1QLFA

Mhc class i h-2db complexed with glycopeptide k3g
Total Genus 69
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
69
sequence length
276
structure length
276
Chain Sequence
GPHSMRYFETAVSRPGLEEPRYISVGYVDNKEFVRFDSDAENPRYEPRAPWMEQEGPEYWERETQKAKGQEQWFRVSLRNLLGYYNQSAGGSHTLQQMSGCDLGSDWRLLRGYLQFAYEGRDYIALNEDLKTWTAADMAAQITRRKWEQSGAAEHYKAYLEGECVEWLHRYLKNGNATLLRTDSPKAHVTHHPRSKGEVTLRCWALGFYPADITLTWQLNGEELTQDMELVETRPAGDGTFQKWASVVVPLGKEQNYTCRVYHEGLPEPLTLRWEP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords MHC CLASS I H-2DB HEAVY CHAIN
publication title Crystal Structures of Two H-2Db/Glycopeptide Complexes Suggest a Molecular Basis for Ctl Cross-Reactivity
pubmed doi rcsb
source organism Mus musculus
molecule tags Immune system/peptide
total genus 69
structure length 276
sequence length 276
ec nomenclature
pdb deposition date 1999-08-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00129 MHC_I Class I Histocompatibility antigen, domains alpha 1 and 2
A PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1qlfA02
3.30.500.10 Alpha Beta 2-Layer Sandwich Murine Class I Major Histocompatibility Complex, H2-DB; Chain A, domain 1 MHC class I-like antigen recognition-like 1qlfA01
4MA8L 1UJTA 1R5WB 3H3KA 4P2OB 3RP1A 4Y4HC 3REVB 3FO0H 3Q48A 4UUJA 2HWZL 3GO1H 2AV7B 4OD1H 4XNZB 2Q6WB 1PKQA 1UXSB 1V05A 2DMKA 3X11A 1LILA 2IQ9H 4P2YA 1N0XL 2K9UA 1WZLA 1UB5A 1GL4B 1FQ9C 3NMEA 5I8EB 4U6YB 4KK8D 1MFCL 3LRSA 4MAYA 3V6ZA 1GZQB 1T6WA 2CR6A 4LRIA 5B4MD 5E2UH 1LDSA 5JXEC 4X5LA 2IJ0C 4EI6A 2Q3AA 4JO4L 2X41A 5ERWA 4PRDA 4E0RB 1YEIL 1EO8H 4OKDA 2ATPB 3KLHD 3SQOL 4HC1H 5GJSL 4N0CC 4YEFA 5EU3B 1FRGH 4DKAA 1M7IB 4XBGA 5DZOA 1D5BA 4FFYH 1MIEH 2AQ3A 3O81A 2CXGA 1IGMH 3ORJA 3NCEB 3WFEL 3WEXA 1F3DJ 2HT2C 4OZFH 2E7LC 5IJKC 3ECBA 1D9KC 1FL3B 4O58H 4WUUE 3RUGA 4M6MH 2VAAB 4X9BA 5CCKL 3T04D 2AJSH 3CU7A 4QOKA 3SBWA 1I1AD 1XF5A 1QSEB 1IEAB 3GBLA 4P2RA 2D0HA 2UZYB 3QCTH 4LRNH 4XXCA 5BMFL 1J10A 3QO0A 5JW4N 1CFTB 3EDEA 2AP2A 4KKAC 5LKNA 2BNRA 4JREC 4Y4HB 2CRMA 1UADC 4Y2OA 5CD3B 4Z78B 4MNGE 5IP4A 3EFFA 2AJ3A 3GMMB 4L3ED 1WZ1L 2QKIB 4FS0A 3UYOD 4CVWA 2ESVE 2W0PA 3VFPB 4JM2A 3P4OA 1QYGL 4G80B 5DMKB 1AP2B 2BY1A 3BP5B 2B7DT 4DZ8A 1IGYB 4LSRH 2B1AH 2H6PB 3KPSE 3UROR 3QIUC 1SY6H 2IADB 4QTIH 5I1LA 5DQJA 4LNRB 5CZVH 3VXRE 4YHYC 4XNMA 4NOFA 4L5FH 4JG1H 3N1GC 1JRHL 4HT1L 3FCTB 4JFYA 4KHXL 3W11D 43CAA 3CD4A 3N9GL 3PGCA 4OLWL 1CDJA 1B9ZA 4YJZL 4L3CB 3FFCA 4OD2A 1D9KB 3G5XA 5J3HC 4TUKH 1G9NL 4XPHL 4G8EB 1M6OA 2W65A 4R96B 3UYPA 1FZOB 1GPOH 4JO1H 4KK9C 4KROC 4NNYA 1A14L 5DR5L 2EDEA 4W4OC 4K94H 1LO2H 4HUMB 5B39G 5CIPB 3RZCD 2A6DA 2FRGP 4JREB 4I9WE 3BKYH 3JBG7 1HKLL 4UT6L 4CAGA 4MHHI 2B20A 3OKLA 4MCZB 2R23A 4DGYH 1HNGA 1YN6A 1DTUA 3V6OE 3M8OH 4GG8B 5DMGD 2VZ1A 5D5MB 1YMHB 3DMMC 4NFBA 1E0OB 4G8IA 2NXZC 1RPQA 3NCJL 3CFDB 1KPVB 3U30C 3QIUB 2ICWA 5EUKB 1NUFA 1ZGLA 4UBDC 1U8IA 4FQ1L 2HG5B 4JFDA 4S0UC 4C56D 4YHYB 4EUPA 1BD2B 3TV3L 2XTJE 5FO9B 4G3YL 4BQ9A 5EOCL 1DLHB 2YK1H 4MAUH 4PRHB 4OLXL 3HRZA 2PXYD 3NCYP 3BVNA 2X4PA 1ZT7B 1I7RA 4GRLC 3ZDXF 4PREB 3LQMA 1X3DA 2M26A 4XCFL 3QEGH 3VI4E 2HFTA 3O6KH 1FGVL 4YHIB 5IBTL 3UTZA 2APVA 1BQSA 3G04B 5JPMB 4KROB 5IB3B 5C0DA 2YXMA 5DK0A 5FGRA 5CP7B 4MB4A 4JRYB 4FP8H 3UEZA 4HMEA 3S36H 1NBQA 4P9ML 2HKHL 1BMGA 1AY1L 2FLRT 2V9TA 5MEOB 2HFFA 2VLRD 4MJIB 4LLMA 2R4RH 1MFDL 1RZKC 3C60C 3MRMB 4Y5XA 5EO0B 3OR7B 4ZDHB 3NIFF 3PP4L 4ODUA 1E4KA 2D7OA 5F7EL 1RIHH 5EU4B 2EYRA 5E70A 4GT7A 4IRZH 3HZKA 1SJVA 4PTTA 5HGBB 3TT1H 4U7MA 5DJZA 3T0EC 3EFDH 4UV7L 2PYED 2Y36H 2YZ1A 3DMMB 4WTZG 1HINL 2CDFB 1EEUA 2VAJA 3GKWL 3MXVH 2NXZB 1W72A 4PJXF 3AS0A 4HK0A 3JV5A 3U30B 1ZA6A 4PJGE 4KZEL 3QG6A 2P5EA 4PUBL 5ICXA 5EIIA 4MWFA 4PGDB 3CC5B 1IFHH 3DURA 1AKJB 2H8PB 3VXUD 3SCMC 4EQ3A 5LGKA 5C0AE 2E6JA 2Z31D 1FJ1A 3QDGA 4LDEB 2OI9C 5MENA 3QDJD 1UM6H 5TE7L 4DKFL 4GRLB 3BO8A 3S9DB 1M71A 2Q8BL 1UXWB 1G9EA 3OZ9L 3G6JB 2RBLA 1KJMB 1AE6H 4OJFH 3H3BC 4WFED 4OFIA 5I1KH 4OZIA 1CU4L 3QWRD 2DBJA 5DJYB 4F33A 5IJVA 4BSWA 5KVGH 2IQAB 5B8CC 4WO4A 4XNXH 3ULVE 5HGAB 2D2OA 5FYJD 5LGJA 3HZYA 4L4VA 3PXHA 5GRZA 1R3JB 1WISA 3JVGA 1RK1B 3V5KA 4GOSA 5I76A 4EI5C 1P5VA 2VL5A 4WW1A 3IAPA 3TVMD 3RL2A 2CKBH 1M7DB 3HZMA 4LLDB 4HJGA 5KTEH 3SGDI 1HHKA 4MNHA 3C60B 1SBSL 4HJ0D 1S9XA 3B9EA 3SGJA 3RDTC 1JNNH 2VN7A 2Q7YA 4L4JA 3VRIA 1NMBL 3T0EB 1TLKA 1IEBB 1YMMA 3S3JA 2ZWLT 1ZHLA 5J12C 1Y6NR 4P59H 4ERSH 2ENSA 5D7IE 3RTQC 1KXTB 3QEUB 4OD3L 1I7ZA 3X17A 5E6YA 3DV4A 3SCMB 1GGCH 1KEGH 4OZHB 1JNLL 4HGWB 3RHWK 4DJMA 4P3DB 3EZ8A 4MAYC 2OI9B 5IG7A 4LRIC 1OGAB 4A6YH 5I17A 4DTGL 3V6BR 1OAKH 1ZGLP 1NCWH 4O5LH 5GHWH 4PJ9D 1FYTB 1OTUD 5EU7E 3CZFB 2X1OA 3UX9B 5B8CB 4XAWL 3UPRA 4TUJB 2GFBA 4TOYH 3TIDB 4ETQB 3MRQB 5D2LF 5GZOC 4LF3A 5DJAB 1EO7A 1H8OA 2AK4A 4EI5B 1A6UL 2Y7QA 1UM5H 3WMSA 3EOAB 5TFSH 4DOHE 2JJTA 4RFEB 4U1NA 4M62H 1QBAA 3FOMB 3WFHA 4NRZA 1BZ9A 4M7LT 2ARJB 4O51B 4POZD 3LEYL 2VIRB 4QRRD 4R4BB 2JTDA 3RDTB 3Q3GB 3TZVA 1B0GA 4XC3L 2P7TB 1FFOA 4HS6B 1U3ZA 1WTLA 4OQ1A 3DO7B 2OTUA 5J12B 3ZE2E 3P11H 4DN3H 2NY6C 4L8CA 4U1MA 3RTQB 1A6ZB 3RVVD 1DBMH 2RAMA 1QSFA 2J3SA 1B0WA 3ULSA 5CP3A 3NFSL 3K4DA 2C3VB 2W60A 2J2ZA 2YBRB 1D3CA 1V3KA 4MAYB 3V6ZB 4JM2C 4S1RL 4ONHA 2OM5A 4MCYB 1CF8H 1AGDA 5C9KA 3DSFL 4Z76A 1X5IA 3WN5C 4EI6B 5FGCE 5ERWB 1KIRA 2EDHA 1MI5E 5AZEL 4N0UB 3IU4H 1C08A 1A6WL 4KTDL 2Z91A 2WMPA 1T03L 3MV9A 1QZ1A 5MP6L 3GNML 3MA9L 1UA6H 3KPPB 2YD8A 3BX7C 4JR9H 2PTUA 3ILQD 3WEXB 4LLWB 3WLBA 3ECBB 1UZ6E 4G9FA 1IM9D 4P49A 1QKZH 1J5OL 4YHZL 1MEXL 4M1DH 3P0VL 5JPNA 1HSAA 4M43H 5K9OB 4QOKB 4JRXE 3SKUD 1XF5B 1OP5H 4RZCA 1VGEH 2DBLH 3QO0B 4KMTH 1BAFL 2YD7A 1PSKL 2IFFH 4K3EL 1IJ9A 4OCNC 1PG7L 1TVBA 2BNRB 3SDXA 4PRAA 4QHKI 2NY6B 1LO4H 4XGZA 5E2TH 1VPOH 3DYMA 1OWWA 1U58A 3X13B 1NGYB 4OCWH 3EFFB 3HCVA 3L3HB 2AJ3B 2EDFA 1MJ7L 5IR1A 3BEWB 4JM2B 2VH5L 3CXHK 3WN5B 1F8TL 4PG9A 3QRFM 1KJ2H 3N85L 2V5TA 1ZS8B 1EUTA 1FL5A 1KTDA 4G7YL 4LLVB 1GC1H 1KIPB 3G5ZB 4Y1AB 3ARBD 4XNMB 3E3QE 3KYNA 3MCLL 2F5BL 43CAB 1F4WL 2P8PB 1R0AL 3BP6A 3MRBB 3VFOA 1DEDA 1LE9B 3FFCB 2VSCA 1DZBA 1UQSA 4WW2A 3MV8B 3WHXB 1BFVH 4NZJA 2CH8A 3EHBC 3DXAA 3GGWA 4IDJH 5GGQH 2R1XB 1JFMA 3PQYE 4JO2H 2W65B 3D85B 5LAXB 4CW1A 1HHIB 4YHMH 3VFNB 1V3JA 2VC2L 3W5MA 5FA4B 1KCVL 3VG0L 4MD4B 3GMQB 3QEHA 1IQDA 4WV1C 3W2DL 3U1SL 3EAKA 1A4KA 2F74A 3OKEB 5EBMB 4P2QA 3TA3D 4OCMC 3K0WA 3RHWF 1K5NB 1YJDH 5D8JL 1Q9LA 4WTWA 3OKLB 5KW9L 3C8DA 1UEYA 3J8F7 2XRAL 3D3VE 1DFBH 4QHUA 5C71A 2PNDA 4Q7DA 4EDWL 1T1YA 3RWGA 2WNGA 1LP9E 4KJYA 2GT9A 1UCTA 2I5YL 3F65A 1KN4L 3FRPG 2R0KH 2MMXA 2GKIA 3O2DH 4JKPL 1KF9B 5T5NF 3WUWA 4EUPB 2P49B 3EDJA 4CU6A 2MFNA 1RZ7H 4BYHA 1NC2D 1MFEH 3BVNB 2X4PB 2EDDA 1ZE3C 4EEEA 3N0PB 1I7RB 4HIHB 5CJQL 5GRXG 5C07A 4NRYA 2Y72A 4LARH 4U33A 2ITCA 3VRLE 3WNNA 1QR4A 4WO4C 5F1IA 4LGPB 4PJIE 4UAOC 3WFBH 1UKQA 3PNWA 3DX9A 1E4XH 5DK0B 4M7JL 3C5ZC 1MAKA 4DGVL 1A1MA 4NN6C 4WV1B 1LEKA 1IRAY 1GXEA 1R3KA 1ZXQA 4DW2L 3ULUE 1EAPA 2X70A 4LIQE 4P99A 2APXA 2VKWA 2HFFB 5E5UB 3VXQA 1ZK9A 2G9HA 5ISZA 2BVQA 2XKNB 5AAMA 2YEZA 4ODUB 3SGJC 3WIFA 2EYRB 2WQRA 1HH9B 2GAZA 3KYOB 3HZKB 3WIHA 5H35B 4Z95L 4KK8C 3C8HA 4JFEE 5F88A 3FMGH 3QEQD 1ADQA 1DQDH 4HK0B 1HE7A 5HBBA 5JW4R 2O93L 2DQEH 3RIAK 1ZA6B 4PB9H 1FG2B 3QG6B 1L6XA 2Y06H 2P5EB 2NY0D 2ED9A 4X4XA 5EIIB 4MWFB 1KBGL 3AXLA 3BKJH 4HWBA 4U49A 3O4OC 3QDGB 1FJ1B 3SDDD 3S97C 3LHPL 4LMQI 2XA3A 2AI0L 2EDWA 4X7DC 4CL7A 5CWSA 5IHZB 1M71B 4GAJL 4OZIB 4WFGD 5IJVB 2HAZA 4WO4B 3ZKNC 5JHDD 5DO2C 2AABL 3SE8L 1INEL 4UAOB 1KB5H 2DWEA 1QBMH 5LGJB 2D0FA 3H42H 3CVHH 3N1FC 4MQ7A 3C5ZB 2DAVA 3V5KB 1AGFB 4NN6B 5I76B 2BK8A 4KHTH 2DDQH 5IUSA 1BJ1J 2EC9T 1P2CA 3DGGA 1MCWM 3OB0K 3HZMB 4V1DD 4UT9L 9CGTA 1HHKB 3VFVA 3ULVL 1OP3H 3GRWH 1PW3A 3MRJA 5D7KD 4E41B 5C0CD 3TZVC 3UPCA 4G8GD 3PE9A 4Z7UB 4G6AD 3VRIB 3VDAA 2AJVL 4HFWA 4XC1L 1YMMB 4F57L 1B4RA 4GW5A 5BO1L 5C0BA 5C09B 1K6QL 4JFFA 2EH8L 3TT3L 3HMWH 2QQKH 1G0DA 1I7ZB 3REWB 4I3GA 5DFWH 2R1WB 5T3ZE 1U8JA 4QHLA 5L6YL 4YZFF 3VI4F 3O4OB 4HUXA 1TCMA 3LQAH 5IG7B 2YPLD 5D7SL 1NGXA 4YDIH 3KJ6H 2W38A 2B2XL 1UKSA 2E9IA 2YN5A 2DQFA 1I85C 4HCRL 2BHUA 3QH3B 2GFBB 2Y07H 3ROOB 1KPUB 2I60L 4AENA 1U42A 2DLFL 3TIEA 3ISWA 5KS9E 5HJ3B 1WBZB 4QXTA 5DDHB 1DDHA 3BWUC 1SVCP 3E6HA 1RUPH 2V17L 2X4SA 1BFSA 1RFDL 5J6GB 5ID0A 1BZ9B 1QFWH 3GSWA 4JJ5B 2QSTA 4OZGF 4KPHH 3QFJD 1Q0XH 4WGWB 1YEHH 3TZVB 3MRDB 4C4KT 1ZHNA 4X7EC 3UAJD 1VADA 4XVTH 3S34H 4NZTH 2A9NH 1J8KA 4IHOB 4KVNH 3QXAA 4M6OL 1JHKH 4GW4B 1W0WB 3GHEL 1NFDE 1QSFB 2P48B 3R4DA 4X6DF 1G6VK 2B39A 5BOZG 4D94A 4J8RA 3MO1A 5IB2B 1WC7B 1P84K 3PV6A 2W9DH 4JANA 3AREC 4HV8A 1X5GA 2W60B 5GS2D 4ONHB 3F5WA 1JHLL 1DEEB 1JK8A 3EGSA 2JCCB 1KIRB 3MNZB 2YD4A 4Z7VE 4JKMA 4NWTH 5L8JB 2R1YB 3GSXA 2BFVH 2Z91B 1S3KH 5FOJA 4P23A 4YO0A 2QHRL 2H1PH 2WV3A 3MA7A 3QUXA 3ILPA 1OT2A 3OHXB 4QRPE 5EU6E 1EJ6A 1PDKA 1ZTXH 3OWEA 4OUUA 4YFEA 5LGHL 4MXWL 1Z3GL 2DQHL 2Q20A 2AQ1A 4JFOA 3THMH 1BVLB 4PDCE 3FL7A 1RZFH 5FOBB 3VWJA 4F9LA 1I1FB 1MHEB 1CGTA 3NFPB 3FQRA 1HH6A 4G43A 5C6TH 3RIAF 2BOCA 1TQBC 1XH3B 2H2PD 1KB9K 4NZUH 1C5CL 4M1GL 5JA8B 4MS8A 1CK0L 2R2HA 3SDXB 3ES6B 5E4IA 5EOQL 4XGZB 4CDHA 4MX7A 4DKDC 4R3SA 3SGEH 3HCVB 3MLTA 4PG2A 3UPAA 3BD3A 4OFYD 3DX6B 4L9LA 5DMIH 3AREB 3PF2A 3HPJA 3PG2A 3TYGL 3B9KA 5IR1B 5J06A 5FYLH 3VA6A 3OG4B 4G6FD 1MPAH 4QRUB 3IS0X 4LAQH 4UB0L 3P73B 1CFVL 4JPWL 4XP5L 4XNUL 4PJXA 4F58L 2NW2A 1F11A 4HS3B 5FA3A 5IWLA 3VFOB 4GXVH 5DMJB 3DYPA 1UQSB 1CTNA 5JO5B 2A6KA 5CKGA 4LCWD 3VXSA 5CFHA 3HC3H 3RBGA 1ZWIB 1MCFA 7FABL 1AXSA 2XG5A 4W6XB 1FVCB 5K33A 1TQBB 3BAEL 4RISH 5AUMB 4TSAL 3DX8A 2PYEB 4JY5L 4LSDA 2KQMA 5GISL 4Q9RH 3S4SA 3O4LB 4WFHD 2I25N 1IMHC 4WUUD 4S0SD 4MQXD 1J12A 1KPRA 5E7FA 1NCDL 2P5WE 2V5SA 12E8H 2OZ4H 4O2CA 5TDPB 5KAQG 2GCYB 1YY9C 1WGOA 2OQJA 5DVOA 3U6RB 1S7XA 3FONA 4MDIA 3CH8A 3PWVA 1T1YB 3KPTA 1S9VA 3UZVB 4KJYB 4M1CC 3V5HB 2VDPH 2EICA 1QBBA 5C0RL 5ADPH 1J1PL 3B5HA 4UQ3B 1JF1A 4C55A 3MQIA 5DT1H 4PRPD 1DBBH 3AAZB 1KYOK 4W4NA 4NHUE 3MROA 1D5MB 3V95A 5CLTA 4P0DA 1ZT4A 4J7RA 2JJUA 4UZGA 3QG7L 5F9JA 4N8VG 4S1QH 2HFGH 5T1LA 2M2DA 1MAMH 2F5AH 3DBXA 5TQ2L 3GSQB 3ZDYE 1Q9WA 5CEZE 5C07B 4X4ME 5GRVK 1GSMA 3RWIB 3KPRD 5F7UA 5F1IB 1KXVC 3C5SB 4KV5E 3PNWB 5L2KA 2GJZA 3DX9B 2H26B 3PIQB 4OGYH 3CXDL 1LE5A 1CXHA 1JGDA 1MRCL 4XNYL 1A1MB 1TZGL 3BD4A 1LEKB 4NQXA 3V4VH 4M6NL 4C57C 2B1HH 4LQ1A 1EAPB 1CXFA 2RIKA 5D1QA 5IMLB 4GUPA 2ERJC 2ITDB 2G9HB 4W81A 1AGBA 5D2LA 3O2VH 4JKLA 4ZNCD 4JFPA 25C8H 2J8UF 3WKMH 2UZXB 1J0HA 1OPGL 2DQIL 3JWDL 3H2WA 3K80A 4OQTH 4PRBA 2N4IA 4HBCL 5GRJH 4MA3B 2X05A 3ULUL 2Z92A 4LIQL 5IFJA 3MX0A 2AJYH 2FD6L 1GOFA 2IAMC 2XXMB 1PBYA 3U9PH 4I4WB 1VFBA 3LZFL 3ZE0F 4HKZB 4LSTH 4QY8B 5IW6A 3AXLB 4JZJA 5GRUH 4HUVA 4ODXB 1MELA 2VDQH 4M8QA 3AB0C 4N5ED 4ZFOA 5IEHA 3MLSL 3EYUL 1TNNA 2DQJL 3FO1A 4Y88A 1OCWH 1MWAH 5CWSB 2FLBT 3SN6N 2WWMD 5CUSL 2UUDK 1HIML 4NC1E 1MOEA 4BZ1H 4XH2B 4YGVA 1YNLH 3M1BA 1DSFH 5E2WL 1RIVH 4M7LH 3L7EB 4G6JH 2OL3A 1LQSR 3DGGB 1LO0L 1BQHA 1KG0A 2E9WA 2ERJB 1A3RH 2V5RA 4IJ3C 3RWDA 2AJUH 1P7QD 3DROA 1F97A 2XIDA 3ZDZF 1YQ2A 5E08L 2B4CL 3DNKA 2P44B 4LP5A 4PJAE 2XZAL 4J12A 5I1EL 1U2HA 3VU2A 3UBXI 3MZTA 1V7NH 3H3PL 2C1PA 3MLUL 1OSPL 3UZQA 2FZ3B 4IRJC 3JV4A 1N3NA 3FO2A 3VXMA 2IAMB 1S8DB 5T33H 3M17A 5FM5O 3TWCL 3QO1A 2X5PA 3NIGE 2UWEF 2BRRH 1ORSB 3AB0B 3WJLA 4HUXB 3VRLF 3T4AA 4ZO7A 1EO5A 4PJIF 1T20B 2PW1A 3DVNA 2ZKHH 2EDQA 1NKRA 3DPBA 4PV9A 4IRSD 1JF6A 1G7IB 3BP7B 3CXHJ 5F44A 2GJ6A 3L5XH 3KLAA 3LS4H 5A2FA 2DQFB 5T3ZL 2AXJA 1NH6A 4XPBL 1H9VA 5C3LD 2DN7A 1CG9B 2E3VA 2BVTA 5DJ2A 1ITCA 5CHNB 4NJAH 5C0AD 4P23C 1IGJA 3TIEB 3RNKB 2IWGA 4XVUC 4LPUA 5ESQB 3LMJH 2D4DA 2G2RB 5ACZA 5TF0A 4QXTB 1DDHB 2IANA 3D0LB 1TTGA 3V2AR 3E6HB 3QUML 1LK3L 4W6YB 5AWNL 5I66B 2ZCHH 1JNHA 4JM4H 1SYSB 5ID0B 1C8PA 2WUCH 2IQ9L 3GSWB 3MLVL 15C8L 4JDVA 3AROA 3VWJC 4F9LC 2W9EL 4NZRH 3RFZC 1F45A 5FV2A 4Q97A 2HT3D 1SHMA 4M9OA 1HCFX 3O8XA 4Z7OE 5CAYB 5BQ7B 1A1OA 1GGYA 4RGNC 3U36A 2L7JA 5D7LE 3VFTB 2F54A 4IRJB 2YN3A 4KJQD 4LCYA 3DUUA 5IQ9B 4HKBA 3CUPB 1I8LA 4ZO6A 1HI6B 3B4NA 1DBAH 1DBJL 3V7AG 3LN5A 3PV6B 4FFYL 1DANT 4L9LC 4OM0L 1PAMA 4KJPD 4JANB 1SQ2N 1AR2A 1WWCA 5L2JA 3B9KC 5LJYH 2CSPA 2R8SL 1F6LL 3ARUA 1MY5A 1NCUA 1JK8B 4M3KB 3CMOH 5HHVL 4XMPL 4NQCE 4K9EH 1OAQL 4RMQA 2CDGB 4G5ZH 3LAFA 4IOIB 3C2AL 1G9NC 3QJFA 1EDQA 4FTVE 4NNXA 1XF3A 3WIIL 1QPXA 4F8QA 1UWGL 1OAYL 1JGLL 4P23B 4YO0B 2HLAA 5IWLC 4HWZA 1H5BA 1KV3A 3ILPB 1F90H 4OCXH 3IDNA 3W9EA 2DQGL 1REIA 3VJ6A 2YHGA 4OUUB 5A2LH 1XGTA 3U48A 1OF2A 1MHCA 5FCUL 4PR5A 3BI9X 1N2RB 5HI5D 4U6HA 3V6FA 3VWJB 4OT1H 1PFCA 1JGUH 2VUOA 1IC4H 3FQRB 2HJFA 5D2NA 3GM8A 3NACH 2IH3A 2BOCB 4HQQH 4PGEB 3AVEA 1MLBA 1JWUB 3FN0H 1BFOA 1EH9A 4NBYB 1NCNA 3ARGD 5IB1A 3IS1X 3PWPA 3SJVB 4I0PD 5T1KD 4PJHE 4PTUA 4GG6E 4RGNB 2R2HB 3BIAX 4PRIE 3SDCD 3EYOA 1OAUH 3F7VB 5C08A 4M61A 4MX7B 5DRNB 4MNGA 5D71L 1UZ8A 3B9VA 1SMOA 3MLTB 4JG1L 3HR5A 4ORZC 4L9LB 2NXYD 3AUVA 4CUCA 1DR9A 1F2XK 3B9KB 3OKDA 3EYSL 3HE6D 4Y2DA 1ZA3B 4OAWA 2FEDD 1YEFH 1NUDA 2I9LA 5DD0H 4I0CC 5EU5A 2VXVL 1L7TH 5B38A 4TVPE 2X7LB 2FO1A 3NA9H 3VXRA 1UYWL 4JFZL 3MRNA 1N8ZB 4HLZH 4OI7A 4IMKA 1GOHA 4X7TA 1F11B 4RFOH 5F6HI 1R24B 3P4LA 5E00B 5F1OB 3TYFA 2MPAL 2DL9A 5HHQA 1YEEL 3O3BA 1OTTD 1MI5D 2CMRL 4JKKA 1P6AB 3UJTH 5E8DH 2P42B 4ZUSB 4RX4D 5D9SA 5IBUB 5I71C 1Z0NA 1NGQH 2OK0L 3MOQA 1KOAA 1LHZA 3IDIA 4Y4KD 2Z9TA 5I1DB 3HE7D 1FPTH 3IVKA 3V4UL 2J6EL 3D18A 3VD7A 1PQZA 3GSRB 3I6LE 1PY4A 4JRXD 1JP5A 1YNTA 1BOYA 4X6CE 4JAMA 5FDWA 2ATKA 3V6OA 2OQJB 4KI1A 2VISA 5FKPB 1S7XB 3FONB 4MDIB 1ZLUH 3P0YH 3MBXH 1TXKA 2AEPL 4LSSL 1KELL 1X5XA 1F6FB 2G75B 1QRND 3V7AE 3VFUB 1Y6MR 2CIIA 5F72S 1IGCH 2MOVA 1MCDA 1CDGA 4TYUA 1DQJB 4UILH 4JZJC 4M7KL 1MSPA 2O5XL 3QFDA 5IESH 2R0LL 5FHBH 3A67H 1ZT4B 2XY2A 4WU7A 3GUTB 5IIEB 5F9JB 1WZKA 3VGBA 5FYLD 4YQXL 4YK4C 1BVKB 3MYJB 1EIBA 4JHWL 4KY1H 2JIXB 3GSUA 5I71B 4DVBB 5L2KB 2GJZB 3GJFH 3AS1A 4UNTA 1S7WA 1C12B 2GIYA 3CX2A 4H88L 3I02A 4D2NA 1A6VL 2O5YH 3S37H 1U6AH 2GSIB 2C3GA 5CEZL 2VQ1B 4OGXH 2CK2A 1I3VA 4OLZH 1IAIL 5IQ7H 1KULA 5EPMB 1NAMH 4U1LB 5HHOE 2J88L 2XQYK 4YDJA 4PRBB 4OSUH 2YWZA 5CMAB 1AIFA 3DETC 5IFJB 2JK5B 4TSBH 4OZGA 1XGPB 1R3IL 4C54A 4FQCH 3BIKA 1E4XI 4JZJB 3QPXL 1KC5H 4HUVB 1T2QH 4DAGL 4M8QB 3WJLC 5IEHB 2AXGB 2AJXH 2XN9E 3QIBD 2F19H 3GBMH 1P84J 1HZHH 2EIDA 3CH1A 4X6DA 5I1CH 3I6GA 2CRYA 4JPIA 2YR3A 3U4BL 4RBPH 5DC4B 3IU3A 4YK4B 1T4KB 4ONFL 4UTBH 5HYJE 1VEPA 3I50L 1LDPH 1R3LB 4YGVB 5E8OA 2EO9A 4D9QD 4MJ6B 3M1BB 4JFXB 1HHHA 4KQ3H 5DD5H 1CTOA 4KJWC 5LVEA 1E4WL 3UCRA 4NT6A 3GIVA 1JE6A 5DYOA 4XVJL 4XWGH 1X5HA 4ENEC 4ELKB 3H9ZA 2VLJE 1KG0B 1BQLL 4NO0B 1I1AA 2AKRA 3ALWA 1KEML 4ODSL 3BEVA 4HDIA 4YX2L 1R5IB 3DROB 1GGCL 3OKNB 3WNOA 4XPTH 4B0MM 1G84A 3GSOA 5T1DL 4EOWH 5KSAA 5ITBH 4OTXH 3BOVA 2YRPA 2IPUK 3KR3L 4OV6F 3EO9H 5HHMD 1OP5K 3M17B 5GS3A 3JTSA 4YDVB 3V0WH 2R0WL 4L3EA 3QO1B 2YPVH 3F7QA 3OL2A 4FNLL 1JYVA 4HCRA 4K3JL 1T80A 4FQIH 1DBKL 4K8RH 3TBWA 4X4YA 5EZOL 1F4AA 2M1KA 5GS0L 5IMMB 4KV5F 2R4SH 2BNQD 2GUOB 3QUYA 1DUZA 1CGUA 5E8NB 1PZ5B 4PV9B 2DD8H 2HMIC 2FX7L 2GJ6B 4I13B 2R2CA 2WBJD 3FQUA 3S37X 4P5TD 5E2JA 2JELH 1H8NA 4Q6IC 4U3XA 5DJ2B 2OR9L 5HD8D 3EYQC 2FWOA 4QYOB 3HMXA 2Q86B 3MJ9A 2ORBL 4M5YH 3RWFA 3HAEB 5GQBA 4MSWA 1NCBL 2H32B 2FBJH 3N1QC 2WWKT 1GCFA 5FIEA 1TTFA 3ABZA 2VXSL 1KTKE 2BSRB 4JDVB 4NRXA 4HX1A 1JI2A 1BLNA 4D8PB 4JVPA 1AFVH 2C1OA 3BGAA 1K9TA 1FP5A 4X5XA 5FB8A 4GRWH 3U4EA 4U1SA 4LCYB 4AG4L 4G6FB 2QQQA 3OXSA 2E5EA 3CVIL 5INCB 4U3CA 3WHE1 4I3SH 1I9RH 1QEWA 3LN5B 4S1DD 4BUGA 4O4YH 3S6CA 4C58B 5SWSD 4ZS7L 4MA7L 5C3TA 4Y2DC 5IHUL 3Q1SL 5AYUL 5CJOH 4X9IA 3U0PB 1HQ4A 5GGVH 5CEXA 1S9KC 2E6QA 3DX7A 3QJFB 1A7PL 5DHVA 3T0EE 4C56A 1XF3B 2BDNH 2IEPA 3RRQA 3H9YA 4Q6IB 1E27A 4HK3N 4IMKC 2K1MA 4HH9A 5GJTH 3EOBA 2PXYA 2HLAB 1RUKH 4HWZB 3SGKA 5A3IC 1T89A 1KYOJ 3H9HA 3IDNB 4I3RL 4DCQB 5EWIL 4YXKL 3VJ6B 2CIKB 1XGTB 4WUUB 1FN4A 3S5LB 3QI9D 4PFEA 4HXAL 4NWUH 4E9LA 1INDL 1AO7E 4PR5B 5J9PA 4U6HB 1ND0A 1EPFA 1YYML 3TNMB 1U8LB 2DM7A 3IKCA 3QNXA 4PJ7F 4LLQA 5KVDL 1IAKA 4FXKA 1WEJH 1NBZA 3ZYIA 1BFOB 3FT2B 5IB1B 3PWPB 2Y5TA 1RY7B 5F96H 3O3DB 4HK3J 4PGZA 2VLRA 3EYOB 4UV4H 3RU8H 3SPVA 3GZKA 5C08B 1G6RL 4M61B 1C16A 4P5KB 1EEZA 5E56A 4AT6A 5BS0E 5CGMA 4MNGB 1UZ8B 4Y4FD 4GS7C 3MFGB 4QTHA 5IVZA 3L3DA 4UDTB 2BSTB 3V6OC 1U8PB 2ESVB 4ALAH 1K8DB 4Q58C 3D39D 3AY4A 5GGTH 4NM4H 4ODHH 3F12A 4Y2DB 3LY6A 5D1ZA 2A77L 5D6DA 4OAWB 2PTTA 4WI3A 1BFVL 3KPSB 4AJ0A 4OZ4A 2FR4B 3PWLA 2J8UA 1X5ZA 5EU5B 2HH0H 3QA3A 1N5AB 4GSDL 3HLAA 3VXRB 3T65A 2YUXA 3VXUA 3MRNB 2XTJC 3E3QA 1RURL 3STZA 4X0KA 2Z31A 1DUYA 4PJFA 1EK3A 1HYRC 1CBVH 2YA0A 3BKML 1QFWM 3NABH 5C92A 1PKQE 2E7MA 2LE9A 3TYFB 4LVHB 2EKSB 4NOBA 5HHQB 4Z7OF 1GOGA 2H3NA 3MRFA 4FQQA 4TVPL 2DI9A 1TJIH 4YLQT 1JNJA 5I1JL 3QWRA 2IFGA 1UM4L 2DTSA 1DQLH 4EUPG 4H1LA 3ELAT 5KVFH 1YQVL 4EJ1C 4FQXC 2Q8AL 5D9SB 1BEYH 2EDNA 4KI5D 4NHCH 1JHTA 3MLWL 2IH1A 1OW0A 3QNYB 4MDJB 1GGBH 5IROA 1N7MH 2C3HA 3IDIB 3TVMA 2H45A 4HIJA 3Q2CA 4LSQL 1F00I 3ZE1E 1MJUL 3IVKB 4WHCA 1SEBA 3D18B 4RIRB 5ESAA 5DJXB 5FAAA 4GS7B 1I1RA 4HJJH 1UT9A 2SEBA 4JAMB 2ATKB 2IMNA 3WE6A 1OB1B 4MNQA 3TN0D 3MPCA 3HS0B 3RUGE 2UYLB 1FV1B 5LWYH 3WV0A 3WXWH 2VDKL 1MNUL 5DQ9A 5TE6L 2WQ8A 4WWKD 4F3FB 3SKMA 3FN3A 4JO3L 4O02H 1LNUB 4MMZC 5SWZD 4H25B 1S7QA 5F1NA 4P2RE 5LQBL 2CIIB 3U7AA 3FAWA 3H7BA 5EOTA 2XTJB 1YEGH 5AYQA 2BNRE 2NY7H 3CK0H 3PXJA 4D0CB 1NDGB 1VFAA 3CZJA 5HYIA 3S88L 1JGVL 2HKFH 4RDQF 5IFHL 1HKFA 1KTLA 4PJ9A 5DA0B 2VDRL 2A73A 4Z8FH 2UWEA 2YUVA 1A7NH 3KYMA 1W0YT 5SX4H 4GMSH 5EZJB 5JIPA 3ULVC 5CJBA 4PJIA 4FQXB 1M7XA 3GSUB 2GYSA 1IAOA 2AGJL 2N7BA 3D69B 4OLYH 1S7VA 3UTPE 5L88L 5ILTH 1WCQA 3I02B 1KN2H 3S3PA 2WSKA 3O9WD 3P4MA 1T1XA 4GKZA 4O2EA 2UV3A 1RZJL 2FIKA 2EEDA 3HC0A 4Z7NF 1ZHBA 3C8KA 2HYMA 3K4AA 2DJUA 3FFCE 4KJPC 4YHKL 1XZ0B 4WDIA 1S78C 4JCLA 4UT7H 3GSNL 5DGRA 1ACYL 3SY0A 5KSAC 2W92A 2FL5A 4HWEL 1AIFB 4WUKH 5ICYA 5E94A 5E7BA 1QR1B 5JOPE 3LIZH 4PJGB 3DRTB 1F42A 2P5WD 1CD1A 2J7LA 4G9DB 2H41A 5ITFB 3RAJL 2EE3A 2EEBA 5CIPH 4NIKB 5GIRB 5C0AB 3ZTJG 1I8IA 1YEDA 1QFPA 5CILL 2ADGA 4XI5D 3CH1B 2IBBA 3MV7D 3QUYC 2AV1A 1CLZL 1FAKT 2GEEA 2BNUA 1RUQL 1DP0A 3MLRL 3I6GB 5CS7A 5EU7C 2QSQA 2DYPA 1BIIA 5ADOH 4KUZH 4QEGA 4LDOB 5ID1A 5HI4D 1QNZL 5E8OB 1KCSH 2IALB 1T04A 3F58L 2GTWA 4YDKL 3F6IA 4DEPC 4NT6B 1A1NB 3GIVB 4JFDE 4Z5RB 1QVOA 1SM3L 5LG1A 1IM9A 5IB4A 4R26L 4K7FA 4DN4L 2G60L 3CLEL 1N64L 2NY5L 4U05A 3BEVB 4HDIB 4YHLH 2IPKB 3B2VL 4I8DA 5DEZA 5B39B 3PGDB 4HD9A 3PP3H 5C6PB 2EDRA 4XPAH 4GXUN 4QNPF 3GSOB 3FB8A 4P9HL 3BH9A 4F7EA 4J4PC 3V4PL 5KSAB 2AEQL 3GMOA 3OKYA 5D7IB 1GVIA 3FZUC 2HTKC 1DQML 1T21B 4X7SL 3JTSB 3NCBB 3FKUS 3P30L 1A9EA 5T5FL 2HP4A 3QXUA 2OMNA 4XB8A 2MJWA 2R2EA 5MEQB 1H15B 1WWAX 1G0XA 1OAXH 3QUYB 3V8OA 1JN6A 1HWGB 3QPQC 1H3XA 4KZDL 4MB5A 5C0GA 4G6KH 4N8CL 4KDTA 2X4UA 4NC2B 3FQUB 2CPCA 3BH8A 3MOBH 3ARBA 1MCLA 1EBPA 2XACC 1AQDA 5BZDA 2QQNL 3LPFA 5D6CB 4HAGA 1IE5A 2FWOB 1T89C 4R8WL 3X14A 2BHYA 4DEPB 5L7XH 1EHAA 1UCBH 3RWFB 4I5BB 4DOHB 2VABA 1U8NB 5EBLB 3VI3E 4XMKH 1K8IB 3VDCA 3BSZL 4WY7H 3RY6A 4U1KB 2YKLH 4HC1A 4R0LC 5MENE 4MXQA 1BLNB 1Z9OA 1ZVSB 3NPZB 3I9GH 4RMTA 1CQYA 1CE6A 2C1OB 2XOTA 2CLZA 3S96A 4GLRH 4OZFA 4OFVA 2VJXA 4U1SB 2VR9A 2A0LD 3TA3A 1U3HC 4ELMF 4P3WA 4QRSA 3QZWA 4LEXH 1MCWW 1RVFL 2NTFA 4ISVA 1Z9LA 4L4VE 1NFIA 2NX5D 3IJHB 1Q9KA 3LKSB 4RWYH 1I9EA 3O0RH 5SV3A 3AY4C 1S7UA 5GGRA 1I8MA 3U0TB 3RGVD 4MD0B 1EVTC 4FG6D 5D1ZC 5D6DC 5JQ6H 1SEQL 5FGCB 3IXTB 1HQ4B 1AGCA 2D7TH 3T3ME 2PKDA 5DHVB 4H20H 3O11B 4C83A 4JKWA 3E3QC 1E27B 4TQEH 5B3NA 1MJ8L 4QGTA 4K8RD 3VWKC 1A02N 4KRPD 1RZKL 3H9HB 1KCUL 4QRPA 2HA1A 1CDCA 1WAAF 3ZTNH 7CGTA 5EO9A 4NGHH 5FUCE 1MAJA 1DE4B 2P24A 3SEPA 1FN4B 2V7HA 3DUSA 2GJJA 4NSKA 1I9IH 1SY6A 4L29B 3JWOL 2WLZA 1J1XH 1U8OA 2IGFH 4LASH 4G6MH 4R0LB 1VEMA 2HRLA 3IKCB 4JY4B 4LLQB 2QQLL 3ZKXC 4FQLH 3VFGH 3X3GH 3HI5H 4JDZB 5HYSA 2B0SH 4EIZC 2VXTH 1U3HB 1ZOXA 1ZSDB 4AT6B 4LGRB 4K2UL 4Y19E 2F8XC 4Z0BL 1I3GH 1UFUA 3U79A 4QTHB 2Z4QB 1NEZA 2AK4E 5HVWA 2VZOA 1HCVA 3P9WB 5JW3L 2VZ3A 3HNVL 5IVXF 3AMLA 1K2DA 3T0WA 3F7PC 5D1ZB 5EO1A 1X5JA 4Y7MA 2PTTB 5E2VH 1S5HA 3C87A 4OZ4B 4X80H 4L8SA 3UO1H 2QSVA 1Z2KA 3QAZC 4GJTB 4JVWA 4YGAB 3T65B 4N1CA 1E6JL 2C3WA 1J1OH 3STZB 4X0KB 2XKUA 4U3HA 3VWKB 5C0JA 1ZLWH 3VRJB 1NBYA 3SKJL 4FZEL 3UTTD 4NQCD 3NVQA 3WUWG 1EJOL 1XGYL 1KFAH 3PQYB 5JHDA 4MJ2A 4H1LB 4E5XA 3LV3A 4WI9A 1U8QA 1JHTB 4NYLB 2IH1B 4UTAH 5F7DA 3ZKXB 3RX7A 2AXFA 3JWDC 3O41A 2FECL 1JMXA 3QSKB 4F7MA 5ACLA 4R6UA 3GI8H 2BVPB 3ULUC 5JA9A 3RWCA 5D7JC 2P4AB 1BECA 3MV9E 3LB6D 5IF0A 5ESAB 3D3VB 4NFDA 4MNQB 3AU1A 3HA0A 4G9FE 1FL6A 1IARB 2XFXB 3BXNB 4ESKA 1N5YH 3QDMD 2ARWA 5DQDH 1LP9B 2Q1EA 3NA4A 4R4ND 1TNMA 4LSPL 4NZDA 2XICA 3SKMB 2OR8A 4KK6D 2X4OA 4ZUUA 5ALCH 4AM0A 1S9WA 1DVFD 2HJKA 5EOTB 5J6HB 1ONQB 4QWWD 5IHBA 5DHXB 3WSQH 1WT5A 3SDXE 2VXQL 1P4IH 4FFZL 2YPLA 5HPMA 4NQDD 3UTQB 1EFXA 1FFPB 3VXPA 1QOKA 2EXYD 3CU1A 2BERA 3EYVA 2HVKA 2VXUL 3ZYJA 2A73B 5F6HJ 4NNPH 4EXKA 4TVPD 3KYMB 4RGOH 3VE0A 4CU8A 1YNKL 1U92A 4PJIB 4JLRA 3TCLB 1IAOB 4XAKD 4P2OD 5EZIH 1S7VB 4TSCH 5HVHB 4QT5A 5I18L 3JWNC 1QFUL 4U1HA 1ZEAH 1T1XB 2CGRH 4GKZB 4PLOB 5D7JB 3HC0B 1JPFB 4N0RA 3C8KB 5T3XE 1IKNC 1EX0A 1LEGA 2V9QA 2GK2A 1PEZA 1IGIL 4JFEB 4TTDD 4X83A 5M95B 5D1XA 1I8KB 3SY0B 2MTPA 3DXAE 3EJYC 4N68A 5ICYB 3MREA 3BRFA 1IAII 4I18C 1CD8A 1J8HE 2CKBA 2PW2B 3Q6FB 1CS6A 4HKXA 2KUTA 3NH7H 2APBA 1WBYB 2XZQL 3L9RA 1F4YL 2FX8H 2F53A 3RIFK 2H2SC 1YEDB 3PUCA 2ZG2A 4P2QE 3MBEA 1CICC 1CLYL 4HH8A 2DM4A 3CFBA 1QSED 5I1IH 5DJ6A 2VQUA 1UJ3C 4XHJC 2O61A 4XCCH 1T1WA 4FFVD 5ID1B 1CGSH 3Q6GL 5CJ8A 3BZEA 5IMKB 4Y4HD 5L8KB 5JDSA 1E6OH 4HZLA 3IDUA 3RKPA 4TPRL 4ZODA 4XT1C 2HFEA 4CN4A 1NCCL 1QVOB 2OR7A 5DUPH 5IB4B 5D70L 4D3CH 2YOCA 3RY6C 4M48L 1A5FH 1MREH 1CE1H 4RMSA 1IEHA 3B83A 2D7MA 4MXQC 5CD5C 3KWWA 2EDKA 5JXED 5EUOF 5EA0L 3IJSB 5CGYC 4LLAA 1NCAL 5D93C 4OLVH 4F7EB 5C07E 2ZCKL 3MXWL 4N0CD 3F7YA 4I18B 1UH3A 2OSLA 1X9QA 3HC4H 1JMZA 3EBAA 1BOGA 1UACH 2IMMA 4PJ7A 4K3DL 1AD0B 5J1SC 3O3EA 4OFYA 4K7PH 3HG1E 4FQJL 2V2TA 2HT2D 3RA7H 1J0KA 2VNCA 1D9KD 1IC5H 5GSVA 3V9FA 1CICB 5K93A 5ISZE 4GRWE 1JN6B 3A6CL 4K3HA 1UJ3B 3WFCH 2X4UB 2UVEA 4HHAA 3BH8B 1CR9H 1WQVT 5H37H 1MCRA 3R06A 4KKAD 1AQDB 4OB5L 3MLXH 4X8XA 2ZSWB 1N6UA 5BZDB 1CGWA 1RUMH 1NBVH 1WIPA 2EC9U 2EDJA 4MLSA 5JXAH 5KS9B 2DI7A 2NY3C 3K8MA 3CAFA 1JZ7A 1A6AA 5CSZA 5F8QC 1JWMA 2XWBA 1MCQA 2CO6B 2BCKA 4LCWA 3SGDH 1C5BH 3MGAA 4L3AA 3WDIA 2I07A 2EYTA 32C2A 1U8KB 3VW3H 2ZCLH 1T0MB 1Q1JH 4N5UA 1W72L 3JV6A 1CXLA 3E6FA 3KPNA 4KQ4H 2GTZA 1CE6B 1FIGH 2CLZB 5D93B 3QIUD 3JSSA 4OZFB 5D7LA 3MV01 1R6VA 3MRHB 4PRHD 3RX5A 3O6FA 4ISVB 5T1MA 3CCHB 5F3HB 5KN5B 2DTML 2GSGB 5CSBA 3GB7A 1QPPA 5J3HD 1IZJA 1I8MB 5I1AA 2O5ZL 1A7QL 1OTSC 4YXLH 3ARDC 1I1YA 3ROLA 2EIEA 5LXGH 1YA5A 4Z7VB 2X89A 3BKCH 4LSUH 2VE6A 4YFLF 4KK9D 2F58H 4KROD 1KCRH 1LO3H 4UU9A 5I30L 3MACH 4FTVA 3B8SA 1WK0A 2EE2A 1QLEL 4RAVA 3WXVH 3ZYZA 2ARJQ 4JRYD 1NLDL 3N50A 5F9WC 5C0BE 1ZLUK 4JFFE 5EORH 4O9HL 2NY3B 2ZSVA 1YDPA 4QRPB 4MJID 5EU6B 4JQXC 3U7WL 1JCKA 3PL6A 2P24B 1OAUL 1M05B 2BSED 1EXUA 3O45B 1KJ2A 4JDTL 3QCVH 3KPRA 2ADIA 5FUOL 3KHQA 3GHBL 3DMMD 5DC0A 4DQOL 4KTEL 2NXZD 2GY5A 1TDQA 5L9DL 2CJUL 5BXFA 4K7PX 4LHJB 4UBDD 2PUQT 5DLMH 5ETUA 4MVBC 1K85A 1V5JA 1AKJD 3QRGH 3TJEH 5FYKE 4D0DA 5I8OH 1CLOL 5ECJE 4L8DB 4GRMB 5KJRL 4ZFZB 1NC4B 5IBUG 3AC0A 2VSDA 2R56L 2OLDA 4OCYL 4GRLD 1FNHA 1XR8A 3Q5YA 3FFDA 8CGTA 1JFQH 1K2DB 4PJDF 3UTSA 4R97C 4WEBL 3UYRH 1L4IA 3O2WL 4U7SA 3S4SG 1N4XH 4H0IA 3V5DA 3EJZC 3ARDB 1D6EB 5BW7A 4S1SL 5FK9A 4FABH 1AHWA 3I2CL 1MCJA 3MODH 5F97E 1EEYB 4HEPG 1PZUB 1FE8L 3G5YA 2D7PA 2VZTA 4N5EA 3HR6A 4EVNB 5FFLA 5C8JA 1BBJB 5F9WB 5BVPL 3LH2H 1IBGH 1H3GA 4FZ8L 4R4FL 1RU9H 1IC7H 1DLFH 5DURB 3WFDH 4KI5F 2LAAA 3ETBF 4NQSB 3C60D 5HHXL 1AI1H 4J6RL 1F4XH 3EO1A 4LEOA 5DD1H 4W68A 4BH8B 4KAQL 4U4BA 3O2DA 3T0ED 1ERNA 3MGOA 3B6SB 2ZUQC 4M5ZH 4ZSOA 4E5XB 3LV3B 2ADFL 4LLUA 4ZQKA 4ZOAA 1F6AA 5F1KC 1JVKA 5F7DB 3SOBH 4XPGH 4AL8H 2MQ3A 1XIWA 3DI2B 2X4TA 1M1SA 1PY9A 1RQ5A 5FGBA 3K1DA 4F2MB 2P5WB 4ODTL 3RWJB 4HIIA 2VZSA 1OGAD 3ZKMC 4XP9H 1MF2L 1FYTD 5D1XC 4R97B 3CSPA 5H8DA 3MOAL 5I75C 3MUGA 2X4RA 2JJSA 4NKMA 5HGDA 3IFPA 1X5KA 3TO2A 3A6BL 1XF2A 2H9GA 1KTRL 4ZUUB 3KPMA 4AM0B 3I3DA 3R1GL 2ZPKH 1S9WB 4YWGL 3BE1L 1RMFL 3MNVB 4NHUB 4EI5D 5TPWL 4ODWA 2W0FA 4Z77B 1FDLL 3C6LC 4BKLA 4K23H 1BX2B 4NO2A 1EFXB 3MBEC 2HN7B 4RCAA 1MHPH 5K9KA 2ID5A 4WHTA 3EYVB 2HVKB 4IRSA 3RGHA 3U46A 3LEVH 4CN6A 3RDTD 4P46A 1C1EL 4LKXB 3O6LL 2EXWC 3FN9A 1JYWA 1VGKB 4JCMA 4M02A 3SE9L 4QRTB 4NC1C 2ZUQB 5C0FB 1FG9C 1F58L 2FJFA 1NDMA 1QO3A 1U92B 4JLRB 4BUHA 4GKSA 4R2GC 3RTQD 3T2NL 4U1HB 3GSNA 1T22A 3OAYH 1SMAA 3DWTA 4JHAH 4KKBC 5DVKA 2CK0L 3FQNA 4PJXE 3ZL4L 2DIBA 3C09C 2Y5EA 1LEGB 4MAYD 2E7CA 1DQTA 4OLUH 1FH5L 1KB5A 3L3JB 2E7BA 4RNRA 4P48A 2Z35B 4PYGA 1QACA 5C0IA 2ADJB 5K9JL 2HLFC 4AMKH 1GH7A 2EDXA 5D1XB 3CVHA 4LCIH 3VXSE 4H26A 5GS0C 5DSCB 4JQIH 3PHQA 4NUGL 5I75B 1J05A 3MREB 1BQHG 4Q0XL 3OG6B 1TJGL 5T3XL 5CJXA 1QLRA 5GZOD 3GRWA 3LQZA 1UKTA 1P9MC 2A9MH 3L9RB 5EN2A 5JW5A 1MIML 1R5VB 1MJJA 3P40A 3C6LB 1WWBX 5F71A 2XN9A 4NKIL 2CD0A 4NQVB 4ELMA 1HXMA 2X4NA 3MBEB 2XZCH 2PO6C 2DWDB 4U6XA 3CFBB 4QOKD 5C2BH 2J8OA 5DJ6B 3QXDB 3CLFH 2VERN 4GBXA 4BQCA 1OARL 2LTQC 5F7HA 1T1WB 1P6FA 5J1AB 1B4JH 4J3TA 1PG7W 3BZEB 1WF5A 2BNRD 1RK0A 2HT4C 4L1DA 2NY6D 4R2GB 5IFAH 1OLLA 4CMHC 4DZBA 4EKXA 2HFEB 4NN7B 3CFCH 5DHYA 3MUHL 5HSFA 2PYFA 5FYJH 5I74C 3C09B 1AQKH 3ZHDA 1VB9A 4JM2D 2HTLC 3PDOA 4HPOL 1WAAA 4PJAB 1VFOA 3P9MA 3UTPD 4X7CC 1HHGA 1BGXH 4RAUA 4I0PA 5T1KA 1D5XA 4HFUH 1XFPA 5TQ0H 3MFFB 1D5IH 3SDCA 3VMOA 4YXHL 4Y1AD 1FNEB 5A43C 3GI9L 2OSLB 2P47B 2A6JA 4D9LL 4NP4H 3PGFL 5JUEH 5L2KE 1BOGB 2JELL 3O6FC 3O3EB 3IDJA 3FFCD 2V2TB 4Z7WF 1P4LA 2WUBL 3LKPA 2KQNA 3MMEA 3MV8D 4NQEA 1RIUL 3HE6A 5DXWA 5ANMA 2YPKA 1QBLL 2PO6B 5D2LE 4DVRL 3CFIC 1VKXA 1V7MH 4N9GA 1EGJH 1HOCA 1GGIL 3D85D 2XI9A 2LTQB 4HHAB 3FOLB 5HYQA 5IVXA 5BJTA 4AH2A 5KG9B 1K4CA 4N8VB 1FCCA 3WUZA 4KXZI 1YYLL 4XP4H 2I27N 1HNFA 4PP2B 4CMHB 3PL6C 2NY2C 4D9RE 3B9AA 1LO5A 2BCKB 3VGFA 3WIHL 2ZJSL 3JTTB 1AD9B 2DQDH 1HQRA 5E99H 5JW4Q 2X6MA 5I74B 32C2B 1GC1C 5IB5B 1X6NA 1ADQL 3EYFA 1Q0YL 2ZG1A 4PLJC 5AD0A 5KSBE 4TULH 4XCNA 1W0VA 1HYSC 4MJ5A 3MJ8A 1OGTA 4WFFD 1MCOH 5T5NG 2J4WL 5D7LB 3HE7A 5EB9A 3FQWA 3GMNB 4HWBL 1RULL 1JUFA 3QNZA 2IG2L 2KDGA 4ZUVA 4NJ9H 1CGYA 2VDNL 2AK1H 3O6FB 5T1MB 5FUZH 5MERB 3G6DH 1CFNA 5DD6A 3DARA 2Z8RA 4JJHA 4GMTH 1FNFA 1J7VR 1IT9L 3EHBD 5GSRB 2EZ0C 4Y16A 2FJGA 1GAFH 3U7YH 3KNBA 1AJ7L 5TJWK 1ZANH 2VE6B 4ZD3L 1OOAA 4UINH 4FTVB 1KJVA 3DLQR 4PGBA 4RAVB 4OKVB 1P5UA 2MCPH 4HBQA 2DQCL 2ZSVB 3VXME 2EIZB 3PL6B 4QHNA 1T6VN 2NY2B 2OP4H 5J1TC 3L6FA 1KJ2B 5B38G 2ADIB 3L5IA 1AO7A 5JZ7C 4BFIA 3BQUA 1S5IH 2R29H 1RJZA 3OKOB 4JQVA 4EN3C 1NGPH 4XRCA 5IT2H 2BSSA 3L5JA 5JIHA 4PJHB 4GG6B 1XIWC 2P5ED 4PRIB 1GHFL 2X40A 3BT2H 1B2WH 1DANU 5FGBC 1T5WA 1T0NB 4D0DB 3WNLA 4QXUH 4GRWF 3QDGD 1RJYA 35C8L 5DRWB 4F37F 1FNGB 5BOPA 4BM7A 4MA8H 4PBWD 5I15L 2IANE 4L4TA 4LFHG 1XR8B 2HWZH 4PPTA 3UTSB 1NJ9A 1TZHA 4KUCD 3Q0HA 1EV2E 1N0XH 1LEIB 4WO4D 5FK9B 1KENL 5FYKL 4ACPA 1GGTA 3UJJL 4PS4L 2JB5L 2XPGA 2Q76A 3FT3B 1MFCH 3MRGB 2LU7A 1I1CA 3G5YB 2OZ4A 3RKDC 3C5ZD 4XVSL 1NSNL 2P8MA 3ARTA 3MRRA 3NZHL 2F54E 3HNSL 4JO4H 1RZ8A 5IKCA 1YEIH 1PLGL 2ZNWA 1HK6A 2VDOL 3SQOH 2V2WA 4LHUA 5GJSH 2UUDH 3ZT6A 4E41D 3EO1B 4P46C 1INQB 5IMOA 1B3JA 5JOFA 1RZJC 3WYRA 3QXWA 1ORQB 1YMMD 1NLBL 3WFEH 4R7DA 5CGTA 5F9OL 3CDGB 1F6AB 5F3BA 4EN3B 1RHFA 5C09D 3WD5L 1J0JA 3CPLB 2XTLA 4Y0GA 1X5LA 5CCKH 2CRZA 4FFEX 1N6QL 2X4TB 4P4KA 1BWMA 1EUUA 3IFNL 3F6LA 5BMFH 4OCRL 1WJ3A 3QHFL 4X6CB 3T4YB 5I1HL 3U0WL 3GM0A 5A16A 1CDHA 1Q94A 4XBPB 1JBJA 6FABL 4IIQA 2WINB 4KKCC 4QF1B 3ZKND 5DO2D 1XF4A 1WZ1H 1X5YA 1FZJA 5EUOA 5D2NE 2YMXL 5C0EB 3ARZA 5CJXC 1MRDL 5BVJA 4QGYA 3PP3K 3PWPE 2AK4D 1QYGH 1TCRA 2YC1A 2W0FB 4ZYKA 4OQTA 2R2BB 4PJ5A 4NO2B 5C08E 5I16A 3ARRA 1ETZB 3WCYA 1H3PL 1ACZA 4U6VL 5K9KB 4WHTB 3GEWB 3VD4A 3U46B 2NR6C 4P46B 3TZVD 2M8XA 4GBXC 2VO5A 1G0YR 5EBGA 1NGZA 4XP1L 4HT1H 4K71C 1RSFA 4KHXH 2GITB 3N9GH 2NY5C 4OLWH 1QO3B 3TF7A 2VMFA 4J3SA 1BBDL 4RMVA 3VFMB 5C9JA 4HKJA 5K9QG 3C6SB 3LQAC 5I0DA 3GSNB 4JFQA 1NAKL 4P9HC 5B3JF 1G9NH 5JR1L 3LKNB 5JLZA 1QSFD 4XPHH 1MWAA 3K2UL 1T22B 5AG8A 2DQTL 3RPIA 3MGTA 3MNWA 5AAWA 1A14H 4PRNA 1TJHL 3OJDB 5HHOB 4X99A 4FQHA 4RNRB 4ZFGL 2EDTA 2ZOKB 1XR9A 5DTFA 1IZKA 5KANI 3IDYC 2EYSB 3HI6L 3QP3A 3SKNB 2AS5M 1HKLH 4WEUD 4UT6H 1HSBA 1J05B 4HS8L 4PV8B 1JIBA 5H94A 3MV9D 4J3VA 1QLRB 1ZHKB 4CMMA 3QUZC 5DUML 1G7LA 2NZ9C 1MHHA 5DD3L 5EN2B 2CLRB 2BVOB 3KYKL 4P57B 4XMLL 5SWSA 3NCJH 4G9FD 1MJJB 3RNQB 1EZVX 3RX8A 2XN9B 4CVZA 4JE4B 1CVSC 4UQ2B 4ELMB 2VITB 1CI5A 5EC2A 2Y9RT 4FQ1H 3PWJB 4ZOBA 1QLFA 3WS3A 3TV3H 4GBXB 4TVSa 3P4NB 4G3YH 4K71B 5EOCH 3TO4C 5HYJB 4OLXH 3PHOA 1HILB 4ONOA 5E9DA 2D3VA 3FRUA 4OM1L 1NGWA 2OX5A 1H0DB 1RK0B 1DN0B 5MEPB 4XCFH 1MRFL 5DVNA 3PDDA 1FGVH 5JHLL 5IBTH 4PB0L 3RI5K 1CGXA 1ZT1B 2PYFB 1CL7L 1XAUA 3SQBA 2VLJB 5KVMC 1IC1A 2WBWB 4NBZB 3ARED 4BZ2L 1TZIA 2E7HA 3K4ZA 4HXBL 3T2PA 4JPVL 1Z5LA 2XNAA 2V5YA 1NCTA 4P9MH 2HKHH 4RAUB 1AY1H 1Y6KR 3IDYB 5KOMC 4YZFE 3T09A 1MFDH 3OR6A 3V52L 3DV6A 3PP4H 2X9YA 5F7EH 1UC6A 2BVEA 4TRPL 2YRLA 4I1NB 4Y4FA 3V0VB 4YE4L 3QUZB 4LCCA 5SX5H 4UV7H 3G5VA 4N90D 3IDJB 2ICWI 4ZAKA 1HINH 5A2IH 4ORGA 4WI5A 3IFOA 5CEYA 1P4LB 3GKWH 5TH2A 3RVWC 1SJXA 3MMEB 2QSCL 3NFNB 1RI8A 1S9YB 3E2HA 5ANMB 3BFOA 5DRZA 3HB3D 2L7UA 4PY8J 2WZPD 4KZEH 4Y16C 1O7SA 4PJBF 1VKXB 4IMLB 1MH5A 4N9GB 1KT2A 1HOCB 3GK8L 5E5MA 3TO4B 5HYQB 3JWOC 1G1YA 4PJDA 3OKKA 1I7TA 4AH2B 4LL9A 4OIAA 5TE7H 4BH7A 3EZJB 4DKFH 1LK2A 3O4LD 3QQ9C 1NMAL 2VWEE 4JGUA 4XNQB 5KVEL 4LOUC 2Q8BH 4OZGE 1ZKAA 4P2QD 1FVEA 4I48A 1LD9B 1KNOA 1CU4H 1ZMYA 3OAZK 5HGHB 1LO5B 2BOBB 1T83A 4Q2ZA 3NCFB 2NZIA 3BHBB 3QWOA 3F8UB 5ALBL 3HHRB 4B7IA 5I19L 3VGAC 4IM8A 3EYFB 4AZ8A 3DGCR 5E1AB 4X6DE 1UGNA 3BGMA 1JV5A 1HXYA 2QADC 1ED3A 1ZLWK 1A47A 4MJ5B 5IGXL 4TNWK 4F7CA 4X98A 1SBSH 3BDYL 3BW9A 4J1UB 2RCSL 3HTLX 1D5ZA 3FQWB 3GMRA 4ZFOL 2XG4A 1SJEA 1NMBH 4ZUVB 4L9DA 5FO8B 3LKRA 3IFLL 2VYRE 1G7MA 1CFNB 3TN0A 4H8WL 3WKNA 4ZTOL 4A2LA 5C07D 1A7OL 2QEJA 1J18A 3TJHA 4Y16B 3IDXL 3QYCA 4OD3H 1SJHA 3KNBB 5SWZA 1SYVB 1YN7A 4OI9A 5E03A 4D0BA 4NM8L 3U2SA 3C9NA 1E4JA 5GS2H 2IGFL 1JNLH 4PGBB 4JY6B 3TPUE 4Q9QL 4NPYB 4UDUB 2OL3L 1OT1A 4DTGH 3CJJA 4E42B 4ZXBA 4KTYA 4Q9BA 1MUJA 3BYTA 3ZSSA 4QHNB 3VXOB 4ZPTA 4L3EE 2I9TB 4XAWH 4ZFFB 3L6FB 5GRWA 1YY9D 1AO7B 2ILLA 3CFKA 4BFIB 2XV6B 1RJZB 3VGAB 1FFQA 2QLVB 3KPQB 1A6UH 1FORL 1B0RA 4M1CD 4U1IA 4GW1A 5F21B 4GKNA 5DEFA 2QADB 2BSSB 2FX9L 1UWEL 3OV6A 4OFKA 1MCEA 2XA8L 3LEYH 1A4JA 4P4KC 3S36X 3MLYL 5KSVA 3IGAA 2D31A 4XC3H 5BS0B 4Y19A 4H1LG 1MFBL 3F62A 3EOTL 2VZUA 4MJ4A 3HAEH 2JLLA 1O0VA 4L4TB 1UVQA 2H32H 1NJ9B 1ES0A 4IIQC 4N0YL 4YNYB 3SBWC 1AXTL 1KCLA 5DWUL 1T1ZB 4ZUTB 4XXCC 3NFSH 2XPGB 3VFWA 4S1RH 4ZTPL 3DSFH 4EDXA 4OF5A 4UUJB 2Y23A 5E95B 3MV7A 1MCIA 1OM3L 1PKQB 1AGEA 3X11B 5AZEH 3RY4A 2KH2B 5KSBF 1A6WH 4KTDH 1UB5B 5IMOB 1BM3L 1T03H 1UH2A 3BPNC 1I3RA 5MP6H 3GNMH 3MA9H 3LRSB 3LEXA 3P77A 3TF7C 3QBTB 5F7MC 5C0BD 4OZHF 4NQTA 2QV2A 5F3BB 3IB4A 4PRDB 2R69H 1J5OH 4HUWA 5J8OA 2IAMD 4YHZH 5EFIA 3RVUC 1MEXH 3P0VH 5FHAH 1U41A 2B8OT 4AEEA 5LBSL 4S2SA 4C56E 4P4KB 4WI8A 4XBGB 1D5BB 1L8JA 1BAFH 3CFJA 1PSKH 5GXBB 3TBVA 3EO0A 2FBOJ 1IGTA 4K3EH 5DVMA 2DI8A 3HZVA 4Y5VA 1PG7H 3GJFA 1DJSA 1WFOA 5A16B 4A2MA 3S7GA 3RUGB 1AC6A 4IIQB 4P3CH 2W1NA 1QP1A 1KUMA 1XF4B 1PX4A 1FZJB 4P2RB 2VLKA 4QCIA 5FYKD 5BVJB 1MJ7H 3QXVA 1JPGA 1NAMA 3C08L 1TCRB 2QR0A 2VH5H 4TSCL 3MRIA 2VUYA 2E27L 4WI4A 1F8TH 2L0DA 2VLRE 1RZIA 3N85H 3UMTA 1A9BA 4G7YH 4WHYG 4NBXB 3ESUF 3MCLH 4R90L 4Z7WA 1NGZB 3BPNB 2F5BH 2ZZUT 1F4WH 1R0AH 1P4BL 3STBA 1OY3B 4ZPVA 5I8KL 3FHQA 3P4OB 3SDAA 5C9JB 4DZ8B 1Z0MA 4POUB 2XQBL 3K74B 3MLPA 4IRJD 2J8UE 4JFQB 1MQKL 4LAJH 1RD6A 3T77A 5JLZB 5I1LB 5DQJB 3VXUE 5CINL 1W8NA 3L7FA 1VSCA 3MGTB 2CLVA 3N06B 4JFYB 4PJFE 4PRNB 1A7BA 2VC2H 3PGCB 3TBTA 1KCVH 4XWOC 3QDJE 3VG0H 1X4XA 4K07A 3NN8A 3W2DH 4X99B 3U1SH 4OD2B 1RUAL 3ZE0E 3G5XB 3RWEA 4WFEE 2L4OA 1KSRA 3H6JA 4YHNA 4P5MA 5D8JH 5KW9H 1KIQA 1M6OB 4UIKL 1J8HA 1YECL 3W39A 2JJWA 2XRAH 3AFLA 5H94B 5HDQL 1QHOA 4NNYB 4XP6L 4P23D 1L9MA 4LCCC 5SWQA 4XVUD 1S7RA 3ZKQD 4ZAKC 4EDWH 1IQWL 2XT1B 2C7UA 1TVDA 4X6EA 2A6DB 4CVZB 3MUZ1 2I5YH 4PLKC 4OIIL 1KN4H 1L0QA 5EC2B 1PJ9A 5IBLC 1TETL 4JKPH 4Y5XC 3DO3A 2NY1C 1E4KC 1NL0L 3VWJD 1PYWA 2R23B 5EZLA 5MHSE 4AENB 3NAAL 1YN6B 4MNQE 3LDBC 3PHOB 5E9DB 3SJVD 2AAVA 4G8IB 1KJ3L 1QSVA 5CJQH 4RGND 3QHZL 4X5WA 1FO0H 4LMQE 2ICWB 3ZDZE 3OJMB 1ZGLB 1U8IB 3VCLA 4JFDB 2KL6A 5DZLA 1BF8A 1GJIA 3W9DA 1JF5A 4KWUA 3FQXA 1VFMA 2X10A 1TZIB 3HRZB 3ARFA 3B9KD 4M7JH 4Y5YA 1I7UA 4DGVH 3IRZA 4N0FA 1HHJA 1Z5LB 2XNAB 1FC2D 4DW2H 1U95A 2UWEE 5LCVL 4HF5L 1MCPL 3OR6B 4LVOC 1FAIH 3UTZB 1S7TA 1IKFL 1J9CT 5BZWA 2WAHA 4Z95H 3HKFA 5C0DB 4LCCB 4ZAKB 3JVGC 3MLXL 4KK5C 3HG1A 4TNVK 5TH2B 3DECA 5KSUA 1NANI 3TJHC 4OZFG 4LLMB 3H9SA 1P7KA 4N1EA 4Y5XB 2NY1B 5HDBF 1KBGH 3QZWG 2A2QT 4PTTB 5DJZB 4YBQC 3LDBB 1YC8A 4DKEL 1QD0A 2Y4SA 1GYAA 3LHPH 1W72B 1ZVYA 2AI0H 4ZXBC 4ZOCA 5KZCB 4GAJH 4ZNEA 3D1MC 3RJQB 5FUCC 5HHNA 3UTTA 4QHMA 1OL0A 5ICXB 5E6IA 4GAGL 3DURB 4KMQA 2X9XA 2AABH 5TDOA 1INEH 3SE8H 4YBHA 2UZIL 4HUUA 1TPXC 2BJML 2DLIA 1H3VA 5MENB 4OCSL 3LPWA 5C0NC 3OAUL 3BO8B 1OSZA 2X1QA 4YHOL 3CSBA 4EXPX 3D9AL 4G7VL 3BJ91 2FATL 4UT9H 4X98B 1G7PA 1ODAA 4LSVL 4LVOB 5AEAA 4F33B 3ULVH 4BSWB 1P1ZA 1D5ZB 3GMRB 3TBSA 2P8LA 1L7IL 2AJVH 8FABA 2EH7L 3HZYB 4L4VB 3GDBA 4XC1H 5IVNA 1G7MB 3PWNA 4F57H 2IPTL 2VL5B 4WW1B 5T1LD 5BO1H 3KDMA 3RL2B 1K6QH 2JJTC 3NTCL 2EH8H 5JNYA 3TT3H 1U8HA 4AIZA 4HJGB 5HYSG 4MNHB 4F7PA 1S9XB 1SJHB 3T1FA 2X4QA 2JIXD 3L3KA 2Q7YB 5L6YH 4D0BB 3E8UL 4OV5A 5L2KD 3N1PC 1VACA 3C9NB 1DVFA 2AW2A 3LS5L 3NZ8A 1CLCA 2MQ0A 4QXGL 5D7SH 1ZHLB 5F7NC 4M03A 3HNTL 4ZXBB 1GIGL 1QA9A 1RHHA 2YUZA 1YEJL 5GGTA 2ZUXA 2HVJA 2B2XH 4ONGL 3W0WA 1GGUA 5C7XL 1FGNL 2RGSA 4XXDA 4HCRH 1J87A 4DK3A 3DV4B 5FYJU 4HIXL 3K81A 3MRKA 3CFKB 2I60H 2DLFH 5IW1A 4HIEA 4AEHL 1TPXB 4NKQB 3TESA 2DQUL 5I17B 4P2OA 3REVA 5BCAA 4GW1B 2AV7A 2V17H 1MCKA 1RFDH 1UXSA 2F8OA 3RWHA 4AEIL 4D9RD 1X5AA 5TE4L 1Q72L 5KSVB 4MZ3A 4KUCF 4U6YA 3RVXC 3STLA 3UPRB 3QIWA 2R0ZH 3IGAB 2D31B 1EMTL 4Y19B 4LF3B 4P4RA 2AK4B 5GZNC 1UVQB 2OS7A 2Y7QB 5AZ2L 3D87B 5B21A 1DLFL 4U1NB 1A0QL 4M6OH 2ATPA 3WFHB 3GHEH 4NRZB 3OAYK 4CJ0A 1G1CA 3KLSA 3GBNL 1EHLL 3X3FL 1B0GB 3NGBC 1FFOB 4FFWC 3HMXL 3BRGC 3MJ9L 3K3QA 4Z7UF 1A7RL 2OTUB 4EDXB 1JHLH 4L8CB 3QWQB 4U1MB 3ALPA 1KLUA 2RJMA 1AGEB 4EBQL 4NO0D 1QSEA 1IEAA 2QTEA 3JZ7A 5TF1L 3ULSB 3LRGA 5C86A 1I3RB 3HFML 4O00A 2QHRH 2HRPL 3LEXB 3SDAC 4Y4HA 4JB9L 1AGDB 5E4EC 4Z76B 3DETD 5LGHH 4PD4K 5CD3A 2VZVA 4MXWH 1Z3GH 2DQHH 4PGCA 4HUWB 3ARWA 5DUBA 1C08B 4S2SB 2W91A 4TNVF 2QKIA 2ZG3A 5A40E 3MV9B 2IBGA 3VFPA 5FGSA 2DOCA 3TBVB 1C5CH 2NNAA 1AP2A 3BYYA 4M1GH 2YD6A 5DMKA 3WLBB 4WW2C 1CK0H 4I77L 4G9FB 3GJFB 5EOQH 3MLZL 3HB3C 2IADA 2GJ6D 5D72L 5JPNB 1A8JH 1HSAB 4N0CA 3ZHLA 5I1GL 4LNRA 4OGAC 3NPSC 4XPFL 1ZLSL 1IGFL 3AM8A 4RZCB 2VLKB 5IEKA 3NGBB 4QCIB 3OJVC 5DA4A 1A3LL 3OPZL 4MD5A 3TYGH 4KJWD 1JPGB 3WNKA 5FF6A 1MY7A 2A1WL 2XKSA 2E7LA 1TVBB 4M6AA 4PRAB 4JFHD 1UH4A 3MRIB 4YUEL 3QCUL 2ZUSA 4ENED 4APQA 1U58B 2KBGA 1KIUA 4UB0H 4JG0L 3FAXA 4R96A 1CFVH 3G08A 4JPWH 4XP5H 4XNUH 3CSYA 4F58H 4Z7WB 4ODVL 3SDYL 4LVNC 3OSKA 4KKNA 3D2UA 5CIPA 3DSNA 3SDAB 2C4FU 4PJBA 5E4EB 1FLRL 1WCBA 4PG9B 4HPYL 3DVIA 3T77B 4UMGA 1FL5B 1KTDB 3FB6A 2JCCF 1DL7L 1N26A 4WCYL 7FABH 1MFAL 1JPTL 3KYNB 3KHOA 4U1GC 3I6KA 2CLVB 4GG8A 1FBIL 4WGVB 3BAEH 3BP6B 2UY7A 4TSAH 3ARFC 2VLLA 4NKOA 4JY5H 2NCMA 3NN8B 5GISH 4WW2B 3CFDA 3RWEB 3QIUA 5IV2A 2HMID 2HG5A 3DXAB 3GGWB 1NCDH 4GQ9L 4WFGE 4P5MB 3NPSB 1JRHI 5JHDE 1KIQB 1BD2A 2NLJA 1J8HB 2BVUA 5FO9A 1DLHA 4PRHA 3KGRA 1VCAA 4CW1B 3GIZL 1B4JL 4JPKL 3FT4A 1FIEA 3EYQD 1S7RB 3QEHB 1ZT7A 1IQDB 2C7UB 4WENB 2EKJA 2WIIA 4X6EB 1A4KB 1XGUA 2F74B 4DFIA 2XQYG 4LGSB 5C0RH 2YD5A 4HWNA 4P2QB 1J1PH 4YHIA 1EHXA 5D7KE 1Q9LB 2EDYA 3G04A 5C0CE 1D6VL 5EZLB 5JPMA 3IF1A 4QHUB 5IB3A 4LVNB 4W4OA 5CP7A 4LU5L 1OAZL 3QG7H 3PWPD 3RWGB 2GT9B 5TQ2H 4MJIA 5C08D 3VCLB 2NMSA 4ZDHA 3OR7A 3WUWB 5E6IC 1AR1C 3W9DB 5EU4A 4U1GB 2ESVD 3WDHA 2J8HA 3CXDH 2YPLE 3ARFB 3DMMA 4NC0B 1MRCH 1JPSL 4XNYH 4Y2DD 1TZGH 1HHJB 1WSST 4M6NH 3O6ML 5FXCH 3VFRA 3KPSD 3BZDA 1U95B 1YEKL 4NRYB 1CL7I 3DRQA 4PP1C 2ITCB 4PGDA 3KXFA 1AKJA 2H8PA 3VXRD 2VDML 4RMWA 3EDDA 1FNSL 4FQ2L 5BZWB 1OPGH 2DQIH 3JWDH 5A3ID 3HG1B 4HBCH 4GRLA 4KMLB 3ULUH 4LIQH 1OQXA 1R3KB 2FD6H 2X70B 2EECA 4MGXA 3VXQB 1X44A 1P7KB 3KS0H 5JORA 5ISZB 2BVQB 3LZFH 4JRWA 4GRWB 2IQAA 3DI3B 2YEZB 3WIFB 5HGAA 1U93A 5E99L 2IPUG 2GAZB 4PJCF 4NN5C 1K3ZA 4LFHD 5F88B 1DCLA 1WTGT 2DIAA 1R3JA 1RK1A 3EYUH 5BV7L 2DQJH 3T2QA 1CIUA 4PJFF 4I9WD 1Z6JT 5CUSH 3C60A 1HIMH 3DYOA 5HHNB 4X4XB 2OJZL 4PY7A 5E6IB 5TDOB 3CDYA 2F53E 3MYZA 4HUUB 5CZKA 1LGVA 5E2WH 4N9OB 3L1OL 4HGKC 5KSBA 4GMTL 2Y6SC 1OSZB 4M9PA 1LO0H 3QEUA 2GW5A 1QRKA 1G7PB 2E9BA 1P1ZB 3WHE0 3SCMA 2RFXA 2XTJD 3QIWC 4PLNC 3TBSB 5E08H 2B4CH 3ZT7A 2DWEB 4OZHA 2P8LB 2XZAH 4HGWA 5I1EH 8FABB 1MLCA 2FB4L 4MQ7B 4RDQG 1CGVA 4AQOA 4PJEE 3H3PH 3MLUH 1OSPH 5M94B 1P2CB 1I9JL 1N59A 5JNYB 1J0YA 1U8HB 1WVZA 3CZFA 5GRVL 2OP4L 5IVOA 3VFVB 3MRJB 4JN1L 5B8CA 3TWCH 2BX5A 3L3KB 4FQXD 4ETQA 3MRQA 4OV5B 3DUHA 4NN5B 4XTRC 1VACB 5DC9B 5DJAA 4HFWB 4EI5A 2YA1A 4GW5B 3M45A 5C0BB 2ICEA 1QA9B 4FHBD 4JFFB 2WP3O 3H7LA 4GAFB 2HVJB 4O51A 4PJ7E 3W0WB 2FH8A 1E28A 2VL4A 3Q3GA 5F7KC 1G9ML 4XPBH 1U8JB 2P7TA 4LQFL 4QHLB 4HS6A 3N1MC 1S7SA 5IW1B 3QQ3A 3DO7A 1GRWA 1NGXB 1IM3A 1CXIA 3KPOA 4PBVC 3QUMH 1LK3H 5AWNH 3RTQA 4M3JA 3UJIL 1A6ZA 3BD5A 3RWHB 2LQRA 3GMLA 3UC0L 3MLVH 4IBLT 15C8H 4GXUM 1CZ8L 2W9EH 3STLB 2VDLL 2D03L 3QIWB 3TH3T 2Y1VA 2C3VA 2YBRA 4KFZC 4P4RB 3QUXC 4MCYA 1TIUA 2ED8A 2BXZA 3FO0L 4TN9A 2R9HC 4XCEA 3D48R 3GO1L 1BF2A 4OD1L 2X4SB 4LCWE 4N0UA 5BRZA 4IJ3B 3ULVD 1DBJH 3AM8C 4OM0H 3G6AA 4M4PA 3B9DA 3KPPA 3KAAA 1ZHNB 5E2UL 5ICZA 2R8SH 1VADB 4LLWA 4WFHE 4MS8C 5HHVH 4XMPH 3QXAB 1EO8L 1KLUB 1OAQH 4APQC 4HC1L 5K9OA 3DIFA 3C2AH 1FRGL 4J8RB 3MJ6A 4PG2C 3MO1B 3T8XA 3WIIH 1A21A 3D5OF 1JTOA 1MIEL 5K59E 1S78D 1UWGH 1OAYH 1JGLH 4HV8B 1IGML 3IYLW 5KSAD 2DLHA 3F5WB 4O58L 4HZAA 2DQGH 1B6UA 3EGSB 4M6ML 2IC2A 4PGCB 2AJSL 3X13A 5FCUH 1FNAA 1NGYA 3GSXB 5DUBB 4PRPE 3L3HA 4OF6A 3D0VA 3QCTL 4LRNL 2DJ4A 3BEWA 3MA7B 3QUXB 1VFUA 2NNAB 5ENWA 3QUYD 1D7FA 3WN5A 1FVDA 4JFOB 1ZS8A 3KPRE 4LLVA 1KIPA 3G5ZA 5D71H 4Y1AA 3VMNA 3L5HA 3ZHKA 5IEKB 1HH6B 4G43B 2P8PA 3P0GB 2OTPA 3MRBA 4PJ8A 5DFVC 2COQA 4MD5B 1LE9A 3EYSH 5FF6B 3PDGA 2E8ZA 4LSRL 2B1AL 3MV8A 3WHXA 1T2JA 1SY6L 2A38A 2VXVH 2R1XA 4APQB 4QTIL 5CZVL 1ZVHA 4R3SB 4L5FL 4DFHA 1UYWH 3G08B 4JFZH 3D85A 5LAXA 2X1XR 1ZAGA 3CSYB 1HHIA 3VFNA 5SX5K 5FA4A 3GMPA 3HPJB 4LPTA 4MD4A 1RJCA 3UTSE 3GMQA 3D2UB 4J4PD 4Z7NE 3U9UA 2LU4A 3OKEA 4PJBB 2MPAH 1CD9B 1YEEH 4TUKL 1WCBB 5EBMA 5HI3C 3FZUD 2HTKD 1XCQA 4UOW1 1K5NA 2CMRH 3FB6B 1EERB 2D7QA 3ARPA 4XHQA 1GPOL 4JO1L 3I6KB 4PJXB 2NW2B 2OK0H 3ZZ1A 5FA3B 4K94L 1LO2L 2VLLB 2WY3A 4NKOB 4URTB 1T66D 5IHLB 3P3YA 3BKYL 1BFTA 2A6KB 3MJGX 3QPQD 1XGRA 3VXSB 5IV2B 1CIDA 1A22B 3V4UH 2J6EH 4DGYL 4ZSOE 2NLJB 1AXSB 3P2TA 3M8OL 1IILE 2DM2A 3DVFA 3FT4B 3DX8B 4JHZA 4KRLB 4HIHA 2WIIB 3S4SB 1XGUB 2AEPH 4LSSH 4M93C 3WLWC 5D1QC 1KELH 5GGUA 1KPRB 4O2CB 1TVHA 4QHKJ 1UEMA 3IF1B 4M7KH 2NPLX 4BSVA 1CXKA 2YK1L 4MAUL 2O5XH 2R0LH 3PWVB 2X1WL 4WV1A 1S9VB 3TFKA 3QEGL 3UDWA 4YQXH 1U3HD 3O6KL 4ZOEA 1JF1B 5IM7A 2XKNA 2DB8A 1X7QA 4OF0A 4QNPE 3LKQA 4JHWH 1HH9A 3KYOA 3QHTC 5H35A 3MROB 5B22A 3EOYG 4FP8L 2W0LA 4H88H 5D1ZD 5E6ZA 4S10A 1A6VH 3S36L 5T1LB 2EDBA 4H8WC 3VFRB 5CEZH 3DBXB 1Q9WB 3A6OA 1FG2A 2R4RL 3AS2A 3AS3A 2A74A 3DRQB 1IAIH 1NKOA 1RIHL 3KXFB 4IRZL 3RVTC 3TT1L 2J88H 1F3JA 3EFDL 2ZUUA 2OYPA 1G7QA 2Y36L 1LE5B 3VWKD 1JGDB 3MXVL 5IHZA 4NQXB 4M93B 5DRXA 5GGVY 5D1QB 43C9A 4LBEA 1RAMA 4GUPB 5D2LB 5JORB 1AGBB 1A2YA 1R3IH 3PQYD 5E8EA 1IFHL 4JFPB 1U93B 3HUJF 3QPXH 5E5RB 4DAGH 3C5ZA 5CSGA 1UM6L 1AGFA 4S11A 3DTXA 1F13A 2Z92B 4OJFL 1AE6L 2C26A 4KKLC 5I1KL 4JN2A 2P1YA 3U4BH 1VFBB 4E41A 5KVGL 4ONFH 4XNXL 3I50H 2OTWA 4PY7B 5IW6B 3TP4A 4Z7UA 5MHSD 3D3VD 4MNQD 4ZFOB 3EDKA 4ELME 1T2XA 4MYWB 1E4WH 5JMRA 3FO1B 3ZMRA 5C09A 5KSBB 2CKBL 4XVJH 3KJ4C 5KTEL 1BQLH 4PD4J 4ODSH 1KEMH 3REWA 1JNNL 1WIUA 2R1WA 4YX2H 4J2XA 2RFXB 2WIMA 1MQ8A 4RA3A 4AIXA 1MLCB 3BUTA 5T1DH 1WZMA 4P59L 4ERSL 2OL3B 2FHCA 2NYYC 1N59B 4ZS6C 1BQHB 3KR3H 4ZO8A 2K7PA 5K9QI 2APFA 2R0WH 3QH3A 3RWDB 3ROOA 4FNLH 1KPUA 1WAAE 4K3JH 1KEGL 1DBKH 3O8XC 5HJ3A 5EZOH 1WBZA 3TPUA 4A6YL 5GS0H 5DDHA 1QUNA 1OAKL 1NCWL 2C1PB 4O5LL 4KGJA 5GHWL 2ICEB 4KVCH 1KCGC 1KB9J 3JV4B 1N3NB 3FO2B 4R9HA 4M7ZC 3ULUD 5J6GA 3VXMB 1T7ZA 5D7JD 2FX7H 4OF8A 3HI1A 1I8LC 4GQPH 4JJ5A 5HGGS 1E28B 4ZUWA 4BK5A 4TOYL 4Z6AT 2D4FA 2V9RA 3MRDA 1S7SB 4JFED 2OR9H 4NQEE 2MQCA 3QQ3B 3T4AB 5ANME 5DFTA 1IM3B 2ORBH 2O26U 2PW1B 1UM5L 3KPOB 5TFSL 3DVNB 4IHOA 1NCBH 4GW4A 4M62L 1W0WA 2Q87A 3KJ4B 4LHUG 3GMLB 3KLAB 2VXSH 2G5BA 5IVXE 5IB2A 1WC7A 3ZLQC 4IOSD 4HG4K 5CBAA 5JQHC 1IGJB 2NQCA 1H5BC 4OI8A 5ACZB 2IANB 1DEEA 3P11L 4XCEB 1YUHA 4DN3L 2JCCA 1YPZE 3MNZA 1JNHB 3ZKSD 1DBML 4AG4H 1CN4A 3R8QA 1UENA 2DYPD 3CX5K 2R1YA 5BRZB 3CVIH 1I85A 1QG3A 3L95A 4M8VA 1JGEA 5D2NC 3G6AB 4FQPA 4PJ8C 1O5DT 3O8XB 5J13C 1BREA 4ZS7H 3OHXA 5ICZB 1A1OB 4MA7H 1CF8L 2ICCA 5IHUH 3RZCA 3EDFA 3Q1SH 5AYUH 3U36B 2F54B 2R69L 3DUUB 3HRPA 4M7ZB 1BVLA 4HKBB 3UZEA 5FHAL 3IU4L 3DIFB 2LABA 5FOBA 2J5LC 1A7PH 1I1FA 1MHEA 2MCG1 3T8XB 4YDLC 3NFPA 1XH3A 1UA6L 3DVGA 4Z7QF 2BY0A 5JOEA 5L2JB 1U8MA 4JR9L 3PV7A <