6C 3IFLL 3RWDB 3LZFL 5I6XC 3ZDYE 1FAKT 5BCAA 2IALA 4JPWL 3VXNA 1TLKA 4RRPA 2BP3A 1JI1A 4JDVB 3SKMA 3LKQA 3GSNL 3S36H 2VJXA 1PG7H 4E5XB 4XB7A 2HT3C 2R69H 4HWZB 4PUBL 3RL2B 5DJDA 3RL1A 2FZ3B 5I1IL 4XMKL 3HNVH 1OP5K 3VFNA 4DN4H 4YFEA 5EBLA 1A6WH 1C5BH 3RZCB 2VLKD 1F6LL 3PDDA 2YOCA 2MHAA 5JA8B 2WIMA 4HFUH 2W65B 4JPIA 4IRZL 5JOPE 1NQBA 1AQDB 5ID1A 1QVOA 1YA5A 3EO9H 5MEOB 1P7KB 4DQOL 4GMTL 1R3JB 1EAPA 5J4MA 4GG6B 3CXHK 4PREA 5IVZB 2VSCA 2VZ1A 3UTQB 3NZHL 1EHNA 5TDNB 2HFGH 3WFHB 5E56A 1OF2B 3CU7A 2B1HL 1FBIL 3IU3B 1BZ9A 5ITFA 5FUCE 4HJ0D 4I3SL 3G04B 1K4DB 5L7XH 3EJYD 4U0RB 5M95B 4QCIA 2HVJA 4XCYA 5J6GB 1NCDL 1BIIB 2QKIB 2D9CA 4M8QA 3EHBD 5EZJB 3HZKA 3NZ8B 4KQ4L 3E2HA 4E41B 5LAXB 3MA9H 3TBSB 2EZ0C 5EO0B 4JDVA 2FIKB 5EOQL 2YXMA 4P23B 4Y16C 2DQUH 3QIUA 1JGEB 1T0PB 4E5XA 3VD5A 2R1WA 4L3CB 3AB0C 4WHTA 1BBJB 3HPJA 2NY7H 1KB5B 3PV6A 5LJYH 1HZHH 4X7TB 5GGVY 1WJ3A 2XTJD 4XZUB 1D9KC 3EDKA 3OR6A 4NYLA 4YK4C 2XKNA 1RHFA 4W6WB 2VIRB 5B38A 5J11C 2Q8BL 3QRGL 3L5WB 5F7EH 4EZMA 1PKQE 1QFWI 1G9MC 4FQIH 3MJ9L 4GFTB 1G7PB 3EJJX 4GRWF 1AO7A 4PP8C 3CIQA 3F6IA 1JWUB 2EO9A 1OF2A 3QQNA 4XGZB 5MP6L 3HS0B 5DTFB 3HKFA 4ZO8A 5L8JB 1VESA 3C08H 3IKCB 3LVEA 2YRLA 5ANME 4FQCL 1F58L 4G6MH 1T6VN 5J6GA 1MFAL 5I0DA 1HHHA 4MA7L 5LGJB 4GAYB 3NZ8A 1YECL 4L3EE 1Y6NR 1R3IL 1JV5A 5A16B 4FP8L 1QLEL 3TBSA 2XA8H 2X4NA 3QO0A 3EFDH 2VZUA 4KUCD 1M6OA 3KPSE 5AZ2L 3AU1B 4LPCA 3VFSB 3C87A 4X6DB 3BHBA 1PZUB 2FNBA 3N85L 1FGNH 3REVB 3M17A 3HMXH 4XPAL 2IJ0C 4LHUA 4LGPB 2G5BB 1OAKL 3B8SA 3QUXB 3TT3L 1N5YL 5CUSL 4OFVA 3RWFA 2VIRA 2ZNXA 3PF2A 1EO7A 5EUOB 4RX4D 2JJSC 2R2EA 1XGUB 3EFFB 3O4LB 3H42L 4M62L 3F12A 2KQMA 4PJFB 5BW7C 2ADFL 3NABH 4NPYA 1N8ZB 2EEAA 3QDAA 4NKDB 5T5FH 3GJFK 1RZJH 5J1SC 5DTFA 4WUUD 1U6AH 1YY9D 3UDWC 2C3HA 5EU3A 3MOBH 3NAAL 3KHOA 1F3RB 2FO4B 3IFPA 2JB5L 4IMKA 2X9XA 4XBGB 3V4PH 2B0SH 1O5DT 2DMCA 4POZD 2W59A 1R5WB 2X10A 4QRPE 1W72A 2VAAB 4Q9RH 4OQTL 4G3YL 3TYGH 3TO2B 3T3PF 3F7QA 4OF3A 4HMDA 3T04D 2BCKB 1DQTA 4KV5F 3T8XB 4TVPH 3X12A 3ULUH 3WL9B 2DQTL 4PR5A 3ZE2E 1W8OA 4CVXB 5IB2B 4AMKL 3UBXB 3MV7D 2G5BA 5C7XL 4U6YA 1DFBH 1F4WL 2KDGA 2XA3A 9CGTA 1P9MA 3QUXA 4XTRC 2ITCA 1BMGA 2VLJB 1UZ8A 2XY2A 5ITBH 3MA7B 3SGEH 4Q7DA 5EUOA 5DF0A 3TN0C 4UTAH 3E3QC 4XNUL 3L3KB 3V79C 2WUBL 3P9LB 2O5XH 3KLHD 1OSZA 1N8ZA 4NKDA 4WGWB 3GFUA 2OSLB 2FIRT 3L5HA 3CFBB 1KULA 1YMME 3E8UH 3PWVA 4I18C 5HYSB 1ZWIA 2P5EB 4J12A 3IJSB 4OM0H 4KDVA 5FFLA 5D1XA 4LDLB 2NW2B 5GJTL 4G6KL 1SM3L 5IBTL 4P4KA 4JHZA 3CFEB 5ISZA 5T1LA 1OT1A 2XQBH 2VUOA 1NMCC 3B9VA 2ARJB 2NXZC 5DUBA 3S96B 4QHLB 4LRNL 1DBBH 5HHOA 1ZVHA 4NO0A 3VXUE 1WTGT 3R8QA 1I1YB 1AXSB 4HS8L 3GSVB 4RFEA 1B4JL 2V2WB 1KPUA 4OZHE 5DHVB 3T8XA 5DYOB 4CUCA 2EXYD 2IAMB 1DUZA 4P2OC 4JFEB 4R90L 4WWKC 5TPWL 3VXOB 5C6PB 4O4YH 3RWJB 4QHKI 3WDJA 3ZKXC 1EO8L 5JIIA 2F53E 3QUMH 1L9NA 4KY1L 3MZTA 3QI9D 4N8VA 4ZD3H 2OP4L 3VFMA 4G7VH 4HKZA 4I5BA 1ZV5A 5I16B 3FOLB 4JKWA 4NCC1 4OGYH 5GSRB 1Z0NA 1H5BC 5CHNB 3BIBX 3C60B 1OTUD 5K33A 3KLAB 1N6QH 1IFHH 2AXGB 2VH5L 2O93L 1BFVH 4I48B 5IFJA 4JFDE 3CFBA 4MAYD 1KCUH 4AIOA 2P5EA 4AH2A 1ZHKB 5DLML 5A3IC 1T83A 1LILA 1B9ZA 3PIQB 4JY6B 1Q9WB 5L2JB 3QEQE 5DMKA 2DIAA 2DYPB 4KVCL 3CFCH 4LVHC 5AYQA 4R0LC 2FWOB 5HD8D 4RGNC 3LMJL 3V0AC 5GGSB 5L0QC 4I3RH 5DD6A 1A5FL 3LDBB 5HHNA 2QHRH 3NPSC 3VGAC 5IW3A 4XNQA 2FGZA 3TJEL 2IAMA 3I9GH 5IG7A 1HXMB 5D2NE 3MMEB 5K93A 3RZWA 5CP3A 4XHQA 1X9QA 5K59E 1XF4A 4WI3A 4WJ5B 3HZYB 2NY3B 2X9WA 3TO4C 4MA8L 3QDJD 3F65A 2YPLD 2ZSVB 4ZMAT 1KV3A 2R2HA 3EYSL 4RMRA 1L7IH 3GRWL 3I50H 4HUKB 4HIJB 4ZFZB 4TQEL 1KGCD 5IB3B 5JW4N 1RK1B 2JCCB 3VXRA 4K7PX 1CD0A 4GW5B 4LGRB 2OI9B 1MFCH 1EZVX 2JF1A 1A6AA 1ZLWH 1KEGH 3C5ZB 3DX6B 4ACPA 4X6CB 2R0WH 2J12B 3KNBA 3O4OC 5CSGA 3NBNA 1K4CB 2W9LA 3AUVA 3HPLA 2VDLL 4G8FB 2EDNA 4LARH 3TESA 3IDJB 3IDUA 3MUGA 5J1AA 1P4IL 4WI4A 2GCYB 3PIQA 2B4CH 3DMMA 1NEUA 4YHKH 1QBMH 4XI5C 1YNKH 5JQ6L 3QQ3B 2C1PB 2JJUA 2QQLH 2C26A 3VXMD 3GBNL 3GZKA 5MENB 2HJKB 3GHBL 4Z77A 2BK8A 4PJ5A 5MERA 2VXQH 2W0KA 5IFAH 3PXHA 2NY1D 3K4AA 1H3WM 5CMAA 4QRRA 1BVKA 4QOKE 3OGOE 1ZGLP 1DBAH 2J8UF 1N2RB 1QRNE 1G6RL 2K3TA 4NNPL 3S35L 2P24A 2F15A 2EC9U 1R3HB 2YR3A 2ZZUT 1CICA 1L8JA 4O2CA 3TIDB 3C09B 2GK0B 3I3BA 3LB6C 3RDTB 1WCBA 3ILPA 4RGOL 4MJID 5ELIA 3VXSD 5IF0A 3BDXA 4YPJA 4L4TB 1GPOH 5IHZA 1ACZA 2AERT 3BP7B 4GKNA 4NFBA 4JCMA 4X83A 5I1LA 3C6LB 5C0JA 3KYMB 2OI9A 1WQVT 4KK8C 5DMGD 1SEBA 4EN3D 1ZGLM 2D7TL 1DBML 4HIHB 1H3TA 1JHKL 3FQWB 4PJEA 4YGVB 1P6AB 5IEKA 3QH3B 4NZUH 3QJHB 4GSDL 4NQED 3QDMA 5A40E 3S98A 3IDJA 5FYLE 3QR2A 4H8WH 4P48A 1LK2B 3H9HB 1GZQB 5C0RL 3MV8E 5DC0A 1KIRB 4ERSH 4F57L 1U41A 5LWYH 3QIWB 5LXGH 5SWZD 4WRLA 4NKMB 3MRMB 2H6PA 1NBYA 3SCMD 1CGTA 3B9EA 1ZA3A 2IF7A 2ZUYA 1A6UL 3UTSE 5KTEH 4LCCA 2OZ4A 3BI9X 3JV0A 2Q76B 5HVGB 3ZZ1A 1CFBA 3FONA 2XZZA 3OSKA 1MHHA 5ESQB 3SE8H 5HHQA 2XG4A 3ECBA 4MJ4A 4YZFF 1G1YA 2OTPA 2X4RB 1U58A 1T1ZB 3BPNB 1EO5A 1M71A 4OCXH 3CSGA 2GK0A 4HWBA 2C3XA 1BWMA 4P46A 4S10A 1RUQL 4AZ8A 3IETA 5IHLB 5FYKE 5IBLC 4JVPA 2NW3A 4R26H 4JGJA 5IQ7H 5ERWB 4HUNB 3JWOH 1P7QB 3KYMA 1BGXH 3V4UH 4YR6A 1LO0L 3ARGB 3FQUA 4GXUM 1HIML 1YQVH 1J0IA 2B20A 1LO4H 4WFGE 5JXEA 4HUUB 5DT1H 4XCNA 3T0XA 2V17L 5I1AB 1RUPH 1HILA 1EJ6A 2HJFA 5FA4A 4FMKA 4JHAL 1DQLH 5I75B 5DS8B 1YEDB 1E6OH 3UTTB 1RZFL 1S7RB 1WVZA 4NQDB 1INEL 2RCSL 1VA9A 1UCBL 4PY8J 5DQ9A 2EDHA 1YEEH 1IKFL 1WV7T 2MCPH 3QFJE 1DTUA 2H32H 5MEQB 2JB6B 3MR9A 3TBTB 4UBDC 2D9QB 1GGTA 5T5NG 1BEYH 1TDQA 3H9YA 3DVGB 4MA1B 3K7UA 2ED9A 4P0DA 1N4XH 5IMKB 3TPUE 1U8QA 4KJPC 1E28A 3MFFA 4ZFOL 5L2KD 2X4RA 2YPKA 2PF6A 5IKCB 1LE9A 3VXTB 4JKMA 5HGAB 3UZEA 5BRZD 1DBJH 4XNXH 5HHVH 1U91A 1E6JH 3UJJL 5FDWA 5LCVL 5E99H 1NCAH 5FV1L 3GB7B 3JV4A 3W82A 5B39G 5DVLA 4MD4B 2BX5A 4Y4FB 1I7RB 4HQQH 1B4RA 2ICEA 5I66A 4Y5XA 1FVEA 1DQML 3OWEA 3P40A 4ODWA 4UT6L 5F1NA 4EI5C 3UTTA 1S7RA 4PJAF 4KI5C 1EUTA 3HE6D 1CDJA 4XCCL 2A6KA 4FQJH 3BGMB 3GMRB 1YNTB 4U3HA 4S0SD 4AEHL 4NHUA 5SV3A 3BJ91 1ZHBB 3O6KL 3SO5A 3ZKND 3TV3H 4OSUH 1S7SA 4YE4L 4YNYB 1T0MB 1AGEA 3DX8B 3PUCA 4NC1C 2OL3H 4DVRL 4QY8B 1DANT 4WO4C 5DJ0A 1UB5A 3SJVA 3RU8L 3MYZA 4P3CH 5I18H 2BMKA 3I6LE 1EMTH 1U42A 4P5MB 3LRGA 1AC0A 4RMTA 5HGAA 3CZJA 4GG6E 2VTFA 5D1QA 5I2IA 4F8TA 3BW9B 4X80H 2P8PB 3BO8A 2HT2C 1L0XA 4JO4H 5D7LE 2VLLA 5EIIB 5GISH 4U1MA 2X7LA 4JZJA 1ZT1A 4XPGL 4JM2C 3MXVH 2AEPL 5L8KB 2DQCL 4D3CL 1W0YT 1KJMB 3GBLA 4NDMB 4H1LG 4M3KB 4WI2A 5ICZB 3VG0H 5JDSA 2C5DC 4E41E 2V7NA 4MCYA 5JPNB 2OQJA 3OKOA 2WMPA 4IRJD 4JO1L 4QYOB 5TE7H 4LVEA 1XEDA 1EDQA 2AJYL 3BGMA 2JELL 2VDOH 4Q58C 3DRTB 5D6CA 1CGWA 4HKJA 2EDDA 3L5JA 1S9YA 4XMPL 2D4FA 4MDIB 2A77H 4K9EC 2EIBA 1A6VL 3EJZC 1MIMH 2FJGA 5IMOB 3VMOA 3B2UC 2RR3A 3SDAB 2Y23A 4O2EA 4FTVD 2XZCH 4M7KH 2FHCA 4OBRA 1E4XI 4ODHH 2FEDD 2J5LC 1XGQA 2BOBA 4JM4H 3DETC 4XC1H 4KK9C 4FFEX 2DLFH 4OV5A 4APQB 1F3DH 1CGYA 3RUGF 1NL0H 5EIIA 5EZLB 3LH2H 4NIKB 4R7DB 4J1UA 1MFEL 3KYKH 5FYLH 1XR8A 5EUKA 4URTB 3TZVB 4PGEB 2D03L 5JW4M 2ILLA 2PR4H 4ZUTA 3SY0A 3WV0A 2ZCHL 4HK3N 1PY9A 3IRZA 4J3TA 3KPOA 5C0GA 4NN7C 3EBAA 1ZOXA 5E2JA 3BYTA 2JJWA 3VFPB 1NFIA 3VI4F 5CP7B 1A2YB 1XGTB 3V6FB 1HXYB 2XFXB 3KJ4C 4K3DL 3E0GA 3VW3L 2A73A 2EKSA 5GRUH 5IBUG 3STZB 3SKJH 3DRTA 4X6DE 3PWPA 4A2MA 3ZE0E 1IEAA 1IEBA 3U46B 3RTQB 5DK0A 5C1MB 2W92A 3T0EA 5DVKA 2WBKA 1NCBL 2IH1B 5HHXL 1G7JA 2H2SC 5KN5B 4XNZC 5FYKH 1BD2B 5DC4B 3O4LE 1MF2L 2NQCA 2DIJA 2XN9B 5GS1A 4XH2B 1HOCB 4PJFE 1GOFA 3TH2T 1H3XA 5I71C 5DR5L 2QSCL 2D7PA 3GK8L 3MLTB 4YFDB 4YHPA 4CMHC 1ZT4B 1RJLA 3RKDC 3RVUD 1C1EH 5LQBL 4JZNB 4I0PD 4R7DA 3KDMA 2VB5A 1FAIL 1OW0A 4EDWL 4IM8A 3ZT7A 2DDQH 4LSQH 4PGEA 3EYUL 2QQKH 1I1FA 4YEEA 3QP3A 4K71C 4DCQA 1T1WB 2DKMA 3RPIB 2UVEA 3LQAL 3V4VH 1MEXL 3BYYA 3MGAA 3RNQA 1FO0B 3BWAB 4PLNC 1YEKL 2IBBA 2X4TB 2YPVH 4QXUH 1MIEH 2NZ9C 3WJJA 4OI7A 4X5XA 3MLWL 1GGCH 1C5DB 2AK4A 2NY4D 4X9FA 2X4SB 1NGWA 2V9RA 1NCWL 2PYEB 1WZLA 4QKXB 3WN5A 1AGBA 2ZCKH 5D5MF 5L88L 3GGWB 4M1CC 3TBVA 1NUDA 4RGMC 1MWAH 4D0CB 1HH6A 3RVXC 2VLJE 4HKXA 3LHPH 5KN5A 3ARBA 4BH7A 4E9LA 1BD2A 2EYTB 1KG0B 1ZEAL 4RFNB 4H26B 4L4VB 3RNKB 4CKVX 1G7LB 2BC4B 5IWLC 3S9DB 1MCOH 1A22B 4OT1H 4UZGA 4ZYKA 4QWWD 4UU9A 3WS3B 2C9AA 3WNNA 1EHLH 3BVNB 1N7ML 1KB9J 1ZT4A 4MXQD 5C09A 1FPTH 4QTHB 3O41B 4PJ7F 2QV2A 1RJYB 4LCCC 3G6JA 3QNXA 1FG9C 2EE9A 4PDCE 2CSPA 2FJHB 5IMLB 25C8H 4B7IA 1OHQA 1T1WA 1SJHB 2Y7QB 1NANH 3NFSH 2P8MB 3FO2A 3AFLA 1FZOA 4JLRB 4QHUB 2IBZX 1LEIA 1UCTA 1FO0A 4TSBL 4PY7A 4JPVH 1KPVA 3EYVB 4IHOB 4KMLB 4OF6A 4PJXF 4HXAL 4ZS7H 3JXAA 1QLFB 3DVFA 2ZUWA 1WFUA 1NUGA 3L3HB 2VDNH 1RZKC 1QKZH 1FL6A 3PWUA 2H41A 1IM3B 3GO1L 4JFEE 4P5TB 1DN0B 5JNYA 5FHBL 1CIUA 3HB3C 3U7YL 4PY8I 3ULUC 3MLSL 4D0CA 4JHWL 2VISB 4D9QD 3QT2A 4PJBF 2BHZA 5HI4D 4HWNA 4P9ML 2AJSL 2YD4A 5JW4R 3DXAD 1AXIB 2AV7A 4MGXA 1IAMA 1QFUH 5FKAB 4PJ9D 1HHKB 3GSQB 4WDIB 1FYTB 1A0QL 3IXTA 1OB1A 3DHMA 5TH2B 2IFGA 5D71L 1G9NH 4KGJA 5I19L 2YD9A 5BO1L 1RJYA 3C9NA 1UXSB 4ZNEE 2BFVL 4O5LL 4NSKA 2Y07H 4Z95H 1YJDC 4ZQKB 4TSAL 1JNLH 2PXYC 5CSBA 4GRLB 2YHGA 3OGCB 2Y7QA 1MAMH 4W6XB 2VLKA 2NY5H 1QFWM 4F7CB 3HR5B 3VRLE 4GXVH 1KB9K 3QHZL 4KTDL 3C2SA 3OB0H 2XTJB 1BAFH 3VU2A 1J1XH 3MGTB 4IHOA 4NN5C 5HGBA 1QFWL 1QLFA 3KPNA 3U48A 4WW1B 4QNPE 1X5XA 3W81A 5IHBA 1U8MB 1CL7I 2H1PH 1T3FA 4G42B 3BAEH 4MVBA 4S1QH 4LLDA 1FQ9C 4MB4A 4KTEH 1T1YB 4Y5XC 4ZTPH 4M61B 3GSNA 2JCCE 4U1LB 2YSSA 3AY4A 2J8UB 1BREA 2BXYA 1QLRA 2LVCA 4JKKA 4WNQA 1AI1H 3LOWA 4X6CE 3WIIH 5FUCC 3CVHL 1JWMA 4ZSOB 4KVNL 4JO2L 3VXPB 1T4KB 4X4YB 2IPUK 5IQ9B 1QUNA 5DFVC 1W72H 3OGCA 4BFGA 4OM1L 3NN8B 1Y6MR 2J88H 4Y2DD 4F7CA 3F5WA 4N90E 5CGYC 5F3HA 4Y4HB 5MENE 5GHWL 5D1QC 2GJZA 1A6TA 4F15C 4U6XA 4N8PA 5TQ2L 3LSOA 5IHUH 3NCYS 4H20H 2XY1A 4RAVA 4RFOH 4EVNB 5C08B 3SO3B 1MCCA 1MCSA 2A9MH 1IKNA 4OKVB 5DJCB 2MCG1 4WCYH 5IB4A 3MRHB 1JPSH 2XWTB 1Q0YL 4G8IB 4KPHL 1F8TH 3FB7A 3HCVB 2ERJC 1NMAL 4NQVA 4DKEH 4NGHL 2CK0H 4WVRA 1IAKB 3DUSB 3HE7C 4L4TE 1IBGH 1AJ7H 1RUML 1BFTA 4HX1B 4PJDF 4P9HC 3IDYC 3LIZH 3MV9D 4G7YL 5DJXB 4DVBB 3NTCH 3FTGB 5E8DH 2X44D 1JPTL 5EU4A 3VXPA 4XBEH 3NCMA 3O9WB 4KUZL 3RBSA 5IQ9A 1JBJA 1AFVH 3HZVA 3MUY1 2Q3AA 4JY5H 2HH0L 3BRGC 3ZT6A 5JHDD 3W0WD 2QR0B 1NKRA 5ESVA 4S1RH 2VKXA 4LCUB 3BP6B 3MV7B 4R7NB 2A6IB 3MJ9A 2B4CC 1WTLA 4RX4A 5HYJB 3EAKA 1CFNB 4PRDB 1QSEB 3GJFB 5I1JH 3P9WB 5GIRB 1F4YL 5C0IB 1F90L 3WMSA 1EH9A 3KPLB 5I1GH 1NLDL 3GEWB 4LCWD 1RULH 2XWTA 4WUUA 2HKFH 2IPTH 3WDHA 4OLYH 2Y25A 1WF5A 2CQVA 2DBJA 1IAKA 1R3KB 1VGEH 3CDFA 1MVFA 1UZ6F 3UP1A 3BZDA 4JG0L 1O7VA 1PDKA 3OMZA 3V7AE 4NRXA 3GIVB 5SWSD 2RGSA 2AXJA 3TVMB 3MRCB 3UAJD 1BF8A 3P3YA 3T1FA 4DVBA 5FO8B 2CMRH 3TBYA 1HKFA 2WNGA 3SOBH 1U3HC 3BKCL 2BNQD 1EGJH 1QO3A 3PWJB 3T0EC 5F1KC 4ZUUB 4Q9QH 3QJFB 1XCTB 3ZKQD 4KRPC 4UNTA 3MRQA 2E9IA 4LCUA 4NQDE 4AL8L 1ZSDB 3OJ2C 4JFFD 2NY2C 4A6YL 4S2SA 3QI9B 3FT2B 5CP3H 1CFNA 2V5TA 4QRSA 3DGGB 3ARPA 2R4SH 3HNTH 3KS0J 4Q6IB 2WIIB 3KJ6L 1XCQB 4PG9B 5FYKU 4F2MA 1OW0C 2N4IA 5JHLL 3CH1B 3QISA 2HT4D 4NUJA 3U30B 2W9DH 3FT3A 4Y8AA 4PJAB 4G6JH 2IFFL 3J8F7 4P3DB 5GJSL 5HYIA 5KSAD 2X4OB 4OQTA 2W60A 4Z0XA 3LS5L 1RIVH 5BS0B 1V3JA 3MNWB 4TNVK 1JGUH 2XQYG 1UM5H 2XZQL 3FKUS 1RURL 1UT9A 5GXBB 2BRQA 4KHTL 1FZMB 5FO8A 1GGBH 5CZXC 2EIZB 2WBJD 1E27B 3MNVB 3JWOC 2HLFC 1IC5H 3GNML 4HIEA 4PIRF 1OQXA 2BY1A 2YZ1A 4RAHA 2YK1L 5EU5B 5I8OL 4RDQF 5C07D 5K9OA 4JEGB 3MLUH 1CT8B 4JHBA 3S34L 4DZ8A 3DV6A 2G60L 5H8DA 5IW6B 1NAMB 5T1DH 5BV7C 3BQUD 3H9SD 4XP9L 5EC2B 3QDJB 1TZHB 2A83B 3IJYB 4WGVB 3WNPA 5HTSA 4XX1G 3LEYL 1CQKA 5CJOH 3IKKA 3IRPX 5ALBH 2W0FB 3L3GA 1XCQA 2NCMA 1BZQK 4PG9A 5DEZA 2G75B 1MQ8A 5I8CA 4MJ5B 4MAYA 4CN4A 3MCLL 4LSRL 3X11A 2GIYA 4HGWB 2A9NL 3SDYH 1OTTC 4XVJH 2FL5A 3EO0A 3NPZB 5CZKA 3SHSA 1F3JB 2NY0D 1ZLSL 2EDQA 4PJ8A 5DJZB 1NBZA 1I3GH 3K8KA 3VXQB 1T04B 1WIOA 1I8MA 4X7FC 4XPBL 1WWAX 1FZMA 3QEGL 5ADPL 4PB0L 5CILH 1J7VR 3LKNB 4J8RA 4LCIL 3V5KB 5AYUL 1V3LA 4YC2C 3GMLA 1R24A 4X9HA 3CK0L 3VCLB 5KSBA 4U49A 2PW1B 3PNWB 3RA7H 3QPQC 4LLQB 1I7ZA 3RUGB 2FJFA 4HUXA 2B7DT 4OZFB 1A7PH 2R29L 4JQIL 1SY6L 3TM6A 2YPLA 1TZHA 4MJIB 2A83A 2PYFB 3ZDXF 1FNFA 1UVQB 1KCLA 1IAIH 4HWBH 2PCPA 2W0FA 1HCVA 2BNRB 5D2NC 3P0YH 1DL7L 3LKSB 3BEVB 2FX8L 4WV1C 3VA2C 4HIXL 3UYRL 2P8LB 1S9WB 4HUVB 4RWYH 1F4AA 5AWNH 1QR1A 1U8NA 1MRDL 4MNHB 5J06A 4FQXD 5DJZA 3MBXH 3FN0H 1H8OA 4NO2A 1GC1L 3KYOA 1TQCC 3SDCD 3VXMA 3H7BB 5INDB 3O2DL 4IOIA 4NJAL 1L4IA 4R2GD 3CFIC 3SCMB 2JK5A 2KH2B 1X5YA 4N68A 5DD1L 2Z31D 5GS0H 3D85D 3DRQA 3D9AH 2YUVA 3ARDA 2PW1A 5C0FA 4G9DB 4ZOBA 1PSKL 4MVBC 2Y36L 4UILH 3MLXL 4ELMB 3GRWA 1OM3L 4AG4L 4DGIH 2VAJA 3F7VA 2JJVA 2J3SA 1LO5A 2YD2A 4P57B 1CGSH 1NSNL 2PYFA 3VXSA 3DVNB 3EDDA 1UVQA 3RWHA 3SDDC 5F7DA 1IARB 1QBAA 4X8XA 2XRAH 3LS4H 1JGVL 1HK6A 2DLIA 3BZFB 3L3IB 1VGKB 5I1DB 5A43C 3CU1A 5B39B 4EN3A 3PHQB 2VXTH 2XN9E 3T3PE 5IGXL 1JZ4A 4K7PY 4KV5E 4NQEA 1EZVY 2HP4A 4MNHA 1OP9A 5DJYA 1D7FA 1KLUB 1SYSA 5EA0H 5CGMA 3W11D 5SWZA 4U1IB 5D5MB 4H25B 1YPZF 3H7BA 1G6RA 3E1F1 3D25A 3RY6A 3SCMA 3EYOB 3O2VL 4KJYA 4M43H 3GDBA 2VDMH 1UKSA 4KKCC 3NCJH 5J6HA 2AEQH 4GW1B 4YHZH 3ZKMC 2LAAA 3TCXA 3WO3B 3GBML 1WBZB 5E8OB 1U8OB 5L2KB 3CX2A 1V7MH 2HFEA 2DICA 1X4ZA 3QQ4B 4Q0XH 5F9DC 3TWCH 1KN2L 4WW2C 1RAMA 3PL6B 1TVHA 3IDNA 1X4YA 4LKCB 2QEJA 5D96C 2ZUVA 4YXKL 2PYEE 1GSMA 4NZRL 3MJ6A 3L95A 4NP4L 4AEFA 2OJEB 2V5SA 2YWYA 4M7LT 1I7TB 1WISA 3SE3C 3L3IA 2Q8AL 5I1CL 1ZGLA 2EEBA 3BKYL 1I7UB 4L4VE 5I15L 4LIQE 3EOAA 3HN3A 4ZAKB 2QADC 4PJXB 2FEEI 5T1KB 3MGOA 3BH8B 3U6RB 2W07A 4AM0A 4MD0A 4H1LB 4D2NA 3BD5A 1KT2A 2EDRA 1OWWA 1NGYB 3LEXA 5FECB 5IMMB 3TYFA 2A6JB 4OTXL 2DLHA 2YUZA 1MUJB 2A38A 1H3PH 4PJBB 2VL4A 3EYOA 4NFDA 4JRYB 1T66D 4ZFOB 3SGJA 1CTOA 1MHCA 2AP2A 4NM4H 3FB5A 4UUJB 5JO5A 4YQXH 4XCEA 3PQYA 4TRPL 5CKAA 2ZUQB 3FO0H 3I6GB 4PJCB 2UZYB 5JR1H 1WBZA 4MS8D 5IR1B 3G08B 1U8OA 4WU7A 5BVJB 5F7UA 2XPGA 4F7MA 2DTSA 3D69B 4WI6A 2W0PA 2O61B 5BRZA 4PJ7A 3BZ4A 3VFVB 3WHE0 4UDTA 2VDKL 3IVKB 5EU6B 1J8HD 4POZC 1LP9E 2E7CA 2KBGA 3D3VD 2I07A 4U1NA 2X5PA 1KC5L 4YXLL 1EVUA 1HCFX 4L8DB 1FVCA 4QT5A 1Q9KB 5TE4H 2FGWL 4UTBH 3I85A 4OFYD 1BM3L 5T3XE 4PJXA 5JIPA 1WZ1H 4WENB 1FYTE 1H0DA 2J8HA 2VZVA 3GSUA 5DEFB 5KG9B 1MJJA 3BH8A 2HT3D 1NGYA 3FQNB 4GKZA 5IMMA 5E2VH 2B1AH 3SGEI 1VADA 1ZLVH 4UV4H 4XP6H 5KZCB 2MTPA 1FGVL 5EO9A 2ORBL 1MCJA 3HE6A 2OTUB 4TNVF 4OUUB 4BFEA 3PP3H 4GRWH 2NXYB 4ZFOA 5C8JB 1YY8A 2BSED 4C4KT 5IBUB 1TFHA 5JIHA 3V7MA 5E5RB 1OCWH 2DQGH 2WQRA 1CZ8L 5KJRH 2XTJE 4NQCD 3NACH 1FYHB 2E8ZA 2BVQA 3G08A 4UI2A 5BVJA 4FQ2H 2JJTA 3JV6A 5DHXB 5IFHH 2MNUA 1FE8L 4JQVA 1UJ3C 5HDLA 1G9ML 3ARXA 1MRFH 5JUEL 3RZCC 3FB6A 1AQKL 4M5YH 2R2BB 2JKXA 5L6YL 2H8PA 4PP1C 5DRZB 3ROOB 3GSXA 3S8WA 2R4RH 4QHMB 4X99A 3IJHA 3C2AH 2HJLB 4LSUL 4Z8FH 3D39D 1FL3B 1UM4L 1MCEA 5FYJH 3FMGL 4S11A 4WFHD 2CRMA 3P73B 1SEQL 4Y16D 5KG9A 4G6AC 2YA2A 2Z9TA 3TIEB 2IEPA 2J8UE 4DFHA 1J12A 4QRTB 4QXGL 1DP0A 5KS9F 4IRJA 2YA0A 4ZSOE 1V3KA 3R1GH 4N1CA 1RVFL 4U6TA 1D9KD 3IDXH 1F11A 3OV6A 5I74B 5C8JA 1PFCA 3MRNA 4RBPK 1AIFA 5CFHA 2VDPL 1Q1JH 4YBHA 3X3GL 3TA3B 2I26N 1Q72L 1L0QA 3U83A 5IVNA 4P23C 1U8PA 4XC3H 4FTVA 3R06B 2X2YA 5F7MC 5C08E 4PJ8C 3EOBB 4Y4KB 5TFSL 1HINL 1XFPA 3VFUB 3OG4B 1I9EA 1J86A 4YDVB 1JHLL 1MLBA 2GJJA 3MBEB 1IGTB 2ESVA 2AJVH 2APTA 2WQ8A 2DBLH 4XPTH 1I9JL 1X6NA 4XBPB 5DRZA 2IQAB 4I0PB 1N59B 4GRMB 3T2NH 4PB9H 1YEFH 1KN4L 1IILE 1WAAA 4IIQB 3BIAX 4KROB 1AHWB 5DMJB 4W68A 1KTLA 3QQ9C 2APBA 2DQDL 3K1DA 5EZOH 4WUKH 4GT7A 3V52L 4QRTA 4U6HB 4YDKL 3QA3A 4X6BB 1FRGH 1QOKA 3MFGB 5JPMA 5CEZH 3BE1L 4HPOH 5D7JD 1AKJD 4TSCL 1I75A 3GSOA 3QWRA 4OGAC 4YHIA 1A6ZB 4IJ3B 2VXVH 5DSCA 1ZMYA 1FO0H 2DQFA 4HPYL 4P2CG 5E9DB 5I1KH 4WY7H 5T33H 2GY7B 3MV7E 3DROA 4PJHF 3FN9A 4O51A 5E5MB 2BRRH 5GQBA 4PJDA 2HLAB 3GMPB 4U1GC 5F89B 1OAUL 5HYJE 1LK3H 1I9RL 5LVEA 1QSEE 2CXKA 2DJSA 1ACYH 5KVFL 4HH9A 2XWBB 2GFBB 3HG1A 4YDVA 3SPVA 4XPFH 3LKRB 4YBLB 3K2UL 1IGTA 4ODTL 2W0LA 4LIQH 4UV7H 5JORB 2OK0H 1MHPH 2CIIB 4XBPA 2AGJH 1C5CH 2IQAA 3DVIA 4MB5A 3O45A 5L8LB 4GRMA 4Y89A 4Z7QF 3KPPA 4I8DA 3VFRA 3ARDC 4I4WA 4IIQA 1AHWA 2C3VA 3ZTNL 1HEZB 3FRUA 3QCVH 3ZLQC 4HS6B 2YUWA 4MLIA 4WHDA 4N0CC 3WFEL 3DV4B 3WUZA 3MNZB 2HA1A 1U92A 3U4BL 5D7IF 3TJHC 2QSVA 1U8JA 1GIGL 3MRFB 4CJ0A 2CKBL 4FZEL 2DMKA 3O3BA 4H5SB 4XTRD 1L6XA 2VXUH 1ED3A 1MJ8H 2DI8A 1MPAL 1CI5A 1S7XB 2Z8WC 3PWLB 3TN0D 1SBSH 4AIZA 3AVEA 5E5MA 4ZFFB 4LHJB 5E0QA 1PEWA 5E7FA 1HHJB 2XZAL 5F1OB 4BQ9A 3DI3B 1R5IB 4M6OL 3HAEB 1U95B 4PJ9B 3Q3GA 4XXCA 4K3EH 1S3KH 3NGBC 3IFLH 3LKRA 1KYOJ 3H3BC 3O6LH 3IS0X 4JPWH 2WWMC 3CCHB 1K5NB 3GSNH 4PJAE 3V8CA 5EWIH 1JN6A 2BDNH 2GSGB 2X4UB 5F9AC 2NXZD 3BEWA 5I1IH 1JK8A 5HSFA 1JMXA 5BS0E 1OP5H 4EQ2A 1HEZA 1A3RL 3BGFB 1WITA 4OGXL 3VFGL 1NH6A 1G7IA 2ZSWA 2PO6B 4IRZH 4P2OD 4WWKD 4JZOB 3PHSA 3MRFA 5GRJL 1X5LA 4Z78B 4DQOH 4GMTH 1UYWL 2ICES 5GRZA 4EUPA 4H5SA 5IVOA 1E4WH 3G6AB 4J3OC 1S7XA 2C7UB 1F97A 3HUJA 3QUYA 5DGQA 5F21B 1NGZA 2BVPB 1S5HA 3QG7H 1J1PH 3A6OA 4M4PA 4I3SH 4ZFFA 4U0QB 1JRHI 3CFKB 35C8H 3DXAA 2UUDK 3QDJE 2GEEA 4WFED 1N64L 1V7NL 4JFOB 3QIBB 3OKDA 5J12C 3HAEA 2DOCA 4PJ9A 5A3ID 4KQ4H 1P1ZB 1BWWA 4NO5B 3DIFB 4AENA 3JV5A 4XPHH 3OPZL 4Z7UF 2CIKA 2XXMB 1S7VB 5JDJA 1K5NA 3WUWB 1ERNA 4F9PC 2W9EL 2WLZA 5E94B 3S5LB 5C0EB 2R0ZL 4RMQA 4JFYB 4RGND 2NTFA 3RFZC 1DUYB 4JVWA 3C60C 3VWJC 5DRNA 1KYOK 4Y2DB 3GM0A 4TUOB 3FRPA 3WFDL 1OPGL 2IC2A 4D8PA 1R5VA 4JZOA 2HKHL 3BMVA 2BOCA 2Q8BH 4KWUA 1OAQL 1NGQL 5ID0B 1TJHH 5KOMC 2R1YB 3T65B 4ZFGL 2IBZY 3TNMA 1J11A 3QEHA 1QBLH 3MJ9H 4LSSH 5DQJB 3LPWA 4PGDA 3RUGE 2X9YA 5MP6H 5D4QA 3WSQL 1A6PA 1I85C 4IDJL 4RNRA 5CJ5A 5F9OL 3WHXB 2V2XB 4F3FB 1KBGL 3AM8A 1MCQA 5CJQH 4MJIE 4FQCH 1MFAH 3LDBC 3BPCA 1BX2A 2ZPKH 1YECH 4PTTB 2CDFB 2D2OA 2BNRE 3DIFA 1QLEH 1D5IL 4X0KA 1RJZB 4X9GA 5ESAB 4JFQB 15C8L 2UVFA 3MPCA 3S4SG 1OAXL 3KLSA 4Z7WF 1DJSA 3Q6FB 1XF5B 1YZZA 2NY3C 5AZ2H 4XI5D 3QCUH 2PKDA 4G5ZL 5HYQB 1TETL 5E94A 4O02H 3S5LA 4LKXB 1DQQB 3G5VA 3G9VA 3RWIB 4OD3H 3ULVF 3N85H 1G7MB 2AK1H 4MQXC 5C0BD 5JHDB 4PV8B 4XPAH 1KNOB 1A1OB 1OAKH 3MODL 4LPTA 2EDKA 3DECA 2D7OA 2ENYA 2IGFL 3C5ZC 3L3JB 5CUSH 4P2RD 1A7RL 2Z93A 4N9GB 4BZYA 1DVFB 1RIUL 1IGIH 4PGCA 2GW5A 2V5YA 4M62H 4LL9A 3LB6D 2EH8L 2P1YA 2ADFH 3BKJL 1QQDB 4ELME 5E08H 4Y5YB 2F19H 2CLZA 3GJFH 4M7ZB 4OZ4B 1A3LH 4R4FL 1EK3A 2WUCH 4DKAA 3NAAH 4KK8D 1YPZB 5J3HC 5IUSA 1JHTA 4YWGL 2JB5H 3CVHA 5KVGL 2CDFA 5FUOL 5E2WL 2YD5A 2R1XB 4MAUL 3ZYZA 1RJZA 1TCMA 4GQPH 2OLDA 3ET9F 2D7MA 3MV9A 5IT2L 3Q6FA 3C09C 3O11B 4EI6A 3LY6A 4Y88A 1U9KA 1J0HA 2FX9H 3MRGB 1I9IH 1CLZL 5F44A 2BNQB 4C83B 1H3UA 1A1MA 2DQTH 2DTML 1G7MA 2MQCA 2Z4QA 4YGAB 3W0WA 1S9VA 4AMKH 1A1OA 3C6LC 2W38A 3MRPA 3T08A 5C7XH 4MQSB 5D5ME 1JZ6A 3S88H 4JFHE 3BSZH 4G8EB 1ZANL 2MPAH 2H9GA 3P0GB 4OLUH 3SKOA 3CXDL 4ZUVB 1EFQA 2DJUA 1UA6H 5DWUL 5EFIA 3V0VB 2KQNA 5FKPB 1QHPA 1UB6B 5IBLD 5L2KE 1FNSH 4LCWA 4GLRI 5JW3L 3QFDB 4YDIL 3U0PB 5ACMA 4OZ4A 2FECL 3BT2L 1A9EB 5SWQB 4PBVC 4YHOL 5B8CB 4PLKC 1QSFB 5KSAB 4NNYA 5GJTH 5DUML 5EBWA 2V5RA 2ZOKB 4BH8B 4J3WA 4U7SA 1YEGH 1XGRA 1Q94B 5SWSA 3BPNC 3MUZ1 2E27L 2P5WD 1Q38A 5FM5O 3O11A 5B38G 4XXDB 3FFCB 2W1NA 1H15B 3RRQA 2H2PC 2BNQA 5DUPH 1B0GB 1V05A 1CYGA 1PLGL 4IMLA 1A7QL 3VA6A 5DA4A 4MNGA 3JUYA 4LLWA 4UBDD 5FM8A 4KKLC 5TPWH 4JN1L 1ZVSB 4ZUSB 3ARGC 1YYLH 4WHYH 1JNNH 4JFFA 4DGVH 4PJBE 4KJPD 1UWEL 4JRYE 1DANU 5DURD 4J4PC 3UPRB 2DQIL 2XKUA 3VWKB 5HYFA 2GTWB 2X42A 1LO3H 4NN6C 4PJCE 4E42A 4C56D 3V0VA 1NAMH 5I75C 3C5SB 4NNXA 5FKPA 1NGXA 1ZA6B 3MRLB 5ICXB 1EPFA 2VH5H 3KGRA 3QFDA 4B41A 2YMXH 4OD1L 1I1AB 4AEIL 4RA0C 3U9PH 1UEMA 5EU6E 1CD1A 4W4NA 2X6MA 1XIWB 4PD4J 1YEJL 5C0CD 5BVPL 1RHHB 4MZ3A 4LHUG 3D0VB 2GSIA 2HTKC 5IJKA 1LD9A 1Q94A 2X1PA 5KANG 3CFJA 3ARFC 4XXDA 1RY7B 1QD0A 4BK4A 2WBJA 4EI5D 4LRIA 4NUGL 1ZT7A 4KI5D 4MXWL 5E03A 5F88B 4HWUA 1ZHLA 3AREA 1NDMA 3TJEH 3I84A 4A6YA 1T6WA 2AJ3B 3QAZB 4X6EB 5HHMB 5C07A 4Y4FC 4MCZB 4MXVF 3IGAB 5FK9B 2K7QA 2CDEB 2GTZA 1A1NB 3KWWB 4GQ9L 4WO4D 3BQUA 3H9SA 3RKPA 3UPRA 5CS7A 3S36L 3D48R 5DFWH 3GRWH 1PG7L 2GTWA 4PRID 4TQEH 2R69L 4EBQH 4K9EL 4KMQA 4OZFH 5I30H 1UENA 3DGCR 4L9LA 4V2CB 1A6WL 1YMHA 4DAGH 2BJMH 3LQAC 3QUZB 2HT2D 5CWSB 3VGEA 4NQXB 1U8KA 1S7WA 4U1JA 4HFUL 4OCWH 2E7MA 1NANI 2VDLH 1TCRB 1EUUA 4JM2D 3UTPD 3EO9L 4PFEA 1DSFL 4ELKB 1AD9B 3DUUA 1K8DB 1S7QA 3VDAA 1QA9A 4ZUWB 4XNMB 4O2FA 5JQ6H 3AS3A 4FA8A 3AS0A 1OARL 3T0AA 4ONHB 5FF6A 1AGDA 3SDCB 4FQHA 4HEME 4CAGA 4R2GB 1DBKH 3QUYC 4WFFD 2I5YL 4R8WH 3MRBB 3KHQA 2LQRA 1CD9B 3LV3A 4HMEA 3S35H 4FFYL 3NA4A 5IB5B 4MCZA 3CPLA 5FK9A 3EJZD 3MA9L 4K7FB 5ILTL 3A6BL 3B2UD 5DI8A 3BFOA 5DZNA 2DQUL 1TENA 4OFKA 3VFWB 1Z5LB 1SJEB 3MROB 3BH9B 3DETD 4KK9D 1IGFH 2EKJA 1X5ZA 2NY7L 2NR6C 5KS9A 1HZHL 1MI5D 5HXMA 4N0UB 2CR6A 3L3DA 3P9MA 4IDLA 4U7KA 4OFDA 4MX7A 5DVMA 1CR9H 5EOCJ 5DDHB 4M6NH 3QUMB 3UBXG 4FQXA 4G80A 3RGVC 5F7EL 3BUTA 3HRZA 5I17B 1YN6B 2IQ9H 1FJ1B 4FQIL 1S5IH 3OAYK 4F7TA 1G7QA