4F7CA

Crystal structure of bovine cd1d with bound c12-di-sulfatide
Total Genus 75
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
75
sequence length
273
structure length
269
Chain Sequence
PFSFQGLQISSFANRSWTRTDGLAWLGELQPYTWRNESDTIRFLKPWSRGTFSDQQWEQLQHTLLVYRSSFTRDIWEFVEKLHVEYPLEIQIATGCELLSESFLRAAFQGRDVLSFQGMSWVSAPDAPPFIQEVIKVLNQNQGTKETVHWLLHDIWPELVRGVLQTGKSELEKQVKPEAWLSSGPSPGPGRLLLVCHVSGFYPKPVRVMWMRGEQEEPGTRQGDVMPNADSTWYLRVTLDVAAGEVAGLSCQVKHSSLGDQDIILYWHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CD1D antigen, d polypeptide
publication title Crystal Structures of Bovine CD1d Reveal Altered αGalCer Presentation and a Restricted A' Pocket Unable to Bind Long-Chain Glycolipids.
pubmed doi rcsb
source organism Bos taurus
molecule tags Immune system
total genus 75
structure length 269
sequence length 273
chains with identical sequence C
ec nomenclature
pdb deposition date 2012-05-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4f7cA02
3.30.500.10 Alpha Beta 2-Layer Sandwich Murine Class I Major Histocompatibility Complex, H2-DB; Chain A, domain 1 MHC class I-like antigen recognition-like 4f7cA01
3QRGH 3MZTA 1KTLA 4DVRL 5LBSL 4HS6B 3CFEA 3OHXA 4CMMB 5C0CB 3U4AA 1QBBA 4PJHE 2X44D 1DN0A 5T1LD 3OAYK 5TDPB 3X11B 4OAWA 4RMVA 1PQZB 1VGKA 1X7QB 2X4SB 4XGZA 4NKDB 1FE8H 2RR3A 3DVNA 3RWHB 1N5AA 2OR8A 5ISZA 5CIPB 3QDJB 4LNVA 2X1WL 1LO4L 4BQCA 5LWYL 5K59E 1CDGA 3HFML 1NGWA 1YPZF 4YBHA 4ALAH 3SKJH 3C5ZD 4H1LA 2G60H 4UIKH 5T5FL 5GS0L 2J8UF 4J4PC 1F4XL 3FOMA 3VWJC 4X6CF 5FCUL 4A6YL 5GGTH 3QIWB 5EOTA 5HDQH 1S7SA 1P7QD 1FO0A 4ZXBD 4A2LA 1UH4A 4U6HB 5AZEH 4L3EE 1KGCE 1HHJA 5T3ZD 1QFPA 4JKWA 1FV1B 4Y4FB 1CU4L 1INDL 3F12A 1S5IH 4WUUD 1AGDA 1JGDB 3UTPE 4NBZB 5EZJA 5KSBA 5FGBA 1FVDB 2H32A 1FDLH 1R3HA 1MHHA 2BFVH 5DJ6B 3TF7A 3BGFB 1FVCA 1A6VL 2XYCA 2GAZB 1CXFA 1RJLB 4JFYA 4LLVA 3G5ZA 5T1KA 4HJ0C 5DQ9A 1ZANL 1CS6A 4I2XA 1R5IA 2DDQL 3MLUL 4DW2L 3QJHA 2FJGB 4LU5H 5CGTA 3Q6GH 1GIGL 1VADB 3DXAE 3FZUD 1G9NC 4LIQL 1HHHB 1FFRA 1NGPL 5HJ3B 4LPCA 2PR4H 2Z31A 3BIBX 4PJBE 3L5XH 3NAAH 2GFBA 2XPGA 1N3NB 3C60B 3TBSB 3V0WH 1BM3L 1ZA3A 2VSDA 1ACYL 4WDIA 3QXDB 4XNUL 1DQDH 4F8TA 4ZUUA 3QUXB 2Y5TB 1CICB 2BSRA 3VFSB 3BRGC 2HJKA 5DJDB 1FPTL 4N8PA 4NRZA 2MHAB 3B9AA 1RULH 3ARGC 1HI6A 1NKOA 5C09A 4CVXA 4GG6A 2APVA 4KHXL 3O3BB 1D5BA 1S7TB 3DECA 2VQ1A 5F8QC 3QQ4A 3ROLB 4BSVB 3U6RA 1BQUA 1OW0A 4G6KL 2VUYA 4YH6A 1I7RA 4FN0A 5MEPB 2DQDH 3AVEA 1MJUH 1BFSA 3DVGB 5EBWA 3BDYH 4KZEL 1ZVSB 2X4PB 2AERT 3G6AB 5ILTL 1DQTA 3LPGA 3AAZB 1F58L 3OG4B 4OSUH 1LNUA 1FN4A 2XTJB 3IRZA 1S7WA 3RWCB 4PJIB 3MLVL 3NPSC 1O7VA 1VA9A 2EZ0C 5HPMB 4U31A 4PG9A 1DUZB 1YMHB 3CUPB 3WJJA 2FYYB 3V95A 1OWWA 3HZMB 4DKFH 2FBJH 2OQJA 1NH6A 3VWKA 2BNRB 5CP3H 2CMRL 1QYGL 3ZKXB 3E3QE 4NCC1 5C2BH 4OZGB 2Y36H 4Z78B 5C07A 4X6BB 4DGIH 1XZ0A 3SKNA 4MQXD 3CH1A 4QRUB 2CXGA 5DSCA 3KPSE 4X80L 3ZTNL 5JHLH 3WHXA 3CXDH 1FL6A 4RRPA 5J4MA 1V7MH 4CVZA 1TETH 3D85B 4ELMB 4PJAF 1A6TB 5T3ZE 4JAMA 4Y19A 4TULH 3WFEL 1XF1A 1KCLA 1N59A 2IEPA 5F7HA 4WEMB 4C56E 5ESVB 5JNYA 4NDMA 2VB5A 4UT9H 4ODHL 4PJDE 5FM8A 3WD5L 3MRBA 2LV4A 3L3IB 4KMLB 1JGLL 2P24B 1JGEA 2AXFA 5GZND 5CZVH 4Z18A 3GO1H 4DZBA 1K8DA 5E8DH 1ZS8B 4ONHB 2VLJD 1C16B 3VRLE 4HWBL 3ZT6A 1KCRL 3EDKA 3SQBA 2XZQL 1J87A 5ECJE 4NPYB 4OZIF 5GGRY 4IIQC 2HKHL 2BDNL 2YXMA 4QXTA 2QHLA 1CFTA 3C87A 3EOYG 3VXUD 4NQDA 1KT2A 4QXWA 5GZOD 3S3SA 1HHKB 3FMGL 3P0VL 4OGYH 1OB1A 3RZWA 1DQJB 3N85H 3GBMH 5IHUH 4MA1B 3TA3D 5TF1L 2VLKA 2E7LC 4ZFOL 4FQ1H 1Q94B 3LKSB 1PKQE 2BHYA 3ARFC 5AG9A 2WBJB 4Q9QL 3L9RA 4X6DA 4OKVB 5DC9B 4NQTA 4ORGB 3WL9A 3HNSH 3BZ4B 4L8BB 3MA7B 5D5MB 3RVXD 1PG7W 3C9NB 3MREA 4URTB 3LOWA 3ZKSD 2QQQA 5HHOA 5DD1H 4Z7WF 2VMFA 3QDGD 1A1NA 4IRJA 2DN7A 3O9WA 3OGCB 3QNZB 3EYOB 5KN5A 2CGRL 4I8DA 4XRCA 2R4SH 1YMMD 4GRLB 1KXQE 4FFWC 4N9GB 2Z0BA 1S7RA 4MJID 5I1LB 1KIUA 2CIKA 4R0LC 1CYGA 5J9PB 4MX7A 3UDWC 1T1WB 4KFZC 4JFED 3AMKA 3BE1L 2JJTA 1JPFA 5KOVC 3KJ6H 1U8HB 1O7SA 3FQUA 1ZEAH 1IC5L 3U4BH 1LK2B 4O51B 3GMNB 4IRSD 1CG9A 2NY1C 5FOBB 3C6SB 4M9OA 1T03L 1TVBA 3MLRH 2ICCA 3NACL 4DFHA 4HUXA 3HZVA 4AQ1B 4WI5A 3MRRA 4P5TC 4F3FB 4GG8B 3DRTB 1P4LA 1JNLH 5H94B 1D6EA 4TNWF 5F7MC 1AR1D 1JJUA 4HWBA 4TSCL 4GRMB 4NO3B 3QXVA 1U92B 1UM4H 3MNVA 1PZ5B 4L1DA 4YFDB 3D25B 3ALWA 1AKJB 2LAAA 4HUNB 1A6AB 4NQXB 4Z7NE 3NZ8A 3QUZC 4NC1E 5D1QC 1D5MA 1CTNA 4G9FB 1A9BB 3ULUD 3MRJA 1YA5A 3I6LE 1RK0B 3UTTA 2NY0C 2CRZA 4XWOC 2J6EH 2N7BA 4G42A 3E2HC 3BKMH 3PWPD 3WN5B 1JHTA 3KGRA 1LWRA 4KZDL 5EDXA 4POZC 3EGSA 4PP1C 2X7LB 4HD9A 2VLJE 1AXSB 5B4MD 1HN1A 5KBNC 3ZHLA 3ZSTA 1YJDL 3MCKA 4XHQA 1FFOB 4OI7A 4X5LA 4WEBH 3U1SL 1T83A 3TZVC 3S5LA 4M61A 3LIZH 3MBEA 1SJVA 3GIVA 4NNXA 1YPZE 5C0EB 4QY8A 2W65B 4FZEL 4Y8DC 2FX8L 2J8UE 3VFMB 1CE1L 1TVHB 1KUMA 1N8ZB 1YYMH 3W39B 2MSPA 3QIUA 4YHKH 4U1LA 1DP0A 4PJ7B 5KOMC 3FQTA 5FXCH 2HMID 1QLEH 1Y18A 4M4RA 1ND0B 3B8SA 4PJ9B 4JFFA 1D9KC 5E08L 3LDBC 4EI5D 4B50A 4NQEB 4JANB 2BK8A 3ARUA 2OM5A 1IAOA 4JRYD 4AIZA 3O45B 4HT1H 3RFZC 5CILL 2HT3C 2WUCH 4K23H 2IG2L 1AQKL 4AEIL 3KPQA 5JZ7C 4PRIA 4Y16B 4YDJA 5F9JB 3H7BA 4HCRH 3PL6D 4XP4H 2OSLA 3VMOA 5BRZA 1YMME 4K94L 1BZ7A 5IFJA 5I74B 4N0YL 1DUYA 4MJIE 1MCDA 1T1YA 2NX5B 3UJJH 4J1UA 4JFEE 1CDCA 3QPQC 4R9HA 4JY6A 2Q7NA 2ZUWA 2I9TA 3G08A 4PJ5B 2WANA 3GSOA 2EDFA 5GRVK 1EVTC 1I9IH 3QG6A 1E28B 2GTWA 3UROR 2DM7A 3MACH 4F2MB 3OKDA 3BRDA 3IJYB 4M5YH 1CDUA 2JJSA 5K9KB 1IARB 4KJYA 1CGYA 2AGJH 4X7SL 1VFBA 4JZOB 5EOCJ 3KXFD 4NO5B 3G5VA 2VJXA 4L9LC 1FP5A 4TNWK 4FXGB 3D0VB 1F6AB 4ZG1A 1GOHA 4RGMB 3FL7A 1A9EB 1FVEA 3L6FA 5IVNA 3UO1H 3VXOA 1CR9H 3T8XB 5CINH 2PXYB 4CDGC 3SJVD 5I75C 5DC0A 1SYSB 5TPWL 1JV5A 3HNTL 1OAKH 3IDGB 4UAOC 4PFEA 4HGKC 1X5KA 1R3JB 3PWPE 4GMSL 4P59L 5GGRA 5E1AA 5FO9B 3MUJA 4U1GC 2D7PA 5D8JL 1UWXK 3DSFL 4LL9A 5C0AB 2W9EL 1CFSB 1A47A 4I5BB 4FABH 5CGYC 2WWKO 1AP2B 3VD7A 3DETD 3QQ9D 3SDAD 1M05A 35C8H 1CVSC 3L7EB 3JTSA 1IGYA 1X3DA 1P6AB 1MNUL 4GMTL 5H37H 3P0YL 1BQLL 5FUZL 1UYWL 2W9LA 2HKFL 4JKPL 4I13B 3T2NL 1NGQL 4H88L 4HIJA 4ZFFB 3REWA 3F7PC 4R0LB 3DMMD 2P5EA 4YDVA 3O11A 5LAXB 1Z3GL 2VTFA 5DURD 2VDRH 4K8RD 3DHJA 4RAVA 1TIUA 4PJAE 1SY6L 4JEGB 3FFDA 3ZKNC 5IBTL 5F1OB 3PWVA 5KS9B 1INEL 4IS6A 3BPOC 2WMPA 4JFQA 2EKSA 4MNQA 2ZWLT 3VXRA 4OD3L 4EJ1C 5EU6B 3T3MF 4OFYA 5HYQB 1IBGL 1W72H 1TZIB 4Y2DB 1FC2D 2GSIB 1SJEB 4XMLH 4JRYE 1RZGB 4BKLB 4R4BB 1S7VA 1E6JH 4W68A 3KYOA 2MNUA 2AV7A 1RUAH 4TVSa 1CBVH 3C6LD 1OF2A 4XHJC 5SWQA 3VXSB 2VISB 4YLQT 3FO2A 5MEOB 3Q48A 2CDGB 1NAML 2QLVB 1LE5A 1H15B 1JPST 5LGJB 1CD9B 4ZSOB 4F33A 4GRWF 4MA8L 4RA0C 1WCBA 2NY0B 2Y4SA 3CSYA 1NL0L 3NTCH 4G6MH 4ODWA 2XWBB 5CZXC 1W72B 1DBBH 5L0QC 2FJHA 2R15A 4MS8C 2X10A 1BIHA 2Y6SC 5BS0B 3GIZL 3KWWA 2IAND 5F3BA 5ID1A 4G6JL 3MNZA 5GS0C 2F53A 1FNLA 8FABB 1CDJA 2EDLA 3TZVB 3DIFB 5FYKU 4Z7WE 4FQXA 1I7UA 5FF6A 5FKPA 3SE3C 1XGUA 2L7JA 4RISH 1KXTB 4Z77B 3VFVB 5F7UA 5CJ5A 1KXVC 1ZGLM 3FQRB 1JL8A 2XACC 5DZLA 1UACH 5ADOH 3MFGB 3EFFA 1GSMA 4YHPB 5L8KB 2DOCA 3NCYS 4MAYD 5BQ7B 1SY6A 4Q9RH 1K4CA 1D9KB 1G0XA 4N8CH 4KHTL 2I5YH 2Y06L 3MA9H 4XPGH 1FFQA 4YEFA 5JOEA 3SO3C 3LDBB 3UTSB 3RKPA 4YHYC 3MV7A 3T09A 1JNJA 3V52H 4PP2B 4RBPK 1NLDH 4EDWH 3HUJB 4DZ8B 2ZNXA 1MFEH 4UTBH 4DUXA 5C0RL 1KFAH 4OUOA 1LE9A 5T1MA 3RDTC 1KYOJ 5HHME 5HGHA 1SEQH 4EUPH 5ICXA 4HKXB 1E6OL 3LRSB 3AC0A 2DBLH 4HIIA 5HVWA 2O61A 3TYFA 2Y9RT 4QCIB 5DD6A 5AZ2H 4LVNC 2Q8BL 5JMRA 3OXRB 2D4FA 4P49A 3KYNB 1QRND 1D5IH 3OKNA 3LS4H 3LAFA 5JPMB 2ATKA 4WIQA 2P5WA 1A8JH 1DBAL 2Q6WB 3MRMA 1QFUH 1KLUA 4PGBB 1YY9D 1J0HA 3EBAA 1SYVA 2EH7L 3SDCA 2R56L 2PO6D 4MA7H 1Q1JH 1DBJH 5AD0A 1KPUA 3MRGB 3BZFB 1B2WH 3J8F7 2ZUTA 4OT1H 3TJHD 2Z8VC 4DWHA 4M7JH 4ERSL 4EUPB 2BNQB 1U8PB 3P40A 2XRAL 3O6FD 2Q20A 4EIGB 5ACLA 2EC9U 2APBA 1IAII 3SGEI 4BFIA 2ICWJ 2DLFH 3H9YA 4AMKH 4PV8A 1S9VB 3G6JB 3RWDA 1KTLB 4I9WE 3CFEB 3OHXB 5CAYB 1GOFA 3WIIH 3VG0L 3BKJH 4Y8AA 3HC0A 2XNAB 4OAWB 4ZFZA 1S9WA 1A4JA 4LFHD 5I75B 4YHML 1LDPH 1VGKB 1IC1A 2VZVA 1WISA 1PLGL 3DVNB 3MC0A 3NMEA 1OPGH 1N5AB 4PB9H 1YQ2A 2HLAA 4HK3N 4CW1A 4U1GB 3PXHA 1K9TA 3LKRA 5HGDA 2X1OA 3BT2L 2DBJA 2VZOA 5HYJE 1NGWB 1XH3A 2B5IC 3DX8A 5FHBL 1WCQA 2VERN 2X5PA 1JBJA 3QI9A 1E4XI 3KJ4C 5EOTB 5DVLA 3I50L 4ZOCA 3GUTA 2WUBL 1S7SB 1FO0B 1U8KA 2ERJB 1HHJB 1T0NA 5JHDE 1IQWL 3Q5OA 3VGEA 3QEQA 4P2OD 5HGGS 4S0SD 4DOHE 3O0RL 2L7UA 2FHCA 5HHXL 2ZCLL 3P11L 2N1KA 4LLDA 2DD8H 5J3HD 4PLNC 5IT2L 4EDXA 1AGDB 1H8NA 3HRPA 4HS8H 1P1ZA 3D9AH 1LO2L 1Q72L 1MHEA 1UM6H 5EZJB 5KSBB 1HYSC 3S36H 2H32B 1BP3B 1A3RH 1HSBA 1R3HB 2H2PD 1MHHB 4DVRH 3HNVL 1U36A 2FBOJ 4U2YA 1FVCB 5I9QB 4AG4L 1FYHB 1J0IA 5CSZA 4JFYB 1URLA 3I2CL 4LLVB 3G5ZB 5T1KB 5CUSL 5DQ9B 1NCUA 4I2XB 5T33L 4W70A 4L4TA 4R8WL 2RQ8A 1EEZA 5IV2A 2ADFL 2DLIA 4LMQE 1MCEA 1FNFA 1LO4H 2Z31B 5L7XL 3WNPA 5LWYH 1FFNA 3HFMH 5C0CD 2GFBB 2XPGB 4NKIL 1JZ5A 4GOSA 1FCCA 3BH9A 5T5FH 5GS0H 2EEBA 1F4XH 1ZA3B 1EDQA 4WWKC 4A6YH 4WDIB 3SGKC 1DFBL 4XNQA 3BDBA 5HGAA 3D1MC 3WYRA 1QFHA 4HMDA 4ZUUB 3TJEL 5C6TL 1AO7E 1VESA 5A2LH 2BSRB 4LLQA 4HUMB 2HJKB 4NRZB 1CU4H 5JDJA 3BQUC 1HI6B 2CRMA 1INDH 2BVQA 4CVXB 4Z7VA 4GG6B 3QBTB 2DWDA 4ELKA 2VQ1B 2XZZA 4HK0A 3QQ4B 3CK0L 1AE6L 3U6RB 2VLRA 2AQ3A 1A6VH 1I7RB 3LB6D 3GDBA 1J5OL 4TVPL 2NZ9C 1U95A 5D5MF 4Y4FD 5EBWB 3DNKA 3ULSA 1UA6L 4D9QD 1ZANH 3RJDA 4WV1C 4A6YB 4X4XA 4DW2H 4NT6A 3L3KA 1GIGH 1KTDA 1LNUB 1FN4B 3NABL 4LIQH 4E41A 1NC4A 1NGPH 1MCRA 1S7WB 4QHNA 5ESAA 2GW5A 5B3JF 5ALCL 4BFGA 4AH2B 3L3JA 4QRQA 1BM3H 4PG9B 1HZHL 5CFHA 4FQPA 1CD0A 1ACYH 5BO1L 3NN8A 4HGWA 2VR9A 2ZSWA 1J18A 3VWKB 1AGBA 4QXUL 1XF4A 2P48B 4HPYL 4ZAKA 5C07B 3ARQA 1WK0A 3E6FA 4LHUA 4S0TD 3MRHA 1XZ0B 3O6LL 4NSKA 1FPTH 3SKNB 4YHYB 1I7ZA 1AQDA 3CH1B 5DSCB 1OAYL 3C60D 4RZCA 2V5TA 3WHXB 4KHXH 1FL6B 1BBDL 5DZOA 1IVLA 5IHBA 2NLJA 2CKNA 4M93C 2AEWA 4M1GL 2Z93A 3QUXD 4GS7C 4OZHF 5AAWA 4G6KH 4JAMB 1CICD 4Y19B 1ZLWH 4MNGE 3ZE0F 5J1AA 1N59B 1KJVA 2R0ZL 5JNYB 2VKXA 4HK3J 1BLNA 3IDYB 4PJGA 4IDJL 4NDMB 5ANMA 5ILTH 3MRBB 1F58H 1YEDA 1JGEB 2AXFB 1CCZA 4DZBB 4K2UL 3IDJA 4QHKI 3UPRA 1K8DB 4X98A 3MLVH 1MQKL 3G5YA 4KMQA 4JKLA 1VSCA 3LCYA 4XNZC 4GRWE 5IVZA 2AJZA 1S3KL 1T04A 3TCXA 5HYSG 1P4IL 3I3DA 2ESVB 3P4OA 1ED3A 4LVHC 3OV6A 4YWGL 1X5XA 3GMQA 3GJEA 3L3OA 2CMRH 1QYGH 4U2ZA 4HS3A 2P1YA 3IGAA 4NGHL 2XTJD 3SE4A 3JWDL 4QXTB 2GJJA 3RUGA 4C59B 2EEAA 4NQDB 1KT2B 2WK2A 1U3HA 1OB1B 4PGDA 4X80H 1LO5A 1FL5A 3ZTNH 4JQIL 4I77L 4LLWA 1QRKA 4MNHA 2VLKB 2XN9A 3HRZA 3K1KC 3CMGA 4UV7L 4L9DA 1QQDA 1DQML 4NO2A 3L9RB 2F74A 2BNRD 4X6DB 5EUOF 2XQYK 5DEFA 2BSTA 3WL9B 5F7DA 1K6QL 2WWKT 3VD3A 3WFEH 1FLRL 1VPOL 5DDHA 3QDJE 5HI4D 5HHVL 5E0QA 3MREB 4DN4L 2R9HC 5DK2A 1A4KA 3LQZA 2ADGA 1MJ7L 1NCAL 4N8VA 4ODHH 3WD5H 3T04D 3TBWA 5HHOB 1EMTL 1JGLH 1Q9KA 5CEXA 1A1NB 3GB7A 5D9SA 4IRJB 2B5IB 5EB9A 3O9WB 5KN5B 4ZO9A 4HAFA 2A77L 4XRCB 4HWBH 2FJFA 4CU8A 3VFUA 2VWEE 1KCRH 1S7RB 2XOTA 2GYSA 5ENWA 5IK3B 4G80A 2CIKB 2XZQH 1KSRA 2MWCA 3CMOL 1F3DJ 3ILQD 2HKHH 2BDNH 4K94C 4MX7B 3VXME 1FNAA 5DRNA 4GKSA 1NMCB 4AEFA 3SGEH 1FSKC 9CGTA 1F3JA 1JPFB 3B9DA 3VD9A 4L8CA 3FMGH 3P0VH 3FO9A 3S98A 3FQUB 3MODL 1P2CA 4PJ8A 5TF1H 2WIIA 3LQAL 3L5HA 2FZ3A 3GBLA 4O4YL 1CG9B 2BC4A 4Q9QH 4YQXL 1PEWA 3H2WA 1MSPA 1TVBB 2B20A 2VXTL 3QFDA 4JQVC 3QSKB 4U1MA 3U36A 4HUXB 3HZVB 4YXLL 5KSAC 3MRRB 4CAGA 3RVUC 4JVWA 1P4LB 4BJLA 3NCMA 2YPLE 3ULVF 5DMGD 5IB3A 2R1XA 3MNVB 4H1LG 3F58L 1L4IA 2K3TA 2WBJD 3NZ8B 15C8L 3RNKB 1JIBA 4RMTA 1D5MB 3GKZA 2AS5M 2CGRH 4Z8FL 4QRRE 2UZIL 3MRJB 2DM3A 3UTTB 4TSBL 4LASL 1TPXC 3GJFA 4G42B 3O3EA 1JHTB 1IGIL 1WBXA 1BFVL 4XP1L 3BE1H 1WF5A 3BP5A 2LAGB 3CXHJ 3EGSB 3BQUB 1P7KA 3GMRA 5JLZA 2F5AH 4M8VA 4AEHL 5I2IA 4G43A 3VWJD 1O5DT 3SGJC 3MCKB 1T6WA 3QIBA 1IC5H 3SE8L 4KROB 3P9LA 5SWZA 3RZCC 2XQBL 3HS0A 2YEZA 1T03H 1U2CA 4JREC 4R2GC 3S5LB 4M61B 3IAPA 3MBEB 3NACH 3GIVB 4NNXB 1D5ZA 4JY5L 6CGTA 1C5BL 4MZ2A 4QY8B 4F80A 2FL5A 5ERWA 4BUHA 5TE6L 2ARWA 3M1BA 4TSCH 2X9XA 5EOCL 4WHYH 1AIFA 3T0VA 4R26L 3QIUB 3O4LA 3SCMA 3FQTB 2BNRE 1Y18B 3EO1A 3V8CA 2P42B 4PRPA 3I9GL 2A9ML 4JFFB 4OZGE 1LP9A 4YK4C 5J12C 4HSQA 3PHOA 4HJ0D 4RGNC 4UI2A 4N0CD 1IAOB 4AIZB 3RWEA 1MCIA 3DUUA 3RI5F 2C3HA 1P53A 4KZDH 2EDXA 4OIIL 1I9RL 1YQVL 4WI7A 2WLYA 3NGBB 5JXEA 2VKWA 3KPQB 4PRIB 1AHWA 4G9FD 4YDJB 3H7BB 2OSLB 4LKXA 1YJDH 3KR3L 5BRZB 4L8SA 4ZDHA 2YRLA 1BZ7B 5IFJB 1DUYB 3U1SH 1T1YB 2IAMA 2NXZB 43C9A 5JQHC 1V3MA 4J1UB 2W0FA 3QFJE 4NQCA 3P2TA 4JY6B 4FZEH 1IKNC 2FX8H 5CMAA 1QACA 3VXQA 5HVHC 1CE1H 3N1GC 4M5ZL 2I9TB 3G08B 3GSOB 3P4NA 1TNNA 2YD8A 1D3CA 3QG6B 4ZO8A 3QUYA 2GTWB 5HDBF 2EIZA 3OKDB 2EDBA 3Q0HA 4NN5B 5E08H 3RTQA 4I18A 5E9DA 4KJYB 3DUSA 1ZOXA 3NH7L 4FFYL 4K3DL 2EH8L 3G5VB 5LXGL 5CILH 1CDBA 5F93C 3H3BC 2EZ0D 3DLQR 1S78C 2IG2H 3B4NA 3NCEB 1AQKH 4ODBD 2OTPA 3W0WA 1FVEB 3T0XA 4H26A 4PJ9D 2R2BA 2Z8SA 2O26U 2C4FU 3NIGF 5D5ME 3VXOB 5J13C 4JHAL 1CDIA 3O8XC 5DHXB 2HJFA 3WDIA 4K94H 4NQED 4HV8A 4N0YH 3S96A 4YEEA 3ARZA 1JV5B 1YECL 3W9DA 2E7CA 3MR9A 5L6YL 5GGRB 3B6SA 5BVPL 3T1WA 5CCKL 4GJTB 3QUKA 4F7CA 4Y16D 1T7WA 2YZ1A 1FRGL 3AB0B 2UZYB 3VFRA 2PTTA 3FHAA 2MPAH 3EDFA 1YZZA 2YWZA 4I3SL 1VACA 1M05B 4Y5YA 4GBXC 3JTSB 3MOAL 1IGYB 5C2UB 4P2RE 2NX5D 3NFSL 3EHBC 4KGJA 5C6PB 3ULVD 4F15C 5DJYA 3GMPA 4HIJB 4X7SH 3REWB 4LSSL 4XH2A 2P5EB 2HT4D 4YDVB 3O11B 1UJ3C 1M6OA 4PJ5D 2BRQA 4RAVB 1EEQA 1FNEA 5E2TL 1FSKB 5FGSA 5IFAL 4WUUA 2EDOA 3PWVB 4IS6B 1MHPL 1OM3L 5AG8A 4JFQB 2EKSB 2NY4B 3MMEA 4MNQB 3VXRB 4XXCC 1EZVY 3HPLB 1S9XB 4LNRA 5TPWH 3RVTC 2DQUL 2ZCHL 3HNTH 2ATPA 4GMSH 4P59H 1S7VB 1U93A 1X4YA 1NUNB 1VCAA 5D8JH 5TH2A 3TBTB 3DSFH 1OF2B 2W9EH 5SWQB 4HDIA 4CKVX 4G9FE 3BIKA 2F54A 2QQNL 2R23A 3FO2B 1WC7A 3MXVL 2PXYD 4KUZL 5I1AA 4QRSA 5HPOA 2GJZA 1LE5B 4GMTH 1MNUH 3P0YH 3BP6A 3FO0L 1EPFA 4F33B 1NPUA 1BQLH 5DUML 5FUZH 1UYWH 2HKFH 4JKPH 1WCBB 5GQBA 1GCFA 3RX8A 5C0AD 5SV4A 3OGOE 3CSYB 3T2NH 1NGQH 1TPXB 4H88H 5DK0A 2ZUSA 1JF5A 4ODWB 5ACZA 4ZUWA 4M7KL 4XB8A 3RNQA 1Z3GH 2FJHB 1SY6H 3G6JF 5JA8B 3KLSA 5IBTH 3S6CA 2Q1EA 3L3DA 4LARL 3MRCA 5F3BB 1INEH 5ID1B 3MNZB 4JPIA 4OD3H 2F53B 2M8XA 4Z0BL 3TH3T 1IBGH 2DLGA 1GAFL 4JREB 2BMKA 4FQXB 1OSPL 5FKPB 1XGUB 3B9EA 4FQQA 4PJ7E 1G6RL 4KJWC 3K46A 1LK3L 5E8PA 2IGFL 3DURA 5EU6D 4LLYA 4NQEE 4F9PA 1NAMH 3MV11 1Z5LA 2ARJA 4U0QB 4Y2DD 4XNXL 4L3CA 1K4CB 4AL8L 4P5TD 4NZRL 4MA8H 2W38A 1UCBL 1VERA 1RUKL 4ZMAT 4DQOL 1JRHL 3MV7B 1FFPA 1NL0H 3T0EC 3VXSD 2NY2C 3HAEA 2OR7A 3MLYL 1CTOA 2E7HA 5KANG 1RIUL 3HC4L 5KSBF 4JLRA 4BFBD 1LE9B 5T1MB 4YHIA 5HGHB 4OCLC 3GIZH 5ICXB 3RWFA 4YDIL 4HIIB 3JVGA 2O61B 1AGEB 4G6JH 3TYFB 4TTDC 5E56A 3S5LG 2NY0D 5IB1B 5DD6B 3ULVE 3O3UN 4XWOD 3E1F1 4NM4L 2R39A 3FFCB 3ARDA 3MUGA 3OKNB 1NAMB 4POZD 2ATKB 4PP1D 2P5WB 4RMQA 2CD0A 3MRMB 4MD4A 1I9EA 1KLUB 1SYVB 3SDCB 1OAQL 4MD5A 2HTKC 3QXUA 5AD0B 2AVGA 1KPUB 4JPWL 1ZLVK 4ODVL 2C1OA 4LQ1A 4R4NC 1MVUA 2IFFL 5MP6L 3TZVD 5E8EA 4GQPH 5A16A 4JDVA 2YA2A 4KHTH 2FLBT 2Y06H 4D9LL 1QP1A 3UPCA 4QOKE 3LEXA 4BFIB 1R6VA 1JYNA 4JB9L 2XFXA 4PV8B 5E4EC 5GGSA 4LPUA 3QNYB 3RWDB 1NFKA 4YDKL 5C0RH 1HDMA 4LCWA 3D39A 1U8IA 1INQB 2D4DA 5HXMA 4L1HA 2Z9TA 1D9KD 1E6OH 2QSCH 4GAYA 4BQ9A 1WZMA 3HC0B 2VLLA 3V4UL 1CVRA 4ZFZB 3UTSD 1S9WB 1A4JB 2ICWA 1UWGL 2Q8BH 4QGYA 1GHFL 3QEGH 2DQTL 2HLAB 3BEVA 4CW1B 5HGDB 3LKRB 1DBAH 4HKBA 4WRLA 5KSUA 1XH3B 3DX8B 4YDLC 2EH7H 1I8LC 2R56H 3QI9B 3TBVB 1T66C 3QDGA 3HZYA 3GUTB 1U8KB 4FFEX 5DHVH 3SKOA 1T0NB 3LN9A 3F8UB 3QEQB 1FYTA 3ZKQD 3QPQD 4WUKL 4EQ2A 4ERSH 3B9VA 3T0EE 5D4QA 1EGJA 1CZ8L 4LLDB 2XRAH 5A40E 3BP7A 5KS9E 4XTRC 4L4VA 4EDXB 2X4QA 4HG4J 5M94B 1BGXH 1P1ZB 1Z9SA 1A21A 1MHEB 3H9ZA 5I1IL 5EU6E 1HSBB 2I9LA 1U3ZA 3VG0H 2D31A 5CSZB 5D7SL 4YHMH 1MOEA 4L4TB 5E2UL 3VXSE 4P46A 4BZ2L 1PY4A 1PLGH 5IV2B 3KYKL 5EU4A 5DHVB 4XAWL 5IEHA 1LVEA 3FB7A 3BT2H 1ADQA 5FGCB 5FHBH 3JWDC 1Q9OA 3BH9B 4WFFD 5HDBE 5I1JL 1OD9A 1JPSL 2BY1A 4RDQG 5DO2C 4H25A 3ZTJH 4XNQB 3I50H 5HGAB 4RWYL 2WUBH 4WTZA 2UWEF 1PGRB 1IQWH 3GI9L 4LLQB 1G0DA 5K93A 3P4LA 3O0RH 4HJGA 5E99L 3D0LA 4WTWA 5HHXH 2ZCLH 2BVQB 3P11H 4Z7VB 3QA3A 3NIGE 5BS0E 4WGVB 2FGZA 5IT2H 2DWDB 2D7MA 4ELKB 4R7NA 4WFGD 2EE3A 1LO2H 1Q72H 1HINL 4D0DB 4HK0B 1FCGA 1YY8B 1ZE3C 4Y5VA 2VLRB 3IDNB 2ZP0T 4KUCF 3HNVH 1HIML 2A6DA 2NPLX 4AG4H 4IMKA 1U95B 3I2CH 4ZNEA 3UC0L 5CUSH 5F9WC 1B6DA 3K0WA 2VUOA 5T33H 5FUOL 1A3LL 4R8WH 4X4XB 4NNYA 2YD6A 3L3KB 4NT6B 5SV3A 1KTDB 1MRCL 3V79C 4E41B 1NC4B 1JF6A 4JO1L 4KMTL 4HKZA 5ESAB 2UVFA 5L7XH 3S4SG 3P3YA 2IPTH 3IAQA 3L3JB 4GW5A 2R1WA 3NN8B 4HGWB 3LPWA 4K71C 5T1KD 1DFBH 4HMCA 3UTSE 1GPOL 2ZSWB 1AGBB 3LQAC 3TJEH 2BZDA 5C6TH 2ZKHL 4ZAKB 3OB0H 3E6FB 2Z31D 4LHUB 3MXWL 3MRHB 4NSKB 4TRPH 3DSNA 1I7ZB 1AQDB 5AYQA 5T1DL 3E0GA 4RZCB 4S2SB 2FX9L 3CSBA 2J8OA 4FOMA 1V3JA 4I0PA 4JM2F 3WEXA 12E8L 2NLJB 2OYPA 3CK0H 1YDPA 1AE6H 4P57A 1XGPA 2Z93B 5KTEL 1HCFX 1F11A 3GZKA 2Z92A 1AFVH 5JOFA 1J5OH 3KPRB 4TVPH 2A73A 4NYLB 3L1OL 3PQYA 3RY4A 2OL3L 1KJVB 1UA6H 4D3CL 4YHZL 1BLNB 3H9HA 2IMNA 5ANMB 1UGNA 5CZXD 1YEDB 2IBZY 5EZIL 3VFPA 4GKZA 3UPRB 3IDJB 3UAJC 4X98B 1CLZL 1P7HL 3G5YB 2EE9A 1HZHH 5IVZB 4NCC2 2AJZB 1T04B 2KUTA 5MERA 5BO1H 3P4OB 1ED3B 2H9GB 2D0GA 2BNQE 3GMQB 1RFDL 2P45B 3GJEB 3FT3A 3L3OB 3TN0C 4HS3B 3IGAB 1FAKT 4QXUH 2A9NL 1GVIA 4HPYH 2W1NA 3RUGB 5FDYA 3IXTA 3G6JE 4KI1A 3O6LH 5DJCA 1DEDA 3KXFA 1U3HB 1OAYH 4PGDB 1FL5B 4LLWB 1PJ9A 4MNHB 1BBDH 2XN9B 1ZT4A 3HRZB 2VE6A 4TUJA 2OZ4A 3WKNA 3EYFA 4NO2B 2F74B 4M1GH 5DEFB 4F7EB 2BSTB 4YHOL 1XF2B 5F7DB 2DMCA 5C07D 5ISZE 5DDHB 4NRYA 5B8CC 1A6ZA 2VDQL 4OF5A 4A2MA 2X1XR 2R0ZH 2OJEA 3SGDH 5DK2B 3D69A 1A4KB 3LQZB 2ADGB 4IDJH 3AGVA 1X9QA 3O6KL 2R29L 4N8VB 1F13A 3TBWB 1Q38A 1Q9KB 2HTLD 5CEXB 3EO9L 3MGOA 5EU7C 4K2UH 3GB7B 3BOVA 5C08E 1MQKH 2WZPD 4EIZC 4Y19D 1QR4A 1WTGT 3TBYA 1AGFB 1S3KH 2FJFB 3VFUB 1P4IH 4LP4A 1DANT 4G80B 4YWGH 1H8SA 1IM9B 3LV3A 1WFTA 5IROC 1BFOA 4NGHH 3W11D 3MLPA 5DRNB 3JWDH 4GKSB 5KSBE 4ZNCD 4Y4KC 4L8CB 3O4OB 4JRWA 3FO9B 4KQ4L 4JQIH 4I77H 2PNDA 5CSBA 4XPFL 1P2CB 2ESVD 2EDNA 2WIIB 3GJFH 4PJ8B 3W2DL 1AC6A 4TNVK 2NYYC 1MHCA 1YN7A 2UVEA 4UV7H 2BC4B 5IMMA 1DQMH 4KK6C 3CVHL 2CR6A 3QFDB 3PABA 1K6QH 1MQ8A 4U1MB 3U36B 1VPOH 3MROA 4NQDD 1YUHA 5HHVH 5LVEA 2G75A 2AJXL 4DN4H 3F6LA 2BSSA 5L9DL 1MJ7H 1NCAH 1WWCA 2E7BA 5IB3B 2R1XB 4FG6C 1EMTH 2VLKD 1A6WL 1WAAA 3JV5A 4NC0B 1OP5K 4KUCD 3SDXF 3FT2A 3C6LA 1EO8L 2ZPKL 4R7DA 2A77H 4P9HL 3L3GA 2JIXA 5DEGA 1L7IL 2EYTA 1BIIA 3CVIL 5C09E 3GJFB 4XBPA 4F7MA 4GG6E 3CMOH 1HE7A 3O3EB 5HHOD 3PWNA 1WBXB 4MA3A 5GS1C 5F89A 2EXYD 4LRIA 4IRJD 2E27L 3O9WD 1P7KB 1JTTA 3GMRB 5JLZB 2NXYC 5I2IB 4G43B 4NFBA 4KJQC 1WQVT 5EIQA 3MODH 3MV01 2DQJL 3LQAH 3QIBB 1LGVA 4O4YH 3RJQB 3P9LB 5SWZB 4YQXH 1UM5L 2YEZB 3HS0B 2VXTH 1NCWL 1LD9A 1PX3A 2JLLA 5IEKA 4FQHA 3WO4C 4YXLH 4MVBA 3PP3K 1D5ZB 2FL5B 4JRXB 5ERWB 1PZUB 3M1BB 5C7XL 3ZLQC 1AIFB 2FB4L 1D5XB 3H0TA 3K7UA 3F58H 3O4LB 3SCMB 2ICWI 4F9PC 5B38A 4XXDA 3PWUA 3EO1B 4RDQF 4PRPB 5F1IA 4Z8FH 4N5UA 3QQ3A 1LP9B 5C07E 3P77A 3PHOB 2UZIH 3ARXA 4AIOA 4PG2C 4TSBH 3RWIA 4LASH 5LQBL 3RWEB 1PVHA 3DUUB 1IGIH 5CD5C 4JM2C 1MCPL 3HI1A 1BFVH 4Q58C 4XP1H 3CVHA 5E6IA 3G9AB 1CT8A 1OGTA 4LIQE 3STLA 1U8QA 1AHWB 4AEHH 4Y19E 1RY7B 4LKXB 4L8DA 1EUTA 3C8DA 4L8SB 5D2NA 3JTCA 3MV9E 4HXBL 3SE8H 2J3SA 3UTTD 4HXAL 4N5EA 4TQEL 2XQBH 2IAMB 3DWTA 3K2UL 43C9B 3FB8A 3ARDC 1JZ8A 4JY5H 4NQCB 1C5BH 4RFNC 2IADA 3BQUD 5GSVA 5TE6H 3OKEA 5CMAB 2DIAA 3VXQB 5EOCH 1QRNA 3BUTA 1F4HA 1WUNT 4K7PY 4R26H 4KROD 3P4NB 2WWMC 2IF7A 4OLXL 4KKLD 3QUYB 3MBED 3I9GH 2A9MH 2NZ9D 2EIZB 4GKOA 4E42B 3RTQB 4H20L 5FM5M 4NQDE 4I18B 4U1JA 5E9DB 3DUSB 5J11B 4PV9A 1XR9A 4LHUG 1OTSC 2PN5A 1GXEA 3VGBA 1WBYA 3QIUD 4O5LL 3LQMA 4OIIH 1I9RH 1YQVH 3EJYD 3NIFF 5LGKA 4X6DE 2AW2A 3W0WB 4H26B 1TENA 2R2BB 4JFFD 2VIRA 2ZSVA 5EZLB 3KR3H 3RL2A 2HJFB 3K4ZA 1CXEA 1XIWA 4HV8B 3S96B 3U83A 3W9DB 2DI7A 1FIEA 3N06B 4NM8L 3MR9B 1FNGA 5HHOE 2HVJA 3B6SB 4Q6IA 1KULA 3HR5A 3QUKB 1MWAL 2XXMB 4F7CB 1OOAA 1HYRC 1H0DA 3QUMA 4PRID 4YIQA 1U91A 3VGFA 4M5ZH 2O5YL 3VFRB 1Q9WA 2HFFA 2IFGA 3BUYA 4JQXC 5BRZD 3M8OL 5BVJB 3W9EB 1VACB 1RHFA 4Y5YB 2NXZD 3B5HA 2ICES 2VDKL 1I3UA 2XKNA 2EDEA 2X4TB 1MY5A 1NSNL 2NZIA 5I6XC 2PYEE 5DJYB 3GMPB 5CJ8A 5IESL 3NH7H 1U2HA 4FFYH 4XH2B 5DF0A 3ME0A 4K3DH 2YD2A 2EH8H 1M6OB 1TDQA 3U48A 5LXGH 4E9LA 3ES6A 5ELIA 1FNEB 3MV8E 4WUUB 2X40A 3BKCH 2EO9A 4MB3A 5C3TA 3TV3L 4K07A 4GQ9L 3QDHA 4JHAH 2X42A 3RA7L 1YECH 4K9EL 2ATPB 3NIDE 5L6YH 1U93B 1BREA 5BVPH 5CCKH 2QEJA 2B8OT 5TH2B 1KBGL 1FRGH 1ZT7A 4CADA 3TO4A 2F54B 2R23B 4HLZH 3MRFB 1WC7B 4W4NA 1ORSA 1KELL 2GK0A 4I3SH 4KDTC 5DMKA 5I1AB 4CMMA 4KJPD 3JUZA 2GJZB 3MOAH 4OLYL 2Z4QA 2NY3B 2I07B 3QCVL 5E1HB 3BP6B 4KGLA 5HHQA 3NFSH 2R9HD 1OP9A 3PGFL 4G6AC 4YBLB 5F9OH 2WSKA 1VKXA 2OP4L 5DK0B 3WS6C 5ACZB 4LSSH 4CN1A 1ZGLP 4NWTL 5D96C 4JE4B 2NTSP 4LPWA 4GO6B 4P4KC 5E2TH 4RAUA 3MBXL 5IFAH 5F6IC 1EHAA 3L3DB 5D71L 1OP5H 2D7TL 3MRCB 4UZGA 4CVUA 2V2XA 1MHPH 1MWAA 1OM3H 3UJTL 3PE9A 1OAUL 5E2JA 2LU4A 4JPIB 1AH1A 4O2CA 2DQUH 2ZCHH 2P5ED 4K7PL 2BMKB 3NFPA 3WO4B 3V6OA 3H6JA 4H5SA 4FQQB 2BVOA 3FN9A 3OXSA 2WAHA 1QPXA 4JFFE 5IVOA 5E8PB 2QQNH 1J11A 2NY4D 3MXVH 3VXRD 3OZ9L 2I60L 4KUZH 4ZS7L 3DURB 4OFYD 4NP4L 2HT2D 4LLYB 1Z5LB 2ARJB 5D1ZA 3O81A 4RMUA 3S97C 3MQIA 4YHLL 5D1XA 3DTXA 4L3CB 4MJ5A 4YE4L 1VFMA 2RBLA 3FO0H 5KSAD 1B9ZA 5DUMH 2R2HA 5GGTA 5JQ6L 3GSWB 1FFPB 1IZKA 1Q8MA 4PJEF 4PRIE 3MUY1 3HAEB 4Y4HA 1IAMA 4M7KH 2HG5A 4JDTL 4I0PC 3T2OA 4TTGA 4JLRB 5DS8B 5D93B 4YHIB 3RWFB 4LARH 4U3XA 2A0LD 3QXDA 3DYPA 4Z0BH 1VDGA 2DQGL 1GAFH 1CICA 4KRNA 3ARDB 1ZLUH 3BVNA 1OSPH 3SDXE 2CPCA 5F9AC 4RFNB 1G7IA 5D70L 1G6RH 4MD4B 3F7RA 2XI9A 4LEXL 5AEAA 1XGQA 2D2OA 1LK3H 4MD5B 3C2SA 3WJLA 4NKQB 2IGFH 2F53D 2C1OB 3QNXA 5F97E 4WW2F 4R2GD 4XNXH 5IMKA 2RHEA 4FQXD 5E8EB 1QZ1A 3CDYA 5A16B 5E8OA 4JDVB 3ZL4L 1MFNA 4AL8H 3HR6A 4NZRH 2X4PA 2IBBA 3SDDA 1F6LL 4JZNA 4EN3C 1UCBH 1RUKH 2HFGH 4DQOH 1JRHH 2X1PA 5JUEL 3MLYH 3ARBA 4Z7VF 4ZODA 3ROOA 3RWCA 4PJIA 3SBWA 4OLVL 2XFXB 3RGVA 5GGSB 1RIUH 2OR9L 3HC4H 1HDMB 4LCWB 3D39B 1U8IB 5IUSA 1ONQB 4GAYB 4BZ1L 4YDIH 1G6RB 2VLLB 4W6WB 2ZJSL 1YYLL 1E4WL 3MV7D 5T3XL 1HHIA 5B39A 2ICWB 4GT7A 3I85A 3L5JA 4NM4H 3ALXA 1I3VA 3BEVB 1ZHKA 3STBA 5BW7A 4HKBB 3QT2A 2HWZL 5KSUB 1LEKA 3AREA 1JZ2A 1ZV5A 1QR1A 1OAQH 1I1CA 2ADJA 4ELMA 2YD5A 1MAKA 4UU9A 1BQHG 3HZYB 4JPWH 4PY8J 3V0VA 4ODVH 5JDSA 5EBLA 5MP6H 2IFFH 1ITCA 2COQA 5DT1L 3SKOB 2Z8WC 3FFCD 4CN4A 1FYTB 3HE7C 1T0PB 3STZA 2P5WD 4D9LH 4KK9C 2PW2A 1TQCC 2DQHH 2J7LA 5DMYA 3L3IA 3DXAA 3SDCD 4QHUA 3BP7B 3CXHK 4L4VB 2X4QB 5CP3A 5A3IC 5LG1A 4JFDE 4JB9H 4MNQE 3VXRE 4LF3B 3MLTB 4IBLT 1NC2A 4ONHA 3TPKA 4YDKH 2I9LB 1NJ9A 2ITDA 1MPAL 1RK1A 3QAZC 4XCCL 4YXKL 2XTLA 2D31B 4P3WA 1G9NL 4X9HA 3V4UH 3QWRA 4F37F 5FV2A 2F5BL 1UWGH 3L3HA 4P46B 3KNBA 2QTEA 4PJGF 1GHFH 4HWEL 5EU4B 5C0DA 3P4MA 2DQTH 1T89C 5IEHB 3T0AA 3FB7B 3BD4A 1A22B 4TSAL 4YC2B 5CS7A 1Q9OB 4NZDA 2F8OA 4S1DC 4W6YB 2ZG1A 1TTFA 5DJAB 4KY1L 4OLWL 5JXAL 2IWGA 4OKVA 3UYOD 5JO5A 2IPKA 1JZ6A 2R2EA 4WUKH 3NIFE 1EEYA 4HJGB 2AP2A 3D0LB 1WLHA 1CZ8H 3QA3B 3QI9D 3R0MA 4KDWA 1MCKA 4R7NB 3WXWL 2D0HA 5I1IH 5IF0A 2F53E 3L7FB 3QNZA 4J4PA 1MF2L 4Y5VB 3VWJA 2VZTA 2A6DB 3QEQD 1U58A 4Y88A 3EHBD 3ELAT 4OF7A 1RUML 3DV4A 5D7SH 3VJ6A 5CJXC 5IJKC 5F72S 1CK0L 3QG7L 2X41A 4XC3L 4PUBL 4BZ2H 4NNYB 5J6HA 1HXYA 4LSRL 3CJJA 3F6IA 3KYKH 4AK1A 4XAWH 3K8MA 4HKZB 5IR1A 4OM0L 4H8WC 3KPSA 3ESVF 1VFUA 1SEBA 2KKQA 5I1JH 4GW5B 2WV3A 1JPSH 2R1WB 4RWYH 2DKMA 3N1QC 4L4TD 3F5WA 1Z0NA 1PYWA 2OTWA 5T5NG 3GI9H 2ZUYA 5H94A 3ZKMC 1J7VR 3VGAC 2JB6B 4HIHB 4C56A 1ZVHA 5E99H 4GRMA 4GW1B 3VXNA 1EERB 2R0KL 2F19L 4J8RA 1XGRA 4KK8C 5BXFA 3U7WL 4UOW0 3WEXB 1A6AA 4I0PB 4KRLB 1U0QA 3CH8A 1HINH 1YDPB 2YD9A 4P57B 1Q9LA 1XGPB 3UBXG 4AYFA 1HIMH 1F11B 2CXKA 3OJMB 2Z92B 5JTWA 5JOFB 4GXVL 3BFOA 3LZFL 3PQYB 2P5WE 5FDWA 2FX7L 3KLAB 4XP6L 3UC0H 3W5NA 1OTUC 2CIIB 3OKLA 5B22A 4MCZA 5FUOH 1QFWI 3H9HB 1A3LH 1BAFL 4P9HC 1UXWA 3DX9A 4Z76A 3U79A 3VFOA 3NOIA 1MRCH 2DTML 3VFPB 4GKZB 4KKBC 3ARGA 4JO1H 4KMTH 4WW2C 2VLRD 4Y5XC 5JIHA 3GSNL 5F96L 3FO1A 3MZGB 1QOKA 1JFQH 2EIEA 4X9FA 5MERB 3RIAK 1GPOH 5F6HI 3MJ6A 3B2UC 2YKLL 1M71A 3Q2CA 4JFHE 3FT3B 4PJHF 4M3KB 2ZKHH 4E41D 1NC4D 4UDTA 3H3KA 1IC4L 2YUZA 4HIXL 3IXTB 4F37K 3HAEG 3QEHA 2ENYA 3MXWH 3SDYL 5DJCB 5FO7A 4KJWD 3KXFB 5T1DH 2A1WL 4KRPC 3VG9C 2FX9H 5CJBA 3RKDD 5JOPD 2BVUA 2E9WA 1ZT4B 12E8H 4MQ7A 4MAUL 2VE6B 3NCYP 4TUJB 4XPAL 1QHPA 3AROA 1F45A 2YK1L 3IB4A 4U33A 5D2LA 4BH7A 5EUKB 5KTEH 1A14L 2AXJA 4ZAKD 3WFDL 3TNMB 4DTGL 1RZKC 4NRYB 1A6ZB 4LHUD 3L1OH 5IW1B 4XI5C 2OL3H 3MX0A 5IP4A 2OJEB 1F90L 4D3CH 1FBIH 4IHOA 2NY2D 3D69B 4YHZH 1C7TA 1UT9A 2W9DL 3TT1L 3FRUA 1F3DH 1J0ZA 5EZIH 3MGOB 3K4AA 2NW3A 1CLZH 1RU9L 3VMPA 2XWJB 5FUCC 3NZHL 2VXSL 4XMKL 3KPRD 3QEQE 3TBYB 1AXTL 2XXCB 4HIEA 5KW9L 1K5NB 4I3GA 4YPGA 1LEIA 1CE6A 1RFDH 3LV3B 2NX5A 3UJIL 5EO1A 1BFOB 3N1FC 4TN9A 2A9NH 5EULV 5IBUB 5TDOB 1CI5A 1CDYA 1SBBA 1AJ7L 2OL3B 2HTKD 3KPLA 4PREB 4FMFA 3S88L 4BH8A 3C8HA 1MHCB 1YN7B 4PJBF 4L4TE 4UUJA 3ZDYF 4I3RL 4YHOH 3CAFA 3PABB 5MI0C 4HCRA 3GSNA 4PRHD 4JR9L 1YUHB 2VDQH 1F00I 1WZKA 2G75B 4LVOC 4TVPD 4IIQA 4N90D 5FGCE 1U3HD 5EIVA 5KG9A 3O6KH 1CGXA 1KOAA 3TO4C 1U41A 2XN9D 4M1DL 1ZSDB 3I3EA 4P2QD 1F6AA 3EO9H 5KVMC 1WICA 3FT2B 5JORA 3NPZB 4RNRA 4R7DB 1N64L 2Q76A 3MOBL 4OCSL 4WU5A 2E7LA 3ARFA 3CFKA 3L3GB 2JIXB 5DEGB 2D7QA 2EYTB 5MEQA 4Z7VE 4F7MB 1JYWA 4P3CL 2DAVA 4KV5F 3PWNB 1QFOA 3RY6C 2XKSA 2YS4A 4MA3B 5F89B 4RCAA 1X6LA 1YPZA 5I73C 1CFSA 3B43A 2VLRE 3FRPG 3QDME 3B9KC 4XVUC 4X6CA 4KQ4H 3VH8A 4XPFH 2DJ4A 3W2DH 2FEDC 5CP7A 1TJGL 1IM9D 5HI3C 3CVHH 1LD9B 1OD7A 1HXMA 4E41E 5BCAA 2AJXH 3IKKA 4R0LA 4YO0B 1IEHA 2MTPA 2EKJA 4XTRD 5L9DH 4V2CB 4PJ8D 2NY5L 3H0TB 1ZLSL 1A6WH 4QRPE 4RFOL 5C8JA 5A43C 2OI9C 1EO8H 2ZPKH 4XXDB 5B38B 1NAKL 1JFMA 3PWUB 2A6JA 5F1IB 3QQ3B 1EAJA 1TFHA 3P77B 4D0BA 5TF0A 4P9HH 4M03A 1L7IH 1NBYA 4X9BA 3W82A 3CVIH 3RWIB 1OL0A 4P5TA 4OIAA 3MPCA 3HI1B 1JNHA 3T0DA 3IFLL 3CVHB 5E6IB 3NFNA 2FHFA 2E27H 4OZFG 1CT8B 1OGTB 4EZMA 1U8QB 1TXKA 1AD0A 4HF5L 5DO2D 3DHMA 4L8DB 1CQKA 1I4FA 2DQJH 5D2NB 3QUZA 5F88B 3HG1A 2A38A 5D1QA 4PJGE 1UM5H 4KC3B 1KG0A 3P30L 3HB3D 5ANME 5ADPL 1NCWH 3FB8B 3WMSA 2HRLA 4ETQA 2EDWA 1RZIA 2IADB 5GSVB 4F7PA 3E2HA 4XNMA 1MEXL 3R8BB 3OKEB 4PRDA 3D3VD 5FCSH 5C7XH 1QRNB 3I75A 3CSGA 3QIBD 2FB4H 5SWZD 5JW4M 4EQ3A 4ODUA 4PRNA 4ODTL 1U9KA 4V3EB 5IMOA 3RUGE 2VC2L 4JRXD 4U1JB 5JIKA 4PV9B 3TZVA 5T5NF 5LQBH 4HHAA 4P23C 2CSPA 1MCPH 4E5XA 2XN9E 1WBYB 3O4LD 3SCMD 25C8L 2H1PL 1NGZA 5TQ2L 5EN2A 4PRPD 4Y0GA 4XT1C 4NZTL 4PD4K 2ZSVB 3RL2B 5IFHL 4HXBH 5CBAA 1XIWB 1OTTC 4HXAH 5C92A 4TQEH 2VAJA 4FFVD 1D9KA 3C09B 1FNGB 3K2UH 3V9FA 2HVJB 4GAFB 2C9AA 4Q6IB 3U9UA 1H0DB 5JXED 1KF9B 4FTVA 4YIQB 3HUJA 1U91B 1Q9WB 2HFFB 2W59A 3BUYB 5FECA 3A67L 3JWOC 2IAMD 1N6UA 5GRVL 4OLXH 5D6DC 1RZJC 4UOW1 3BH8A 2XKNB 4KKAD 4H20H 4UTAL 1PX4A 5FKAA 3OXRA 4ODXA 2CJUH 3WV0A 4W4OA 5JPMA 4LOUD 1NEUA 4OB5L 3ES6B 1KN2L 3O6ML 4O5LH 5HHPA 3H8NA 1FL3B 4JKMA 3HTLX 5EBMA 3VI4F 4M9PA 4ONGL 2R8SL 5CWSA 3ZYJA 3RTQD 3BZFA 2NY6C 2X9YA 4FP8L 5E9DD 4OZIA 2CKBL 3TN0D 4NM8H 2EO1A 5E5MB 5ICZA 4LLUA 4RMWA 1F97A 4POUB 1MWAH 2D9CA 3W0WD 1SQ2N 2EIBA 3MRDA 1ZT7B 4L9LA 3TO4B 3BPLC 1QSFA 2O5YH 5FFLA 1ORSB 4UIMA 3M8OH 2GK0B 1Z0MA 5DMKB 1II4E 2Q7YA 2Z4QB 4ZQKA 3VE0A 1XCTA 4G5ZL 2XNAA 3HA0A 2VDKH 5HHQB 1NBZA 5CLTA 1DLFL 1IEBA 3ZE2F 1NSNH 1VKXB 5IESH 4M6NH 1EFXA 3HE6C 5DXWA 2EECA 3F62A 4APQC 5HI5C 1HKLL 4JG1H 3HCVA 4RAUB 1U6AL 4GLRH 3U82B 3SQOL 3B9KB 5GRUL 4YX2L 5JPNA 1BPVA 4H0GA 3FB6A 4MDIA 3TV3H 2V2XB 1MWAB 4ZUSA 1IQDA 4GQ9H 5DFWH 3LD8B 3MUZ1 2LTQC 5K9JL 1U8LA 4O2CB 2OX5A 3RA7H 3E3QC 4K9EH 3NFPB 1WGOA 1J8HE 4H5SB 2BVOB 3O4LE 1I3RA 1FJ1A 3LKNA 1KBGH 1X6NA 2GEEA 3C5ZC 3OXSB 2VR4A 1DQLL 4PRPE 3VGDA 1LP9E 2KZ1B 1DQQA 1KELH 1MIEL 3ZDXE 4PYHA 4ZXBC 4HUWA 5JMOC 3WUWG 5D1ZB 4OLYH 5HHMA 3CSPA 1S7QA 5D1XB 3DTXB 3S3JA 4MJ5B 3QCVH 1GGBL 1UFUA 4QKXB 4XAKD 2P7TA 2R2HB 5I0DA 3PGFH 1WIOA 4JY4A 2OP4H 2WQ8A 1H5BC 1R3IL 2E6PA 4Y4HB 5IHZA 3UEZA 5C0IA 2F54D 2DI9A 1EK3A 2HG5B 4NWTH 3V5DA 1CFVL 2CKBA 3WFBL 3ZDYE 3MBXH 2NY3D 1R24A 2BHUA 3FQNB 5D71H 2D7TH 1NFDA 4P3DA 3UJTH 1OAUH 4K7PX 4NQCE 1GZPA 1WFNA 2VXUL 2Y1VA 4K7PH 3I3BA 3BVNB 5I18L 1J12A 3U30C 1G7IB 1J86A 4W81A 1FHGA 1XGQB 4B5EA 4MS8A 3KLHD 2I60H 4ZS7H 4R96A 2DL2A 5E9DE 3IXAB 3QNXB 4NP4H 5ICYA 4KV5E 5IMKB 4P48A 4KXZI 4YHLH 2H2SD 5E8OB 2IH1A 2VQTA 4HMEA 3D87B 3SDDB 4JZNB 3ULUF 4A6YA 4DUWA 5JQ6H 3KYMA 3SE3A 3ARBB 4OGXL 1VENA 3ROOB 1YEFL 4JDTH 2HLFD 3RGVB 2APFA 5HYJA 4AH2A 4BQ8A 4OFVA 3T2QA 3KHOA 5KJRL 3AM8C 3WIFA 1HHIB 5B39B 2DQGH 4D2NA 1QVOA 5EORL 3KLDA 4OLZL 1H9VA 1ZHKB 3ZYOA 5D70H 1UCTA 4BFEA 1LEKB 3AREB 2NNAA 3NCFB 4LEXH 1QR1B 2CO7B 1YEHL 2ADJB 4UU9B 3B5TA 1U3YA 3V0VB 3RDTA 5JDSB 1ZVYA 5EBLB 5DWUL 4DEPB 1MJJA 3BD3A 4M02A 3ARDD 5ETUA 3ZL4H 2EDRA 4WI3A 3TWCL 3STZB 3C2AL 1MCWM 4JCMA 2Y07L 3U7YL 2PW2B 4WUUE 2CDEB 4N0RA 1GGTA 3DXAB 4QHUB 5JUEH 4PJCA 2NR6C 4J3UA 1RJZA 4OLVH 5C9KA 5I71B 1UKSA 2WWMD 1NC2B 5DFVD 5D7JA 2OR9H 4Q9BA 5KVFL 1NJ9B 2ITDB 4NC1C 5L2JA 2XZAL 1RK1B 3X3FL 2ESVA 4K3GA 4NN6B 4BZ1H 4PPTA 4LRNL 4XAKE 4WHDA 2ZJSH 1YYLH 3VRJA 4UDUB 1E4WH 5T3XH 4ETYA 1C1EL 3L3HB 3KNBB 3EYQD 4LFHG 1AO7A 1HWHB 1RJYA 2CDFA 2F54E 5C0DB 5GZNC 3P4MB 3LRHA 4LCWD 3BPNB 3D39D 2HWZH 5DJ8A 4NWUL 2DM2A 2JCCA 4JO4L 3TM6A 5JO5B 2IPKB 4GAJL 4JHBA 5DT1H 1DDHA 2EE6A 2R2EB 3SN6N 3TIDA 4KU1A 4CMHC 3BISA 4OV6F 1EEYB 1RIVL 4LDLB 1QKZL 2D7OA 3TA3C 3U7AA 5IF0B 3T3PF 3VWJB 2QSVA 1V3LA 1MPAH 4XCCH 1U58B 1FYTD 3RVXC 4YXKH 4V1DA 1G9NH 3DV4B 1N7ML 5IK3A 3OAYH 5DRZA 3VJ6B 4G8GA 4KKCD 1CLYL 3T08A 2F5BH 2AEPL 4LPTA 5J6HB 1GC1C 1HXYB 4L4VD 1MJ8L 4PLOB 4WFED 4HWEH 4JFXA 5IR1B 5CKGA 3E6HA 3KPSB 4TSAH 1KN4L 1SEBB 4B0MM 1NLBL 2EYSA 2HAZA 4KY1H 4OLWH 5JXAH 5K9QI 1OT1A 3F5WB 4P46D 5EFIA 1B4RA 1A7OL 1PYWB 2OTWB 2ED7A 5C6WH 4HPOL 5J7CC 4C56B 1WIPA 3VI4E 3VXNB 5EO0A 2RB8A 4PJDB 1C08A 4KRMB 5GISL 4J8RB 1XGRB 1UKTA 5BXFB 1A2YB 3RNKA 3WXWH 4IRSC 4O2EA 3GSQA 3VI3F 1Q9LB 2A83A 1MF2H 3L5WA 4WWKA 3SGKA 1EHXA 1K8IA 1RUMH 3F7YA 1WT5C 4G6AD 4LSVL 5FDWB 3J7HA 3OKLB 1CK0H 4MCZB 1AR1C 4Q0XL 4ZFOA 4OFDA 4PUBH 4XC3H 1UXWB 3DX9B 4Z76B 3ISWA 3V4PL 4LSRH 3VFOB 3BMWA 4P4KD 4ZS6D 3ARGB 3BQUA 2BX5A 1M1SA 3C5SA 3O3AA 1WAAF 4OM0H 3K2MC 2UYLB 3FO1B 4Z7QF 3PDDA 1EXUA 4KTEL 3DYMA 1D6VL 3ZE2E 2JK5A 3FQXA 3RPIA 5IM7A 5DRXA 1M71B 5I0ZA 3MO1B 3PHQA 4RX4A 4UDTB 1KCSL 3VXUE 3R06B 3QEHB 4WV1A 4JZJC 5FO7B 1NGXA 4LCWE 3D39E 3T77A 2R0KH 2F19H 4FXKB 5B4MC 1P5VA 2GT9B 1A1OA 3U7WH 1OQOA 3NPSB 4M1CD 4PGCB 4MQ7B 3R8QA 3K81A 1A7BA 2BSED 3P9WB 4BH7B 3JBG7 5D2LB 5FAAA 2NY5C 4GXVH 2E9IA 3U0WL 3LZFH 1HWGB 2FX7H 4XP6H 1MVFA 5DD3L 4Z0XB 2X4RA 4IHOB 2ED9A 1CGWA 1BAFH 1ZHBA 3FRUB 1WZ1L 3VXMA 3FONA 4I0PD 1QLFA 2DTMH 3QDGE 1EO7A 4LCYA 2NW3B 2B1AL 3FTGA 3OJDA 3GSNH 5F96H 2HMIC 1G9ML 5GRWA 3TNNA 4EBQL 3PQYD 4D9RD 4HIEB 4KXZH 2DLHA 5CBEB 3V7MA 3HLAA 4EI5C 4YPGB 1LEIB 1CE6B 2YKLH 1DBKL 5EO1B 3QQNA 4W4OC 1IC4H 4HIXH 1F3RB 4XCNA 1BVLA 3SDYH 2PW1B 2B2XL 32C2A 2A1WH 3KPLB 3PL6C 1SVZA 4IJ3C 4BH8B 1U8OA 4MAUH 4B41A 4XPAH 1T2XA 4FRWA 4UUJB 2YK1H 1RJCA 1A14H 3JV4A 3WFDH 4DTGH 4ODSL 4HULB 3GSNB 1K3IA 4AQOA 4HWNA 4PJFF 2VABA 4IIQB 1F90H 1YNKL 3LKPA 3WNKA 5KG9B 3V5HA 2EDTA 1WFOA 2W9DH 3TT1H 5I8OL 4NN7C 2B39A 2X4NA 4J3VA 4OM1L 5JORB 3CPLB 1FORL 1RU9H 4LSQL 5DJXA 4RNRB 5EO9A 3SOBL 4U6VL 1UWEL 3BHBA 3NZHH 1BOYA 1LMKA 1MFDL 2Q76B 2VXSH 4WU5B 4XMKH 3CDFA 3CC5A 5D7LA 2WM0A 3ULUE 3OB8A 3ARFB 3CFKB 1AXTH 5KW9H 4P9MH 5FOJA 4PGEB 1BECA 5CD3A 5MEQB 2VH5L 3UJIH 1HK6A 4U4BA 5E8NB 1YPZB 2BY3A 2J8UB 4ONOA 5TQ0L 2B0SL 3QHFL 4X6CB 3RX5A 1AJ7H 2FIKA 2UZXB 3VH8B 2VYRE 5CP7B 1FGVL 4PRBA 5I76A 3IU3A 4I3RH 4IOFD 1WWWX 1HXMB 1NANH 3RX7A 2I24N 4JR9H 1RAMA 1ZWIA 1LO3L 5A3ID 1I8MA 4M1DH 3DETC 3QQ9C 3SDAC 4JFZL 5C8JB 3A0OA 1Y6MR 1KCGC 1AXIB 2A6JB 1N64H 3MOBH 4OCSH 4D0BB 2NY1B 2XT1B 3HPLA 1S9XA 1NBYB 1F42A 3TT3L 1DTUA 2X4UA 3BXNA 8CGTA 4JQVA 1Z2KA 2E5EA 3DMMC 4P3CH 5KSAA 4P5TB 3UTQA 4W6XB 4UNVA 1JI1A 2YMXL 1JNHB 4K8RC 5IW6A 1FNSL 4YUEL 3TBTA 2BVEA 3NFNB 4JHZA 1MCHA 2F58L 2VO5A 1QSEA 1T20A 1AD0B 1E4KC 2QR0A 5EZOL 5DJ2A 4JVPA 1I4FB 2JIXD 3PQYE 4D9RE 1XGTA 3QUZB 4MQSB 3A6BL 3HG1B 5D1QB 4O9HL 3MRPA 4S1QL 3TYGL 1TJGH 4L5FL 1KG0B 3VRIA 1JGUL 1TZHA 4ETQB 1RZIB 2VXVL 4F7PB 1RUPL 3E2HB 4XNMB 2DKSA 4MJ2A 4PRDB 3I75B 5DA4A 3DOSA 5J1TC 1A7NL 4OCXL 2NY5H 1ZLSH 3TVMA 2FWOA 5JW4Q 4RFOH 1ETZA 2C1PA 1U8JA 3KG5A 1UADC 4ODUB 5A1AA 4PRNB 1NAKH 1R5VA 3SGJA 5IMOB 2XV6B 4MVBD 1VFOA 1HNGA 3RZCA 5EU3A 2H6PB 1YEEL 1H3PL 3RVVD 3KXFE 3OAUL 4OBSA 4OQTL 4HHAB 5SX5K 4DN3L 4E5XB 3T3PE 3IFLH 1CF8L 4WY7L 4JZJB 1Y0LB 5DMIL 2BVTA 1NGZB 4JVUA 4V3DB 5GHWL 5EN2B 1RD6A 2NW2A 5HY9A 4WTXA 5DQDL 4HF5H 3FAXA 1UVQA 2EXWD 4X4ZA 2AEQL 4MXQC 4U1IA 3SJVE 1M7IA 2H45A 5CBAB 1H3WM 1IAKA 3P30H 5ADPH 5I66A 4TUOA 2J1KA 3ZKMD 5KSVA 5E6ID 4X4YA 3U9UB 3H9SD 1MEXH 4FTVB 3L95A 5FECB 4YFLF 4OZHA 5HD8C 4N5ED 4MAYC 3RIFF 1P6FA 4ODTH 1AGEA 4ZPVA 3BH8B 1ZMYA 5SWSD 5IB1A 3OR7B 2BXYA 2VC2H 3U9PL 5FKAB 4G6FB 4ODXB 4U3HA 3FFCA 2UUDK 3RY5A 2VXQL 5ALBL 5I15L 3V4VL 4Q7DA 1NAMA 3HKFA 1W8OA 1JF1A 1ZA6B 5I1DA 4KK5C 4KKBD 3VI3E 1IKNA 5HHPB 4ZTPL 25C8H 5D7JC 2H1PH 5TQ2H 5EBMB 4P5MA 3P9MB 4N0FA 3ULVL 1A3QA 1M7DB 4NZTH 3DJ9A 5CWSB 3LN4A 1MAML 4HKJB 1JPGA 5IFHH 1CGVA 2MFNA 5INCA 4OZIB 2F15A 1T21A 2ZOLA 3B2UD 1OGAD 3Q5YA 5ICZB 5IW3A 1WAAE 1IJ9A 4EXPX 4LLUB 5F7LB 4L4JA 3IVKA 2N4IA 4Z7QE 1HILA 5IB2A 3MRDB 4M6AA 4L9LB 2PO6C 4YAQA 1QSFB 1TJIL 3KVQA 3QNYA 4UIMB 3LSOA 5GS3A 5EUOA 3A67H 1XIWD 4OQTA 4OBRA 1INQA 2Q7YB 2K9UA 2DS4A 3D5OF 4ZQKB 3VE0B 1XCTB 1H8OA 4K3JL 3O8XA 3TJHC 1NBZB 3QO1A 4XI5D 3EDDA 2ED8A 1IEBB 3OR6A 3DI3B 4UTAH 4UAOB 3GRWL 3RAJL 4KTDL 4QGTA 2O5XL 4WJ5A 4NQVA 3O6FC 2FH6A 2DJSA 1EFXB 1PSKH 2AKRA 3HCVB 1KN2H 2HA1A 3O6MH 4PJIF 4PTTB 1NUFA 3EYVA 3ESUF 2IANE 1B0GA 5JPNB 1BZ9A 3TBVA 3FB6B 4MDIB 1U3JA 4ZUSB 1IQDB 2VDMH 4ONGH 2EC9T 2R8SH 4PBVC 4GBXA 1U8LB 2R0WH 4FP8H 2CKBH 4YNYA 1KC5L 3GK8L 4OZGF 2JJWA 1I3RB 3S36X 2NY7L 1FJ1B 3LKNB 1UJ3A 1UWXH 4R97C 3B8YA 4AM0A 1DQQB 2RFXA 5LBSH 4ELMF 4HUWB 2C26A 5HHMB 4JJ5A 3BPOB 3EYSL 1QG3A 1S7QB 1WFUA 2DICA 4G5ZH 1BVKA 2GKIA 4XXCA 4P2OC 3UYPA 2P7TB 3DROA 1DLFH 3H7LA 1H3XA 3JWNC 4JY4B 5J3HC 5IHZB 5C0IB 5DHVA 3TO4D 3CFIC 3V5DB 2CKBB 1HKLH 3MCLL 4PLJC 1U6AH 5I8EA 3VH8G 3BWAA 3SQOH 5GRUH 3VXTA 1R24B 4MSWA 5FCUH 5AYUL 1NFDB 4P3DB 2AJVL 4LPXA 5GS2D 4PJFE 5K9JH 4MJ6A 1GZPB 3H3PL 1OARL 3RIFK 2DI8A 2J5LC 1QRNE 3V6BR 4KI5D 2YN3A 5I1KL 4QOKA 4XVUD 2CRYA 3HZKA 3B9KD 3WDHA 1XF5A 1DQLH 2VRAA 1GOGA 1MELA 4D0DA 5LJYH 5L0QB 5JR1L 1YY8A 5FIEA 1MIEH 4R96B 4XVJL 3IDNA 5HI3D 5ICYB 3QPXL 2FGWL 5FHAL 4TPRL 1I7TA 1GGBH 2V6HA 2IH1B 4CGTA 4XPBL 4OI8A 2DDQH 3MLUH 5H37G 3GM8A 3KYMB 1R3IH 3O2VL 2J2ZA 1CFVH 1I1YA 1IGFL 2VZSA 3QIWC 3WFBH 4U6TA 5HYJB 5D1ZD 4NBYB 3WS3A 5D1XD 2VITB 1KIRA 3S37L 4JO3L 2VWEC 2FNBA 2HH0L 4Y4FC 4XNUH 4JG0L 5FM5O 3WIFB 2W07A 1CGUA 4Y4HD 1U8MA 2VXUH 1QVOB 2QADC 3SO3B 2B4CL 5C0NC 1E0OB 5I18H 1QHOA 3T0EA 2GHWB 1NDMB 4S2SA 3BGFC 2NNAB 3ETBF 2I25N 3EOBA 5MENA 3KPNA 3WE6A 3VA2C 3RDTB 1IAIM 5C0JA 1MJJB 4FMKA 3KPRA 5ETUB 4D8PB 4NYLA 4S1RL 2CLRA 1BD2A 4XWGL 3VDBA 4KZEH 2YPVL 4LVNB 5D72L 3C60C 5IIEA 4NC2B 3DVIA 4OGXH 4PJCB 1RJZB 1YEFH 4RBPH 4GAGL 4K55A 4R90L 5DK3A 1NUDA 5D7JB 2IALA 3PGDA 5L2JB 3BYYA 1CFNB 1CXKA 1MH5A 2DJUA 1BZQK 3WXVL 3MA9L 2H9GA 3SDDD 5KJRH 4RWHA 3AU1A 3VRJB 5M95B 4NO0A 4PY7A 1P9MC 3ARBD 3QJFA 1AO7B 4IM8A 5EORH 1RJYB 1IZJA 2CDFB 5K9QG 5F7KC 4OLZH 4PRHA 3RGVD 5IVXA 5C0CE 3OG6B 2KZWA 1T0MB 1EBPA 1SEQL 5DJ8B 3EYUL 1UKQA 1EJOL 1IT9L 4QWWD 4P2QA 1JCKA 3CGTA 1YEHH 3MUHL 2JCCB 1OTTD 1KGCD 3UZQA 3BEWA 4F7EA 1XF2A 2QSTA 5DWUH 1DDHB 2FIRT 4MDJA 3TIDB 3WLWD 1L0XA 3LS4L 2XTJC 4BYHA 3TWCH 3C2AH 3WIHL 5C9JA 2F8VA 2Y07H 3ARED 3U7YH 3QH3A 4ZFGL 2YD1A 5FYJL 4D94A 1G7PA 4PJ7F 4R6UA 5HYSA 1F4YL 3D48R 4PDCE 4LK4A 3TP4A 5KVFH 1I8LA 3K4DA 1XCQA 3ZKXC 3SHSA 2N56A 1AGFA 3KJ4B 5D2LF 3X3FH 3X12A 2X6MA 4M6ML 1RZ8A 4LRNH 3V6OE 4V1DB 1F4AA 3LN5A 2K7PA 4D9QE 2LVCA 3QCTL 5DRZB 3OMZA 4G8GB 1IM9A 1G9MC 4KQ3L 4TOYL 4EUPG 1C1EH 3DXAD 1FO0L 1P84J 1IEAA 1K3ZA 3GHEL 1JUFA 4JFXB 1NC2D 4GRWH 3DRQA 3BN9C 2KL6A 1AI1L 4YHNA 4LPVA 3QR2A 4Q74A 3E6HB 1RSFA 3WDJA 3BKJL 4R97B 2V7NA 3FOLA 4U1HA 3VCLA 2UY6A 4YGVA 2EYSB 1WIUA 1MRFL 3QWRD 4JO4H 1IL1A 4G9DA 2DLTA 1CWVA 4CNIA 1C5DB 4GAJH 2VDNL 5EFIB 1XMWA 2DIBA 1S9KC 4G59A 4JJHA 1IGTA 1RIVH 4WHTA 4OD1L 5EO0B 1C08B 1G1CA 3V2AR 5IWLC 1A6UL 2D3VA 1T2QL 4O2EB 5CIPH 3GSQB 3T1FA 2A83B 3L5WB 3BPCA 4WWKB 1IILE 1RURL 4GRWB 1K8IB 4I0CC 3F7YB 4OUUA 1N7MH 4UINL 2XKUA 4HFWA 5GXBB 1YEJL 1CLYH 2LU7A 4ZFOB 2AEPH 3MRNA 5DMGC 4MA1C 1AC0A 5T3XD 1MJ8H 3TVMC 3O3AB 3C5SB 2LFGA 2WBJC 4PRAA 1A1MA 4J4PD 2OTUA 3D3VA 1WBZA 3BJ91 1KN4H 1EXUB 2A74B 3WIHA 5JW5B 1NLBH 2JK5B 3FQXB 1BMGA 2Q86A 3RPIB 1NFIA 5IM7B 5DRXB 1ZAGA 2GJ6A 4XB7A 1A7OH 2XTJE 1CFQA 3CLEL 3PHQB 4X5XA 2YUWA 5TE4L 4AY0A 2DQFA 1B4JL 3PWJB 4PJIE 3KPMB 4JRXA 2APXA 5E03A 2K1MA 1MI5A 1NUGA 4HPOH 4WV1B 1NGXB 3KPSD 3T77B 4UQ3A 2XWTA 5GISH 3GGWA 1A1OB 1D5XA 1EHLL 4GRLC 3ZYIA 4RIRA 5C08A 1U42A 4N1EA 3U2SA 4KKNA 1B6UA 2P8MA 2A6KA 1L8JA 3QYCA 4Q2ZA 5DJZA 1IGCL 1T3FB 4NKOA 3MRQA 4C56D 4LSVH 1RZ7L 1DN2A 2X4RB 1T7YA 1ZGLA 2HRPL 4Q0XH 1ZHBB 3MYZA 3PG2A 3VXMB 3FONB 2IJ0C 2QADB 1QLFB 3V4PH 4H0IA 1RUQL 4ELME 3RQ3A 2FO1A 4LCYB 4R4FL 4WEUD 3FTGB 3OJDB 4UOJA 3TCLA 1Z9MA 5DEZA 3A6CL 5K9OA 5KS9F 3TNNB 4KTEH 4X9IA 1D6VH 4M93B 4GS7B 3HLAB 3LEYL 2VZ3A 4N0CC 4OCYL 1PD6A 1KJMA 2OMBA 4UT6L 4NUJA 3WNNA 3ARGD 2WNGA 1KCSH 4XCNB 2YBRA 1BVLB 4QTHA 3MCG1 5CJQL 2YPLB 5D7IA 4EI6A 32C2B 4WW1B 4B7LA 2YPKA 4RMSA 3NA9L 3U46A 1DE4A 2E6JA 3X3GL 1U8OB 3FN0L 1FGNL 2UY7A 2ZUXA 4XNZB 3WN5C 4F9LC 4E42A 3JV4B 4QRRB 4LVHB 4G7VL 1CGTA 2JB5L 3U0WH 4NHCL 3BZDA 4BM7A 1HOCA 5DD3H 3TN0A 3PDOA 2VABB 4QNPE 1TVDA 4RMRA 1L7TL 1EBAA 3LKPB 3V5HB 1YN6B 1NCNA 1WZ1H 2X4NB 3IS0X 5CSGA 1B0RA 4KDVA 3LY6A 4RRPG 4AEIH 2B1AH 5DJXB 3OL2A 5EO9B 4OTXL 3BHBB 1G9MH 3MNWA 3IFNL 5EZLA 5D7LB 3CC5B 3GMLA 4EBQH 1TTUA 5EIIA 3LKQA 4QHLA 3RHWF 3QCUL 5CD3B 1GGIL 1A0QL 1DBKH 3HPJA 3CZJA 5JA9A 5B8CA 4ZYKA 3MFFA 5T3XE 1EJ6A 4PTUB 4L29A 2QKIB 3GMMA 3PV7A 5E5RB 2B2XH 4PJ9C 2FIKB 5BVJA 3W9EA 3KDMA 5I1GL 4YFEA 4Z5RA 5BOPA 2Y7QA 4PRBB 5I76B 3IU3B 5FYLL 2X4TA 1CFBA 1SMAA 4ODSH 1I85C 1UC6A 2L4OA 4DJMA 4O02L 1MFCL 2C4FT 2E8YA 5IROA 5E2WL 3AXLB 4JCLA 4Y16C 1ZWIB 1YNKH 1V3KA 2NR6D 4LDEB 5I8OH 3HUJF 3LS5L 1I8MB 3DX6A 2EYRA 4XP5L 4Y4KA 4J6RL 4OM1H 1XGYL 5I74C 1H3TA 1FORH 3K80A 4LSQH 1K2DB 5ACMA 3SOBH 1J88A 4U6VH 1UWEH 1X4ZA 1MFDH 1KCKA 3I6LD 3MV9A 2Z91B 3ULVC 1KEML 3BXNB 2X4UB 4GXUM 2GSGA 2RJMA 5EPMA 5M7QA 1N2RA 2VH5H 5KSAB 3TIEA 3B3IA 2HT4C 3UTQB 3KS0J 3QFJB 5IW6B 3VFGL 2E6QA 4LGRB 2KQNA 3RI5K 4JKKA 5TQ0H 2B0SH 3QHFH 1QSEB 1X44A 2GK2A 1T20B 3MRFA 3CDGA 4G8FA 2QR0B 3TLRA 4XBGB 5ESQB 5FO8A 2H26A 5DJ2B 3ARFD 1XGTB 2UWEA 4FNLL 4F57L 3MRPB 5E94A 2X05A 1FGVH 2I07A 3JV0A 3OF6A 3VRIB 2VAAA 4BQBA 2JJVA 1JZ3A 1IAIL 1TZHB 1P4BL 2YD7A 4RGMC 5EBGA 3IFOA 2ZOKA 4M6OL 1KB9K 5GS1A 1LO3H 4WU7A 3K1DA 4OF0A 1EIBA 2F9BT 2PXYC 3TVMB 2FWOB 2ZZUT 1ETZB 2C1PB 4JFZH 2I27N 1U8JB 5IB4A 1DVFC 5L88L 1GZQA 1R5VB 1X5IA 4WENB 4FFWD 4D0CA 3RZCB 2VLMD 5EU3B 4JN2B 2EDYA 3ZYZA 3TT3H 3M17A 4R2GB 1H3UA 4IOSD 2Y23A 3DX7A 4RFEA 1JPTL 2YMXH 2APTA 1FNSH 4YUEH 3MOQA 5ITFA 1E4XL 1LO0L 4EEEA 4M7LT 2F58H 5D2LE 2NW2B 5DLML 5HY9B 4PJXA 2R69L 5IGXL 5EC2A 1UVQB 5C0FA 5EZOH 5F3HA 1MLBA 2NY1D 5C0BA 1N6VA 5DVOA 4U1IB 1B88A 5JIIA 1M7IB 3A6BH 3TYGH 2J12B 2UV3A 4O9HH 4S1QH 4P2RB 4L5FH 1IAKB 4YK4B 5I66B 5J12B 4TUOB 1OLLA 1JGUH 3Q3GA 1X5LA 2IPUG 4MXVF 4RGNB 4PG2A 3VW3L 3RHWK 3GSWA 5FEBA 5KSVB 4X4YB 2VXVH 2PYEA 2WBKA 1RUPH 2F5AL 4UNTA 4JM2A 1P5UA 3TFKC 3L95B 5F7FA 1A7NH 3MV8A 3QUZD 4OCXH 1KPRA 1REIA 3HG1D 4OZHB 5D1QD 5DS8A 2CK0L 3T65B 4Y2DC 1N6QL 2NX5E 4OCRL 4ZPVB 1OSZA 5E00A 4ZTOL 1JZ4A 4IMLA 3CFDA 1YEEH 1H3PH 1OVZA 2X4OA 3N9GL 1HH9A 1KV3A 1I1AC 3OAUH 2Q3AA 3QHTC 4OQTH 3SGDI 4WI8A 4PJ5E 1J1PL 2AJYL 1JF1B 5I1DB 4DN3H 1CF8H 4WY7H 5DMIH 5HVHB 5GHWH 4QO1A 5C70A 4P5MB 4N0FB 5DQDH 4DKDC 2YOCA 3LN4B 5DUPL 5IMLA 3WNMA 1JPGB 1UH2A 2AEQH 1QLRA 1NFDF 1V7NL 2M26A 4I0KA 5INCB 1T21B 2ZOLB 3BZEB 1ITBB 1KNOA 2IBGA 2CUHA 4WO4A 5GSRA 1RHHA 2OBGA 3ZDZF 4QLRA 3IVKB 2CH8A 1SM3L 4LAQL 1HILB 1SMOA 1HCVA 1NCBL 4CUCA 5IB2B 4M4PA 4GG6F 4MXWL 4PS4L 2E7LE 1DCLA 4YAQB 1NBVL 4AIXA 3LSOB 5EUOB 1WEJL 4DK6A 4S1SL 1ONQA 1TNMA 5E2VL 1BWWA 3OX8A 4WHYG 5J13B 1G6RA 3O8XB 3QO1B 1YNLL 5C0AE 3OR6B 1IRAY 1IGML 4DCQB 3U9PH 4WJ5B 4FTVD 1G0YR 4M8QA 4NQVB 4X6CE 5I15H 2VXQH 5ALBH 1MCSA 3V4VH 3HMWL 1JI2A 2HT3D 3V8OA 3VDAA 2AKRB 2BJML 4N68A 3DV6A 5JZ7D 2O93L 3EJZC 4ZTPH 3EYVB 4X8JA 5HYEA 4O58L 1MCLA 1N26A 4C83A 1B0GB 2B4CC 1NCCL 4JQXA 1BZ9B 3ULVH 2FO4A 1MAMH 3BW9A 1OWRM 4GBXB 2JE8A 2VLME 1ZT1B 2C3GA 4G6FD 3ZMRA 4YNYB 5GJSL 4HUVA 3B5GA 3EOAA 3WLBB 4F15B 1DSFL 1A7RL 1UJ3B 4RGOL 2ZCKL 4CBPA 1I8IA 2PUQT 5AUMA 1UJTA 4LF3A 3MLTA 1BEYL 1TJIH 4PD4J 2PYFA 4AM0B 1DJSA 1GGUA 2RFXB 4GSDL 5F71A 2OXHA 2FSEA 2X2YA 5F44A 4JJ5B 5E6ZA 4K3JH 1BVKB 4U7MA 1M7XA 1QO3A 2V5YA 3KPOA 1V5JA 3DROB 3LH2L 1Q0XL 3GRWH 4P4RA 2ORBL 4KTDH 3RAJH 2O5XH 4BUGA 2E7MA 1QSFD 2MPAL 5I17A 3SDXA 4CRPA 4PJCF 3HG1E 5I8EB 5GRYA 1SJHA 2FRGP 2MJWA 3N50A 3BWAB 2FR4A 4ZSOE 3VXTB 4MSWB 5DJAA 3AY4C 4KDTA 4FXLA 4MJ6B 2XG5A 2ITCA 3PXJA 1OT2A 1EFXD 1KC5H 1WWBX 3GK8H 3T2PA 1KTKE 2AJUL 1SBSL 4QOKB 3WS6A 4Q97A 3HZKB 4HH9B 5GRJL 2NY7H 5CGYD 3PJSA 4L3AA 5IKCA 1XF5B 3BD5A 1JTPA 4N0UA 4P4KA 5KVEL 3L7FA 1B0WA 2AK4A 5HBBA 2JCCF 2CO6B 2LVEA 4OF3A 1DVFB 4X6DF 4X4MA 3EYSH 2IQ9L 1I7TB 2BVYA 3D18A 4ESKA 4AENA 4ZUVA 2MOVA 3HI5L 1YEKL 4P2CG 2XQYG 2ADFH 1I1YB 3MCLH 3MRLB 3ZKND 4NKIH 1T4KA 3ORJA 2ERJC 5HHMD 3WS3B 1KEGL 1JHLL 4R3SB 1KIRB