4MS8A

42f3 tcr pcpb9/h-2ld complex
Total Genus 51
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
51
sequence length
176
structure length
162
Chain Sequence
MGPHSMRYYETATSPRYTSVGYVDDKEFVRFDSDAENPRYEPQVPWMEQEGPEYWERITQIAKGQEQWFRVNLRTLLGYHTLQWMYGCDVGSDGRLLRGYEQFAYDGCDYIALNEDLRTWTAADMAAQITRRKWEQAGAAEYYRAYLEGECVEWLHRYLKNG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural interplay between germline interactions and adaptive recognition determines the bandwidth of TCR-peptide-MHC cross-reactivity.
pubmed doi rcsb
source organism Mus musculus
molecule tags Immune system
molecule keywords 42F3 alpha
total genus 51
structure length 162
sequence length 176
ec nomenclature
pdb deposition date 2013-09-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00129 MHC_I Class I Histocompatibility antigen, domains alpha 1 and 2
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.500.10 Alpha Beta 2-Layer Sandwich Murine Class I Major Histocompatibility Complex, H2-DB; Chain A, domain 1 MHC class I-like antigen recognition-like 4ms8A00
1MI5A 4JFFA 4MJ5A 3QDMA 1QLFA 1BIIA 2BVOA 3E6FA 3HAEA 3X14A 4E0RA 1P4LA 2X4TA 4QOKA 4PV8A 1T0NA 1W72A 1I4FA 1RK1A 5SWZA 1A9EA 3V5HA 3RL1A 5HHOA 3C9NA 3DX8A 3E3QA 4F7PA 1CG9A 1R3HA 4V3DB 1QO3A 2RFXA 1JPGA 5D9SA 3MRBA 2VAAA 4G9FA 5C0BA 5BXFA 5GSRA 3RUGA 1AKJA 1N3NA 4CW1A 1FZJA 1TMCA 3DXAA 4JFEA 1W0WA 4L9LC 3DTXA 1A1MA 3MGTA 1HYRC 5HGHA 3H7BA 3D18A 1HOCA 2X4OA 4U1SA 3O9WA 1T1XA 3OX8A 5C0EA 2CIKA 3LKPA 4HUXA 3O3AA 1N59A 5EU4A 4D0CA 5L2KA 4ZFZA 3KPLA 2BSRA 3JTSA 4L8DA 2X4SA 1I1FA 3QFDA 4MS8A 1ZSDA 4PJAA 3PWPA 2XPGA 4Z78A 3M17A 1BZ9A 2C7UA 1SYSA 1T21A 3TBTA 2FZ3A 2GITA 3D25A 1OSZA 3PWNA 5E00A 3FQRA 2D31A 2E7LE 5B39A 1YN6A 1T7VA 2YPLA 4U1LA 1U58A 1OGTA 3FQNA 1NEZA 1HSAA 1T22A 1W0VA 1GZQA 3SKOA 1QRNA 2HLAA 2PYEA 3KPSA 1VADA 1G7QA 2F74A 2PO6A 5ENWA 3OXRA 1T80A 2MHAA 1QSFA 4Y2DA 3GMQA 1JGDA 3BUYA 3GMPA 3MRHA 3BXNA 2GAZA 4GKNA 5INDA 1ZS8A 4QRPA 1XR9A 1C16A 4O2EA 3KYNA 4PGEA 3KPNA 2BNQA 4PRIA 1TVBA 3O8XA 5MEPA 2P5WA 1KCGC 4PGCA 5HGAA 4MVBA 3BZFA 3QQ4A 5BJTA 3ARBA 1RK0A 2P5EA 4LCCC 3TO4A 4O2FA 2HN7A 3GMMA 4L8SC 4PJFA 3LKOA 1Q94A 5BRZA 1T7ZA 1ZT1A 5D7LA 1OGAA 2HJKA 4ZUUA 1T1ZA 5F9JA 4ELMA 3RWCA 3B6SA 3GMOA 3TO2A 4HUVA 5D5MA 3VFOA 1AGDA 3VXUA 4PR5A 3GSOA 3HCVA 4ZUWA 5C0AA 5E9DA 4PGBA 5EOTA 1T20A 3TBVA 2ZOLA 3RWGA 4ZUSA 2CLZA 2FYYA 2H26A 4K71B 3LKSA 4PG9A 3TA3A 1JF1A 3VXRA 5C0FA 3UTSA 4JFPA 3C8KA 3RTQA 1EEYA 3AU1A 3BW9A 3CDGA 1FO0H 5FA3A 5C07A 3P9MA 3M1BA 1QEWA 3VFVA 1VGKA 1UQSA 5INCA 4WO4A 3RZCA 5C0GA 4MNGA 4PJHA 2VLKA 3FT2A 1ED3A 3GSQA 5D2NA 3VWKA 3KYOA 3FOLA 4PJGA 1JE6A 1FZOA 3DX6A 3FFCA 4D0BA 4MJIA 3TPUE 3D2UA 5HHQA 4K7FA 4FTVA 4MX7A 1WBYA 4F7EA 4G8GA 2AXFA 3RWDA 4NQVA 1QQDA 3LN5A 3MRGA 4X6DA 5E8PA 3REWA 3SJVA 3BGMA 3SCMA 3L3IA 1A1OA 2BCKA 3CVHA 1OF2A 3MRRA 4FFEX 2VABA 3BHBA 4U6XA 3LKNA 3GJFA 4Z76A 1S9YA 4PRHA 1JFMA 1KPUA 4WU7A 3ILPA 4U1IA 3O3EA 3CZFA 5BS0A 3MRDA 1PQZA 2GTWA 1A9BA 4PG2A 3QUZA 4NQCA 4X6CA 3TIEA 3LKQA 3TVMA 3MRFA 1ZAGA 2AKRA 1KJ3H 2CIIA 3T8XA 5IROA 1T7XA 1KJMA 3P9LA 4QRUA 2X4PA 2GT9A 3PWUA 4NQXA 1YDPA 1XZ0A 4NO5A 1A6ZA 1MWAH 1I7RA 3D3VA 1HHIA 3MRPA 2BVPA 3BEVA 1HHKA 1E27A 4NNXA 4PV9A 1N5AA 2AXGA 3BP7A 3ROLA 1AGCA 3ARFA 3UPRA 5FKPA 3GIVA 3VFMA 1ZHLA 3LN4A 4GKSA 1M6OA 3V5DA 1ONQA 2GJ6A 4N0FA 4E5XA 3MRLA 3MV8A 1NAMH 1LP9A 1UXWA 3HPJA 2H6PA 3FQUA 1HSBA 3PQYA 3KPQA 4PJCA 3VH8A 3IXAA 1AGEA 4WUUA 3VWJA 5L2JA 3GMNA 1K8DA 1SYVA 4PDCE 1X7QA 1N2RA 4F7CA 3VCLA 1JPFA 1KTLA 3VXOA 4NT6A 4G42A 5IB1A 4Y16A 3MROA 3TF7A 5D7IA 4JQXA 4L4VA 5DEGA 3PWVA 3DMMA 3SDCA 4PRBA 1DUYA 1YPZA 4MNQA 4L3CA 3FRUA 4IRJA 2F53A 3MV7A 2AV1A 4U1MA 3VFWA 3BWAA 4L8CA 3I6KA 3T1FA 4QRRA 1S7WA 1UXSA 4ZUTA 1S7RA 3O3BA 3WL9A 1S7TA 1QR1A 5EU6A 2YPKA 4MJ6A 4PJ8A 2X4RA 1VACA 1FFOA 3TFKA 3PABA 3AREA 3AM8A 4IRSA 4L29A 2HJLA 3IT8D 3MGOA 4G9DA 4QRQA 1DE4A 1ZHBA 5EU3A 3GSRA 4N0CA 1FZMA 1T0MA 4HUUA 1IM9A 4JFQA 1MHEA 4U1JA 4L8BA 4QRTA 1ZHKA 2A83A 3GMRA 3HLAA 3KPRA 3L3HA 4NO2A 4WU5A 2VE6A 4Y4FA 4UQ2A 5E8NA 4UQ3A 2BVQA 2UWEA 1AO7A 3H9HA 3NFNA 5J6HA 3CCHA 3JVGA 1HHHA 4Y4HA 3GSNH 1L8JA 5F1IA 4G59A 1JGEA 1KJ2H 3P4OA 1AGBA 3X12A 4PREA 3U0PA 3RL2A 4PGDA 2BSSA 4N8VA 5SWSA 3OXSA 4G8IA 4PJXA 5EO0A 5HHMA 2CKBH 1S9XA 3MRMA 3VFUA 5C0JA 3VXMA 5ACZA 5DDHA 2YEZA 1P7QA 4PJ5A 5D2LA 3CH1A 1LDPH 1YN7A 5EFIA 2BSTA 4NO3A 3FTGA 2VLRA 2GTZA 1S7XA 4PJ7A 1LK2A 3TN0A 2VLJA 1TVHA 2ESVA 1A1NA 5IB5A 3FONA 5C9JA 1K5NA 4GUPA 1G7PA 1ZVSA 4PRDA 3P4MA 4ZUVA 3RWFA 5IEHA 3QDJA 4X6EA 3ARDA 4L3EA 4MXQA 4HKJA 1T1YA 4V3EB 3QFJA 4PRAA 5C0IA 1QVOA 3ARGA 5F7DA 3WS6A 5MENA 4U1KA 1FFPA 1WBZA 4HUWA 5C09A 3FQTA 3FT4A 4JFOA 4CVXA 4XXCA 2GUOA 1S7VA 3TBWA 3GSXA 3V5KA 3BZEA 3X13A 3D39A 3ES6A 4I48A 3PWJA 3QULA 5E6IC 3MRIA 1B0GA 4L4TA 3SPVA 3PWLA 4QRSA 4ZAKA 3MRJA 3RWEA 1M05A 3HE7A 1T1WA 5IB4A 3W39A 4HS3A 2BNRA 3L3DA 3G08A 3BH8A 2X70A 1BQHA 4PJ9A 1KJVA 3BO8A 5C0DA 3BP4A 3P73A 5HHPA 2FIKA 5EUOA 3QEQA 4S0UC 1LEKA 3ECBA 3MRNA 2X4NA 2CLRA 3ILQC 4LCWA 1AGFA 4JRYA 4O2CA 1E28A 1I7TA 1I7UA 3CC5A 2AV7A 2V2XA 3ROOA 3DBXA 4I4WA 5FA4A 4WDIA 1ZT7A 3CPLA 1DDHA 3GSVA 3O4LA 5HHNA 3RWHA 4IIQC 3TJHA 1EXUA 3E2HA 1Z5LA 1HHGA 3FOMA 5H94A 1GZPA 3UTTA 3WLBA 4PJDA 3UTQA 4LHUA 1FFNA 2X4UA 1NANH 1XH3A 3MV9A 3VFSA 3X11A 3L9RA 2WY3A 4NQDA 3QUXA 5MERA 1XR8A 2FO4A 3KLAA 4Y4KA 5J1AA 4HX1A 3P4NA 4EUPA 1QSEA 1I1YA 5C08A 3VJ6A 4NNYA 3VXPA 5C0CA 4LCYA 3MRKA 3UBXA 3BH9A 2ZSWA 4CVZA 3FT3A 3TBYA 1CE6A 1LQVA 1S7UA 2NX5A 3H9SA 4PRNA 4PP8C 3RWJA 4PJEA 1B3JA 4WJ5A 3DX7A 3VXNA 5IEKA 3MRCA 5FDWA 1S9WA 4WW2C 4JFDA 4IHOA 5SWQA 1IM3A 4LNRA 1G6RH 3TZVC 1S7QA 3E6HA 1KPVA 3I6GA 3L3JA 1KPRA 3BVNA 5J6GA 4N5EA 2DYPA 4U1NA 1EFXA 1EEZA 4NHUE 4PJIA 4WWKC 3FQWA 2FWOA 5DEFA 4NQEA 4U1HA 3VFRA 3SKMA 4D0DA 5EU5A 5HGBA 3WS3A 1ZHNA 3KPMA 4F7MA 4N0UA 3SDDA 2CLVA 3HUJA 5GSVA 5AD0A 3VFNA 5F1NA 3MR9A 3MREA 3JTTA 3S6CA 1BD2A 1T7WA 3LKRA 3KPOA 1CD1A 4MQ7A 3BEWA 4JQVA 3SDXA 3B3IA 3JTCA 3P77A 2AK4A 4U6YA 1HHJA 1S7SA 5IB3A 1FZKA 3GMLA 5B38A 3MA7A 1I1AA 5ISZA 4EN3C 1LD9A 3QZWA 3SDAA 1ZT4A 5IM7A 3VRJA 1JUFA 1KBGH 1RJYA 2X4QA 3TBSA 3QI9A 3WUWA 3GSUA 3HG1A 2OL3H 1RJZA 3L3KA 2VLLA 4NSKA 4EI5A 3HE6A 1DUZA 5JHDA 4PJBA 5IB2A 2F54A 1P1ZA 2J8UA 3VRIA 4ONOA 3OV6A 3ERYA 3I6LD 5E8OA 5EO1A 4Z77A 3TIDA 4NO0A 4X6FA 5IVXA 1B0RA 5MEQA 3VFPA 2Q7YA 3KXFA 5HYJA 2ZOKA 1MHCA 5HGDA 1WBXA 1JHTA 3KPPA 5D7JC 5MEOA 4HV8A 3MRQA 3MYJA 1T7YA 4JRXA 3LV3A 1FG2A 1LEGA 3FQXA 3QUYA 4PRPA 2ZSVA 3RGVC 3W0WA 4F7TA 3L3GA 3QDGA 2NW3A 4APQA 3VFTA 3RWIA 3KWWA 3VXSA 2OI9A 1S8DA 1INQA 2V2WA 3GSWA 3QUKA 4G43A 2XFXA 2JCCA 4HWZA 3QQ3A 3O3DA
chains in the Genus database with same CATH superfamily
1MI5A 4JFFA 4MJ5A 3QDMA 1QLFA 1BIIA 2BVOA 3E6FA 3HAEA 3X14A 4E0RA 1P4LA 2X4TA 4QOKA 4PV8A 1T0NA 1W72A 1I4FA 1RK1A 5SWZA 1A9EA 3V5HA 3RL1A 5HHOA 3C9NA 3DX8A 3E3QA 4F7PA 1CG9A 1R3HA 4V3DB 1QO3A 4JO8A 2RFXA 1JPGA 5D9SA 3MRBA 2VAAA 4G9FA 5C0BA 5BXFA 5GSRA 3RUGA 1AKJA 1N3NA 4CW1A 1FZJA 1TMCA 3DXAA 4JFEA 1W0WA 4L9LC 3DTXA 1A1MA 3MGTA 2NYKA 1HYRC 5HGHA 3H7BA 3D18A 1HOCA 2X4OA 4U1SA 3O9WA 1T1XA 3OX8A 5C0EA 2CIKA 3LKPA 4HUXA 3O3AA 1N59A 5EU4A 4D0CA 5L2KA 4ZFZA 3KPLA 2BSRA 3JTSA 4L8DA 2X4SA 1I1FA 3QFDA 4MS8A 1ZSDA 4PJAA 3PWPA 2XPGA 4Z78A 3M17A 1BZ9A 2C7UA 1SYSA 1T21A 3TBTA 2FZ3A 2GITA 3D25A 1OSZA 3PWNA 5E00A 3FQRA 2D31A 2E7LE 5B39A 1YN6A 1T7VA 2YPLA 4U1LA 1U58A 1OGTA 3FQNA 1NEZA 1HSAA 1T22A 1W0VA 1GZQA 3SKOA 1QRNA 2HLAA 2PYEA 3KPSA 1VADA 1G7QA 2F74A 2PO6A 5ENWA 3OXRA 1T80A 2MHAA 1QSFA 4Y2DA 3GMQA 1JGDA 3BUYA 3GMPA 3MRHA 3BXNA 2GAZA 4GKNA 5INDA 1ZS8A 4QRPA 1XR9A 1C16A 4O2EA 3KYNA 4PGEA 3KPNA 2BNQA 4PRIA 1TVBA 3O8XA 5MEPA 2P5WA 1KCGC 4PGCA 5HGAA 4MVBA 3BZFA 3QQ4A 5BJTA 3ARBA 1RK0A 2P5EA 4LCCC 3TO4A 4O2FA 2HN7A 3GMMA 4L8SC 4PJFA 3LKOA 1Q94A 5BRZA 1T7ZA 1ZT1A 5D7LA 1OGAA 2HJKA 4ZUUA 1T1ZA 5F9JA 4ELMA 3RWCA 3B6SA 3GMOA 3TO2A 4HUVA 5D5MA 3VFOA 1AGDA 3VXUA 4PR5A 3GSOA 3HCVA 4ZUWA 5C0AA 5E9DA 4PGBA 5EOTA 1T20A 3TBVA 2ZOLA 3RWGA 4ZUSA 2CLZA 2FYYA 2H26A 4K71B 3LKSA 4PG9A 3TA3A 1JF1A 3VXRA 5C0FA 3UTSA 4JFPA 3C8KA 3RTQA 1EEYA 3AU1A 3BW9A 3CDGA 1FO0H 5FA3A 5C07A 3P9MA 3M1BA 1QEWA 3VFVA 1VGKA 1UQSA 5INCA 4WO4A 3RZCA 5C0GA 4MNGA 4PJHA 2VLKA 3FT2A 1ED3A 3GSQA 5D2NA 3VWKA 3KYOA 3FOLA 4PJGA 1JE6A 1FZOA 3DX6A 3FFCA 4D0BA 4MJIA 3TPUE 3D2UA 5HHQA 4K7FA 4FTVA 4MX7A 1WBYA 4F7EA 4G8GA 2AXFA 3RWDA 4NQVA 1QQDA 3LN5A 3MRGA 4X6DA 5E8PA 3REWA 3SJVA 3BGMA 3SCMA 3L3IA 1A1OA 2BCKA 3CVHA 1OF2A 3MRRA 4FFEX 2VABA 3BHBA 4U6XA 3LKNA 3GJFA 4Z76A 1S9YA 4PRHA 1JFMA 1KPUA 4WU7A 3ILPA 4U1IA 3O3EA 3CZFA 5BS0A 3MRDA 1PQZA 2GTWA 1A9BA 4PG2A 3QUZA 4NQCA 4X6CA 3TIEA 3LKQA 3TVMA 3MRFA 1ZAGA 2AKRA 1KJ3H 2CIIA 3T8XA 5IROA 1T7XA 1KJMA 3P9LA 4QRUA 2X4PA 2GT9A 3PWUA 4NQXA 1YDPA 1XZ0A 4NO5A 1A6ZA 1MWAH 1I7RA 3D3VA 1HHIA 3MRPA 2BVPA 3BEVA 1HHKA 1E27A 4NNXA 4PV9A 1N5AA 2AXGA 3BP7A 3ROLA 1AGCA 3ARFA 3UPRA 5FKPA 3GIVA 3VFMA 1ZHLA 3LN4A 4GKSA 1M6OA 3V5DA 1ONQA 2GJ6A 4N0FA 4E5XA 3MRLA 3MV8A 1NAMH 1LP9A 1UXWA 3HPJA 2H6PA 3FQUA 1HSBA 3PQYA 3KPQA 4PJCA 3VH8A 3IXAA 1AGEA 4WUUA 3VWJA 5L2JA 3GMNA 1K8DA 1SYVA 4PDCE 1X7QA 1N2RA 4F7CA 3VCLA 1JPFA 1KTLA 3VXOA 4NT6A 4G42A 5IB1A 4Y16A 3MROA 3TF7A 5D7IA 4JQXA 4L4VA 5DEGA 3PWVA 3DMMA 3SDCA 4PRBA 1DUYA 1YPZA 4MNQA 4L3CA 3FRUA 4IRJA 2F53A 3MV7A 2AV1A 4U1MA 3VFWA 3BWAA 4L8CA 3I6KA 3T1FA 4QRRA 1S7WA 1UXSA 4ZUTA 1S7RA 3O3BA 3WL9A 1S7TA 1QR1A 5EU6A 2YPKA 4MJ6A 4PJ8A 2X4RA 1VACA 1FFOA 3TFKA 3PABA 3AREA 3AM8A 4IRSA 4L29A 2HJLA 3IT8D 3MGOA 4G9DA 4QRQA 1DE4A 1ZHBA 5EU3A 3GSRA 4N0CA 1FZMA 1T0MA 4HUUA 1IM9A 4JFQA 1MHEA 4U1JA 4L8BA 4QRTA 1ZHKA 2A83A 3GMRA 3HLAA 3KPRA 3L3HA 4NO2A 4WU5A 2VE6A 4Y4FA 4UQ2A 5E8NA 4UQ3A 2BVQA 2UWEA 1AO7A 3H9HA 3I0TA 3NFNA 5J6HA 3CCHA 3JVGA 1HHHA 4Y4HA 3GSNH 1L8JA 5F1IA 4G59A 1JGEA 1KJ2H 2IA1A 3P4OA 1AGBA 3X12A 4PREA 3U0PA 3RL2A 4PGDA 2BSSA 4N8VA 5SWSA 3OXSA 4G8IA 4PJXA 5EO0A 5HHMA 2CKBH 1S9XA 3MRMA 3VFUA 5C0JA 3VXMA 5ACZA 5DDHA 2YEZA 1P7QA 4PJ5A 5D2LA 3CH1A 1LDPH 1YN7A 5EFIA 2BSTA 4NO3A 3FTGA 2VLRA 2GTZA 1S7XA 4PJ7A 1LK2A 3TN0A 2VLJA 1TVHA 2ESVA 1A1NA 5IB5A 3FONA 5C9JA 1K5NA 4GUPA 1G7PA 1ZVSA 4PRDA 3P4MA 4ZUVA 3RWFA 5IEHA 3QDJA 4X6EA 3ARDA 4L3EA 4MXQA 4HKJA 1T1YA 4V3EB 3QFJA 4PRAA 5C0IA 1QVOA 3ARGA 5F7DA 3WS6A 5MENA 4U1KA 1FFPA 1WBZA 4HUWA 4BKWA 5C09A 3FQTA 3FT4A 4JFOA 4CVXA 4XXCA 2GUOA 1S7VA 3TBWA 3GSXA 3V5KA 3BZEA 3X13A 3D39A 3ES6A 4I48A 3PWJA 3QULA 5E6IC 3MRIA 1B0GA 4L4TA 3SPVA 3PWLA 4QRSA 4ZAKA 3MRJA 3RWEA 1M05A 3HE7A 1T1WA 5IB4A 3W39A 4HS3A 2BNRA 3L3DA 3G08A 3BH8A 2X70A 1BQHA 4PJ9A 1KJVA 3BO8A 5C0DA 3BP4A 3P73A 5HHPA 2FIKA 5EUOA 3QEQA 4S0UC 1LEKA 3ECBA 3MRNA 2X4NA 2CLRA 3ILQC 4LCWA 1AGFA 4JRYA 4O2CA 1E28A 1I7TA 1I7UA 3CC5A 2AV7A 2V2XA 3ROOA 3DBXA 4I4WA 5FA4A 4WDIA 1ZT7A 3CPLA 2O5NA 1DDHA 3GSVA 3O4LA 5HHNA 3RWHA 4IIQC 3TJHA 1EXUA 3E2HA 1Z5LA 1HHGA 3FOMA 5H94A 1GZPA 3UTTA 3WLBA 4PJDA 3UTQA 4LHUA 1FFNA 2X4UA 1NANH 1XH3A 3MV9A 3VFSA 3X11A 3L9RA 2WY3A 4NQDA 3QUXA 5MERA 1XR8A 2FO4A 3KLAA 4Y4KA 5J1AA 4HX1A 3P4NA 4EUPA 1QSEA 1I1YA 5C08A 3VJ6A 4NNYA 3VXPA 5C0CA 4LCYA 3MRKA 3UBXA 3BH9A 2ZSWA 4CVZA 3FT3A 3TBYA 1CE6A 1LQVA 1S7UA 2NX5A 3H9SA 4PRNA 4PP8C 3RWJA 4PJEA 1B3JA 4WJ5A 3DX7A 3VXNA 5IEKA 3MRCA 5FDWA 1S9WA 4WW2C 4JFDA 4IHOA 5SWQA 1IM3A 4LNRA 1G6RH 3TZVC 1S7QA 3E6HA 1KPVA 3I6GA 3L3JA 1KPRA 3BVNA 5J6GA 4N5EA 2DYPA 4U1NA 1EFXA 1EEZA 4NHUE 4PJIA 4WWKC 3FQWA 2FWOA 5DEFA 4NQEA 4U1HA 3VFRA 3SKMA 4D0DA 5EU5A 5HGBA 3WS3A 1ZHNA 3KPMA 4F7MA 4N0UA 3SDDA 2CLVA 3HUJA 5GSVA 5AD0A 3VFNA 5F1NA 3MR9A 3MREA 3JTTA 3S6CA 1BD2A 1T7WA 3LKRA 3KPOA 1CD1A 4MQ7A 3BEWA 4JQVA 3SDXA 3B3IA 3JTCA 3P77A 2AK4A 4U6YA 1HHJA 1S7SA 5IB3A 1FZKA 3GMLA 5B38A 3MA7A 1I1AA 5ISZA 4EN3C 1LD9A 3QZWA 3SDAA 1ZT4A 4G59C 3VRJA 1JUFA 5IM7A 1KBGH 1RJYA 2X4QA 3TBSA 3QI9A 3WUWA 3GSUA 3HG1A 2OL3H 1RJZA 3L3KA 2VLLA 4NSKA 4EI5A 3HE6A 1DUZA 5JHDA 4PJBA 5IB2A 2F54A 1P1ZA 2J8UA 3VRIA 4ONOA 3OV6A 3ERYA 3I6LD 5E8OA 5EO1A 4Z77A 3TIDA 4NO0A 4X6FA 5IVXA 1B0RA 5MEQA 3VFPA 2Q7YA 3KXFA 5HYJA 2ZOKA 1MHCA 5HGDA 1WBXA 1JHTA 3KPPA 5D7JC 5MEOA 4HV8A 3MRQA 3MYJA 1T7YA 4JRXA 3LV3A 1FG2A 1LEGA 3FQXA 3QUYA 4PRPA 2ZSVA 3RGVC 3W0WA 4F7TA 3L3GA 3QDGA 2NW3A 4APQA 3VFTA 3RWIA 3KWWA 3VXSA 2OI9A 1S8DA 1INQA 2V2WA 3GSWA 3QUKA 4G43A 2XFXA 2JCCA 4HWZA 3QQ3A 3O3DA
chains in the Genus database with same CATH topology
1MI5A 4JFFA 4MJ5A 3QDMA 1QLFA 1BIIA 2BVOA 3E6FA 3HAEA 3X14A 4E0RA 1P4LA 2X4TA 4QOKA 4PV8A 1T0NA 1W72A 1I4FA 1RK1A 5SWZA 1A9EA 3V5HA 3RL1A 5HHOA 3C9NA 3DX8A 3E3QA 4F7PA 1CG9A 1R3HA 4V3DB 1QO3A 2RFXA 1JPGA 5D9SA 3MRBA 2VAAA 4G9FA 5C0BA 5BXFA 5GSRA 3RUGA 1AKJA 1N3NA 4CW1A 1FZJA 1TMCA 3DXAA 4JFEA 1W0WA 4L9LC 3DTXA 1A1MA 3MGTA 1HYRC 5HGHA 3H7BA 3D18A 1HOCA 2X4OA 4U1SA 3O9WA 1T1XA 3OX8A 5C0EA 2CIKA 3LKPA 4HUXA 3O3AA 1N59A 5EU4A 4D0CA 5L2KA 4ZFZA 3KPLA 2BSRA 3JTSA 4L8DA 2X4SA 1I1FA 3QFDA 4MS8A 1ZSDA 4PJAA 3PWPA 2XPGA 4Z78A 3M17A 1BZ9A 2C7UA 1SYSA 1T21A 3TBTA 2FZ3A 2GITA 3D25A 1OSZA 3PWNA 5E00A 3FQRA 2D31A 2E7LE 5B39A 1YN6A 1T7VA 2YPLA 4U1LA 1U58A 1OGTA 3FQNA 1NEZA 1HSAA 1T22A 1W0VA 1GZQA 3SKOA 1QRNA 2HLAA 2PYEA 3KPSA 1VADA 1G7QA 2F74A 2PO6A 5ENWA 3OXRA 1T80A 2MHAA 1QSFA 4Y2DA 3GMQA 1JGDA 3BUYA 3GMPA 3MRHA 3BXNA 2GAZA 4GKNA 5INDA 1ZS8A 4QRPA 1XR9A 1C16A 4O2EA 3KYNA 4PGEA 3KPNA 2BNQA 4PRIA 1TVBA 3O8XA 5MEPA 2P5WA 1KCGC 4PGCA 5HGAA 4MVBA 3BZFA 3QQ4A 5BJTA 3ARBA 1RK0A 2P5EA 4LCCC 3TO4A 4O2FA 2HN7A 3GMMA 4L8SC 4PJFA 3LKOA 1Q94A 5BRZA 1T7ZA 1ZT1A 5D7LA 1OGAA 2HJKA 4ZUUA 1T1ZA 5F9JA 4ELMA 3RWCA 3B6SA 3GMOA 3TO2A 4HUVA 5D5MA 3VFOA 1AGDA 3VXUA 4PR5A 3GSOA 3HCVA 4ZUWA 5C0AA 5E9DA 4PGBA 5EOTA 1T20A 3TBVA 2ZOLA 3RWGA 4ZUSA 2CLZA 2FYYA 2H26A 4K71B 3LKSA 4PG9A 3TA3A 1JF1A 3VXRA 5C0FA 3UTSA 4JFPA 3C8KA 3RTQA 1EEYA 3AU1A 3BW9A 3CDGA 1FO0H 5FA3A 5C07A 3P9MA 3M1BA 1QEWA 3VFVA 1VGKA 1UQSA 5INCA 4WO4A 3RZCA 5C0GA 4MNGA 4PJHA 2VLKA 3FT2A 1ED3A 3GSQA 5D2NA 3VWKA 3KYOA 3FOLA 4PJGA 1JE6A 1FZOA 3DX6A 3FFCA 4D0BA 4MJIA 3TPUE 3D2UA 5HHQA 4K7FA 4FTVA 4MX7A 1WBYA 4F7EA 4G8GA 2AXFA 3RWDA 4NQVA 1QQDA 3LN5A 3MRGA 4X6DA 5E8PA 3REWA 3SJVA 3BGMA 3SCMA 3L3IA 1A1OA 2BCKA 3CVHA 1OF2A 3MRRA 4FFEX 2VABA 3BHBA 4U6XA 3LKNA 3GJFA 4Z76A 1S9YA 4PRHA 1JFMA 1KPUA 4WU7A 3ILPA 4U1IA 3O3EA 3CZFA 5BS0A 3MRDA 1PQZA 2GTWA 1A9BA 4PG2A 3QUZA 4NQCA 4X6CA 3TIEA 3LKQA 3TVMA 3MRFA 1ZAGA 2AKRA 1KJ3H 2CIIA 3T8XA 5IROA 1T7XA 1KJMA 3P9LA 4QRUA 2X4PA 2GT9A 3PWUA 4NQXA 1YDPA 1XZ0A 4NO5A 1A6ZA 1MWAH 1I7RA 3D3VA 1HHIA 3MRPA 2BVPA 3BEVA 1HHKA 1E27A 4NNXA 4PV9A 1N5AA 2AXGA 3BP7A 3ROLA 1AGCA 3ARFA 3UPRA 5FKPA 3GIVA 3VFMA 1ZHLA 3LN4A 4GKSA 1M6OA 3V5DA 1ONQA 2GJ6A 4N0FA 4E5XA 3MRLA 3MV8A 1NAMH 1LP9A 1UXWA 3HPJA 2H6PA 3FQUA 1HSBA 3PQYA 3KPQA 4PJCA 3VH8A 3IXAA 1AGEA 4WUUA 3VWJA 5L2JA 3GMNA 1K8DA 1SYVA 4PDCE 1X7QA 1N2RA 4F7CA 3VCLA 1JPFA 1KTLA 3VXOA 4NT6A 4G42A 5IB1A 4Y16A 3MROA 3TF7A 5D7IA 4JQXA 4L4VA 5DEGA 3PWVA 3DMMA 3SDCA 4PRBA 1DUYA 1YPZA 4MNQA 4L3CA 3FRUA 4IRJA 2F53A 3MV7A 2AV1A 4U1MA 3VFWA 3BWAA 4L8CA 3I6KA 3T1FA 4QRRA 1S7WA 1UXSA 4ZUTA 1S7RA 3O3BA 3WL9A 1S7TA 1QR1A 5EU6A 2YPKA 4MJ6A 4PJ8A 2X4RA 1VACA 1FFOA 3TFKA 3PABA 3AREA 3AM8A 4IRSA 4L29A 2HJLA 3IT8D 3MGOA 4G9DA 4QRQA 1DE4A 1ZHBA 5EU3A 3GSRA 4N0CA 1FZMA 1T0MA 4HUUA 1IM9A 4JFQA 1MHEA 4U1JA 4L8BA 4QRTA 1ZHKA 2A83A 3GMRA 3HLAA 3KPRA 3L3HA 4NO2A 4WU5A 2VE6A 4Y4FA 4UQ2A 5E8NA 4UQ3A 2BVQA 2UWEA 1AO7A 3H9HA 3NFNA 5J6HA 3CCHA 3JVGA 1HHHA 4Y4HA 3GSNH 1L8JA 5F1IA 4G59A 1JGEA 1KJ2H 3P4OA 1AGBA 3X12A 4PREA 3U0PA 3RL2A 4PGDA 2BSSA 4N8VA 5SWSA 3OXSA 4G8IA 4PJXA 5EO0A 5HHMA 2CKBH 1S9XA 3MRMA 3VFUA 5C0JA 3VXMA 5ACZA 5DDHA 2YEZA 1P7QA 4PJ5A 5D2LA 3CH1A 1LDPH 1YN7A 5EFIA 2BSTA 4NO3A 3FTGA 2VLRA 2GTZA 1S7XA 4PJ7A 1LK2A 3TN0A 2VLJA 1TVHA 2ESVA 1A1NA 5IB5A 3FONA 5C9JA 1K5NA 4GUPA 1G7PA 1ZVSA 4PRDA 3P4MA 4ZUVA 3RWFA 5IEHA 3QDJA 4X6EA 3ARDA 4L3EA 4MXQA 4HKJA 1T1YA 4V3EB 3QFJA 4PRAA 5C0IA 1QVOA 3ARGA 5F7DA 3WS6A 5MENA 4U1KA 1FFPA 1WBZA 4HUWA 5C09A 3FQTA 3FT4A 4JFOA 4CVXA 4XXCA 2GUOA 1S7VA 3TBWA 3GSXA 3V5KA 3BZEA 3X13A 3D39A 3ES6A 4I48A 3PWJA 3QULA 5E6IC 3MRIA 1B0GA 4L4TA 3SPVA 3PWLA 4QRSA 4ZAKA 3MRJA 3RWEA 1M05A 3HE7A 1T1WA 5IB4A 3W39A 4HS3A 2BNRA 3L3DA 3G08A 3BH8A 2X70A 1BQHA 4PJ9A 1KJVA 3BO8A 5C0DA 3BP4A 3P73A 5HHPA 2FIKA 5EUOA 3QEQA 4S0UC 1LEKA 3ECBA 3MRNA 2X4NA 2CLRA 3ILQC 4LCWA 1AGFA 4JRYA 4O2CA 1E28A 1I7TA 1I7UA 3CC5A 2AV7A 2V2XA 3ROOA 3DBXA 4I4WA 5FA4A 4WDIA 1ZT7A 3CPLA 1DDHA 3GSVA 3O4LA 5HHNA 3RWHA 4IIQC 3TJHA 1EXUA 3E2HA 1Z5LA 1HHGA 3FOMA 5H94A 1GZPA 3UTTA 3WLBA 4PJDA 3UTQA 4LHUA 1FFNA 2X4UA 1NANH 1XH3A 3MV9A 3VFSA 3X11A 3L9RA 2WY3A 4NQDA 3QUXA 5MERA 1XR8A 2FO4A 3KLAA 4Y4KA 5J1AA 4HX1A 3P4NA 4EUPA 1QSEA 1I1YA 5C08A 3VJ6A 4NNYA 3VXPA 5C0CA 4LCYA 3MRKA 3UBXA 3BH9A 2ZSWA 4CVZA 3FT3A 3TBYA 1CE6A 1LQVA 1S7UA 2NX5A 3H9SA 4PRNA 4PP8C 3RWJA 4PJEA 1B3JA 4WJ5A 3DX7A 3VXNA 5IEKA 3MRCA 5FDWA 1S9WA 4WW2C 4JFDA 4IHOA 5SWQA 1IM3A 4LNRA 1G6RH 3TZVC 1S7QA 3E6HA 1KPVA 3I6GA 3L3JA 1KPRA 3BVNA 5J6GA 4N5EA 2DYPA 4U1NA 1EFXA 1EEZA 4NHUE 4PJIA 4WWKC 3FQWA 2FWOA 5DEFA 4NQEA 4U1HA 3VFRA 3SKMA 4D0DA 5EU5A 5HGBA 3WS3A 1ZHNA 3KPMA 4F7MA 4N0UA 3SDDA 2CLVA 3HUJA 5GSVA 5AD0A 3VFNA 5F1NA 3MR9A 3MREA 3JTTA 3S6CA 1BD2A 1T7WA 3LKRA 3KPOA 1CD1A 4MQ7A 3BEWA 4JQVA 3SDXA 3B3IA 3JTCA 3P77A 2AK4A 4U6YA 1HHJA 1S7SA 5IB3A 1FZKA 3GMLA 5B38A 3MA7A 1I1AA 5ISZA 4EN3C 1LD9A 3QZWA 3SDAA 1ZT4A 5IM7A 3VRJA 1JUFA 1KBGH 1RJYA 2X4QA 3TBSA 3QI9A 3WUWA 3GSUA 3HG1A 2OL3H 1RJZA 3L3KA 2VLLA 4NSKA 4EI5A 3HE6A 1DUZA 5JHDA 4PJBA 5IB2A 2F54A 1P1ZA 2J8UA 3VRIA 4ONOA 3OV6A 3ERYA 3I6LD 5E8OA 5EO1A 4Z77A 3TIDA 4NO0A 4X6FA 5IVXA 1B0RA 5MEQA 3VFPA 2Q7YA 3KXFA 5HYJA 2ZOKA 1MHCA 5HGDA 1WBXA 1JHTA 3KPPA 5D7JC 5MEOA 4HV8A 3MRQA 3MYJA 1T7YA 4JRXA 3LV3A 1FG2A 1LEGA 3FQXA 3QUYA 4PRPA 2ZSVA 3RGVC 3W0WA 4F7TA 3L3GA 3QDGA 2NW3A 4APQA 3VFTA 3RWIA 3KWWA 3VXSA 2OI9A 1S8DA 1INQA 2V2WA 3GSWA 3QUKA 4G43A 2XFXA 2JCCA 4HWZA 3QQ3A 3O3DA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1MI5 A;  4JFF A;  4MJ5 A;  3QDM A;  1QLF A;  1BII A;  2BVO A;  3E6F A;  3HAE A;  3X14 A;  4E0R A;  1P4L A;  2X4T A;  4QOK A;  4PV8 A;  1T0N A;  1W72 A;  1I4F A;  1RK1 A;  5SWZ A;  1A9E A;  3V5H A;  3RL1 A;  5HHO A;  3C9N A;  3DX8 A;  3E3Q A;  4F7P A;  1CG9 A;  1R3H A;  4V3D B;  1QO3 A;  2RFX A;  1JPG A;  5D9S A;  3MRB A;  2VAA A;  4G9F A;  5C0B A;  5BXF A;  5GSR A;  3RUG A;  1AKJ A;  1N3N A;  4CW1 A;  1FZJ A;  1TMC A;  3DXA A;  4JFE A;  1W0W A;  4L9L C;  3DTX A;  1A1M A;  3MGT A;  1HYR C;  5HGH A;  3H7B A;  3D18 A;  1HOC A;  2X4O A;  4U1S A;  3O9W A;  1T1X A;  3OX8 A;  5C0E A;  2CIK A;  3LKP A;  4HUX A;  3O3A A;  1N59 A;  5EU4 A;  4D0C A;  5L2K A;  4ZFZ A;  3KPL A;  2BSR A;  3JTS A;  4L8D A;  2X4S A;  1I1F A;  3QFD A;  4MS8 A;  1ZSD A;  4PJA A;  3PWP A;  2XPG A;  4Z78 A;  3M17 A;  1BZ9 A;  2C7U A;  1SYS A;  1T21 A;  3TBT A;  2FZ3 A;  2GIT A;  3D25 A;  1OSZ A;  3PWN A;  5E00 A;  3FQR A;  2D31 A;  2E7L E;  5B39 A;  1YN6 A;  1T7V A;  2YPL A;  4U1L A;  1U58 A;  1OGT A;  3FQN A;  1NEZ A;  1HSA A;  1T22 A;  1W0V A;  1GZQ A;  3SKO A;  1QRN A;  2HLA A;  2PYE A;  3KPS A;  1VAD A;  1G7Q A;  2F74 A;  2PO6 A;  5ENW A;  3OXR A;  1T80 A;  2MHA A;  1QSF A;  4Y2D A;  3GMQ A;  1JGD A;  3BUY A;  3GMP A;  3MRH A;  3BXN A;  2GAZ A;  4GKN A;  5IND A;  1ZS8 A;  4QRP A;  1XR9 A;  1C16 A;  4O2E A;  3KYN A;  4PGE A;  3KPN A;  2BNQ A;  4PRI A;  1TVB A;  3O8X A;  5MEP A;  2P5W A;  1KCG C;  4PGC A;  5HGA A;  4MVB A;  3BZF A;  3QQ4 A;  5BJT A;  3ARB A;  1RK0 A;  2P5E A;  4LCC C;  3TO4 A;  4O2F A;  2HN7 A;  3GMM A;  4L8S C;  4PJF A;  3LKO A;  1Q94 A;  5BRZ A;  1T7Z A;  1ZT1 A;  5D7L A;  1OGA A;  2HJK A;  4ZUU A;  1T1Z A;  5F9J A;  4ELM A;  3RWC A;  3B6S A;  3GMO A;  3TO2 A;  4HUV A;  5D5M A;  3VFO A;  1AGD A;  3VXU A;  4PR5 A;  3GSO A;  3HCV A;  4ZUW A;  5C0A A;  5E9D A;  4PGB A;  5EOT A;  1T20 A;  3TBV A;  2ZOL A;  3RWG A;  4ZUS A;  2CLZ A;  2FYY A;  2H26 A;  4K71 B;  3LKS A;  4PG9 A;  3TA3 A;  1JF1 A;  3VXR A;  5C0F A;  3UTS A;  4JFP A;  3C8K A;  3RTQ A;  1EEY A;  3AU1 A;  3BW9 A;  3CDG A;  1FO0 H;  5FA3 A;  5C07 A;  3P9M A;  3M1B A;  1QEW A;  3VFV A;  1VGK A;  1UQS A;  5INC A;  4WO4 A;  3RZC A;  5C0G A;  4MNG A;  4PJH A;  2VLK A;  3FT2 A;  1ED3 A;  3GSQ A;  5D2N A;  3VWK A;  3KYO A;  3FOL A;  4PJG A;  1JE6 A;  1FZO A;  3DX6 A;  3FFC A;  4D0B A;  4MJI A;  3TPU E;  3D2U A;  5HHQ A;  4K7F A;  4FTV A;  4MX7 A;  1WBY A;  4F7E A;  4G8G A;  2AXF A;  3RWD A;  4NQV A;  1QQD A;  3LN5 A;  3MRG A;  4X6D A;  5E8P A;  3REW A;  3SJV A;  3BGM A;  3SCM A;  3L3I A;  1A1O A;  2BCK A;  3CVH A;  1OF2 A;  3MRR A;  4FFE X;  2VAB A;  3BHB A;  4U6X A;  3LKN A;  3GJF A;  4Z76 A;  1S9Y A;  4PRH A;  1JFM A;  1KPU A;  4WU7 A;  3ILP A;  4U1I A;  3O3E A;  3CZF A;  5BS0 A;  3MRD A;  1PQZ A;  2GTW A;  1A9B A;  4PG2 A;  3QUZ A;  4NQC A;  4X6C A;  3TIE A;  3LKQ A;  3TVM A;  3MRF A;  1ZAG A;  2AKR A;  1KJ3 H;  2CII A;  3T8X A;  5IRO A;  1T7X A;  1KJM A;  3P9L A;  4QRU A;  2X4P A;  2GT9 A;  3PWU A;  4NQX A;  1YDP A;  1XZ0 A;  4NO5 A;  1A6Z A;  1MWA H;  1I7R A;  3D3V A;  1HHI A;  3MRP A;  2BVP A;  3BEV A;  1HHK A;  1E27 A;  4NNX A;  4PV9 A;  1N5A A;  2AXG A;  3BP7 A;  3ROL A;  1AGC A;  3ARF A;  3UPR A;  5FKP A;  3GIV A;  3VFM A;  1ZHL A;  3LN4 A;  4GKS A;  1M6O A;  3V5D A;  1ONQ A;  2GJ6 A;  4N0F A;  4E5X A;  3MRL A;  3MV8 A;  1NAM H;  1LP9 A;  1UXW A;  3HPJ A;  2H6P A;  3FQU A;  1HSB A;  3PQY A;  3KPQ A;  4PJC A;  3VH8 A;  3IXA A;  1AGE A;  4WUU A;  3VWJ A;  5L2J A;  3GMN A;  1K8D A;  1SYV A;  4PDC E;  1X7Q A;  1N2R A;  4F7C A;  3VCL A;  1JPF A;  1KTL A;  3VXO A;  4NT6 A;  4G42 A;  5IB1 A;  4Y16 A;  3MRO A;  3TF7 A;  5D7I A;  4JQX A;  4L4V A;  5DEG A;  3PWV A;  3DMM A;  3SDC A;  4PRB A;  1DUY A;  1YPZ A;  4MNQ A;  4L3C A;  3FRU A;  4IRJ A;  2F53 A;  3MV7 A;  2AV1 A;  4U1M A;  3VFW A;  3BWA A;  4L8C A;  3I6K A;  3T1F A;  4QRR A;  1S7W A;  1UXS A;  4ZUT A;  1S7R A;  3O3B A;  3WL9 A;  1S7T A;  1QR1 A;  5EU6 A;  2YPK A;  4MJ6 A;  4PJ8 A;  2X4R A;  1VAC A;  1FFO A;  3TFK A;  3PAB A;  3ARE A;  3AM8 A;  4IRS A;  4L29 A;  2HJL A;  3IT8 D;  3MGO A;  4G9D A;  4QRQ A;  1DE4 A;  1ZHB A;  5EU3 A;  3GSR A;  4N0C A;  1FZM A;  1T0M A;  4HUU A;  1IM9 A;  4JFQ A;  1MHE A;  4U1J A;  4L8B A;  4QRT A;  1ZHK A;  2A83 A;  3GMR A;  3HLA A;  3KPR A;  3L3H A;  4NO2 A;  4WU5 A;  2VE6 A;  4Y4F A;  4UQ2 A;  5E8N A;  4UQ3 A;  2BVQ A;  2UWE A;  1AO7 A;  3H9H A;  3NFN A;  5J6H A;  3CCH A;  3JVG A;  1HHH A;  4Y4H A;  3GSN H;  1L8J A;  5F1I A;  4G59 A;  1JGE A;  1KJ2 H;  3P4O A;  1AGB A;  3X12 A;  4PRE A;  3U0P A;  3RL2 A;  4PGD A;  2BSS A;  4N8V A;  5SWS A;  3OXS A;  4G8I A;  4PJX A;  5EO0 A;  5HHM A;  2CKB H;  1S9X A;  3MRM A;  3VFU A;  5C0J A;  3VXM A;  5ACZ A;  5DDH A;  2YEZ A;  1P7Q A;  4PJ5 A;  5D2L A;  3CH1 A;  1LDP H;  1YN7 A;  5EFI A;  2BST A;  4NO3 A;  3FTG A;  2VLR A;  2GTZ A;  1S7X A;  4PJ7 A;  1LK2 A;  3TN0 A;  2VLJ A;  1TVH A;  2ESV A;  1A1N A;  5IB5 A;  3FON A;  5C9J A;  1K5N A;  4GUP A;  1G7P A;  1ZVS A;  4PRD A;  3P4M A;  4ZUV A;  3RWF A;  5IEH A;  3QDJ A;  4X6E A;  3ARD A;  4L3E A;  4MXQ A;  4HKJ A;  1T1Y A;  4V3E B;  3QFJ A;  4PRA A;  5C0I A;  1QVO A;  3ARG A;  5F7D A;  3WS6 A;  5MEN A;  4U1K A;  1FFP A;  1WBZ A;  4HUW A;  5C09 A;  3FQT A;  3FT4 A;  4JFO A;  4CVX A;  4XXC A;  2GUO A;  1S7V A;  3TBW A;  3GSX A;  3V5K A;  3BZE A;  3X13 A;  3D39 A;  3ES6 A;  4I48 A;  3PWJ A;  3QUL A;  5E6I C;  3MRI A;  1B0G A;  4L4T A;  3SPV A;  3PWL A;  4QRS A;  4ZAK A;  3MRJ A;  3RWE A;  1M05 A;  3HE7 A;  1T1W A;  5IB4 A;  3W39 A;  4HS3 A;  2BNR A;  3L3D A;  3G08 A;  3BH8 A;  2X70 A;  1BQH A;  4PJ9 A;  1KJV A;  3BO8 A;  5C0D A;  3BP4 A;  3P73 A;  5HHP A;  2FIK A;  5EUO A;  3QEQ A;  4S0U C;  1LEK A;  3ECB A;  3MRN A;  2X4N A;  2CLR A;  3ILQ C;  4LCW A;  1AGF A;  4JRY A;  4O2C A;  1E28 A;  1I7T A;  1I7U A;  3CC5 A;  2AV7 A;  2V2X A;  3ROO A;  3DBX A;  4I4W A;  5FA4 A;  4WDI A;  1ZT7 A;  3CPL A;  1DDH A;  3GSV A;  3O4L A;  5HHN A;  3RWH A;  4IIQ C;  3TJH A;  1EXU A;  3E2H A;  1Z5L A;  1HHG A;  3FOM A;  5H94 A;  1GZP A;  3UTT A;  3WLB A;  4PJD A;  3UTQ A;  4LHU A;  1FFN A;  2X4U A;  1NAN H;  1XH3 A;  3MV9 A;  3VFS A;  3X11 A;  3L9R A;  2WY3 A;  4NQD A;  3QUX A;  5MER A;  1XR8 A;  2FO4 A;  3KLA A;  4Y4K A;  5J1A A;  4HX1 A;  3P4N A;  4EUP A;  1QSE A;  1I1Y A;  5C08 A;  3VJ6 A;  4NNY A;  3VXP A;  5C0C A;  4LCY A;  3MRK A;  3UBX A;  3BH9 A;  2ZSW A;  4CVZ A;  3FT3 A;  3TBY A;  1CE6 A;  1LQV A;  1S7U A;  2NX5 A;  3H9S A;  4PRN A;  4PP8 C;  3RWJ A;  4PJE A;  1B3J A;  4WJ5 A;  3DX7 A;  3VXN A;  5IEK A;  3MRC A;  5FDW A;  1S9W A;  4WW2 C;  4JFD A;  4IHO A;  5SWQ A;  1IM3 A;  4LNR A;  1G6R H;  3TZV C;  1S7Q A;  3E6H A;  1KPV A;  3I6G A;  3L3J A;  1KPR A;  3BVN A;  5J6G A;  4N5E A;  2DYP A;  4U1N A;  1EFX A;  1EEZ A;  4NHU E;  4PJI A;  4WWK C;  3FQW A;  2FWO A;  5DEF A;  4NQE A;  4U1H A;  3VFR A;  3SKM A;  4D0D A;  5EU5 A;  5HGB A;  3WS3 A;  1ZHN A;  3KPM A;  4F7M A;  4N0U A;  3SDD A;  2CLV A;  3HUJ A;  5GSV A;  5AD0 A;  3VFN A;  5F1N A;  3MR9 A;  3MRE A;  3JTT A;  3S6C A;  1BD2 A;  1T7W A;  3LKR A;  3KPO A;  1CD1 A;  4MQ7 A;  3BEW A;  4JQV A;  3SDX A;  3B3I A;  3JTC A;  3P77 A;  2AK4 A;  4U6Y A;  1HHJ A;  1S7S A;  5IB3 A;  1FZK A;  3GML A;  5B38 A;  3MA7 A;  1I1A A;  5ISZ A;  4EN3 C;  1LD9 A;  3QZW A;  3SDA A;  1ZT4 A;  5IM7 A;  3VRJ A;  1JUF A;  1KBG H;  1RJY A;  2X4Q A;  3TBS A;  3QI9 A;  3WUW A;  3GSU A;  3HG1 A;  2OL3 H;  1RJZ A;  3L3K A;  2VLL A;  4NSK A;  4EI5 A;  3HE6 A;  1DUZ A;  5JHD A;  4PJB A;  5IB2 A;  2F54 A;  1P1Z A;  2J8U A;  3VRI A;  4ONO A;  3OV6 A;  3ERY A;  3I6L D;  5E8O A;  5EO1 A;  4Z77 A;  3TID A;  4NO0 A;  4X6F A;  5IVX A;  1B0R A;  5MEQ A;  3VFP A;  2Q7Y A;  3KXF A;  5HYJ A;  2ZOK A;  1MHC A;  5HGD A;  1WBX A;  1JHT A;  3KPP A;  5D7J C;  5MEO A;  4HV8 A;  3MRQ A;  3MYJ A;  1T7Y A;  4JRX A;  3LV3 A;  1FG2 A;  1LEG A;  3FQX A;  3QUY A;  4PRP A;  2ZSV A;  3RGV C;  3W0W A;  4F7T A;  3L3G A;  3QDG A;  2NW3 A;  4APQ A;  3VFT A;  3RWI A;  3KWW A;  3VXS A;  2OI9 A;  1S8D A;  1INQ A;  2V2W A;  3GSW A;  3QUK A;  4G43 A;  2XFX A;  2JCC A;  4HWZ A;  3QQ3 A;  3O3D A; 
#chains in the Genus database with same CATH topology
 1MI5 A;  4JFF A;  4MJ5 A;  3QDM A;  1QLF A;  1BII A;  2BVO A;  3E6F A;  3HAE A;  3X14 A;  4E0R A;  1P4L A;  2X4T A;  4QOK A;  4PV8 A;  1T0N A;  1W72 A;  1I4F A;  1RK1 A;  5SWZ A;  1A9E A;  3V5H A;  3RL1 A;  5HHO A;  3C9N A;  3DX8 A;  3E3Q A;  4F7P A;  1CG9 A;  1R3H A;  4V3D B;  1QO3 A;  4JO8 A;  2RFX A;  1JPG A;  5D9S A;  3MRB A;  2VAA A;  4G9F A;  5C0B A;  5BXF A;  5GSR A;  3RUG A;  1AKJ A;  1N3N A;  4CW1 A;  1FZJ A;  1TMC A;  3DXA A;  4JFE A;  1W0W A;  4L9L C;  3DTX A;  1A1M A;  3MGT A;  2NYK A;  1HYR C;  5HGH A;  3H7B A;  3D18 A;  1HOC A;  2X4O A;  4U1S A;  3O9W A;  1T1X A;  3OX8 A;  5C0E A;  2CIK A;  3LKP A;  4HUX A;  3O3A A;  1N59 A;  5EU4 A;  4D0C A;  5L2K A;  4ZFZ A;  3KPL A;  2BSR A;  3JTS A;  4L8D A;  2X4S A;  1I1F A;  3QFD A;  4MS8 A;  1ZSD A;  4PJA A;  3PWP A;  2XPG A;  4Z78 A;  3M17 A;  1BZ9 A;  2C7U A;  1SYS A;  1T21 A;  3TBT A;  2FZ3 A;  2GIT A;  3D25 A;  1OSZ A;  3PWN A;  5E00 A;  3FQR A;  2D31 A;  2E7L E;  5B39 A;  1YN6 A;  1T7V A;  2YPL A;  4U1L A;  1U58 A;  1OGT A;  3FQN A;  1NEZ A;  1HSA A;  1T22 A;  1W0V A;  1GZQ A;  3SKO A;  1QRN A;  2HLA A;  2PYE A;  3KPS A;  1VAD A;  1G7Q A;  2F74 A;  2PO6 A;  5ENW A;  3OXR A;  1T80 A;  2MHA A;  1QSF A;  4Y2D A;  3GMQ A;  1JGD A;  3BUY A;  3GMP A;  3MRH A;  3BXN A;  2GAZ A;  4GKN A;  5IND A;  1ZS8 A;  4QRP A;  1XR9 A;  1C16 A;  4O2E A;  3KYN A;  4PGE A;  3KPN A;  2BNQ A;  4PRI A;  1TVB A;  3O8X A;  5MEP A;  2P5W A;  1KCG C;  4PGC A;  5HGA A;  4MVB A;  3BZF A;  3QQ4 A;  5BJT A;  3ARB A;  1RK0 A;  2P5E A;  4LCC C;  3TO4 A;  4O2F A;  2HN7 A;  3GMM A;  4L8S C;  4PJF A;  3LKO A;  1Q94 A;  5BRZ A;  1T7Z A;  1ZT1 A;  5D7L A;  1OGA A;  2HJK A;  4ZUU A;  1T1Z A;  5F9J A;  4ELM A;  3RWC A;  3B6S A;  3GMO A;  3TO2 A;  4HUV A;  5D5M A;  3VFO A;  1AGD A;  3VXU A;  4PR5 A;  3GSO A;  3HCV A;  4ZUW A;  5C0A A;  5E9D A;  4PGB A;  5EOT A;  1T20 A;  3TBV A;  2ZOL A;  3RWG A;  4ZUS A;  2CLZ A;  2FYY A;  2H26 A;  4K71 B;  3LKS A;  4PG9 A;  3TA3 A;  1JF1 A;  3VXR A;  5C0F A;  3UTS A;  4JFP A;  3C8K A;  3RTQ A;  1EEY A;  3AU1 A;  3BW9 A;  3CDG A;  1FO0 H;  5FA3 A;  5C07 A;  3P9M A;  3M1B A;  1QEW A;  3VFV A;  1VGK A;  1UQS A;  5INC A;  4WO4 A;  3RZC A;  5C0G A;  4MNG A;  4PJH A;  2VLK A;  3FT2 A;  1ED3 A;  3GSQ A;  5D2N A;  3VWK A;  3KYO A;  3FOL A;  4PJG A;  1JE6 A;  1FZO A;  3DX6 A;  3FFC A;  4D0B A;  4MJI A;  3TPU E;  3D2U A;  5HHQ A;  4K7F A;  4FTV A;  4MX7 A;  1WBY A;  4F7E A;  4G8G A;  2AXF A;  3RWD A;  4NQV A;  1QQD A;  3LN5 A;  3MRG A;  4X6D A;  5E8P A;  3REW A;  3SJV A;  3BGM A;  3SCM A;  3L3I A;  1A1O A;  2BCK A;  3CVH A;  1OF2 A;  3MRR A;  4FFE X;  2VAB A;  3BHB A;  4U6X A;  3LKN A;  3GJF A;  4Z76 A;  1S9Y A;  4PRH A;  1JFM A;  1KPU A;  4WU7 A;  3ILP A;  4U1I A;  3O3E A;  3CZF A;  5BS0 A;  3MRD A;  1PQZ A;  2GTW A;  1A9B A;  4PG2 A;  3QUZ A;  4NQC A;  4X6C A;  3TIE A;  3LKQ A;  3TVM A;  3MRF A;  1ZAG A;  2AKR A;  1KJ3 H;  2CII A;  3T8X A;  5IRO A;  1T7X A;  1KJM A;  3P9L A;  4QRU A;  2X4P A;  2GT9 A;  3PWU A;  4NQX A;  1YDP A;  1XZ0 A;  4NO5 A;  1A6Z A;  1MWA H;  1I7R A;  3D3V A;  1HHI A;  3MRP A;  2BVP A;  3BEV A;  1HHK A;  1E27 A;  4NNX A;  4PV9 A;  1N5A A;  2AXG A;  3BP7 A;  3ROL A;  1AGC A;  3ARF A;  3UPR A;  5FKP A;  3GIV A;  3VFM A;  1ZHL A;  3LN4 A;  4GKS A;  1M6O A;  3V5D A;  1ONQ A;  2GJ6 A;  4N0F A;  4E5X A;  3MRL A;  3MV8 A;  1NAM H;  1LP9 A;  1UXW A;  3HPJ A;  2H6P A;  3FQU A;  1HSB A;  3PQY A;  3KPQ A;  4PJC A;  3VH8 A;  3IXA A;  1AGE A;  4WUU A;  3VWJ A;  5L2J A;  3GMN A;  1K8D A;  1SYV A;  4PDC E;  1X7Q A;  1N2R A;  4F7C A;  3VCL A;  1JPF A;  1KTL A;  3VXO A;  4NT6 A;  4G42 A;  5IB1 A;  4Y16 A;  3MRO A;  3TF7 A;  5D7I A;  4JQX A;  4L4V A;  5DEG A;  3PWV A;  3DMM A;  3SDC A;  4PRB A;  1DUY A;  1YPZ A;  4MNQ A;  4L3C A;  3FRU A;  4IRJ A;  2F53 A;  3MV7 A;  2AV1 A;  4U1M A;  3VFW A;  3BWA A;  4L8C A;  3I6K A;  3T1F A;  4QRR A;  1S7W A;  1UXS A;  4ZUT A;  1S7R A;  3O3B A;  3WL9 A;  1S7T A;  1QR1 A;  5EU6 A;  2YPK A;  4MJ6 A;  4PJ8 A;  2X4R A;  1VAC A;  1FFO A;  3TFK A;  3PAB A;  3ARE A;  3AM8 A;  4IRS A;  4L29 A;  2HJL A;  3IT8 D;  3MGO A;  4G9D A;  4QRQ A;  1DE4 A;  1ZHB A;  5EU3 A;  3GSR A;  4N0C A;  1FZM A;  1T0M A;  4HUU A;  1IM9 A;  4JFQ A;  1MHE A;  4U1J A;  4L8B A;  4QRT A;  1ZHK A;  2A83 A;  3GMR A;  3HLA A;  3KPR A;  3L3H A;  4NO2 A;  4WU5 A;  2VE6 A;  4Y4F A;  4UQ2 A;  5E8N A;  4UQ3 A;  2BVQ A;  2UWE A;  1AO7 A;  3H9H A;  3I0T A;  3NFN A;  5J6H A;  3CCH A;  3JVG A;  1HHH A;  4Y4H A;  3GSN H;  1L8J A;  5F1I A;  4G59 A;  1JGE A;  1KJ2 H;  2IA1 A;  3P4O A;  1AGB A;  3X12 A;  4PRE A;  3U0P A;  3RL2 A;  4PGD A;  2BSS A;  4N8V A;  5SWS A;  3OXS A;  4G8I A;  4PJX A;  5EO0 A;  5HHM A;  2CKB H;  1S9X A;  3MRM A;  3VFU A;  5C0J A;  3VXM A;  5ACZ A;  5DDH A;  2YEZ A;  1P7Q A;  4PJ5 A;  5D2L A;  3CH1 A;  1LDP H;  1YN7 A;  5EFI A;  2BST A;  4NO3 A;  3FTG A;  2VLR A;  2GTZ A;  1S7X A;  4PJ7 A;  1LK2 A;  3TN0 A;  2VLJ A;  1TVH A;  2ESV A;  1A1N A;  5IB5 A;  3FON A;  5C9J A;  1K5N A;  4GUP A;  1G7P A;  1ZVS A;  4PRD A;  3P4M A;  4ZUV A;  3RWF A;  5IEH A;  3QDJ A;  4X6E A;  3ARD A;  4L3E A;  4MXQ A;  4HKJ A;  1T1Y A;  4V3E B;  3QFJ A;  4PRA A;  5C0I A;  1QVO A;  3ARG A;  5F7D A;  3WS6 A;  5MEN A;  4U1K A;  1FFP A;  1WBZ A;  4HUW A;  4BKW A;  5C09 A;  3FQT A;  3FT4 A;  4JFO A;  4CVX A;  4XXC A;  2GUO A;  1S7V A;  3TBW A;  3GSX A;  3V5K A;  3BZE A;  3X13 A;  3D39 A;  3ES6 A;  4I48 A;  3PWJ A;  3QUL A;  5E6I C;  3MRI A;  1B0G A;  4L4T A;  3SPV A;  3PWL A;  4QRS A;  4ZAK A;  3MRJ A;  3RWE A;  1M05 A;  3HE7 A;  1T1W A;  5IB4 A;  3W39 A;  4HS3 A;  2BNR A;  3L3D A;  3G08 A;  3BH8 A;  2X70 A;  1BQH A;  4PJ9 A;  1KJV A;  3BO8 A;  5C0D A;  3BP4 A;  3P73 A;  5HHP A;  2FIK A;  5EUO A;  3QEQ A;  4S0U C;  1LEK A;  3ECB A;  3MRN A;  2X4N A;  2CLR A;  3ILQ C;  4LCW A;  1AGF A;  4JRY A;  4O2C A;  1E28 A;  1I7T A;  1I7U A;  3CC5 A;  2AV7 A;  2V2X A;  3ROO A;  3DBX A;  4I4W A;  5FA4 A;  4WDI A;  1ZT7 A;  3CPL A;  2O5N A;  1DDH A;  3GSV A;  3O4L A;  5HHN A;  3RWH A;  4IIQ C;  3TJH A;  1EXU A;  3E2H A;  1Z5L A;  1HHG A;  3FOM A;  5H94 A;  1GZP A;  3UTT A;  3WLB A;  4PJD A;  3UTQ A;  4LHU A;  1FFN A;  2X4U A;  1NAN H;  1XH3 A;  3MV9 A;  3VFS A;  3X11 A;  3L9R A;  2WY3 A;  4NQD A;  3QUX A;  5MER A;  1XR8 A;  2FO4 A;  3KLA A;  4Y4K A;  5J1A A;  4HX1 A;  3P4N A;  4EUP A;  1QSE A;  1I1Y A;  5C08 A;  3VJ6 A;  4NNY A;  3VXP A;  5C0C A;  4LCY A;  3MRK A;  3UBX A;  3BH9 A;  2ZSW A;  4CVZ A;  3FT3 A;  3TBY A;  1CE6 A;  1LQV A;  1S7U A;  2NX5 A;  3H9S A;  4PRN A;  4PP8 C;  3RWJ A;  4PJE A;  1B3J A;  4WJ5 A;  3DX7 A;  3VXN A;  5IEK A;  3MRC A;  5FDW A;  1S9W A;  4WW2 C;  4JFD A;  4IHO A;  5SWQ A;  1IM3 A;  4LNR A;  1G6R H;  3TZV C;  1S7Q A;  3E6H A;  1KPV A;  3I6G A;  3L3J A;  1KPR A;  3BVN A;  5J6G A;  4N5E A;  2DYP A;  4U1N A;  1EFX A;  1EEZ A;  4NHU E;  4PJI A;  4WWK C;  3FQW A;  2FWO A;  5DEF A;  4NQE A;  4U1H A;  3VFR A;  3SKM A;  4D0D A;  5EU5 A;  5HGB A;  3WS3 A;  1ZHN A;  3KPM A;  4F7M A;  4N0U A;  3SDD A;  2CLV A;  3HUJ A;  5GSV A;  5AD0 A;  3VFN A;  5F1N A;  3MR9 A;  3MRE A;  3JTT A;  3S6C A;  1BD2 A;  1T7W A;  3LKR A;  3KPO A;  1CD1 A;  4MQ7 A;  3BEW A;  4JQV A;  3SDX A;  3B3I A;  3JTC A;  3P77 A;  2AK4 A;  4U6Y A;  1HHJ A;  1S7S A;  5IB3 A;  1FZK A;  3GML A;  5B38 A;  3MA7 A;  1I1A A;  5ISZ A;  4EN3 C;  1LD9 A;  3QZW A;  3SDA A;  1ZT4 A;  4G59 C;  3VRJ A;  1JUF A;  5IM7 A;  1KBG H;  1RJY A;  2X4Q A;  3TBS A;  3QI9 A;  3WUW A;  3GSU A;  3HG1 A;  2OL3 H;  1RJZ A;  3L3K A;  2VLL A;  4NSK A;  4EI5 A;  3HE6 A;  1DUZ A;  5JHD A;  4PJB A;  5IB2 A;  2F54 A;  1P1Z A;  2J8U A;  3VRI A;  4ONO A;  3OV6 A;  3ERY A;  3I6L D;  5E8O A;  5EO1 A;  4Z77 A;  3TID A;  4NO0 A;  4X6F A;  5IVX A;  1B0R A;  5MEQ A;  3VFP A;  2Q7Y A;  3KXF A;  5HYJ A;  2ZOK A;  1MHC A;  5HGD A;  1WBX A;  1JHT A;  3KPP A;  5D7J C;  5MEO A;  4HV8 A;  3MRQ A;  3MYJ A;  1T7Y A;  4JRX A;  3LV3 A;  1FG2 A;  1LEG A;  3FQX A;  3QUY A;  4PRP A;  2ZSV A;  3RGV C;  3W0W A;  4F7T A;  3L3G A;  3QDG A;  2NW3 A;  4APQ A;  3VFT A;  3RWI A;  3KWW A;  3VXS A;  2OI9 A;  1S8D A;  1INQ A;  2V2W A;  3GSW A;  3QUK A;  4G43 A;  2XFX A;  2JCC A;  4HWZ A;  3QQ3 A;  3O3D A; 
#chains in the Genus database with same CATH homology
 1MI5 A;  4JFF A;  4MJ5 A;  3QDM A;  1QLF A;  1BII A;  2BVO A;  3E6F A;  3HAE A;  3X14 A;  4E0R A;  1P4L A;  2X4T A;  4QOK A;  4PV8 A;  1T0N A;  1W72 A;  1I4F A;  1RK1 A;  5SWZ A;  1A9E A;  3V5H A;  3RL1 A;  5HHO A;  3C9N A;  3DX8 A;  3E3Q A;  4F7P A;  1CG9 A;  1R3H A;  4V3D B;  1QO3 A;  2RFX A;  1JPG A;  5D9S A;  3MRB A;  2VAA A;  4G9F A;  5C0B A;  5BXF A;  5GSR A;  3RUG A;  1AKJ A;  1N3N A;  4CW1 A;  1FZJ A;  1TMC A;  3DXA A;  4JFE A;  1W0W A;  4L9L C;  3DTX A;  1A1M A;  3MGT A;  1HYR C;  5HGH A;  3H7B A;  3D18 A;  1HOC A;  2X4O A;  4U1S A;  3O9W A;  1T1X A;  3OX8 A;  5C0E A;  2CIK A;  3LKP A;  4HUX A;  3O3A A;  1N59 A;  5EU4 A;  4D0C A;  5L2K A;  4ZFZ A;  3KPL A;  2BSR A;  3JTS A;  4L8D A;  2X4S A;  1I1F A;  3QFD A;  4MS8 A;  1ZSD A;  4PJA A;  3PWP A;  2XPG A;  4Z78 A;  3M17 A;  1BZ9 A;  2C7U A;  1SYS A;  1T21 A;  3TBT A;  2FZ3 A;  2GIT A;  3D25 A;  1OSZ A;  3PWN A;  5E00 A;  3FQR A;  2D31 A;  2E7L E;  5B39 A;  1YN6 A;  1T7V A;  2YPL A;  4U1L A;  1U58 A;  1OGT A;  3FQN A;  1NEZ A;  1HSA A;  1T22 A;  1W0V A;  1GZQ A;  3SKO A;  1QRN A;  2HLA A;  2PYE A;  3KPS A;  1VAD A;  1G7Q A;  2F74 A;  2PO6 A;  5ENW A;  3OXR A;  1T80 A;  2MHA A;  1QSF A;  4Y2D A;  3GMQ A;  1JGD A;  3BUY A;  3GMP A;  3MRH A;  3BXN A;  2GAZ A;  4GKN A;  5IND A;  1ZS8 A;  4QRP A;  1XR9 A;  1C16 A;  4O2E A;  3KYN A;  4PGE A;  3KPN A;  2BNQ A;  4PRI A;  1TVB A;  3O8X A;  5MEP A;  2P5W A;  1KCG C;  4PGC A;  5HGA A;  4MVB A;  3BZF A;  3QQ4 A;  5BJT A;  3ARB A;  1RK0 A;  2P5E A;  4LCC C;  3TO4 A;  4O2F A;  2HN7 A;  3GMM A;  4L8S C;  4PJF A;  3LKO A;  1Q94 A;  5BRZ A;  1T7Z A;  1ZT1 A;  5D7L A;  1OGA A;  2HJK A;  4ZUU A;  1T1Z A;  5F9J A;  4ELM A;  3RWC A;  3B6S A;  3GMO A;  3TO2 A;  4HUV A;  5D5M A;  3VFO A;  1AGD A;  3VXU A;  4PR5 A;  3GSO A;  3HCV A;  4ZUW A;  5C0A A;  5E9D A;  4PGB A;  5EOT A;  1T20 A;  3TBV A;  2ZOL A;  3RWG A;  4ZUS A;  2CLZ A;  2FYY A;  2H26 A;  4K71 B;  3LKS A;  4PG9 A;  3TA3 A;  1JF1 A;  3VXR A;  5C0F A;  3UTS A;  4JFP A;  3C8K A;  3RTQ A;  1EEY A;  3AU1 A;  3BW9 A;  3CDG A;  1FO0 H;  5FA3 A;  5C07 A;  3P9M A;  3M1B A;  1QEW A;  3VFV A;  1VGK A;  1UQS A;  5INC A;  4WO4 A;  3RZC A;  5C0G A;  4MNG A;  4PJH A;  2VLK A;  3FT2 A;  1ED3 A;  3GSQ A;  5D2N A;  3VWK A;  3KYO A;  3FOL A;  4PJG A;  1JE6 A;  1FZO A;  3DX6 A;  3FFC A;  4D0B A;  4MJI A;  3TPU E;  3D2U A;  5HHQ A;  4K7F A;  4FTV A;  4MX7 A;  1WBY A;  4F7E A;  4G8G A;  2AXF A;  3RWD A;  4NQV A;  1QQD A;  3LN5 A;  3MRG A;  4X6D A;  5E8P A;  3REW A;  3SJV A;  3BGM A;  3SCM A;  3L3I A;  1A1O A;  2BCK A;  3CVH A;  1OF2 A;  3MRR A;  4FFE X;  2VAB A;  3BHB A;  4U6X A;  3LKN A;  3GJF A;  4Z76 A;  1S9Y A;  4PRH A;  1JFM A;  1KPU A;  4WU7 A;  3ILP A;  4U1I A;  3O3E A;  3CZF A;  5BS0 A;  3MRD A;  1PQZ A;  2GTW A;  1A9B A;  4PG2 A;  3QUZ A;  4NQC A;  4X6C A;  3TIE A;  3LKQ A;  3TVM A;  3MRF A;  1ZAG A;  2AKR A;  1KJ3 H;  2CII A;  3T8X A;  5IRO A;  1T7X A;  1KJM A;  3P9L A;  4QRU A;  2X4P A;  2GT9 A;  3PWU A;  4NQX A;  1YDP A;  1XZ0 A;  4NO5 A;  1A6Z A;  1MWA H;  1I7R A;  3D3V A;  1HHI A;  3MRP A;  2BVP A;  3BEV A;  1HHK A;  1E27 A;  4NNX A;  4PV9 A;  1N5A A;  2AXG A;  3BP7 A;  3ROL A;  1AGC A;  3ARF A;  3UPR A;  5FKP A;  3GIV A;  3VFM A;  1ZHL A;  3LN4 A;  4GKS A;  1M6O A;  3V5D A;  1ONQ A;  2GJ6 A;  4N0F A;  4E5X A;  3MRL A;  3MV8 A;  1NAM H;  1LP9 A;  1UXW A;  3HPJ A;  2H6P A;  3FQU A;  1HSB A;  3PQY A;  3KPQ A;  4PJC A;  3VH8 A;  3IXA A;  1AGE A;  4WUU A;  3VWJ A;  5L2J A;  3GMN A;  1K8D A;  1SYV A;  4PDC E;  1X7Q A;  1N2R A;  4F7C A;  3VCL A;  1JPF A;  1KTL A;  3VXO A;  4NT6 A;  4G42 A;  5IB1 A;  4Y16 A;  3MRO A;  3TF7 A;  5D7I A;  4JQX A;  4L4V A;  5DEG A;  3PWV A;  3DMM A;  3SDC A;  4PRB A;  1DUY A;  1YPZ A;  4MNQ A;  4L3C A;  3FRU A;  4IRJ A;  2F53 A;  3MV7 A;  2AV1 A;  4U1M A;  3VFW A;  3BWA A;  4L8C A;  3I6K A;  3T1F A;  4QRR A;  1S7W A;  1UXS A;  4ZUT A;  1S7R A;  3O3B A;  3WL9 A;  1S7T A;  1QR1 A;  5EU6 A;  2YPK A;  4MJ6 A;  4PJ8 A;  2X4R A;  1VAC A;  1FFO A;  3TFK A;  3PAB A;  3ARE A;  3AM8 A;  4IRS A;  4L29 A;  2HJL A;  3IT8 D;  3MGO A;  4G9D A;  4QRQ A;  1DE4 A;  1ZHB A;  5EU3 A;  3GSR A;  4N0C A;  1FZM A;  1T0M A;  4HUU A;  1IM9 A;  4JFQ A;  1MHE A;  4U1J A;  4L8B A;  4QRT A;  1ZHK A;  2A83 A;  3GMR A;  3HLA A;  3KPR A;  3L3H A;  4NO2 A;  4WU5 A;  2VE6 A;  4Y4F A;  4UQ2 A;  5E8N A;  4UQ3 A;  2BVQ A;  2UWE A;  1AO7 A;  3H9H A;  3NFN A;  5J6H A;  3CCH A;  3JVG A;  1HHH A;  4Y4H A;  3GSN H;  1L8J A;  5F1I A;  4G59 A;  1JGE A;  1KJ2 H;  3P4O A;  1AGB A;  3X12 A;  4PRE A;  3U0P A;  3RL2 A;  4PGD A;  2BSS A;  4N8V A;  5SWS A;  3OXS A;  4G8I A;  4PJX A;  5EO0 A;  5HHM A;  2CKB H;  1S9X A;  3MRM A;  3VFU A;  5C0J A;  3VXM A;  5ACZ A;  5DDH A;  2YEZ A;  1P7Q A;  4PJ5 A;  5D2L A;  3CH1 A;  1LDP H;  1YN7 A;  5EFI A;  2BST A;  4NO3 A;  3FTG A;  2VLR A;  2GTZ A;  1S7X A;  4PJ7 A;  1LK2 A;  3TN0 A;  2VLJ A;  1TVH A;  2ESV A;  1A1N A;  5IB5 A;  3FON A;  5C9J A;  1K5N A;  4GUP A;  1G7P A;  1ZVS A;  4PRD A;  3P4M A;  4ZUV A;  3RWF A;  5IEH A;  3QDJ A;  4X6E A;  3ARD A;  4L3E A;  4MXQ A;  4HKJ A;  1T1Y A;  4V3E B;  3QFJ A;  4PRA A;  5C0I A;  1QVO A;  3ARG A;  5F7D A;  3WS6 A;  5MEN A;  4U1K A;  1FFP A;  1WBZ A;  4HUW A;  5C09 A;  3FQT A;  3FT4 A;  4JFO A;  4CVX A;  4XXC A;  2GUO A;  1S7V A;  3TBW A;  3GSX A;  3V5K A;  3BZE A;  3X13 A;  3D39 A;  3ES6 A;  4I48 A;  3PWJ A;  3QUL A;  5E6I C;  3MRI A;  1B0G A;  4L4T A;  3SPV A;  3PWL A;  4QRS A;  4ZAK A;  3MRJ A;  3RWE A;  1M05 A;  3HE7 A;  1T1W A;  5IB4 A;  3W39 A;  4HS3 A;  2BNR A;  3L3D A;  3G08 A;  3BH8 A;  2X70 A;  1BQH A;  4PJ9 A;  1KJV A;  3BO8 A;  5C0D A;  3BP4 A;  3P73 A;  5HHP A;  2FIK A;  5EUO A;  3QEQ A;  4S0U C;  1LEK A;  3ECB A;  3MRN A;  2X4N A;  2CLR A;  3ILQ C;  4LCW A;  1AGF A;  4JRY A;  4O2C A;  1E28 A;  1I7T A;  1I7U A;  3CC5 A;  2AV7 A;  2V2X A;  3ROO A;  3DBX A;  4I4W A;  5FA4 A;  4WDI A;  1ZT7 A;  3CPL A;  1DDH A;  3GSV A;  3O4L A;  5HHN A;  3RWH A;  4IIQ C;  3TJH A;  1EXU A;  3E2H A;  1Z5L A;  1HHG A;  3FOM A;  5H94 A;  1GZP A;  3UTT A;  3WLB A;  4PJD A;  3UTQ A;  4LHU A;  1FFN A;  2X4U A;  1NAN H;  1XH3 A;  3MV9 A;  3VFS A;  3X11 A;  3L9R A;  2WY3 A;  4NQD A;  3QUX A;  5MER A;  1XR8 A;  2FO4 A;  3KLA A;  4Y4K A;  5J1A A;  4HX1 A;  3P4N A;  4EUP A;  1QSE A;  1I1Y A;  5C08 A;  3VJ6 A;  4NNY A;  3VXP A;  5C0C A;  4LCY A;  3MRK A;  3UBX A;  3BH9 A;  2ZSW A;  4CVZ A;  3FT3 A;  3TBY A;  1CE6 A;  1LQV A;  1S7U A;  2NX5 A;  3H9S A;  4PRN A;  4PP8 C;  3RWJ A;  4PJE A;  1B3J A;  4WJ5 A;  3DX7 A;  3VXN A;  5IEK A;  3MRC A;  5FDW A;  1S9W A;  4WW2 C;  4JFD A;  4IHO A;  5SWQ A;  1IM3 A;  4LNR A;  1G6R H;  3TZV C;  1S7Q A;  3E6H A;  1KPV A;  3I6G A;  3L3J A;  1KPR A;  3BVN A;  5J6G A;  4N5E A;  2DYP A;  4U1N A;  1EFX A;  1EEZ A;  4NHU E;  4PJI A;  4WWK C;  3FQW A;  2FWO A;  5DEF A;  4NQE A;  4U1H A;  3VFR A;  3SKM A;  4D0D A;  5EU5 A;  5HGB A;  3WS3 A;  1ZHN A;  3KPM A;  4F7M A;  4N0U A;  3SDD A;  2CLV A;  3HUJ A;  5GSV A;  5AD0 A;  3VFN A;  5F1N A;  3MR9 A;  3MRE A;  3JTT A;  3S6C A;  1BD2 A;  1T7W A;  3LKR A;  3KPO A;  1CD1 A;  4MQ7 A;  3BEW A;  4JQV A;  3SDX A;  3B3I A;  3JTC A;  3P77 A;  2AK4 A;  4U6Y A;  1HHJ A;  1S7S A;  5IB3 A;  1FZK A;  3GML A;  5B38 A;  3MA7 A;  1I1A A;  5ISZ A;  4EN3 C;  1LD9 A;  3QZW A;  3SDA A;  1ZT4 A;  5IM7 A;  3VRJ A;  1JUF A;  1KBG H;  1RJY A;  2X4Q A;  3TBS A;  3QI9 A;  3WUW A;  3GSU A;  3HG1 A;  2OL3 H;  1RJZ A;  3L3K A;  2VLL A;  4NSK A;  4EI5 A;  3HE6 A;  1DUZ A;  5JHD A;  4PJB A;  5IB2 A;  2F54 A;  1P1Z A;  2J8U A;  3VRI A;  4ONO A;  3OV6 A;  3ERY A;  3I6L D;  5E8O A;  5EO1 A;  4Z77 A;  3TID A;  4NO0 A;  4X6F A;  5IVX A;  1B0R A;  5MEQ A;  3VFP A;  2Q7Y A;  3KXF A;  5HYJ A;  2ZOK A;  1MHC A;  5HGD A;  1WBX A;  1JHT A;  3KPP A;  5D7J C;  5MEO A;  4HV8 A;  3MRQ A;  3MYJ A;  1T7Y A;  4JRX A;  3LV3 A;  1FG2 A;  1LEG A;  3FQX A;  3QUY A;  4PRP A;  2ZSV A;  3RGV C;  3W0W A;  4F7T A;  3L3G A;  3QDG A;  2NW3 A;  4APQ A;  3VFT A;  3RWI A;  3KWW A;  3VXS A;  2OI9 A;  1S8D A;  1INQ A;  2V2W A;  3GSW A;  3QUK A;  4G43 A;  2XFX A;  2JCC A;  4HWZ A;  3QQ3 A;  3O3D A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...