3MRJA

Crystal structure of mhc class i hla-a2 molecule complexed with hcv ns3-1073-1081 nonapeptide v5m variant
Total Genus 79
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
79
sequence length
275
structure length
275
Chain Sequence
GSHSMRYFFTSVSRPGRGEPRFIAVGYVDDTQFVRFDSDAASQRMEPRAPWIEQEGPEYWDGETRKVKAHSQTHRVDLGTLRGYYNQSEAGSHTVQRMYGCDVGSDWRFLRGYHQYAYDGKDYIALKEDLRSWTAADMAAQTTKHKWEAAHVAEQLRAYLEGTCVEWLRRYLENGKETLQRTDAPKTHMTHHAVSDHEATLRCWALSFYPAEITLTWQRDGEDQTQDTELVETRPAGDGTFQKWVAVVVPSGQEQRYTCHVQHEGLPKPLTLRWE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system
molecule keywords HLA class I histocompatibility antigen, A-2 alpha chain
publication title Crystal Structure of MHC class I HLA-A2 molecule complexed with HCV NS3-1073-1081 nonapeptide V5M variant
rcsb
source organism Homo sapiens
total genus 79
structure length 275
sequence length 275
ec nomenclature
pdb deposition date 2010-04-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00129 MHC_I Class I Histocompatibility antigen, domains alpha 1 and 2
A PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3mrjA02
3.30.500.10 Alpha Beta 2-Layer Sandwich Murine Class I Major Histocompatibility Complex, H2-DB; Chain A, domain 1 MHC class I-like antigen recognition-like 3mrjA01
1OARH 1T20B 3N50A 2NR6C 1F4WL 1AFVH 5J1AB 2EDRA 4Y16C 1ZS8B 3TIDA 4Q9RH 2F15A 1F11B 4TNWF 5HGHA 2KBGA 3GBLA 4OLVL 1RK0A 1I9JL 1BJMA 3U83A 1EGJA 4OIIL 1WBXB 4JN1H 5DT1H 5GGTL 3TT3H 3BWAB 4MNQB 3BGFB 3BEVB 1D6EB 2DKSA 1T7WA 4P3CL 5IW6B 3HHRB 4M7JH 4ONHA 1A9EB 1MCRA 3ZTJG 2GK2A 3C6LC 2IANB 4FTVB 1BGXH 1L0YA 1HSBA 4N8CL 1ZGLA 5FO7B 3DGGB 3OX8A 3E3QC 2A0LC 5F7YC 5B39G 1C5DB 1VESA 2YD7A 1G7IB 1X9QA 2DS4A 1GPOL 3UAJC 4U1SB 5FGRA 1EERB 5DEFA 4PJIA 5JLZB 3P11H 5CJQH 3QIBA 3ULSB 2AJVH 4JFQB 4QRSB 5IVOA 5J1SC 1P1ZA 3RJDA 1XR9A 4PRDA 5C0BE 1G6RL 4CMHC 2MCPL 3VE0B 4JQIH 3U7WL 4KRPB 3ELAT 4HIIB 5FO9A 1BFOB 2X4NB 3ARDA 1OGTB 4UV4H 1E4KC 3V6ZB 3IDXH 3GSOB 4ODWA 4LCWD 2MMXA 1QRNA 3U0PA 4XNZC 5EB9A 5F1IB 1JTOA 2F9BT 3MV7A 4O2EA 1RUAH 1MHPH 2R0ZL 4XP4H 4GW4B 5TPWL 3RWHB 3EOYG 1MLCA 4RISL 2PKDA 1UA6H 2YZ1A 2YD5A 1WTLA 3ZKXC 4NO3A 5JOPD 1NUFA 4X7TA 2ZNXA 5JPMA 4JFPA 4U1KA 5GRJH 1LQSR 3OKKB 4OGZA 5DD6A 4ORGA 1PSKH 4AQOA 4YHIB 2O61A 5A2IH 4CVXB 1NC2A 4KK8D 3L5JA 1U93A 3KPRA 4ALAL 1KPRA 3CMOL 5D1QA 1A21A 2CRMA 3JTSB 4ZFFB 4BQCA 4EI5C 2JJTC 2P8PA 1BX2A 3UEZA 4HS8H 4UOW1 5CSZA 5FECA 3KXFB 5KTEH 4JO3H 2EDKA 5IJVA 1QRND 2VR9A 1UQSA 4ZXBA 1PEWA 5F3HA 4NQSB 5IMOB 5C0RH 2EIBA 1RZKC 2HRLA 3FRUB 2EIDA 2EDQA 4UDTA 3O6MH 4FG6C 4N0FB 3DUSB 3GMLB 2V2XA 2QJDA 4TSAL 5D7JB 2JCCB 3DTXB 1ZLVK 1GXEA 1JV5B 2OP4L 2D4DA 4X8JB 5AWNL 3X11B 5FGSA 3EHBD 1PY9A 1BD2D 1BEYH 5GGQH 3MJ9L 4Y5VC 2BZDA 3QUZA 4J2XA 1FZKA 5EUOB 2JF1A 4OCSH 2XTJD 4MDJB 4V1DD 2PW2B 3KPRD 3SGEI 3BUYB 4ZPTB 1XF4B 2JCCF 4XCNB 3U1SL 5DD1L 3O4OC 4FFWD 5EU4A 1D5ZB 2EEBA 4LCCC 1J0ZA 5E6IC 4KMQA 1J9CT 1I3GL 4JCLA 2BNRD 5IFHH 1JWSA 4X5XA 1OT2A 1CLYL 1XT5A 5CP3A 2PYEA 4H20L 2WINA 1I7UA 1WC7B 3LQAC 4ZODA 3SKMA 3H2WA 5KZCB 5DJ0A 3G5ZA 4KGLA 5H94B 1DDHB 2BC4B 1RJLA 2ID5A 4YQXH 2LV4A 3NA9L 3TPUA 2W60B 5L2KD 1ZAGA 1YMMD 2EDLA 4PB9H 5IEHB 2E7CA 3ZE0F 4X0KB 1CN4A 4R26L 5EFIB 2YPKB 3AREC 4MNQE 2JJWA 5I18H 2EDOA 2A73B 4R90L 3QZWB 4OBSA 2NXZD 4IS6B 1U8IB 1E6JH 1AKJD 2N7BA 3WO4C 4DGYH 1MCDA 3C08H 4G6AC 2LU4A 3UXFA 3SGKA 3O6KL 4U1MA 5E70A 4IMKC 1IC7L 4TVPD 1GZPB 4YNYA 4XPFH 1WQVT 5L2JB 1LD9A 3IFPB 2FRGP 4G9FD 5E5MA 2ADGA 2D0GA 3FB8B 3KLSA 1VFUA 3H9YA 5CP7A 2X4TA 3EDFA 4W68A 4NQCB 3VFUB 3Q1SL 1MI5A 5DMJB 1T1XB 5FCUH 5HHNA 3L95B 2D9QB 1D7FA 4ZDHB 4G7YH 4ONGL 3QDGB 4RX4A 1IEAA 2Z93B 3MV8B 5D1XA 2VAJA 3BXNA 3VXSB 2YD4A 3QDHA 2WQ8A 4MNHA 3F6IA 4NGHH 4XBGA 5F9JA 2BOBB 3QXDA 4KY1L 1C1EL 1J8HB 2OJZL 5GZOD 1H3UA 1T22A 4NCC2 1CT8A 1DEEB 4HJGA 1UYWH 3P30H 1KJ2A 4LGRB 3MRBB 4U0RB 2YA2A 3MRGA 4DCQB 4BH8B 1MFCH 5I30H 5T1KB 1JZ2A 2RJMA 1QFWL 5I17B 1OOAA 4OIBA 2YEZA 1OARL 1RIVH 1WAAE 4KKAC 1AFVL 2BFVH 5IVXE 2R1WB 2XWBA 3I3DA 3MLVH 4NQVB 3SDDA 4JFFD 1NC4B 1GGUA 5FYKH 2HFEB 2YMXH 4CVZA 1RJYB 2P49B 1WBZB 1I3RA 1WLHA 3GSQB 4N90D 4Y2DC 1W72A 4RX4D 3W0WB 3RI5K 1FE8H 5D1XD 5DT1L 1DJSA 4JN1L 5JDJA 3VD7A 4HAGA 3TT3L 4KRNA 4NZUH 4XNMB 4JKKA 4M7JL 1QR1A 4LHUA 2LAAA 2M26A 1BGXL 3LS5L 2R39A 5MENB 1C16A 3VXOA 5H35A 5CBAA 1NEZA 3L5XH 1KEGH 5EUOE 4BZ1H 2NX5B 1FFOA 4IHOA 5DJDB 2FL5B 4XP5H 5DMIL 1RZJC 3P11L 3MNZB 3PIQB 5CJQL 2BMKA 4O5LL 2AJVL 1EEQA 4R2GC 1KNOB 2APFA 1II4E 3SDDD 1MCSA 5DDHA 2X1XR 2YHGA 1TJGH 4JQIL 4LMQE 1CXLA 5IVXA 4MQXC 3KYOB 5IB1B 3FO1A 3NZ8B 5EZJA 1F6FB 2A6KB 4UV4L 3IDXL 3WO3B 3ULUF 4E9LA 1XGTA 1KTDA 5FB8A 4Y4HD 1BIIA 4CN4A 4YHOH 4L3EA 1RUAL 3LMJH 2JB6B 3NTCH 2FDBP 2SEBB 2ZUSA 4FQHA 1I85A 1XIWA 1NFIA 2WUBH 2WIMA 2W0PA 3UZEA 1X5GA 1OTSC 5IHUH 1UA6L 2Y4SA 4WU7A 1B6DA 3CXHJ 3TO2A 2OL3A 5SWZB 3DX6B 4OLXH 5GRJL 2BSSA 3VH8G 3MRPA 4QYOA 5F1SA 3T0EB 1R3KB 3VFSB 3UPRB 1V3JA 4ZUSB 1QSED 3DUUB 5TH2B 3ZO0A 4QXUH 2VO5A 6CGTA 4S1DD 3C2SA 5J13C 3CC5A 1S7QB 3FT2A 1EMTH 1N0LA 5KTEL 2OTUA 4JO3L 5FYLH 3GJFB 1WWAX 5E9DE 3QXAA 1DQJA 5C0RL 4NKMA 2W9DH 3ZZ1A 2AXHA 4L3ED 1XAUA 4LSUH 4Y4KB 4Z6AT 5DRNB 1IVLA 2BCKA 3P4MB 4PGJA 1UKSA 3O6ML 1A9BB 5FYJU 1JWMA 2FYYA 2YD2A 2NYYD 4I2XA 3RZCB 3JUZA 1FFPB 1UWEH 4R7NA 2DLHA 3LN5B 4XZUB 2X4OB 1BEYL 5GGQL 2Q87A 3I50L 3VXSE 4OCSL 1INEH 12E8L 3TZVA 3ARBA 4LSRL 1T7VA 3IETB 3K8MA 3RIFF 2FNBA 3L9RB 1M7IB 4JFOA 5TQ0H 5F89A 3C60A 2OS7A 1JF1B 5DHYB 2BSTB 4N8PA 2X4RA 5EOCJ 1CFSB 2RB8A 3OR6A 4Z0BH 3DROA 3ZLQC 5CD5D 5T33L 1OSZA 5IFHL 3V5KB 4CN6A 5DYOA 2XICA 4PLOB 3HRZA 5IGXH 1QSFD 1L0XA 2YKLH 3WXVH 4YQXL 3GB7A 1W0WB 2DIAA 4PB9L 3ZKMD 1X3DA 1KT2B 1SY6A 3MUY1 2DLEA 4LLYA 5HGBB 2HLAA 4R0LB 3WV0A 4YBLC 5I18L 5FO8A 3QFJB 1HEZA 5BRZA 2ERJC 4GOSA 3VD3A 1E6JL 3FN0H 1KB9J 4QXTB 3QJFA 4DGYL 1K8DA 3GUTA 3C08L 3HCVB 4GKSA 3CVHB 5DEZA 5K59E 3S9DB 5HHME 1DQQA 5ESQB 2H9GB 3Q2CA 3LDBB 4N68A 4XPFL 3U46B 1OP9A 2VH5H 3X14B 5TDOB 3NIGF 3WLWD 3B9AA 5F7LB 4DKEL 1H3TA 4KGJA 5TF1H 3AS2A 4QRRE 2FHFA 1S7WA 3MV9B 5J11B 2X70B 3MODH 2YOCA 1OGAE 4OV6F 5HXMA 2DKMA 1BMGA 5FCUL 3NIDE 1M05A 3QULA 1TETH 5KN5A 1S78D 2PN5A 4G7YL 4EN3A 5BRZD 4KH2A 3JVGA 1MRCH 2UZXB 1JTPA 4KJYA 4Q6YA 2UV3A 2G60H 4NGHL 4BZYA 3TESA 3WJJA 2Q1EA 2VN4A 2YPLD 4P23A 5DJ2B 5EC1B 1IE5A 4MJ6A 1ZA3A 3GZKA 4WUUA 4YK4B 4ONOA 1G9MC 5T1LD 1MEXH 1UYWL 3P30L 4KKCD 3PWUB 1MLBA 5HHPA 3HRPA 2X1QA 1TVBB 1N59B 5TDNB 5HHMA 1I8IA 1MFCL 1AGDA 4K07A 1RY7B 1RIVL 1L4IA 2ZCLH 3SO5A 4P9HH 2BFVL 3MLVL 7FABH 1FG2B 3TN0D 4EUPB 1OP5H 2PNDA 1UJ3C 4FXKA 3ZE2E 1A6ZA 3TBWA 1DR9A 3HC4H 3QEQA 1F6AA 5FYKL 2LVEA 2YMXL 4X6CB 2PXYC 3X3FH 4LLAA 1G7PB 2VXUH 1TNMA 4WI3A 5ERWA 1FE8L 4Z7UE 5T1DH 3OKYA 4NZUL 2YWZA 1L0QA 3PNWB 4X6CF 3OJDB 5CEYA 2VL4A 1RSFA 5L8KB 1OQXA 4L1DA 2GJZA 1F3DJ 5HI3D 2J1KA 4WFEE 3QWOB 3L5XL 3QO1A 1JTTA 4RMVA 1ZT4B 4HMCA 3OL2A 5DHXB 4BZ1L 4UDUA 4LLDA 3BT2H 1E4WH 1FVEA 2XPGB 4XP5L 1LO0H 3L1OH 2DI7A 1EZVY 4OF8A 3HKFA 5IG7B 2OQJA 4NNYB 1T21A 5IQ9A 2X9YA 5C71A 5KS9E 3IFNH 4J3WA 3T2NL 1TJGL 4HWNA 5D72H 1FAIH 5HY9B 3ABZA 5C0FA 5C08E 3RL2B 3QRGH 1DVFC 3Q6FA 2P8LA 4GBXA 4YFDB 3GJFH 3LMJL 3NTCL 4ZFOA 4MDIA 4C56A 1U92A 1DBKL 3H9ZA 2WUBL 2KZWA 1IL1B 4IM8A 3V79C 1FVDB 4OZIF 5IHUL 2P7TB 1HWHB 3DVFA 4NRYB 3BKYH 4I0PB 2G2RB 1ZHNA 2Y72A 5I1AB 1MJJB 4OLXL 3T8XA 4JQVC 1I1AA 3UPCA 3VMOA 5JW5A 1Q1JH 1Z2KA 3P0YH 1F4AA 2C5DC 4OKVA 1FSKB 5JHDA 3GHBH 1AO7E 2H3NB 4K8RC 5ANME 4QRUB 4YDJB 4KK5D 3O3BA 1QHPA 5KS9A 4N5EC 3MUJA 3TC9A 5EH1A 3BDXA 2J8OA 5FYLL 2FEEL 3S35X 4YDKH 2OK0H 5EG6C 3VRJB 1TCRA 1G7QA 2W9DL 4ZUWB 2QKIB 3D6GA 1OLLA 4KI5D 4LSUL 5C08A 4APQD 4C56D 2ZP0T 4JDVA 1LO3H 4HCRL 4PFEA 5E00B 1G7MB 3BSZL 4PGCA 3PDOA 4FN0A 2DAVA 1UWEL 2W0FB 1A1OB 4J3UA 2ZUUA 4OTXH 2X09A 4Y5XA 4MCYA 5CEXA 3BJLA 2RHEA 5E8OB 5HYJD 2Y6SC 3FO9A 1INEL 5I71C 3QIUA 5F88A 4F33B 1NEZG 3SKNB 1TXKA 3D3VD 5TQ0L 2F74A 4H0IA 4JFZH 3V8OA 3F12B 3LV3B 2P5EA 3ROLA 5CD3A 1YPZF 3DRTA 1VB9A 2D7QA 5ESAA 1KTKE 1HHIA 4Z0BL 1MFDH 3KPNB 3CVHH 4W4OA 3SPVA 1CQKA 3BQUB 3VGGA 4PV9A 2Y9RT 3N1PC 1A1NA 1AHWA 3C5JA 3QDJD 2JK5A 2NNAA 4YUEH 5KSAB 5IB2B 2YC1A 1JI1A 4QRPD 5IGXL 3SCMD 1AGBB 1UACH 2YKLL 5AZ2H 1HIMH 3WXVL 1A7PH 2UWEB 4E5XB 4Z5RB 1EEZA 1CDGA 1S7SA 3K7UA 4KC3B 5I1DB 1GZQA 2DTMH 1CFNB 3I6GB 3VA2C 2A9NH 5D7LA 1JN6A 4NN5C 1RULH 3VXRB 2V17H 2QQLH 1CBVH 1MCQA 5C6PB 2AXGA 3BKCH 1XGQB 2BJMH 3QBTB 3KPMB 4XVUC 4C59B 3IKCB 5C0AE 2P5ED 3D85A 1YJDH 2GJ6B 1PG7W 3RNKA 2HRPH 5TJWK 1KIPA 1TTFA 3HE7B 2A9MH 5MERA 1OF2A 2VKWA 2IADA 4GO6B 2VH5L 4OZHA 4F37F 2QEJA 2AS5M 4IRJA 1KTLA 3RWFA 1ZVHA 1MCIA 3H42L 1AD0A 5TF1L 3MCLH 3DYOA 3KPLA 1I9EA 2AJ3A 1A3QA 2ICEB 3JV4B 4N0YH 5BQ7B 3MODL 4ZO9A 1FIGH 4KJQC 3RX5A 3VXQB 3HZVB 4U3CA 4EUPH 2ED8A 1TETL 2DOCA 3DMMA 1GC1L 3JUYA 2X1WL 3L5WA 4PRIB 3WS6A 1J1PH 2B8OT 3IAPA 5K9KA 1VADB 1WCBA 3SDXB 1MRCL 1T0NB 4CU8A 1YQVH 1CG9A 1A6TA 1JZ4A 2G60L 4U6VH 3CJJA 4P2OC 1QYGH 4AEHL 1NCAH 1XH3B 4U1NA 2Y5EA 4UZGA 1W0VB 4HWEH 3I6KA 1DANT 2R2HB 4U1LB 3ZE1F 5M94B 1XF5B 3EJYC 1P7KA 3X13A 1CD1A 1ERNA 3GK8H 1F6LL 1FJ1B 5IMKB 1KIRA 4IOSD 4P3DB 2NY6C 1Z6JT 1IGTB 4FMKA 2ZCLL 2AEQH 3L6FB 1BIHA 4P9HL 1QQDA 5H2BA 3ULUL 7FABL 4UUJA 1RZIB 1WUNT 3DIFB 3H7BA 1G9EA 4S2SA 1S7XA 3PQYE 5D7SH 3WN5A 4EDXB 4PDCE 1B0GB 4P4KC 4ELMF 2HJKA 3TBYA 3X3FL 4JQXA 1LQVA 5GGTA 4AG4H 3T77A 4PRHD 1OWWA 2BX5A 3WEXB 3EYFB 5GS3A 1RK1A 2D9CA 3RWIB 4JFEE 1NGYA 4H1LB 4FQQB 2Y1VA 1CDYA 3GMOB 1MCHA 5LKNA 1T3FB 4ISVB 2F54B 3VFMB 5IV2A 1T0PB 4WNQB 3BO8A 1C7SA 5MEPA 5IB3B 3K81A 1QHOA 3TJHC 4JHWH 3S37L 3FOLB 2DN7A 4D9LH 1LO0L 1QBBA 3L1OL 3UJJH 2VTFA 3QIWC 1G6RA 5EA0H 3RTQB 5DK2B 3AU1A 5AEAA 1K4CB 2HFTA 5C0GA 3ZHKA 3CIQA 3IFNL 4LMQI 4HC1A 5IBTH 5BOZG 1ZTXH 1IEHA 5D72L 4UBDC 4DW2H 1FAIL 5SWSB 3HI5H 1HHGA 3E6HA 1KC5H 1HILA 1UT9A 5ACLA 4PYGA 3QRGL 4HHAB 4F7TB 5CEZE 1Q9LA 1X4XA 1T89A 1F90H 1UWXH 4L8DB 1CFTA 2UWEE 4Y19D 3UDWA 3IGAB 5HVGB 2I24N 1A6AB 3FQWB 5T1MB 5HYIA 3BKYL 4U6YB 2CR6A 5D1ZD 1HYRC 2NW3A 5I8CB 3DHJA 2NY0D 1Q1JL 4NYLB 3E2HB 1NBYA 3VI4F 1KCSH 3VXTA 4TNWK 3GSUB 2LU3A 1UFUA 5BXFB 5D6CA 2EDWA 2VLKB 3GHBL 2X1PA 5F9WB 4Z18A 1HSAA 5DUML 4OSUH 5ICXB 1B0WA 4PJBE 2ZKHL 1NDGA 5F3BA 3D39E 4YDKL 2IALA 2OK0L 3SKUD 2GSIB 3GSXA 2C26A 3DX9B 3HC0A 1G9NH 4XPBH 4PJXF 2JIXB 5CSBA 1LO3L 4FQIH 3MRDB 1NFDF 2DYPA 4TVSa 4PJFE 5EU6E 4YLQT 4GMTL 4HUWA 5HPMB 1F3RB 3MJ9A 4PBVC 3RPIA 4OTXL 3U36A 4LVOB 2P1YA 4HIEB 2IGFL 4XWGH 4PJ9C 3FTGA 3SDXE 5IVNA 5CJ8A 3HAEG 4AY0A 1W8NA 2NY1D 1JF5A 5ILTH 4RWYL 3SJVA 5ABDE 3Q5OA 2X44D 4OZGA 5F97E 1IM3A 1WT5C 4DN3H 2QL1A 1MFDL 1J10A 1U8QA 3CVHL 1F4HA 1Q94A 2A83A 4PV8A 1A6VH 4D0BA 2RAMA 4D8PB 3L5HA 1L9MA 3MLZH 4YUEL 3IDUA 2DYPD 4ETQB 5DJ8A 4BFGA 1WFTA 4P2RD 1UACL 5AZ2L 1CXKA 1HIML 1A7PL 1MOEA 3H9SA 3NFNB 4MMZC 1DQDH 1ZWIA 1JGLH 4FQXA 4G42B 2DTML 4N0UE 5C0EA 3VA6A 1N8ZB 2A9NL 2IH1B 3AY4A 4N8VB 2Y06H 2DQTH 2VZVA 3VGBA 4XBEH 4UNVA 5F6HJ 4CUCA 2NW2A 4L8BA 5T3XH 4PRBA 2NLJB 3VRIA 1ZGLM 5A3IC 2DLTA 1YN7B 1UZ8B 1CBVL 4P99A 3SJVD 2BJML 1RUPH 1KB5B 4JVUA 4PJ8B 1S5HA 2CDGA 4Z7WA 1A2YB 1Q9WB 4HUNB 3TVMA 3IXAA 3UZVB 1J5OH 1YJDL 1K5NB 4P4RA 2D7PA 3MLTA 1WICA 3F8UB 2HRPL 1RVFH 3ARFB 3LSOA 4JO1H 5AZEH 3PWLB 3WKMH 2A9ML 3RWJB 2VC2L 3DBXA 3ROOA 4XNQA 3AB0C 4AJ0A 1VKXA 3VI3F 2NXYD 3KPSA 3WL9B 3CU1A 3MCLL 4NUJB 1TPXC 5ETUA 2FJFB 1U91B 2IPUG 5MEOA 4M7ZC 2QADB 3H9SD 3BZ4A 4WENB 3MOBH 4C4KT 4X7FC 1FIGL 5FYJH 4OF5A 2IAMA 2PTTB 5CILH 4M03A 4XPHH 1HXYB 2EDHA 3W82A 1D9KD 3LN9A 2ED7A 1JZ8A 4HF5H 4M6NL 3QJHA 1HI6A 3GBNH 3D18B 3FFDB 1J1PL 3IDJB 2OTWA 3QIBC 4C4KO 3D87B 5I76B 3MJ6A 5D6DC 1HHHA 2RR3A 1WWCA 4KK8C 5FUCE 2R4SL 1TFHA 4U6VL 1IM9A 3TVMD 3I02A 3OKLB 1NCAL 4H1LH 1HN1A 1U3HD 6FABH 4XGZB 3ARGA 3H0TB 5D5ME 2GT9B 2A6IB 4DZ8A 3ARDC 5DI8B 4HUUA 2HT2D 3GK8L 3KYNA 5F6HI 3UTSA 4E0RB 3PDDA 1H15B 3N1GC 2EE2A 1P84J 3DVIA 2K7PA 2CKBB 1M7XA 2AEQL 4YHNA 2LTQC 4OF0A 3MQIA 3P73B 1LO4H 4JE4B 4ZTOH 2ESVE 4UQ3B 1DL7H 5D7SL 5A40E 5J56B 4KHTH 4GKNB 4Z0XA 4Z9KB 2R2EA 1QEWB 4AG4L 2DQFB 4NHUB 2GFBB 3EO1B 4YXHH 2APTA 1K3ZA 2FECL 3G6AA 3LQAL 3PWPB 3S36X 3MX0A 5HYSG 4M5YH 3PWNB 4PGBA 2XACC 3GSRB 5EO1A 3DV4B 1FL3A 5D1QC 4DKAA 1CICA 4FXLA 4QHLB 4YXLL 5E99H 3REVA 5FM5O 1NCCH 4X7DC 4C83A 4RIRA 3BEWA 2J6EH 2E27H 3RDTB 4WI7A 2EKJA 1D5BA 4ZXBC 5GGRY 4JHWL 2B7DT 4DAGH 1OY3B 2CRZA 4D9LL 1KGCE 1BOGA 2J88H 2QSVA 3HUJB 3UJJL 3WFEH 1QA9A 5J6GB 2FEDC 4WGVB 5HHOA 5IBTL 5C8JB 1ZTXL 4U7MA 4NQEA 4DW2L 1WEJH 4NQDE 3HI5L 1KC5L 4HAFA 4ZQKB 3HUJF 4LLWA 2H32A 3QUZC 3BYTA 4OUUA 3S3SA 3ULVC 1DN2A 1FZJB 3PG2A 1DBJH 1F90L 4H88H 3MZTA 4LVHC 3AMLA 4ZSOE 1HKLH 3IFOB 4ZUUB 2C3GA 2R0WH 3X12B 2C3VA 4D9QE 1C12A 1OTTC 5I74C 5GGRB 3TNMA 2APBA 3D9AL 4OD1H 5ACZA 1VENA 4UIMB 3MMEB 3DXAD 4YIQA 3H9HB 5J12B 5ICYA 3ZDXE 1KCSL 2NTFA 3QSKB 4L4VB 1BQHB 4WDIB 1X5KA 4JDZB 3VFGH 3L3OB 3OKNB 2AAVA 3TP4A 3ZHDA 3MRJB 1YUHB 4L4TB 4NQDA 1G9NL 3PXJA 3IDYB 1N6VA 4XPBL 4ZOCA 4O2FB 3MRIA 3ILQD 4IJ3B 4FQIL 1PDKA 3PV7A 4PRNA 5D70L 2DMKA 3T4AA 1FH5H 2CLVB 4KUCD 3SGKC 1IAIM 1BZ7A 4M62H 4KJPD 1TVDA 1Z0MA 4KTDH 3BD3A 4XWGL 2XT1B 5C6WH 2NY2C 4S0TD 3LY6A 5I16B 4UU9B 3LD8B 5DFTA 3S4SB 4Y5YB 5ILTL 3O6LH 1WSST 4NQTA 1NGWA 4TOYH 5C0BD 4ZAKB 4Y89A 2QHRH 3T0VA 1KB5H 1OP5K 3LIZH 1BPVA 4NBZB 2CR3A 2BVPB 4DN3L 4JM4H 3VXUB 2PYFB 1KELH 4X6EB 1L7TH 1P6FA 3TH2T 3ZKQD 1LILA 4IRSD 3IS0X 4MXWL 3VW3H 4OCNC 1C08A 5D1XC 3MLWH 3MLZL 2EE9A 2NY4D 5FHBH 5DRWB 3WMSA 3CSYB 4PP8C 1OAUH 1HZHH 4W6XB 1DQDL 4LHQB 4AT6A 4ZOBA 2E8ZA 1JGLL 2VZ1A 5DFVD 5GGUA 1ZHLA 1S7TB 4K3HA 2BDNL 3U2SA 2Y06L 2DQTL 3BISA 4XBEL 5T3XL 1KPUA 2APWA 1KSRA 2AI0H 4K94C 5GS0H 5HYQB 3QQ4B 2X89D 1RUPL 4P2QB 5EU7E 2GHWB 3WHE0 3SDDC 1J5OL 2R1YA 3QPXH 5JQHC 1A7QH 5DJAA 4U3XA 4GKZA 5F6IC 1A7NH 1RVFL 3TNNB 4JO1L 3NFPB 3WKML 1V3KA 1JPFB 1ODAA 2VLRB 2A38A 4NKIH 2GY5A 3V6OE 4X4YB 3RY4A 3GJFK 5JW4N 3IRZA 1HHJB 1KFAL 3EOBA 3RUGB 3MXWH 2CKBH 1ZS8A 4GAYB 3T3ME 3MOBL 3UTQB 2ADJB 5FYJL 5CILL 1F11A 2XY2A 4XPHL 1JZ5A 4PLNC 3DVNB 1VFOA 1T7ZA 4HF5L 3EYOA 3UO1H 3GBNL 3IAGC 3RIFK 4L5FH 1IKNC 1WBXA 4OI8A 3BWAA 4M7KL 1D6EA 4K7PY 1P53A 3DYPA 1A9EA 3RRQA 1UM5H 4L1HA 6FABL 2HJFB 5T3ZE 5BS0B 5DMGC 3V4UH 5FO7A 3DGGA 4PJ5A 2GKIA 3FAXA 1EV2E 1XGRB 5LG1A 5E2UH 2DIBA 4LLVB 1QBLH 4G8GB 4HDIA 3FONB 5JLZA 1Q38A 2CJUH 3ULSA 4MZ3A 1T6VN 3HE6A 3TFKD 4QRSA 2VNCA 3PL6B 1I85C 1XIWC 4NFDA 1KXTB 3V6OA 3KLAB 2VAAB 1T7XA 1ZMYA 1U58A 4OGAC 1LO4L 4K3DH 4ZTOL 1BFOA 5EOTA 4KHTL 3JZ7A 3KDMB 4Q6IB 4BJLA 4NQUA 4GW1B 4L4TE 2CDFB 1BJ8A 1T4KB 3I85A 4J1UA 3GSNL 5F1IA 1Q9OA 4YXHL 5FA3A 4HKJB 4MNQD 4M5YL 1KG0B 1WWBX 2E9BA 1P7HL 2IAND 4FTVD 4NO2B 4UT7H 2X4QB 3MLSH 1H9VA 5E99L 4Z7QE 1NCCL 4U0QB 2OMBA 1DE4A 1KN2L 2J6EL 2E27L 5C6TH 4OFYD 2OR9H 2NY3B 3UTZA 4LEXH 1INQA 3W9EA 3MJ7A 2J88L 4P0DA 4POUB 2B4CC 4S1QH 3WFEL 1I3VA 1P7QB 2IPKB 4KRPD 1EH9A 4ZFFA 1AI1H 5F1NA 3KR3H 3VXUE 1I7ZB 1WEJL 4AH2B 2N4IA 1INDL 1CGYA 3ZKMC 4XNUH 3KXFA 3FN3A 2BP3A 5MHSD 4BK5A 2Z31A 1Z9LA 3OGCB 4RAUB 4NQSA 4UI2A 5IMOA 4RRPA 1ZGLP 2CQVA 3KYMB 1C7TA 1DBJL 3FRUA 4H88L 3TZVC 2FJHB 3ARBC 5EO9A 4N0FA 3MOQA 4R3SB 3DUSA 3GMLA 3U7AA 1HKLL 3UTTE 2R0WL 4GG6F 2WZPD 4YFEA 1CDBA 4HKBA 5D7JA 2JCCA 3LKPB 5DVMA 3DTXA 1JV5A 4OD1L 4X8JA 4WIQA 5CIPB 2DI8A 2PO6D 3FT3B 3VD4A 1MWAH 2W9LA 4GAGH 2VDRL 4K9EC 4OGYH 2DLGA 3WLWC 1H5BA 1JJUA 1HQ4A 4OLZH 3BUYA 4ZPTA 3S3PA 1XF4A 4MA3A 3QRFM 2LE9A 2PR4H 3IKKA 3FFCE 1D5ZA 3G5VA 4LDEB 2UVFA 2BRQA 5I1CH 5EPMB 3KXFD 1KBGL 5EBMA 2VR5A 2VLRE 3B83A 4ZUTB 1NGPH 4HCRA 2MWCA 1R3LB 5IUSA 2R23B 1S78C 4YPGA 3U79A 1WC7A 3TV3L 4MVBD 3L3JB 3RUGE 2P24B 5IOPA 3GHEL 1DDHA 1AC6A 1NUDA 2BC4A 4L8SB 1RZ8A 3LKSB 2HJLA 2W60A 4X4ME 3WNKA 1FH5L 3NMEA 5IEHA 1J87A 5FM4A 2MQCA 4X0KA 4JFXB 3MGOB 4RSVA 4M62L 4HT1H 2YPKA 4KTDL 3B8SA 5E4IA 2A73A 4K71B 3QZWA 2FBJL 4IS6A 3WLBB 3O6LL 4TOYL 2QHRL 3V95A 5I9QB 3LIZL 3DETC 3QNZB 4JM4L 5C0DB 4KI1A 4YO0B 1GZPA 3RP1A 4RMUA 1KELL 1UCBH 1YEEH 1Y0LA 3TT1L 1QUNA 5L2JA 1L7TL 4J4PA 3M45A 4CDHA 5C07E 1J1OH 5DUPH 4EN3C 5DD5L 1JP5A 1D3CA 3VW3L 1T5XB 3JVGC 3MLWL 1OPGL 5KZCD 3NH7H 5FHBL 5E8EA 3WJJC 1CE1H 4P23C 4U6HB 3LB6C 1BD2B 1TMCB 1QLFB 5I66B 1OAUL 1X5LA 3BP7A 4NQCA 8FABB 3MCG1 4AM0B 2XTJB 5HI3C 1T1XA 3GEWB 4XBPA 3QPQD 4G7VH 35C8H 1MH5B 3L95A 5JDSB 4LIQH 3AAZB 4ZDHA 4PGDB 4ZS6D 1U8PB 2Z93A 3MV8A 4MD0A 2BNUB 2AI0L 1IAOA 5HDLA 5GS0L 2BNRB 1J8HA 4BK4A 2K7QA 3IDMB 4M1CD 2CRYA 1A7QL 2Z4QB 2FHCA 3OXRA 3UTPE 4XP9H 4H25B 3JWDC 4JN2B 4NKIL 5T1KA 5I17A 4DKFH 2QQQA 3PXHA 1Z9SA 5L2KB 3A67H 2CK0H 5C07A 1YMMB 4K8RL 1UWXK 5E2JA 2R1WA 3MXWL 3RBGA 2CKBL 1FG9C 2CSPA 3MLRH 2HFEA 1CVSC 2R69H 4KRMB 1YEKH 4LDOB 2NXZB 3UO1L 3GSQA 1KF9B 1AKJB 1YYLH 3QDGD 4LLQB 3REWB 3W0WA 2JB5H 4MGXA 1D5XA 4K7PH 5J0BA 2V5SA 3VXSD 4Q9BA 3ZKXB 4RQQA 1BJ1H 3K4ZA 1T04A 1YQ2A 5ISZB 1AGCA 1J7VR 3OBAA 1UM5L 5GRZA 5MENA 3DYMA 3V4UL 4ZYKA 2YR3A 5E2UL 1VFAB 5JIKA 1QBLL 4PP1D 5DJDA 3SKOB 2UY7A 2FL5A 4GBXC 4HPOH 5E2TH 4EI5B 3MNZA 2CJUL 3PIQA 4QRTA 4KI5C 1XFPA 2H6PB 1KNOA 1RIUH 2QTEA 2VLME 1NC4D 3T08A 4K3DL 2DJSA 2I9LB 4QHMA 2NPLX 5IB1A 3NZ8A 5DK3A 4KPHH 3S96B 2WBJD 2A6KA 3MRKA 4JM2B 1IFHL 1BLNB 1RD6A 4GJTB 1I1AC 1XCQA 4TTDD 5HHXH 5F7NC 2JB6A 1NUNB 3C2AL 5HDBE 2SEBA 3EJZD 3G04A 1BQLH 4F37K 4M6ML 4UT7L 1A8JH 1P2CB 3MLSL 3GIVB 2Q6WB 5SWZA 2NX5D 3QUMB 2JELH 4PR5B 2OR9L 5CIPH 4M5ZH 4LEXL 3VCLB 3C5SB 3T0EA 1I1YB 3VFSA 4X7SH 3UPRA 4LKXB 4ZUSA 1NCUA 3I75A 4QRRD 5TH2A 4Z95H 5GQBA 3KPPB 1AI1L 1O7SA 1OGAD 1S7QA 1L9NA 2IH3B 4XNUL 2I9TB 2Z0BA 3DX8B 2X2YA 3GJFA 2HG5B 5F96H 2DIJA 2O5ZH 3UBXA 4UINH 2ZPKL 1H8OA 2DJUA 2Y5TB 4ODTL 4KROD 4LOUC 3P4MA 3QIUC 4YZFE 4GS7C 4HEPG 1A9BA 5A1AA 3NCYP 3AREB 3P77B 1NMCC 2WBKA 3RZCA 4F7MB 1FFPA 1EO5A 1MUJB 3MRFB 3LN5A 4XRCB 2X4OA 1MWAL 4GAGL 4QHKJ 4W4OC 5L7XL 4OGYL 3ESVF 1FIEA 3E3QE 2DRUA 3LN4B 3DURB 5C0ND 1AHWC 5IFAH 4ZFZB 3WIFB 4KKNA 3D0LB 3IETA 3O4LE 3L9RA 3SDCB 2E3VA 4WHTB 3O41B 1JF1A 5DHYA 3QI9D 4P2CG 5J57B 2BSTA 3B2VH 4E41E 5K93A 4TQEH 1WBYB 4MCZB 5I1CL 3AS1A 1CD8A 5JORB 4Y4HB 1CFSA 1A6WH 3CXDH 1VFBA 2A2QT 3HNSL 1NGPL 4Y16A 4Y4KD 1NGXB 1X5XA 1NBZB 2EDFA 3CNKA 5SX4I 4HUXB 1MJUH 4JRWA 1H3VA 1AXTH 4LBEB 1UGNA 1OD7A 4YBHA 2IQAB 2D03H 3BPCB 1KT2A 1DP0A 3VFVB 4HT1L 3SEPA 5EBWB 4I9WE 4IRJC 1UM4H 5EULV 2XA3A 3OR7B 5E7FA 2J8UF 3QFJA 3P3YA 3LEXB 1UWGH 5F7UA 5IT2H 2K1MA 5HHVH 5CGYD 4XTRD 2VIRA 3IRPX 4X4ZA 3EYVB 4UAOB 3VGAC 3DJ9A 3O4LA 2O93L 2WUCH 1NCWH 3CVHA 3IU4H 2P46B 5ESQA 3N1MC 1UCBL 3CGTA 1YEEL 3U46A 3DMMC 1OLZA 5DWUH 5TDOA 5BZDA 3WS6C 1BQHG 1J1OL 3HG1E 3KPOB 4NO5B 5DUPL 5LQBH 4XI5C 1BM3H 4WO4B 2H8PB 1A7OH 2ZCKH 4P5MB 1VACA 3NH7L 2C3XA 1UJTA 4MQ7B 3TIEB 1CE1L 1J12A 3F7VB 1T66D 3MV9A 1BBDH 4RRPG 1JPST 5EN2B 5FF6A 3ARYA 2J5LB 1EEYB 3LH2H 5E8NB 4FFVD 5B3JE 3TYFB 4G7VL 35C8L 3IXTB 4LIQL 3QFJD 1RV6X 4HS6A 3U30B 1JNNH 3GSWB 4WFGD 3MA9H 1WIPA 3MLXH 1FBIH 3AGVA 1ZEAH 5DJYB 5DJ2A 5EC1A 3T09A 3TO4D 2R15A 1AO7D 1MJ8H 3HPLB 1GYAA 1UVQB 4CN1A 3WN5C 4YGVB 2BY2A 4D0CB 5EO0B 1JGVH 2E9JA 4OFIA 3PWUA 4QEGA 4URTB 3U9UB 1B88A 1S7UB 1N59A 5TDNA 1CTOA 5FOJA 2OZ4L 4GRWF 4KZEH 4DKFL 1QSFB 4JHBA 3PABB 1J05B 1QACA 2ARJA 4LLUB 3A67L 2CK0L 1BZ9B 2HLFC 4PS4H 4ODXB 3D25A 4WW1B 4TRPH 3LPFA 2AK4B 2F53B 2RCSH 2UZYB 4OZIE 1S8DB 3MLRL 4PG2A 3RNQB 4X6CA 1YEKL 3GFUA 1B2WH 1G7PA 3NAAH 5SWQB 1YYLL 2JB5L 1CDCA 4K7PL 2P5WB 2RFXB 1YNKH 5F7FA 2DQIH 4PD4K 3OZ9H 3OJDA 3O3UN 4BFEA 2ICWB 3QP3A 1N2RA 4PJ7F 3QWOA 4J3VA 2H2PD 3BGMB 5D7IB 1F3JB 1FN4B 1P4BL 2XPGA 4HPOL 4OCXH 5E2TL 3QUMH 3BPNC 4Z7VB 1ZVSB 2KZ1B 4LCCA 3I3BA 1RIUL 1HH6B 4JLRA 5IG7A 4NNYA 4DTGH 2J8HA 4K3GA 4NFCA 5L8LB 4V3EB 4L9LC 5DQJB 5D7IF 2ATPB 5HY9A 4NBXB 4PJHF 2Q76B 2AEIT 2CLRB 4Z7VF 4OZIA 4X9GA 2EYRB 1BF8A 2ZG1A 3RL2A 1CGUA 3ZDYE 2YPLB 5HHXL 4XXDA 1XEDA 3NACH 3LKQB 3MACL 2E6PA 4DZBA 2VUYA 5LWYH 5EU5B 3AMKA 3WNMA 1V8HA 1BQLL 1IL1A 3N1QC 4ONFH 1FVDA 1C8PA 2P7TA 5FIEA 4NRYA 3WHE1 1FHGA 4I0PA 3WNPA 2AP2A 3BP6A 5IB4B 2LU7A 1CE6B 4IRZH 5AD0A 2JELL 3PWVB 4LAJH 5EBLB 3TN0B 3HI1A 4X7SL 1L6ZA 3PWJB 1LEGB 2HYMA 5KSBF 4FS0A 5I2IA 2FH8A 2IQ9H 3EW3B 4KJWD 4Z95L 4A6YB 3O0RH 4QRUA 2MJWA 1F97A 3BVNB 4XCEB 4B50A 4M7LH 5F96L 1KTRL 3BN9C 3VRJA 3B5GA 2O5ZL 5I1KH 4RAVA 4UINL 4ZUWA 3ZYJA 2QKIA 3QQ9D 4N5UA 3RVUD 1WJ3A 5E00A 1G7MA 5E8PB 3EDDA 3U4EA 1P4LA 4YBLB 4QOKE 4H8WL 1A47A 2W0FA 1A1OA 1AD9B 2EDXA 1ZA6B 4U05A 5E8OA 1VEMA 2VABB 1YPZA 4U7SA 4PTUB 2JJVA 4JG1H 5DJZA 2AJYH 3BP5B 5IFAL 1NCDH 3EGSB 1R3JB 4NZJA 1JRHH 1JK8B 4F33A 4F7EB 5C09B 4M61B 3SKNA 4AEFA 2X4UB 3WYRA 3MNWB 2HT3C 5C9JA 5HI4D 4TQEL 4FQXC 2HT4D 2IG2H 1J0YA 3PQYD 3CXDL 1A6WL 3NGBC 4JJHA 1JI2A 2FJGB 3LEYL 3AY4C 5FEBA 5F1KC 4LVNC 5JOFB 4WRLA 1IARB 5DMYA 2CMRL 5DJCB 3VG9C 1MJUL 5KSAA 5IB2A 5IW3A 2F53E 3B5HA 1I8MB 1F45A 1FNAA 2WWMC 5DRZA 3TVMC 3P0VH 4Z5RA 2CIKB 3FZUD 3MXVH 4E5XA 2E7LA 2O26U 4Y2DA 1U3HC 2DQDH 2CIIB 1FCCA 2D03L 1CFNA 3I6GA 4HX1A 2P5WE 1V7NH 5BZWB 4PTTA 3BESR 1CXHA 1UM4L 1HDMB 3BIAX 3JV6B 4JRXE 4UT6H 1UWGL 5IT2L 4MXQD 1XGQA 5HHVL 1I7TB 1QFWM 1X5ZA 3RGVD 3AXLB 1M6OA 2Z9TA 5L6YH 1U95B 4LCIH 2GJ6A 3STZB 1XF2B 1OAXH 1NCWL 1CI5A 3IU4L 4X6BA 3GSVB 1QLRB 3BHBB 3BQUD 2G5BB 1T1ZA 2EH8H 4ZOAA 5DWUL 5FXCH 3ZHLA 4JY5L 4JFHD 5CEZD 1CU4H 3QCTL 5KSAD 2XNAB 1A7OL 2ZCKL 4LP5A 3QG6A 2XFXB 4O02H 5BQ7A 4Z7OE 4YBQD 3UBXG 4HG4K 1BBDL 5DJ6B 3IU3B 1NKRA 2D3VA 3DSFH 3LH2L 1N7MH 4OZFB 2XRAH 2XN9E 3D3VB 4MLSA 4IOFD 3VFOB 4MA8H 3VXRD 1KJMB 1JNNL 4NJAH 4RZCB 3TBVB 3BKJL 5CCKL 5D2LF 2DF3A 3MA9L 3MLXL 1I75A 1FBIL 1T1YB 1ZEAL 4R97C 3CDYA 4FFZH 2GJ6D 5BJTB 1W0VA 3MBED 1MJ8L 2XZCH 4AK1A 5F70A 1NAMB 1XF5A 4TVPL 5D9SA 5HVHC 3HE7D 1JGVL 3IDNB 5CZXD 4QRPB 5IMKA 1BBJA 1F5WA 2YN3A 4AIZB 5BVJB 4GLRI 4YH6A 1U6AH 4ELMA 3HC3H 1X6NA 4P3DA 4UQ2A 1Q72L 1IGTA 2B5IB 4PS4L 1PYWB 2Q8AH 1DVFB 1LP9B 4P9ML 4TRPL 4BQBA 1RZIA 1CICC 2VLJE 3DIFA 5EU6D 3TBTB 1N6UA 2F5AH 5D71H 3CFKA 3CSBA 3GKWH 4P46B 3EBAA 1B2WL 3NAAL 3MRMA 4PRID 3WUWB 3AVEA 3BDBA 2VLLB 1LP9F 3RWIA 1JNLH 4FQQA 2DQIL 3GMOA 1EO7A 2FR4A 2IJ0C 4Y4FB 2HFGH 2UYLA 1T3FA 3OZ9L 4ISVA 4S11A 4EBQH 5GGVY 1TZIB 5DMKB 1H0DB 1LNUB 2YD3A 4WNQA 1HCFX 2Q3AA 3S8WA 4AEEA 3T2PA 5IB3A 1CLOL 1E4XI 1RUKH 3QEUA 3W9DB 2EDEA 3QUML 4NJ9L 5C09E 4GG8A 1N64H 4JY6B 5FYJD 5ID1B 3ZDZE 2V2TB 1K4CA 1LO2L 2V9QA 5IKCA 4PJDE 4PY7B 4ZO7A 1OVZA 4BSWB 3AUVA 5KG9A 2VQ1B 1BZQK 2AV7B 4LSDA 4DOHE 1RHHB 4JFDE 5SWSA 3UBXI 3GSNA 3M1BB 4A6YH 2VLJA 1QKZH 1CIDA 5J9PB 4HHAA 4F7TA 4OFKA 3HZMB 1SJHB 4R6UA 1VA9A 3NACL 1LMKA 4L8DA 4XMLH 5LWYL 4M48H 1RJZB 2F54D 1U42A 4EDWH 1HKFA 4ONFL 2C1PB 3K2MC 2PW1B 5HBBA 3VWKD 3C6SB 1NJ9A 5AUMB 3ARUA 4IRZL 2M1KA 5I8CA 5I1LB 1NLDH 1UXSA 3VXPB 2GITB 1XR8B 2MCG1 3BZEB 2EEDA 4M6OH 3RTQD 4NYLA 3E2HA 3MFFB 2BNQB 3V6BR 3V8CA 3GSUA 2XA8H 5BXFA 3WE6B 3ISWA 4ELKB 2IQ9L 4PJXA 3O0RL 3EDKA 5I8OH 3QQ3A 4F9LA 1JGEB 1F13A 2P8MB 4PRHB 1EXUA 5SWSD 4PJAB 3PHSA 5ICXA 3RWGB 2HFFA 1NFDA 4PRPE 3RVXC 4M7LL 2GSIA 4JFDA 1TCMA 4W6YB 5I1KL 3UCRA 3NCMA 5F71A 2VDLH 1I3UA 4KTEH 4M00A 2JIXA 1ADQL 3EZ8A 3NPSC 2YZ8A 3MRDA 3O2DH 4PJAF 1ACZA 5E8DL 1UEMA 4X9HA 5GZND 5HPMA 3KVQA 5DZNA 5HGDB 5C0CB 2PF6A 1GL4B 2AJYL 1LK3H 1NCDL 3NFSL 2VXVH 3QEHB 5LAXB 3GGWB 5FCSH 3GMMB 2VLKD 5CBEB 4QHUA 1FVCB 5BCAA 2IG2L 4KAQH 4PRPA 4GRLD 3S98A 1MJ7L 3P9LB 4LAQH 4Y2OA 1QSVA 5TDPB 4D8PA 4YHMH 1V05A 1T0MB 5T5NG 4CKVX 4NWUH 1G7JB 1WFNA 1UM6H 2NY0B 3KJ4B 3QR2A 5F7DB 4U1HB 4N8VA 3QDME 1V7NL 4OD3L 2DM2A 2VZ3A 4MSWB 1YC8A 2W91A 4OZFH 1KGCD 1YN7A 3O3EA 4UT6L 3B9KB 3T65B 3CFDB 3HR5A 5D93B 1Q9WA 2APVA 5L6YL 4LCIL 1K5NA 3P9MB 4JZJB 2NY6B 5E4EB 3ARFA 3IJSB 3WXWL 3PWLA 2BHYA 3QWRA 2X5PA 4EJ1C 4H0GA 1NAMH 2VE6B 4EQ3A 1RIHH 2EH8L 4NRXA 4WWKB 4OBRA 5CJ5A 3SKJH 3MR9B 1X5AA 2YUXA 4PY8I 4NKOA 3WL9A 3BGFC 4NUJA 2EZ0C 3OAZH 2FJFA 4O02L 3FB7A 3O45B 4JO2H 2G75A 2DM3A 3LKOA 4D9QD 2R0KH 3QUXD 5GSRB 1HXYA 2CRIA 3DSFL 2A6JA 4LFHG 4NFBA 1N7ML 3ZMRA 3D18A 4FQ1H 2XRAL 3IDJA 4MA8L 3VG0H 1JNHB 5I76A 4NJAL 3FQRA 1S9YB 1QO3B 4PJ8D 1WTGT 4IOIA 1U8KB 3OKLA 4FFZL 4ZO6A 3GRWH 4BM7A 1DTUA 4LGSB 4XGZA 5JQ6H 2H2SC 3V5DB 4KRPC 4JQVA 5GSVA 4YEEA 1TJHH 1CFVH 2BVQB 3T1WA 4P5TB 3JV5A 4D9RD 2OCFD 2QHLA 3NCYS 4JHAH 3VWJD 5AYQA 1U6AL 2EDDA 4E0RA 3HC3L 5JXEA 5KJRL 1W8OA 3G6JF 2CKBA 4MAYD 2VZSA 2QADD 1GGBL 4WW2B 1FLRH 2FECI 4NNPH 3D69B 4XH2A 4UQ3A 3IJYB 5D71L 3ZTJH 5HD8D 3GKWL 2BVOB 4MA1B 5IM7B 1LEKA 5I73B 5C1MB 2VITB 1QEWA 2DQFA 4NHUA 2GFBA 5GIRB 2ZZUT 3EO1A 1CD9B 5E6YA 3PWPA 4WW2F 2IBZX 4RGNC 3SGEH 5BMFH 1JNLL 2L7UA 5A2FA 5GGVH 3WIHL 3T04D 2HFGL 2VISB 1AP2B 3DV4A 3BKML 1RZGB 3QUYA 2WAHA 4EBQL 2BOCB 4QHLA 4CRPA 3AROA 4G3YH 1T5WB 1FYTE 2KL6A 2NXYB 1MHEA 3LQMA 5JZ7D 1RUKL 4AYFA 1X7QB 4KHXH 4NWTH 4J12A 3HUJA 3QFDA 3R8BB 4ERSH 1N64L 2ZOLA 1FFNA 2ATKB 1D9KB 5J6GA 3VXME 3M17B 5D7JC 5C8JA 3L3HB 1K6QH 4PJCF 1QKZL 4ZQKA 1V5JA 3MV01 2W92A 1LK2B 3E6FA 1CFQA 4L3AA 1UZ6F 1DUZB 5CHNB 5K9JH 1FZJA 3BX7C 4Q74A 3P2TA 1FYHB 4BUGA 4EIGB 1NMBH 3V0WH 4XMLL 5I8EA 4M48L 3IFOA 2NMSA 1LDPH 5B4MC 1HXMB 3MO1B 4W70A 5GGRA 3M07A 4EDWL 4J8RB 1KCRL 2DLFH 2ADIB 3MRCB 2AW2A 1B0RB 3RDTD 2HTKD 3MMEA 3KLHC 2VZOA 1R3HB 2UVEA 2GYSA 4WFFD 5KVDH 3C8DA 3H9HA 3GKZA 4N0CD 4DEPB 5DVLA 4M6OL 3WS3B 1WISA 3GJEB 1MFAH 2XA8L 3O3AB 5EUKB 4L4VA 4WDIA 1ZT7B 3B3IB 4ZTPH 3PE9A 5I8OL 3L3OA 5GRUH 3LQZB 3JWDL 2IFFH 3VGFA 4CGTA 3ARZA 1R5WB 3U0TB 5DURD 3PJSB 4TPRH 7CGTA 3VH8B 3QPQC 3HZYB 4HFWB 5B38G 2C1OB 1GCFA 4X98B 1MAKA 2J12B 1UC6A 4BQ6A 4O2FA 4ZS6C 3BRGC 4KTEL 5J3HC 1KYOJ 5FGCB 4LKCB 4Y1AB 3O2DL 4L8CB 1EJ6A 4YDIL 1YZZA 3BIKB 2BERA 1ZSDB 5T3ZD 1MWAA 4WUKH 3NCCB 4GKOA 3MBXH 3HZKA 4J4PC 4F2MB 5E5UB 3TIDB 2R29H 2PCPA 1LK3L 3WJLC 5HGHB 4UU9A 3KJ6H 1G1CA 2VXVL 3S4SA 4Y5YA 1IAKB 3K4DA 4L4VD 1ONQA 4ZAKA 4NC1C 1K3IA 1FRGH 3I84A 2XZZA 3J7HA 2BVPA 4KAQL 1CVRA 3BN3B 3HS0A 1TPXB 1CLCA 4L4TD 1HSBB 2YRLA 3DV6B 3U0WH 1ZGLB 3TCLA 4YHML 3VRLF 4NN6B 2ZJSH 4NWUL 3CSYA 5DEFB 5D2NA 3DXAB 4S0UC 2ORBH 3G5XA 1S7TA 1F4XH 3RAJH 5HYFA 2CO6B 2VDPH 4MJIE 2FHBA 4D94A 5FO9B 5A16B 3CFJB 4ODWB 4P2QA 4RFOH 4ZAKD 2VDOH 5IHLB 3MV7B 1FAKT 1F4YL 1GC1C 3TNNA 4WV1B 3VXUD 3QIWA 4FFYH 3SO3B 4HIHA 1NAML 1RIHL 4Z7NE 1DQMH 4DK3A 4KKBD 3SKJL 1S7RA 4TTDC 4X4YA 2L7JA 2CKNA 1G7HB 1CGVA 1E6OH 1HHJA 2GSGB 4X7TB 4E42A 4U1KB 3EJZC 4JO2L 4GAYA 3SDAD 3UTTD 4L29A 3CUPB 4ORGB 5DD6B 1JVKA 2ADJA 4DFIA 1QBAA 2R0KL 1IGCH 1AE6H 5F9DC 3GDBA 3CDFA 4DVBB 4HGWB 1PKQE 1KPRB 5K33A 1MREH 4FQ1L 4KUCF 4P9HC 3VG0L 3OF6A 2P8PB 1BX2B 3ULUC 1L8JA 3ZTNH 1PG7H 5FECB 1Y18B 3PV6B 3WNOA 1UEYA 1UQSB 3HMWH 1NAKH 5F3HB 3GRWL 5JQ6L 5BS0A 3FFCD 3WIIH 4G5ZH 4MB5A 4JRYE 4Q7DA 4IRSB 3QT2A 2WSKA 1CFVL 4UDTB 2OZ4A 1NMAH 1XGRA 4H5SB 2VLRD 5EU3B 2V2XB 4LLVA 4U7KA 4ZO8A 4QNPE 2NY4B 4G8GA 1KV3A 4JHAL 1A4JB 3WDHA 2AGJH 4I3RH 1DANU 2ITCA 2BXZA 3RWCB 3TGXA 3TF7A 3MROB 2V5RA 2VAAA 3KLAA 4YDVB 1FZKB 2GQHA 1FLRL 4NNPL 4PG9B 1GGTA 1CWVA 1IRAY 1T2JA 3KDMA 4Q6IA 4WTZA 4GW1A 4XCYA 2CDFA 2CH8A 5EU4B 3T3PE 4HKJA 3T0EC 4Y1AE 1CR9H 1RHFA 5HHQA 5BMFL 2FX8H 1XF3B 2DWDA 2ZUWA 4QHNA 1JWSB 4XX1E 1BAFH 3K1DA 4HSQA 1EFXA 3MUGA 4PLJC 2EXYD 2PYEB 3C5ZD 2A74B 4NP4H 1I7UB 4NKDA 3SKMB 1J0IA 3G5ZB 4DUXA 1RJLB 3GM0A 4PUBH 4X4XA 1TENA 3WFDH 3VFTB 4OQ1A 5TF0A 4KHXL 4JKPH 4Y4KC 4G43B 4FQJH 1R5IB 3PL6D 5EZLA 3EYQC 2PTUA 2YWYA 1P7QA 3AFLA 1RQ5A 2IPKA 3E0GA 3RZCC 1WIOA 1K6QL 1I7ZA 1YNLH 2R9HC 4O51B 3EFDH 4GG6A 3O9WD 1NEUA 3OGCA 1OTUD 4RAUA 5EC2B 2Z91A 5K9JL 4QT5B 2NY5H 3FRPA 4U6XB 3BW9B 4CNIB 1NMBL 2FJHA 5KBNC 2GUOB 3V0WL 2FX7H 4PJIE 4XTRC 3MPCA 2DICA 4MWFB 5E5MB 1JIBA 2ADGB 1NUGA 3LKPA 3MJ8B 4G6JH 1N5AB 5CIPA 4ZFGH 3WCYA 4LRNH 3UTPD 2NY3D 3X3GL 3TLRA 1MF2H 2X4TB 5KVDL 2X9XA 1QZ1A 1QRNE 3WD5H 1P7QD 1MFAL 4WY7H 3MV7E 5SV4A 4LCWA 4ZTPL 4YR6B 1JHLH 5GRUL 1IEAB 4I13B 5EOCH 5ITFB 1YECH 5EPMA 1OM3H 2IFFL 5B8CB 5E03A 1EGJH 4MNHB 4RBPK 4XBGB 4TPRL 2EDJA 1A6PA 2FATH 2VRAA 1ZVYA 4JHZA 4ZUTA 2ZNWA 1CZ8H 1T22B 2R23A 2QR0B 4HXAH 1KCLA 3UX9B 4LCYA 3L3JA 2P24A 1KJ2B 3L3IB 1IGML 3MRGB 1KACB 4L8SA 4V1DE 1Q8MA 3KPRE 3HPJB 2YEZB 4WUKL 5KOVC 3MBXL 3D2UD 4YX2H 1Z3GH 5D6DA 4PREB 3LDBC 4NT6B 1JPGB 3EAKA 1J11A 2R29L 3QH3A 4D3CH 1BVKA 3KJ6L 1HYSD 3WLBA 4Q9CA 1M7DB 3VDBA 5EWIH 5J11C 3GMRA 1W72B 2VLMD 1MHCB 1U8NA 1FRGL 4YHYB 3QNZA 4K7PX 5C0DA 4YO0A 1QR1B 3STLB 3AS3A 2XQYG 2I27N 1AGEB 3U0WL 2V6HA 3OGOE 3S3JA 3VXOB 5CBAB 1YJDC 1NDMA 1ZE3C 1NEZB 3ULVE 4U6HA 2PO6B 1BD2A 1S9VA 3RKDD 1XGUB 1QLFA 5I66A 4QY8B 8FABA 1HOCA 4HS3A 2VKXA 5KSVA 4YK4C 4V1DA 2ORBL 4ORZC 1F4XL 3RAJL 2ZUVA 2VDPL 4TUKH 1MH5A 2H2PC 3HNVH 4PLKC 4PGDA 1YDPB 1U8PA 5IVXB 2EDNA 2BNUA 5I8KH 5EZJB 1I9IH 3EYUH 3MLUH 3RVWD 2PYEE 1F2QA 4RFOL 4G9FE 4XAWH 2VDOL 2BNRA 1J8KA 5FB8B 3EDEA 3MNVA 2Z4QA 2VWEC 1MAML 5BW7A 4PG2C 1WAAF 1MFEH 2ZUQC 5FM8A 4ODVH 4FQHB 4FFYL 1NSNH 1XIWB 3TPUE 4H25A 4MHHI 1ROWA 4JN2A 5FA4A 1VDGA 3HMXH 2X42A 5L2KA 2E9IA 1E6OL 1YMMA 1FL6A 3UJIH 3AM8A 5DTFB 1A22B 2I5YH 1KJVA 4LARL 3IF1A 2X9WA 1IGCL 3QWQB 2Q86B 1AE6L 3ULVH 1WGOA 1T83A 4YAQB 2C4FU 3C6LD 1MREL 3GIZH 3REWA 1AKJA 3BGAA 4LLQA 3S36L 4B5EA 1FNHA 3BD4A 4NPYB 3CC5B 1KLGA 5GRVL 1PY4A 4N1CA 3ZTNL 1ZLUK 3FT2B 1PG7L 5EUOF 2OTUB 1FZMB 1XGYH 3QXAB 1U2CA 3HMWL 1NAKL 8CGTA 1DQJB 3WIIL 4RFEB 4E41D 4G5ZL 1F3DH 2BCKB 1QVOA 4G9FA 5ADPH 5FM5M 5CP3H 1NMAL 4XCCL 3IDGB 4JFFE 1JWMB 3SKOA 1UKQA 1MI5E 1X5FA 3MLPA 2XG4A 3L3KB 2AGJL 2H6PA 4I3RL 2E5EA 3QQ9C 4OV5A 2XY1A 2R56H 1A0QH 3RVUC 1U9KA 2I9LA 2Z8SA 4NQXA 4JGJA 2QBWA 4I77H 4I0PC 5CJOL 3EFFB 3S96A 5JNYB 2RBLA 3I9GH 5FKAB 5ITBH 1J18A 3C60B 1MCOH 1BLNA 5H8DA 4CMMB 5AG9A 4QTIH 2X4RB 1LE5A 1CR9L 2A77L 3OR6B 2FX8L 5ISZD 1FORH 1FSKC 1RZFH 4GAJH 1BAFL 4J7RA 5CINH 5E9DB 4NP4L 1P2CA 5F7EH 2ZG2A 3GIVA 3NVQA 3H8NA 3FMGH 5DYOB 4EVNB 4Q97A 3QUMA 3HRZB 1ZANH 4PR5A 4PUBL 4EI5D 2A1WH 3WFDL 3VCLA 3C5SA 3GB7B 4GW5A 4JKPL 3HG1D 4JFFA 1JYXA 2GTZA 1SJVA 4LKXA 2KPNA 1WVZA 4GT7A 2AJSH 3LS4H 1I4FA 4LLYB 2GCYA 3QB7C 1H8NA 2HLAB 3KPPA 3FZUC 1MCCA 4F15B 1YNLL 3EFDL 2IH3A 1K4DB 3I3EA 3DVGB 3FB6A 4JM2D 2I9TA 1U8HA 4J3TA 2HG5A 4NIKB 1K8DB 3I6LE 3S34H 2NY5L 3ARQA 2YS4A 2J8UE 1RZ7H 2FX7L 3BMVA 4NSKA 3TH4T 1KJ2H 1CGWA 3P77A 1I1CA 4NNXA 1QSZA 4FNLH 1X5IA 4OFPA 1QSEE 5HTSA 1CGSH 4G6JL 3MRFA 2QLVB 1G9NC 4ZFGL 3V4VH 4LRNL 1S7WB 5CMAB 5ENWA 1JMZA 3BQUC 1N3NA 3FQTB 4MB3A 2UUDH 3LN4A 3DURA 4ZFZA 3WIFA 5IR1B 4Q9RL 3D0LA 5KSAC 3WD5L 5K9QG 2IC2A 4WY7L 3QULB 3OAZK 4YC2B 3O41A 2WBJB 4M93C 4L3EE 5FV2A 2E7LC 4YBQC 3OMZA 5LCVH 1DBAH 1JHLL 1WBYA 2V5YA 4MCZA 5EOCL 5FHAH 5JORA 1YECL 2VL5A 4Y4HA 1OM3L 4KJYB 5DRXB 3RX7A 2AEWA 2FATL 3NIFE 3T0XA 1ADQA 1TZHA 1CGTA 5D96B 1CZ8L 4U1IB 1NGXA 1NBZA 2EXWC 4HXAL 4Y7MA 4TSBH 2X10A 4UV7H 1MLBB 4G8IB 4A2LA 4FQPA 3ARED 3U4BH 5HHMB 2J8UA 1U8OA 4GXVH 4LBEA 1VHPA 1IKNA 1FFRA 2A6DB 43C9B 1RUMH 5E1AB 4WTWA 1MCPH 4JJ5A 4BSVB 4EQ2A 3VFVA 1QSEA 2VJXA 5EBWA 4G6AD 4QRRB 4MS8A 4FXKB 4LRIA 5K59F 3OR7A 1F6AB 4D3CL 4PYHA 5MP6H 1WWWX 3LEXA 3MRRB 5E0QA 3SDCD 1QFHA 5DJXA 1OGAB 5EWIL 3Q3GA 2XZQH 4HIJA 4PJGE 2XV6B 3BPOB 1L7IH 3B2UD 1MHPL 3MJGX 1BECA 4KROB 2J7LA 3IVKB 3NA4A 4XP4L 4I2XE 5CEYB 1GOHA 4NO5A 5JW4M 3HAEB 1JGDB 4LFHD 5JW3H 2GJZB 5KVGH 4K7FA 3NIDF 3QO1B 3IS1X 4MQ7A 3CZFB 3F7VA 4HH9A 3VJ6B 4GRMB 1B6UA 2XXMB 1FVEB 5EN2A 1PSKL 4LL9A 5IW1B 4PJ7E 5E8NA 2OQJB 5IQ9B 4RMSA 3TYFA 4MS8D 3HNVL 3IXTA 3HB3D 1U8MB 2UZIH 3QI9B 1YEIH 4XHQA 5E7BA 4XX1G 3GSWA 5I8KL 1A02N 1I9IL 4HS8L 3EYUL 3D0VB 1EFQA 3MLUL 1MQKH 5C0FB 3V2AR 1HQRB 5K9QI 2ZOKA 4XAWL 5GPRA 4HUMB 2CUIA 3SE3C 1G7LB 1MFEL 4HUKB 5EO0A 4F9PA 4ODVL 4PJHE 3U9UA 4OCRH 1NSNL 3MRQB 4Z7UB 3FQNA 1S7UA 2P42B 4PJGA 3EOAB 3ZE2F 4BA8A 4WO4D 1QSFA 3HMXL 5LGHH 3PABA 3THMH 4LLUA 3UJIL 4ODXA 1ZHNB 2Q20A 4WW1A 3T8XB 4JCMA 5BRZE 2I5YL 4Z7UF 5JW5B 1S8DA 1MCLA 5HYEA 2XWTB 4QOKD 3RNQA 3Q48A 4S1RH 3GO1H 5SWQA 2BHUA 5CJBA 5JHDB 3GIZL 5TQ2H 3ERYA 4QGYA 5INCB 5JA9A 4PJ7A 1Q9KB 2F8XC 3G6DH 5KS9B 2OMNA 2IPTH 4K3JH 5IJKA 4EZMA 1K9TA 1XGYL 2E8YA 1AXSB 2Y36H 3JTTB 3MCKA 5KSBE 3X17A 1E28A 5C08B 2ICWA 4R2GD 2FO4A 1ACYH 3GMNB 3NN8A 3CFBA 2HVJA 3PHOA 1MPAH 3QUKB 4LK4A 5KS9F 3F58H 3O6FB 4U4BA 5E95B 5D7IA 1F3JA 4PJHA 4MQXD 3PDOB 4C58B 2V7HB 4OF3A 4Z7VA 1ZVSA 3FQXB 4Y5XB 4NM8H 2ZUYA 2M2DA 4MCYB 2AK4D 2F53D 3FCTB 3L5IA 3FO9B 2YSSB 4XMKH 5DQJA 2ATPA 4RDQF 4KRLB 1D5IH 3I9GL 2Q76A 2CLRA 5ITBL 2EIZB 2EYRA 4DGVH 1OTSD 1YEGH 2F74B 4WUUE 1RJCA 3K4AA 2P5WD 3WIHA 2YPLA 1I1FB 4QTIL 3TO4B 3VD5A 5KANG 3DRTB 1J0JA 3KHQA 1OB1B 3E2HC 1AO7B 3LKQA 4XVTH 3E8UH 4JRXD 5ANMB 2YBRA 1FORL 2F8VA 5EU5A 5T1LA 2VDQH 1RZFL 4GAJL 4S1SH 5I6XB 5F9WC 4PV9B 4UMGA 2YXMA 4F9LC 1AHWB 4MNGE 5F7EL 1CYGA 5KSBA 3FMGL 2IMMA 5IB4A 1ZANL 3QEQE 3N06B 3ILPA 5DQDH 5IMMB 3L7EB 2A1WL 5HYSB 3MSPA 1S7VA 1JCKA 3TN0A 1S3KH 3W2DH 2QQKH 1GZQB 3PWJA 2AJSL 3LS4L 1YN6A 2ARJQ 4IEFB 2XKSA 3O8XB 1ND0B 3BVNA 4XCEA 2HWZH 4WFHE 3K8LA 2WP3T 3S34L 2XN9D 3RNKB 4PJEE 4AIXA 1KIPB 1MHHB 5MERB 3C8KB 5I1HH 2IADB 3WDJA 1AY1H 1U8JB 2WP3O 1KJ2L 4IRJB 5GS1A 5I30L 4FNLL 1AD0B 1CGSL 1AD9A 3BE1H 3V4VL 1ZA6A 1PD6A 3OSKA 4M3JA 4MNGA 1DFBH 1MFBH 3WHXA 1SEBB 1DUYA 1ZHKA 4PTUA 4UOW0 3BP5A 3EGSA 1R3JA 5F9OH 4X6DE 1JK8A 4HKZB 4M61A 2P45B 4ZS7H 4OFDA 1LEIA 4K55A 5DK0A 3MNWA 4KI5E 4C56E 5K9KB 1IQDB 1DBAL 5LCVL 1WCBB 1Z9MA 2OYPA 2Y23A 1A6TB 1NQBA 1IEBB 1WK0A 4MYWB 4B41A 5A43C 4U1NB 1QPXA 2CO7B 5JOFA 3O2DA 4R96B 4TSBL 5C0AB 3G5YB 1EPFA 3ARRA 4UV7L 1P7KB 3X13B 5GRVK 3HAEH 5HYJE 5KANI 2IWGA 3OXSB 4PJEA 1KEGL 4C55A 4GXVL 1KIRB 1BP3B 4MX7B 2ENYA 2CIIA 1RUML 3ARFC 2DKUA 4YWGH 4XPGH 1MCPL 1PVHA 5JHDE 4GQ9H 1AQDB 3OKEB 1QQDB 3H3BC 5H2BB 2XKNB 3S5LA 2WIIB 4UUJB 4LP4A 3H7BB 2XKUA 2EC8A 1S7XB 3JV6A 3LRGA 4AENB 5MP6L 5DZLA 5C09D 4OLYH 2AXFA 5A2KH 3TBYB 1I7TA 4NCC1 2QADC 4X6DA 2XZQL 3QDJE 3STZA 1XF2A 3LKNB 4RNRB 4YHOL 1M4KA 1L7IL 2CXKA 5HD8C 4APQA 3GSVA 1QLRA 3BHBA 3A0OA 4MA7H 2G5BA 5IV2B 5IMLB 2XXCB 5GS0C 2B1AH 5JW3L 3G08A 5KVGL 3BO8B 2XFXA 4TN9A 1IC4H 5FGBA 5JOEA 3JBG7 4ENED 5DJ6A 5HYJA 1EJOH 5D2LA 3OB0H 1FC2D 1PW3A 1G6RB 1TJIH 2BVUA 4I1NB 3AU1B 4AL8H 3CXHK 2WM0A 2P5EE 1BFTA 5JMOC 3D3VA 4RCAA 4QXUL 3VFOA 4OI7A 1KJMA 1YEIL 5JXEC 4JY4A 4RZCA 3TBVA 1HHGB 2VERN 1T1YA 1EMTL 3PQYB 1MQKL 5BJTA 1Q9LB 5ICZB 4C57C 3ARVA 5KVEH 4N1EA 1NAMA 1RAMA 3EO0B 3QDJA 3IDNA 1CFTB 4OCRL 4XHJC 4FQCH 4QRPA 4JFEB 3LRSA 2P47B 4AIZA 4HPYH 3SCMA 4WI5A 5LGHL 4U31A 3THML 2PXYD 4IDJH 2FWOB 3CX5J 5D7LE 3LHPH 1CL7I 1LP9A 3QUYC 4JANB 5CSGA 4LHUG 5AG8A 5I1EH 2X4SB 3O3DA 3A6OA 4P46A 4HLZG 4LU5H 2FIKA 4S1RL 3WUWA 2HTKC 5D6CB 2KKQA 5TQ2L 2VLLA 5FDWA 3EO9H 2DDQH 1HSAB 3RGVB 3AC0A 3CFEB 4HZLA 2ARWA 4CJ0A 3G6DL 3L3GB 3GRWA 4OZHE 2IPTL 4K3JL 1JYNA 2Y36L 3GSXB 5DMKA 1H0DA 3SGDI 1LNUA 1ACYL 3LKRA 1MPAL 2I60H 3F58L 5FYKU 1MELA 5JMRA 3PGCB 1NGZB 2KH2B 4HUWB 4R4ND 5FFLA 5KAQG 4JY6A 1TQCC 4NM8L 5ID1A 3U36B 2V2TA 4JR9H 1DVFD 4PY7A 1IAII 4WHYG 3FTGB 4XMKL 1I8KA 4BSWA 2AV7A 4TTGA 2FLBT 4P46D 4LEOA 1RHHA 3M1BA 5KW9H 2UWEF 5DHVB 5B39A 1D5IL 1EHNA 3RHWF 5J9PA 1RI8A 1YEGL 3FN0L 3GBMH 2VMFA 1ZLSH 5BOPA 1P5UA 1CDIA 2IBBA 5J12C 4EKXA 3MBEB 4S0SD 4XVTL 3E8UL 4Y4FD 1G0DA 1J0HA 2VDQL 1RJZA 4S1SL 1Q94B 1KB9K 4PJBB 4OCWH 1EBAA 2A83B 2C1PA 3D39B 4PV8B 2Q8BH 3C6SA 3CPLA 4G6KH 4KQ4H 5DJ8B 4FOMA 5I1LA 3IDYC 4O9HH 1XR8A 3BZEA 1WF5A 4FQXB 1S3KL 4N5ED 3MFFA 4P57B 4PJBF 3WSQH 4IJ3C 4PJFB 5EU6B 5C0EB 1NANI 2AQ3A 3Q0HA 5FUOH 4KTYA 4KK9C 4ELKA 5TE7H 2JTDA 4KWUA 5C2UB 2P8MA 4PRHA 3B8YA 4PRBB 3ZSTA 3RWGA 2RGSA 5LGKA 2P4AB 4Y19E 1U8LA 2HWZL 1F8TH 4IMLB 2QQNH 4KV5F 3V9FA 1S5HB 1PBYA 4PJFF 4Z7WB 3IXAB 1EHXA 4Z8FH 2AKRB 4WI8A 1KCUH 2NZ9C 3LD8C 4MZ2A 1NLBH 1XCTB 4Y5YC 1MEXL 3ZSSA 3F7QA 5EZOH 5I1HL 3BDYH 4XNQB 3SDXF 1AY1L 4ZAKC 2N1KA 3KPSB 2E9WA 5ETUB 5C0CA 3BE1L 5MEOB 4WI4A 1XZ0B 1MFBL 2C9AA 1FNGB 2IAMB 2BNQD 5F9OL 3HC4L 3QEHA 3GGWA 3GMMA 4ZS7L 3QJHB 1HI6B 1QRKA 5CBEA 2VXUL 4N0UB 1FVCA 3FO2B 2OTWB 5D2NC 2GTWB 3CSGA 5T5FH 3CDGA 4XP6H 1Z5LB 2YK1H 5T1DL 2OI9B 4U1GB 1IM9B 3ZL4H 4Y19A 3P9LA 3ARGB 5FOBA 4AEIH 5TDPA 2GAZB 4LNRA 3O2WH 4HUUB 3VWKB 1YY8B 2EYTA 1DLHB 3FB5A 1T2QH 3V7MA 5D1ZA 1G7JA 4EIZC 3BT2L 1E4WL 4LQFH 5INDB 4NC2B 3BH9A 5ELIA 2R8SH 5C0CD 4YWGL 4XPGL 4NO0D 4GQ9L 2AJXH 4OM0H 1YY9C 4U1HA 1JGUH 1FYTD 4OZ4A 5E1HB 4R97B 2W07A 4FP8H 5CAYB 4MSWA 4YFLF 4JREB 1AQKH 4OLYL 3TWCH 4HC1H 3GI9H 3B9KA 1Y6NR 4TUOA 3T65A 3CFDA 2YRPA 3KS0H 1J1XH 2Q7YB 4XB8A 3G6AB 3VXMD 3P9MA 4JZJA 4PGBB 5F93C 5AAWA 5FUZH 4RFNB 4G9DA 4P2RE 3HTLX 4MA7L 4OAWA 2B1AL 4ZNCD 4ZNEA 9CGTA 3REVB 2DBJA 2D31B 4L9LA 4RIRB 5D5MB 2MKLC 3C09B 5EORH 3O45A 1OW0A 4HK0B 1EJOL 1PQZB 1BOGB 5GSRA 4G80B 4I4WA 3SJVE 1QA9B 1TJIL 3P0YL 3SQBA 1Y6MR 4OZGE 4AL8L 1G6VK 2I26N 5DD3H 5HHOB 5D5MF 5DZOA 3EJYD 4WEBH 3B9KD 2IBZY 3PL6C 1QO3A 2ESVB 1UB6B 3TF7C 3TA3B 2H32B 1U3YA 4X83A 1U8KA 4EI6B 4OUUB 4HUVB 3G6JA 3A6BH 5HI5D 4GRLB 2NY6D 5KVEL 4IIQB 4Q6IC 5DSCB 2BVQA 5C0IA 2MHAB 4P5TA 3DO7B 3H9SE 3RL1B 4WWKD 4FQCL 4HW6A 1OAQH 5CEZH 1MY7A 2HTLC 3TNMB 3ES6B 4P2RA 4HPYL 1BF2A 5ACZB 3PHQB 4IDJL 3QDAA 5MI0B 1AGFB 3LHPL 4WW2A 1A4KB 4JZOA 4JZNB 1P5VA 3K74B 3GM8A 3D69A 4YIQB 2Z35B 5I1EL 3IJYA 2APXA 2BVOA 4Z7WE 4LU5L 5IM7A 5IQ7H 3U1SH 1H3XA 1TZGH 3K0WA 5F7HA 3GMPB 2NY3C 4JFZL 5DHVH 3EO9L 4FA8A 2DDQL 4XVSH 2IFGA 1NCBH 2UUDK 4B7IA 3VXNB 1BFSA 4Z76A 1AP2A 3TJHD 1RZGA 3KPSE 4NQDB 2BOCA 4AZ8A 3WFZA 1ULVA 1T5WA 3GNMH 1CGXA 4R4FH 2EICA 4P5TD 2VN7A 5DA4A 4X5LA 1UH3A 1EHLH 2I60L 2WMPA 5IBUG 4PJCA 3T4AB 1X7QA 4UBDD 4ZSOB 2LQRA 1QFPA 5C3LD 1HWGB 3QUXB 1BZ7B 4JKMA 2ATKA 2Y7QB 4JR9L 1D9KA 2X40A 2G9HB 3BZFB 2E6JA 1RULL 3L3HA 3VFPB 2V17L 5KW9L 2QQLL 2HKHH 5CKGA 2R2BB 3BKCL 1NGWB 1OP3H 1DUZA 3ALXA 3GBML 4FQ2H 5CHNA 1ZLSL 1AR2A 1U3HA 2D4FA 4MJID 1FZOA 2OR8A 5IHBA 3VFNB 3UTSE 3KYAA 3BI9X 1HXMA 4NOFA 3MO1A 4OCWL 3FQUB 2DM7A 3RFZC 4J8RA 1C08B 4HWZB 2Q8BL 3ZDXF 2ADIA 3VWJB 2C4FT 2DLIA 4JB9H 4KQ4L 4N9OB 3EUUA 4HKXA 4MAYB 1R3HA 1JWUB 4N0YL 2C3HA 4O9HL 1QBMH 1OCWH 1IGJA 1MQ8A 3WSQL 3N85H 3GJEA 5GGUB 4H8WC 3O3AA 5TE7L 4L8SC 3B3IA 1KPUB 3LQZA 2GK0B 1R5WA 5E08H 1YQVL 1F8TL 2I07A 2QQNL 3P4NA 2Z8WC 4KY1H 3VH8A 1QYGL 3HZYA 2C1OA 4LF3A 4X98A 4K71C 4HWEL 4DN4H 1KCUL 1IQWH 1NLBL 4LKCA 5EZOL 4MXVE 3RVWC 5I75B 4PJ9D 3BDYL 4WWID 4L8CA 5E94A 4G6FD 3BIKA 1F2XK 4TSCH 4J23A 5I9QC 2C4XA 4JRYD 2YUVA 5HHOE 5HPOA 3EOBB 3OJMB 4F2MA 1R24A 4NQEE 4NN7B 1IC1A 1WZ1H 1AIFB 4HFUH 3JTCA 3U48A 3JWNC 1QP1A 1IAKA 3BFOA 3EYOB 3EHBC 4BQ8A 3H7LA 5BVPH 1SYVA 3KNBB 1EDQA 1A3RH 5T5FL 4XP6L 2AABH 4F3FB 2XTJC 2ADFH 2YK1L 3SDYH 1PG7X 4HMEA 3ZL4L 1N5YH 3LS5H 4FFWC 3DV6A 4AEIL 5ESVB 1KCVH 4PJ5B 4Y1AD 3O2WL 2BY0A 4OLWH 1N0XH 5CJXA 1T2QL 3T1FB 3J8F7 1RU9H 3MYJB 2BVEA 2AJUH 4HDIB 5DMIH 4LQFL 3DXAA 4JGMA 5A3ID 4O5LH 5BW7C 3HE6B 3RBSA 2R8SL 5EA0L 2AJXL 4OM0L 1JGUL 2XOTA 1U58B 4QLRA 4FP8L 5EOTB 5A16A 3TWCL 1AQKL 4HC1L 3ZT6A 3CFJA 3GI9L 3AM8C 4BFIB 4J1UB 4YHPA 5DURB 1J1XL 1Q9OB 1RPQA 3ZKSD 5F44A 5FA3B 4BKLA 4J3SA 2H32H 1R0AH 3OHXB 5EOQH 4WV1A 4P5KB 5FUZL 1NL0H 1T83C 1HHKB 2NXZC 1K8IA 3T3MF 5JO5B 1TLKA 1OAZH 3QO0B 5A2JH 2LABA 3FT4B 2DL9A 4OM1H 5D7KE 3B6SA 2GW5A 1G7HA 2VUOA 3BJ91 3N1FC 1DE4B 3TBSA 2GSGA 1BQUA 2EE3A 1T2XA 5EORL 3UTZB 3B9VA 1INQB 3W9EB 1OSPH 3CUPA 3MJ7B 3QIBD 5IESH 5LJYH 4RGNB 4HMDA 4I0CC 2AJZB 4DVBA 4HGWA 3O11B 3VFRA 4O2CB 3C8HA 5DD3L 2H26B 1JZ7A 1OAKH 5F1NB 3ARDD 5C0BA 1SJEB 4OSUL 4WEBL 4LSPH 1R5VB 1Y18A 3PV6A 2Z31B 3NOIA 3L7FB 3MV7D 5KVFH 3A6BL 4XNYH 4IRSA 2EKSB 4QTHB 5EO9B 4BSJA 4H5SA 4HULB 3HMXA 4F57H 4JM2C 5EU3A 5F9AC 1OAQL 5CEZL 5DA0B 5H37H 4HKBB 2FH6A 1A4JA 4LQ1A 2XIDA 5DC4B 5GZOC 4DFHA 3CH1B 3RWCA 3MROA 2NZIA 3I50H 4YDVA 4PG9A 1H5BB 1NC2D 12E8H 1HQ4B 4LSRH 1TIUA 4X5WB 4OCLC 4MA3B 5IQ7L 5LGJA 5D1QD 1TZGL 2X89A 3G5VB 4XVSL 1NCBL 4Z7QF 1Z9OA 4RMWA 5EBMB 1XF3A 5T33H 4ZXBD 1TQBB 1YEDA 4LPWA 1U36A 4JPVH 4GMSH 3SN6N 2A74A 2QSTA 4YPGB 1A6VL 3GNML 5HGAB 5IOPB 4R4FL 4CVWA 1NFKA 4NDMA 2FEDD 4POZD 1YEJH 3CFIC 1AR1D 1EHLL 1RZ8B 5DS8B 2X7LB 3VFTA 3EYSH 2HJLB 2DMCA 4G43A 3SDAB 5SX4H 3UTTB 2DQUH 1R5IA 3DI3B 1NPUA 4QWWD 5C0JB 1ES0B 4KXZI 3QUZD 3ARXA 2P43B 4ETYA 5I1GH 2BRRH 3ULVD 5CFHA 4V2BA 4PGEB 1Y6KR 1ED3A 4O51A 5C3TA 4D0DB 4U2ZA 2IANE 1HINH 2HKHL 4FTVE 1OTTD 1NCNA 5EC2A 4FQ2L 1IZKA 5TFSH 4PJ5E 4I18A 3KS0J 4QT5A 4U6XA 5DD0H 3BW9A 4CNIA 3B9EA 3HLAA 3FFCB 4TNVF 2GUOA 1JZ3A 1U3JA 5ACMA 3SDCC 5AZEL 1Y0LB 1MCWW 3V0AC 2PYED 4UB0H 1KCGC 4DKEH 4MWFA 3T4YB 2F5BH 3WNLA 3MJ8A 1N5AA 4Y4HC 1T20A 5GS2D 5FYKE 3B2UC 4JB9L 5E8EB 3TFKA 3HN3A 5J1AA 4OF6A 1CK0H 3BP7B 3N0PB 1QBML 1OCWL 3ETBF 3N85L 5MHSE 4J3OC 4XBPB 4B53A 1LDSA 1SM3H 3WFHB 2RIKA 1BFVH 4YR6A 4F7CB 4MD0B 3RUGF 3OB0K 4MQSB 5ITFA 4R7DB 5B8CA 4MNQA 1IAOB 3OKMB 3BEVA 5E08L 5IW6A 3KPTA 1SYSB 4MS8C 2IANA 4LRIC 2QR0A 4FTVA 4MJ5B 4S1DC 3HB3C 1G0XA 4DN4L 3C5ZB 2XI9A 1YMHB 1IQWL 3L3IA 3OXRB 1C5DA 1SMOA 2BY3A 1G7IA 4UAOC 3P9WB 2NY2D 4HV8B 1WFOA 4RGNE 4U1SA 4OFYA 4PIRF 3HPJA 4TSCL 2IPUK 5C07B 1EK3A 4JFQA 2Q3ZA 4PREA 4NT6A 1JPGA 5L88H 3K46A 3VE0A 3KXFE 1WZ1L 4WO4C 1MI5D 2NYYC 4HIIA 1DL7L 4HFUL 3OKOB 1P84K 2X4NA 2Y07H 1OGTA 4CJ1A 3V6ZA 3GSOA 4EXPX 1M7DA 3O9WB 2X1OA 4R4BB 1MHCA 5BVPL 3RWEB 1D5XB 4LSTH 2VB5A 4RQQB 1A3RL 2F58H 2AABL 2J5LC 2ADFL 1T04B 4OQTH 2CD0A 3SDYL 1AGCB 3NCEB 4GW4A 2JCCE 4KVCH 1N5YL 4QCIB 2L4OA 3STLA 3BZDA 3RWHA 1AGEA 3U30C 2W1NA 5KSUB 1P6AB 1KCVL 4J3XA 4ZYKB 2ICES 2OJEB 1GGYA 4OLWL 1N0XL 4LSVH 1RU9L 3BAEH 5CD5C 2PO6A 2AJUL 5T3ZH 1XGUA 4QY8A 3OKKA 4DAGL 4QRTB 4YHIA 3QAZC 4CVXA 3EDJA 4F9PC 3WDIA 1UH4A 1A7RH 1LE9B 2EC9T 5IIEB 5FYLE 1MCWM 1WAAA 3T2NH 3JTSA 5LXGH 1YDPA 4QHMB 1YNTB 3MGTB 5BO1H 3Q5YA 3MRKB 3ZE0E 1NCTA 3Q6GH 1XCQB 1OQOA 1R0AL 1NBQA 5EOQL 2EDBA 2BSRB 1DBKH 1P9MC 1NL0L 4LHUD 4MVBA 3G04B 5DGRA 1BHGA 1OAZL 4LPCA 4JAMB 4OM1L 3I6LD 5F7MC 2VXTH 3X11A 5BV7B 5IJKC 3D2UB 4AMKH 5C9KA 3HNTH 5DTFA 5EIVA 2W9EH 1OSPL 3BPLB 5EUOA 5IESL 2Q86A 4MDJA 2MFNA 2PW2A 3MGAA 3I75B 4GFTB 4YAQA 4XCNA 5EZIH 5DMGD 4DWHA 1OAKL 3VFGL 4NPYA 5DUBB 3OKDB 4LSPL 2MTPA 1FZMA 1V3LA 4YJZL 4ODSH 3UBXB 5KVFL 2FO1A 4OF7A 1MY5A 5AYUH 4RFEA 4K23H 4XNYL 1FO0B 4LPXA 4BYHA 1CTNA 4HCRH 1XIWD 3IDGA 4NC1E 4F57L 3BSZH 4NQCE