4MS8A

42f3 tcr pcpb9/h-2ld complex
Total Genus 51
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
51
sequence length
176
structure length
162
Chain Sequence
MGPHSMRYYETATSPRYTSVGYVDDKEFVRFDSDAENPRYEPQVPWMEQEGPEYWERITQIAKGQEQWFRVNLRTLLGYHTLQWMYGCDVGSDGRLLRGYEQFAYDGCDYIALNEDLRTWTAADMAAQITRRKWEQAGAAEYYRAYLEGECVEWLHRYLKNG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 42F3 alpha
publication title Structural interplay between germline interactions and adaptive recognition determines the bandwidth of TCR-peptide-MHC cross-reactivity.
pubmed doi rcsb
source organism Mus musculus
molecule tags Immune system
total genus 51
structure length 162
sequence length 176
ec nomenclature
pdb deposition date 2013-09-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00129 MHC_I Class I Histocompatibility antigen, domains alpha 1 and 2
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.500.10 Alpha Beta 2-Layer Sandwich Murine Class I Major Histocompatibility Complex, H2-DB; Chain A, domain 1 MHC class I-like antigen recognition-like 4ms8A00
5IB2A 4U1HA 5C0AA 4MNGA 3MRPA 5C09A 5GSRA 1T20A 3FQRA 5C0FA 5D2LA 1AKJA 4WW2C 1B0GA 5BXFA 4PJXA 3JTTA 1YPZA 3X11A 3QFJA 1WBXA 1ZS8A 1CG9A 1A6ZA 1KJMA 3O4LA 4ZUUA 3IXAA 4NQCA 3KPPA 5F1NA 1S8DA 4ZUWA 1XZ0A 1QSFA 1YN7A 3O9WA 4E0RA 4HUVA 3RWGA 1QQDA 1T0NA 3ERYA 4PV9A 1ONQA 1G7QA 1CE6A 1P7QA 4IIQC 2BCKA 2XPGA 3PWJA 4PJFA 2H26A 2AXGA 1HHGA 2RFXA 3GSUA 3MRIA 5EU5A 3SDDA 5ENWA 3NFNA 4PGBA 4PRHA 3FFCA 4EN3C 4K7FA 3G08A 5IB1A 1RK0A 2VLRA 3JTSA 5F9JA 3VFMA 4NNXA 3LKSA 3BP7A 4G8IA 1LQVA 3BW9A 2CKBH 3VFNA 3T1FA 4MVBA 3GSXA 1KJ3H 2HJLA 3GMOA 4U1LA 3V5KA 3VXMA 5ISZA 1B3JA 4Y4KA 3QZWA 3SCMA 3E2HA 4NQVA 1HHJA 4F7EA 4G42A 3O8XA 3VXNA 2OI9A 3VFVA 3GMRA 4MXQA 4PJ7A 3T8XA 1HHKA 4PDCE 4U1MA 3B6SA 3KLAA 1EEZA 3DBXA 3GMPA 1INQA 1QSEA 3BGMA 1SYSA 3O3AA 3QDJA 1IM9A 1ZT4A 5C0GA 1MWAH 3P77A 5EU4A 1M6OA 4ZUSA 3SDCA 3TBWA 2ZSWA 4NQEA 1N2RA 1S7XA 1T7VA 3RL2A 5H94A 1AGBA 5C0DA 4PJHA 4ELMA 1HSBA 1A9EA 1S9XA 1LEKA 3FQUA 5F1IA 4X6FA 3HPJA 4I48A 1ZT1A 2HJKA 3CC5A 1I7UA 1RJYA 1A1OA 3MRCA 1LK2A 5HGBA 1EXUA 2C7UA 4PJIA 2P5EA 1KPRA 3L3IA 2ZSVA 4JQVA 4K71B 3KPOA 5E6IC 4F7CA 1T7XA 3DMMA 3E3QA 3FT3A 1Z5LA 2ZOKA 2BVOA 4V3EB 4JFEA 4PP8C 4LCCC 3LKNA 4FFEX 3ILPA 3M1BA 3P9LA 3P73A 3TN0A 1T21A 4PJGA 4D0CA 1I4FA 3VFUA 5SWZA 5MEPA 5D7JC 3VFOA 1UXSA 4NO2A 5EOTA 1ZHBA 1I1YA 4CVXA 2VAAA 3BZFA 2P5WA 3QUZA 4Y2DA 3RTQA 1KPVA 1T7YA 3VFPA 4Y4HA 2E7LE 1QO3A 1QEWA 3LN5A 2FO4A 3MRJA 5B38A 5C0IA 3BZEA 1ED3A 2AXFA 5HYJA 3DX8A 3O3EA 1XR9A 1KJ2H 3OXRA 4Z76A 4NSKA 1KBGH 3VRIA 3L3DA 2GTZA 5L2KA 4X6CA 2X70A 3HAEA 5IEKA 1FZOA 1T22A 1YDPA 3M17A 4APQA 3CCHA 3LN4A 4LCYA 2VLKA 4X6DA 5BJTA 3D25A 5C9JA 2GTWA 1N5AA 2NW3A 4X6EA 2BSTA 3GSVA 1ZHLA 3QULA 1Q94A 3O3DA 4QRTA 4WU5A 4Y4FA 3RL1A 4MJ6A 4L8CA 3TBSA 3B3IA 4U6XA 1AGEA 4V3DB 5IEHA 1HHIA 3VRJA 1UXWA 1QR1A 4PJ8A 2X4OA 4U1JA 3MV8A 1L8JA 4PJDA 2Q7YA 4WDIA 3ROLA 3FTGA 4QRUA 1LP9A 3RWHA 3PQYA 3CZFA 3HG1A 5HGDA 3MV7A 1N59A 3D39A 3MA7A 2VABA 1FFNA 1JPGA 3MRLA 5MEQA 4JFPA 1MHCA 5AD0A 2VLJA 1N3NA 1JGDA 1DUZA 3I6LD 4HS3A 3QQ3A 1YN6A 3V5DA 4HUXA 1BQHA 3VFSA 1AGFA 3SDXA 3KXFA 5MENA 4FTVA 5HHPA 4PG9A 3BHBA 1TVBA 1DE4A 1W72A 1VADA 2BSSA 3GSNH 5D9SA 4ZFZA 5C0BA 3V5HA 4NQXA 1KCGC 1T0MA 1FFPA 5C0JA 1KJVA 3P9MA 1WBZA 1R3HA 4F7TA 4U1SA 1JFMA 1QRNA 5F7DA 2HLAA 1OF2A 3HUJA 1ZVSA 3VFTA 2VE6A 3FQTA 4CW1A 5DDHA 3KPRA 3L3HA 4CVZA 1U58A 3ARFA 4QOKA 4MJ5A 3BO8A 3MRDA 2H6PA 1T1WA 3BXNA 3FONA 3GSQA 3P4OA 4QRQA 1OGTA 3GSRA 2FYYA 1T7ZA 2WY3A 4HKJA 3GJFA 4N0CA 2X4PA 2GITA 4XXCA 2ESVA 3BP4A 1IM3A 3JTCA 4GKNA 1ZAGA 4WUUA 1VACA 1JHTA 4F7MA 1TVHA 2YPKA 3MRBA 4U1NA 3MRNA 2OL3H 3SKOA 4EI5A 3LV3A 3VWKA 4LCWA 1S7WA 2X4QA 3CPLA 3PWLA 4G43A 4PRBA 3VFRA 3PABA 3WUWA 1MHEA 3DXAA 2UWEA 2J8UA 2VLLA 3MRRA 5INDA 3UTTA 2CLVA 3MGOA 1JUFA 2F74A 3ARGA 4N0UA 1G6RH 3MV9A 1FG2A 2FWOA 4N8VA 3SKMA 1T1YA 4HV8A 4PRAA 1JF1A 3BH9A 3HE6A 3TBVA 1FZMA 3FT4A 1ZSDA 5EO1A 4JFDA 5J1AA 3GMNA 4NO3A 3GSWA 3H7BA 1S7VA 1VGKA 4O2EA 5D2NA 1W0VA 1G7PA 1XR8A 2V2XA 5EU3A 1NAMH 1HOCA 4PREA 4PRIA 3P4NA 4WWKC 5IROA 1QVOA 5E8OA 3TJHA 5GSVA 1E27A 2AV1A 3QUXA 1JPFA 3RWFA 1FO0H 5FDWA 2F54A 5C0CA 4WU7A 5SWSA 3P4MA 2PYEA 4NO5A 3D2UA 3FQXA 1S7QA 5E00A 4G9DA 5EO0A 5IB4A 5SWQA 3KYOA 5D7IA 4PGCA 1S7RA 4HUUA 4NHUE 4NNYA 4ONOA 2XFXA 4PGDA 4U1IA 3MRGA 5FKPA 1KPUA 3FRUA 2AKRA 3S6CA 3VXOA 2X4TA 3LKOA 4MJIA 4PGEA 2MHAA 4UQ2A 3O3BA 2X4UA 1K5NA 2X4NA 5HGAA 2BVQA 3GMQA 4NO0A 5HGHA 4PV8A 3BEWA 3KPMA 3WS3A 3KWWA 4PJAA 4U1KA 3MRKA 3PWPA 5JHDA 1DDHA 4GUPA 5E8PA 3UBXA 3OV6A 4PJCA 3TFKA 3OXSA 5DEGA 3MRFA 3KPQA 3BVNA 3UTSA 3CH1A 1DUYA 4IRJA 4WO4A 1XH3A 3VWJA 3LKQA 3ES6A 4PRNA 1ZT7A 4NT6A 3SPVA 3ROOA 3E6FA 3ARDA 1P1ZA 5ACZA 3X13A 1FFOA 3TIEA 1GZQA 1E28A 2AK4A 5EU6A 3ECBA 1HSAA 3VH8A 3RUGA 4Z78A 3I6KA 4NQDA 4IHOA 1K8DA 5DEFA 3TPUE 2D31A 3E6HA 1S9WA 4O2FA 2GAZA 3DX7A 4G59A 4L3CA 3MRHA 3BEVA 3D18A 3VJ6A 1ZHKA 1JE6A 2YEZA 5INCA 3FQWA 3C8KA 1EEYA 3KPLA 3JVGA 3QFDA 4L4VA 3DX6A 3PWVA 4MQ7A 1LD9A 4QRPA 1X7QA 4PRPA 5HHMA 5HHQA 1SYVA 3MGTA 1NANH 2X4SA 3TIDA 2AV7A 3BH8A 4JRYA 2BNRA 3GMMA 3QDGA 5MERA 1TMCA 2DYPA 3H9SA 3OX8A 4PJBA 2PO6A 2GUOA 3MREA 1GZPA 1KTLA 4ZUVA 5D7LA 4G9FA 1T7WA 1S9YA 3MRMA 4LNRA 3VXPA 1BIIA 4LHUA 3ARBA 3GIVA 1I1AA 3MROA 4L8DA 5E8NA 1EFXA 3QQ4A 3SJVA 4JRXA 5IB5A 1T80A 3AU1A 4QRSA 4PR5A 2BSRA 4L8BA 5D5MA 1I7TA 3L3JA 1OGAA 4MS8A 4WJ5A 1MI5A 1B0RA 2V2WA 1FZJA 4GKSA 4MX7A 3KPSA 2HN7A 3AM8A 3L3GA 4N5EA 1A1MA 3VXRA 2BVPA 4PJ9A 1T1ZA 1HYRC 4F7PA 3GMLA 3REWA 3RGVC 3MRQA 2A83A 3W39A 2FZ3A 3PWUA 3MR9A 2X4RA 1UQSA 3GSOA 2F53A 1JGEA 4JFOA 4U6YA 1P4LA 3CDGA 2GT9A 1FZKA 5J6GA 1PQZA 3TA3A 3TZVC 3UPRA 1WBYA 4N0FA 4IRSA 5FA3A 2BNQA 5C08A 1NEZA 2GJ6A 3D3VA 3RWIA 4G8GA 3TVMA 5EFIA 3QDMA 2CLRA 3WL9A 5BRZA 4L8SC 3DTXA 3RWDA 4L3EA 1AGCA 1S7SA 4PJ5A 3TBTA 3SDAA 3TBYA 3TO2A 1I7RA 3KYNA 2YPLA 4Z77A 2JCCA 3VFWA 5MEOA 5L2JA 3AREA 3QUYA 1S7UA 3BUYA 3CVHA 3L3KA 3QUKA 4HUWA 4JQXA 4UQ3A 3BWAA 5C0EA 3LKRA 3U0PA 1S7TA 4D0BA 1RJZA 5IB3A 1BZ9A 4I4WA 5HHNA 3RWJA 1LDPH 2ZOLA 1T1XA 4PRDA 4HWZA 3LKPA 4ZAKA 3UTQA 1AGDA 4JFFA 4PJEA 5EUOA 3PWNA 4L29A 3TO4A 1RK1A 3I6GA 4S0UC 5J6HA 3FOLA 4D0DA 3RZCA 1M05A 2CIIA 1I1FA 1ZHNA 2CIKA 5FA4A 3RWEA 3VXSA 3H9HA 3WS6A 5IVXA 3W0WA 3WLBA 4ZUTA 3X14A 3FQNA 3RWCA 2CLZA 1BD2A 5IM7A 3MYJA 3QEQA 4O2CA 3ILQC 3FT2A 1CD1A 4MNQA 3HE7A 1AO7A 5B39A 4JFQA 1C16A 1LEGA 1OSZA 4L9LC 4PG2A 4QRRA 2FIKA 1A9BA 1QLFA 3TF7A 3VCLA 3HCVA 3IT8D 5HHOA 3X12A 4EUPA 3L9RA 3QI9A 3VXUA 1A1NA 4Y16A 2NX5A 4HX1A 5E9DA 5C07A 4L4TA 3HLAA 3C9NA 4E5XA 3FOMA 1HHHA 5BS0A 1W0WA 3KPNA
chains in the Genus database with same CATH superfamily
5IB2A 4U1HA 5C0AA 4MNGA 3MRPA 5C09A 5GSRA 1T20A 3FQRA 5C0FA 5D2LA 1AKJA 4WW2C 1B0GA 5BXFA 4PJXA 3JTTA 1YPZA 3X11A 3QFJA 1WBXA 1ZS8A 1CG9A 1A6ZA 1KJMA 3O4LA 4ZUUA 3IXAA 4NQCA 3KPPA 5F1NA 1S8DA 4ZUWA 1XZ0A 1QSFA 1YN7A 3O9WA 4E0RA 4HUVA 3RWGA 1QQDA 1T0NA 3ERYA 4PV9A 1ONQA 1G7QA 1CE6A 1P7QA 4IIQC 2BCKA 2XPGA 3PWJA 4PJFA 2H26A 2AXGA 1HHGA 2RFXA 3GSUA 3MRIA 5EU5A 3SDDA 5ENWA 3NFNA 4PGBA 4PRHA 3FFCA 4EN3C 4K7FA 3G08A 5IB1A 1RK0A 2VLRA 3JTSA 5F9JA 3VFMA 4NNXA 3LKSA 3BP7A 4G8IA 1LQVA 4JO8A 3BW9A 2CKBH 3VFNA 3T1FA 4MVBA 3GSXA 1KJ3H 2HJLA 3GMOA 4U1LA 3V5KA 3VXMA 5ISZA 1B3JA 4Y4KA 3QZWA 3SCMA 3E2HA 4NQVA 1HHJA 4F7EA 4G42A 3O8XA 3KPNA 3VXNA 2OI9A 3VFVA 3GMRA 4MXQA 4PJ7A 3T8XA 1HHKA 4PDCE 4U1MA 3B6SA 3KLAA 1EEZA 3DBXA 3GMPA 4G59C 1INQA 1QSEA 3BGMA 1SYSA 3O3AA 3QDJA 1IM9A 1ZT4A 5C0GA 1MWAH 3P77A 5EU4A 1M6OA 4ZUSA 3SDCA 3TBWA 2ZSWA 4NQEA 1N2RA 1S7XA 1T7VA 3RL2A 5H94A 1AGBA 5C0DA 4PJHA 4ELMA 1HSBA 1A9EA 1S9XA 1LEKA 3FQUA 5F1IA 4X6FA 3HPJA 4I48A 1ZT1A 2HJKA 3CC5A 1I7UA 1RJYA 1A1OA 3MRCA 1LK2A 5HGBA 1EXUA 2C7UA 4PJIA 2P5EA 1KPRA 3L3IA 2ZSVA 4JQVA 4K71B 3KPOA 5E6IC 4F7CA 1T7XA 3DMMA 3E3QA 3FT3A 1Z5LA 2ZOKA 2BVOA 4V3EB 4JFEA 4PP8C 4LCCC 3LKNA 4FFEX 3ILPA 3M1BA 3P9LA 3P73A 3TN0A 1T21A 4PJGA 4D0CA 1I4FA 3VFUA 5SWZA 5MEPA 5D7JC 3VFOA 1UXSA 4NO2A 5EOTA 1ZHBA 1I1YA 4CVXA 2VAAA 3BZFA 2P5WA 3QUZA 4Y2DA 3RTQA 1KPVA 1T7YA 3VFPA 4Y4HA 2E7LE 1QO3A 1QEWA 3LN5A 2FO4A 3MRJA 5B38A 5C0IA 3BZEA 1ED3A 2AXFA 5HYJA 3DX8A 3O3EA 1XR9A 1KJ2H 3OXRA 4Z76A 4NSKA 1KBGH 3VRIA 3L3DA 2GTZA 5L2KA 4X6CA 2X70A 3HAEA 5IEKA 1FZOA 1T22A 1YDPA 3M17A 4APQA 3CCHA 3LN4A 4LCYA 2VLKA 4X6DA 5BJTA 3D25A 5C9JA 2GTWA 1N5AA 2NW3A 4X6EA 2BSTA 3GSVA 1ZHLA 3QULA 1Q94A 3O3DA 4QRTA 4WU5A 4Y4FA 3RL1A 4MJ6A 4L8CA 3TBSA 3B3IA 4U6XA 1AGEA 4V3DB 5IEHA 1HHIA 3VRJA 1UXWA 1QR1A 4PJ8A 2X4OA 4U1JA 3MV8A 1L8JA 4PJDA 2Q7YA 4WDIA 3ROLA 3FTGA 4QRUA 1LP9A 3RWHA 3PQYA 3CZFA 3HG1A 5HGDA 3MV7A 1N59A 3D39A 3MA7A 2VABA 1FFNA 1JPGA 3MRLA 5MEQA 4JFPA 1MHCA 5AD0A 2VLJA 1N3NA 1JGDA 1DUZA 3I6LD 4HS3A 3QQ3A 1YN6A 3V5DA 4HUXA 1BQHA 3VFSA 1AGFA 3SDXA 3KXFA 5MENA 4FTVA 5HHPA 4PG9A 3BHBA 1TVBA 1DE4A 1W72A 1VADA 2BSSA 3GSNH 5D9SA 4ZFZA 5C0BA 3V5HA 4NQXA 1KCGC 1T0MA 1FFPA 5C0JA 1KJVA 3P9MA 1WBZA 1R3HA 4F7TA 4U1SA 1JFMA 1QRNA 5F7DA 2HLAA 1OF2A 3HUJA 1ZVSA 3VFTA 2VE6A 3FQTA 4CW1A 5DDHA 3KPRA 3L3HA 4CVZA 1U58A 3ARFA 4QOKA 4MJ5A 3BO8A 3MRDA 2H6PA 1T1WA 3BXNA 3FONA 3GSQA 3P4OA 4QRQA 1OGTA 3GSRA 2FYYA 1T7ZA 2WY3A 4HKJA 3GJFA 4N0CA 2X4PA 2GITA 4XXCA 2ESVA 3BP4A 1IM3A 3JTCA 4GKNA 1ZAGA 4WUUA 1VACA 1JHTA 4F7MA 1TVHA 2YPKA 3MRBA 4U1NA 3MRNA 2OL3H 3SKOA 4EI5A 3LV3A 3VWKA 4LCWA 1S7WA 2X4QA 3CPLA 3PWLA 4G43A 4PRBA 3VFRA 3PABA 3WUWA 1MHEA 3DXAA 2UWEA 2J8UA 2VLLA 3MRRA 5INDA 3UTTA 2CLVA 3MGOA 1JUFA 2F74A 3ARGA 4N0UA 1G6RH 3MV9A 1FG2A 2FWOA 4N8VA 3SKMA 1T1YA 4HV8A 4PRAA 1JF1A 3BH9A 3HE6A 3TBVA 1FZMA 3FT4A 1ZSDA 5EO1A 4JFDA 5J1AA 3GMNA 4NO3A 3GSWA 3H7BA 1S7VA 1VGKA 4O2EA 5D2NA 1W0VA 1G7PA 1XR8A 2V2XA 5EU3A 1NAMH 1HOCA 4PREA 4PRIA 3P4NA 4WWKC 5IROA 1QVOA 5E8OA 3TJHA 5GSVA 1E27A 2AV1A 3QUXA 1JPFA 3RWFA 1FO0H 5FDWA 2F54A 5C0CA 4WU7A 5SWSA 3P4MA 2PYEA 4NO5A 3D2UA 3FQXA 1S7QA 5E00A 4G9DA 5EO0A 5IB4A 5SWQA 3KYOA 5D7IA 4PGCA 1S7RA 4HUUA 4NHUE 4NNYA 4ONOA 2XFXA 4PGDA 4U1IA 3MRGA 5FKPA 1KPUA 3FRUA 2AKRA 3S6CA 3VXOA 2X4TA 3LKOA 4MJIA 4PGEA 2MHAA 4UQ2A 3O3BA 2X4UA 1K5NA 2X4NA 5HGAA 2BVQA 3GMQA 4NO0A 5HGHA 4PV8A 3BEWA 3KPMA 3WS3A 3KWWA 4PJAA 4U1KA 3MRKA 3PWPA 5JHDA 1DDHA 4GUPA 5E8PA 3UBXA 3OV6A 4PJCA 3TFKA 3OXSA 5DEGA 3MRFA 3KPQA 3BVNA 3UTSA 3CH1A 1DUYA 4IRJA 4WO4A 1XH3A 3VWJA 3LKQA 3ES6A 4PRNA 1ZT7A 4NT6A 3SPVA 3ROOA 3E6FA 3ARDA 1P1ZA 5ACZA 3X13A 1FFOA 3TIEA 1GZQA 1E28A 2AK4A 5EU6A 3ECBA 1HSAA 3VH8A 3RUGA 4Z78A 3I6KA 4NQDA 4IHOA 1K8DA 5DEFA 3TPUE 2D31A 3E6HA 1S9WA 4O2FA 2GAZA 3DX7A 4G59A 4L3CA 3MRHA 3BEVA 3D18A 3VJ6A 1ZHKA 1JE6A 2YEZA 5INCA 3FQWA 3C8KA 1EEYA 3KPLA 3JVGA 3QFDA 4L4VA 3DX6A 3PWVA 4MQ7A 1LD9A 4QRPA 1X7QA 4PRPA 5HHMA 5HHQA 1SYVA 3MGTA 1NANH 2X4SA 3TIDA 2AV7A 3BH8A 4JRYA 2BNRA 3GMMA 3QDGA 5MERA 1TMCA 2DYPA 3H9SA 3OX8A 4PJBA 2PO6A 2GUOA 3MREA 1GZPA 1KTLA 4ZUVA 5D7LA 4G9FA 1T7WA 1S9YA 3MRMA 4LNRA 3VXPA 1BIIA 4LHUA 3ARBA 3GIVA 1I1AA 3MROA 4L8DA 5E8NA 1EFXA 2IA1A 3QQ4A 3SJVA 4JRXA 5IB5A 1T80A 3AU1A 4QRSA 4PR5A 2BSRA 4L8BA 5D5MA 1I7TA 3L3JA 1OGAA 4MS8A 4WJ5A 1MI5A 1B0RA 2V2WA 1FZJA 4GKSA 4MX7A 3KPSA 2HN7A 3AM8A 3L3GA 4N5EA 1A1MA 3VXRA 2BVPA 4PJ9A 1T1ZA 1HYRC 4F7PA 3GMLA 3REWA 3RGVC 3MRQA 2A83A 3W39A 2FZ3A 3PWUA 3MR9A 2X4RA 1UQSA 3GSOA 2F53A 1JGEA 4JFOA 4U6YA 1P4LA 3CDGA 2GT9A 1FZKA 5J6GA 1PQZA 3TA3A 3TZVC 3UPRA 1WBYA 4N0FA 4IRSA 5FA3A 2BNQA 5C08A 1NEZA 2GJ6A 3D3VA 3RWIA 4G8GA 3TVMA 4BKWA 5EFIA 3QDMA 2CLRA 3WL9A 5BRZA 4L8SC 3DTXA 3RWDA 4L3EA 1AGCA 1S7SA 4PJ5A 3TBTA 3SDAA 3TBYA 3TO2A 1I7RA 3KYNA 2YPLA 4Z77A 2JCCA 3VFWA 5MEOA 5L2JA 3AREA 3QUYA 1S7UA 3BUYA 3CVHA 3L3KA 3QUKA 4HUWA 4JQXA 4UQ3A 3BWAA 2O5NA 3LKRA 5C0EA 3U0PA 1S7TA 4D0BA 1RJZA 5IB3A 1BZ9A 4I4WA 5HHNA 3RWJA 1LDPH 2ZOLA 1T1XA 4PRDA 4HWZA 3LKPA 4ZAKA 3UTQA 1AGDA 4JFFA 4PJEA 5EUOA 3PWNA 4L29A 3TO4A 1RK1A 3I6GA 4S0UC 5J6HA 3FOLA 4D0DA 3RZCA 1M05A 2CIIA 1I1FA 1ZHNA 2CIKA 5FA4A 3RWEA 3VXSA 3H9HA 3I0TA 3WS6A 5IVXA 3W0WA 3WLBA 4ZUTA 3X14A 3FQNA 3RWCA 2CLZA 1BD2A 5IM7A 3MYJA 3QEQA 4O2CA 3ILQC 3FT2A 1CD1A 4MNQA 3HE7A 1AO7A 5B39A 4JFQA 1C16A 1LEGA 1OSZA 4L9LC 4PG2A 4QRRA 2FIKA 1A9BA 1QLFA 3TF7A 3VCLA 3HCVA 3IT8D 5HHOA 3X12A 4EUPA 3L9RA 3QI9A 3VXUA 1A1NA 4Y16A 2NX5A 4HX1A 5E9DA 5C07A 4L4TA 3HLAA 3C9NA 4E5XA 3FOMA 1HHHA 5BS0A 1W0WA 2NYKA
chains in the Genus database with same CATH topology
5IB2A 4U1HA 5C0AA 4MNGA 3MRPA 5C09A 5GSRA 1T20A 3FQRA 5C0FA 5D2LA 1AKJA 4WW2C 1B0GA 5BXFA 4PJXA 3JTTA 1YPZA 3X11A 3QFJA 1WBXA 1ZS8A 1CG9A 1A6ZA 1KJMA 3O4LA 4ZUUA 3IXAA 4NQCA 3KPPA 5F1NA 1S8DA 4ZUWA 1XZ0A 1QSFA 1YN7A 3O9WA 4E0RA 4HUVA 3RWGA 1QQDA 1T0NA 3ERYA 4PV9A 1ONQA 1G7QA 1CE6A 1P7QA 4IIQC 2BCKA 2XPGA 3PWJA 4PJFA 2H26A 2AXGA 1HHGA 2RFXA 3GSUA 3MRIA 5EU5A 3SDDA 5ENWA 3NFNA 4PGBA 4PRHA 3FFCA 4EN3C 4K7FA 3G08A 5IB1A 1RK0A 2VLRA 3JTSA 5F9JA 3VFMA 4NNXA 3LKSA 3BP7A 4G8IA 1LQVA 3BW9A 2CKBH 3VFNA 3T1FA 4MVBA 3GSXA 1KJ3H 2HJLA 3GMOA 4U1LA 3V5KA 3VXMA 5ISZA 1B3JA 4Y4KA 3QZWA 3SCMA 3E2HA 4NQVA 1HHJA 4F7EA 4G42A 3O8XA 3VXNA 2OI9A 3VFVA 3GMRA 4MXQA 4PJ7A 3T8XA 1HHKA 4PDCE 4U1MA 3B6SA 3KLAA 1EEZA 3DBXA 3GMPA 1INQA 1QSEA 3BGMA 1SYSA 3O3AA 3QDJA 1IM9A 1ZT4A 5C0GA 1MWAH 3P77A 5EU4A 1M6OA 4ZUSA 3SDCA 3TBWA 2ZSWA 4NQEA 1N2RA 1S7XA 1T7VA 3RL2A 5H94A 1AGBA 5C0DA 4PJHA 4ELMA 1HSBA 1A9EA 1S9XA 1LEKA 3FQUA 5F1IA 4X6FA 3HPJA 4I48A 1ZT1A 2HJKA 3CC5A 1I7UA 1RJYA 1A1OA 3MRCA 1LK2A 5HGBA 1EXUA 2C7UA 4PJIA 2P5EA 1KPRA 3L3IA 2ZSVA 4JQVA 4K71B 3KPOA 5E6IC 4F7CA 1T7XA 3DMMA 3E3QA 3FT3A 1Z5LA 2ZOKA 2BVOA 4V3EB 4JFEA 4PP8C 4LCCC 3LKNA 4FFEX 3ILPA 3M1BA 3P9LA 3P73A 3TN0A 1T21A 4PJGA 4D0CA 1I4FA 3VFUA 5SWZA 5MEPA 5D7JC 3VFOA 1UXSA 4NO2A 5EOTA 1ZHBA 1I1YA 4CVXA 2VAAA 3BZFA 2P5WA 3QUZA 4Y2DA 3RTQA 1KPVA 1T7YA 3VFPA 4Y4HA 2E7LE 1QO3A 1QEWA 3LN5A 2FO4A 3MRJA 5B38A 5C0IA 3BZEA 1ED3A 2AXFA 5HYJA 3DX8A 3O3EA 1XR9A 1KJ2H 3OXRA 4Z76A 4NSKA 1KBGH 3VRIA 3L3DA 2GTZA 5L2KA 4X6CA 2X70A 3HAEA 5IEKA 1FZOA 1T22A 1YDPA 3M17A 4APQA 3CCHA 3LN4A 4LCYA 2VLKA 4X6DA 5BJTA 3D25A 5C9JA 2GTWA 1N5AA 2NW3A 4X6EA 2BSTA 3GSVA 1ZHLA 3QULA 1Q94A 3O3DA 4QRTA 4WU5A 4Y4FA 3RL1A 4MJ6A 4L8CA 3TBSA 3B3IA 4U6XA 1AGEA 4V3DB 5IEHA 1HHIA 3VRJA 1UXWA 1QR1A 4PJ8A 2X4OA 4U1JA 3MV8A 1L8JA 4PJDA 2Q7YA 4WDIA 3ROLA 3FTGA 4QRUA 1LP9A 3RWHA 3PQYA 3CZFA 3HG1A 5HGDA 3MV7A 1N59A 3D39A 3MA7A 2VABA 1FFNA 1JPGA 3MRLA 5MEQA 4JFPA 1MHCA 5AD0A 2VLJA 1N3NA 1JGDA 1DUZA 3I6LD 4HS3A 3QQ3A 1YN6A 3V5DA 4HUXA 1BQHA 3VFSA 1AGFA 3SDXA 3KXFA 5MENA 4FTVA 5HHPA 4PG9A 3BHBA 1TVBA 1DE4A 1W72A 1VADA 2BSSA 3GSNH 5D9SA 4ZFZA 5C0BA 3V5HA 4NQXA 1KCGC 1T0MA 1FFPA 5C0JA 1KJVA 3P9MA 1WBZA 1R3HA 4F7TA 4U1SA 1JFMA 1QRNA 5F7DA 2HLAA 1OF2A 3HUJA 1ZVSA 3VFTA 2VE6A 3FQTA 4CW1A 5DDHA 3KPRA 3L3HA 4CVZA 1U58A 3ARFA 4QOKA 4MJ5A 3BO8A 3MRDA 2H6PA 1T1WA 3BXNA 3FONA 3GSQA 3P4OA 4QRQA 1OGTA 3GSRA 2FYYA 1T7ZA 2WY3A 4HKJA 3GJFA 4N0CA 2X4PA 2GITA 4XXCA 2ESVA 3BP4A 1IM3A 3JTCA 4GKNA 1ZAGA 4WUUA 1VACA 1JHTA 4F7MA 1TVHA 2YPKA 3MRBA 4U1NA 3MRNA 2OL3H 3SKOA 4EI5A 3LV3A 3VWKA 4LCWA 1S7WA 2X4QA 3CPLA 3PWLA 4G43A 4PRBA 3VFRA 3PABA 3WUWA 1MHEA 3DXAA 2UWEA 2J8UA 2VLLA 3MRRA 5INDA 3UTTA 2CLVA 3MGOA 1JUFA 2F74A 3ARGA 4N0UA 1G6RH 3MV9A 1FG2A 2FWOA 4N8VA 3SKMA 1T1YA 4HV8A 4PRAA 1JF1A 3BH9A 3HE6A 3TBVA 1FZMA 3FT4A 1ZSDA 5EO1A 4JFDA 5J1AA 3GMNA 4NO3A 3GSWA 3H7BA 1S7VA 1VGKA 4O2EA 5D2NA 1W0VA 1G7PA 1XR8A 2V2XA 5EU3A 1NAMH 1HOCA 4PREA 4PRIA 3P4NA 4WWKC 5IROA 1QVOA 5E8OA 3TJHA 5GSVA 1E27A 2AV1A 3QUXA 1JPFA 3RWFA 1FO0H 5FDWA 2F54A 5C0CA 4WU7A 5SWSA 3P4MA 2PYEA 4NO5A 3D2UA 3FQXA 1S7QA 5E00A 4G9DA 5EO0A 5IB4A 5SWQA 3KYOA 5D7IA 4PGCA 1S7RA 4HUUA 4NHUE 4NNYA 4ONOA 2XFXA 4PGDA 4U1IA 3MRGA 5FKPA 1KPUA 3FRUA 2AKRA 3S6CA 3VXOA 2X4TA 3LKOA 4MJIA 4PGEA 2MHAA 4UQ2A 3O3BA 2X4UA 1K5NA 2X4NA 5HGAA 2BVQA 3GMQA 4NO0A 5HGHA 4PV8A 3BEWA 3KPMA 3WS3A 3KWWA 4PJAA 4U1KA 3MRKA 3PWPA 5JHDA 1DDHA 4GUPA 5E8PA 3UBXA 3OV6A 4PJCA 3TFKA 3OXSA 5DEGA 3MRFA 3KPQA 3BVNA 3UTSA 3CH1A 1DUYA 4IRJA 4WO4A 1XH3A 3VWJA 3LKQA 3ES6A 4PRNA 1ZT7A 4NT6A 3SPVA 3ROOA 3E6FA 3ARDA 1P1ZA 5ACZA 3X13A 1FFOA 3TIEA 1GZQA 1E28A 2AK4A 5EU6A 3ECBA 1HSAA 3VH8A 3RUGA 4Z78A 3I6KA 4NQDA 4IHOA 1K8DA 5DEFA 3TPUE 2D31A 3E6HA 1S9WA 4O2FA 2GAZA 3DX7A 4G59A 4L3CA 3MRHA 3BEVA 3D18A 3VJ6A 1ZHKA 1JE6A 2YEZA 5INCA 3FQWA 3C8KA 1EEYA 3KPLA 3JVGA 3QFDA 4L4VA 3DX6A 3PWVA 4MQ7A 1LD9A 4QRPA 1X7QA 4PRPA 5HHMA 5HHQA 1SYVA 3MGTA 1NANH 2X4SA 3TIDA 2AV7A 3BH8A 4JRYA 2BNRA 3GMMA 3QDGA 5MERA 1TMCA 2DYPA 3H9SA 3OX8A 4PJBA 2PO6A 2GUOA 3MREA 1GZPA 1KTLA 4ZUVA 5D7LA 4G9FA 1T7WA 1S9YA 3MRMA 4LNRA 3VXPA 1BIIA 4LHUA 3ARBA 3GIVA 1I1AA 3MROA 4L8DA 5E8NA 1EFXA 3QQ4A 3SJVA 4JRXA 5IB5A 1T80A 3AU1A 4QRSA 4PR5A 2BSRA 4L8BA 5D5MA 1I7TA 3L3JA 1OGAA 4MS8A 4WJ5A 1MI5A 1B0RA 2V2WA 1FZJA 4GKSA 4MX7A 3KPSA 2HN7A 3AM8A 3L3GA 4N5EA 1A1MA 3VXRA 2BVPA 4PJ9A 1T1ZA 1HYRC 4F7PA 3GMLA 3REWA 3RGVC 3MRQA 2A83A 3W39A 2FZ3A 3PWUA 3MR9A 2X4RA 1UQSA 3GSOA 2F53A 1JGEA 4JFOA 4U6YA 1P4LA 3CDGA 2GT9A 1FZKA 5J6GA 1PQZA 3TA3A 3TZVC 3UPRA 1WBYA 4N0FA 4IRSA 5FA3A 2BNQA 5C08A 1NEZA 2GJ6A 3D3VA 3RWIA 4G8GA 3TVMA 5EFIA 3QDMA 2CLRA 3WL9A 5BRZA 4L8SC 3DTXA 3RWDA 4L3EA 1AGCA 1S7SA 4PJ5A 3TBTA 3SDAA 3TBYA 3TO2A 1I7RA 3KYNA 2YPLA 4Z77A 2JCCA 3VFWA 5MEOA 5L2JA 3AREA 3QUYA 1S7UA 3BUYA 3CVHA 3L3KA 3QUKA 4HUWA 4JQXA 4UQ3A 3BWAA 5C0EA 3LKRA 3U0PA 1S7TA 4D0BA 1RJZA 5IB3A 1BZ9A 4I4WA 5HHNA 3RWJA 1LDPH 2ZOLA 1T1XA 4PRDA 4HWZA 3LKPA 4ZAKA 3UTQA 1AGDA 4JFFA 4PJEA 5EUOA 3PWNA 4L29A 3TO4A 1RK1A 3I6GA 4S0UC 5J6HA 3FOLA 4D0DA 3RZCA 1M05A 2CIIA 1I1FA 1ZHNA 2CIKA 5FA4A 3RWEA 3VXSA 3H9HA 3WS6A 5IVXA 3W0WA 3WLBA 4ZUTA 3X14A 3FQNA 3RWCA 2CLZA 1BD2A 5IM7A 3MYJA 3QEQA 4O2CA 3ILQC 3FT2A 1CD1A 4MNQA 3HE7A 1AO7A 5B39A 4JFQA 1C16A 1LEGA 1OSZA 4L9LC 4PG2A 4QRRA 2FIKA 1A9BA 1QLFA 3TF7A 3VCLA 3HCVA 3IT8D 5HHOA 3X12A 4EUPA 3L9RA 3QI9A 3VXUA 1A1NA 4Y16A 2NX5A 4HX1A 5E9DA 5C07A 4L4TA 3HLAA 3C9NA 4E5XA 3FOMA 1HHHA 5BS0A 1W0WA 3KPNA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5IB2 A;  4U1H A;  5C0A A;  4MNG A;  3MRP A;  5C09 A;  5GSR A;  1T20 A;  3FQR A;  5C0F A;  5D2L A;  1AKJ A;  4WW2 C;  1B0G A;  5BXF A;  4PJX A;  3JTT A;  1YPZ A;  3X11 A;  3QFJ A;  1WBX A;  1ZS8 A;  1CG9 A;  1A6Z A;  1KJM A;  3O4L A;  4ZUU A;  3IXA A;  4NQC A;  3KPP A;  5F1N A;  1S8D A;  4ZUW A;  1XZ0 A;  1QSF A;  1YN7 A;  3O9W A;  4E0R A;  4HUV A;  3RWG A;  1QQD A;  1T0N A;  3ERY A;  4PV9 A;  1ONQ A;  1G7Q A;  1CE6 A;  1P7Q A;  4IIQ C;  2BCK A;  2XPG A;  3PWJ A;  4PJF A;  2H26 A;  2AXG A;  1HHG A;  2RFX A;  3GSU A;  3MRI A;  5EU5 A;  3SDD A;  5ENW A;  3NFN A;  4PGB A;  4PRH A;  3FFC A;  4EN3 C;  4K7F A;  3G08 A;  5IB1 A;  1RK0 A;  2VLR A;  3JTS A;  5F9J A;  3VFM A;  4NNX A;  3LKS A;  3BP7 A;  4G8I A;  1LQV A;  3BW9 A;  2CKB H;  3VFN A;  3T1F A;  4MVB A;  3GSX A;  1KJ3 H;  2HJL A;  3GMO A;  4U1L A;  3V5K A;  3VXM A;  5ISZ A;  1B3J A;  4Y4K A;  3QZW A;  3SCM A;  3E2H A;  4NQV A;  1HHJ A;  4F7E A;  4G42 A;  3O8X A;  3VXN A;  2OI9 A;  3VFV A;  3GMR A;  4MXQ A;  4PJ7 A;  3T8X A;  1HHK A;  4PDC E;  4U1M A;  3B6S A;  3KLA A;  1EEZ A;  3DBX A;  3GMP A;  1INQ A;  1QSE A;  3BGM A;  1SYS A;  3O3A A;  3QDJ A;  1IM9 A;  1ZT4 A;  5C0G A;  1MWA H;  3P77 A;  5EU4 A;  1M6O A;  4ZUS A;  3SDC A;  3TBW A;  2ZSW A;  4NQE A;  1N2R A;  1S7X A;  1T7V A;  3RL2 A;  5H94 A;  1AGB A;  5C0D A;  4PJH A;  4ELM A;  1HSB A;  1A9E A;  1S9X A;  1LEK A;  3FQU A;  5F1I A;  4X6F A;  3HPJ A;  4I48 A;  1ZT1 A;  2HJK A;  3CC5 A;  1I7U A;  1RJY A;  1A1O A;  3MRC A;  1LK2 A;  5HGB A;  1EXU A;  2C7U A;  4PJI A;  2P5E A;  1KPR A;  3L3I A;  2ZSV A;  4JQV A;  4K71 B;  3KPO A;  5E6I C;  4F7C A;  1T7X A;  3DMM A;  3E3Q A;  3FT3 A;  1Z5L A;  2ZOK A;  2BVO A;  4V3E B;  4JFE A;  4PP8 C;  4LCC C;  3LKN A;  4FFE X;  3ILP A;  3M1B A;  3P9L A;  3P73 A;  3TN0 A;  1T21 A;  4PJG A;  4D0C A;  1I4F A;  3VFU A;  5SWZ A;  5MEP A;  5D7J C;  3VFO A;  1UXS A;  4NO2 A;  5EOT A;  1ZHB A;  1I1Y A;  4CVX A;  2VAA A;  3BZF A;  2P5W A;  3QUZ A;  4Y2D A;  3RTQ A;  1KPV A;  1T7Y A;  3VFP A;  4Y4H A;  2E7L E;  1QO3 A;  1QEW A;  3LN5 A;  2FO4 A;  3MRJ A;  5B38 A;  5C0I A;  3BZE A;  1ED3 A;  2AXF A;  5HYJ A;  3DX8 A;  3O3E A;  1XR9 A;  1KJ2 H;  3OXR A;  4Z76 A;  4NSK A;  1KBG H;  3VRI A;  3L3D A;  2GTZ A;  5L2K A;  4X6C A;  2X70 A;  3HAE A;  5IEK A;  1FZO A;  1T22 A;  1YDP A;  3M17 A;  4APQ A;  3CCH A;  3LN4 A;  4LCY A;  2VLK A;  4X6D A;  5BJT A;  3D25 A;  5C9J A;  2GTW A;  1N5A A;  2NW3 A;  4X6E A;  2BST A;  3GSV A;  1ZHL A;  3QUL A;  1Q94 A;  3O3D A;  4QRT A;  4WU5 A;  4Y4F A;  3RL1 A;  4MJ6 A;  4L8C A;  3TBS A;  3B3I A;  4U6X A;  1AGE A;  4V3D B;  5IEH A;  1HHI A;  3VRJ A;  1UXW A;  1QR1 A;  4PJ8 A;  2X4O A;  4U1J A;  3MV8 A;  1L8J A;  4PJD A;  2Q7Y A;  4WDI A;  3ROL A;  3FTG A;  4QRU A;  1LP9 A;  3RWH A;  3PQY A;  3CZF A;  3HG1 A;  5HGD A;  3MV7 A;  1N59 A;  3D39 A;  3MA7 A;  2VAB A;  1FFN A;  1JPG A;  3MRL A;  5MEQ A;  4JFP A;  1MHC A;  5AD0 A;  2VLJ A;  1N3N A;  1JGD A;  1DUZ A;  3I6L D;  4HS3 A;  3QQ3 A;  1YN6 A;  3V5D A;  4HUX A;  1BQH A;  3VFS A;  1AGF A;  3SDX A;  3KXF A;  5MEN A;  4FTV A;  5HHP A;  4PG9 A;  3BHB A;  1TVB A;  1DE4 A;  1W72 A;  1VAD A;  2BSS A;  3GSN H;  5D9S A;  4ZFZ A;  5C0B A;  3V5H A;  4NQX A;  1KCG C;  1T0M A;  1FFP A;  5C0J A;  1KJV A;  3P9M A;  1WBZ A;  1R3H A;  4F7T A;  4U1S A;  1JFM A;  1QRN A;  5F7D A;  2HLA A;  1OF2 A;  3HUJ A;  1ZVS A;  3VFT A;  2VE6 A;  3FQT A;  4CW1 A;  5DDH A;  3KPR A;  3L3H A;  4CVZ A;  1U58 A;  3ARF A;  4QOK A;  4MJ5 A;  3BO8 A;  3MRD A;  2H6P A;  1T1W A;  3BXN A;  3FON A;  3GSQ A;  3P4O A;  4QRQ A;  1OGT A;  3GSR A;  2FYY A;  1T7Z A;  2WY3 A;  4HKJ A;  3GJF A;  4N0C A;  2X4P A;  2GIT A;  4XXC A;  2ESV A;  3BP4 A;  1IM3 A;  3JTC A;  4GKN A;  1ZAG A;  4WUU A;  1VAC A;  1JHT A;  4F7M A;  1TVH A;  2YPK A;  3MRB A;  4U1N A;  3MRN A;  2OL3 H;  3SKO A;  4EI5 A;  3LV3 A;  3VWK A;  4LCW A;  1S7W A;  2X4Q A;  3CPL A;  3PWL A;  4G43 A;  4PRB A;  3VFR A;  3PAB A;  3WUW A;  1MHE A;  3DXA A;  2UWE A;  2J8U A;  2VLL A;  3MRR A;  5IND A;  3UTT A;  2CLV A;  3MGO A;  1JUF A;  2F74 A;  3ARG A;  4N0U A;  1G6R H;  3MV9 A;  1FG2 A;  2FWO A;  4N8V A;  3SKM A;  1T1Y A;  4HV8 A;  4PRA A;  1JF1 A;  3BH9 A;  3HE6 A;  3TBV A;  1FZM A;  3FT4 A;  1ZSD A;  5EO1 A;  4JFD A;  5J1A A;  3GMN A;  4NO3 A;  3GSW A;  3H7B A;  1S7V A;  1VGK A;  4O2E A;  5D2N A;  1W0V A;  1G7P A;  1XR8 A;  2V2X A;  5EU3 A;  1NAM H;  1HOC A;  4PRE A;  4PRI A;  3P4N A;  4WWK C;  5IRO A;  1QVO A;  5E8O A;  3TJH A;  5GSV A;  1E27 A;  2AV1 A;  3QUX A;  1JPF A;  3RWF A;  1FO0 H;  5FDW A;  2F54 A;  5C0C A;  4WU7 A;  5SWS A;  3P4M A;  2PYE A;  4NO5 A;  3D2U A;  3FQX A;  1S7Q A;  5E00 A;  4G9D A;  5EO0 A;  5IB4 A;  5SWQ A;  3KYO A;  5D7I A;  4PGC A;  1S7R A;  4HUU A;  4NHU E;  4NNY A;  4ONO A;  2XFX A;  4PGD A;  4U1I A;  3MRG A;  5FKP A;  1KPU A;  3FRU A;  2AKR A;  3S6C A;  3VXO A;  2X4T A;  3LKO A;  4MJI A;  4PGE A;  2MHA A;  4UQ2 A;  3O3B A;  2X4U A;  1K5N A;  2X4N A;  5HGA A;  2BVQ A;  3GMQ A;  4NO0 A;  5HGH A;  4PV8 A;  3BEW A;  3KPM A;  3WS3 A;  3KWW A;  4PJA A;  4U1K A;  3MRK A;  3PWP A;  5JHD A;  1DDH A;  4GUP A;  5E8P A;  3UBX A;  3OV6 A;  4PJC A;  3TFK A;  3OXS A;  5DEG A;  3MRF A;  3KPQ A;  3BVN A;  3UTS A;  3CH1 A;  1DUY A;  4IRJ A;  4WO4 A;  1XH3 A;  3VWJ A;  3LKQ A;  3ES6 A;  4PRN A;  1ZT7 A;  4NT6 A;  3SPV A;  3ROO A;  3E6F A;  3ARD A;  1P1Z A;  5ACZ A;  3X13 A;  1FFO A;  3TIE A;  1GZQ A;  1E28 A;  2AK4 A;  5EU6 A;  3ECB A;  1HSA A;  3VH8 A;  3RUG A;  4Z78 A;  3I6K A;  4NQD A;  4IHO A;  1K8D A;  5DEF A;  3TPU E;  2D31 A;  3E6H A;  1S9W A;  4O2F A;  2GAZ A;  3DX7 A;  4G59 A;  4L3C A;  3MRH A;  3BEV A;  3D18 A;  3VJ6 A;  1ZHK A;  1JE6 A;  2YEZ A;  5INC A;  3FQW A;  3C8K A;  1EEY A;  3KPL A;  3JVG A;  3QFD A;  4L4V A;  3DX6 A;  3PWV A;  4MQ7 A;  1LD9 A;  4QRP A;  1X7Q A;  4PRP A;  5HHM A;  5HHQ A;  1SYV A;  3MGT A;  1NAN H;  2X4S A;  3TID A;  2AV7 A;  3BH8 A;  4JRY A;  2BNR A;  3GMM A;  3QDG A;  5MER A;  1TMC A;  2DYP A;  3H9S A;  3OX8 A;  4PJB A;  2PO6 A;  2GUO A;  3MRE A;  1GZP A;  1KTL A;  4ZUV A;  5D7L A;  4G9F A;  1T7W A;  1S9Y A;  3MRM A;  4LNR A;  3VXP A;  1BII A;  4LHU A;  3ARB A;  3GIV A;  1I1A A;  3MRO A;  4L8D A;  5E8N A;  1EFX A;  3QQ4 A;  3SJV A;  4JRX A;  5IB5 A;  1T80 A;  3AU1 A;  4QRS A;  4PR5 A;  2BSR A;  4L8B A;  5D5M A;  1I7T A;  3L3J A;  1OGA A;  4MS8 A;  4WJ5 A;  1MI5 A;  1B0R A;  2V2W A;  1FZJ A;  4GKS A;  4MX7 A;  3KPS A;  2HN7 A;  3AM8 A;  3L3G A;  4N5E A;  1A1M A;  3VXR A;  2BVP A;  4PJ9 A;  1T1Z A;  1HYR C;  4F7P A;  3GML A;  3REW A;  3RGV C;  3MRQ A;  2A83 A;  3W39 A;  2FZ3 A;  3PWU A;  3MR9 A;  2X4R A;  1UQS A;  3GSO A;  2F53 A;  1JGE A;  4JFO A;  4U6Y A;  1P4L A;  3CDG A;  2GT9 A;  1FZK A;  5J6G A;  1PQZ A;  3TA3 A;  3TZV C;  3UPR A;  1WBY A;  4N0F A;  4IRS A;  5FA3 A;  2BNQ A;  5C08 A;  1NEZ A;  2GJ6 A;  3D3V A;  3RWI A;  4G8G A;  3TVM A;  5EFI A;  3QDM A;  2CLR A;  3WL9 A;  5BRZ A;  4L8S C;  3DTX A;  3RWD A;  4L3E A;  1AGC A;  1S7S A;  4PJ5 A;  3TBT A;  3SDA A;  3TBY A;  3TO2 A;  1I7R A;  3KYN A;  2YPL A;  4Z77 A;  2JCC A;  3VFW A;  5MEO A;  5L2J A;  3ARE A;  3QUY A;  1S7U A;  3BUY A;  3CVH A;  3L3K A;  3QUK A;  4HUW A;  4JQX A;  4UQ3 A;  3BWA A;  5C0E A;  3LKR A;  3U0P A;  1S7T A;  4D0B A;  1RJZ A;  5IB3 A;  1BZ9 A;  4I4W A;  5HHN A;  3RWJ A;  1LDP H;  2ZOL A;  1T1X A;  4PRD A;  4HWZ A;  3LKP A;  4ZAK A;  3UTQ A;  1AGD A;  4JFF A;  4PJE A;  5EUO A;  3PWN A;  4L29 A;  3TO4 A;  1RK1 A;  3I6G A;  4S0U C;  5J6H A;  3FOL A;  4D0D A;  3RZC A;  1M05 A;  2CII A;  1I1F A;  1ZHN A;  2CIK A;  5FA4 A;  3RWE A;  3VXS A;  3H9H A;  3WS6 A;  5IVX A;  3W0W A;  3WLB A;  4ZUT A;  3X14 A;  3FQN A;  3RWC A;  2CLZ A;  1BD2 A;  5IM7 A;  3MYJ A;  3QEQ A;  4O2C A;  3ILQ C;  3FT2 A;  1CD1 A;  4MNQ A;  3HE7 A;  1AO7 A;  5B39 A;  4JFQ A;  1C16 A;  1LEG A;  1OSZ A;  4L9L C;  4PG2 A;  4QRR A;  2FIK A;  1A9B A;  1QLF A;  3TF7 A;  3VCL A;  3HCV A;  3IT8 D;  5HHO A;  3X12 A;  4EUP A;  3L9R A;  3QI9 A;  3VXU A;  1A1N A;  4Y16 A;  2NX5 A;  4HX1 A;  5E9D A;  5C07 A;  4L4T A;  3HLA A;  3C9N A;  4E5X A;  3FOM A;  1HHH A;  5BS0 A;  1W0W A;  3KPN A; 
#chains in the Genus database with same CATH topology
 5IB2 A;  4U1H A;  5C0A A;  4MNG A;  3MRP A;  5C09 A;  5GSR A;  1T20 A;  3FQR A;  5C0F A;  5D2L A;  1AKJ A;  4WW2 C;  1B0G A;  5BXF A;  4PJX A;  3JTT A;  1YPZ A;  3X11 A;  3QFJ A;  1WBX A;  1ZS8 A;  1CG9 A;  1A6Z A;  1KJM A;  3O4L A;  4ZUU A;  3IXA A;  4NQC A;  3KPP A;  5F1N A;  1S8D A;  4ZUW A;  1XZ0 A;  1QSF A;  1YN7 A;  3O9W A;  4E0R A;  4HUV A;  3RWG A;  1QQD A;  1T0N A;  3ERY A;  4PV9 A;  1ONQ A;  1G7Q A;  1CE6 A;  1P7Q A;  4IIQ C;  2BCK A;  2XPG A;  3PWJ A;  4PJF A;  2H26 A;  2AXG A;  1HHG A;  2RFX A;  3GSU A;  3MRI A;  5EU5 A;  3SDD A;  5ENW A;  3NFN A;  4PGB A;  4PRH A;  3FFC A;  4EN3 C;  4K7F A;  3G08 A;  5IB1 A;  1RK0 A;  2VLR A;  3JTS A;  5F9J A;  3VFM A;  4NNX A;  3LKS A;  3BP7 A;  4G8I A;  1LQV A;  4JO8 A;  3BW9 A;  2CKB H;  3VFN A;  3T1F A;  4MVB A;  3GSX A;  1KJ3 H;  2HJL A;  3GMO A;  4U1L A;  3V5K A;  3VXM A;  5ISZ A;  1B3J A;  4Y4K A;  3QZW A;  3SCM A;  3E2H A;  4NQV A;  1HHJ A;  4F7E A;  4G42 A;  3O8X A;  3KPN A;  3VXN A;  2OI9 A;  3VFV A;  3GMR A;  4MXQ A;  4PJ7 A;  3T8X A;  1HHK A;  4PDC E;  4U1M A;  3B6S A;  3KLA A;  1EEZ A;  3DBX A;  3GMP A;  4G59 C;  1INQ A;  1QSE A;  3BGM A;  1SYS A;  3O3A A;  3QDJ A;  1IM9 A;  1ZT4 A;  5C0G A;  1MWA H;  3P77 A;  5EU4 A;  1M6O A;  4ZUS A;  3SDC A;  3TBW A;  2ZSW A;  4NQE A;  1N2R A;  1S7X A;  1T7V A;  3RL2 A;  5H94 A;  1AGB A;  5C0D A;  4PJH A;  4ELM A;  1HSB A;  1A9E A;  1S9X A;  1LEK A;  3FQU A;  5F1I A;  4X6F A;  3HPJ A;  4I48 A;  1ZT1 A;  2HJK A;  3CC5 A;  1I7U A;  1RJY A;  1A1O A;  3MRC A;  1LK2 A;  5HGB A;  1EXU A;  2C7U A;  4PJI A;  2P5E A;  1KPR A;  3L3I A;  2ZSV A;  4JQV A;  4K71 B;  3KPO A;  5E6I C;  4F7C A;  1T7X A;  3DMM A;  3E3Q A;  3FT3 A;  1Z5L A;  2ZOK A;  2BVO A;  4V3E B;  4JFE A;  4PP8 C;  4LCC C;  3LKN A;  4FFE X;  3ILP A;  3M1B A;  3P9L A;  3P73 A;  3TN0 A;  1T21 A;  4PJG A;  4D0C A;  1I4F A;  3VFU A;  5SWZ A;  5MEP A;  5D7J C;  3VFO A;  1UXS A;  4NO2 A;  5EOT A;  1ZHB A;  1I1Y A;  4CVX A;  2VAA A;  3BZF A;  2P5W A;  3QUZ A;  4Y2D A;  3RTQ A;  1KPV A;  1T7Y A;  3VFP A;  4Y4H A;  2E7L E;  1QO3 A;  1QEW A;  3LN5 A;  2FO4 A;  3MRJ A;  5B38 A;  5C0I A;  3BZE A;  1ED3 A;  2AXF A;  5HYJ A;  3DX8 A;  3O3E A;  1XR9 A;  1KJ2 H;  3OXR A;  4Z76 A;  4NSK A;  1KBG H;  3VRI A;  3L3D A;  2GTZ A;  5L2K A;  4X6C A;  2X70 A;  3HAE A;  5IEK A;  1FZO A;  1T22 A;  1YDP A;  3M17 A;  4APQ A;  3CCH A;  3LN4 A;  4LCY A;  2VLK A;  4X6D A;  5BJT A;  3D25 A;  5C9J A;  2GTW A;  1N5A A;  2NW3 A;  4X6E A;  2BST A;  3GSV A;  1ZHL A;  3QUL A;  1Q94 A;  3O3D A;  4QRT A;  4WU5 A;  4Y4F A;  3RL1 A;  4MJ6 A;  4L8C A;  3TBS A;  3B3I A;  4U6X A;  1AGE A;  4V3D B;  5IEH A;  1HHI A;  3VRJ A;  1UXW A;  1QR1 A;  4PJ8 A;  2X4O A;  4U1J A;  3MV8 A;  1L8J A;  4PJD A;  2Q7Y A;  4WDI A;  3ROL A;  3FTG A;  4QRU A;  1LP9 A;  3RWH A;  3PQY A;  3CZF A;  3HG1 A;  5HGD A;  3MV7 A;  1N59 A;  3D39 A;  3MA7 A;  2VAB A;  1FFN A;  1JPG A;  3MRL A;  5MEQ A;  4JFP A;  1MHC A;  5AD0 A;  2VLJ A;  1N3N A;  1JGD A;  1DUZ A;  3I6L D;  4HS3 A;  3QQ3 A;  1YN6 A;  3V5D A;  4HUX A;  1BQH A;  3VFS A;  1AGF A;  3SDX A;  3KXF A;  5MEN A;  4FTV A;  5HHP A;  4PG9 A;  3BHB A;  1TVB A;  1DE4 A;  1W72 A;  1VAD A;  2BSS A;  3GSN H;  5D9S A;  4ZFZ A;  5C0B A;  3V5H A;  4NQX A;  1KCG C;  1T0M A;  1FFP A;  5C0J A;  1KJV A;  3P9M A;  1WBZ A;  1R3H A;  4F7T A;  4U1S A;  1JFM A;  1QRN A;  5F7D A;  2HLA A;  1OF2 A;  3HUJ A;  1ZVS A;  3VFT A;  2VE6 A;  3FQT A;  4CW1 A;  5DDH A;  3KPR A;  3L3H A;  4CVZ A;  1U58 A;  3ARF A;  4QOK A;  4MJ5 A;  3BO8 A;  3MRD A;  2H6P A;  1T1W A;  3BXN A;  3FON A;  3GSQ A;  3P4O A;  4QRQ A;  1OGT A;  3GSR A;  2FYY A;  1T7Z A;  2WY3 A;  4HKJ A;  3GJF A;  4N0C A;  2X4P A;  2GIT A;  4XXC A;  2ESV A;  3BP4 A;  1IM3 A;  3JTC A;  4GKN A;  1ZAG A;  4WUU A;  1VAC A;  1JHT A;  4F7M A;  1TVH A;  2YPK A;  3MRB A;  4U1N A;  3MRN A;  2OL3 H;  3SKO A;  4EI5 A;  3LV3 A;  3VWK A;  4LCW A;  1S7W A;  2X4Q A;  3CPL A;  3PWL A;  4G43 A;  4PRB A;  3VFR A;  3PAB A;  3WUW A;  1MHE A;  3DXA A;  2UWE A;  2J8U A;  2VLL A;  3MRR A;  5IND A;  3UTT A;  2CLV A;  3MGO A;  1JUF A;  2F74 A;  3ARG A;  4N0U A;  1G6R H;  3MV9 A;  1FG2 A;  2FWO A;  4N8V A;  3SKM A;  1T1Y A;  4HV8 A;  4PRA A;  1JF1 A;  3BH9 A;  3HE6 A;  3TBV A;  1FZM A;  3FT4 A;  1ZSD A;  5EO1 A;  4JFD A;  5J1A A;  3GMN A;  4NO3 A;  3GSW A;  3H7B A;  1S7V A;  1VGK A;  4O2E A;  5D2N A;  1W0V A;  1G7P A;  1XR8 A;  2V2X A;  5EU3 A;  1NAM H;  1HOC A;  4PRE A;  4PRI A;  3P4N A;  4WWK C;  5IRO A;  1QVO A;  5E8O A;  3TJH A;  5GSV A;  1E27 A;  2AV1 A;  3QUX A;  1JPF A;  3RWF A;  1FO0 H;  5FDW A;  2F54 A;  5C0C A;  4WU7 A;  5SWS A;  3P4M A;  2PYE A;  4NO5 A;  3D2U A;  3FQX A;  1S7Q A;  5E00 A;  4G9D A;  5EO0 A;  5IB4 A;  5SWQ A;  3KYO A;  5D7I A;  4PGC A;  1S7R A;  4HUU A;  4NHU E;  4NNY A;  4ONO A;  2XFX A;  4PGD A;  4U1I A;  3MRG A;  5FKP A;  1KPU A;  3FRU A;  2AKR A;  3S6C A;  3VXO A;  2X4T A;  3LKO A;  4MJI A;  4PGE A;  2MHA A;  4UQ2 A;  3O3B A;  2X4U A;  1K5N A;  2X4N A;  5HGA A;  2BVQ A;  3GMQ A;  4NO0 A;  5HGH A;  4PV8 A;  3BEW A;  3KPM A;  3WS3 A;  3KWW A;  4PJA A;  4U1K A;  3MRK A;  3PWP A;  5JHD A;  1DDH A;  4GUP A;  5E8P A;  3UBX A;  3OV6 A;  4PJC A;  3TFK A;  3OXS A;  5DEG A;  3MRF A;  3KPQ A;  3BVN A;  3UTS A;  3CH1 A;  1DUY A;  4IRJ A;  4WO4 A;  1XH3 A;  3VWJ A;  3LKQ A;  3ES6 A;  4PRN A;  1ZT7 A;  4NT6 A;  3SPV A;  3ROO A;  3E6F A;  3ARD A;  1P1Z A;  5ACZ A;  3X13 A;  1FFO A;  3TIE A;  1GZQ A;  1E28 A;  2AK4 A;  5EU6 A;  3ECB A;  1HSA A;  3VH8 A;  3RUG A;  4Z78 A;  3I6K A;  4NQD A;  4IHO A;  1K8D A;  5DEF A;  3TPU E;  2D31 A;  3E6H A;  1S9W A;  4O2F A;  2GAZ A;  3DX7 A;  4G59 A;  4L3C A;  3MRH A;  3BEV A;  3D18 A;  3VJ6 A;  1ZHK A;  1JE6 A;  2YEZ A;  5INC A;  3FQW A;  3C8K A;  1EEY A;  3KPL A;  3JVG A;  3QFD A;  4L4V A;  3DX6 A;  3PWV A;  4MQ7 A;  1LD9 A;  4QRP A;  1X7Q A;  4PRP A;  5HHM A;  5HHQ A;  1SYV A;  3MGT A;  1NAN H;  2X4S A;  3TID A;  2AV7 A;  3BH8 A;  4JRY A;  2BNR A;  3GMM A;  3QDG A;  5MER A;  1TMC A;  2DYP A;  3H9S A;  3OX8 A;  4PJB A;  2PO6 A;  2GUO A;  3MRE A;  1GZP A;  1KTL A;  4ZUV A;  5D7L A;  4G9F A;  1T7W A;  1S9Y A;  3MRM A;  4LNR A;  3VXP A;  1BII A;  4LHU A;  3ARB A;  3GIV A;  1I1A A;  3MRO A;  4L8D A;  5E8N A;  1EFX A;  2IA1 A;  3QQ4 A;  3SJV A;  4JRX A;  5IB5 A;  1T80 A;  3AU1 A;  4QRS A;  4PR5 A;  2BSR A;  4L8B A;  5D5M A;  1I7T A;  3L3J A;  1OGA A;  4MS8 A;  4WJ5 A;  1MI5 A;  1B0R A;  2V2W A;  1FZJ A;  4GKS A;  4MX7 A;  3KPS A;  2HN7 A;  3AM8 A;  3L3G A;  4N5E A;  1A1M A;  3VXR A;  2BVP A;  4PJ9 A;  1T1Z A;  1HYR C;  4F7P A;  3GML A;  3REW A;  3RGV C;  3MRQ A;  2A83 A;  3W39 A;  2FZ3 A;  3PWU A;  3MR9 A;  2X4R A;  1UQS A;  3GSO A;  2F53 A;  1JGE A;  4JFO A;  4U6Y A;  1P4L A;  3CDG A;  2GT9 A;  1FZK A;  5J6G A;  1PQZ A;  3TA3 A;  3TZV C;  3UPR A;  1WBY A;  4N0F A;  4IRS A;  5FA3 A;  2BNQ A;  5C08 A;  1NEZ A;  2GJ6 A;  3D3V A;  3RWI A;  4G8G A;  3TVM A;  4BKW A;  5EFI A;  3QDM A;  2CLR A;  3WL9 A;  5BRZ A;  4L8S C;  3DTX A;  3RWD A;  4L3E A;  1AGC A;  1S7S A;  4PJ5 A;  3TBT A;  3SDA A;  3TBY A;  3TO2 A;  1I7R A;  3KYN A;  2YPL A;  4Z77 A;  2JCC A;  3VFW A;  5MEO A;  5L2J A;  3ARE A;  3QUY A;  1S7U A;  3BUY A;  3CVH A;  3L3K A;  3QUK A;  4HUW A;  4JQX A;  4UQ3 A;  3BWA A;  2O5N A;  3LKR A;  5C0E A;  3U0P A;  1S7T A;  4D0B A;  1RJZ A;  5IB3 A;  1BZ9 A;  4I4W A;  5HHN A;  3RWJ A;  1LDP H;  2ZOL A;  1T1X A;  4PRD A;  4HWZ A;  3LKP A;  4ZAK A;  3UTQ A;  1AGD A;  4JFF A;  4PJE A;  5EUO A;  3PWN A;  4L29 A;  3TO4 A;  1RK1 A;  3I6G A;  4S0U C;  5J6H A;  3FOL A;  4D0D A;  3RZC A;  1M05 A;  2CII A;  1I1F A;  1ZHN A;  2CIK A;  5FA4 A;  3RWE A;  3VXS A;  3H9H A;  3I0T A;  3WS6 A;  5IVX A;  3W0W A;  3WLB A;  4ZUT A;  3X14 A;  3FQN A;  3RWC A;  2CLZ A;  1BD2 A;  5IM7 A;  3MYJ A;  3QEQ A;  4O2C A;  3ILQ C;  3FT2 A;  1CD1 A;  4MNQ A;  3HE7 A;  1AO7 A;  5B39 A;  4JFQ A;  1C16 A;  1LEG A;  1OSZ A;  4L9L C;  4PG2 A;  4QRR A;  2FIK A;  1A9B A;  1QLF A;  3TF7 A;  3VCL A;  3HCV A;  3IT8 D;  5HHO A;  3X12 A;  4EUP A;  3L9R A;  3QI9 A;  3VXU A;  1A1N A;  4Y16 A;  2NX5 A;  4HX1 A;  5E9D A;  5C07 A;  4L4T A;  3HLA A;  3C9N A;  4E5X A;  3FOM A;  1HHH A;  5BS0 A;  1W0W A;  2NYK A; 
#chains in the Genus database with same CATH homology
 5IB2 A;  4U1H A;  5C0A A;  4MNG A;  3MRP A;  5C09 A;  5GSR A;  1T20 A;  3FQR A;  5C0F A;  5D2L A;  1AKJ A;  4WW2 C;  1B0G A;  5BXF A;  4PJX A;  3JTT A;  1YPZ A;  3X11 A;  3QFJ A;  1WBX A;  1ZS8 A;  1CG9 A;  1A6Z A;  1KJM A;  3O4L A;  4ZUU A;  3IXA A;  4NQC A;  3KPP A;  5F1N A;  1S8D A;  4ZUW A;  1XZ0 A;  1QSF A;  1YN7 A;  3O9W A;  4E0R A;  4HUV A;  3RWG A;  1QQD A;  1T0N A;  3ERY A;  4PV9 A;  1ONQ A;  1G7Q A;  1CE6 A;  1P7Q A;  4IIQ C;  2BCK A;  2XPG A;  3PWJ A;  4PJF A;  2H26 A;  2AXG A;  1HHG A;  2RFX A;  3GSU A;  3MRI A;  5EU5 A;  3SDD A;  5ENW A;  3NFN A;  4PGB A;  4PRH A;  3FFC A;  4EN3 C;  4K7F A;  3G08 A;  5IB1 A;  1RK0 A;  2VLR A;  3JTS A;  5F9J A;  3VFM A;  4NNX A;  3LKS A;  3BP7 A;  4G8I A;  1LQV A;  3BW9 A;  2CKB H;  3VFN A;  3T1F A;  4MVB A;  3GSX A;  1KJ3 H;  2HJL A;  3GMO A;  4U1L A;  3V5K A;  3VXM A;  5ISZ A;  1B3J A;  4Y4K A;  3QZW A;  3SCM A;  3E2H A;  4NQV A;  1HHJ A;  4F7E A;  4G42 A;  3O8X A;  3VXN A;  2OI9 A;  3VFV A;  3GMR A;  4MXQ A;  4PJ7 A;  3T8X A;  1HHK A;  4PDC E;  4U1M A;  3B6S A;  3KLA A;  1EEZ A;  3DBX A;  3GMP A;  1INQ A;  1QSE A;  3BGM A;  1SYS A;  3O3A A;  3QDJ A;  1IM9 A;  1ZT4 A;  5C0G A;  1MWA H;  3P77 A;  5EU4 A;  1M6O A;  4ZUS A;  3SDC A;  3TBW A;  2ZSW A;  4NQE A;  1N2R A;  1S7X A;  1T7V A;  3RL2 A;  5H94 A;  1AGB A;  5C0D A;  4PJH A;  4ELM A;  1HSB A;  1A9E A;  1S9X A;  1LEK A;  3FQU A;  5F1I A;  4X6F A;  3HPJ A;  4I48 A;  1ZT1 A;  2HJK A;  3CC5 A;  1I7U A;  1RJY A;  1A1O A;  3MRC A;  1LK2 A;  5HGB A;  1EXU A;  2C7U A;  4PJI A;  2P5E A;  1KPR A;  3L3I A;  2ZSV A;  4JQV A;  4K71 B;  3KPO A;  5E6I C;  4F7C A;  1T7X A;  3DMM A;  3E3Q A;  3FT3 A;  1Z5L A;  2ZOK A;  2BVO A;  4V3E B;  4JFE A;  4PP8 C;  4LCC C;  3LKN A;  4FFE X;  3ILP A;  3M1B A;  3P9L A;  3P73 A;  3TN0 A;  1T21 A;  4PJG A;  4D0C A;  1I4F A;  3VFU A;  5SWZ A;  5MEP A;  5D7J C;  3VFO A;  1UXS A;  4NO2 A;  5EOT A;  1ZHB A;  1I1Y A;  4CVX A;  2VAA A;  3BZF A;  2P5W A;  3QUZ A;  4Y2D A;  3RTQ A;  1KPV A;  1T7Y A;  3VFP A;  4Y4H A;  2E7L E;  1QO3 A;  1QEW A;  3LN5 A;  2FO4 A;  3MRJ A;  5B38 A;  5C0I A;  3BZE A;  1ED3 A;  2AXF A;  5HYJ A;  3DX8 A;  3O3E A;  1XR9 A;  1KJ2 H;  3OXR A;  4Z76 A;  4NSK A;  1KBG H;  3VRI A;  3L3D A;  2GTZ A;  5L2K A;  4X6C A;  2X70 A;  3HAE A;  5IEK A;  1FZO A;  1T22 A;  1YDP A;  3M17 A;  4APQ A;  3CCH A;  3LN4 A;  4LCY A;  2VLK A;  4X6D A;  5BJT A;  3D25 A;  5C9J A;  2GTW A;  1N5A A;  2NW3 A;  4X6E A;  2BST A;  3GSV A;  1ZHL A;  3QUL A;  1Q94 A;  3O3D A;  4QRT A;  4WU5 A;  4Y4F A;  3RL1 A;  4MJ6 A;  4L8C A;  3TBS A;  3B3I A;  4U6X A;  1AGE A;  4V3D B;  5IEH A;  1HHI A;  3VRJ A;  1UXW A;  1QR1 A;  4PJ8 A;  2X4O A;  4U1J A;  3MV8 A;  1L8J A;  4PJD A;  2Q7Y A;  4WDI A;  3ROL A;  3FTG A;  4QRU A;  1LP9 A;  3RWH A;  3PQY A;  3CZF A;  3HG1 A;  5HGD A;  3MV7 A;  1N59 A;  3D39 A;  3MA7 A;  2VAB A;  1FFN A;  1JPG A;  3MRL A;  5MEQ A;  4JFP A;  1MHC A;  5AD0 A;  2VLJ A;  1N3N A;  1JGD A;  1DUZ A;  3I6L D;  4HS3 A;  3QQ3 A;  1YN6 A;  3V5D A;  4HUX A;  1BQH A;  3VFS A;  1AGF A;  3SDX A;  3KXF A;  5MEN A;  4FTV A;  5HHP A;  4PG9 A;  3BHB A;  1TVB A;  1DE4 A;  1W72 A;  1VAD A;  2BSS A;  3GSN H;  5D9S A;  4ZFZ A;  5C0B A;  3V5H A;  4NQX A;  1KCG C;  1T0M A;  1FFP A;  5C0J A;  1KJV A;  3P9M A;  1WBZ A;  1R3H A;  4F7T A;  4U1S A;  1JFM A;  1QRN A;  5F7D A;  2HLA A;  1OF2 A;  3HUJ A;  1ZVS A;  3VFT A;  2VE6 A;  3FQT A;  4CW1 A;  5DDH A;  3KPR A;  3L3H A;  4CVZ A;  1U58 A;  3ARF A;  4QOK A;  4MJ5 A;  3BO8 A;  3MRD A;  2H6P A;  1T1W A;  3BXN A;  3FON A;  3GSQ A;  3P4O A;  4QRQ A;  1OGT A;  3GSR A;  2FYY A;  1T7Z A;  2WY3 A;  4HKJ A;  3GJF A;  4N0C A;  2X4P A;  2GIT A;  4XXC A;  2ESV A;  3BP4 A;  1IM3 A;  3JTC A;  4GKN A;  1ZAG A;  4WUU A;  1VAC A;  1JHT A;  4F7M A;  1TVH A;  2YPK A;  3MRB A;  4U1N A;  3MRN A;  2OL3 H;  3SKO A;  4EI5 A;  3LV3 A;  3VWK A;  4LCW A;  1S7W A;  2X4Q A;  3CPL A;  3PWL A;  4G43 A;  4PRB A;  3VFR A;  3PAB A;  3WUW A;  1MHE A;  3DXA A;  2UWE A;  2J8U A;  2VLL A;  3MRR A;  5IND A;  3UTT A;  2CLV A;  3MGO A;  1JUF A;  2F74 A;  3ARG A;  4N0U A;  1G6R H;  3MV9 A;  1FG2 A;  2FWO A;  4N8V A;  3SKM A;  1T1Y A;  4HV8 A;  4PRA A;  1JF1 A;  3BH9 A;  3HE6 A;  3TBV A;  1FZM A;  3FT4 A;  1ZSD A;  5EO1 A;  4JFD A;  5J1A A;  3GMN A;  4NO3 A;  3GSW A;  3H7B A;  1S7V A;  1VGK A;  4O2E A;  5D2N A;  1W0V A;  1G7P A;  1XR8 A;  2V2X A;  5EU3 A;  1NAM H;  1HOC A;  4PRE A;  4PRI A;  3P4N A;  4WWK C;  5IRO A;  1QVO A;  5E8O A;  3TJH A;  5GSV A;  1E27 A;  2AV1 A;  3QUX A;  1JPF A;  3RWF A;  1FO0 H;  5FDW A;  2F54 A;  5C0C A;  4WU7 A;  5SWS A;  3P4M A;  2PYE A;  4NO5 A;  3D2U A;  3FQX A;  1S7Q A;  5E00 A;  4G9D A;  5EO0 A;  5IB4 A;  5SWQ A;  3KYO A;  5D7I A;  4PGC A;  1S7R A;  4HUU A;  4NHU E;  4NNY A;  4ONO A;  2XFX A;  4PGD A;  4U1I A;  3MRG A;  5FKP A;  1KPU A;  3FRU A;  2AKR A;  3S6C A;  3VXO A;  2X4T A;  3LKO A;  4MJI A;  4PGE A;  2MHA A;  4UQ2 A;  3O3B A;  2X4U A;  1K5N A;  2X4N A;  5HGA A;  2BVQ A;  3GMQ A;  4NO0 A;  5HGH A;  4PV8 A;  3BEW A;  3KPM A;  3WS3 A;  3KWW A;  4PJA A;  4U1K A;  3MRK A;  3PWP A;  5JHD A;  1DDH A;  4GUP A;  5E8P A;  3UBX A;  3OV6 A;  4PJC A;  3TFK A;  3OXS A;  5DEG A;  3MRF A;  3KPQ A;  3BVN A;  3UTS A;  3CH1 A;  1DUY A;  4IRJ A;  4WO4 A;  1XH3 A;  3VWJ A;  3LKQ A;  3ES6 A;  4PRN A;  1ZT7 A;  4NT6 A;  3SPV A;  3ROO A;  3E6F A;  3ARD A;  1P1Z A;  5ACZ A;  3X13 A;  1FFO A;  3TIE A;  1GZQ A;  1E28 A;  2AK4 A;  5EU6 A;  3ECB A;  1HSA A;  3VH8 A;  3RUG A;  4Z78 A;  3I6K A;  4NQD A;  4IHO A;  1K8D A;  5DEF A;  3TPU E;  2D31 A;  3E6H A;  1S9W A;  4O2F A;  2GAZ A;  3DX7 A;  4G59 A;  4L3C A;  3MRH A;  3BEV A;  3D18 A;  3VJ6 A;  1ZHK A;  1JE6 A;  2YEZ A;  5INC A;  3FQW A;  3C8K A;  1EEY A;  3KPL A;  3JVG A;  3QFD A;  4L4V A;  3DX6 A;  3PWV A;  4MQ7 A;  1LD9 A;  4QRP A;  1X7Q A;  4PRP A;  5HHM A;  5HHQ A;  1SYV A;  3MGT A;  1NAN H;  2X4S A;  3TID A;  2AV7 A;  3BH8 A;  4JRY A;  2BNR A;  3GMM A;  3QDG A;  5MER A;  1TMC A;  2DYP A;  3H9S A;  3OX8 A;  4PJB A;  2PO6 A;  2GUO A;  3MRE A;  1GZP A;  1KTL A;  4ZUV A;  5D7L A;  4G9F A;  1T7W A;  1S9Y A;  3MRM A;  4LNR A;  3VXP A;  1BII A;  4LHU A;  3ARB A;  3GIV A;  1I1A A;  3MRO A;  4L8D A;  5E8N A;  1EFX A;  3QQ4 A;  3SJV A;  4JRX A;  5IB5 A;  1T80 A;  3AU1 A;  4QRS A;  4PR5 A;  2BSR A;  4L8B A;  5D5M A;  1I7T A;  3L3J A;  1OGA A;  4MS8 A;  4WJ5 A;  1MI5 A;  1B0R A;  2V2W A;  1FZJ A;  4GKS A;  4MX7 A;  3KPS A;  2HN7 A;  3AM8 A;  3L3G A;  4N5E A;  1A1M A;  3VXR A;  2BVP A;  4PJ9 A;  1T1Z A;  1HYR C;  4F7P A;  3GML A;  3REW A;  3RGV C;  3MRQ A;  2A83 A;  3W39 A;  2FZ3 A;  3PWU A;  3MR9 A;  2X4R A;  1UQS A;  3GSO A;  2F53 A;  1JGE A;  4JFO A;  4U6Y A;  1P4L A;  3CDG A;  2GT9 A;  1FZK A;  5J6G A;  1PQZ A;  3TA3 A;  3TZV C;  3UPR A;  1WBY A;  4N0F A;  4IRS A;  5FA3 A;  2BNQ A;  5C08 A;  1NEZ A;  2GJ6 A;  3D3V A;  3RWI A;  4G8G A;  3TVM A;  5EFI A;  3QDM A;  2CLR A;  3WL9 A;  5BRZ A;  4L8S C;  3DTX A;  3RWD A;  4L3E A;  1AGC A;  1S7S A;  4PJ5 A;  3TBT A;  3SDA A;  3TBY A;  3TO2 A;  1I7R A;  3KYN A;  2YPL A;  4Z77 A;  2JCC A;  3VFW A;  5MEO A;  5L2J A;  3ARE A;  3QUY A;  1S7U A;  3BUY A;  3CVH A;  3L3K A;  3QUK A;  4HUW A;  4JQX A;  4UQ3 A;  3BWA A;  5C0E A;  3LKR A;  3U0P A;  1S7T A;  4D0B A;  1RJZ A;  5IB3 A;  1BZ9 A;  4I4W A;  5HHN A;  3RWJ A;  1LDP H;  2ZOL A;  1T1X A;  4PRD A;  4HWZ A;  3LKP A;  4ZAK A;  3UTQ A;  1AGD A;  4JFF A;  4PJE A;  5EUO A;  3PWN A;  4L29 A;  3TO4 A;  1RK1 A;  3I6G A;  4S0U C;  5J6H A;  3FOL A;  4D0D A;  3RZC A;  1M05 A;  2CII A;  1I1F A;  1ZHN A;  2CIK A;  5FA4 A;  3RWE A;  3VXS A;  3H9H A;  3WS6 A;  5IVX A;  3W0W A;  3WLB A;  4ZUT A;  3X14 A;  3FQN A;  3RWC A;  2CLZ A;  1BD2 A;  5IM7 A;  3MYJ A;  3QEQ A;  4O2C A;  3ILQ C;  3FT2 A;  1CD1 A;  4MNQ A;  3HE7 A;  1AO7 A;  5B39 A;  4JFQ A;  1C16 A;  1LEG A;  1OSZ A;  4L9L C;  4PG2 A;  4QRR A;  2FIK A;  1A9B A;  1QLF A;  3TF7 A;  3VCL A;  3HCV A;  3IT8 D;  5HHO A;  3X12 A;  4EUP A;  3L9R A;  3QI9 A;  3VXU A;  1A1N A;  4Y16 A;  2NX5 A;  4HX1 A;  5E9D A;  5C07 A;  4L4T A;  3HLA A;  3C9N A;  4E5X A;  3FOM A;  1HHH A;  5BS0 A;  1W0W A;  3KPN A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...