4MS8A

42f3 tcr pcpb9/h-2ld complex
Total Genus 51
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
51
sequence length
176
structure length
162
Chain Sequence
b'MGPHSMRYYETATSPRYTSVGYVDDKEFVRFDSDAENPRYEPQVPWMEQEGPEYWERITQIAKGQEQWFRVNLRTLLGYHTLQWMYGCDVGSDGRLLRGYEQFAYDGCDYIALNEDLRTWTAADMAAQITRRKWEQAGAAEYYRAYLEGECVEWLHRYLKNG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 42F3 alpha
publication title Structural interplay between germline interactions and adaptive recognition determines the bandwidth of TCR-peptide-MHC cross-reactivity.
pubmed doi rcsb
source organism Mus musculus
molecule tags Immune system
total genus 51
structure length 162
sequence length 176
ec nomenclature
pdb deposition date 2013-09-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00129 MHC_I Class I Histocompatibility antigen, domains alpha 1 and 2
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.500.10 Alpha Beta 2-Layer Sandwich Murine Class I Major Histocompatibility Complex, H2-DB; Chain A, domain 1 MHC class I-like antigen recognition-like 4ms8A00
1LD9A 4PV8A 5AD0A 5FKPA 1G7PA 5HGDA 4F7TA 2V2XA 3KXFA 3O9WA 3QFDA 2A83A 4U1MA 5BXFA 3D25A 3FQUA 3E6HA 4PJFA 3LN4A 3QUZA 3GMPA 5C0AA 3H9HA 1N2RA 1S7XA 1S7UA 1AGDA 3KLAA 3GJFA 1T1YA 4HX1A 3BVNA 3HE7A 5C09A 1LP9A 1QQDA 1OF2A 3FQRA 3KPMA 5D5MA 1P1ZA 3UPRA 2GUOA 4LCCC 1UQSA 4G8GA 5HHMA 4L4VA 4NQCA 3FT2A 4O2FA 4MJ6A 2VE6A 3VFSA 3TFKA 1G7QA 3SDCA 3FOMA 4IRJA 3FOLA 4GKSA 5F1IA 1FZOA 3KYNA 5EU3A 4WU7A 1INQA 3MRPA 3L9RA 3DMMA 4PJGA 4X6EA 1U58A 3FFCA 1KPRA 4NSKA 3VXRA 3MA7A 4PJXA 1PQZA 2VABA 3TF7A 3FQTA 3CVHA 3LKPA 3VXOA 3MR9A 4L4TA 3I6LD 5C07A 1QSEA 3P73A 1BQHA 2XFXA 4WJ5A 3ES6A 4NO2A 4E0RA 1JFMA 2BSTA 2HJLA 3QQ4A 5E9DA 2FWOA 1S9YA 3SKOA 4D0CA 2WY3A 3I6KA 2GT9A 4F7EA 4HUUA 3JTTA 4UQ2A 1VADA 1FFPA 3JTCA 4MNGA 3ARBA 3HPJA 3GIVA 1T80A 3KPLA 1I7UA 2BNRA 5SWZA 5J6HA 4NO0A 1T7WA 1ZHBA 1YN6A 5C0EA 4PDCE 1ZHNA 2H26A 1I1AA 4NO5A 1AGEA 1R3HA 3GSXA 4ZUWA 2NX5A 5BJTA 2YEZA 3REWA 5C9JA 3WUWA 1I1FA 2GAZA 3V5HA 3BUYA 1T22A 4PGDA 1XR9A 1Z5LA 3RWDA 3VH8A 1KTLA 4V3DB 4F7MA 3P9LA 3MYJA 5L2KA 4Z77A 4NQXA 5IROA 2C7UA 3ROLA 1AGFA 3RWJA 3DXAA 3HLAA 5MERA 4N0UA 4JRYA 3ERYA 5IB5A 4U6YA 1TVHA 4PRPA 4Y4FA 1A9BA 3BXNA 3O3DA 2BSRA 4PRIA 3P77A 5D7JC 5EU6A 3VFOA 4Z76A 4PRNA 1KCGC 1YN7A 4MQ7A 5IVXA 3JTSA 3VFNA 4HS3A 3RWGA 5DEGA 2F54A 4NQDA 1HHGA 4K71B 3MRKA 2VLRA 1IM3A 4HUXA 4MVBA 3BH9A 4X6CA 2BVQA 4ZUSA 5J6GA 3GSNH 3G08A 4EN3C 2VAAA 4X6FA 5ACZA 3IT8D 3KPNA 4PG9A 1HHHA 4PJIA 5SWQA 1MI5A 5DEFA 3FRUA 5IB3A 3LKRA 1S7WA 2AKRA 2HLAA 3FQNA 3DX8A 4PP8C 3MRHA 1T1WA 1LK2A 1T0MA 1QLFA 4QRPA 1LEKA 5D2LA 2X4RA 1ZT4A 3CPLA 1HSBA 3QDMA 3T8XA 1KBGH 4NT6A 3ROOA 3LKNA 3UTTA 4L8BA 1A1OA 3BP7A 4G59A 3CZFA 4O2CA 3PWNA 1HYRC 4PJ7A 1ZT7A 4MXQA 3TA3A 3VXMA 4QRRA 3MRQA 2E7LE 3TN0A 4PRBA 2FZ3A 4EI5A 4JFPA 3TBTA 3MRLA 2VLJA 1S9WA 1I1YA 3HG1A 4PRDA 3L3IA 2F74A 4PJ5A 3QEQA 2D31A 3BP4A 5IB1A 2GTZA 4HUVA 4PRAA 3FQXA 3BW9A 3L3GA 5HHNA 3SDXA 1B0RA 1JGEA 3PWJA 4PJBA 3KPQA 2HJKA 5D7IA 3ARGA 2BSSA 3MRDA 4IRSA 3MV8A 1T1XA 2CLZA 2JCCA 4L3CA 4PJAA 1N3NA 4APQA 1ZT1A 3S6CA 1ZSDA 4QRUA 3RUGA 3GSQA 1E28A 4CVXA 1S7RA 3MROA 4MNQA 4NNXA 1SYSA 1JPGA 2MHAA 4Y16A 3BHBA 4JFOA 4LCWA 3DX7A 3MGOA 3GSUA 3P4MA 4V3EB 3VRJA 5ENWA 3RTQA 5B38A 3AREA 3E6FA 3BWAA 4JRXA 5C0DA 3TBVA 1CD1A 4FFEX 1HHJA 1KJVA 4QRSA 4F7PA 3GMLA 1ZHLA 3E2HA 5D7LA 3KPPA 3X11A 5C0JA 1B0GA 5EU5A 3GMOA 3VXSA 4GKNA 2CIKA 3I6GA 3RWFA 3RWEA 1UXSA 3CCHA 3GMQA 5MEQA 1E27A 4ZFZA 1AKJA 2BVPA 4MX7A 4G42A 3TZVC 3VXUA 3GSOA 2XPGA 3O3EA 4NQEA 1OGTA 2UWEA 3QUYA 4PJDA 4U1JA 2X4TA 1WBXA 1BIIA 1A6ZA 1MHEA 1I7RA 4PREA 3RWCA 1QSFA 3SPVA 2X4QA 3W0WA 1T7VA 4PGBA 1JHTA 3ARFA 2HN7A 5HGAA 3C9NA 5E00A 1EFXA 3LKOA 4N0FA 4PGEA 5FDWA 1M6OA 4JFFA 3TBYA 3HCVA 1JUFA 1S9XA 1S7SA 3HE6A 4D0BA 5C0IA 4L8CA 1EEZA 2CLRA 4WO4A 4ONOA 1WBZA 3MRGA 4U1NA 1S7VA 3GMNA 3QFJA 5C08A 3MRMA 5IB4A 2X4PA 1LDPH 2ZSWA 1X7QA 1A9EA 1W0WA 4N0CA 3OXRA 3KYOA 1KJMA 1NANH 3VXNA 3VJ6A 4PJHA 3GSWA 3LKQA 5E8PA 3NFNA 3QDJA 1P7QA 1TVBA 1QEWA 3QDGA 2BVOA 5IEKA 1P4LA 1HSAA 5E8NA 1B3JA 1AGCA 1S7TA 4WUUA 4Y2DA 2RFXA 3GSVA 3MRNA 1G6RH 4Y4HA 3GMMA 3WS3A 4G8IA 3C8KA 3D39A 1QR1A 5IEHA 1WBYA 4U1IA 2ZSVA 4O2EA 1KJ3H 3TIDA 3O4LA 3HAEA 3W39A 3D3VA 4HKJA 1DUZA 3L3JA 3TIEA 3VFUA 4S0UC 3GSRA 3QZWA 2CIIA 3PQYA 1A1NA 4QRQA 3T1FA 2VLKA 3UTQA 2FYYA 3H9SA 3PABA 4L8DA 3OV6A 3ECBA 3D18A 3VFRA 3RL1A 2J8UA 3TJHA 2OI9A 3L3HA 1ZHKA 1NAMH 4PJEA 3PWUA 5F1NA 5D9SA 3VRIA 2GITA 3ILQC 4PG2A 5MEPA 2AV1A 4WU5A 3TBSA 2Q7YA 2X70A 4PR5A 4K7FA 1HHKA 1I4FA 5HHPA 3HUJA 3VCLA 4PRHA 1ZAGA 4D0DA 3KPRA 4Z78A 4ZUVA 3X12A 1T0NA 2P5WA 3BZFA 3LKSA 5DDHA 4L3EA 5J1AA 3RWIA 3MRBA 4G9DA 3E3QA 2OL3H 1OSZA 3TO4A 3U0PA 4CW1A 1CE6A 4JFDA 1XR8A 3OXSA 4PV9A 3VFVA 4U1KA 4NQVA 3MRRA 1HOCA 3FONA 1FO0H 4JFEA 4JFQA 3TO2A 3IXAA 1M05A 1Q94A 3FT3A 1W0VA 4LNRA 5C0GA 1QRNA 3CDGA 1N5AA 1RK0A 3UBXA 1QO3A 3L3KA 1S8DA 3TVMA 1C16A 3BO8A 3L3DA 3O3BA 4PJCA 4HWZA 3P4NA 1L8JA 1VACA 2NW3A 4HUWA 3FTGA 4ZUTA 3GMRA 3QUXA 3M17A 4QRTA 3V5DA 4WWKC 2BCKA 1KPUA 2CKBH 3MRIA 4G43A 4XXCA 4E5XA 4NO3A 1KPVA 2ZOLA 1I7TA 4GUPA 3RGVC 1MWAH 4F7CA 1QVOA 3SJVA 2YPLA 4U1SA 1DUYA 5EUOA 1S7QA 1JGDA 2P5EA 4L29A 4PJ9A 5E6IC 5MENA 1SYVA 4FTVA 5L2JA 5SWSA 3VFMA 1EXUA 2PO6A 5BS0A 4ELMA 2PYEA 4WDIA 3RWHA 1EEYA 1LQVA 4HV8A 2VLLA 3BH8A 5GSRA 1A1MA 3QQ3A 4MJ5A 3B6SA 1AGBA 1FFNA 1GZQA 2X4OA 3LN5A 1T7XA 3VWJA 2GJ6A 3CC5A 4EUPA 1RJYA 1FG2A 3B3IA 2YPKA 5HGBA 3DX6A 1ZVSA 4I4WA 5IB2A 2X4UA 3MREA 5H94A 5ISZA 3SDAA 1IM9A 3TPUE 3WS6A 4QOKA 3WLBA 1GZPA 4LHUA 3D2UA 3X14A 4MJIA 5BRZA 1XH3A 4N5EA 3MRCA 1AO7A 5GSVA 1T1ZA 3VFPA 5C0CA 3OX8A 5EO1A 1RJZA 2FO4A 3PWVA 4NHUE 1ED3A 4ZAKA 3H7BA 5INDA 3BEVA 1HHIA 3QUKA 4LCYA 1T7ZA 3M1BA 2GTWA 4WW2C 3RL2A 3VWKA 1MHCA 1N59A 3QI9A 1K5NA 2AXGA 1DDHA 3DBXA 5D2NA 3P4OA 4ZUUA 3AU1A 3ILPA 3LV3A 5EFIA 5FA4A 5HGHA 1YDPA 3FQWA 4I48A 2FIKA 4JQXA 4PGCA 3P9MA 4U1LA 1JPFA 2ESVA 5HHQA 3VFTA 3WL9A 1TMCA 3BGMA 5C0FA 1KJ2H 4U1HA 5JHDA 2BNQA 3TBWA 4X6DA 1T7YA 4L9LC 2H6PA 3V5KA 3VFWA 3PWLA 1NEZA 4UQ3A 5B39A 1XZ0A 2DYPA 4JQVA 3X13A 1ZS8A 4MS8A 4U6XA 3KWWA 5INCA 3JVGA 3UTSA 3MV7A 4G9FA 1DE4A 5EOTA 4NNYA 4L8SC 3MV9A 3KPSA 5F7DA 2F53A 3RZCA 3O3AA 3SCMA 1JF1A 5E8OA 4CVZA 1OGAA 2ZOKA 3DTXA 3BZEA 3ARDA 2AV7A 2X4NA 5EU4A 2AXFA 1ONQA 1JE6A 3SDDA 3QULA 5FA3A 5C0BA 3AM8A 5EO0A 1T20A 1VGKA 3VXPA 5HYJA 3FT4A 1FFOA 3CH1A 1CG9A 4PJ8A 5IM7A 5F9JA 1BZ9A 5MEOA 3MRFA 1RK1A 2V2WA 1YPZA 4IIQC 2X4SA 3SKMA 4N8VA 4Y4KA 3O8XA 4IHOA 1UXWA 2CLVA 3PWPA 3BEWA 1T21A 3MGTA 3MRJA 1FZJA 1LEGA 1FZMA 1K8DA 1BD2A 1W72A 3KPOA 1FZKA 2AK4A 5HHOA
chains in the Genus database with same CATH superfamily
1LD9A 4PV8A 5AD0A 5FKPA 1G7PA 5HGDA 4F7TA 4G59C 2V2XA 3KXFA 3O9WA 3QFDA 2A83A 4U1MA 5BXFA 3D25A 3FQUA 3E6HA 4PJFA 3LN4A 3QUZA 3GMPA 5C0AA 3H9HA 1N2RA 1S7XA 1S7UA 1AGDA 3KLAA 3GJFA 1T1YA 4HX1A 3BVNA 3HE7A 5C09A 1LP9A 1QQDA 1OF2A 3FQRA 3KPMA 5D5MA 1P1ZA 4BKWA 2GUOA 3UPRA 4LCCC 1UQSA 3I0TA 4G8GA 5HHMA 4L4VA 4NQCA 3FT2A 4O2FA 4MJ6A 2VE6A 3VFSA 3TFKA 1G7QA 3SDCA 3FOMA 4IRJA 3FOLA 4GKSA 5F1IA 1FZOA 3KYNA 5EU3A 4WU7A 1INQA 3MRPA 3L9RA 3DMMA 4PJGA 4X6EA 1U58A 3FFCA 1KPRA 4NSKA 3VXRA 3MA7A 4PJXA 1PQZA 2VABA 3TF7A 3FQTA 3CVHA 3LKPA 3VXOA 3MR9A 4L4TA 3I6LD 5C07A 1QSEA 3P73A 1BQHA 2XFXA 4WJ5A 3ES6A 4NO2A 4E0RA 1JFMA 2BSTA 2HJLA 3QQ4A 5E9DA 2FWOA 1S9YA 3SKOA 4D0CA 2WY3A 3I6KA 2GT9A 4F7EA 4HUUA 3JTTA 4UQ2A 1VADA 1FFPA 3JTCA 4MNGA 3ARBA 3HPJA 3GIVA 1T80A 3KPLA 1I7UA 2BNRA 5SWZA 5J6HA 4NO0A 1T7WA 1ZHBA 1YN6A 5C0EA 4PDCE 1ZHNA 2H26A 1I1AA 4NO5A 1AGEA 1R3HA 3GSXA 4ZUWA 2NX5A 5BJTA 2YEZA 3REWA 5C9JA 3WUWA 1I1FA 2GAZA 3V5HA 1T22A 3BUYA 4PGDA 1XR9A 1Z5LA 3RWDA 3VH8A 1KTLA 4V3DB 4F7MA 3P9LA 3MYJA 5L2KA 4Z77A 4NQXA 5IROA 2C7UA 3ROLA 1AGFA 3RWJA 3DXAA 3HLAA 5MERA 4N0UA 4JRYA 3ERYA 5IB5A 4U6YA 1TVHA 4PRPA 4Y4FA 1A9BA 3BXNA 3O3DA 2BSRA 4PRIA 3P77A 5D7JC 5EU6A 3VFOA 4Z76A 4PRNA 1KCGC 1YN7A 4MQ7A 5IVXA 3JTSA 3VFNA 4HS3A 3RWGA 5DEGA 2F54A 4NQDA 1HHGA 4K71B 3MRKA 2VLRA 1IM3A 4HUXA 4MVBA 3BH9A 4X6CA 2BVQA 4ZUSA 5J6GA 3GSNH 3G08A 4EN3C 2VAAA 4X6FA 5ACZA 3IT8D 3KPNA 4PG9A 1HHHA 4PJIA 5SWQA 1MI5A 5DEFA 3FRUA 5IB3A 3LKRA 1S7WA 2AKRA 2HLAA 3FQNA 3DX8A 4PP8C 3MRHA 1T1WA 1LK2A 1T0MA 1QLFA 4QRPA 1LEKA 5D2LA 2X4RA 1ZT4A 3CPLA 1HSBA 3QDMA 3T8XA 1KBGH 4NT6A 3ROOA 3LKNA 3UTTA 4L8BA 1A1OA 3BP7A 4G59A 3CZFA 4O2CA 3PWNA 1HYRC 4PJ7A 1ZT7A 4MXQA 3TA3A 3VXMA 4QRRA 3MRQA 2E7LE 3TN0A 4PRBA 2FZ3A 4EI5A 4JFPA 3TBTA 3MRLA 2VLJA 1S9WA 1I1YA 3HG1A 4PRDA 3L3IA 2F74A 4PJ5A 3QEQA 2D31A 3BP4A 5IB1A 2GTZA 4HUVA 4PRAA 3FQXA 3BW9A 3L3GA 5HHNA 3SDXA 2IA1A 1B0RA 2O5NA 1JGEA 3PWJA 4PJBA 3KPQA 2HJKA 5D7IA 3ARGA 2BSSA 3MRDA 4IRSA 3MV8A 1T1XA 2CLZA 2JCCA 4L3CA 4PJAA 1N3NA 4APQA 1ZT1A 3S6CA 1ZSDA 4QRUA 3RUGA 3GSQA 1E28A 4CVXA 1S7RA 3MROA 4MNQA 4NNXA 1SYSA 1JPGA 2MHAA 4Y16A 3BHBA 4JFOA 4LCWA 3DX7A 3MGOA 3GSUA 3P4MA 4V3EB 3VRJA 5ENWA 3RTQA 5B38A 3AREA 3E6FA 3BWAA 4JRXA 5C0DA 3TBVA 1CD1A 4FFEX 1HHJA 1KJVA 4QRSA 4F7PA 3GMLA 1ZHLA 3E2HA 5D7LA 3KPPA 3X11A 5C0JA 1B0GA 5EU5A 3GMOA 3VXSA 4GKNA 2CIKA 3I6GA 3RWFA 3RWEA 1UXSA 3CCHA 3GMQA 5MEQA 1E27A 4ZFZA 1AKJA 2BVPA 4MX7A 4G42A 3TZVC 3VXUA 2NYKA 3GSOA 2XPGA 3O3EA 4NQEA 1OGTA 2UWEA 3QUYA 4PJDA 4U1JA 2X4TA 1WBXA 1BIIA 1A6ZA 1MHEA 1I7RA 4PREA 3RWCA 1QSFA 3SPVA 2X4QA 3W0WA 1T7VA 4PGBA 1JHTA 3ARFA 2HN7A 4JO8A 5HGAA 3C9NA 5E00A 1EFXA 3LKOA 4N0FA 4PGEA 5FDWA 1M6OA 4JFFA 3TBYA 3HCVA 1JUFA 1S9XA 1S7SA 3HE6A 4D0BA 5C0IA 4L8CA 1EEZA 2CLRA 4WO4A 4ONOA 1WBZA 3MRGA 4U1NA 1S7VA 3GMNA 3QFJA 5C08A 3MRMA 5IB4A 2X4PA 1LDPH 2ZSWA 1X7QA 1A9EA 1W0WA 4N0CA 3OXRA 3KYOA 1KJMA 1NANH 3VXNA 3VJ6A 4PJHA 3GSWA 3LKQA 5E8PA 3NFNA 3QDJA 1P7QA 1TVBA 1QEWA 3QDGA 2BVOA 5IEKA 1P4LA 1HSAA 5E8NA 1B3JA 1AGCA 1S7TA 4WUUA 4Y2DA 2RFXA 3GSVA 3MRNA 1G6RH 4Y4HA 3GMMA 3WS3A 4G8IA 3C8KA 3D39A 1QR1A 5IEHA 1WBYA 4U1IA 2ZSVA 4O2EA 1KJ3H 3TIDA 3O4LA 3HAEA 3W39A 3D3VA 4HKJA 1DUZA 3L3JA 3TIEA 3VFUA 4S0UC 3GSRA 3QZWA 2CIIA 3PQYA 1A1NA 4QRQA 3T1FA 2VLKA 3UTQA 2FYYA 3H9SA 3PABA 4L8DA 3OV6A 3ECBA 3D18A 3VFRA 3RL1A 2J8UA 3TJHA 2OI9A 3L3HA 1ZHKA 1NAMH 4PJEA 3PWUA 5F1NA 5D9SA 3VRIA 2GITA 3ILQC 4PG2A 5MEPA 2AV1A 4WU5A 3TBSA 2Q7YA 2X70A 4PR5A 4K7FA 1HHKA 1I4FA 5HHPA 3HUJA 3VCLA 4PRHA 1ZAGA 4D0DA 3KPRA 4Z78A 4ZUVA 3X12A 1T0NA 2P5WA 3BZFA 3LKSA 5DDHA 4L3EA 5J1AA 3RWIA 3MRBA 4G9DA 3E3QA 2OL3H 1OSZA 3TO4A 3U0PA 4CW1A 1CE6A 4JFDA 1XR8A 3OXSA 4PV9A 3VFVA 4U1KA 4NQVA 3MRRA 1HOCA 3FONA 1FO0H 4JFEA 4JFQA 3TO2A 3IXAA 1M05A 1Q94A 3FT3A 1W0VA 4LNRA 5C0GA 1QRNA 3CDGA 1N5AA 1RK0A 3UBXA 1QO3A 3L3KA 1S8DA 3TVMA 1C16A 3BO8A 3L3DA 3O3BA 4PJCA 4HWZA 3P4NA 1L8JA 1VACA 2NW3A 4HUWA 3FTGA 4ZUTA 3GMRA 3QUXA 3M17A 4QRTA 3V5DA 4WWKC 2BCKA 1KPUA 2CKBH 3MRIA 4G43A 4XXCA 4E5XA 4NO3A 1KPVA 2ZOLA 1I7TA 4GUPA 3RGVC 1MWAH 4F7CA 1QVOA 3SJVA 2YPLA 4U1SA 1DUYA 5EUOA 1S7QA 1JGDA 2P5EA 4L29A 4PJ9A 5E6IC 5MENA 1SYVA 4FTVA 5L2JA 5SWSA 3VFMA 1EXUA 2PO6A 5BS0A 4ELMA 2PYEA 4WDIA 3RWHA 1EEYA 1LQVA 4HV8A 2VLLA 3BH8A 5GSRA 1A1MA 3QQ3A 4MJ5A 3B6SA 1AGBA 1FFNA 1GZQA 2X4OA 3LN5A 1T7XA 3VWJA 2GJ6A 3CC5A 4EUPA 1RJYA 1FG2A 3B3IA 2YPKA 5HGBA 3DX6A 1ZVSA 4I4WA 5IB2A 2X4UA 3MREA 5H94A 5ISZA 3SDAA 1IM9A 3TPUE 3WS6A 4QOKA 3WLBA 1GZPA 4LHUA 3D2UA 3X14A 4MJIA 5BRZA 1XH3A 4N5EA 3MRCA 1AO7A 5GSVA 1T1ZA 3VFPA 5C0CA 3OX8A 5EO1A 1RJZA 2FO4A 3PWVA 4NHUE 1ED3A 4ZAKA 3H7BA 5INDA 3BEVA 1HHIA 3QUKA 4LCYA 1T7ZA 3M1BA 2GTWA 4WW2C 3RL2A 3VWKA 1MHCA 1N59A 3QI9A 1K5NA 2AXGA 1DDHA 3DBXA 5D2NA 3P4OA 4ZUUA 3AU1A 3ILPA 3LV3A 5EFIA 5FA4A 5HGHA 1YDPA 3FQWA 4I48A 2FIKA 4JQXA 4PGCA 3P9MA 4U1LA 1JPFA 2ESVA 5HHQA 3VFTA 3WL9A 1TMCA 3BGMA 5C0FA 1KJ2H 4U1HA 5JHDA 2BNQA 3TBWA 4X6DA 1T7YA 4L9LC 2H6PA 3V5KA 3VFWA 3PWLA 1NEZA 4UQ3A 5B39A 1XZ0A 2DYPA 4JQVA 3X13A 1ZS8A 4MS8A 4U6XA 3KWWA 5INCA 3JVGA 3UTSA 3MV7A 4G9FA 1DE4A 5EOTA 4NNYA 4L8SC 3MV9A 3KPSA 5F7DA 2F53A 3RZCA 3O3AA 3SCMA 1JF1A 5E8OA 4CVZA 1OGAA 2ZOKA 3DTXA 3BZEA 3ARDA 2AV7A 2X4NA 5EU4A 2AXFA 1ONQA 1JE6A 3SDDA 3QULA 5FA3A 5C0BA 3AM8A 5EO0A 1T20A 1VGKA 3VXPA 5HYJA 3FT4A 1FFOA 3CH1A 1CG9A 4PJ8A 5IM7A 5F9JA 1BZ9A 5MEOA 3MRFA 1RK1A 2V2WA 1YPZA 4IIQC 2X4SA 3SKMA 4N8VA 4Y4KA 3O8XA 4IHOA 1UXWA 2CLVA 3PWPA 3BEWA 1T21A 3MGTA 3MRJA 1FZJA 1LEGA 1FZMA 1K8DA 1BD2A 1W72A 3KPOA 1FZKA 2AK4A 5HHOA
chains in the Genus database with same CATH topology
1LD9A 4PV8A 5AD0A 5FKPA 1G7PA 5HGDA 4F7TA 2V2XA 3KXFA 3O9WA 3QFDA 2A83A 4U1MA 5BXFA 3D25A 3FQUA 3E6HA 4PJFA 3LN4A 3QUZA 3GMPA 5C0AA 3H9HA 1N2RA 1S7XA 1S7UA 1AGDA 3KLAA 3GJFA 1T1YA 4HX1A 3BVNA 3HE7A 5C09A 1LP9A 1QQDA 1OF2A 3FQRA 3KPMA 5D5MA 1P1ZA 3UPRA 2GUOA 4LCCC 1UQSA 4G8GA 5HHMA 4L4VA 4NQCA 3FT2A 4O2FA 4MJ6A 2VE6A 3VFSA 3TFKA 1G7QA 3SDCA 3FOMA 4IRJA 3FOLA 4GKSA 5F1IA 1FZOA 3KYNA 5EU3A 4WU7A 1INQA 3MRPA 3L9RA 3DMMA 4PJGA 4X6EA 1U58A 3FFCA 1KPRA 4NSKA 3VXRA 3MA7A 4PJXA 1PQZA 2VABA 3TF7A 3FQTA 3CVHA 3LKPA 3VXOA 3MR9A 4L4TA 3I6LD 5C07A 1QSEA 3P73A 1BQHA 2XFXA 4WJ5A 3ES6A 4NO2A 4E0RA 1JFMA 2BSTA 2HJLA 3QQ4A 5E9DA 2FWOA 1S9YA 3SKOA 4D0CA 2WY3A 3I6KA 2GT9A 4F7EA 4HUUA 3JTTA 4UQ2A 1VADA 1FFPA 3JTCA 4MNGA 3ARBA 3HPJA 3GIVA 1T80A 3KPLA 1I7UA 2BNRA 5SWZA 5J6HA 4NO0A 1T7WA 1ZHBA 1YN6A 5C0EA 4PDCE 1ZHNA 2H26A 1I1AA 4NO5A 1AGEA 1R3HA 3GSXA 4ZUWA 2NX5A 5BJTA 2YEZA 3REWA 5C9JA 3WUWA 1I1FA 2GAZA 3V5HA 3BUYA 1T22A 4PGDA 1XR9A 1Z5LA 3RWDA 3VH8A 1KTLA 4V3DB 4F7MA 3P9LA 3MYJA 5L2KA 4Z77A 4NQXA 5IROA 2C7UA 3ROLA 1AGFA 3RWJA 3DXAA 3HLAA 5MERA 4N0UA 4JRYA 3ERYA 5IB5A 4U6YA 1TVHA 4PRPA 4Y4FA 1A9BA 3BXNA 3O3DA 2BSRA 4PRIA 3P77A 5D7JC 5EU6A 3VFOA 4Z76A 4PRNA 1KCGC 1YN7A 4MQ7A 5IVXA 3JTSA 3VFNA 4HS3A 3RWGA 5DEGA 2F54A 4NQDA 1HHGA 4K71B 3MRKA 2VLRA 1IM3A 4HUXA 4MVBA 3BH9A 4X6CA 2BVQA 4ZUSA 5J6GA 3GSNH 3G08A 4EN3C 2VAAA 4X6FA 5ACZA 3IT8D 3KPNA 4PG9A 1HHHA 4PJIA 5SWQA 1MI5A 5DEFA 3FRUA 5IB3A 3LKRA 1S7WA 2AKRA 2HLAA 3FQNA 3DX8A 4PP8C 3MRHA 1T1WA 1LK2A 1T0MA 1QLFA 4QRPA 1LEKA 5D2LA 2X4RA 1ZT4A 3CPLA 1HSBA 3QDMA 3T8XA 1KBGH 4NT6A 3ROOA 3LKNA 3UTTA 4L8BA 1A1OA 3BP7A 4G59A 3CZFA 4O2CA 3PWNA 1HYRC 4PJ7A 1ZT7A 4MXQA 3TA3A 3VXMA 4QRRA 3MRQA 2E7LE 3TN0A 4PRBA 2FZ3A 4EI5A 4JFPA 3TBTA 3MRLA 2VLJA 1S9WA 1I1YA 3HG1A 4PRDA 3L3IA 2F74A 4PJ5A 3QEQA 2D31A 3BP4A 5IB1A 2GTZA 4HUVA 4PRAA 3FQXA 3BW9A 3L3GA 5HHNA 3SDXA 1B0RA 1JGEA 3PWJA 4PJBA 3KPQA 2HJKA 5D7IA 3ARGA 2BSSA 3MRDA 4IRSA 3MV8A 1T1XA 2CLZA 2JCCA 4L3CA 4PJAA 1N3NA 4APQA 1ZT1A 3S6CA 1ZSDA 4QRUA 3RUGA 3GSQA 1E28A 4CVXA 1S7RA 3MROA 4MNQA 4NNXA 1SYSA 1JPGA 2MHAA 4Y16A 3BHBA 4JFOA 4LCWA 3DX7A 3MGOA 3GSUA 3P4MA 4V3EB 3VRJA 5ENWA 3RTQA 5B38A 3AREA 3E6FA 3BWAA 4JRXA 5C0DA 3TBVA 1CD1A 4FFEX 1HHJA 1KJVA 4QRSA 4F7PA 3GMLA 1ZHLA 3E2HA 5D7LA 3KPPA 3X11A 5C0JA 1B0GA 5EU5A 3GMOA 3VXSA 4GKNA 2CIKA 3I6GA 3RWFA 3RWEA 1UXSA 3CCHA 3GMQA 5MEQA 1E27A 4ZFZA 1AKJA 2BVPA 4MX7A 4G42A 3TZVC 3VXUA 3GSOA 2XPGA 3O3EA 4NQEA 1OGTA 2UWEA 3QUYA 4PJDA 4U1JA 2X4TA 1WBXA 1BIIA 1A6ZA 1MHEA 1I7RA 4PREA 3RWCA 1QSFA 3SPVA 2X4QA 3W0WA 1T7VA 4PGBA 1JHTA 3ARFA 2HN7A 5HGAA 3C9NA 5E00A 1EFXA 3LKOA 4N0FA 4PGEA 5FDWA 1M6OA 4JFFA 3TBYA 3HCVA 1JUFA 1S9XA 1S7SA 3HE6A 4D0BA 5C0IA 4L8CA 1EEZA 2CLRA 4WO4A 4ONOA 1WBZA 3MRGA 4U1NA 1S7VA 3GMNA 3QFJA 5C08A 3MRMA 5IB4A 2X4PA 1LDPH 2ZSWA 1X7QA 1A9EA 1W0WA 4N0CA 3OXRA 3KYOA 1KJMA 1NANH 3VXNA 3VJ6A 4PJHA 3GSWA 3LKQA 5E8PA 3NFNA 3QDJA 1P7QA 1TVBA 1QEWA 3QDGA 2BVOA 5IEKA 1P4LA 1HSAA 5E8NA 1B3JA 1AGCA 1S7TA 4WUUA 4Y2DA 2RFXA 3GSVA 3MRNA 1G6RH 4Y4HA 3GMMA 3WS3A 4G8IA 3C8KA 3D39A 1QR1A 5IEHA 1WBYA 4U1IA 2ZSVA 4O2EA 1KJ3H 3TIDA 3O4LA 3HAEA 3W39A 3D3VA 4HKJA 1DUZA 3L3JA 3TIEA 3VFUA 4S0UC 3GSRA 3QZWA 2CIIA 3PQYA 1A1NA 4QRQA 3T1FA 2VLKA 3UTQA 2FYYA 3H9SA 3PABA 4L8DA 3OV6A 3ECBA 3D18A 3VFRA 3RL1A 2J8UA 3TJHA 2OI9A 3L3HA 1ZHKA 1NAMH 4PJEA 3PWUA 5F1NA 5D9SA 3VRIA 2GITA 3ILQC 4PG2A 5MEPA 2AV1A 4WU5A 3TBSA 2Q7YA 2X70A 4PR5A 4K7FA 1HHKA 1I4FA 5HHPA 3HUJA 3VCLA 4PRHA 1ZAGA 4D0DA 3KPRA 4Z78A 4ZUVA 3X12A 1T0NA 2P5WA 3BZFA 3LKSA 5DDHA 4L3EA 5J1AA 3RWIA 3MRBA 4G9DA 3E3QA 2OL3H 1OSZA 3TO4A 3U0PA 4CW1A 1CE6A 4JFDA 1XR8A 3OXSA 4PV9A 3VFVA 4U1KA 4NQVA 3MRRA 1HOCA 3FONA 1FO0H 4JFEA 4JFQA 3TO2A 3IXAA 1M05A 1Q94A 3FT3A 1W0VA 4LNRA 5C0GA 1QRNA 3CDGA 1N5AA 1RK0A 3UBXA 1QO3A 3L3KA 1S8DA 3TVMA 1C16A 3BO8A 3L3DA 3O3BA 4PJCA 4HWZA 3P4NA 1L8JA 1VACA 2NW3A 4HUWA 3FTGA 4ZUTA 3GMRA 3QUXA 3M17A 4QRTA 3V5DA 4WWKC 2BCKA 1KPUA 2CKBH 3MRIA 4G43A 4XXCA 4E5XA 4NO3A 1KPVA 2ZOLA 1I7TA 4GUPA 3RGVC 1MWAH 4F7CA 1QVOA 3SJVA 2YPLA 4U1SA 1DUYA 5EUOA 1S7QA 1JGDA 2P5EA 4L29A 4PJ9A 5E6IC 5MENA 1SYVA 4FTVA 5L2JA 5SWSA 3VFMA 1EXUA 2PO6A 5BS0A 4ELMA 2PYEA 4WDIA 3RWHA 1EEYA 1LQVA 4HV8A 2VLLA 3BH8A 5GSRA 1A1MA 3QQ3A 4MJ5A 3B6SA 1AGBA 1FFNA 1GZQA 2X4OA 3LN5A 1T7XA 3VWJA 2GJ6A 3CC5A 4EUPA 1RJYA 1FG2A 3B3IA 2YPKA 5HGBA 3DX6A 1ZVSA 4I4WA 5IB2A 2X4UA 3MREA 5H94A 5ISZA 3SDAA 1IM9A 3TPUE 3WS6A 4QOKA 3WLBA 1GZPA 4LHUA 3D2UA 3X14A 4MJIA 5BRZA 1XH3A 4N5EA 3MRCA 1AO7A 5GSVA 1T1ZA 3VFPA 5C0CA 3OX8A 5EO1A 1RJZA 2FO4A 3PWVA 4NHUE 1ED3A 4ZAKA 3H7BA 5INDA 3BEVA 1HHIA 3QUKA 4LCYA 1T7ZA 3M1BA 2GTWA 4WW2C 3RL2A 3VWKA 1MHCA 1N59A 3QI9A 1K5NA 2AXGA 1DDHA 3DBXA 5D2NA 3P4OA 4ZUUA 3AU1A 3ILPA 3LV3A 5EFIA 5FA4A 5HGHA 1YDPA 3FQWA 4I48A 2FIKA 4JQXA 4PGCA 3P9MA 4U1LA 1JPFA 2ESVA 5HHQA 3VFTA 3WL9A 1TMCA 3BGMA 5C0FA 1KJ2H 4U1HA 5JHDA 2BNQA 3TBWA 4X6DA 1T7YA 4L9LC 2H6PA 3V5KA 3VFWA 3PWLA 1NEZA 4UQ3A 5B39A 1XZ0A 2DYPA 4JQVA 3X13A 1ZS8A 4MS8A 4U6XA 3KWWA 5INCA 3JVGA 3UTSA 3MV7A 4G9FA 1DE4A 5EOTA 4NNYA 4L8SC 3MV9A 3KPSA 5F7DA 2F53A 3RZCA 3O3AA 3SCMA 1JF1A 5E8OA 4CVZA 1OGAA 2ZOKA 3DTXA 3BZEA 3ARDA 2AV7A 2X4NA 5EU4A 2AXFA 1ONQA 1JE6A 3SDDA 3QULA 5FA3A 5C0BA 3AM8A 5EO0A 1T20A 1VGKA 3VXPA 5HYJA 3FT4A 1FFOA 3CH1A 1CG9A 4PJ8A 5IM7A 5F9JA 1BZ9A 5MEOA 3MRFA 1RK1A 2V2WA 1YPZA 4IIQC 2X4SA 3SKMA 4N8VA 4Y4KA 3O8XA 4IHOA 1UXWA 2CLVA 3PWPA 3BEWA 1T21A 3MGTA 3MRJA 1FZJA 1LEGA 1FZMA 1K8DA 1BD2A 1W72A 3KPOA 1FZKA 2AK4A 5HHOA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1LD9 A;  4PV8 A;  5AD0 A;  5FKP A;  1G7P A;  5HGD A;  4F7T A;  2V2X A;  3KXF A;  3O9W A;  3QFD A;  2A83 A;  4U1M A;  5BXF A;  3D25 A;  3FQU A;  3E6H A;  4PJF A;  3LN4 A;  3QUZ A;  3GMP A;  5C0A A;  3H9H A;  1N2R A;  1S7X A;  1S7U A;  1AGD A;  3KLA A;  3GJF A;  1T1Y A;  4HX1 A;  3BVN A;  3HE7 A;  5C09 A;  1LP9 A;  1QQD A;  1OF2 A;  3FQR A;  3KPM A;  5D5M A;  1P1Z A;  3UPR A;  2GUO A;  4LCC C;  1UQS A;  4G8G A;  5HHM A;  4L4V A;  4NQC A;  3FT2 A;  4O2F A;  4MJ6 A;  2VE6 A;  3VFS A;  3TFK A;  1G7Q A;  3SDC A;  3FOM A;  4IRJ A;  3FOL A;  4GKS A;  5F1I A;  1FZO A;  3KYN A;  5EU3 A;  4WU7 A;  1INQ A;  3MRP A;  3L9R A;  3DMM A;  4PJG A;  4X6E A;  1U58 A;  3FFC A;  1KPR A;  4NSK A;  3VXR A;  3MA7 A;  4PJX A;  1PQZ A;  2VAB A;  3TF7 A;  3FQT A;  3CVH A;  3LKP A;  3VXO A;  3MR9 A;  4L4T A;  3I6L D;  5C07 A;  1QSE A;  3P73 A;  1BQH A;  2XFX A;  4WJ5 A;  3ES6 A;  4NO2 A;  4E0R A;  1JFM A;  2BST A;  2HJL A;  3QQ4 A;  5E9D A;  2FWO A;  1S9Y A;  3SKO A;  4D0C A;  2WY3 A;  3I6K A;  2GT9 A;  4F7E A;  4HUU A;  3JTT A;  4UQ2 A;  1VAD A;  1FFP A;  3JTC A;  4MNG A;  3ARB A;  3HPJ A;  3GIV A;  1T80 A;  3KPL A;  1I7U A;  2BNR A;  5SWZ A;  5J6H A;  4NO0 A;  1T7W A;  1ZHB A;  1YN6 A;  5C0E A;  4PDC E;  1ZHN A;  2H26 A;  1I1A A;  4NO5 A;  1AGE A;  1R3H A;  3GSX A;  4ZUW A;  2NX5 A;  5BJT A;  2YEZ A;  3REW A;  5C9J A;  3WUW A;  1I1F A;  2GAZ A;  3V5H A;  3BUY A;  1T22 A;  4PGD A;  1XR9 A;  1Z5L A;  3RWD A;  3VH8 A;  1KTL A;  4V3D B;  4F7M A;  3P9L A;  3MYJ A;  5L2K A;  4Z77 A;  4NQX A;  5IRO A;  2C7U A;  3ROL A;  1AGF A;  3RWJ A;  3DXA A;  3HLA A;  5MER A;  4N0U A;  4JRY A;  3ERY A;  5IB5 A;  4U6Y A;  1TVH A;  4PRP A;  4Y4F A;  1A9B A;  3BXN A;  3O3D A;  2BSR A;  4PRI A;  3P77 A;  5D7J C;  5EU6 A;  3VFO A;  4Z76 A;  4PRN A;  1KCG C;  1YN7 A;  4MQ7 A;  5IVX A;  3JTS A;  3VFN A;  4HS3 A;  3RWG A;  5DEG A;  2F54 A;  4NQD A;  1HHG A;  4K71 B;  3MRK A;  2VLR A;  1IM3 A;  4HUX A;  4MVB A;  3BH9 A;  4X6C A;  2BVQ A;  4ZUS A;  5J6G A;  3GSN H;  3G08 A;  4EN3 C;  2VAA A;  4X6F A;  5ACZ A;  3IT8 D;  3KPN A;  4PG9 A;  1HHH A;  4PJI A;  5SWQ A;  1MI5 A;  5DEF A;  3FRU A;  5IB3 A;  3LKR A;  1S7W A;  2AKR A;  2HLA A;  3FQN A;  3DX8 A;  4PP8 C;  3MRH A;  1T1W A;  1LK2 A;  1T0M A;  1QLF A;  4QRP A;  1LEK A;  5D2L A;  2X4R A;  1ZT4 A;  3CPL A;  1HSB A;  3QDM A;  3T8X A;  1KBG H;  4NT6 A;  3ROO A;  3LKN A;  3UTT A;  4L8B A;  1A1O A;  3BP7 A;  4G59 A;  3CZF A;  4O2C A;  3PWN A;  1HYR C;  4PJ7 A;  1ZT7 A;  4MXQ A;  3TA3 A;  3VXM A;  4QRR A;  3MRQ A;  2E7L E;  3TN0 A;  4PRB A;  2FZ3 A;  4EI5 A;  4JFP A;  3TBT A;  3MRL A;  2VLJ A;  1S9W A;  1I1Y A;  3HG1 A;  4PRD A;  3L3I A;  2F74 A;  4PJ5 A;  3QEQ A;  2D31 A;  3BP4 A;  5IB1 A;  2GTZ A;  4HUV A;  4PRA A;  3FQX A;  3BW9 A;  3L3G A;  5HHN A;  3SDX A;  1B0R A;  1JGE A;  3PWJ A;  4PJB A;  3KPQ A;  2HJK A;  5D7I A;  3ARG A;  2BSS A;  3MRD A;  4IRS A;  3MV8 A;  1T1X A;  2CLZ A;  2JCC A;  4L3C A;  4PJA A;  1N3N A;  4APQ A;  1ZT1 A;  3S6C A;  1ZSD A;  4QRU A;  3RUG A;  3GSQ A;  1E28 A;  4CVX A;  1S7R A;  3MRO A;  4MNQ A;  4NNX A;  1SYS A;  1JPG A;  2MHA A;  4Y16 A;  3BHB A;  4JFO A;  4LCW A;  3DX7 A;  3MGO A;  3GSU A;  3P4M A;  4V3E B;  3VRJ A;  5ENW A;  3RTQ A;  5B38 A;  3ARE A;  3E6F A;  3BWA A;  4JRX A;  5C0D A;  3TBV A;  1CD1 A;  4FFE X;  1HHJ A;  1KJV A;  4QRS A;  4F7P A;  3GML A;  1ZHL A;  3E2H A;  5D7L A;  3KPP A;  3X11 A;  5C0J A;  1B0G A;  5EU5 A;  3GMO A;  3VXS A;  4GKN A;  2CIK A;  3I6G A;  3RWF A;  3RWE A;  1UXS A;  3CCH A;  3GMQ A;  5MEQ A;  1E27 A;  4ZFZ A;  1AKJ A;  2BVP A;  4MX7 A;  4G42 A;  3TZV C;  3VXU A;  3GSO A;  2XPG A;  3O3E A;  4NQE A;  1OGT A;  2UWE A;  3QUY A;  4PJD A;  4U1J A;  2X4T A;  1WBX A;  1BII A;  1A6Z A;  1MHE A;  1I7R A;  4PRE A;  3RWC A;  1QSF A;  3SPV A;  2X4Q A;  3W0W A;  1T7V A;  4PGB A;  1JHT A;  3ARF A;  2HN7 A;  5HGA A;  3C9N A;  5E00 A;  1EFX A;  3LKO A;  4N0F A;  4PGE A;  5FDW A;  1M6O A;  4JFF A;  3TBY A;  3HCV A;  1JUF A;  1S9X A;  1S7S A;  3HE6 A;  4D0B A;  5C0I A;  4L8C A;  1EEZ A;  2CLR A;  4WO4 A;  4ONO A;  1WBZ A;  3MRG A;  4U1N A;  1S7V A;  3GMN A;  3QFJ A;  5C08 A;  3MRM A;  5IB4 A;  2X4P A;  1LDP H;  2ZSW A;  1X7Q A;  1A9E A;  1W0W A;  4N0C A;  3OXR A;  3KYO A;  1KJM A;  1NAN H;  3VXN A;  3VJ6 A;  4PJH A;  3GSW A;  3LKQ A;  5E8P A;  3NFN A;  3QDJ A;  1P7Q A;  1TVB A;  1QEW A;  3QDG A;  2BVO A;  5IEK A;  1P4L A;  1HSA A;  5E8N A;  1B3J A;  1AGC A;  1S7T A;  4WUU A;  4Y2D A;  2RFX A;  3GSV A;  3MRN A;  1G6R H;  4Y4H A;  3GMM A;  3WS3 A;  4G8I A;  3C8K A;  3D39 A;  1QR1 A;  5IEH A;  1WBY A;  4U1I A;  2ZSV A;  4O2E A;  1KJ3 H;  3TID A;  3O4L A;  3HAE A;  3W39 A;  3D3V A;  4HKJ A;  1DUZ A;  3L3J A;  3TIE A;  3VFU A;  4S0U C;  3GSR A;  3QZW A;  2CII A;  3PQY A;  1A1N A;  4QRQ A;  3T1F A;  2VLK A;  3UTQ A;  2FYY A;  3H9S A;  3PAB A;  4L8D A;  3OV6 A;  3ECB A;  3D18 A;  3VFR A;  3RL1 A;  2J8U A;  3TJH A;  2OI9 A;  3L3H A;  1ZHK A;  1NAM H;  4PJE A;  3PWU A;  5F1N A;  5D9S A;  3VRI A;  2GIT A;  3ILQ C;  4PG2 A;  5MEP A;  2AV1 A;  4WU5 A;  3TBS A;  2Q7Y A;  2X70 A;  4PR5 A;  4K7F A;  1HHK A;  1I4F A;  5HHP A;  3HUJ A;  3VCL A;  4PRH A;  1ZAG A;  4D0D A;  3KPR A;  4Z78 A;  4ZUV A;  3X12 A;  1T0N A;  2P5W A;  3BZF A;  3LKS A;  5DDH A;  4L3E A;  5J1A A;  3RWI A;  3MRB A;  4G9D A;  3E3Q A;  2OL3 H;  1OSZ A;  3TO4 A;  3U0P A;  4CW1 A;  1CE6 A;  4JFD A;  1XR8 A;  3OXS A;  4PV9 A;  3VFV A;  4U1K A;  4NQV A;  3MRR A;  1HOC A;  3FON A;  1FO0 H;  4JFE A;  4JFQ A;  3TO2 A;  3IXA A;  1M05 A;  1Q94 A;  3FT3 A;  1W0V A;  4LNR A;  5C0G A;  1QRN A;  3CDG A;  1N5A A;  1RK0 A;  3UBX A;  1QO3 A;  3L3K A;  1S8D A;  3TVM A;  1C16 A;  3BO8 A;  3L3D A;  3O3B A;  4PJC A;  4HWZ A;  3P4N A;  1L8J A;  1VAC A;  2NW3 A;  4HUW A;  3FTG A;  4ZUT A;  3GMR A;  3QUX A;  3M17 A;  4QRT A;  3V5D A;  4WWK C;  2BCK A;  1KPU A;  2CKB H;  3MRI A;  4G43 A;  4XXC A;  4E5X A;  4NO3 A;  1KPV A;  2ZOL A;  1I7T A;  4GUP A;  3RGV C;  1MWA H;  4F7C A;  1QVO A;  3SJV A;  2YPL A;  4U1S A;  1DUY A;  5EUO A;  1S7Q A;  1JGD A;  2P5E A;  4L29 A;  4PJ9 A;  5E6I C;  5MEN A;  1SYV A;  4FTV A;  5L2J A;  5SWS A;  3VFM A;  1EXU A;  2PO6 A;  5BS0 A;  4ELM A;  2PYE A;  4WDI A;  3RWH A;  1EEY A;  1LQV A;  4HV8 A;  2VLL A;  3BH8 A;  5GSR A;  1A1M A;  3QQ3 A;  4MJ5 A;  3B6S A;  1AGB A;  1FFN A;  1GZQ A;  2X4O A;  3LN5 A;  1T7X A;  3VWJ A;  2GJ6 A;  3CC5 A;  4EUP A;  1RJY A;  1FG2 A;  3B3I A;  2YPK A;  5HGB A;  3DX6 A;  1ZVS A;  4I4W A;  5IB2 A;  2X4U A;  3MRE A;  5H94 A;  5ISZ A;  3SDA A;  1IM9 A;  3TPU E;  3WS6 A;  4QOK A;  3WLB A;  1GZP A;  4LHU A;  3D2U A;  3X14 A;  4MJI A;  5BRZ A;  1XH3 A;  4N5E A;  3MRC A;  1AO7 A;  5GSV A;  1T1Z A;  3VFP A;  5C0C A;  3OX8 A;  5EO1 A;  1RJZ A;  2FO4 A;  3PWV A;  4NHU E;  1ED3 A;  4ZAK A;  3H7B A;  5IND A;  3BEV A;  1HHI A;  3QUK A;  4LCY A;  1T7Z A;  3M1B A;  2GTW A;  4WW2 C;  3RL2 A;  3VWK A;  1MHC A;  1N59 A;  3QI9 A;  1K5N A;  2AXG A;  1DDH A;  3DBX A;  5D2N A;  3P4O A;  4ZUU A;  3AU1 A;  3ILP A;  3LV3 A;  5EFI A;  5FA4 A;  5HGH A;  1YDP A;  3FQW A;  4I48 A;  2FIK A;  4JQX A;  4PGC A;  3P9M A;  4U1L A;  1JPF A;  2ESV A;  5HHQ A;  3VFT A;  3WL9 A;  1TMC A;  3BGM A;  5C0F A;  1KJ2 H;  4U1H A;  5JHD A;  2BNQ A;  3TBW A;  4X6D A;  1T7Y A;  4L9L C;  2H6P A;  3V5K A;  3VFW A;  3PWL A;  1NEZ A;  4UQ3 A;  5B39 A;  1XZ0 A;  2DYP A;  4JQV A;  3X13 A;  1ZS8 A;  4MS8 A;  4U6X A;  3KWW A;  5INC A;  3JVG A;  3UTS A;  3MV7 A;  4G9F A;  1DE4 A;  5EOT A;  4NNY A;  4L8S C;  3MV9 A;  3KPS A;  5F7D A;  2F53 A;  3RZC A;  3O3A A;  3SCM A;  1JF1 A;  5E8O A;  4CVZ A;  1OGA A;  2ZOK A;  3DTX A;  3BZE A;  3ARD A;  2AV7 A;  2X4N A;  5EU4 A;  2AXF A;  1ONQ A;  1JE6 A;  3SDD A;  3QUL A;  5FA3 A;  5C0B A;  3AM8 A;  5EO0 A;  1T20 A;  1VGK A;  3VXP A;  5HYJ A;  3FT4 A;  1FFO A;  3CH1 A;  1CG9 A;  4PJ8 A;  5IM7 A;  5F9J A;  1BZ9 A;  5MEO A;  3MRF A;  1RK1 A;  2V2W A;  1YPZ A;  4IIQ C;  2X4S A;  3SKM A;  4N8V A;  4Y4K A;  3O8X A;  4IHO A;  1UXW A;  2CLV A;  3PWP A;  3BEW A;  1T21 A;  3MGT A;  3MRJ A;  1FZJ A;  1LEG A;  1FZM A;  1K8D A;  1BD2 A;  1W72 A;  3KPO A;  1FZK A;  2AK4 A;  5HHO A; 
#chains in the Genus database with same CATH topology
 1LD9 A;  4PV8 A;  5AD0 A;  5FKP A;  1G7P A;  5HGD A;  4F7T A;  4G59 C;  2V2X A;  3KXF A;  3O9W A;  3QFD A;  2A83 A;  4U1M A;  5BXF A;  3D25 A;  3FQU A;  3E6H A;  4PJF A;  3LN4 A;  3QUZ A;  3GMP A;  5C0A A;  3H9H A;  1N2R A;  1S7X A;  1S7U A;  1AGD A;  3KLA A;  3GJF A;  1T1Y A;  4HX1 A;  3BVN A;  3HE7 A;  5C09 A;  1LP9 A;  1QQD A;  1OF2 A;  3FQR A;  3KPM A;  5D5M A;  1P1Z A;  4BKW A;  2GUO A;  3UPR A;  4LCC C;  1UQS A;  3I0T A;  4G8G A;  5HHM A;  4L4V A;  4NQC A;  3FT2 A;  4O2F A;  4MJ6 A;  2VE6 A;  3VFS A;  3TFK A;  1G7Q A;  3SDC A;  3FOM A;  4IRJ A;  3FOL A;  4GKS A;  5F1I A;  1FZO A;  3KYN A;  5EU3 A;  4WU7 A;  1INQ A;  3MRP A;  3L9R A;  3DMM A;  4PJG A;  4X6E A;  1U58 A;  3FFC A;  1KPR A;  4NSK A;  3VXR A;  3MA7 A;  4PJX A;  1PQZ A;  2VAB A;  3TF7 A;  3FQT A;  3CVH A;  3LKP A;  3VXO A;  3MR9 A;  4L4T A;  3I6L D;  5C07 A;  1QSE A;  3P73 A;  1BQH A;  2XFX A;  4WJ5 A;  3ES6 A;  4NO2 A;  4E0R A;  1JFM A;  2BST A;  2HJL A;  3QQ4 A;  5E9D A;  2FWO A;  1S9Y A;  3SKO A;  4D0C A;  2WY3 A;  3I6K A;  2GT9 A;  4F7E A;  4HUU A;  3JTT A;  4UQ2 A;  1VAD A;  1FFP A;  3JTC A;  4MNG A;  3ARB A;  3HPJ A;  3GIV A;  1T80 A;  3KPL A;  1I7U A;  2BNR A;  5SWZ A;  5J6H A;  4NO0 A;  1T7W A;  1ZHB A;  1YN6 A;  5C0E A;  4PDC E;  1ZHN A;  2H26 A;  1I1A A;  4NO5 A;  1AGE A;  1R3H A;  3GSX A;  4ZUW A;  2NX5 A;  5BJT A;  2YEZ A;  3REW A;  5C9J A;  3WUW A;  1I1F A;  2GAZ A;  3V5H A;  1T22 A;  3BUY A;  4PGD A;  1XR9 A;  1Z5L A;  3RWD A;  3VH8 A;  1KTL A;  4V3D B;  4F7M A;  3P9L A;  3MYJ A;  5L2K A;  4Z77 A;  4NQX A;  5IRO A;  2C7U A;  3ROL A;  1AGF A;  3RWJ A;  3DXA A;  3HLA A;  5MER A;  4N0U A;  4JRY A;  3ERY A;  5IB5 A;  4U6Y A;  1TVH A;  4PRP A;  4Y4F A;  1A9B A;  3BXN A;  3O3D A;  2BSR A;  4PRI A;  3P77 A;  5D7J C;  5EU6 A;  3VFO A;  4Z76 A;  4PRN A;  1KCG C;  1YN7 A;  4MQ7 A;  5IVX A;  3JTS A;  3VFN A;  4HS3 A;  3RWG A;  5DEG A;  2F54 A;  4NQD A;  1HHG A;  4K71 B;  3MRK A;  2VLR A;  1IM3 A;  4HUX A;  4MVB A;  3BH9 A;  4X6C A;  2BVQ A;  4ZUS A;  5J6G A;  3GSN H;  3G08 A;  4EN3 C;  2VAA A;  4X6F A;  5ACZ A;  3IT8 D;  3KPN A;  4PG9 A;  1HHH A;  4PJI A;  5SWQ A;  1MI5 A;  5DEF A;  3FRU A;  5IB3 A;  3LKR A;  1S7W A;  2AKR A;  2HLA A;  3FQN A;  3DX8 A;  4PP8 C;  3MRH A;  1T1W A;  1LK2 A;  1T0M A;  1QLF A;  4QRP A;  1LEK A;  5D2L A;  2X4R A;  1ZT4 A;  3CPL A;  1HSB A;  3QDM A;  3T8X A;  1KBG H;  4NT6 A;  3ROO A;  3LKN A;  3UTT A;  4L8B A;  1A1O A;  3BP7 A;  4G59 A;  3CZF A;  4O2C A;  3PWN A;  1HYR C;  4PJ7 A;  1ZT7 A;  4MXQ A;  3TA3 A;  3VXM A;  4QRR A;  3MRQ A;  2E7L E;  3TN0 A;  4PRB A;  2FZ3 A;  4EI5 A;  4JFP A;  3TBT A;  3MRL A;  2VLJ A;  1S9W A;  1I1Y A;  3HG1 A;  4PRD A;  3L3I A;  2F74 A;  4PJ5 A;  3QEQ A;  2D31 A;  3BP4 A;  5IB1 A;  2GTZ A;  4HUV A;  4PRA A;  3FQX A;  3BW9 A;  3L3G A;  5HHN A;  3SDX A;  2IA1 A;  1B0R A;  2O5N A;  1JGE A;  3PWJ A;  4PJB A;  3KPQ A;  2HJK A;  5D7I A;  3ARG A;  2BSS A;  3MRD A;  4IRS A;  3MV8 A;  1T1X A;  2CLZ A;  2JCC A;  4L3C A;  4PJA A;  1N3N A;  4APQ A;  1ZT1 A;  3S6C A;  1ZSD A;  4QRU A;  3RUG A;  3GSQ A;  1E28 A;  4CVX A;  1S7R A;  3MRO A;  4MNQ A;  4NNX A;  1SYS A;  1JPG A;  2MHA A;  4Y16 A;  3BHB A;  4JFO A;  4LCW A;  3DX7 A;  3MGO A;  3GSU A;  3P4M A;  4V3E B;  3VRJ A;  5ENW A;  3RTQ A;  5B38 A;  3ARE A;  3E6F A;  3BWA A;  4JRX A;  5C0D A;  3TBV A;  1CD1 A;  4FFE X;  1HHJ A;  1KJV A;  4QRS A;  4F7P A;  3GML A;  1ZHL A;  3E2H A;  5D7L A;  3KPP A;  3X11 A;  5C0J A;  1B0G A;  5EU5 A;  3GMO A;  3VXS A;  4GKN A;  2CIK A;  3I6G A;  3RWF A;  3RWE A;  1UXS A;  3CCH A;  3GMQ A;  5MEQ A;  1E27 A;  4ZFZ A;  1AKJ A;  2BVP A;  4MX7 A;  4G42 A;  3TZV C;  3VXU A;  2NYK A;  3GSO A;  2XPG A;  3O3E A;  4NQE A;  1OGT A;  2UWE A;  3QUY A;  4PJD A;  4U1J A;  2X4T A;  1WBX A;  1BII A;  1A6Z A;  1MHE A;  1I7R A;  4PRE A;  3RWC A;  1QSF A;  3SPV A;  2X4Q A;  3W0W A;  1T7V A;  4PGB A;  1JHT A;  3ARF A;  2HN7 A;  4JO8 A;  5HGA A;  3C9N A;  5E00 A;  1EFX A;  3LKO A;  4N0F A;  4PGE A;  5FDW A;  1M6O A;  4JFF A;  3TBY A;  3HCV A;  1JUF A;  1S9X A;  1S7S A;  3HE6 A;  4D0B A;  5C0I A;  4L8C A;  1EEZ A;  2CLR A;  4WO4 A;  4ONO A;  1WBZ A;  3MRG A;  4U1N A;  1S7V A;  3GMN A;  3QFJ A;  5C08 A;  3MRM A;  5IB4 A;  2X4P A;  1LDP H;  2ZSW A;  1X7Q A;  1A9E A;  1W0W A;  4N0C A;  3OXR A;  3KYO A;  1KJM A;  1NAN H;  3VXN A;  3VJ6 A;  4PJH A;  3GSW A;  3LKQ A;  5E8P A;  3NFN A;  3QDJ A;  1P7Q A;  1TVB A;  1QEW A;  3QDG A;  2BVO A;  5IEK A;  1P4L A;  1HSA A;  5E8N A;  1B3J A;  1AGC A;  1S7T A;  4WUU A;  4Y2D A;  2RFX A;  3GSV A;  3MRN A;  1G6R H;  4Y4H A;  3GMM A;  3WS3 A;  4G8I A;  3C8K A;  3D39 A;  1QR1 A;  5IEH A;  1WBY A;  4U1I A;  2ZSV A;  4O2E A;  1KJ3 H;  3TID A;  3O4L A;  3HAE A;  3W39 A;  3D3V A;  4HKJ A;  1DUZ A;  3L3J A;  3TIE A;  3VFU A;  4S0U C;  3GSR A;  3QZW A;  2CII A;  3PQY A;  1A1N A;  4QRQ A;  3T1F A;  2VLK A;  3UTQ A;  2FYY A;  3H9S A;  3PAB A;  4L8D A;  3OV6 A;  3ECB A;  3D18 A;  3VFR A;  3RL1 A;  2J8U A;  3TJH A;  2OI9 A;  3L3H A;  1ZHK A;  1NAM H;  4PJE A;  3PWU A;  5F1N A;  5D9S A;  3VRI A;  2GIT A;  3ILQ C;  4PG2 A;  5MEP A;  2AV1 A;  4WU5 A;  3TBS A;  2Q7Y A;  2X70 A;  4PR5 A;  4K7F A;  1HHK A;  1I4F A;  5HHP A;  3HUJ A;  3VCL A;  4PRH A;  1ZAG A;  4D0D A;  3KPR A;  4Z78 A;  4ZUV A;  3X12 A;  1T0N A;  2P5W A;  3BZF A;  3LKS A;  5DDH A;  4L3E A;  5J1A A;  3RWI A;  3MRB A;  4G9D A;  3E3Q A;  2OL3 H;  1OSZ A;  3TO4 A;  3U0P A;  4CW1 A;  1CE6 A;  4JFD A;  1XR8 A;  3OXS A;  4PV9 A;  3VFV A;  4U1K A;  4NQV A;  3MRR A;  1HOC A;  3FON A;  1FO0 H;  4JFE A;  4JFQ A;  3TO2 A;  3IXA A;  1M05 A;  1Q94 A;  3FT3 A;  1W0V A;  4LNR A;  5C0G A;  1QRN A;  3CDG A;  1N5A A;  1RK0 A;  3UBX A;  1QO3 A;  3L3K A;  1S8D A;  3TVM A;  1C16 A;  3BO8 A;  3L3D A;  3O3B A;  4PJC A;  4HWZ A;  3P4N A;  1L8J A;  1VAC A;  2NW3 A;  4HUW A;  3FTG A;  4ZUT A;  3GMR A;  3QUX A;  3M17 A;  4QRT A;  3V5D A;  4WWK C;  2BCK A;  1KPU A;  2CKB H;  3MRI A;  4G43 A;  4XXC A;  4E5X A;  4NO3 A;  1KPV A;  2ZOL A;  1I7T A;  4GUP A;  3RGV C;  1MWA H;  4F7C A;  1QVO A;  3SJV A;  2YPL A;  4U1S A;  1DUY A;  5EUO A;  1S7Q A;  1JGD A;  2P5E A;  4L29 A;  4PJ9 A;  5E6I C;  5MEN A;  1SYV A;  4FTV A;  5L2J A;  5SWS A;  3VFM A;  1EXU A;  2PO6 A;  5BS0 A;  4ELM A;  2PYE A;  4WDI A;  3RWH A;  1EEY A;  1LQV A;  4HV8 A;  2VLL A;  3BH8 A;  5GSR A;  1A1M A;  3QQ3 A;  4MJ5 A;  3B6S A;  1AGB A;  1FFN A;  1GZQ A;  2X4O A;  3LN5 A;  1T7X A;  3VWJ A;  2GJ6 A;  3CC5 A;  4EUP A;  1RJY A;  1FG2 A;  3B3I A;  2YPK A;  5HGB A;  3DX6 A;  1ZVS A;  4I4W A;  5IB2 A;  2X4U A;  3MRE A;  5H94 A;  5ISZ A;  3SDA A;  1IM9 A;  3TPU E;  3WS6 A;  4QOK A;  3WLB A;  1GZP A;  4LHU A;  3D2U A;  3X14 A;  4MJI A;  5BRZ A;  1XH3 A;  4N5E A;  3MRC A;  1AO7 A;  5GSV A;  1T1Z A;  3VFP A;  5C0C A;  3OX8 A;  5EO1 A;  1RJZ A;  2FO4 A;  3PWV A;  4NHU E;  1ED3 A;  4ZAK A;  3H7B A;  5IND A;  3BEV A;  1HHI A;  3QUK A;  4LCY A;  1T7Z A;  3M1B A;  2GTW A;  4WW2 C;  3RL2 A;  3VWK A;  1MHC A;  1N59 A;  3QI9 A;  1K5N A;  2AXG A;  1DDH A;  3DBX A;  5D2N A;  3P4O A;  4ZUU A;  3AU1 A;  3ILP A;  3LV3 A;  5EFI A;  5FA4 A;  5HGH A;  1YDP A;  3FQW A;  4I48 A;  2FIK A;  4JQX A;  4PGC A;  3P9M A;  4U1L A;  1JPF A;  2ESV A;  5HHQ A;  3VFT A;  3WL9 A;  1TMC A;  3BGM A;  5C0F A;  1KJ2 H;  4U1H A;  5JHD A;  2BNQ A;  3TBW A;  4X6D A;  1T7Y A;  4L9L C;  2H6P A;  3V5K A;  3VFW A;  3PWL A;  1NEZ A;  4UQ3 A;  5B39 A;  1XZ0 A;  2DYP A;  4JQV A;  3X13 A;  1ZS8 A;  4MS8 A;  4U6X A;  3KWW A;  5INC A;  3JVG A;  3UTS A;  3MV7 A;  4G9F A;  1DE4 A;  5EOT A;  4NNY A;  4L8S C;  3MV9 A;  3KPS A;  5F7D A;  2F53 A;  3RZC A;  3O3A A;  3SCM A;  1JF1 A;  5E8O A;  4CVZ A;  1OGA A;  2ZOK A;  3DTX A;  3BZE A;  3ARD A;  2AV7 A;  2X4N A;  5EU4 A;  2AXF A;  1ONQ A;  1JE6 A;  3SDD A;  3QUL A;  5FA3 A;  5C0B A;  3AM8 A;  5EO0 A;  1T20 A;  1VGK A;  3VXP A;  5HYJ A;  3FT4 A;  1FFO A;  3CH1 A;  1CG9 A;  4PJ8 A;  5IM7 A;  5F9J A;  1BZ9 A;  5MEO A;  3MRF A;  1RK1 A;  2V2W A;  1YPZ A;  4IIQ C;  2X4S A;  3SKM A;  4N8V A;  4Y4K A;  3O8X A;  4IHO A;  1UXW A;  2CLV A;  3PWP A;  3BEW A;  1T21 A;  3MGT A;  3MRJ A;  1FZJ A;  1LEG A;  1FZM A;  1K8D A;  1BD2 A;  1W72 A;  3KPO A;  1FZK A;  2AK4 A;  5HHO A; 
#chains in the Genus database with same CATH homology
 1LD9 A;  4PV8 A;  5AD0 A;  5FKP A;  1G7P A;  5HGD A;  4F7T A;  2V2X A;  3KXF A;  3O9W A;  3QFD A;  2A83 A;  4U1M A;  5BXF A;  3D25 A;  3FQU A;  3E6H A;  4PJF A;  3LN4 A;  3QUZ A;  3GMP A;  5C0A A;  3H9H A;  1N2R A;  1S7X A;  1S7U A;  1AGD A;  3KLA A;  3GJF A;  1T1Y A;  4HX1 A;  3BVN A;  3HE7 A;  5C09 A;  1LP9 A;  1QQD A;  1OF2 A;  3FQR A;  3KPM A;  5D5M A;  1P1Z A;  3UPR A;  2GUO A;  4LCC C;  1UQS A;  4G8G A;  5HHM A;  4L4V A;  4NQC A;  3FT2 A;  4O2F A;  4MJ6 A;  2VE6 A;  3VFS A;  3TFK A;  1G7Q A;  3SDC A;  3FOM A;  4IRJ A;  3FOL A;  4GKS A;  5F1I A;  1FZO A;  3KYN A;  5EU3 A;  4WU7 A;  1INQ A;  3MRP A;  3L9R A;  3DMM A;  4PJG A;  4X6E A;  1U58 A;  3FFC A;  1KPR A;  4NSK A;  3VXR A;  3MA7 A;  4PJX A;  1PQZ A;  2VAB A;  3TF7 A;  3FQT A;  3CVH A;  3LKP A;  3VXO A;  3MR9 A;  4L4T A;  3I6L D;  5C07 A;  1QSE A;  3P73 A;  1BQH A;  2XFX A;  4WJ5 A;  3ES6 A;  4NO2 A;  4E0R A;  1JFM A;  2BST A;  2HJL A;  3QQ4 A;  5E9D A;  2FWO A;  1S9Y A;  3SKO A;  4D0C A;  2WY3 A;  3I6K A;  2GT9 A;  4F7E A;  4HUU A;  3JTT A;  4UQ2 A;  1VAD A;  1FFP A;  3JTC A;  4MNG A;  3ARB A;  3HPJ A;  3GIV A;  1T80 A;  3KPL A;  1I7U A;  2BNR A;  5SWZ A;  5J6H A;  4NO0 A;  1T7W A;  1ZHB A;  1YN6 A;  5C0E A;  4PDC E;  1ZHN A;  2H26 A;  1I1A A;  4NO5 A;  1AGE A;  1R3H A;  3GSX A;  4ZUW A;  2NX5 A;  5BJT A;  2YEZ A;  3REW A;  5C9J A;  3WUW A;  1I1F A;  2GAZ A;  3V5H A;  3BUY A;  1T22 A;  4PGD A;  1XR9 A;  1Z5L A;  3RWD A;  3VH8 A;  1KTL A;  4V3D B;  4F7M A;  3P9L A;  3MYJ A;  5L2K A;  4Z77 A;  4NQX A;  5IRO A;  2C7U A;  3ROL A;  1AGF A;  3RWJ A;  3DXA A;  3HLA A;  5MER A;  4N0U A;  4JRY A;  3ERY A;  5IB5 A;  4U6Y A;  1TVH A;  4PRP A;  4Y4F A;  1A9B A;  3BXN A;  3O3D A;  2BSR A;  4PRI A;  3P77 A;  5D7J C;  5EU6 A;  3VFO A;  4Z76 A;  4PRN A;  1KCG C;  1YN7 A;  4MQ7 A;  5IVX A;  3JTS A;  3VFN A;  4HS3 A;  3RWG A;  5DEG A;  2F54 A;  4NQD A;  1HHG A;  4K71 B;  3MRK A;  2VLR A;  1IM3 A;  4HUX A;  4MVB A;  3BH9 A;  4X6C A;  2BVQ A;  4ZUS A;  5J6G A;  3GSN H;  3G08 A;  4EN3 C;  2VAA A;  4X6F A;  5ACZ A;  3IT8 D;  3KPN A;  4PG9 A;  1HHH A;  4PJI A;  5SWQ A;  1MI5 A;  5DEF A;  3FRU A;  5IB3 A;  3LKR A;  1S7W A;  2AKR A;  2HLA A;  3FQN A;  3DX8 A;  4PP8 C;  3MRH A;  1T1W A;  1LK2 A;  1T0M A;  1QLF A;  4QRP A;  1LEK A;  5D2L A;  2X4R A;  1ZT4 A;  3CPL A;  1HSB A;  3QDM A;  3T8X A;  1KBG H;  4NT6 A;  3ROO A;  3LKN A;  3UTT A;  4L8B A;  1A1O A;  3BP7 A;  4G59 A;  3CZF A;  4O2C A;  3PWN A;  1HYR C;  4PJ7 A;  1ZT7 A;  4MXQ A;  3TA3 A;  3VXM A;  4QRR A;  3MRQ A;  2E7L E;  3TN0 A;  4PRB A;  2FZ3 A;  4EI5 A;  4JFP A;  3TBT A;  3MRL A;  2VLJ A;  1S9W A;  1I1Y A;  3HG1 A;  4PRD A;  3L3I A;  2F74 A;  4PJ5 A;  3QEQ A;  2D31 A;  3BP4 A;  5IB1 A;  2GTZ A;  4HUV A;  4PRA A;  3FQX A;  3BW9 A;  3L3G A;  5HHN A;  3SDX A;  1B0R A;  1JGE A;  3PWJ A;  4PJB A;  3KPQ A;  2HJK A;  5D7I A;  3ARG A;  2BSS A;  3MRD A;  4IRS A;  3MV8 A;  1T1X A;  2CLZ A;  2JCC A;  4L3C A;  4PJA A;  1N3N A;  4APQ A;  1ZT1 A;  3S6C A;  1ZSD A;  4QRU A;  3RUG A;  3GSQ A;  1E28 A;  4CVX A;  1S7R A;  3MRO A;  4MNQ A;  4NNX A;  1SYS A;  1JPG A;  2MHA A;  4Y16 A;  3BHB A;  4JFO A;  4LCW A;  3DX7 A;  3MGO A;  3GSU A;  3P4M A;  4V3E B;  3VRJ A;  5ENW A;  3RTQ A;  5B38 A;  3ARE A;  3E6F A;  3BWA A;  4JRX A;  5C0D A;  3TBV A;  1CD1 A;  4FFE X;  1HHJ A;  1KJV A;  4QRS A;  4F7P A;  3GML A;  1ZHL A;  3E2H A;  5D7L A;  3KPP A;  3X11 A;  5C0J A;  1B0G A;  5EU5 A;  3GMO A;  3VXS A;  4GKN A;  2CIK A;  3I6G A;  3RWF A;  3RWE A;  1UXS A;  3CCH A;  3GMQ A;  5MEQ A;  1E27 A;  4ZFZ A;  1AKJ A;  2BVP A;  4MX7 A;  4G42 A;  3TZV C;  3VXU A;  3GSO A;  2XPG A;  3O3E A;  4NQE A;  1OGT A;  2UWE A;  3QUY A;  4PJD A;  4U1J A;  2X4T A;  1WBX A;  1BII A;  1A6Z A;  1MHE A;  1I7R A;  4PRE A;  3RWC A;  1QSF A;  3SPV A;  2X4Q A;  3W0W A;  1T7V A;  4PGB A;  1JHT A;  3ARF A;  2HN7 A;  5HGA A;  3C9N A;  5E00 A;  1EFX A;  3LKO A;  4N0F A;  4PGE A;  5FDW A;  1M6O A;  4JFF A;  3TBY A;  3HCV A;  1JUF A;  1S9X A;  1S7S A;  3HE6 A;  4D0B A;  5C0I A;  4L8C A;  1EEZ A;  2CLR A;  4WO4 A;  4ONO A;  1WBZ A;  3MRG A;  4U1N A;  1S7V A;  3GMN A;  3QFJ A;  5C08 A;  3MRM A;  5IB4 A;  2X4P A;  1LDP H;  2ZSW A;  1X7Q A;  1A9E A;  1W0W A;  4N0C A;  3OXR A;  3KYO A;  1KJM A;  1NAN H;  3VXN A;  3VJ6 A;  4PJH A;  3GSW A;  3LKQ A;  5E8P A;  3NFN A;  3QDJ A;  1P7Q A;  1TVB A;  1QEW A;  3QDG A;  2BVO A;  5IEK A;  1P4L A;  1HSA A;  5E8N A;  1B3J A;  1AGC A;  1S7T A;  4WUU A;  4Y2D A;  2RFX A;  3GSV A;  3MRN A;  1G6R H;  4Y4H A;  3GMM A;  3WS3 A;  4G8I A;  3C8K A;  3D39 A;  1QR1 A;  5IEH A;  1WBY A;  4U1I A;  2ZSV A;  4O2E A;  1KJ3 H;  3TID A;  3O4L A;  3HAE A;  3W39 A;  3D3V A;  4HKJ A;  1DUZ A;  3L3J A;  3TIE A;  3VFU A;  4S0U C;  3GSR A;  3QZW A;  2CII A;  3PQY A;  1A1N A;  4QRQ A;  3T1F A;  2VLK A;  3UTQ A;  2FYY A;  3H9S A;  3PAB A;  4L8D A;  3OV6 A;  3ECB A;  3D18 A;  3VFR A;  3RL1 A;  2J8U A;  3TJH A;  2OI9 A;  3L3H A;  1ZHK A;  1NAM H;  4PJE A;  3PWU A;  5F1N A;  5D9S A;  3VRI A;  2GIT A;  3ILQ C;  4PG2 A;  5MEP A;  2AV1 A;  4WU5 A;  3TBS A;  2Q7Y A;  2X70 A;  4PR5 A;  4K7F A;  1HHK A;  1I4F A;  5HHP A;  3HUJ A;  3VCL A;  4PRH A;  1ZAG A;  4D0D A;  3KPR A;  4Z78 A;  4ZUV A;  3X12 A;  1T0N A;  2P5W A;  3BZF A;  3LKS A;  5DDH A;  4L3E A;  5J1A A;  3RWI A;  3MRB A;  4G9D A;  3E3Q A;  2OL3 H;  1OSZ A;  3TO4 A;  3U0P A;  4CW1 A;  1CE6 A;  4JFD A;  1XR8 A;  3OXS A;  4PV9 A;  3VFV A;  4U1K A;  4NQV A;  3MRR A;  1HOC A;  3FON A;  1FO0 H;  4JFE A;  4JFQ A;  3TO2 A;  3IXA A;  1M05 A;  1Q94 A;  3FT3 A;  1W0V A;  4LNR A;  5C0G A;  1QRN A;  3CDG A;  1N5A A;  1RK0 A;  3UBX A;  1QO3 A;  3L3K A;  1S8D A;  3TVM A;  1C16 A;  3BO8 A;  3L3D A;  3O3B A;  4PJC A;  4HWZ A;  3P4N A;  1L8J A;  1VAC A;  2NW3 A;  4HUW A;  3FTG A;  4ZUT A;  3GMR A;  3QUX A;  3M17 A;  4QRT A;  3V5D A;  4WWK C;  2BCK A;  1KPU A;  2CKB H;  3MRI A;  4G43 A;  4XXC A;  4E5X A;  4NO3 A;  1KPV A;  2ZOL A;  1I7T A;  4GUP A;  3RGV C;  1MWA H;  4F7C A;  1QVO A;  3SJV A;  2YPL A;  4U1S A;  1DUY A;  5EUO A;  1S7Q A;  1JGD A;  2P5E A;  4L29 A;  4PJ9 A;  5E6I C;  5MEN A;  1SYV A;  4FTV A;  5L2J A;  5SWS A;  3VFM A;  1EXU A;  2PO6 A;  5BS0 A;  4ELM A;  2PYE A;  4WDI A;  3RWH A;  1EEY A;  1LQV A;  4HV8 A;  2VLL A;  3BH8 A;  5GSR A;  1A1M A;  3QQ3 A;  4MJ5 A;  3B6S A;  1AGB A;  1FFN A;  1GZQ A;  2X4O A;  3LN5 A;  1T7X A;  3VWJ A;  2GJ6 A;  3CC5 A;  4EUP A;  1RJY A;  1FG2 A;  3B3I A;  2YPK A;  5HGB A;  3DX6 A;  1ZVS A;  4I4W A;  5IB2 A;  2X4U A;  3MRE A;  5H94 A;  5ISZ A;  3SDA A;  1IM9 A;  3TPU E;  3WS6 A;  4QOK A;  3WLB A;  1GZP A;  4LHU A;  3D2U A;  3X14 A;  4MJI A;  5BRZ A;  1XH3 A;  4N5E A;  3MRC A;  1AO7 A;  5GSV A;  1T1Z A;  3VFP A;  5C0C A;  3OX8 A;  5EO1 A;  1RJZ A;  2FO4 A;  3PWV A;  4NHU E;  1ED3 A;  4ZAK A;  3H7B A;  5IND A;  3BEV A;  1HHI A;  3QUK A;  4LCY A;  1T7Z A;  3M1B A;  2GTW A;  4WW2 C;  3RL2 A;  3VWK A;  1MHC A;  1N59 A;  3QI9 A;  1K5N A;  2AXG A;  1DDH A;  3DBX A;  5D2N A;  3P4O A;  4ZUU A;  3AU1 A;  3ILP A;  3LV3 A;  5EFI A;  5FA4 A;  5HGH A;  1YDP A;  3FQW A;  4I48 A;  2FIK A;  4JQX A;  4PGC A;  3P9M A;  4U1L A;  1JPF A;  2ESV A;  5HHQ A;  3VFT A;  3WL9 A;  1TMC A;  3BGM A;  5C0F A;  1KJ2 H;  4U1H A;  5JHD A;  2BNQ A;  3TBW A;  4X6D A;  1T7Y A;  4L9L C;  2H6P A;  3V5K A;  3VFW A;  3PWL A;  1NEZ A;  4UQ3 A;  5B39 A;  1XZ0 A;  2DYP A;  4JQV A;  3X13 A;  1ZS8 A;  4MS8 A;  4U6X A;  3KWW A;  5INC A;  3JVG A;  3UTS A;  3MV7 A;  4G9F A;  1DE4 A;  5EOT A;  4NNY A;  4L8S C;  3MV9 A;  3KPS A;  5F7D A;  2F53 A;  3RZC A;  3O3A A;  3SCM A;  1JF1 A;  5E8O A;  4CVZ A;  1OGA A;  2ZOK A;  3DTX A;  3BZE A;  3ARD A;  2AV7 A;  2X4N A;  5EU4 A;  2AXF A;  1ONQ A;  1JE6 A;  3SDD A;  3QUL A;  5FA3 A;  5C0B A;  3AM8 A;  5EO0 A;  1T20 A;  1VGK A;  3VXP A;  5HYJ A;  3FT4 A;  1FFO A;  3CH1 A;  1CG9 A;  4PJ8 A;  5IM7 A;  5F9J A;  1BZ9 A;  5MEO A;  3MRF A;  1RK1 A;  2V2W A;  1YPZ A;  4IIQ C;  2X4S A;  3SKM A;  4N8V A;  4Y4K A;  3O8X A;  4IHO A;  1UXW A;  2CLV A;  3PWP A;  3BEW A;  1T21 A;  3MGT A;  3MRJ A;  1FZJ A;  1LEG A;  1FZM A;  1K8D A;  1BD2 A;  1W72 A;  3KPO A;  1FZK A;  2AK4 A;  5HHO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...