4F7CA

Crystal structure of bovine cd1d with bound c12-di-sulfatide
Total Genus 75
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
75
sequence length
273
structure length
269
Chain Sequence
b'PFSFQGLQISSFANRSWTRTDGLAWLGELQPYTWRNESDTIRFLKPWSRGTFSDQQWEQLQHTLLVYRSSFTRDIWEFVEKLHVEYPLEIQIATGCELLSESFLRAAFQGRDVLSFQGMSWVSAPDAPPFIQEVIKVLNQNQGTKETVHWLLHDIWPELVRGVLQTGKSELEKQVKPEAWLSSGPSPGPGRLLLVCHVSGFYPKPVRVMWMRGEQEEPGTRQGDVMPNADSTWYLRVTLDVAAGEVAGLSCQVKHSSLGDQDIILYWHH'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CD1D antigen, d polypeptide
publication title Crystal Structures of Bovine CD1d Reveal Altered αGalCer Presentation and a Restricted A' Pocket Unable to Bind Long-Chain Glycolipids.
pubmed doi rcsb
source organism Bos taurus
molecule tags Immune system
total genus 75
structure length 269
sequence length 273
chains with identical sequence C
ec nomenclature
pdb deposition date 2012-05-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4f7cA02
3.30.500.10 Alpha Beta 2-Layer Sandwich Murine Class I Major Histocompatibility Complex, H2-DB; Chain A, domain 1 MHC class I-like antigen recognition-like 4f7cA01
2ICWB 4S1RL 3RNQB 1JRHH 3AREB 4LLVB 3B9EA 1KCGC 2B5IC 3U2SA 3ES6B 4OT1L 5H37G 1Y6KR 4GSDH 4P4KB 4W68A 1SJHA 4NQCA 2DRUA 4X4ME 3PNWA 1NFDA 3OKKA 3QFJB 2X4OA 1Z3GL 5KVGH 1URLA 4J1UA 1BREA 5EN2B 1PDKA 1T2XA 1KXTB 1QTYT 1HEZB 1X3DA 4LCYB 5GJSL 4NM8L 4ODTL 3STZB 4FG6D 2XXMB 1P7QB 5I2IB 4GAYA 1OGAA 1UJTA 1IGYB 2WQRA 4IIQC 2JCCE 4JRYD 3GFUA 4G42B 4G9FE 3VFVB 4QRSB 5D96C 2H1PL 3Q5YA 1CICA 1U0QA 1KENL 4I77H 4WHDA 3EYUH 5HHVH 2FHBA 5LWYL 2BSRB 4D9LH 1YNTB 4YO0A 5IB5B 4AM0A 1FZJA 4L29B 4WY7H 4LGSB 2EE2A 1J12A 2W9DH 4EOWH 2VOTA 1DQJB 4JR9L 5I17A 5A2IH 4UV7H 4DVBB 3U6RB 5E6YA 3V95A 1CN4A 1XMWA 1E6JH 3EYQC 3OR6A 4GFTB 1ZVSA 1RUML 5BS0B 3BN3B 2KBGA 4I48B 2BJML 4L8SA 4JQVC 1S9XA 4Z7UF 3LPFA 5FEBA 5IMLB 5IQ7H 1KGCD 2Z93B 3KHOA 4XNQA 2HJFA 3TBSB 4Y2DA 4KRPB 1ZANL 5CS7A 5JNYB 2XQYG 4EZMA 4M3JA 4J3OC 2HJKA 1NAMB 1QRNB 5I1JL 3IB4A 3L7FB 4P46A 1JN6B 1YY8A 1YN6B 5DEGA 1PY4A 2UY6A 3WKML 4CMMB 4RX4A 2J4WL 1A5FH 3BH8A 3ES6A 1SMAA 3O4LE 2W65A 1UCTA 1F4HA 1K2DA 4GKNB 4NC0B 4PRHD 1B2WL 2R0LH 3W9DB 2UZXB 4D9RE 3QFJA 3C5ZB 3B3IA 3MRMA 1ZLUH 4NQDE 2H6PB 3WO3B 3RWCB 1XAUA 4PJEF 5C0JA 5I2IA 4FQCL 3P9WB 3ARDC 5DUML 2BX5A 2R23B 1AGDB 4R3SA 1L9NA 3GM0A 3Q6FB 3NIFE 3HI1A 3VA6A 3I6LE 1LILA 3L5HA 4PJAA 2I07A 1IEBA 1RIVH 5FYLD 3A67L 4GH7B 3NA9H 4MLIA 4S11A 3CXHK 4X7TA 4WHTA 1NCCL 1YNTA 3FL7A 1NAML 3WUWB 4R9HA 4Z7OE 4ZXBC 5IB5A 3GSNB 5F9AC 3ZYZA 1DQJA 5L88L 5FO9A 1ZHLB 3EW3B 4GRLD 3GB7A 1DLFH 4LP5A 1FG2B 5LVEA 4HK3J 5EO0B 4PB0H 1MHPL 2Z92B 4LVEA 1YEIL 5KSAA 3P9LB 3L3JA 2V5TA 1U92B 4PV9A 1M71B 1L0YA 2IADB 5CINL 5HHQA 5J6HB 1BD2E 3RY6A 2BVPA 2V6HA 4HH8A 3SDAA 4NDMA 4LEXL 3NH7H 2NX5E 4OCSL 1R5IA 4BFIB 1GZQA 3UAJC 1EO8H 5E24E 4D9QD 5EBWA 3TN0C 1IT9H 1INDH 4F7PB 1JN6A 1LEGB 4WWKC 1YN6A 2W0FA 3LKNA 2CK0H 5JUEL 4DCQB 1JF1B 2ZPKH 2E7LE 2X4UB 4CMMA 4MJIA 4UDUB 3DVNA 3SPVB 4WTWA 4X6CF 3W2DL 3CDCA 2F54B 3GSNL 2UY7A 4NCC1 4N0RA 4KGJA 4WO4A 1L9MA 1X5ZA 2VE6B 3CX5K 5EO1A 5F9WB 3UTTE 3RL2A 4KZEL 2B1AH 5HDLA 2I24N 5GZOC 3GHBH 2VRAA 4ZTPL 3RZCA 2DOCA 3FAXA 1U8LB 3BJ91 3TJEL 5F96H 4DKEL 2EC9U 3QH3A 4OZHF 4D0DB 4MQ7B 32C2A 4UAOB 5HDOA 1YNKL 4UDTA 3C2AL 4ZPVB 3Q6FA 1UWEL 5DO2D 4TNWF 1OAUL 3MCKA 4R7NA 1LDSA 4V1DE 1KJMA 3ECBA 4EI6A 5EC1A 1LP9F 3P4OA 5E2UH 3CSYB 2YUXA 4OF6A 1JWSA 2QSCL 3CDGA 1OAQL 4M7LH 5MEOA 3AB0C 1H3PH 2EICA 4JRYE 1CCZA 4P23D 3ZHDA 2RFXA 1UG9A 4UIKH 3L95A 4ZTOL 5DHYB 4BA8A 1DQQA 1HYSD 2ZZUT 1HINH 3D9AH 5I16A 1CT8B 2AEQL 4PRAB 4K94L 4KKNA 5EB9A 3WL9A 4M5YL 4HV8B 4G6FB 1M71A 2A73B 4JFFB 4P2OD 5ALCL 3ZE0F 2YA1A 5GGTL 2R0ZH 2VR9A 5CJ5A 5IUSA 4OD1H 4U31A 5MERB 4HPOL 3T04D 1B90A 3S5LA 3NFNA 2FX8H 1XF4B 2UZIH 5IB2A 1J1OH 4QXUH 4F9LC 2X4NA 1MCOH 2YK1L 4QEGA 1IZKA 2P8PA 4KTDH 1KTDB 4IOFC 5C0IB 1XGTB 3QDGD 3VFNA 4QRQB 4CUCA 4LFHD 1A0QH 1P7KB 1FFRA 4UDUA 5TE7H 1AQKL 3KPNA 3WJJA 4O5LH 2V7HA 1DBKH 1YEJH 4JFYB 4QRPD 4QWWC 4MD0A 4QHMA 2KH2B 3QPXL 4S1RH 5GGTA 2XWJA 3VDBA 4X6DB 4YXHL 3TA3B 4UOW0 1AHWB 3DX8A 1BOYA 3SBWC 1G7PA 4MVBC 3D5OF 4DEPC 1MFAL 4Q58C 2V7NB 1Z3GH 3QXVA 3RVVD 3O4LA 5TDPB 3ARBC 5GJSH 1Q38A 4NM8H 4ODTH 2IFFH 2YC1A 4D3CL 3B43A 1UH3A 3PXHA 2ZSVA 3NBNA 3QXDB 1NGZA 3CSYA 4F7MB 4J3SA 1DBJL 1MNUL 4LFHG 1A6ZB 3QDJB 1QNZL 3W11C 1KENH 5J56B 3MFGB 3SDDA 5DHYA 3IFPB 5LWYH 3WUZA 4R90L 5FYLE 5DJXB 3T0AA 1ZVHA 5E6IA 4R0LA 4OCMC 3BWAA 5ESQA 2YD9A 1JGDA 4XGZA 5T1DL 5BV7B 4AT6A 5IJKA 4HFUL 4HLJA 1SEQL 1MVUA 1RUMH 3V6BR 3KPRB 3K1DA 2BJMH 1HHKB 4Y5YB 1G7MA 2APFA 2ZCKL 2R8SL 2I26N 1ZANH 4QT5B 5C0IA 1RZKC 2FECI 1XGTA 3IDYB 3DMMA 1VKXA 1CL7I 1TCMA 1XCTA 3MJ9L 3FO0L 4WU5A 1OCWL 3OJDB 5DJYB 1BD2A 1CXLA 3DUHA 1P6AB 4ZXBD 4D9QE 1JPFB 3WKMH 1NLDL 3UDWC 1KG0B 2J4WH 1BJMA 2K7PA 3TA3A 2GW5A 3DGGB 2XN9E 5J0BA 3PV6A 4CL7A 1B2WH 1XR9B 4QRRD 1Y0LA 2BCKB 5FOJA 2E7LA 5J57B 3CFEB 5BV7L 2NY2C 2Y5EA 4QF1B 3MV9A 5HDBE 1LO2L 5L9DL 4U2YA 4JFOB 3W5MA 2EIZA 4NT6B 1TZIA 5IFJA 1BBDL 4QHUA 2R9HC 2ED9A 3C09C 1FNEA 1RJLA 3KPPB 3DVFA 3MJ9A 4MD5A 5D1ZA 3UAJD 1ZHKB 4J4PC 4FQCH 3CFJA 4QTIL 1EAPA 4Y4KA 3FHQA 3ULUC 5HHNB 5HYIA 3BKJL 5H2BA 4LLMB 4Z7WE 4HUXB 2PNDA 2EKSB 3U0TB 1YMMB 2AEIT 4K3DL 3A67H 4HXAL 3FQRB 5GGSY 5IB4A 1NCCH 1KELL 5FO7A 1NAMH 1RZ7L 2YEZB 1KCSL 4MHHG 5DJXA 4GKOA 3VXRB 4GKSB 5CJBA 1UACL 1ETZB 1T0PB 3Q2CA 1WZMA 2OM5A 3KPSB 5KAQG 4PJ8C 1XIWB 1EHLL 3TBYB 1MHPH 3LRSB 1MAML 5FYJD 1YEIH 2BVOB 4RWHA 4Y5YA 4JRYA 2WW8A 2Y72A 3HG1E 5D1XB 5CINH 1HXYB 1QEWA 4JM4L 4LEXH 1HHHB 4OCSH 4QT5A 4UT6L 3CCHA 5IK3B 3UC0H 2HFFB 5EUOB 2P5WB 2Y06L 2V9TA 3OJDA 4M5ZL 4GW1B 3GSUA 5CZXC 2DQJH 5JUEH 2DBLL 5M94B 1NUNB 3GSWB 4JM2F 3OGCB 3QDGE 1BX2B 1NGXB 1T1ZB 2FECL 3OKEB 5CLTA 5IEKB 1JZ7A 4MCZB 3MOQA 1JF6A 5IEHB 4W6XB 2GEEA 3W2DH 3GSNH 3WXWL 2DKUA 1T2JA 5GISL 1OTSC 3MJGX 4LCIL 4C57C 4CU8A 4JFDE 4JM2C 3QWOA 2HFGL 5F7MC 3CFBB 1ZHKA 3TJEH 4DKEH 5DJ8A 1INEL 2ERJC 4F37K 1IC4L 2X9YA 4X9GA 2D0GA 3VI3F 3C2AH 5IG7B 4IOFD 3AMLA 4MXQD 2RAMA 4U1MA 3E8UL 3R8QA 4BQ9A 4Z76A 1QG3A 4MJ6B 5CJOL 2J8OA 2DLTA 5E4IA 1JK8B 4PRHA 5TQ2L 2CLZB 4OD3H 4XBPB 4WTXA 3U0WL 2QSCH 1WITA 2YEZA 4JCLA 5FV1L 3FO1B 4FQXC 1D9KD 4MAUL 1PX4A 4OZFB 4RGNC 5SX4I 4Z5RB 3W81A 1JHTB 2EYTB 4G6AC 4ZTOH 3SDCC 1MJ7L 2EEAA 2AEQH 1JZ8A 1U8OB 4K94H 4JRXD 3KPTA 4FXGB 4M5YH 2CIKA 5ALCH 4RRPG 3GMOB 5GGTH 1HXYA 5HYSB 2UWEB 1K8DA 3CSGA 3VRLF 1F5WA 1JIBA 4M1GL 1LNUB 3IF1A 4WEBL 2VN4A 2HFFA 1F4YL 1VFAB 1OGTB 2YK1H 1T5XB 3WFDL 4GRLA 5TDNB 3TWCL 1EBAA 3VFMB 4PJDE 3V6OE 2B5IB 3GSWA 4JGUA 1G7LA 3REVB 1AQKH 2VKWA 3ZDYE 3X3FL 4HKXA 1E0OB 5IEKA 1LEIB 1DZBA 3ET9F 3OF6D 4PJAF 1FNFA 4GW5A 1CFVL 4EDXB 2GI7A 3VXQA 3QPXH 1P4LA 3VXUD 4YXHH 1DUZB 1HHGB 4RMSA 5DHVB 2R2BA 4WTZG 1N59B 1N7ML 3TC9A 3WFEL 4YWGL 3DECA 2CR6A 3MYZA 1MFAH 1I8MA 1OP3H 4HCRL 3CH8A 4X6BB 1NCAL 1A9BA 4IIQB 2WNGA 1LK3L 1S5HB 5D96B 5IG7A 4OQTL 1CDGA 1DUYB 4JKLA 1HI6B 3QB7C 2V9QA 3QCTL 1FAIL 2FB4L 4QRPB 5A16B 1JK8A 4XBPA 3UP1A 1NL0L 3WFCL 1DBJH 3NABL 1N5YL 3FO1A 1MNUH 1N6UA 4M61A 3F5WB 3WEXB 1QNZH 5DSCB 1JHTA 5FGRA 3MUY1 2D7NA 5H37H 4YR6B 4RCAA 4R90H 4HUVB 3LQZA 4UNUA 4H0IA 1UM5L 4FQIL 3U82B 1I8KA 4HCRA 4FXGA 4Z7WA 5T1DH 3MLPA 3FN9A 5GRYA 2VZSA 1CLYL 2V2XB 1MELA 4CDGC 3OKLA 3GMOA 4HFUH 4OQTA 4FFWC 5HI5C 3GMQA 3ULVD 1EIBA 1TDQA 1SEQH 4LDOB 5I1DB 2IAND 4PGCA 1U8QB 5SV4A 5E1HB 2XZZA 4Y4HC 1LNUA 2EE9A 1A3QA 3MQIA 2ZCKH 2R8SH 2HT4D 5FYJE 1YPZE 3O2DA 3SGEI 5L7XL 5FUOL 3BEWB 1NQBA 4L4JA 1Q9OA 4P23A 3VFMA 3NFPA 3FO2B 4MJ2A 2DTML 3MJ9H 3REVA 3FO0H 3PGDA 1OCWH 1MFEL 3S4SA 3H7LA 2ESVB 4P2OA 3RVWD 4L4TB 2WAHA 3BISA 4G59A 4NQEB 1HHGA 2H3NB 3N1FC 5F7EH 3ZMRA 3ZSTA 1IQDB 3AU1B 3FT4A 3MNVA 1BQHG 3LN5B 4X6BA 3ARDB 1HCFX 5BV7H 4P2QD 1C1EL 5L9DH 1LO2H 1NCTA 2JCCF 1OSPL 5ID0A 3QDGA 2FH6A 3MZTA 5CBAA 4WDIB 1BBDH 1YDPB 4DOHB 1S3KL 5GGQL 3PHSA 4JO4L 4QGYA 1XFPA 1EUTA 2PTTB 4QRPA 1U8IA 1UB6A 4QTIH 4PJEB 4ZXBB 5C0NC 1ZAGA 1T1WB 3BKJH 2QKIA 2BHUA 3JBG7 3EBAA 5C07B 4K3DH 3F5WA 3WEXA 1YJDC 4HXAH 5GPRA 5I1GL 2V9RA 4QRRB 1KELH 4YR6A 1RZ7H 1KCSH 4WV1A 5CEZD 1UACH 3OB8A 1PAMA 5EOCL 2Q86B 1OTSD 5FGSA 3V4PL 3ZDZE 4LQ1A 3LH2L 1U8PA 3BZ4A 1EHLH 1H8SA 3IFOB 1HSAB 2OJZL 3TN0B 3H2WA 3K80A 4QLRA 1EDQA 4JRXE 4WWKB 4FA8A 5EU6B 3BEWA 2XV6B 2APWA 4JM4H 1T21B 4RNRB 3TPUE 4UT6H 3RIAF 2GAZA 3KPMB 5JOPE 3QQ4B 1X5HA 2RB8A 2Y06H 4M5ZH 2PN5A 4WJ5B 4ETQA 2I9TA 1I85C 4NFDA 1QSED 3DETD 4M93C 4RGND 4L4TA 5IBTL 2FL5B 1PG7L 1BFVL 1A64A 1T7ZA 3FMGL 4PJXE 3D0VA 4CADB 1RZFH 3O3EA 2QSQA 1KCKA 3JWOC 5T3XD 3D18A 3WXWH 4F57L 3LN5A 4U1IB 2HP4A 4LCIH 1EXUA 1FZOB 1I3GL 4ELME 5C71A 3NIFF 5FECA 1YDPA 3VXUE 4A2LA 4BFEA 2HFGH 2H41A 4WWID 3VXOB 2PW2A 4JHBA 1INEH 2Z8VC 5HJ3B 1PYWB 4ZXBA 4Z7OF 1IC4H 2J7LA 2XYCA 5SWSE 2W0LA 1ONQB 3AB0B 3DIFA 4MNGB 1AP2B 3ME0A 1JZ4A 2O5ZL 3B9VA 5CJOH 1FLTX 2IPUG 5DJ2B 5TQ2H 4ZNEE 4QRRA 35C8L 3V5KB 3U0WH 1CI5A 4KZDL 3UO1L 1JI2A 2D7MA 4MAUH 4P99A 2Y07L 2ILLA 2ZOKB 3KLHD 1JGEB 4A2MA 1NC4D 1TITA 4WW1B 4F9PA 1R24A 3T8XA 2NMSA 5IHZB 8FABB 1CVRA 1JV5A 2O5XL 1BZ7A 3TN0A 3S35X 4D2NA 5GGUA 5D1QC 3HC0A 1JMXA 4OUOA 4PJBA 3OMZA 5TH2B 1T21A 4OCLC 4U6XA 5HHMD 3TCLB 1JHKL 3QA3A 3H7BB 2Q6WB 3ULVE 4WEBH 2BVTA 4P3DA 2IANE 1F4YH 4U2ZA 1FNLA 4Z7QE 4K23L 3WFDH 4MNHA 1AC6A 4E0RB 4HUNB 3PJSA 3IGAB 4FQHB 1KPVA 3P11L 3ARWA 2CDFB 5CBEA 2DICA 5F89A 1YPZA 1RJZA 1Z5LB 3KPOA 4DEPB 1QRKA 1BIHA 1CFVH 2F5AL 4V2CB 1BBJA 1CFTA 4ALAH 1HH9A 3ARBB 4I2XB 4HXBL 4PJGB 1N7MH 3VU2A 3WFEH 3QG6A 4YWGH 4LCUA 2OI9A 2YPVL 3HLAB 4DW2L 3U9UB 3IYLW 4HCRH 1P9MC 3ZYIA 2OL3B 1NCAH 4JCMA 3FB6B 1LK3H 4PRIE 3EYSL 2YRLA 4OQTH 1A4JA 1EHAA 2D2OA 1AP2A 1WWCA 3MUJA 3U4AA 1FAIH 2FB4H 4IDJL 1GJIA 1NBYA 3VXMD 5DJ2A 4I3GA 1FLRL 1NL0H 2DI8A 3WFCH 1N5YH 2X4RB 2V5RA 5E70A 3RHWK 1KB9J 2ZOKA 1RHHB 2FJGA 1J05B 2PTVA 1ZHNB 2QV2A 2AV1B 2X70B 3P0YL 4J2XA 3QNYB 1UM5H 4FQIH 5JIIA 4XAWL 8FABA 4P4RB 1CLYH 4F9LA 4MXQA 2IGFL 3MV8B 4NNPL 5J6GB 3S37X 1BMGA 5E5UB 1JPSL 3T0EC 4PYGA 3ETBF 2F58L 2XQBL 4UT7L 2OL3L 5L7XH 1D9KA 5FUOH 1WF5A 3LEYL 2YPKB 5I73C 4WENB 3DO3A 2DTMH 5F6HJ 4XPFL 4FFEX 3I6KB 4WTZA 1ZA6A 2CDFA 4JRXA 3ALXA 1MFEH 1BP3B 4YAQB 1BQHB 2VZUA 1PKQB 2VLMD 1T1XA 5DD6A 3TPUA 4NKDB 1UA6L 2NY2B 4P0DA 3BP5A 1CFBA 3GZKA 3VXSB 1I9JL 1QSEE 1JZ2A 3C09B 1TNNA 1MIEL 2H2PD 3LKOA 2ORBL 4ETYA 4RAUB 4OSUL 4RIRB 5ANMB 1A7QL 1FH5L 4KAQL 5FYJU 1C1EH 5T3XE 1OSPH 1CDCA 4PJXA 1UM6L 2YD6A 1S3KH 1RZKL 2GTZB 3UYRL 5D7IE 5EBGA 3MGOA 5GGQH 2Y23A 5B3JE 2AJZB 4JO4H 3U0PB 4RGOL 2E6JA 4GG6E 3HZYA 3OF6A 2I9LB 3ZO0A 1FN4A 5D8JL 3AM8C 4ELMA 2X4RA 1T80A 1S9KC 1WV7T 1KEML 4NNXB 3VXUA 1WIOA 3QEHB 4PJ8B 1BFOB 5I1GH 4ONFL 3IU3A 3SDXE 4FN0A 3QNYA 1G7IA 2R1YB 4OCXL 2FSEA 4P2QB 2EDLA 3PABB 5EOCH 4O2FB 2Y9RT 1U41A 1U58B 2EDTA 3V4PH 2NPLX 3C6SB 3LH2H 4JHZA 3T2PA 1PD6A 5C0FB 2W60A 4JKPL 2WBWB 2VMFA 3SKNA 2OJZH 4NZUL 1RK1B 4ZYKB 2ZUXA 4MNQD 3C8HA 3ULUL 4MZ3A 1MOEA 3TT1L 1MLCA 1F6AB 3AS2A 4I9WD 5EUKA 3CIQA 3BOVA 3CPLB 5HHME 3O9WC 4FQJL 1NCDL 4NC1E 5DURD 1K5NA 2X4PB 1RZJC 1HWGB 4LPYA 1PKQA 1HE7A 3QDMB 4C58B 5IBTH 1Q1JL 2P7TA 3PQYD 2EYRA 5HDBF 1PG7H 1ZGLB 1BFVH 1J8HB 1FFNA 3FMGH 2HT2C 4Y4FC 5CIPB 4JM2B 3ZKQD 3JZ7A 5E1AB 3SHSA 4F57H 1R5VA 2ERJB 3IXAB 4AEIL 5D1QD 3JUYA 1I3GH 2BNQD 4LNVA 2CUIA 5C86A 1SYVB 4Z7WF 1S8DB 2GTZA 5DJ6B 3ELAT 4QYOB 5EZIL 1EVUA 2OR9L 3L3OB 3UBXI 3H9HA 3O3BB 4X9IA 4A6YA 4C83B 3H8NA 3EOAA 4FQXB 4NSKA 4RGNB 2O5ZH 1G7QA 5DC9B 2MCPL 3ARGD 4UZGA 3SDCB 3WBDA 5J4MA 2HJLB 1BFOA 2NY3D 4OIBA 1WCBA 3FOLB 2CRZA 35C8H 4N5UA 1S9YA 5CEZL 2PW1B 4KZDH 3RWGA 3SO3C 3UO1H 1C5CL 3RTQC 4NOFA 2Y07H 3IJSB 3VXME 1JGUL 4P2QA 4IOSD 1H8OA 3FO9A 1AR1D 3AXLB 4YPJA 5IESL 4PLOB 2HWZL 2ICWJ 4O2EB 1MIML 4X6FA 5JDSA 4Q2ZB 1HQ4A 3MRIB 4J3VA 4DGYL 5C0FA 4N9GB 3MRBB 2C4XA 3UTQA 43C9A 2DBJA 2O5XH 4FZ8L 5H94B 5BVJB 3QYCA 2VR5A 5FAAA 1LO0L 4DVRL 5CD3B 1VGKB 1JHKH 4KRNA 4XVSL 1A1NA 4P5TC 1I4FA 1HKFA 3CPLA 2OJEB 1CBVL 3B2VL 1G0XA 2QBWA 1FIEA 1SJEB 4K23H 3M45A 1PKOA 5DDHB 4XCYB 5F7DB 5HVGB 3P11H 5DI8A 1ZGLA 1W72B 3OL2A 1FYHB 3QQ3B 1J8KA 5JW5B 1OAKL 5CIPA 2J6EL 2F5AH 1R3JA 1U3HC 1EGJA 3CUPA 5IW6B 1T66C 1U91B 1O7SA 3IXAA 2HVKA 5TQ0L 5LGJA 1ZSDB 2VLME 4PJHE 3GEWB 2A0LC 4HXBH 4HULB 1S8DA 4NQSB 1Y18B 2YPVH 5DJ6A 2D0FA 4DW2H 1KB5A 3OKDB 3L3OA 5EBLB 3LKPA 3ARVA 1DTUA 3EYSH 1QSEA 2MQCA 4QTHB 1I1FB 5GXBB 1U3JA 4HS3B 4OZIE 4OCRL 3TO4C 4IDJH 5DJ0B 2Z8SA 4PYHA 5H35B 2J6EA 5T33L 1FLRH 3FOLA 2DLIA 4G8GB 1U8MA 3P0VL 5C6WH 4HH9A 4URTB 4L3ED 5F9OL 5J89A 3AXLA 4GG6A 1W72L 4N0FA 4NZRL 4K07A 3P0YH 3MRIA 3ZYJA 4N9GA 1LO5B 4XAWH 4Y4HB 2GSGA 3BZFB 3BD5A 5BVJA 2IGFH 3RX5A 1P2CB 4M6ML 4NNPH 3SDXA 3M1BB 3PP4L 4PJDF 1JPSH 3MLVL 2E8ZA 3MA7B 3O45A 1UJ3A 1F58L 2F58H 2FNBA 2P4AB 3ZDYF 1KOAA 4UT7H 2CRIA 2OL3H 2AQ2A 4F80A 1HNGA 3UBXA 2DJSA 3LEYH 3LRGA 4NHUB 5DDHA 4WU7B 1NC4A 3V2AR 4R26L 5F7WC 5T5NG 3N50A 4PJIB 1W72A 3BDBA 4OV6F 3SY0B 4MD4A 4CBPA 5JW5A 4I9WE 1NFIB 2GT9B 4JN2B 3SCMC 5C9JA 5DMGC 1ZS8B 4LEOA 4TSAL 3KYNB 5FUCE 2IALA 1UA6H 2G9HB 2PYEE 3VRJB 4N5ED 4JAMA 5GSVA 5HHMA 1I9JH 4QGTA 1BVKB 5DMKB 1MIEH 4NQSA 2ORBH 3G6DL 4OSUH 5DS8B 4JFHE 3OG6B 4KAQH 1FH5H 5EBLA 2UUDH 3R8BB 1WFOA 1ZA3B 1UM6H 4QTHA 1RZKH 3UYRH 2JCCB 4RGOH 1J5OL 3H3BC 3CAFA 5DVMA 5GRVL 4H5SB 4LHQB 5D8JH 3MRGA 4E9LA 2OR7A 1KEMH 3IVKB 4M8QA 2AKRA 3GMRB 4FTVD 1AGFB 1Q9WB 2FWOB 4ONFH 2VZ3A 3MRHB 1IM3A 4LSPL 2CUMA 4OCXH 1ODAA 3BZFA 3D85D 4UNTA 5HYJD 4HKBA 2DLGA 3VD4A 1YPZF 1II4E 3RY5A 5IB1A 3QCVL 2PXYD 5IW1A 2HG5B 4JVPA 2VLKB 2WZPD 2OTUB 3P9MB 3LD8C 4JKPH 4LCCA 3VGEA 1Q9LB 4NZUH 4ZAKC 3MA7A 1I9RL 1W0YT 3VXMA 4H20L 1UVQB 3TNMB 4X4ZA 1ZT7B 3Q48A 5EPMA 3ULUH 4LSUL 3VD7A 3PWNB 4JDVB 4M93B 3TT1H 3T0WA 4U1NB 1P4BL 1YJDL 4PP2A 1D5XA 1NCDH 3GK8L 4GS7C 3TF7A 2GT9A 3BPCB 5E9DB 1ZS8A 3W39A 5BOZG 3I02B 3RTQD 3KYNA 2G60L 3F7RA 1Q1JH 1G84A 4KHXL 2ZOLB 1CGVA 1YYML 5CWSA 1JUFB 1S78C 4NQDB 3QO1A 2Q7NA 3P4NB 5DS8A 3VFRA 3OKMA 1NBZB 3MROB 5IVXB 2FX9L 4AEIH 1NGQL 2VITA 1GOHA 1KLGA 1KBGL 1OD7A 3GIVA 4Y1AD 3HC3L 2FEEL 5EZIH 2OR9H 3TYFB 3L9RA 5EIIB 4FXKB 1CDUA 3ARFD 4HDIA 3WE6A 2ADGB 4PJHA 1UFUA 4AZ8A 2X4QB 1NANI 3PQYB 5AD0B 2MCPH 3S3SA 3OJ2C 3GMRA 3MLZL 1CLCA 3ZDZF 3PV7A 2WQ8A 5KG9B 1KIRB 4NOBA 4NQXB 2FWOA 5CEZH 1MFBL 1TIUA 4R4FL 1C5CH 4HJ0C 3LZFL 5DF0A 2COQA 1JGUH 1HSBA 1NBVL 3PP3H 5D1QB 3FQWA 3OV6A 2X4TA 1EEZB 3CXDH 5IESH 2HWZH 1BOGB 4L3EE 4DGYH 2RIKA 3GJFB 5CIPH 4U1HB 3QUZC 5IJVA 4FZ8H 4XP5L 3QUMA 4FOMA 3SGJC 4PG9B 3UTPD 5TDOA 1EGJH 3G6JE 5DQDL 2QHRL 2XKNB 4WUUD 1LO0H 4PY7B 3RL1B 4DVRH 5E4EC 4F2MA 5C92A 1S7QB 4TOYL 3RRQA 3QEQD 4PREB 5L0QC 1TFHA 4XVSH 2IQ9L 1A1OB 1CBVH 3B2VH 3IXTA 2WMPA 3EZJB 4PJXF 4POZC 4OJFL 4YHLL 3UEZA 2JF1A 3DUSB 4HX1B 3VWKC 2LAAA 4ZO6A 3PHQB 5ETUB 4ODUB 4ZS6C 5JHDB 1V05A 4ELMF 2D4DA 1OAKH 2J6EH 2CDEA 4ZFFA 5ALBL 3S88H 2R2CA 1EEYB 4KJPD 1EERB 4MNQA 4LAQL 3PL6D 5TQ0H 3B8SA 2EE3A 1CFNB 1A7OL 3VFGL 3BD3A 3BESR 2A6KA 4Z7VE 4UBDC 4EXPX 4NN6C 1N2RB 4FXKA 4HMDA 3O11B 2MFNA 4P9HC 4DTGL 3K1KC 5FB8B 3PQYA 2DIJA 5AD0A 1AGBB 1OVZA 4OCRH 3S3JA 5A2JH 3P77B 1KIRA 1YN7B 4KK9C 2D31B 5T33H 4U0QB 4LQFL 3RWEB 3ZTJG 3HB3C 5DMGD 5EZOL 4ESKA 5F9OH 3ZKMD 5D1QA 3ARQA 2BNQA 1EEZA 1W72H 4NZRH 3V52L 1HHIA 4M03A 3VCLB 2R2HA 4PGDA 4IRJD 3T0EB 1UZ8A 4WNQA 4CN6A 2WP3O 3ULVF 1I7UB 3MRQA 3TZVC 4G8IB 4PG9A 3O6LL 4Z7QF 3KNBB 1FGVL 5T3ZD 5IFAL 1U8NA 4OFIA 4APQD 4M6MH 4PR5A 4UU9B 5HYJE 5I73B 3ARGA 1S7QA 3ARTA 3MO1A 3PP4H 3MLVH 5IWLC 4Q97A 1F58H 2P43B 3L3IA 3QHTC 2BVQA 3BN9D 4AIZA 2VB5A 2BY2A 2HTKC 4PJ7E 3VFSA 3C8KA 4KROC 3V4UL 4FQQB 3HZVB 4R26H 2YR3A 3KWWA 5INCA 5JDJA 4YXKL 4HK3N 4YIQB 5E8DL 4LRNL 1X6NA 3SKJL 4NKQB 1ZGLM 4JFPB 3OX8B 4TSAH 4TRPL 3BD4A 3H9SB 4KVCL 3DJ9A 2P8LA 4RZCB 4Y16D 2YS4A 4QNPE 1CR9L 3T65A 1CFNA 2ITCB 3G6DH 3MV7B 4ZAKD 5MHSD 1LQVA 2Y5TA 1HXMA 3KJ4C 2X4SA 2ADIB 3CC5B 4NUGL 2VLJD 4UUJB 3H0TA 5GRWA 3FQUA 4BQ6A 2E9JA 3DXAD 3DX6A 1J5OH 4Y1AE 5KSUB 4BKLB 5DK2B 1QBBA 3BO8A 2JTDA 5F7UA 2GJZB 1T3FB 3RVXC 4M02A 4KHTL 5DUPL 3TH4T 2GKIA 1ZHBA 4JO3L 3VCLA 5ICXA 1JWMA 2EXYD 2VH5L 4LSPH 3KJ6L 3RIFF 5IGXH 2HVJA 1I7UA 4CNIB 4G8IA 5JLZB 4CU7A 2ZUQC 1F3RB 3MNWA 4U1JA 4KI1A 3QCVH 3C6LC 4KKLD 4LHUD 4NO0D 1JZ3A 3IDJA 4F33A 4JDZA 1ZWIA 2AK4D 4XPTH 3O9WB 2BY3A 1I9RH 5L8LB 5ACZB 2AXGA 1I3UA 3FB8B 3NIDE 4HIJA 3FOMB 4NN7C 4L3EA 1OM3L 3UTPE 4KUCD 3E6FA 4XPHH 3LN4A 4QKXB 3VA2C 1J0HA 1P4BH 1MFCH 1YJDH 2FO1A 4WUUE 1KPRB 4Y4FB 3S36X 4XNMA 5HVWA 2CMRL 3GK8H 1CXKA 3G6JA 3QEQE 4LSTH 3LS4L 1LDPL 4KI5C 3K46A 4C59B 1G9EA 3HPLA 2XN9B 4HJ0D 1OSZB 2G60H 4QOKE 2HT3C 4LIQE 1CG9A 4RZCA 4DJMA 4X4XB 4KHXH 1AD9B 5CJXA 1EAJA 1YYMH 5D7IF 3MRLA 5IMMA 2VLRD 5B3JF 1QOKA 2NXYD 4TTDD 4ZMAT 2DQUL 4GG6F 4YGVB 4PJ5D 2FX9H 1NGQH 2ADIA 1KBGH 3DX7B 5AYUL 2X7LB 3ILPB 3WN5C 1NMBL 1J1PL 3HC3H 5BZDA 4HUUB 2CXGA 5K33A 4WI3A 4LKXB 4I3RL 5D5ME 3HMXL 3SO3B 4V3EB 1IAIL 3SDXF 3RTQB 5JO5A 4YXLL 3MJ8A 4K7PX 1M7IB 5J9PB 3GGWA 1RZJL 1T03L 4WFFD 4N5EA 3A6BL 4AY0A 4YHPA 5AWNL 4Z7VA 4UOJA 3MLZH 4ZS6D 1E4KA 1YECL 2I60L 5C0AD 2BNRD 1G7JB 1MFBH 4JB9L 1TPXC 4R4FH 4GXUN 3VMOA 4U7SA 2C7UB 5FYKD 2VLLB 3LEXB 3MX0A 2AW2A 2XPGB 3DUUB 2C3GA 3WHE1 4Z95L 3GMLB 3HG1B 3ARZA 3F7VA 4UQ2A 1IEAB 5HD8C 4P5TB 4TVPE 4H26B 1FC2D 4XP5H 4ELKB 3LN9A 1IGTB 2YHGA 5FGBA 5DQDH 2QHRH 4F7TB 2KUTA 3KDMB 1OWRM 4FTVA 4X7EC 1OLLA 4TOYH 4JANB 5C08D 5DTFB 2B0SL 5T3ZE 2IQ9H 3QNXA 1QSFB 1TXKA 4R2GC 4YDVB 4AJ0A 5DQJA 4OJFH 1ES0B 4YHLH 1KLUB 3D85A 3UROR 4XXDB 1NC2D 1U3HB 5HYJA 3HB3D 1MRFL 1DN0B 5LAXB 1ACYL 4NRYA 5EZLB 5IMKA 2PXYA 3SQOL 4X4XA 5DVNA 1AD9A 1VB9A 3RWJB 5EU4B 5ALBH 1F13A 4ZOCA 4NRXB 1MCRA 4LAQH 3O41B 3O6FD 2VO5A 3LMJL 1N3NB 5DD1L 5C8JB 1R5WA 1A7OH 3VFGH 3TO4B 4Q6YA 1SEBA 1HDMA 2YD4A 5IVOA 3SGKC 3MBXL 4TNVF 2FGZA 3U4BL 3RTQA 1NFKA 5IR1B 1WZ1L 1BIIA 2YUWA 2QJDA 1EBPA 3THML 2GTWB 2VLJE 1LO3L 5F3HB 3MRJB 1I8IA 1XZ0A 4LQFH 1IZJA 5EZOH 1E28A 5KOVC 2VLLA 1D5IL 3LEXA 1VCAA 4WUKL 4YDLC 5DRWB 4KK6C 1S7WA 4G9DA 1A2YB 5EOCJ 1QQDB 3V52H 4KUZL 4Y8AA 4NQVA 2BOCA 4H26A 2DM7A 3ARFA 2X2YA 3O6LH 4KVNL 5IFAH 1FGVH 3UPCA 2VDQL 2AEWA 2CKNA 3IDMA 4W81A 2Q20A 2UYLA 3SCMB 2Q1EA 1G9MC 3RDTC 1KLUA 4GT7A 4YUEL 2P42B 4AQOA 1I3RA 4QRUA 3V4UH 1EFXB 3L3KB 3NIGE 4ENED 3FB5B 5EZLA 3PWVA 5J13C 1WZLA 3CX2A 4PJHF 4RFNC 4YXKH 2AJUL 5E8DH 4LRNH 3SKJH 5ESVA 4XP6L 2W92A 1RK0B 4TRPH 5EU4A 5EU3A 1QLEL 4KVCH 4NRXA 1E4XL 1UKQA 4J8RB 3O6ML 3O41A 1PQZB 1KTLB 2J8UE 1ZLSL 4WUUA 5E99L 1CR9H 1QA9B 2R56L 4G7YL 4I3SL 3QEQA 4HC1A 1AI1H 3ZE1E 43CAB 5IROC 2X41A 1I75A 4OZIF 2BNUA 3BFOA 3HS0A 5I74C 1UWXH 3BGMB 2VLRE 4NUGH 4EUPG 4POUB 4E41B 2NY6C 3T0VA 2GTWA 2Q7YB 3RPIA 3C08L 5SWZD 4Q9QL 1TTGA 3MRNB 3B8YA 3MRJA 3BX7C 3O6KL 3QG7L 4M3KB 2AV7B 4LU5L 5C9KA 5D9SA 5I0DA 1XGRA 3KPLB 3PL6A 3AY4C 4X9BA 2BK8A 4KHTH 4Y89A 4WFFE 5DUPH 3LD8B 3UZVB 5D5MA 3PWUA 4IBLT 4ZAKB 1FZMA 2VH5H 2WV3A 3KJ6H 4W4OC 3GIZL 3WMSA 2BNRE 2JIXD 4HKJB 3MBEC 1I8LA 4B5EA 1NJ9B 5FYKE 1U2CA 5C0BB 3SEPA 3DXAB 1CLZL 4HGWB 1OARL 4OLVL 3U36B 4GS7B 1RJCA 1WBXB 2XKUA 1LE5A 3LQAL 5CSGA 2EEBA 3KGRA 1OM3H 3MLTB 2DJUA 1MLBB 2YD7A 1Q9KB 2CMRH 1I1AD 4IRJA 5C08E 3LS4H 1LDPH 4OM0L 1QHPA 4LSVL 3VD9A 5JZ7C 3VFOA 2A6DA 3BI9X 3FTGA 1HQRA 1PQZA 4U49A 4APQA 1CTNA 5FUCC 5I1EL 2AK4B 4DK3A 2BMKB 3I9GH 1G6RL 2DQUH 2OSLB 5ITFA 3BGMA 5AYUH 4CGTA 2LV4A 1E27B 1NMBH 1J1PH 2XTJE 4DZBB 5K9OA 4WHCA 4XP9L 4DQOL 3SO5A 4I3RH 5EU7E 3W0WB 4R2GD 1ROWA 1IM9D 2BHZA 3HMXH 5GS2H 1IAIH 4YXLH 2A6JB 1RZJH 1T03H 5C0EB 3A6BH 4Y16A 5AWNH 4LHJB 4NFCA 1NGPL 3QJFB 1CU4L 3T1FB 1YECH 2I60H 1H15A 1T7WA 4JB9H 4TNWK 3EOTL 1CIDA 4L1DA 3QUZB 4ZAKA 3V7AG 3UTZA 5ID1A 3R0MA 1G6RA 4HIIB 4LPCA 1RVFL 5DK0B 5EA0L 3RNKB 4I4WA 1B4JL 1S7TA 1WBYB 2VLJA 4BH7B 4XXCC 1NJ9A 5GIRB 5E4EB 2AXJA 2DWDA 3ROOA 3VWJD 5C0BA 3DXAA 5L0QB 1A7NH 4HGWA 1AIFA 2BDNL 3IAQA 1BAFL 1MQKH 3L7EA 4PV8B 2DDQL 3VWKB 4KXZI 5FV2A 3WIHA 5HYQA 3MLTA 5JQHC 3DRQA 2B0SH 5FIEA 1P69B 5C0AB 3P0GB 1EEUA 2IAMC 3B6SB 2DMBA 1NDMA 4E5XA 4P5MA 1G9NC 1MRFH 1BJ8A 2DS4A 2V17L 1JBJA 4WFGE 3FRPG 4NO0A 1X5AA 3DRTB 4LHUA 3SQOH 3TO2B 4KTYA 4MWFB 3F6LA 3IKCB 1FZKA 1YY9D 5F8RC 2YKLH 4PTUB 2IH1A 4XCEA 1ITBB 2AK4A 3MUGA 3U1SL 2EH7L 4NN6B 5CJQL 2BMKA 1ERNA 3BHBB 3LMJH 5D6CA 4BSJA 2MJWA 5DD1H 2A6IA 4ZFZB 3K81A 5FCUL 3L3HA 4MA8L 1E27A 1RZIA 4DZBA 3WIFA 2ZSWB 3I75A 5SWSB 1FL6B 4PFEA 3TEUA 3D2UD 3MBXH 5BJTA 1WSST 2J8UA 1AE6L 3U4BH 1WZ1H 3MGTA 4YFLI 4N0UB 3THMH 2APVA 5HGDA 2QHLA 4Y8DC 3HKFA 5BZWB 1LO3H 2HRLA 2VLRA 2OBGA 1A6WL 3D87B 5SWZE 2IBGA 3QUZA 4PJ5A 4WHYG 5DUBB 5TGBA 1YC8A 2W38A 3TZVB 1D5IH 4WUKH 3G6JF 1MAJA 4BH7A 4QXGL 4KUZH 1F97A 1G1YA 2MHAB 3C60C 4OGXL 2WWMD 5HI4C 3H9ZA 5CGYD 2GJJA 2Z31D 1WWWX 2IH3B 3F7YA 2FIKB 4KVNH 4KROB 3MRCB 4P9HL 2O61A 2VDQH 4B7LA 4NN5C 1LWRA 1IAIM 2FLBT 5D2LB 4HC1H 4LNRB 4YFDB 2ENYA 3QHFL 5C0AA 2BNRA 1CDJA 1XGUB 3KXFD 3D3VE 4YUEH 4X7FC 3ZTJH 2AVGA 5D7LD 3GHEL 1K3ZA 1F00I 3VH8G 2R69H 3PGFL 3VXPB 2VZ1A 2AJUH 5JPMB 1OL0A 1WFUA 1A8JH 1FFPB 4U1SA 4BUGA 4ISVB 2DM3A 4Z7VF 3DO7B 1C08B 2EDXA 3KJ4B 4PRNB 1E4XH 3O6MH 1BF8A 3BHBA 1ZLSH 4EUPB 4M00A 5E99H 2FEDD 5IQ9A 1DBML 1N5AA 1FO0B 2ID5A 2R56H 4G7YH 4I3SH 4LVOC 5C08A 3SKOA 2PYFA 2IQAA 1GH7A 4PJFE 1EFQA 1J10A 5DWUL 1U42A 5BRZD 1BM3L 1NC2A 1QLFA 1ADQA 2D0HA 4N0CD 1XF5A 2V2TB 4U7MA 5JA9A 3QWQB 3CLEL 3C08H 4Q9QH 2B8OT 5BZWA 5E8EB 3O6KH 3QG7H 4B0MM 4LU5H 6FABL 4ZO8A 1MWAB 3O6FA 5DJAA 5JMRA 1Q94A 2ZUQB 2OXGA 1L6XA 2AXHA 5KVEL 1AKJB 3EO1A 4KFZC 2G5BB 3C6LB 1CLOL 2P5ED 1WLHA 2MHAA 2J5LC 5IWLA 1EEQA 3GIZH 2CLRA 4TUKL 4NJAL 4OIIL 2IH3A 5C2BL 1QFWI 2FIKA 2IF7A 4NO3A 5F93C 4Z78B 4PJ7F 4NN7B 3BUYB 3MRCA 2Q76A 3SN6N 4LCWD 4JY6A 1FO0L 4RWYH 4OV5A 5KJRL 1OARH 3IJHB 3FZUD 3M07A 3V8CA 4NUJB 2BOBA 4OLVH 4LBEB 5IB3A 3LQAH 1KCUH 1MCJA 1CFQB 5GS0C 5C70A 3I6GA 3VXPA 4UQ3B 1NGWB 1JZ6A 1RMFL 4XAKE 3DX9B 4OM0H 4P57B 5C0GB 1QHOA 4LSVH 1H5BC 4IM8A 4JPIB 3QIWD 1MWAL 1OAXL 1D5ZA 1IGJB 5J12C 3BKYL 5FYKU 3WN5B 5E03A 3BRFA 2EDJA 1IARB 4L4VE 5I1EH 4UNVA 3BYYA 2XOTA 4MXVE 3D0LA 4OZGB 1G6RH 4N8VB 5D7IB 2HLAA 4TVSa 5L8JB 4KQ3L 1BFSA 3X12A 3K4ZA 1YMHB 1LD9B 1P5VA 1MCSA 5I9QC 1J18A 5D6DC 9CGTA 4XP9H 3Q3GA 2HFEA 3V7MA 4DQOH 2VISA 1T1YA 4EXKA 1ZT1A 5TE4L 4C56D 1TPXB 5CEYB 2IAMD 5F1IB 1XR8B 4U05A 1YC7A 4KTEL 1MWAA 3WIHH 1IAKA 3LSOB 1YZZA 3PHOB 1NGPH 4DN3L 5DMIL 3BPLC 1CU4H 5E56A 3EOTH 2EZ0D 2CLVB 4MQSB 1A6VL 4YQXL 1RVFH 2VZTA 1S7SA 5EA0H 3UYOD 1B4JH 1G7HB 5EIVA 3NIDF 4KWUA 1YEEL 1WT5A 3G04A 5KANI 1F8TL 1KSRA 3B9KD 3UX9B 5SWZA 3GSQB 2BDNH 4R2GB 1G6VK 3RX7A 3GMMB 5IF0A 1BAFH 1FVEB 3QQ9D 5KVFL 2LVCA 1BPVA 4JFEB 1M7DA 2GFBB 5AG9A 2DDQH 2H26A 3LKRA 5LGHL 2E27H 3U4EB 4ONGL 4JZNA 4HUKB 4K7FA 4U6HA 3SE3C 3VDAA 4UQ3A 1NGWA 5HDQL 3BZEB 1U95B 4X5WA 2JIXA 1NMAL 1L6ZA 4GQ9L 4ZUTB 1HHJA 1VDGA 3DURB 3QISA 4OF5A 2EIDA 4B41A 3CFIC 5D7LE 1LE9A 2FZ3B 4AIXA 2JB5L 3U1SH 2EH7H 4HWBL 5CJQH 5HI4D 2CXKA 5E5MB 4PJ9C 3QIBC 4HD9A 4OFKA 12E8L 1HH6B 5D5MF 1FFQA 1ZOXA 5FCUH 2Q8AL 4MA8H 5IIEB 2K9UA 1MUJA 1AC0A 1IKFL 1S7VB 2NW3A 1I1AA 1AE6H 3O0RL 5F1IA 4YHOL 3U7WL 3BW9A 4YDLB 3OXSA 5C6TL 3PHOA 5FGCB 1Z0NA 2ATKB 1I7RB 3TVMD 5I1CL 5HI3C 4N90D 1N64L 1A6WH 2CLVA 2WBKA 1KCVL 5FHBL 5KSBB 2F9BT 1K8IB 1RZ8B 2FBOJ 1J7VR 3S96B 3FQXB 4RA3A 5FUZL 3FN0L 2HLFC 4QXGH 4HIHA 5JOFB 1UWGL 5L2JB 5LG1A 2QQQA 3QR2A 4MA7L 3GSQA 2P5EE 1IM9A 3NVQA 2NY4C 4X80L 3V6FA 3RDTB 4P9HH 2AGJL 2GFBA 4G8EB 3DHMA 5C3LD 5DD5L 1M6OA 2V5YA 3GUTA 1KCLA 4RDQF 3DV4B 4LLQB 3FRPA 5J13B 4V3DB 3QHFH 4RFNB 4LCWE 4Q0XL 5HVHC 4D8PB 5CD5D 1ORSA 5JORB 3GHEH 3OR7B 3PGFH 1U8JA 3VWJA 1AXSA 1WIPA 3DYMA 2FZ3A 4U6TA 2KZ1B 4RBPK 1N8ZB 2MQ0A 1AO7B 3UPRA 1CFSB 5I74B 2F53D 5ERWB 1XCQB 4M43L 4MZ2A 3RWDB 3WLBB 4MA3B 1DBMH 3LKQA 3QAZC 1OPGL 2NY6B 5IIEA 4OIAA 4JPWL 3RU8L 1UB5B 3KXFB 3QIUD 1D6EA 2AQ3A 5DWUH 5IM7A 4ZUVA 3EZ8A 3FCTA 3RKDC 4OZIB 1BM3H 3WJLA 1QFUL 3FT2A 1G9ML 1H8NA 2X1PA 3DV6A 4DUWA 1CQYA 4DZ8B 2BVEA 3V0WL 3CLEH 4YFEA 2ED7A 2ATKA 3ABZA 2EXWD 2NNAA 1ZK9A 1JRHI 4R7DA 1VFOA 6FABH 1QR1B 3R06B 3MBEB 3QUXD 5FM5M 5KVEH 1U8KB 1O0VA 1CLOH 4UTBL 3MXVL 5JOFA 5L2JA 2NLJB 3VFWA 5D2NC 3JV4B 3I3BA 3D2UA 2RCSH 5BRZB 4TUKH 3MRDB 4NJAH 5C2BH 5I8EA 4EUPH 3SOBL 3LS5L 1MCPL 5MENB 1FO0H 2R1XA 3RVUC 5KJRH 2B39A 1GZPB 2B4CC 3NIGF 4RQQB 3DV4A 3VH8A 3O3AB 3C9NA 3FB7B 4KUCF 5BVPL 1QO3A 4QHNA 1PZ5B 1CS6A 5I1KL 5F9JB 2VZOA 3CU7A 2QQNL 5F88B 2XFXA 4UIMB 2J8UF 4BSWA 2PYEB 5FA3B 5EH1A 1RMFH 2WBJC 1OB1A 4BELD 4YHNB 3ZE1F 3RIAK 1AO7A 5T5FL 2Z31A 2ARJA 3EYVB 4NRZA 3IDIA 5ERWA 1MWAH 4ZFOB 1OAXH 2B20A 4ZSOE 4K3JL 1VEMA 5D7KE 4MA3A 2HRPH 3MZGB 3L6FA 1I1YA 3QUYD 4RAHA 2GIYA 4NM4H 3KXFA 4CVZA 3RWFB 1W0VA 2EYSA 4KQ3H 5D7LA 3ARED 5DFTA 3PWPB 4RX4D 2WIIB 3E3QE 2DL9A 1WZKA 1ZV5A 3RZWA 4P4KD 2OS7A 5JW4N 1IL1B 4JJHA 5TE4H 2ZG1A 1AGCB 5J3HD 3KYOB 3LCYA 1UKTA 4KTEH 1RAMA 3T4YB 1B6UA 1XF2B 3AUVA 4DN3H 5DMIH 8CGTA 1H0DA 5IOPB 3BEVA 1ED3B 4M7KL 3H3PL 1P7QD 2DMCA 1A6VH 1QVOB 2QSVA 4OD2B 4YQXH 2GITB 5C0DA 5BRZA 3H6JA 4QHLB 1A22B 4N90E 3MLRL 1P53A 4PJ9D 4ZFOL 1YEEH 5ACMA 2GCYB 4KGLA 5LQBL 4N0CA 1XGPB 1F8TH 1WAAE 1W0WA 4HPYL 3V0AC 1GZPA 2OMBA 3NPZB 1GAFL 4TQEL 3GJFK 1EK3A 4C56B 5KVFH 2IAMB 2PCPA 5IT2L 1GGYA 2H9GB 4NWUL 2AK1L 4OCWL 3TJHD 4OI8A 3N1PC 4ONGH 1JYXA 3QEUB 5DRXB 4WI6A 3STBA 4D0CB 5MEPA 1LK2B 2P5EA 5HDQH 5BS0D 1W8OA 1S7UA 1T83C 1NMAH 2NY1C 4PGJA 4LMQE 2AP2A 4GQ9H 4YHIB 5JHLL 3S7GA 4LCWA 5E8OB 5AUMA 3ARSA 2NTFB 5HGAB 2JB5H 5DVKA 4HWBH 1QRND 5GGSA 2FJFB 1NKOA 2AXFB 2NY4D 12E8H 1F02I 3V0VB 2Q8AH 3MODL 2A83B 3QRGL 1IKFH 1P1ZA 3O2WL 2FDBP 3FRUA 4PGEA 1C5DA 5IV2A 2XTJC 5F6HI 1KIPA 3O0RH 4EI5C 1N6QH 3QIWA 4YHOH 5FK9B 3C5ZD 5EU7C 3U7WH 1G9NL 1IGCL 1QSVA 3VG0L 3L3DB 3QSKB 5C6TH 4XXCA 3CFDB 1SQ2N 4XVUD 5I1CH 3DTXB 5IOPA 3HN3A 3C60B 4XX1G 5IVZA 4OLXL 3E6HB 1N64H 1ZLWK 1QVOA 4NQCE 2CGRL 5EZJB 4H0HB 1KCVH 1NFDE 5FHBH 4YFLF 3G6AA 4NHCL 4QHLA 5D7SL 3OQ3B 4RFEA 4WEMB 5FUZH 3FN0H 4NN5B 2GCYA 4PD4K 4PBWD 1UWGH 1XGPA 2XXCB 4XP4L 4JG1L 4HJGA 1T7YA 4MA7H 4PLJC 3LEVL 4P2RB 3PDDA 4C56A 4J3XA 4QY8B 2IAMA 4X80H 3RKDD 1ORQA 3MR9B 4R8WL 5ILTL 4PJCE 3G5XA 2AGJH 4JY4A 5DD5H 1PGRB 1A9EA 5DGQA 4YK4C 2K1MA 4XHQA 1KIQB 5DRXA 3WDJA 3EOBB 5E6ZA 3RUGE 5A2FA 4Q0XH 2NY0C 4XB7A 4Z7NE 3OXRB 3GSRA 1KNOB 4WHYH 2DQFA 2IWGA 4GO6B 1A6AA 3X14A 4X9FA 4CW1B 4Q9RL 4CVXA 4YHML 4LVOB 1FGNH 5E8OA 3G5VB 3B9KA 4L8BB 3VXTB 2W59A 1EA9C 4M7JL 3SJVB 3VI3E 3HUJE 4M43H 1QFHA 2FJFA 3MYJA 4KKCC 4RMQA 3OKOB 5ICZA 2VQ1B 2VIRB 3V0VA 2WUBL 1J1XL 1OPGH 3TESA 3DROA 3TBTB 4JPWH 3RU8H 5CKAA 1NCWH 3WUWG 1OOAA 4O51B 5K9QG 1F11A 1PSKL 4ZSOA 2F54D 1UC6A 1QFUH 1G9MH 4OTXH 1RIHL 3V0WH 4JZOB 4M7LT 4KK8C 1CIUA 2QADC 1MCWW 5A3IC 3DTXA 4H8WC 4JKWA 2J5LB 2WBJD 4IMKA 3RGHA 4FS0A 4ODXB 5EZJA 4BZ2L 2HKFL 3E3QA 3BRGC 3QFJE 4G7VL 1BZQK 4ORGB 4UTBH 3RJQB 3MXVH 5IBUG 4ZQKA 3D1MC 3U7YL 3TPKA 1IJ9A 4HWNA 4MMZC 5E94B 1UQSA 4TPRL 3MR9A 5DEFB 5GRJL 4YEEA 3SOBH 2XG5A 3LS5H 5CGTA 1MCPH 5B4MD 4DFHA 4HKZA 4PJ7B 3TP4A 4NKMA 1KIQA 2N7AA 1XGQB 2AJYL 3TVMA 3EOBA 1X5IA 1E6OL 4OKVA 5BVPH 2ICES 4WGWB 2C3XA 5TJWK 1H5BB 5I1KH 2QQNH 1KNOA 4JFFD 1CDYA 1KPUB 2WLYA 5J12B 5HHOB 1GOFA 3UJIH 4U6YA 4P2YA 4YHYC 3ALWA 2OX5A 2ICWI 5T5FH 4PJFF 5B38G 3VGBA 3BP7A 1DLHA 4K3JH 3LV3A 3KLAA 3ZKNC 1CYGA 1BZ9B 2VIRA 5KSVB 5I9QB 4JKMA 3VFUB 4HF5L 3SE4A 3U46B 3ULSA 3CVHB 2EO9A 2OZ4A 1C12B 3B5GA 4MQTB 3CFCL 5F44A 4GKZA 3RGVC 3HCVB 1YUHB 1AD0B 3IDGB 4GRWB 1QRNE 2QLVB 4DKFL 5KTEL 2FD6L 2NZIA 3D6GA 4JZOA 1CGYA 4ODBD 4Y88A 5KN5A 3GKWL 3BPLB 2ZKHL 3TA3D 4TUOA 5D93C 2L7UA 3A0OA 4IRSC 3DVGB 4HMCA 4DAGL 4ZPTB 2F53A 5KS9B 3SGDH 2DWEB 4UTAL 3HE6C 5EOTB 5CSZA 5HSFA 5LKNA 3S97C 5I1LB 2IBZY 4M7KH 5C6PB 3H3PH 2LU7A 1DEEB 1JF5A 3QIUA 3K2MC 5IW3A 1BF2A 1TCRA 3MLRH 3MJ6A 1RUKL 4WGVB 3BIKA 1F90L 2OP4L 3OKNB 5K9KB 2A9NL 1B9ZA 3QDJD 1PZUB 1DE4B 1Q72L 3BKCH 4HPYH 1IEHA 1GAFH 1LVEA 4HZLA 3CVHL 5IT2H 4LLDB 2C3VA 4NWUH 4OBSA 1D5MB 2Y1VA 2AK1H 4OCWH 1CDIA 1CDBA 4BSVB 3QUXA 4D0BB 1MHCA 3C2SA 1TVHA 2VWEE 1KPUA 3RWHB 5MP6L 5HHOA 3KPRD 1PX3A 1Z6JT 4PJCA 1CDHA 3RVTD 3TIDB 1OD9A 4MXVF 1MCFA 2D03L 1IFHL 4PJ9B 2OXHA 3BP4A 3QIBB 1HYRC 3PWJB 5E2VL 3RUGA 1WGOA 3C5SB 1BZ9A 1JP5A 3KYMB 1CZ8L 3R1GL 4KV5E 3AFLA 5FDWB 3U46A 2OTWB 1E4JA 1IAOA 4PLJD 1C12A 3OAUH 1D3CA 1AD0A 1HILA 1TNMA 3B2UC 3QPQD 4JGJA 3MODH 4NPYA 3QRGH 3NCBB 2FJHA 1XH3B 3O2WH 5E8NA 3EGSA 3HUJA 5CP7B 1OW0C 3FQTB 4LVNC 3ZSSA 4P2CG 2PTUA 1RZGA 2DWEA 1G9NH 4QRTA 1IGCH 2HN7B 5I1AB 3VG0H 2F54E 5B21A 1JNHA 1FG9C 2G2RA 3QUYA 3BDYL 4OLXH 1J0ZA 4UOW1 4L9LA 4V2BA 4X0KB 2CGRH 1XEDA 1IGML 4MYWB 2NY4B 4NHCH 5SWQB 3CXHJ 5EULV 2ICWA 3MLUL 5D7SH 3RNQA 5GS3A 3AREA 2MSPA 2WANA 1IBGL 4LLVA 1YMMD 3HAEG 4PP1C 5JXAL 4XP4H 5JTWA 4JG1H 1DE4A 4P4KA 4XTRC 3LEVH 1OHQA 5HVHB 4ODWB 3VXRD 4R8WH 3K8KA 5ILTH 4I13B 5C09B 3G08B 5HGBB 1N0XL 1CXEA 4X7SL 3JV6B 5EN2A 3WFHB 4LCYA 1HEZA 1HOCB 5GHWL 5E7FA 3KPSD 2NR6D 3I85A 3STZA 1XIWD 1IVLA 5FOBB 2J12B 1P7QA 3BMVA 3STLB 2Z8RA 4JFZL 5JR1L 4XPBH 3NN8B 3H42L 3HI6H 1OTUD 1IGYA 1GC1C 5D1XD 4G42A 5A43C 3VFVA 4PJ9A 1BHGA 4Q9RH 1BLNB 4QRSA 3BKML 4X8XA 4YHMH 3BP6B 4YDJB 4S1QL 1FPTL 3QAZB 4JFFE 2H45A 3GMPB 4QHKJ 3HE7C 4FP8L 2BSRA 5FDWA 4M7JH 4L29A 2P5WD 5CUSL 3MLSL 3WFBL 1DCLA 4IS6B 1OTTD 4XNYL 2C1OB 3TJHA 2EDKA 4DVBA 3U6RA 2WUBH 1J1XH 5BW7A 3TFKD 4GBXC 2P46B 4AH2B 2VZVA 5EFIB 1XH3A 2FH8A 5I66B 5B8CC 2GYSA 2HAZA 3CX5J 5BS0A 4I18C 3O3UN 3FJTA 4I48A 1QR4A 5CP7A 2H32B 1PSKH 5IMLA 1LMKA 3HRZB 4LLUB 2Z93A 2R1WB 1RIHH 1QYGL 3TBSA 2DQEL 3MOBL 5JNYA 5HXMA 5IBUB 4X6DE 4BH8B 4KDTC 5D2NB 4L8DB 1NAMA 1QRNA 5J06A 4J3TA 5CEXB 3L7FA 4X0KA 4BZ2H 2HKFH 4KQ4L 2BSSB 3B9DA 5SWQA 1OP9A 4Y7MA 3JUZA 4G7VH 4PG2C 2BXYA 3T2NL 3ZKND 3MV9E 4J23A 2KQNA 2D7PA 5EBMB 2P47B 3U7YH 1TTFA 4GKNA 2DQTL 3MJ7B 3W9DA 1YNLL 4TPRH 3U9PH 4OLEA 4S0TD 1ZT4B 4GG8B 2Z4QB 3C5ZA 5GRJH 4OLZL 4HUWB 3GMNB 3JV6A 3S8WA 2H6PA 2AJYH 2WP3T 3U83A 2KQMA 2W07A 2OZ4H 3QDJE 3RWCA 3IJYB 2WBJB 4PBXA 4O02L 1JFMA 3FFCB 5BMFL 3B9AA 2R23A 1AGDA 5B38B 2J88L 5IMOB 2PR4L 1MJJB 2FATL 4WI7A 2HA1A 3WUWA 5I8KL 3KPRE 3GSNA 1UYWL 3MRFB 5F70A 1ZHLA 1SJVA 25C8H 2OYPA 4AEHL 4BZYA 1GCFA 3N1MC 4EIZC 1FG2A 2KL6A 4HF5H 4CDHA 2YSSB 3UXFA 5EO0A 2ZG3A 4KJWC 3HNTL 2Z92A 1CGUA 3CFCH 2EDFA 3P9LA 3F7QA 4OZFG 1U92A 2IADA 4LLUA 4DKFH 5KTEH 2FD6H 2FBJL 3NTCL 2HTLC 2VDOL 5J6HA 3GKWH 2ZKHH 2AJVH 5CILL 3QI9C 4BFIA 4WI9A 5A2KH 4NWTL 2W0PA 4F7PA 4JZJC 1LEGA 4UTAH 4HWEL 4R6UA 3PGCB 2BSSA 4LPVA 5BO1L 5I6XC 4DCQA 5HYSG 1KGCE 1JF1A 2EDQA 2XICA 2X4UA 3BPNC 2A1WL 2ICCA 1A6TB 3DGCR 4JO1L 3SPVA 5EC2B 1FNSL 3HR5B 3TBWB 3LHPL 2F54A 1RUKH 4S0SD 2NY5C 4H1LG 2JE8A 1F90H 2OP4H 2PF6A 2WUCL 4GG8A 2A9NH 4OT1H 1NCNA 2VE6A 3VFTB 1Q72H 3EYQD 1B6DA 3PE9A 1YMME 1CE1L 3CVHH 5DFVC 3IJYA 4QO1A 2EDBA 2WBJA 1U8LA 3RWIB 2L0DA 4D0DA 4PRHE 2NY1B 4MQ7A 4GRWH 4BQBA 3VXRE 5B38A 3HZKB 4ZPVA 4EEEA 5MP6H 2C1PB 4M7ZC 4WW2F 2KKQA 1AGEB 3MTRA 3IFNL 3KPSE 2YRZA 3WLWC 1A4KB 2F15A 4TULL 2LU4A 5AG8A 2D03H 1IFHH 1ITCA 3KYAA 4O2CB 2H1PH 1X4XA 5E2VH 2CD0A 4M9OA 4Z77B 1OQOA 3R1GH 2GSIB 1CZ8H 3DYOA 4IDLA 1TJIL 1K4CB 2YSSA 2YUZA 1CT8A 4PRAA 4K8RC 4UI2A 1GGUA 2XTJB 4JR9H 3RBSA 4EI5B 5EUOE 4HV8A 1AXTL 2A73A 2ESVD 4JFFA 4L4TD 3MRKB 5DJDB 5DRZB 4NQED 1NDGB 3VJ6B 5JW4R 5MERA 1EZVX 4OM1L 5I8CB 1XF4A 3KR3L 4JREC 2EH8L 4XC1L 1PY9A 3ARDD 1KTDA 2JJSC 4NP4L 3EDKA 4QRQA 1P7KA 1MRDL 3HAEB 4RMUA 1WAAF 3BDYH 2VDKL 5I1JH 1KTKE 4NO2B 5EU5B 1IGMH 3D25B 4JFYA 4I5BB 1TMCB 3HR5A 3TBWA 3QDHA 3MLUH 4FFVC 4HG4K 1IBGH 3JTTB 3V79C 4YK4B 4PBVC 5C07D 5JXAH 4X6DA 1AHWA 2AI0L 5ITBL 4X4YB 2NY0B 4J3UA 2V7NA 4QCIB 4BQCA 3RWIA 3WNOA 1N0XH 4X7SH 4LPXA 1FVDB 4P5KB 5TDPA 5GHWH 5FM5O 4XHJC 1KJVB 3LB6C 5K59E 5D7JC 4KKBC 3I3EA 4JFZH 4N9OB 5E8PB 2I27N 5JR1H 3H42H 3TN0D 3QXDA 3ZDXE 3KLSA 5DUMH 4F7MA 4XT1C 5GS1C 4WWKD 2W91A 5EU6D 3B83A 4PUBL 4JPVL 4OFVA 1A6ZA 3QFDB 3DLQR 5ISZB 1FPTH 3QDJA 1VENA 2GSIA 5ADPL 3IFPA 3RI5F 1QFOA 1T22B 3G5ZB 3MLSH 5L88H 3WFBH 1GIGL 3FQNB 2IPTL 2E7BA 4XNYH 3IRPX 3V8OA 5DRZA 5GZOD 2VAAB 2QADB 3KPRA 4OCYL 2LVEA 1HHKA 3V6ZB 1G1CA 2CSPA 1QYGH 1NFDF 2DQEH 5GGRY 1QLRB 1OLZA 3MOBH 5GGVL 2YPLB 2ZNWA 4FFZL 2WINB 4YNYB 3P30L 4P3WA 2Q8BL 4PRPB 3UTSB 4NO2A 5DJYA 4KQ4H 5TFSL 4LVHC 1JPFA 2A9ML 1TMCA 2A74B 4PJCF 2AEPL 1X4YA 3T2NH 1KG0A 5SX5K 1FCCA 3T2OA 2RJMA 3QZWB 1W8NA 3DGGA 2DQTH 3RUGF 1XR9A 1YNLH 4NGHL 2BCKA 4Z7NF 3GSOB 4QRPE 3CFEA 4OLZH 5C0CB 3RIFK 4QF1A 2GUOB 1FVDA 4JFOA 3WIIL 4NT6A 2BERA 4KZEH 3S35L 3D3VB 4ZTPH 4TUJB 4YHYB 2ZUYA 3KPPA 3QI9D 4O02H 1GGIL 3BUTA 4S1DC 4HGMA 4H8WL 2H32H 3D69B 3G9AB 5BMFH 1CICC 3INUL 1YNKH 5HHNA 5T1MB 2J88H 3HUJF 4DGVL 4LLMA 1ACZA 4HUXA 5GRZA 2PR4H 1UWEH 2EKSA 3U0TA 1YMMA 1B0GB 1OAUH 4L9DA 2FATH 4ACPA 5EIQA 1MCNA 1RFDL 3FQRA 3KG5A 3QDAA 5I8KH 2E3VA 4EDWL 1MI5B 3VXRA 1OAQH 1UYWH 4GKSA 3RGVB 4QWWD 5CHNB 4PJFB 1ETZA 4S1SL 1PJ9A 3T4AB 3REWB 4L8SC 4IJ3C 3KPSA 1XIWA 3TBYA 2X42A 3HNTH 3L5IA 3LRSA 4MVBD 5D93B 5L2KB 2BVOA 4IRSB 5GSRB 1R3IL 4Y2DC 1NUGA 4OGZA 1MPAL 4KJQC 5D1XA 4YLQT 3V5HB 3NTCH 2VDOH 3HE6B 1V3MA 2IMNA 3ARBD 1HHHA 2DN7A 4HPOH 1Z2KA 4P46C 5CILH 5F1OB 4L4TE 1X9QA 1FORL 5IK3A 4NWTH 3NPSC 4NQEE 5EUOA 2P5WA 4HJJL 5J11C 4HWEH 4GW1A 5BO1H 3HZMB 1V7NL 3FAWA 4H1LB 3T08A 1TVBB 3TFKA 3ZT5A 3W11D 4XH2B 3OGCA 3LPWA 4JO1H 1BX2A 1NGXA 1T1ZA 3OKEA 5E5RB 4MCZA 2NY7L 5IEHA 1YQVL 2VL4A 3F62A 1FNSH 4XCFL 1EUUA 3LHPH 3VXNB 2VNCA 2NQCA 4X6EB 2WUCH 3QXAB 2GUOA 4ZO9A 4R4NC 1JYVA 2Z0BA 3SQBA 4LLAA 1CE1H 5C07E 4GMTL 4EBQL 3NCEB 4TYUA 3P73B 3BXNB 3J7HA 4F8TA 3CFBA 3QNZB 3S37L 1GVIA 4QRRE 1JTOA 5DJCB 4R97C 5B39G 4YBQC 5ICYB 4D3CH 3MV8D 4J12A 4MJ6A 1T6VN 3IFNH 4R4BB 2FR4B 3OPZL 1LO4L 4TULH 2CLZA 3FT3B 4L4VB 5C7XL 2UVFA 2G75B 1P4IL 1K3IA 1ZEAL 2NXZC 3VFPB 4FFVD 4OZFA 4FNLL 4Z5RA 1JHLL 4AQ1B 5KSAC 2EYTA 5EU6E 4PJBE 1TJIH 5I18L 1AJ7L 1ZMYA 1U8OA 1S9WB 4PRDB 4NKOB 4IRSA 4LVNB 3SDAC 3O3DB 2V5SA 1AXTH 3IETB 1JWUB 4ZUWB 2NY2D 3V5HA 5HYSA 2UWEA 3VXSD 3AS3A 1U2HA 2AJ3B 4OM1H 3MRRB 2R9HD 4MQXC 1GGBL 4MHHI 4EIGB 4XWOC 4J4PD 3WS3B 3KR3H 2EH8H 4XC1H 3IAGC 1EJ6A 1VFAA 1OGTA 4Z7UB 1T5XA 3ULUD 4TNVK 4NP4H 5TDNA 1MRDH 5BOPA 5FA4B 2VDKH 4WO4C 1LEIA 3X13B 1SMOA 3MXWL 2SEBB 4EDXA 5M95B 3X17A 1NLDH 2XWBB 4X6EA 1Y6NR 3RZCC 1DUZA 3QXAA 2BRQA 5DHVA 1NLBL 1NPUA 5F3BB 1N59A 2AI0H 4GW4B 4MNGE 4MDIB 4PJ8D 4AL8L 5ITBH 4ZOBA 4IMLB 1X5FA 4IOIB 2FCBA 3BXNA 4FQ1L 2JKXA 4IIQA 5IFHL 1S5HA 5DJCA 2BP3A 4Y5VC 2YN3A 2VDPL 1TQCC 3ILQC 1DUYA 5ICYA 2VDRL 3L5XL 1HI6A 3HE7B 4KV5F 5A16A 3X11B 2VXVL 1G0DA 4OF8A 4X5LA 5CZXD 4PUBH 4JPVH 4PGBB 1T0MB 4RISL 3VFPA 4LOUC 3T0BA 5JPNB 4Z6AT 4GBXB 3MLXL 5DSCA 5ADPH 3HAEH 5F9DC 5B8CB 3GSVB 2DLHA 4HUVA 5J1AB 4I18B 4K55A 1CF8L 3TIEB 4JQVA 1BJ1J 1GIGH 2IPTH 1S9VB 3AMKA 5L6YL 2V2XA 3QDMD 5B22A 3QUKB 5I1DA 1J8HD 4OCYH 1MAMH 5D71L 3EFDL 4JM2D 1U8QA 2AQ1A 3CGTA 1DSFL 3K4DA 2GK0B 1H3TA 1GC1L 4RMWA 3AS0A 1OAYL 2R2EB 3WJJC 5GGVH 3FO2A 4FFZH 1Z9SA 3B4NA 4LSRL 4I2XE 3IFLL 2Q8BH 1WVZA 1FL5B 4NBXB 2A9MH 2DBLH 2SEBA 4FQXD 3QULB 2ESVA 4F7EB 2AEPH 4KDWA 5DC0A 2F74B 4YHKL 3CLFL 2APXA 4G6AD 4NQEA 4GRMB 2H3NA 4CJ0A 5JIKA 3SDCD 1UXWB 2XWTB 5ADOL 1IQDA 3AU1A 4NGHH 1ZKAA 4X6CB 5GISH 4OGAC 3ARDA 1QBLL 5HHPB 3ZT7A 3WIIH 3S35H 1DR9A 5TF0A 4WDIA 4HBQA 4U3HA 2BC4B 2ATPB 4JFXB 1GGIH 5I76B 1J86A 3A6OA 4H8WH 1NGYB 3DNKA 2CKBB 2PTTA 3WNLA 1HWHB 4PJEA 4I0PC 4OI9A 3Q6GL 1T1WA 2APTA 4OZHB 3SDDC 4DGVH 3E8UH 2GJ6B 4MB5A 5C07A 5E6IC 2ADJB 3A6CL 1PBYA 4R0LC 1WCQA 1RFDH 1V7ML 3MV8E 5IJKC 2ZG2A 1QFPA 4EDWH 1LP9B 1OF2B 3EDJA 3D39B 3TIEA 4S1SH 1S9VA 2EC8A 2Q86A 1W2KT 3N0PB 5BXFB 3BDXA 5HPOA 1MJ7H 3QI9B 1FL3B 1WWAX 1KLFA 3IFOA 1HSAA 4HFWB 1R3IH 4L8CB 4KDTA 2UVEA 4X6DF 1MPAH 3DMMC 4JZJB 4WWKA 1CK0L 5EU6A 5I6XB 1A6UL 4RNRA 1PKQE 2X1QA 3BPOC 3BPNB 4NYLB 5GRXG 3DBXB 1FORH 4M1GH 3KPMA 3VXSE 4S2SB 4FMFA 4KDVA 1RULL 3QQ4A 2NW2B 2CKBL 4HJJH 4S0UC 5C1MB 5GZNC 1FL5A 3GJEB 4WJ5A 1V7NH 3T77B 1FDLL 3TWCH 3ROLB 5ANME 3ULUE 2FL5A 1SY6L 3GNML 3X3FH 4ZO7A 2E7LC 5T1KD 5DEZA 1UXWA 2DIBA 2NY7H 2XWTA 1YQVH 4CADA 4XCFH 1WJ3A 1JPST 4G8GD 4U1IA 4OZFH 5BQ7B 4MX7B 4NQUA 5D1ZC 1FZOA 5B39B 4FFWD 5HI5D 5IKCB 4M7ZB 4Y4KC 4ZUUB 4GMTH 1BWMA 1FYTB 3VXOA 4W70A 4Y19B 4Y4HD 2CKBA 2QL1A 5HJ3A 3S37H 1PYWA 2AABL 4LKCB 4OLYL 4OZHA 1RHFA 1F2QA 1ONQA 4MNGA 4P2QE 3ZE2E 2CJUL 2GJ6A 3QCTH 2ADJA 4DK6A 4OZ4B 4GUPB 2Z91B 1C5BL 3OPZH 4LLWB 3V5KA 4ONHB 5C7XH 5HGHB 3NABH 1OF2A 3NCYS 3BJLA 1P4IH 4FG6C 2NY5L 1JGEA 4H1LH 3E2HC 4FNLH 5FFLA 1JHLH 4RRPA 1FBIL 1GYAA 1UXSB 2XIDA 5I18H 2R4SL 2CK2A 4WW1A 3GSXB 3QI9A 1AJ7H 5IHZA 4HFWA 4JREB 5CEZE 2IPKB 4X5XB 5TH2A 5DHVH 3TCLA 3QDME 1GGBH 3H7BA 2Q6WA 4EVNB 3N1GC 1J8HE 4HHAB 5E7BA 5C0ND 3OBAA 4Z9KB 3DOSA 2FRGP 1TQBC 4CJ1A 4E0RA 4JHAL 2HFTA 3ROLA 3IGAA 4FQHA 1K6QL 4G9FD 4ZODA 1AQDB 3SBWA 1KIUA 4MVBA 4U1LB 1Z5LA 1UCBL 2JELL 4K8RL 1WTGT 3MXWH 1Q8MA 3CFKB 3TCXA 4AK1A 5BQ7A 4X99B 3ARBA 4M1CC 4MX7A 4I2XA 3MV01 4YPGB 1NLBH 3MFFB 1JYWA 4AL8H 4PJGA 4RGNE 2EKJA 5D7JB 2E6QA 1MCDA 4PTTB 4MSWB 3FFDB 4CRPA 3HLAA 3U9UA 4OLUL 2OL3A 1S7RB 1MCLA 5GS1B 3FB6A 3ALPA 5IFHH 4LKCA 4XBEL 2VDPH 2VLKD 2VDRH 3L5XH 1YEKL 4OGYL 4GUPA 5F6IC 5F8QC 2Z91A 2EDHA 2VXVH 4LLWA 4ONHA 5DGRA 1F3JB 4G80B 4RISH 1RHHA 2I5YL 5EUOF 1J05A 4NCDA 3MLXH 2X6MA 1ZHNA 2AV1A 4JFQB 2X70A 1CF8H 4CN4A 5E9DD 1IKNC 4P4RA 5L6YH 3S5LG 1X5KA 5FKPB 4ZDHB 4OGAD 3L5WB 3HR6A 2YD5A 3TYGL 3SKMB 2JJSA 4D9RD 3MV8A 5J6GA 5D71H 3EFDH 5DD3L 1U36A 2FHCA 3O8XC 4GRLC 4NQDD 1DSFH 2WY3A 1J87A 3J8F7 1GC1H 3U2SB 3LY6A 4LVHB 3BSZL 1AY1L 1OAYH 1SJHB 2YPKA 1CD8A 3PNWB 3OKKB 3UDWA 3BVNB 3BWUC 2X4OB 4U1KB 5A40E 4LSRH 5F96L 3IFLH 3I6KA 1AQDA 3KPQB 2APBA 4YAQA 1BQHA 4NKDA 2DAVA 2YA2A 4YHKH 3VD5A 4CAGA 1VEOA 3CLFH 3U48A 3VXSA 4GAYB 4H88L 1OGAB 1LEKB 3CNKA 1M05B 5ADOH 1J0YA 5CAYB 1BQLL 4MSWA 4PTTA 3FFDA 4J4PA 5K59F 4RAUA 4ERSL 4RIRA 1CICB 1OP5K 1QBLH 5ANMA 3ZDXF 2ZUSA 3T2QA 3BE1L 4NBYB 1HINL 3JVGC 4AM0B 1FZJB 2Q3AA 2C3WA 1PEZA 2AJZA 3U0PA 3GI8L 5I17B 5GQBA 2FX7L 3Q6GH 2I9LA 2GY5A 3OR6B 5GZND 2VJXA 1ZVSB 4IEFB 4NNXA 1B4RA 5F7HA 4L8SB 3A6CH 4IJ3B 3QEHA 1S9XB 4PJ8A 4M8VA 4JFQA 2C4FT 4XNQB 1VADB 1ZLVK 2HJFB 4Y2DB 2R1YA 3EIFA 4KPHL 5DO2C 1FFOB 3PABA 4O2FA 1U58A 4ZDHA 2HJKB 3C6SA 4Q6IC 2LE9A 4P46B 4NHUE 5JHDD 1JGVL 5DEGB 3NPSB 2VABB 1KYOJ 4PJIE 3UTTD 1RK1A 3CZJA 3GDBA 4P23C 4ZYKA 5J11B 1CK0H 3BH8B 1HYSC 2W65B 1A6UH 3K0WA 3N85L 1K2DB 2BSTB 1F6AA 3BVNA 1PLGL 5KZCD 2NYYC 4U1KA 3CDYA 4F7CB 4P2OC 1RULH 3B3IB 3KPQA 1MCWM 2CKBH 3RX8A 3MRMB 4V1DD 3LKSB 5DK3A 2X4PA 1FDLH 3QDMA 2IFFL 5C0JB 1SY6H 3GNMH 1J8HA 2EEDA 1LEKA 1YEGL 3MRPB 1M05A 4JM2A 4R3SB 4LGRB 7CGTA 5E1AA 2P8MB 3HI1B 4PJAB 2I07B 1IEBB 1M7XA 4XI5C 2X40A 5GGVY 4R97B 2H2SC 4X7TB 4WHTB 1KYOK 1SYVA 1OWWA 5K93A 1JFQL 3W5NA 4QYOA 3T0ED 5FO9B 1RQ5A 1ND0B 3GB7B 3O3BA 5AAMA 2YXMA 4C83A 4MAYC 2AABH 3MACL 4FQXA 4OLYH 5K9JL 2NXZB 3F12B 1WIUA 3RPKA 3LIZL 1IGIL 2CJUH 4WV1C 5KSAB 2JJTC 5T1KB 3SDCA 3L3JB 2HJLA 1C5BH 4PV9B 2VLKE 3RVVC 3WXVL 5HHQB 2PW1A 2BVPB 1VADA 3SDAB 4NDMB 3IJSA 1R5IB 4BFBD 1N4XL 1GZQB 1FFOA 2NY5H 1FBIH 1IILE 5AYQA 3ARYA 2FIRT 5EBWB 4M1CD 4O2EA 2R4SH 4Q2ZA 3MRBA 4M48L 2W0FB 3LKNB 4PLNC 2VABA 3DARA 3FHAA 5H94A 4MJIB 3H9SD 1I9EA 5FF6B 3DVNB 4ODSL 5E9DE 2LQRA 1F3DH 2E7CA 5CD3A 1VGKA 2VL5B 2BSTA 4N1HB 3CSBA 3OGOE 2XQBH 3T3PE 4WO4B 1O7VA 2OJEA 4F7CA 1WFNA 3MV7D 1UENA 1SJEA 5EO1B 2MMXA 3RL2B 3LKSA 3MNZB 4JHAH 4MNQE 4XCYA 1L7IL 5F7DA 3RZCB 5IVXE 4ZFGL 1K6QH 4NZTL 4XPFH 1KEGL 5C2UB 4X83A 3QH3B 3QQ3A 3MRPA 3V6OC 32C2B 1UCBH 2JELH 4K8RH 4UDTB 4M4RA 1QD0A 3FONB 5IP4A 2P8MA 5GRUL 5KAQF 5IW6A 1T7XA 2ED8A 3MCKB 4R7NB 1U91A 1KJMB 2FEEI 3ECBB 3CMOL 4EI6B 5EC1B 1ZSDA 3P4OB 3PDOB 1JCKA 4Y5VB 1TQCB 2DTSA 1JWSB 3CDGB 3PQYE 1Y18A 4H0GA 5MEOB 3W82A 4OLUH 1BWWA 3OKDA 1OT2A 2VUOA 5CP3H 3GBNL 3WSQL 1A7QH 3O8XD 1ND0A 2D7OA 4JO2L 3NOIA 2RFXB 3L95B 2M8XA 1DQQB 4XBEH 5I16B 3F12A 1I1FA 1BQUA 4G9FB 3KS0H 4HS3A 1YEKH 2BNQE 3WL9B 4OGYH 2EDEA 5T1KA 5DJ0A 4PJBF 3I50L 3O9WD 2DQGL 5H35A 2QQKL 5GS2D 4G8GA 4LRIC 3S36L 3S5LB 2I5YH 4F9PC 3NFNB 3UC0L 5IB2B 3VMNA 2HT2D 1NBQA 2X4NB 4Y4FD 2P8PB 1LO5A 4Y4HA 2DQJL 3VFNB 3RJDA 1PW3A 2XN9D 5FF6A 3TYGH 1QP1A 3KPNB 1P2CA 2V7HB 3M1BA 2W0KA 2VL5A 4MD0B 5DD3H 4KY1L 4QHMB 4KMTL 5J1SC 2C4FU 2ITDB 5JHDE 2XWJB 1FNAA 4MA1C 3BSZH 1AY1H 3DX8B 4NHUA 3RFZC 1G7PB 4LK4A 3MNZA 2C3HA 4WU7A 3EJJX 1KT2B 4K7PL 4PJIA 4FQJH 5E08L 2OR8A 4LSQL 3TH3T 3DI2B 3SY0A 1NFIA 3O4LB 4JN2A 3NGBC 3FONA 1A1MB 2X1XR 2E9WA 4X4MA 2YC1B 2LU3A 2G9HA 3VRJA 1TVDA 2OI9C 1REIA 1M4KA 1F45A 4H88H 2ZSVB 3K4AA 3PDOA 1NGZB 4Y5VA 1BVKA 4OD3L 5DMKA 1BQLH 4ERSH 3ESVF 4I0PB 4J7RA 3SDDB 3BE1H 3RA7L 1SVZA 1ZA3A 5LBSL 2F19L 2JCCA 3HG1D 2DQIL 5E6IB 4G9FA 4R0LB 3BWAB 5ESQB 4GAFB 1JGDB 4XGZB 3GI8H 2NYYD 4P5TD 4AT6B 3ZL4L 2FX7H 1X6LA 1Z9OA 2DQDL 2UV3A 4FFYL 5FKAB 4H5SA 3T0EE 4OB5L 2LAGB 3ZKSD 1MVUB 3NFSL 3IVKA 2CPCA 1G7MB 1OT1A 1AGFA 2YXFA 3JTSB 1NEZG 1QSFD 1V8HA 1Q9WA 3MRHA 3JWOL 2YD2A 4MXQC 4KPHH 4PB9L 1IC5L 3DMMB 1VKXB 1U3HD 1XCTB 1T66D 3BIBX 4XI5D 1I9IL 1MIMH 2HG5A 2H2SD 2VLKA 3BPOB 4WU5B 2OTUA 2A0LD 3P9MA 2AERT 4WIQA 1JGVH 1BD2B 1D9KC 2P24B 4AENB 1Q9LA 3OB0K 2NX5B 1TJGL 1TLKA 1UVQA 3MLWL 3TNMA 2ITDA 2VTFA 1ZT7A 4PJGF 4JFDD 4MAYD 4HIEB 1I85A 1MHHB 4KMLB 4UINL 3AROA 3N85H 5IBLC 3PWNA 4JDVA 3H9SE 3PV6B 3S4SG 1PLGH 1Y0LB 4U1NA 1KT2A 3TO4D 2XZAL 3MV9B 2EIZB 1TZIB 3BPCA 5E9DA 5IFJB 1A1MA 3I02A 4QHUB 3MV7E 1MCHA 2MPAL 3VE0B 1FNEB 1RJLB 2DM2A 5D1ZB 4MD5B 2DI7A 5FM4A 5CJ8A 3CFJB 1YEGH 1EAPB 4Y4KB 3WD5L 2ZOLA 3UTTB 1UM4L 1JUFA 5H2BB 4NQDA 3P4NA 1NBZA 3MROA 4I0PA 5IVXA 2X44D 3RAJL 5CZVL 5IB4B 4HT1L 5FO7B 3WNKA 5KZCB 3IDUA 1JFQH 3QXTA 3TYFA 1PEWA 5EIIA 4V1DB 3MACH 5K9JH 3MCLL 5FKAA 2ADGA 1CE6B 3GBML 4JPKL 2X4QA 3E2HB 3LIZH 4CN1A 1IGIH 5HPMB 1AR2A 2X1OA 5KG9A 1A14L 2Y6SC 4JRYB 4EQ2A 4NQXA 3JTSA 3WXVH 2R39A 1QEWB 3AC0A 3P0VH 1JPGB 4RMTA 5HHXL 3SCMD 2EDRA